4NXMT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxmT00
3T1YT 4DR7T 4DR6T 4X66T 4B3TT 2VQET 1N32T 4DV0T 2UUCT 4DV1T 4B3ST 3T1HT 4LF7T 4LFAT 1N33T 4JI5T 4JI2T 4JYAT 5BR8T 4GKKT 2UXDT 4OX9T 5IWAT 2UXCT 1HNXT 4X65T 4LF9T 4LFBT 4JI7T 4DV5T 2UXBT 1XNQT 1N34T 4DR1T 2UUAT 1I94T 5LMUT 4LF4T 4DV3T 4DR2T 1IBMT 2VQFT 4DR5T 4GKJT 4B3RT 1HR0T 1IBKT 2UU9T 4JI8T 4X64T 1XMOT 4JV5T 4LFCT 1HNWT 4LF8T 4DR3T 4NXMT 1XNRT 4LF6T 4B3MT 4YY3T 2F4VT 1FJGT 4DR4T 4X62T 4DV2T 1HNZT 4DV7T 1J5ET 4JI3T 4DUYT 5LMNT 4JI4T 4KHPT 4K0KT 4JI6T 4JI1T 4LF5T 4DV6T 2UUBT 1IBLT 2HHHT 2ZM6T 4JI0T 1XMQT 4NXNT 4AQYT 3OTOT 4DV4T 4YHHT 2E5LT 4DUZT 1N36T
chains in the Genus database with same CATH superfamily
4MALA 3PJAA 3WAKA 4AKRB 3AE7A 3AAAB 4PFOA 3HKEE 5FL1A 3AE2A 1YKEB 3P7IA 3AEAA 5L3DB 2N2NA 4GKKT 4BJNA 4LF9T 4C90A 1W09A 4MLKA 3PV0F 3KBTA 4P09A 3LFMA 2QGSA 4H63H 2JMHA 3PUZF 4CN4A 4AI6A 4H9QC 4O2BE 2IIUA 2V6XA 4EZ4A 4DBRA 5LHIB 4ZOLE 1YQ3A 2LRLA 4DR3T 1T8BA 3ZKRA 3K8PC 4IDOA 3JAFA 5KX5E 4UF0B 5L2LA 3EUHA 5F5WA 3AE4A 4IDQA 1OEDE 2FJAA 1YXRA 4DV7T 1DU2A 4IDZA 4TV8E 1HS7A 3ANWA 1XZYA 4IE0A 2NR4A 1D1BA 2MBGA 3C51A 5FVKA 3EDVA 3ZMVB 3C4ZA 1UK5A 3H3MA 3AEEA 5BMVE 4H9OC 5F8PA 2G0UA 4NXNT 5EK4A 2BDEA 4TWHA 4DR6T 2X9HA 4QH5A 4X66T 4O4HE 3LJCA 1UCUA 4OHFA 2MYSA 2HPLA 5L47A 5L4EA 4BA9A 2KWHA 1XWMA 5FL0A 2NW8A 1HFAA 4AKLA 1D0ZA 4H9RC 2LEHA 1S94A 3N2GE 2VKJA 5LGTB 3GA8A 4IE6A 1YQ4A 3PUAA 1XDPA 4DV3T 3PUWF 3Q5DA 2J62A 1MMDA 4O8SA 4PFPA 2BKNA 4UEMA 5AQQB 3PURA 4LF6T 2NTXA 3ZC0A 2I59A 3VR9A 4IDPA 3PUVF 2LHNA 3KV9A 4CI3B 3OPCA 2V5CA 5J1GA 2IC6A 4JI4T 2UXXB 2DWKA 3JCFA 4AXPA 3EHZA 2WMOA 2A9UA 5DJQC 3A7MA 3RC8A 3RRCA 3RKGA 3W15B 4X20E 3ZN1B 1M62A 3AVRA 3LDQB 3FBLA 2X9YA 2BS2A 1LVFA 1IJ5A 3RC3A 3U78A 3ZC1A 5HWXA 4N78D 3QNUA 1D0YA 4ZXLA 2NOXA 5AQNB 4OK0A 4UXNB 4GYSA 1KF6A 4HN9A 4DV5T 3PU3A 4YT0A 2XQ9A 4QKNA 4G63A 2DLRA 4ERRA 1JNZA 3GN5A 1IBMT 3I9WA 2VQFT 3KBUA 5LCYA 3C50A 2V7JA 3IEEA 4TUYE 1WYBA 2E9XA 4I0UA 4JV5T 2BKOA 3C98B 5AQTB 2ACZA 1QUUA 3EAMA 3CIRA 1T7SA 3EVYA 4KUMB 4MBQA 2CMRA 2LOSA 5LA6E 2JPFA 5IUXA 3ZLIA 4JI3T 4TZ4C 2WCAA 4J2CA 4YJ2E 4HKAA 2MPKA 2X51A 3HKBE 2CXFA 2UXNB 2UUBT 3NBXX 4HTEA 1GQEA 5LHGB 3ANWB 3RF1A 3MA9A 3NWIA 2KXPB 2D9DA 4YSXA 2HPJA 3UTKA 4DMVA 2MTQA 2X9XA 2CLYB 1IZNB 4EB6E 4ILUA 5ABEA 4NUVA 2UUAT 2NTYA 1KNPA 3IBPA 1ZV4X 3E22E 5JDMA 3VRAA 3LSVA 3UFGA 4JI8T 4YTMA 3UT5E 1O3XA 2BS3A 4LFCT 2N9DA 3IA3A 4GK0E 3SRZA 5JDFA 5E0OA 2W66A 5JDQA 2CE7A 1UURA 2XY8B 5ABGA 3RIUA 4AQGA 4BJMA 3KVAA 3RQWA 3ZJ1A 3AE8A 2WBLA 2I0MA 4K0KT 5L3EB 1WFDA 5FNVE 3N9NA 4JLEA 4O4JE 5J2TE 5FP3A 4AQFC 3AEBA 1XMQT 2ZM8A 3FXEB 2YINA 3UU5A 2CA5A 2CXDA 2UUCT 2M67A 2LSIA 2FUPA 4OYJA 3C4XA 2KSRA 2QA7A 4JYAT 5CA0E 3ZMSB 5IHYA 5IWAT 2UXCT 3B5MA 5CGMA 4YLHA 4UVAB 3LG7A 4G2AA 3VU7H 3AB3B 5EZYE 1U5PA 3A8YC 4ISTA 1NAFA 3I9YA 2X0LB 4KP3C 1OEDA 3GMIA 4X1KE 3UU4A 4X1YE 4U7YA 4IREA 4E7ZA 5LHHB 2LJLA 3DJBA 3OYXA 5KMGP 4E7SA 2EHOB 4U33A 4IT4A 5FXXA 1LVKA 4ILCA 1CUNA 4WYVA 4HFBA 5LMNT 