4NXMT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxmT00
4K0KT 1HNWT 2UUAT 4DV6T 4LF6T 4JI5T 4OX9T 4LF5T 4JI6T 1N36T 4X64T 4DV0T 1J5ET 5LMUT 4DR4T 4JI2T 4LF8T 4DR1T 2HHHT 4DR3T 4YY3T 5IWAT 4B3RT 1N33T 1XNRT 4NXMT 4YHHT 2UXCT 2UXBT 4DV4T 1HNXT 4LFAT 2UUCT 1XNQT 1HNZT 4DR2T 4JI8T 3OTOT 3T1HT 4DV5T 4LF7T 4X62T 4LFBT 1N32T 4B3ST 4DR6T 4B3TT 2E5LT 4X66T 5BR8T 2UUBT 2F4VT 2UU9T 5LMNT 2VQET 1IBLT 2UXDT 4DUYT 4JV5T 1XMOT 4DR5T 4DV7T 4JI0T 4DUZT 4JI7T 2VQFT 1IBKT 4JI4T 1IBMT 4DV3T 1N34T 1XMQT 2ZM6T 4JI1T 4DR7T 4NXNT 4LF9T 1HR0T 3T1YT 4X65T 1I94T 4GKJT 4JYAT 4JI3T 4KHPT 4AQYT 4LF4T 4LFCT 4B3MT 4DV2T 4GKKT 4DV1T 1FJGT
chains in the Genus database with same CATH superfamily
1UUSA 4YTNA 4K0KT 4TNWA 2E2AA 2E9XD 3QOFA 2R6GF 4UF0A 1HNWT 1L0VA 1SUMB 3UFEA 2C5JA 5KXJA 4HWCA 4LF6T 4EIWA 3HKCE 4O4HE 4B6XA 4CXYA 2VWAA 1HG2A 1XDOA 3JADA 4YHJA 4ZZBA 5HEJA 3KV5A 1LVFA 3I0OA 3T8OA 4X64T 2K3WA 5LJNA 3PUAA 3P4PA 3ZLIA 5F3JA 5JDLA 5JH7E 1QUUA 1HFAA 3O4XE 4JBWF 3E08A 4JI2T 2A9UA 3JC6C 4EV6A 2E9XA 4HWFA 3BQLA 3ONJA 2HHHT 2JJ9A 5AFUL 3PTRB 4K0UA 3UUBA 1UK5A 2WP9A 2WZIA 5LJMA 4ILUA 1XNRT 4ZI2C 1YQ4A 2KLQA 4X1YE 2BG9B 3P4SA 4UELA 3PJAJ 2W66A 5F8PA 1VOMA 1WFDA 2EHOC 3MA9A 1Y64B 3NZPA 4TV9E 2UXCT 2FJAA 3MK7C 2A2FX 5A1LA 4DV4T 1HNXT 4G63A 2CM0A 4IE0A 1S35A 1YKEB 4XAXB 5FKYA 5LA6E 2UUCT 5CB4E 1HS7A 3GWHA 4HFEA 3ZYLA 2V6YB 1T72A 2DWKA 3C4WA 4CI3B 2JIWA 2DL1A 2B76A 2ODVA 4H9RC 2W67A 4QH1A 5AQTB 2AXDS 3UUNA 1GQEA 2V7LA 3EDVA 3OYZA 2RP4A 3ZMZB 3K3NA 2LM9A 2KT9A 2ZMAA 1OEDB 4QXBB 5AQLB 5AQRB 4TV8E 3ZMUB 4CN6A 4B3ST 2BZBA 2WU2A 2JQKA 1J5WA 2D0TA 3HI2A 3RI5A 1SE7A 4ZS3A 5LHGB 2F4VT 3H3AA 2CXFA 2Q9QB 3CX6B 3WI3A 2UU9T 4O4LE 2X66A 1DU2A 3L09A 4HEAA 1S94A 2HPJA 2JPFA 2VVSA 4GYSA 2ZLYA 3KV6A 5LOVE 4NUVA 4MLKA 2VL0A 3FXDB 4KX6A 2NW7A 4U7IA 3EAMA 5LB7B 4JV5T 4U2ZA 2UXDT 2LE8A 4ISSA 2PTFA 2Q9QD 4QHOA 5H6QB 2BKNA 3P8CD 4IDNA 4IDPA 4X5TA 2ACXA 2YN6A 3KVBA 1FMVA 3P7IA 2DHRA 3AAEB 5F5WA 5L3FB 2AE9A 3CK6A 1MMNA 2X0LB 1V9DA 5EK4A 4IIJE 2YK0A 3AA1B 3B57A 2PG8A 2WDVA 3RGLA 4DUZT 3SFEA 3ANWB 3RIAA 3ZT6A 3AE9A 3N9LA 3RYFE 4HFVA 1IBKT 5IYZE 4PFPA 1YXRA 3RRWA 2YEVC 2XQYA 3AAAB 2D5UA 3N2OA 1ZEEA 3OBVE 3QK6A 2XJ7A 3L39A 2WZHA 3NZQA 5J1GA 1D0YA 4AXPA 2RPAA 3LJCA 1N34T 3TLUA 3AB3B 2LSJA 2XQ5A 2W00A 2C5KT 3CX8B 3RX6A 3ZKRA 4TWFA 3AA7B 2LLYA 3ZYKA 4AKLA 5L4HA 5LNKA 2L8KA 2LJLA 2CWYA 2VVNA 3P4WA 3PUQA 4H9QC 4YXDA 3O1HA 2P9BA 2VKDA 3RKOA 2B1EA 1HR0T 1ZV4X 3AA0B 4HFBA 3T1YT 4C90A 4PJNA 2JQQA 5C2TA 1I94T 2V7MA 2BS4A 3FHNA 2IMLA 3PJAA 4I50E 4EYYR 4PNIA 5JREA 4P0AA 4GKJT 5FL1A 4JYAT 1VCTA 2WMNA 2NOXA 2E8IA 4KHPT 5JR9B 4AQYT 3EVYA 3SWHA 4LF4T 2WY2A 2QYWA 3O9XA 4LFCT 1T98A 