3ZT6A 5J2UE 4K0UA 3KV6A 2YN6A 4QXBB 4DO0A 4Q25A 2MAWA 4AQYT 3PUQA 1IJ6A 3QK6A 3ABVA 1U4QA 1SUMB 3FZLB 2C5KT 1MMGA 5JRCB 4HWHA 2L3LA 1Z8UA 4QXHB 5JR9B 3FZHB 4P0BA 4GIWA 1T72A 1LRZA 5A1LA 5HAXA 3JADA 2HN1A 3D0TA 1E7PA 3ONJA 1ZP0A 2NW7A 2FJEA 2CRBA 4DR5T 3BQIA 2HN2A 4A56A 3AAIA 4IE7A 3P4SA 1SE7A 3RRWA 4PK4A 3BQLA 4HWDA 4LF8T 1XNRT 1WLXA 5LG4A 3OKQA 2P9BA 1HNZT 5AQRB 1HF8A 2BG9E 2JMKA 2HH7A 4M1PA 3RYHE 2ODUA 2LHRA 2E9XD 4C91A 4LF5T 4ZI2D 2J4GA 3H37A 3LK2B 4ILAA 1Y64B 2K24A 1D1CA 2CXLA 3MJXA 4EAHA 3UQ7A 3UUBA 2X66A 2D5UA 1ZOYA 1IAPA 2MOZA 2LLYA 2YDQA 4ZEYA 3ZYKA 3ZPOA 1N36T 3T1YT 1BR2A 2E9XC 3P8CD 2WP9A 2K48A 3RX6A 4ADZA 3ZCJA 3AE3A 4ZI2C 3NZQA 4IGUA 1N33T 4FJOA 3FZFB 3AAEB 5C3JA 1MMAA 3CWZB 3K3QC 3Q5XA 2DNXA 2BS4A 1LKXA 4JI7T 1XNQT 3TLVA 3R6NA 1B7TA 2Y6XA 2B76A 3NRXA 2JQQA 2IUBA 3AEFA 2VB6A 2W63A 2KT9A 2ODVA 3SOLA 5AQPB 1S35A 4DR2T 3KVBA 2BG9B 5FKYA 4B3RT 5JQGE 3CMLA 5FYMA 4UVCB 5HEJA 2DHRA 1HNWT 2CHOA 4U74A 3FZMB 5EK2A 3B57A 4CN1A 4QWNB 5AQOB 1FJGT 1OEDB 5HXRA 3CX8B 5JREA 3AXJB 2VK9A 1XDOA 5AQSB 2YK0A 1Z0PA 1FMWA 2XQ7A 4JI1T 4DBQA 3VKGA 2XQ8A 5JDGA 2WM9A 3I0OA 3EDUA 1VRBA 2V7LA 1MMNA 4DUZT 2YEVC 5FXWA 2VQET 3R84B 2WQYA 3EABA 3PTRB 4LFAT 2LM9A 1HNXT 4LFBT 1OXZA 1W0BA 5ETWA 4H63V 2XQYA 3SFEA 4YHJA 4KHZF 1MIVA 4V1Av 4GOUA 2XPKA 2IHR1 2E2AA 3ONXA 4YSZA 3K3OA 4BAYB 2NW9A 2YKSA 3C64A 2WZHA 1SA0E 2UU9T 4L9IA 4EYYR 3N2OA 3UQ4A 2XJ7A 2XM1A 4HWCA 3RPUA 3VRBA 1M7KA 3RYIE 3V5SA 4PW8A 4HFIA 3RQUA 1NWMX 3NVOA 4OYKA 3P4RA 4OFZA 2X68A 5JDNA 2H88A 2CWOA 5CFBA 2EHOA 3TLWA 1YKHB 5ABFB 3QOFA 5JDLA 5FVLA 2XUEA 2WZIA 4CI1B 3RH3A 2A72A 1UX5A 4YXDA 2QRXA 4DR7T 2DL1A 2PFVA 5AQVB 3N9LA 2LKGA 4H9NC 3P4PA 4IHJE 5JRCA 3ZEFB 3O4XE 5JR9A 2WAUA 2V6YA 5LYJE 4I55E 2Y48B 1X9BA 2V8SV 4DIDB 3ZMUB 4PJNA 4IIJE 4COFA 1D1AA 2V26A 3LBXB 3V5UA 2Y8DA 4HFHA 3I0QA 2RP4A 2H7OA 4GKJT 2KNDA 2J47A 4QX8B 3Q5EA 3MKDA 1D0XA 4EEDA 3FHNA 2FJBA 2VL8A 4U3CA 3ZJ2A 4ZI3D 3LK42 5FXVA 4AIUA 1E2AA 3K3NA 2F4VT 4X62T 2VURA 3E08A 3ZYLA 2A3DA 2OA5A 4I4TE 1WCRA 2LSJA 4KHPT 2XQ5A 4ZI3C 3A5XA 2V7KA 3PUYF 2CCQA 2K9AA 2WU5A 3KFWX 4ZHQE 5L3CB 4I43B 2C0SA 5EK3A 3O1IA 3ONLC 1WR6A 2KLQA 3VHLA 2PBIA 3L8RA 3Q9DA 4DV4T 5CB4E 2D0TA 4DMWA 4EZHA 4ASKA 1E1HB 2LSGA 2Q9QB 4PK5A 3F57A 3MZKB 3J9X1 3RIFA 2WDQA 4OX9T 2V7IA 2LKHA 2QVAA 4KMCA 4UV9B 1US7B 1FIOA 2XQ3A 4X1IE 1I6ZA 2SPCA 3L3PA 4NUUA 4CXXA 2X67A 3CQCB 3ZYMA 3EI0A 2VKHA 2AXDS 2LSYA 5JDHA 1J5WA 4JUYA 1X79A 2V7MA 3ZSSA 2H3RA 2BG9A 1FMVA 3SFDA 2XM2A 1JNRA 3L09A 4EYUA 3PUXF 2C5IT 1H7CA 2VL0A 2XASB 2H7VC 4EIWA 4QH1A 3RGLA 1WR0A 4WNKA 4DV2T 5LG3A 4HWFA 2C5JA 2LRKA 1KEYA 3T8OA 3QB5K 3O9XA 4ISSA 3RYFE 1YW0A 2CLYC 2LOPA 3AXJA 1BR0A 2LT3A 2XQ6A 2XQ4A 4EXTA 2W67A 5LB7B 3SS1A 3ETVA 3CK6A 3RKOA 3UU3A 3QB5A 3PDYA 2IC9A 2BZBA 4MHCA 2D2SA 2YDSA 4CQIA 2E5LT 2X0YA 4QXCB 1KNZA 4O4IE 2W4XA 2WWVA 4DV0T 3T1HT 3RHWA 4O4LE 4ZZBA 2WMNA 2XAFB 4F8HA 2NWBA 2FJDA 5HWYA 5CA1E 4CZZB 3PE0A 4X5TA 1G8XA 3O1JA 3AVSA 3CQXC 5HXEA 4Z90A 4B6XA 3C4WA 1BR1A 2WDVA 5HCJA 2CHNA 4TNVA 4UVBB 2WY2A 2W61A 3AA6B 3CX7B 4ZS3A 2V6YB 2VKDA 3CQGB 2JIWA 5TAOA 2A2FX 3TLSA 5HEOA 4UR9A 2XAHB 1J1JA 2ZM2A 2V5DA 4TX5A 4AISA 4WW0A 4U7IA 5IYZE 2KMFA 3HL6A 4XAXB 3K1SA 2VVSA 2PJQA 1FEWA 4NIQA 5M4YA 4HFVA 2X9WA 5JTGA 2GK9A 2JJ9A 5LBMA 3IHRA 2W2UA 2PTFA 5ABFA 4ANJA 4ZI7E 4TWFA 2ZM6T 3QUJA 1CHUA 4LMKA 2H89A 4UIGA 4GYRA 1QLBA 3WAJA 2EHOD 4CN6A 5JVDE 3HKDE 3PUSA 3OBVE 2V1DB 2N1GA 3B13A 4DNDA 2K3WA 1UX4A 3PU8A 4DV1T 2WWUA 3FZKB 1KFYA 4AQFA 5BR8T 5AQUB 2ZLYA 1SHZC 3ZMZB 2YU2A 4X65T 2LSKA 2EHOC 2DCFA 3HA4A 3RLFF 3MXZA 3ZMTB 1YD8G 5LMUT 4UELA 4AKIA 4DVDA 2CEAA 3LBXA 3WI3A 2IAKA 1MNEA 2WSSV 1HTJF 1WRDA 2LE8A 4X64T 1KK7A 3M3ZB 1XMOT 3UUNA 2OLTA 5DABA 3DTOA 2D0UA 4HE8A 2L8KA 3E0ZA 4HFCA 2ZM0A 4B3MT 2ZMAA 2VASA 4CI2B 2VWAA 3AA7B 2XAQB 5JR9C 4YTNA 2K5BB 4L5GA 4F6RC 3O1HA 3M65A 2W62A 3ZT7A 2QYWA 1HX1B 5L3BB 4YSYA 5LGNB 5LGUB 2NP9A 3AA1B 2B1EA 3OVUA 2X0HA 1W9RA 5C2TA 2XAGB 3FB2A 3FXDB 2KINB 4QHOA 4PNIA 2PG8A 3N5LA 5L3GB 2J1DG 2JRKA 3PUGA 3UULA 4LF7T 2Q9QA 5L4HA 5LBQB 4GK5E 3RIAA 4JBWF 4TN7B 3LK3B 5AQGB 4HFDA 1MIWA 3AEDA 3CX6B 3AEGA 3KV4A 4PK6A 3PJAJ 2CWYA 4QH4A 5H6QB 2UXBT 3UUXB 1W0AA 4MFRA 5HEGA 2W00A 2IDOB 4U2ZA 3IF8B 5AQJB 4IE4A 1V9DA 3RIUC 5AQIB 2BVMA 4H9PC 3ETUA 1R8IA 2W0GA 5DQWA 4CXWA 3NZPA 2XQAA 3X1DA 2R6GF 3TLTA 2IMLA 2XAJB 3P50A 5FXZA 1HG2A 4DR4T 3N9MA 1L0VA 5F3JA 5LNKA 3G06A 3CKDA 3OYZA 5FY1A 2CM0A 4Z8XA 2VKOA 5AFUL 3HI2A 4HEAA 4DV6T 5ABHA 2BVLA 3AE5A 5HEUA 2RA1A 4WZXA 2WB5A 4CXYA 3U3IA 3Q5WA 2YOEA 2BG9C 5FY0A 1NEKA 3UFEA 4IL4A 1MIYA 4P0AA 4YJ3E 3NRYA 3AECA 3I1AA 4A5XA 5LP6E 2CBJA 1NENA 2YDRA 2UXDT 1WYCA 3F31A 3HKCE 1OEDC 4P1NA 4QX7B 3BK9A 4U72A 5HYAA 2JQ9A 4HGAA 4U31A 4KBMB 4HWIB 4FI5A 4A97A 5KXJA 4TV9E 1UGOA 4EOZB 1EZ3A 1IBKT 3N9OA 2DWGA 4NXMT 5JH7E 4PJJA 5AQHB 2CBIA 3RI5A 4PJMA 3AE1A 2AE9A 2JQHA 3F2EA 3Q2MA 4DUYT 4U2YA 4KX6A 3VR8A 5DQVA 4EEBA 1HG5A 2HHHT 3AE6A 1KNRA 4JI0T 3ZCIA 5CJ5A 1T98A 4XZCA 3OTOT 2Z6EA 1HX8A 3UU6A 5L3FB 5LJMA 3ZSTA 2M6BA 4B3TT 1N32T 2CPTA 2KZ7B 3N2KE 4B3ST 4IE5A 2I6HA 3P4WA 4JI5T 4TNWA 1ZHCA 1VOMA 5AQFB 1HCIA 3SWHA 3J7Yq 3VKHA 2BBHA 3AE9A 3KV5A 5LJNA 4DR1T 3FBZA 3UUMA 2WDRA 2E8IA 2IW5B 5HCMA 3QC9A 2LM2A 3CVRA 3KDSE 4UF0A 1QSDA 4WBOA 5HXCA 2E5VA 3NKZA 3H3AA 5KDMC 2XSAA 5AQKB 3JC6D 4YFSA 1BR4A 4YY3T 2FBWA 3KINB 3N9QA 2VVNA 3P4QA 1J5ET 5LOVE 5FY7A 4YTPA 5C8YE 2WU2A 5HXHA 4AKGA 4ZS2A 4NPPA 5LXTE 3JC6C 2BKPA 4H9SE 1IBLT 1OWAA 3MACA 3ZN0B 2JQKA 1G73A 5FMNA 3MK7C 1ZKEA 2WS3A 3N9PA 2BBJA 5ADXL 5AQLB 1VCTA 2L9QA 4JI2T 5HXSA 3GWHA 2M6IA 3TKLB 4HFEA 5GONE 4O2AE 4IL9A 5J0ZA 1ZEEA 4ZZCA 4IDNA 4EV6A 4KI0F 4A98A 1N34T 4PAGA 1I94T 3ESLA 3GN5B 4JEHB 1Y01A 2RPAA 4LF4T 2Q9QD 2XSBA 3AA0B 1VCSA 2DI4A 4UV8B 4EGWA 3TLUA 2E9XB 2OV9A 1HR0T 4ILBA 3BQKA 5AQMB 3UU8A 2XZEA 4XBFB 3HR0A 2KWIB 2XTLA 4LMJA 3JAEA 3OJAA 5H6RB 5HEHA 2Q9QC 2ACXA 4Z91A 1MNDA 4JEUB 4PJLA 3CPZA 4JI6T 3L39A 4L0RA 4LMLA 2XHEB 4WBNE 1UUSA 4AKHA 3DP7A 1AJ3A 4I50E 3RYCE 4YHHT 4TWDA 3S4UA 2YU1A 3ZT5A 2ES0A