1BR1A 1FEWA 2LSIA 3AVSA 3I9YA 1T7SA 2Z6EA 1US7B 2CWOA 2Y8DA 3LBXA 1UGOA 5AQHB 2CBJA 3C98B 2IIUA 4UF0B 5IUXA 4AKIA 3KDSE 2VURA 4YT0A 2XSBA 5FP3A 1KNZA 2NW8A 1XWMA 2WDRA 4PK4A 3R6NA 4A5XA 2X9YA 2VKOA 1WYCA 2VKHA 3CIRA 4ZZCA 2W61A 4KI0F 3HL6A 2M6IA 3UQ7A 4DV6T 2WBLA 3E22E 4JLEA 2KMFA 4OX9T 4JEHB 4KMCA 4WBOA 4NUUA 2H89A 3O1JA 3P4RA 3S4UA 3A7MA 5EK2A 2JMKA 2KINB 2C0SA 1OXZA 4WBNE 4JI6T 1CUNA 3KV4A 3N9NA 3PDYA 2X0YA 3H3MA 1M7KA 2XAHB 3C50A 2MBGA 1N36T 1J5ET 5JRCA 3RC3A 5JDQA 2XAGB 3N9PA 5AQKB 5JVDE 2ZM0A 3PUGA 5ABFB 5FY0A 1YKHB 3K1SA 4HTEA 3ZYMA 5ABFA 2LSYA 5FVLA 3BQKA 3UU3A 5LGNB 3U3IA 2XUEA 5IWAT 2FJDA 5HXHA 4B3RT 3ZMSB 2BVMA 4EXTA 4PK6A 2WB5A 2LKHA 4YHHT 4I4TE 4KBMB 4ZI3C 3GN5B 4EYUA 3M65A 4G2AA 3UTKA 3F31A 1KFYA 3ZT7A 4EB6E 3UUXB 3HKBE 4LFAT 3CKDA 5TAOA 5JTGA 2YOEA 4OFZA 3RYHE 1AJ3A 4AKGA 3JAEA 4O8SA 4UIGA 2X9HA 3C64A 1J1JA 4CQIA 4DR2T 3MACA 4JI8T 2VKJA 1LVKA 4IDQA 1D0ZA 4ISTA 2V7JA 3RYIE 5HXEA 4DV5T 2VB6A 2IDOB 2V1DB 4A98A 1UCUA 1Z8UA 3QUJA 4LMJA 5LBMA 5LYJE 3ZJ1A 5BMVE 3PUYF 4YFSA 4EZHA 2CXLA 1KNPA 3NKZA 5AQPB 3KBTA 1KNRA 2JQ9A 1QLBA 1SHZC 3VRBA 4A56A 2E5LT 4ZS2A 3ONLC 5BR8T 3PURA 1T8BA 4TX5A 4KUMB 2UUBT 4NXMT 4U31A 2X0HA 3FZFB 5DQVA 2XTLA 5LMNT 2BS2A 4QX7B 2VQET 4TZ4C 2BVLA 1OEDE 2J1DG 3EHZA 3TLSA 1E2AA 3I1AA 3P4QA 2OV9A 3UQ4A 5FYMA 2LSGA 3MJXA 5DQWA 2XQ9A 4UR9A 4DUYT 2MAWA 1UX4A 1UX5A 1VRBA 2KWIB 2LHRA 1E7PA 3LSVA 2KNDA 3CMLA 4JUYA 1CHUA 2XQ3A 4PJMA 2CMRA 2HH7A 2YU2A 2IC6A 3KV9A 3NVOA 2CRBA 3AEEA 2YINA 3Q9DA 4I55E 2V26A 4ADZA 3FXEB 2LOPA 4QH4A 3AXJB 4ASKA 3J7Yq 1QSDA 1XZYA 1B7TA 4IDOA 3TLVA 4ZHQE 2CE7A 5JDGA 3AXJA 1MIWA 2N2NA 2NP9A 2PFVA 4MFRA 4YTMA 5EZYE 3W15B 2WQYA 4DMWA 4EEDA 1Y01A 2HN1A 3N9QA 4IE7A 4F6RC 5HXSA 2CBIA 1M62A 3JAFA 1HTJF 4NPPA 4O2BE 5HEHA 3RKGA 4N78D 2E9XB 2WMOA 2NW9A 1BR2A 2K48A 2XQ4A 2XM1A 5EK3A 2K24A 2V6XA 3QB5A 5AQFB 2WWVA 2CXDA 4JI1T 2XZEA 4NXNT 5J0ZA 4LF9T 5LGUB 4CI1B 5FXVA 4ZI2D 3AE1A 4HWHA 1O3XA 2GK9A 2V5CA 2XM2A 3LBXB 4ILCA 2M67A 2BBJA 2LRLA 2XASB 3M3ZB 2UXNB 3HKDE 5IHYA 4DIDB 3ONXA 4ERRA 2N1GA 3E0ZA 2XQ6A 3FZKB 4UVAB 3VRAA 5LG4A 2WSSV 4V1Av 4UEMA 1ZHCA 2NTXA 5LBQB 4YTPA 2ACZA 1OEDC 4B3MT 3CQXC 5J2TE 3N2KE 2CA5A 4ZI3D 2VL8A 3BQIA 4DV1T 3ETVA 1NEKA 1HF8A 2CLYB 3EUHA 2KWHA 3CWZB 2V5DA 3UU4A 2W62A 3KBUA 4HE8A 5DABA 4IE4A 2DI4A 2M6BA 4DR6T 4HGAA 2Q9QA 4U72A 3C51A 3ZC1A 5JDHA 3R84B 5FXZA 4PFOA 3RH3A 5C3JA 2UUAT 1HX8A 4Q25A 4CN1A 3NBXX 2XSAA 4TNVA 5CA1E 5JRCB 4HFDA 3Q5EA 5AQJB 5ADXL 4LF5T 2BG9E 4UVBB 2X68A 3FZMB 3ZCIA 3NRXA 4YSYA 3ZMVB 5JDMA 5LG3A 4EEBA 2DCFA 3V5SA 2X9XA 3U78A 1BR4A 2OA5A 4DV0T 4AI6A 5AQNB 4H9OC 5LMUT 1R8IA 3RIUA 1G8XA 1MIYA 3SRZA 5CGMA 5HWXA 1MMAA 4DR4T 2JMHA 3ZMTB 