chains in the Genus database with same CATH topology
3T1YT 4DR7T 4DR6T 4X66T 4B3TT 2VQET 1N32T 4DV0T 2UUCT 4DV1T 4B3ST 3T1HT 4LF7T 4LFAT 1N33T 4JI5T 4JI2T 4JYAT 5BR8T 4GKKT 2UXDT 4OX9T 5IWAT 2UXCT 1HNXT 4X65T 4LF9T 4LFBT 4JI7T 4DV5T 2UXBT 1XNQT 1N34T 4DR1T 2UUAT 1I94T 5LMUT 4LF4T 4DV3T 4DR2T 1IBMT 2VQFT 4DR5T 4GKJT 4B3RT 1HR0T 1IBKT 2UU9T 4JI8T 4X64T 1XMOT 4JV5T 4LFCT 1HNWT 4LF8T 4DR3T 4NXMT 1XNRT 4LF6T 4B3MT 4YY3T 2F4VT 1FJGT 4DR4T 4X62T 4DV2T 1HNZT 4DV7T 1J5ET 4JI3T 4DUYT 5LMNT 4JI4T 4KHPT 4K0KT 4JI6T 4JI1T 4LF5T 4DV6T 2UUBT 1IBLT 2HHHT 2ZM6T 4JI0T 1XMQT 4NXNT 4AQYT 3OTOT 4DV4T 4YHHT 2E5LT 4DUZT 1N36T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1Y T;  4DR7 T;  4DR6 T;  4X66 T;  4B3T T;  2VQE T;  1N32 T;  4DV0 T;  2UUC T;  4DV1 T;  4B3S T;  3T1H T;  4LF7 T;  4LFA T;  1N33 T;  4JI5 T;  4JI2 T;  4JYA T;  5BR8 T;  4GKK T;  2UXD T;  4OX9 T;  5IWA T;  2UXC T;  1HNX T;  4X65 T;  4LF9 T;  4LFB T;  4JI7 T;  4DV5 T;  2UXB T;  1XNQ T;  1N34 T;  4DR1 T;  2UUA T;  1I94 T;  5LMU T;  4LF4 T;  4DV3 T;  4DR2 T;  1IBM T;  2VQF T;  4DR5 T;  4GKJ T;  4B3R T;  1HR0 T;  1IBK T;  2UU9 T;  4JI8 T;  4X64 T;  1XMO T;  4JV5 T;  4LFC T;  1HNW T;  4LF8 T;  4DR3 T;  4NXM T;  1XNR T;  4LF6 T;  4B3M T;  4YY3 T;  2F4V T;  1FJG T;  4DR4 T;  4X62 T;  4DV2 T;  1HNZ T;  4DV7 T;  1J5E T;  4JI3 T;  4DUY T;  5LMN T;  4JI4 T;  4KHP T;  4K0K T;  4JI6 T;  4JI1 T;  4LF5 T;  4DV6 T;  2UUB T;  1IBL T;  2HHH T;  2ZM6 T;  4JI0 T;  1XMQ T;  4NXN T;  4AQY T;  3OTO T;  4DV4 T;  4YHH T;  2E5L T;  4DUZ T;  1N36 T; 
#chains in the Genus database with same CATH topology
 4MAL A;  3PJA A;  3WAK A;  4AKR B;  3AE7 A;  3AAA B;  4PFO A;  3HKE E;  5FL1 A;  3AE2 A;  1YKE B;  3P7I A;  3AEA A;  5L3D B;  2N2N A;  4GKK T;  4BJN A;  4LF9 T;  4C90 A;  1W09 A;  4MLK A;  3PV0 F;  3KBT A;  4P09 A;  3LFM A;  2QGS A;  4H63 H;  2JMH A;  3PUZ F;  4CN4 A;  4AI6 A;  4H9Q C;  4O2B E;  2IIU A;  2V6X A;  4EZ4 A;  4DBR A;  5LHI B;  4ZOL E;  1YQ3 A;  2LRL A;  4DR3 T;  1T8B A;  3ZKR A;  3K8P C;  4IDO A;  3JAF A;  5KX5 E;  4UF0 B;  5L2L A;  3EUH A;  5F5W A;  3AE4 A;  4IDQ A;  1OED E;  2FJA A;  1YXR A;  4DV7 T;  1DU2 A;  4IDZ A;  4TV8 E;  1HS7 A;  3ANW A;  1XZY A;  4IE0 A;  2NR4 A;  1D1B A;  2MBG A;  3C51 A;  5FVK A;  3EDV A;  3ZMV B;  3C4Z A;  1UK5 A;  3H3M A;  3AEE A;  5BMV E;  4H9O C;  5F8P A;  2G0U A;  4NXN T;  5EK4 A;  2BDE A;  4TWH A;  4DR6 T;  2X9H A;  4QH5 A;  4X66 T;  4O4H E;  3LJC A;  1UCU A;  4OHF A;  2MYS A;  2HPL A;  5L47 A;  5L4E A;  4BA9 A;  2KWH A;  1XWM A;  5FL0 A;  2NW8 A;  1HFA A;  4AKL A;  1D0Z A;  4H9R C;  2LEH A;  1S94 A;  3N2G E;  2VKJ A;  5LGT B;  3GA8 A;  4IE6 A;  1YQ4 A;  3PUA A;  1XDP A;  4DV3 T;  3PUW F;  3Q5D A;  2J62 A;  1MMD A;  4O8S A;  4PFP A;  2BKN A;  4UEM A;  5AQQ B;  3PUR A;  4LF6 T;  2NTX A;  3ZC0 A;  2I59 A;  3VR9 A;  4IDP A;  3PUV F;  2LHN A;  3KV9 A;  4CI3 B;  3OPC A;  2V5C A;  5J1G A;  2IC6 A;  4JI4 T;  2UXX B;  2DWK A;  3JCF A;  4AXP A;  3EHZ A;  2WMO