1X9BA 2LKGA 2Y48B 2X51A 2N9DA 5J2UE 2XPKA 5FMNA 4DR1T 4I43B 4P09A 4O4JE 2LSKA 4U33A 4EGWA 4YY3T 5L47A 3AE7A 4ZXLA 3ANWA 1UURA 5CA0E 1N33T 3AE6A 2XAQB 3ZN0B 3X1DA 4O4IE 2I6HA 2Q9QC 4AQFC 4DMVA 5JQGE 2UXBT 2HN2A 1KEYA 3LK42 2KZ7B 4MHCA 4CZZB 4GK0E 5KX5E 4ILBA 2A3DA 5LCYA 4GYRA 5DJQC 1VCSA 4EAHA 2G0UA 4JEUB 2H7OA 3QNUA 1SA0E 2VASA 4J2CA 3SOLA 1HNZT 5LP6E 3AEBA 3D0TA 3KFWX 1KF6A 2PJQA 4HFHA 4HWDA 3OTOT 3T1HT 4IL9A 3RIUC 2DNXA 4CXXA 4YSXA 1YD8G 2XQAA 4LFBT 3PV0F 5AQQB 3KINB 4X20E 3TKLB 5JR9A 2D2SA 2W4XA 4WYVA 3K3QC 5FVKA 4B3TT 3ZSSA 4U74A 2D0UA 2K9AA 4TN7B 3HR0A 3UU8A 5LHIB 2I0MA 5L3DB 4X66T 4FI5A 2X67A 2BG9C 3GA8A 5HCMA 5HEGA 5FY1A 4BAYB 4O2AE 5FL0A 4F8HA 1MMGA 3N2GE 5L3BB 4L5GA 4U2YA 1LRZA 4IHJE 1IBMT 2WS3A 3EI0A 4QXHB 2E5VA 1IBLT 5M4YA 2V7KA 4QH5A 3VKHA 1X79A 4UV9B 2L9QA 2LT3A 5H6RB 5KDMC 3DP7A 3O1IA 4NIQA 4WNKA 5FXWA 4CI2B 4EOZB 1E1HB 3OYXA 4OHFA 4AKHA 5FY7A 2ODUA 4ZEYA 4JI4T 5FNVE 4COFA 4LMLA 4JI0T 3I9WA 1XDPA 3PUWF 3IHRA 3HKEE 5JR9C 1IJ6A 1YW0A 3B5MA 3OVUA 2VQFT 4JI7T 2YDQA 4IT4A 3ABVA 4WW0A 5L3GB 2KSRA 4OK0A 2QGSA 2BG9A 3PUZF 1WCRA 5HCJA 3JCFA 1IZNB 4E7SA 2V6YA 3VKGA 2CEAA 2FBWA 2BDEA 2ZM6T 2QRXA 1WR6A 5AQVB 4DR7T 3LDQB 4WZXA 3SS1A 3K3OA 3SFDA 3LK2B 4ZI7E 1OWAA 2MYSA 4H9PC 4Z90A 2BS3A 4KHZF 4AKRB 3C4XA 1MNDA 3AE8A 3ESLA 1JNZA 3N9MA 3OJAA 3AE4A 4MALA 4DO0A 5CFBA 3RRCA 4L9IA 1D1CA 1NENA 2XY8B 3FZLB 3L3PA 3L8RA 5KMGP 3BK9A 1W0AA 3LK3B 1OEDA 3ZT5A 3UT5E 3UFGA 2W2UA 1FIOA 4IGUA 4DV2T 1WRDA 5AQIB 4GKKT 4IDZA 4MBQA 4PJLA 5HXRA 2CLYC 3J9X1 2RA1A 4A97A 2FJEA 3Q2MA 2DWGA 4ILAA 4AISA 2FUPA 5ETWA 1D1BA 1D0XA 1ZOYA 2JRKA 2VK9A 3IA3A 2XQ7A 3PE0A 2XQ8A 3G06A 2ZM2A 3I0QA 3RPUA 2CCQA 3RQUA 3JC6D 5L4EA 2H7VC 1YQ3A 1Z0PA 3AECA 3CQGB 4I0UA 4IL4A 2NTYA 2XAFB 3QC9A 2H88A 4H9SE 3AE2A 4KP3C 1NWMX 4YJ3E 4JI5T 5C8YE 3EABA 2WCAA 3AE3A 3PUXF 3Q5XA 5ABGA 4YLHA 3CVRA 2WM9A 3ZCJA 1W09A 3PU8A 3AEFA 2I59A 2CHOA 4OYJA 2J4GA 4U7YA 2IUBA 4C91A 2ZM8A 4LF8T 3EDUA 5AQMB 2IW5B 5HEUA 2E9XC 2J62A 2YDRA 3AA6B 4IE5A 4TWHA 4X1KE 5HEOA 4DR3T 2BKPA 3UUMA 2DLRA 2L3LA 4CN4A 3F2EA 3TLTA 1LKXA 2HPLA 2WWUA 4HKAA 3Q5WA 1D1AA 4GK5E 4AQFA 4BJMA 1ZKEA 3TLWA 3A8YC 2W63A 2EHOA 4H63H 2YKSA 3LFMA 4IREA 3VHLA 4LMKA 2EHOB 3RQWA 3AVRA 2LM2A 2MOZA 4H63V 3DTOA 4U3CA 1ZP0A 3UU6A 3WAKA 3ZN1B 2EHOD 2NR4A 2MPKA 3ZPOA 1XNQT 4AIUA 3C4ZA 4H9NC 3Q5DA 5AQSB 2QA7A 4GOUA 2OLTA 5LXTE 1FMWA 3RHWA 4QXCB 4QX8B 1IJ5A 2LRKA 4LF7T 4X62T 2LHNA 2A72A 2X9WA 4PW8A 1IAPA 4ZOLE 3ZSTA 4BJNA 5ABHA 1N32T 5HXCA 3AAIA 3B13A 1MMDA 2WAUA 2W0GA 4IE6A 4OYKA 2LEHA 1MNEA 5AQUB 1MIVA 5HAXA 1WYBA 2V8SV 3CPZA 2J47A 3AEDA 4PK5A 4QWNB 4UV8B 4PAGA 2XHEB 3RIFA 3VR8A 4X1IE 5AQGB 3MZKB 3PU3A 3PUSA 5LHHB 