A;  2A9U A;  5DJQ C;  3A7M A;  3RC8 A;  3RRC A;  3RKG A;  3W15 B;  4X20 E;  3ZN1 B;  1M62 A;  3AVR A;  3LDQ B;  3FBL A;  2X9Y A;  2BS2 A;  1LVF A;  1IJ5 A;  3RC3 A;  3U78 A;  3ZC1 A;  5HWX A;  4N78 D;  3QNU A;  1D0Y A;  4ZXL A;  2NOX A;  5AQN B;  4OK0 A;  4UXN B;  4GYS A;  1KF6 A;  4HN9 A;  4DV5 T;  3PU3 A;  4YT0 A;  2XQ9 A;  4QKN A;  4G63 A;  2DLR A;  4ERR A;  1JNZ A;  3GN5 A;  1IBM T;  3I9W A;  2VQF T;  3KBU A;  5LCY A;  3C50 A;  2V7J A;  3IEE A;  4TUY E;  1WYB A;  2E9X A;  4I0U A;  4JV5 T;  2BKO A;  3C98 B;  5AQT B;  2ACZ A;  1QUU A;  3EAM A;  3CIR A;  1T7S A;  3EVY A;  4KUM B;  4MBQ A;  2CMR A;  2LOS A;  5LA6 E;  2JPF A;  5IUX A;  3ZLI A;  4JI3 T;  4TZ4 C;  2WCA A;  4J2C A;  4YJ2 E;  4HKA A;  2MPK A;  2X51 A;  3HKB E;  2CXF A;  2UXN B;  2UUB T;  3NBX X;  4HTE A;  1GQE A;  5LHG B;  3ANW B;  3RF1 A;  3MA9 A;  3NWI A;  2KXP B;  2D9D A;  4YSX A;  2HPJ A;  3UTK A;  4DMV A;  2MTQ A;  2X9X A;  2CLY B;  1IZN B;  4EB6 E;  4ILU A;  5ABE A;  4NUV A;  2UUA T;  2NTY A;  1KNP A;  3IBP A;  1ZV4 X;  3E22 E;  5JDM A;  3VRA A;  3LSV A;  3UFG A;  4JI8 T;  4YTM A;  3UT5 E;  1O3X A;  2BS3 A;  4LFC T;  2N9D A;  3IA3 A;  4GK0 E;  3SRZ A;  5JDF A;  5E0O A;  2W66 A;  5JDQ A;  2CE7 A;  1UUR A;  2XY8 B;  5ABG A;  3RIU A;  4AQG A;  4BJM A;  3KVA A;  3RQW A;  3ZJ1 A;  3AE8 A;  2WBL A;  2I0M A;  4K0K T;  5L3E B;  1WFD A;  5FNV E;  3N9N A;  4JLE A;  4O4J E;  5J2T E;  5FP3 A;  4AQF C;  3AEB A;  1XMQ T;  2ZM8 A;  3FXE B;  2YIN A;  3UU5 A;  2CA5 A;  2CXD A;  2UUC T;  2M67 A;  2LSI A;  2FUP A;  4OYJ A;  3C4X A;  2KSR A;  2QA7 A;  4JYA T;  5CA0 E;  3ZMS B;  5IHY A;  5IWA T;  2UXC T;  3B5M A;  5CGM A;  4YLH A;  4UVA B;  3LG7 A;  4G2A A;  3VU7 H;  3AB3 B;  5EZY E;  1U5P A;  3A8Y C;  4IST A;  1NAF A;  3I9Y A;  2X0L B;  4KP3 C;  1OED A;  3GMI A;  4X1K E;  3UU4 A;  4X1Y E;  4U7Y A;  4IRE A;  4E7Z A;  5LHH B;  2LJL A;  3DJB A;  3OYX A;  5KMG P;  4E7S A;  2EHO B;  4U33 A;  4IT4 A;  5FXX A;  1LVK A;  4ILC A;  1CUN A;  4WYV A;  4HFB A;  5LMN T;  3ZT6 A;  5J2U E;  4K0U A;  3KV6 A;  2YN6 A;  4QXB B;  4DO0 A;  4Q25 A;  2MAW A;  4AQY T;  3PUQ A;  1IJ6 A;  3QK6 A;  3ABV A;  1U4Q A;  1SUM B;  3FZL B;  2C5K T;  1MMG A;  5JRC B;  4HWH A;  2L3L A;  1Z8U A;  4QXH B;  5JR9 B;  3FZH B;  4P0B A;  4GIW A;  1T72 A;  1LRZ A;  5A1L A;  5HAX A;  3JAD A;  2HN1 A;  3D0T A;  1E7P A;  3ONJ A;  1ZP0 A;  2NW7 A;  2FJE A;  2CRB A;  4DR5 T;  3BQI A;  2HN2 A;  4A56 A;  3AAI A;  4IE7 A;  3P4S A;  1SE7 A;  3RRW A;  4PK4 A;  3BQL A;  4HWD A;  4LF8 T;  1XNR T;  1WLX A;  5LG4 A;  3OKQ A;  2P9B A;  1HNZ T;  5AQR B;  1HF8 A;  2BG9 E;  2JMK A;  2HH7 A;  4M1P A;  3RYH E;  2ODU A;  2LHR A;  2E9X D;  4C91 A;  4LF5 T;  4ZI2 D;  2J4G A;  3H37 A;  3LK2 B;  4ILA A;  1Y64 B;  2K24 A;  1D1C A;  2CXL A;  3MJX A;  4EAH A;  3UQ7 A;  3UUB A;  2X66 A;  2D5U A;  1ZOY A;  1IAP A;  2MOZ A;  2LLY A;  2YDQ A;  4ZEY A;  3ZYK A;  3ZPO A;  1N36 T;  3T1Y T;  1BR2 A;  2E9X C;  3P8C D;  2WP9 A;  