3ZEFB 3FB2A 2H3RA 3UULA 1EZ3A 4YSZA 5CJ5A 3V5UA 3AEGA 4PJJA 2D9DA 4UXNB 5HWYA 2IHR1 4E7ZA 3AE5A 3OPCA 3QB5K 2IAKA 5JDNA 5ABEA 3HA4A 5JDFA 4Z91A 4AQGA 4P1NA 3VU7H 3OKQA 2BKOA 4DR5T 1XMOT 3ETUA 3NRYA 4DV7T 4TUYE 4XZCA 1HCIA 1HG5A 2PBIA 3IF8B 3KVAA 3P50A 3H37A 1HX1B 2WU5A 5E0OA 3VR9A 3GMIA 1U4QA 3ZJ2A 3IEEA 4HFIA 5FXXA 4CXWA 1XMQT 2YU1A 2WDQA 3DJBA 3GN5A 4DV3T 2JQHA 2YDSA 4FJOA 4P0BA 3AEAA 4M1PA 4EZ4A 5AQOB 3RF1A 5LGTB 3IBPA 3NWIA 2V7IA 2UXXB 1H7CA 3F57A 3N5LA 1BR0A 3N9OA 2CPTA 1JNRA 3MXZA 2XAJB 3K8PC 1NAFA 4HWIB 2K5BB 4YJ2E 5L3EB 1W9RA 4BA9A 3RC8A 4QKNA 3A5XA 4DVDA 2KXPB 5L2LA 4L0RA 5HYAA 4X65T 1G73A 1I6ZA 2QVAA 2SPCA 2IC9A 1U5PA 2CHNA 2ES0A 2LOSA 3FBZA 1KK7A 4HN9A 3FZHB 4TWDA 3FBLA 3UU5A 5GONE 3RLFF 3RYCE 3CQCB 3MKDA 3WAJA 4JI3T 1W0BA 1WR0A 3PUVF 4ANJA 4XBFB 2MTQA 4DBRA 2Y6XA 2BBHA 4UVCB 4DBQA 1WLXA 5L3CB 2FJBA 4Z8XA 3ZC0A 2C5IT 4HFCA 1FJGT 3CX7B 3LG7A 2NWBA 4DNDA 4GIWA
chains in the Genus database with same CATH topology
4K0KT 1HNWT 2UUAT 4DV6T 4LF6T 4JI5T 4OX9T 4LF5T 4JI6T 1N36T 4X64T 4DV0T 1J5ET 5LMUT 4DR4T 4JI2T 4LF8T 4DR1T 2HHHT 4DR3T 4YY3T 5IWAT 4B3RT 1N33T 1XNRT 4NXMT 4YHHT 2UXCT 2UXBT 4DV4T 1HNXT 4LFAT 2UUCT 1XNQT 1HNZT 4DR2T 4JI8T 3OTOT 3T1HT 4DV5T 4LF7T 4X62T 4LFBT 1N32T 4B3ST 4DR6T 4B3TT 2E5LT 4X66T 5BR8T 2UUBT 2F4VT 2UU9T 5LMNT 2VQET 1IBLT 2UXDT 4DUYT 4JV5T 1XMOT 4DR5T 4DV7T 4JI0T 4DUZT 4JI7T 2VQFT 1IBKT 4JI4T 1IBMT 4DV3T 1N34T 1XMQT 2ZM6T 4JI1T 4DR7T 4NXNT 4LF9T 1HR0T 3T1YT 4X65T 1I94T 4GKJT 4JYAT 4JI3T 4KHPT 4AQYT 4LF4T 4LFCT 4B3MT 4DV2T 4GKKT 4DV1T 1FJGT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K0K T;  1HNW T;  2UUA T;  4DV6 T;  4LF6 T;  4JI5 T;  4OX9 T;  4LF5 T;  4JI6 T;  1N36 T;  4X64 T;  4DV0 T;  1J5E T;  5LMU T;  4DR4 T;  4JI2 T;  4LF8 T;  4DR1 T;  2HHH T;  4DR3 T;  4YY3 T;  5IWA T;  4B3R T;  1N33 T;  1XNR T;  4NXM T;  4YHH T;  2UXC T;  2UXB T;  4DV4 T;  1HNX T;  4LFA T;  2UUC T;  1XNQ T;  1HNZ T;  4DR2 T;  4JI8 T;  3OTO T;  3T1H T;  4DV5 T;  4LF7 T;  4X62 T;  4LFB T;  1N32 T;  4B3S T;  4DR6 T;  4B3T T;  2E5L T;  4X66 T;  5BR8 T;  2UUB T;  2F4V T;  2UU9 T;  5LMN T;  2VQE T;  1IBL T;  2UXD T;  4DUY T;  4JV5 T;  1XMO T;  4DR5 T;  4DV7 T;  4JI0 T;  4DUZ T;  4JI7 T;  2VQF T;  1IBK T;  4JI4 T;  1IBM T;  4DV3 T;  1N34 T;  1XMQ T;  2ZM6 T;  4JI1 T;  4DR7 T;  4NXN T;  4LF9 T;  1HR0 T;  3T1Y T;  4X65 T;  1I94 T;  4GKJ T;  4JYA T;  4JI3 T;  4KHP T;  4AQY T;  4LF4 T;  4LFC T;  4B3M T;  4DV2 T;  4GKK T;  4DV1 T;  1FJG T; 
#chains in the Genus database with same CATH topology