2K48 A;  3RX6 A;  4ADZ A;  3ZCJ A;  3AE3 A;  4ZI2 C;  3NZQ A;  4IGU A;  1N33 T;  4FJO A;  3FZF B;  3AAE B;  5C3J A;  1MMA A;  3CWZ B;  3K3Q C;  3Q5X A;  2DNX A;  2BS4 A;  1LKX A;  4JI7 T;  1XNQ T;  3TLV A;  3R6N A;  1B7T A;  2Y6X A;  2B76 A;  3NRX A;  2JQQ A;  2IUB A;  3AEF A;  2VB6 A;  2W63 A;  2KT9 A;  2ODV A;  3SOL A;  5AQP B;  1S35 A;  4DR2 T;  3KVB A;  2BG9 B;  5FKY A;  4B3R T;  5JQG E;  3CML A;  5FYM A;  4UVC B;  5HEJ A;  2DHR A;  1HNW T;  2CHO A;  4U74 A;  3FZM B;  5EK2 A;  3B57 A;  4CN1 A;  4QWN B;  5AQO B;  1FJG T;  1OED B;  5HXR A;  3CX8 B;  5JRE A;  3AXJ B;  2VK9 A;  1XDO A;  5AQS B;  2YK0 A;  1Z0P A;  1FMW A;  2XQ7 A;  4JI1 T;  4DBQ A;  3VKG A;  2XQ8 A;  5JDG A;  2WM9 A;  3I0O A;  3EDU A;  1VRB A;  2V7L A;  1MMN A;  4DUZ T;  2YEV C;  5FXW A;  2VQE T;  3R84 B;  2WQY A;  3EAB A;  3PTR B;  4LFA T;  2LM9 A;  1HNX T;  4LFB T;  1OXZ A;  1W0B A;  5ETW A;  4H63 V;  2XQY A;  3SFE A;  4YHJ A;  4KHZ F;  1MIV A;  4V1A v;  4GOU A;  2XPK A;  2IHR 1;  2E2A A;  3ONX A;  4YSZ A;  3K3O A;  4BAY B;  2NW9 A;  2YKS A;  3C64 A;  2WZH A;  1SA0 E;  2UU9 T;  4L9I A;  4EYY R;  3N2O A;  3UQ4 A;  2XJ7 A;  2XM1 A;  4HWC A;  3RPU A;  3VRB A;  1M7K A;  3RYI E;  3V5S A;  4PW8 A;  4HFI A;  3RQU A;  1NWM X;  3NVO A;  4OYK A;  3P4R A;  4OFZ A;  2X68 A;  5JDN A;  2H88 A;  2CWO A;  5CFB A;  2EHO A;  3TLW A;  1YKH B;  5ABF B;  3QOF A;  5JDL A;  5FVL A;  2XUE A;  2WZI A;  4CI1 B;  3RH3 A;  2A72 A;  1UX5 A;  4YXD A;  2QRX A;  4DR7 T;  2DL1 A;  2PFV A;  5AQV B;  3N9L A;  2LKG A;  4H9N C;  3P4P A;  4IHJ E;  5JRC A;  3ZEF B;  3O4X E;  5JR9 A;  2WAU A;  2V6Y A;  5LYJ E;  4I55 E;  2Y48 B;  1X9B A;  2V8S V;  4DID B;  3ZMU B;  4PJN A;  4IIJ E;  4COF A;  1D1A A;  2V26 A;  3LBX B;  3V5U A;  2Y8D A;  4HFH A;  3I0Q A;  2RP4 A;  2H7O A;  4GKJ T;  2KND A;  2J47 A;  4QX8 B;  3Q5E A;  3MKD A;  1D0X A;  4EED A;  3FHN A;  2FJB A;  2VL8 A;  4U3C A;  3ZJ2 A;  4ZI3 D;  3LK4 2;  5FXV A;  4AIU A;  1E2A A;  3K3N A;  2F4V T;  4X62 T;  2VUR A;  3E08 A;  3ZYL A;  2A3D A;  2OA5 A;  4I4T E;  1WCR A;  2LSJ A;  4KHP T;  2XQ5 A;  4ZI3 C;  3A5X A;  2V7K A;  3PUY F;  2CCQ A;  2K9A A;  2WU5 A;  3KFW X;  4ZHQ E;  5L3C B;  4I43 B;  2C0S A;  5EK3 A;  3O1I A;  3ONL C;  1WR6 A;  2KLQ A;  3VHL A;  2PBI A;  3L8R A;  3Q9D A;  4DV4 T;  5CB4 E;  2D0T A;  4DMW A;  4EZH A;  4ASK A;  1E1H B;  2LSG A;  2Q9Q B;  4PK5 A;  3F57 A;  3MZK B;  3J9X 1;  3RIF A;  2WDQ A;  4OX9 T;  2V7I A;  2LKH A;  2QVA A;  4KMC A;  4UV9 B;  1US7 B;  1FIO A;  2XQ3 A;  4X1I E;  1I6Z A;  2SPC A;  3L3P A;  4NUU A;  4CXX A;  2X67 A;  3CQC B;  3ZYM A;  3EI0 A;  2VKH A;  2AXD S;  2LSY A;  5JDH A;  1J5W A;  4JUY A;  1X79 A;  2V7M A;  3ZSS A;  2H3R A;  2BG9 A;  1FMV A;  3SFD A;  2XM2 A;  1JNR A;  3L09 A;  4EYU A;  3PUX F;  2C5I T;  1H7C A;  2VL0 A;  2XAS B;  2H7V C;  4EIW A;  4QH1 A;  3RGL A;  1WR0 A;  4WNK A;  4DV2 T;  5LG3 A;  4HWF A;  2C5J A;  2LRK A;  1KEY A;  3T8O A;  3QB5 K;  3O9X A;  4ISS A;  3RYF E;  1YW0 A;  2CLY C;  2LOP A;  3AXJ A;  1BR0 A;  2LT3 A;  2XQ6 A;  2XQ4 A;  4EXT A;  2W67 A;  5LB7 B;  3SS1 A;  3ETV A;  3CK6 A;  3RKO A;  3UU3 A;  3QB5 A;  3PDY A;  2IC9 A;  2BZB A;  4MHC A;  2D2S A;  2YDS A;  4CQI A;  2E5L T;  2X0Y A;  4QXC B;  1KNZ A;  4O4I E;  2W4X A;  2WWV A;  4DV0 T;  3T1H T;  3RHW A;  4O4L E;  4ZZB A;  2WMN A;  2XAF B;  4F8H A;  2NWB A;  2FJD A;  5HWY A;  5CA1 E;  4CZZ B;  3PE0 A;  4X5T A;  1G8X A;  3O1J A;  3AVS A;  3CQX C;  5HXE A;  4Z90 A;  4B6X A;  3C4W A;  1BR1 A;  2WDV A;  5HCJ A;  2CHN A;  4TNV A;  4UVB B;  2WY2 A;  2W61 A;  3AA6 B;  3CX7 B;  4ZS3 A;  2V6Y B;  2VKD A;  3CQG B;  2JIW A;  5TAO A;  2A2F X;  3TLS A;  5HEO A;  4UR9 A;  2XAH B;  1J1J A;  2ZM2 A;  2V5D A;  4TX5 A;  4AIS A;  4WW0 A;  4U7I A;  5IYZ E;  2KMF A;  3HL6 A;  4XAX B;  3K1S A;  2VVS A;  2PJQ A;  1FEW A;  4NIQ A;  5M4Y A;  4HFV A;  2X9W A;  5JTG A;  2GK9 A;  2JJ9 A;  5LBM A;  3IHR A;  2W2U A;  2PTF A;  5ABF A;  4ANJ A;  4ZI7 E;  4TWF A;  2ZM6 T;  3QUJ A;  1CHU A;  4LMK A;  2H89 A;  4UIG A;  4GYR A;  1QLB A;  3WAJ A;  2EHO D;  4CN6 A;  5JVD E;  3HKD E;  3PUS A;  3OBV E;  2V1D B;  2N1G A;  3B13 A;  4DND A;  2K3W A;  1UX4 A;  3PU8 A;  4DV1 T;  2WWU A;  3FZK B;  1KFY A;  4AQF A;  5BR8 T;  5AQU B;  2ZLY A;  1SHZ C;  3ZMZ B;  2YU2 A;  4X65 T;  2LSK A;  2EHO C;  2DCF A;  3HA4 A;  3RLF F;  3MXZ A;  3ZMT B;  1YD8 G;  5LMU T;  4UEL A;  4AKI A;  4DVD A;  2CEA A;  3LBX A;  3WI3 A;  2IAK A;  1MNE A;  2WSS V;  1HTJ F;  1WRD A;  2LE8 A;  4X64 T;  1KK7 A;  3M3Z B;  1XMO T;  3UUN A;  2OLT A;  5DAB A;  3DTO A;  2D0U A;  4HE8 A;  2L8K A;  3E0Z A;  4HFC A;  2ZM0 A;  4B3M T;  2ZMA A;  2VAS A;  4CI2 B;  2VWA A;  3AA7 B;  2XAQ B;  5JR9 C;  4YTN A;  2K5B B;  4L5G A;  4F6R C;  3O1H A;  3M65 A;  2W62 A;  3ZT7 A;  2QYW A;  1HX1 B;  5L3B B;  4YSY A;  5LGN B;  5LGU B;  2NP9 A;  3AA1 B;  2B1E A;  3OVU A;  2X0H A;  1W9R A;  5C2T A;  2XAG B;  3FB2 A;  3FXD B;  2KIN B;  4QHO A;  4PNI A;  2PG8 A;  3N5L A;  5L3G B;  2J1D G;  2JRK A;  3PUG A;  3UUL A;  4LF7 T;  2Q9Q A;  5L4H A;  5LBQ B;  4GK5 E;  3RIA A;  4JBW F;  4TN7 B;  3LK3 B;  5AQG B;  4HFD A;  1MIW A;  3AED A;  3CX6 B;  3AEG A;  3KV4 A;  4PK6 A;  3PJA J;  2CWY A;  4QH4 A;  5H6Q B;  2UXB T;  3UUX B;  1W0A A;  4MFR A;  5HEG A;  2W00 A;  2IDO B;  4U2Z A;  3IF8 B;  5AQJ B;  4IE4 A;  1V9D A;  3RIU C;  5AQI B;  2BVM A;  4H9P C;  3ETU A;  1R8I A;  2W0G A;  5DQW A;  4CXW A;  3NZP A;  2XQA A;  3X1D A;  2R6G F;  3TLT A;  2IML A;  2XAJ B;  3P50 A;  5FXZ A;  1HG2 A;  4DR4 T;  3N9M A;  1L0V A;  5F3J A;  5LNK A;  3G06 A;  3CKD A;  3OYZ A;  5FY1 A;  2CM0 A;  4Z8X A;  2VKO A;  5AFU L;  3HI2 A;  4HEA A;  4DV6 T;  5ABH A;  2BVL A;  3AE5 A;  5HEU A;  2RA1 A;  4WZX A;  2WB5 A;  4CXY A;  3U3I A;  3Q5W A;  2YOE A;  2BG9 C;  5FY0 A;  1NEK A;  3UFE A;  4IL4 A;  1MIY A;  4P0A A;  4YJ3 E;  3NRY A;  3AEC A;  3I1A A;  4A5X A;  5LP6 E;  2CBJ A;  1NEN A;  2YDR A;  2UXD T;  1WYC A;  3F31 A;  3HKC E;  1OED C;  4P1N