 1UUS A;  4YTN A;  4K0K T;  4TNW A;  2E2A A;  2E9X D;  3QOF A;  2R6G F;  4UF0 A;  1HNW T;  1L0V A;  1SUM B;  3UFE A;  2C5J A;  5KXJ A;  4HWC A;  4LF6 T;  4EIW A;  3HKC E;  4O4H E;  4B6X A;  4CXY A;  2VWA A;  1HG2 A;  1XDO A;  3JAD A;  4YHJ A;  4ZZB A;  5HEJ A;  3KV5 A;  1LVF A;  3I0O A;  3T8O A;  4X64 T;  2K3W A;  5LJN A;  3PUA A;  3P4P A;  3ZLI A;  5F3J A;  5JDL A;  5JH7 E;  1QUU A;  1HFA A;  3O4X E;  4JBW F;  3E08 A;  4JI2 T;  2A9U A;  3JC6 C;  4EV6 A;  2E9X A;  4HWF A;  3BQL A;  3ONJ A;  2HHH T;  2JJ9 A;  5AFU L;  3PTR B;  4K0U A;  3UUB A;  1UK5 A;  2WP9 A;  2WZI A;  5LJM A;  4ILU A;  1XNR T;  4ZI2 C;  1YQ4 A;  2KLQ A;  4X1Y E;  2BG9 B;  3P4S A;  4UEL A;  3PJA J;  2W66 A;  5F8P A;  1VOM A;  1WFD A;  2EHO C;  3MA9 A;  1Y64 B;  3NZP A;  4TV9 E;  2UXC T;  2FJA A;  3MK7 C;  2A2F X;  5A1L A;  4DV4 T;  1HNX T;  4G63 A;  2CM0 A;  4IE0 A;  1S35 A;  1YKE B;  4XAX B;  5FKY A;  5LA6 E;  2UUC T;  5CB4 E;  1HS7 A;  3GWH A;  4HFE A;  3ZYL A;  2V6Y B;  1T72 A;  2DWK A;  3C4W A;  4CI3 B;  2JIW A;  2DL1 A;  2B76 A;  2ODV A;  4H9R C;  2W67 A;  4QH1 A;  5AQT B;  2AXD S;  3UUN A;  1GQE A;  2V7L A;  3EDV A;  3OYZ A;  2RP4 A;  3ZMZ B;  3K3N A;  2LM9 A;  2KT9 A;  2ZMA A;  1OED B;  4QXB B;  5AQL B;  5AQR B;  4TV8 E;  3ZMU B;  4CN6 A;  4B3S T;  2BZB A;  2WU2 A;  2JQK A;  1J5W A;  2D0T A;  3HI2 A;  3RI5 A;  1SE7 A;  4ZS3 A;  5LHG B;  2F4V T;  3H3A A;  2CXF A;  2Q9Q B;  3CX6 B;  3WI3 A;  2UU9 T;  4O4L E;  2X66 A;  1DU2 A;  3L09 A;  4HEA A;  1S94 A;  2HPJ A;  2JPF A;  2VVS A;  4GYS A;  2ZLY A;  3KV6 A;  5LOV E;  4NUV A;  4MLK A;  2VL0 A;  3FXD B;  4KX6 A;  2NW7 A;  4U7I A;  3EAM A;  5LB7 B;  4JV5 T;  4U2Z A;  2UXD T;  2LE8 A;  4ISS A;  2PTF A;  2Q9Q D;  4QHO A;  5H6Q B;  2BKN A;  3P8C D;  4IDN A;  4IDP A;  4X5T A;  2ACX A;  2YN6 A;  3KVB A;  1FMV A;  3P7I A;  2DHR A;  3AAE B;  5F5W A;  5L3F B;  2AE9 A;  3CK6 A;  1MMN A;  2X0L B;  1V9D A;  5EK4 A;  4IIJ E;  2YK0 A;  3AA1 B;  3B57 A;  2PG8 A;  2WDV A;  3RGL A;  4DUZ T;  3SFE A;  3ANW B;  3RIA A;  3ZT6 A;  3AE9 A;  3N9L A;  3RYF E;  4HFV A;  1IBK T;  5IYZ E;  4PFP A;  1YXR A;  3RRW A;  2YEV C;  2XQY A;  3AAA B;  2D5U A;  3N2O A;  1ZEE A;  3OBV E;  3QK6 A;  2XJ7 A;  3L39 A;  2WZH A;  3NZQ A;  5J1G A;  1D0Y A;  4AXP A;  2RPA A;  3LJC A;  1N34 T;  3TLU A;  3AB3 B;  2LSJ A;  2XQ5 A;  2W00 A;  2C5K T;  3CX8 B;  3RX6 A;  3ZKR A;  4TWF A;  3AA7 B;  2LLY A;  3ZYK A;  4AKL A;  5L4H A;  5LNK A;  2L8K A;  2LJL A;  2CWY A;  2VVN A;  3P4W A;  3PUQ A;  4H9Q C;  4YXD A;  3O1H A;  2P9B A;  2VKD A;  3RKO A;  2B1E A;  1HR0 T;  1ZV4 X;  3AA0 B;  4HFB A;  3T1Y T;  4C90 A;  4PJN A;  2JQQ A;  5C2T A;  1I94 T;  2V7M A;  2BS4 A;  3FHN A;  2IML A;  3PJA A;  4I50 E;  4EYY R;  4PNI A;  5JRE A;  4P0A A;  4GKJ T;  5FL1 A;  4JYA T;  1VCT A;  2WMN A;  2NOX A;  2E8I A;  4KHP T;  5JR9 B;  4AQY T;  3EVY A;  3SWH A;  4LF4 T;  2WY2 A;  2QYW A;  3O9X A;  4LFC T;  1T98 A;  1BR1 A;  1FEW A;  2LSI A;  3AVS A;  3I9Y A;  1T7S A;  2Z6E A;  1US7 B;  2CWO A;  2Y8D A;  3LBX A;  1UGO A;  5AQH B;  2CBJ A;  3C98 B;  2IIU A;  4UF0 B;  5IUX A;  4AKI A;  3KDS E;  2VUR A;  4YT0 A;  2XSB A;  5FP3 A;  1KNZ A;  2NW8 A;  1XWM A;  2WDR A;  4PK4 A;  3R6N A;  4A5X A;  2X9Y A;  2VKO A;  1WYC A;  2VKH A;  3CIR A;  4ZZC A;  2W61 A;  4KI0 F;  3HL6 A;  2M6I A;  3UQ7 A;  4DV6 T;  2WBL A;  3E22 E;  4JLE A;  2KMF A;  4OX9 T;  4JEH B;  4KMC A;  4WBO A;  4NUU A;  2H89 A;  3O1J A;  3P4R A;  3S4U A;  3A7M A;  5EK2 A;  2JMK A;  2KIN B;  2C0S A;  1OXZ A;  4WBN E;  4JI6 T;  1CUN A;  3KV4 A;  3N9N A;  3PDY A;  2X0Y A;  3H3M A;  1M7K A;  2XAH B;  3C50 A;  2MBG A;  1N36 T;  1J5E T;  5JRC A;  3RC3 A;  5JDQ A;  2XAG B;  3N9P A;  5AQK B;  5JVD E;  2ZM0 A;  3PUG A;  5ABF B;  5FY0 A;  1YKH B;  3K1S A;  4HTE A;  3ZYM A;  5ABF A;  2LSY A;  5FVL A;  3BQK A;  3UU3 A;  5LGN B;  3U3I A;  2XUE A;  5IWA T;  2FJD A;  5HXH A;  4B3R T;  3ZMS B;  2BVM A;  4EXT A;  4PK6 A;  2WB5 A;  2LKH A;  4YHH T;  4I4T E;  4KBM B;  4ZI3 C;  3GN5 B;  4EYU A;  3M65 A;  4G2A A;  3UTK A;  3F31 A;  1KFY A;  3ZT7 A;  4EB6 E;  3UUX B;  3HKB E;  4LFA T;  3CKD A;  5TAO A;  5JTG A;  2YOE A;  4OFZ A;  3RYH E;  1AJ3 A;  4AKG A;  3JAE A;  4O8S A;  4UIG A;  2X9H A;  3C64 A;  1J1J A;  4CQI A;  4DR2 T;  3MAC A;  4JI8 T;  2VKJ A;  1LVK A;  4IDQ A;  1D0Z A;  4IST A;  2V7J A;  3RYI E;  5HXE A;  4DV5 T;  2VB6 A;  2IDO B;  2V1D B;  4A98 A;  1UCU A;  1Z8U A;  3QUJ A;  4LMJ A;  5LBM A;  5LYJ E;  3ZJ1 A;  5BMV E;  3PUY F;  4YFS A;  4EZH A;  2CXL A;  1KNP A;  3NKZ A;  5AQP B;  3KBT A;  1KNR A;  2JQ9 A;  1QLB A;  1SHZ C;  3VRB A;  4A56 A;  2E5L T;  4ZS2 A;  3ONL C;  5BR8 T;  3PUR A;  1T8B A;  4TX5 A;  4KUM B;  2UUB T;  4NXM T;  4U31 A;  2X0H A;  3FZF B;  5DQV A;  2XTL A;  5LMN T;  2BS2 A;  4QX7 B;  2VQE T;  4TZ4 C;  2BVL A;  1OED E;  2J1D G;  3EHZ A;  3TLS A;  1E2A A;  3I1A A;  3P4Q A;  2OV9 A;  3UQ4 A;  5FYM A;  2LSG A;  3MJX A;  5DQW A;  2XQ9 A;  4UR9 A;  4DUY T;  2MAW A;  1UX4 A;  1UX5 A;  1VRB A;  2KWI B;  2LHR A;  1E7P A;  3LSV A;  2KND A;  3CML A;  4JUY A;  1CHU A;  2XQ3 A;  4PJM A;  2CMR A;  2HH7 A;  2YU2 A;  2IC6 A;  3KV9 A;  3NVO A;  2CRB A;  3AEE A;  2YIN A;  3Q9D A;  4I55 E;  2V26 A;  4ADZ A;  3FXE B;  2LOP A;  4QH4 A;  3AXJ B;  4ASK A;  3J7Y q;  1QSD A;  1XZY A;  1B7T A;  4IDO A;  3TLV A;  4ZHQ E;  2CE7 A;  5JDG A;  3AXJ A;  1MIW A;  2N2N A;  2NP9 A;  2PFV A;  4MFR A;  4YTM A;  5EZY E;  3W15 B;  2WQY A;  4DMW A;  4EED