A;  4QX7 B;  3BK9 A;  4U72 A;  5HYA A;  2JQ9 A;  4HGA A;  4U31 A;  4KBM B;  4HWI B;  4FI5 A;  4A97 A;  5KXJ A;  4TV9 E;  1UGO A;  4EOZ B;  1EZ3 A;  1IBK T;  3N9O A;  2DWG A;  4NXM T;  5JH7 E;  4PJJ A;  5AQH B;  2CBI A;  3RI5 A;  4PJM A;  3AE1 A;  2AE9 A;  2JQH A;  3F2E A;  3Q2M A;  4DUY T;  4U2Y A;  4KX6 A;  3VR8 A;  5DQV A;  4EEB A;  1HG5 A;  2HHH T;  3AE6 A;  1KNR A;  4JI0 T;  3ZCI A;  5CJ5 A;  1T98 A;  4XZC A;  3OTO T;  2Z6E A;  1HX8 A;  3UU6 A;  5L3F B;  5LJM A;  3ZST A;  2M6B A;  4B3T T;  1N32 T;  2CPT A;  2KZ7 B;  3N2K E;  4B3S T;  4IE5 A;  2I6H A;  3P4W A;  4JI5 T;  4TNW A;  1ZHC A;  1VOM A;  5AQF B;  1HCI A;  3SWH A;  3J7Y q;  3VKH A;  2BBH A;  3AE9 A;  3KV5 A;  5LJN A;  4DR1 T;  3FBZ A;  3UUM A;  2WDR A;  2E8I A;  2IW5 B;  5HCM A;  3QC9 A;  2LM2 A;  3CVR A;  3KDS E;  4UF0 A;  1QSD A;  4WBO A;  5HXC A;  2E5V A;  3NKZ A;  3H3A A;  5KDM C;  2XSA A;  5AQK B;  3JC6 D;  4YFS A;  1BR4 A;  4YY3 T;  2FBW A;  3KIN B;  3N9Q A;  2VVN A;  3P4Q A;  1J5E T;  5LOV E;  5FY7 A;  4YTP A;  5C8Y E;  2WU2 A;  5HXH A;  4AKG A;  4ZS2 A;  4NPP A;  5LXT E;  3JC6 C;  2BKP A;  4H9S E;  1IBL T;  1OWA A;  3MAC A;  3ZN0 B;  2JQK A;  1G73 A;  5FMN A;  3MK7 C;  1ZKE A;  2WS3 A;  3N9P A;  2BBJ A;  5ADX L;  5AQL B;  1VCT A;  2L9Q A;  4JI2 T;  5HXS A;  3GWH A;  2M6I A;  3TKL B;  4HFE A;  5GON E;  4O2A E;  4IL9 A;  5J0Z A;  1ZEE A;  4ZZC A;  4IDN A;  4EV6 A;  4KI0 F;  4A98 A;  1N34 T;  4PAG A;  1I94 T;  3ESL A;  3GN5 B;  4JEH B;  1Y01 A;  2RPA A;  4LF4 T;  2Q9Q D;  2XSB A;  3AA0 B;  1VCS A;  2DI4 A;  4UV8 B;  4EGW A;  3TLU A;  2E9X B;  2OV9 A;  1HR0 T;  4ILB A;  3BQK A;  5AQM B;  3UU8 A;  2XZE A;  4XBF B;  3HR0 A;  2KWI B;  2XTL A;  4LMJ A;  3JAE A;  3OJA A;  5H6R B;  5HEH A;  2Q9Q C;  2ACX A;  4Z91 A;  1MND A;  4JEU B;  4PJL A;  3CPZ A;  4JI6 T;  3L39 A;  4L0R A;  4LML A;  2XHE B;  4WBN E;  1UUS A;  4AKH A;  3DP7 A;  1AJ3 A;  4I50 E;  3RYC E;  4YHH T;  4TWD A;  3S4U A;  2YU1 A;  3ZT5 A;  2ES0 A; 
#chains in the Genus database with same CATH homology
 3T1Y T;  4DR7 T;  4DR6 T;  4X66 T;  4B3T T;  2VQE T;  1N32 T;  4DV0 T;  2UUC T;  4DV1 T;  4B3S T;  3T1H T;  4LF7 T;  4LFA T;  1N33 T;  4JI5 T;  4JI2 T;  4JYA T;  5BR8 T;  4GKK T;  2UXD T;  4OX9 T;  5IWA T;  2UXC T;  1HNX T;  4X65 T;  4LF9 T;  4LFB T;  4JI7 T;  4DV5 T;  2UXB T;  1XNQ T;  1N34 T;  4DR1 T;  2UUA T;  1I94 T;  5LMU T;  4LF4 T;  4DV3 T;  4DR2 T;  1IBM T;  2VQF T;  4DR5 T;  4GKJ T;  4B3R T;  1HR0 T;  1IBK T;  2UU9 T;  4JI8 T;  4X64 T;  1XMO T;  4JV5 T;  4LFC T;  1HNW T;  4LF8 T;  4DR3 T;  4NXM T;  1XNR T;  4LF6 T;  4B3M T;  4YY3 T;  2F4V T;  1FJG T;  4DR4 T;  4X62 T;  4DV2 T;  1HNZ T;  4DV7 T;  1J5E T;  4JI3 T;  4DUY T;  5LMN T;  4JI4 T;  4KHP T;  4K0K T;  4JI6 T;  4JI1 T;  4LF5 T;  4DV6 T;  2UUB T;  1IBL T;  2HHH T;  2ZM6 T;  4JI0 T;  1XMQ T;  4NXN T;  4AQY T;  3OTO T;  4DV4 T;  4YHH T;  2E5L T;  4DUZ T;  1N36 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...