A;  1Y01 A;  2HN1 A;  3N9Q A;  4IE7 A;  4F6R C;  5HXS A;  2CBI A;  1M62 A;  3JAF A;  1HTJ F;  4NPP A;  4O2B E;  5HEH A;  3RKG A;  4N78 D;  2E9X B;  2WMO A;  2NW9 A;  1BR2 A;  2K48 A;  2XQ4 A;  2XM1 A;  5EK3 A;  2K24 A;  2V6X A;  3QB5 A;  5AQF B;  2WWV A;  2CXD A;  4JI1 T;  2XZE A;  4NXN T;  5J0Z A;  4LF9 T;  5LGU B;  4CI1 B;  5FXV A;  4ZI2 D;  3AE1 A;  4HWH A;  1O3X A;  2GK9 A;  2V5C A;  2XM2 A;  3LBX B;  4ILC A;  2M67 A;  2BBJ A;  2LRL A;  2XAS B;  3M3Z B;  2UXN B;  3HKD E;  5IHY A;  4DID B;  3ONX A;  4ERR A;  2N1G A;  3E0Z A;  2XQ6 A;  3FZK B;  4UVA B;  3VRA A;  5LG4 A;  2WSS V;  4V1A v;  4UEM A;  1ZHC A;  2NTX A;  5LBQ B;  4YTP A;  2ACZ A;  1OED C;  4B3M T;  3CQX C;  5J2T E;  3N2K E;  2CA5 A;  4ZI3 D;  2VL8 A;  3BQI A;  4DV1 T;  3ETV A;  1NEK A;  1HF8 A;  2CLY B;  3EUH A;  2KWH A;  3CWZ B;  2V5D A;  3UU4 A;  2W62 A;  3KBU A;  4HE8 A;  5DAB A;  4IE4 A;  2DI4 A;  2M6B A;  4DR6 T;  4HGA A;  2Q9Q A;  4U72 A;  3C51 A;  3ZC1 A;  5JDH A;  3R84 B;  5FXZ A;  4PFO A;  3RH3 A;  5C3J A;  2UUA T;  1HX8 A;  4Q25 A;  4CN1 A;  3NBX X;  2XSA A;  4TNV A;  5CA1 E;  5JRC B;  4HFD A;  3Q5E A;  5AQJ B;  5ADX L;  4LF5 T;  2BG9 E;  4UVB B;  2X68 A;  3FZM B;  3ZCI A;  3NRX A;  4YSY A;  3ZMV B;  5JDM A;  5LG3 A;  4EEB A;  2DCF A;  3V5S A;  2X9X A;  3U78 A;  1BR4 A;  2OA5 A;  4DV0 T;  4AI6 A;  5AQN B;  4H9O C;  5LMU T;  1R8I A;  3RIU A;  1G8X A;  1MIY A;  3SRZ A;  5CGM A;  5HWX A;  1MMA A;  4DR4 T;  2JMH A;  3ZMT B;  1X9B A;  2LKG A;  2Y48 B;  2X51 A;  2N9D A;  5J2U E;  2XPK A;  5FMN A;  4DR1 T;  4I43 B;  4P09 A;  4O4J E;  2LSK A;  4U33 A;  4EGW A;  4YY3 T;  5L47 A;  3AE7 A;  4ZXL A;  3ANW A;  1UUR A;  5CA0 E;  1N33 T;  3AE6 A;  2XAQ B;  3ZN0 B;  3X1D A;  4O4I E;  2I6H A;  2Q9Q C;  4AQF C;  4DMV A;  5JQG E;  2UXB T;  2HN2 A;  1KEY A;  3LK4 2;  2KZ7 B;  4MHC A;  4CZZ B;  4GK0 E;  5KX5 E;  4ILB A;  2A3D A;  5LCY A;  4GYR A;  5DJQ C;  1VCS A;  4EAH A;  2G0U A;  4JEU B;  2H7O A;  3QNU A;  1SA0 E;  2VAS A;  4J2C A;  3SOL A;  1HNZ T;  5LP6 E;  3AEB A;  3D0T A;  3KFW X;  1KF6 A;  2PJQ A;  4HFH A;  4HWD A;  3OTO T;  3T1H T;  4IL9 A;  3RIU C;  2DNX A;  4CXX A;  4YSX A;  1YD8 G;  2XQA A;  4LFB T;  3PV0 F;  5AQQ B;  3KIN B;  4X20 E;  3TKL B;  5JR9 A;  2D2S A;  2W4X A;  4WYV A;  3K3Q C;  5FVK A;  4B3T T;  3ZSS A;  4U74 A;  2D0U A;  2K9A A;  4TN7 B;  3HR0 A;  3UU8 A;  5LHI B;  2I0M A;  5L3D B;  4X66 T;  4FI5 A;  2X67 A;  2BG9 C;  3GA8 A;  5HCM A;  5HEG A;  5FY1 A;  4BAY B;  4O2A E;  5FL0 A;  4F8H A;  1MMG A;  3N2G E;  5L3B B;  4L5G A;  4U2Y A;  1LRZ A;  4IHJ E;  1IBM T;  2WS3 A;  3EI0 A;  4QXH B;  2E5V A;  1IBL T;  5M4Y A;  2V7K A;  4QH5 A;  3VKH A;  1X79 A;  4UV9 B;  2L9Q A;  2LT3 A;  5H6R B;  5KDM C;  3DP7 A;  3O1I A;  4NIQ A;  4WNK A;  5FXW A;  4CI2 B;  4EOZ B;  1E1H B;  3OYX A;  4OHF A;  4AKH A;  5FY7 A;  2ODU A;  4ZEY A;  4JI4 T;  5FNV E;  4COF A;  4LML A;  4JI0 T;  3I9W A;  1XDP A;  3PUW F;  3IHR A;  3HKE E;  5JR9 C;  1IJ6 A;  1YW0 A;  3B5M A;  3OVU A;  2VQF T;  4JI7 T;  2YDQ A;  4IT4 A;  3ABV A;  4WW0 A;  5L3G B;  2KSR A;  4OK0 A;  2QGS A;  2BG9 A;  3PUZ F;  1WCR A;  5HCJ A;  3JCF A;  1IZN B;  4E7S A;  2V6Y A;  3VKG A;  2CEA A;  2FBW A;  2BDE A;  2ZM6 T;  2QRX A;  1WR6 A;  5AQV B;  4DR7 T;  3LDQ B;  4WZX A;  3SS1 A;  3K3O A;  3SFD A;  3LK2 B;  4ZI7 E;  1OWA A;  2MYS A;  4H9P C;  4Z90 A;  2BS3 A;  4KHZ F;  4AKR B;  3C4X A;  1MND A;  3AE8 A;  3ESL A;  1JNZ A;  3N9M A;  3OJA A;  3AE4 A;  4MAL A;  4DO0 A;  5CFB A;  3RRC A;  4L9I A;  1D1C A;  1NEN A;  2XY8 B;  3FZL B;  3L3P A;  3L8R A;  5KMG P;  3BK9 A;  1W0A A;  3LK3 B;  1OED A;  3ZT5 A;  3UT5 E;  3UFG A;  2W2U A;  1FIO A;  4IGU A;  4DV2 T;  1WRD A;  5AQI B;  4GKK T;  4IDZ A;  4MBQ A;  4PJL A;  5HXR A;  2CLY C;  3J9X 1;  2RA1 A;  4A97 A;  2FJE A;  3Q2M A;  2DWG A;  4ILA A;  4AIS A;  2FUP A;  5ETW A;  1D1B A;  1D0X A;  1ZOY A;  2JRK A;  2VK9 A;  3IA3 A;  2XQ7 A;  3PE0 A;  2XQ8 A;  3G06 A;  2ZM2 A;  3I0Q A;  3RPU A;  2CCQ A;  3RQU A;  3JC6 D;  5L4E A;  2H7V C;  1YQ3 A;  1Z0P A;  3AEC A;  3CQG B;  4I0U A;  4IL4 A;  2NTY A;  2XAF B;  3QC9 A;  2H88 A;  4H9S E;  3AE2 A;  4KP3 C;  1NWM X;  4YJ3 E;  4JI5 T;  5C8Y E;  3EAB A;  2WCA A;  3AE3 A;  3PUX F;  3Q5X A;  5ABG A;  4YLH A;  3CVR A;  2WM9 A;  3ZCJ A;  1W09 A;  3PU8 A;  3AEF A;  2I59 A;  2CHO A;  4OYJ A;  2J4G A;  4U7Y A;  2IUB A;  4C91 A;  2ZM8 A;  4LF8 T;  3EDU A;  5AQM B;  2IW5 B;  5HEU A;  2E9X C;  2J62 A;  2YDR A;  3AA6 B;  4IE5 A;  4TWH A;  4X1K E;  5HEO A;  4DR3 T;  2BKP A;  3UUM A;  2DLR A;  2L3L A;  4CN4 A;  3F2E A;  3TLT A;  1LKX A;  2HPL A;  2WWU A;  4HKA A;  3Q5W A;  1D1A A;  4GK5 E;  4AQF A;  4BJM A;  1ZKE A;  3TLW A;  3A8Y C;  2W63 A;  2EHO A;  4H63 H;  2YKS A;  3LFM A;  4IRE A;  3VHL A;  4LMK A;  2EHO B;  3RQW A;  3AVR A;  2LM2 A;  2MOZ A;  4H63 V;  3DTO A;  4U3C A;  1ZP0 A;  3UU6 A;  3WAK A;  3ZN1 B;  2EHO D;  2NR4 A;  2MPK A;  3ZPO A;  1XNQ T;  4AIU A;  3C4Z A;  4H9N C;  3Q5D A;  5AQS B;  2QA7 A;  4GOU A;  2OLT A;  5LXT E;  1FMW A;  3RHW A;  4QXC B;  4QX8 B;  1IJ5 A;  2LRK A;  4LF7 T;  4X62 T;  2LHN A;  2A72 A;  2X9W A;  4PW8 A;  1IAP A;  4ZOL E;  3ZST A;  4BJN A;  5ABH A;  1N32 T;  5HXC A;  3AAI A;  3B13 A;  1MMD A;  2WAU A;  2W0G A;  4IE6 A;  4OYK A;  2LEH A;  1MNE A;  5AQU B;  1MIV A;  5HAX A;  1WYB A;  2V8S V;  3CPZ A;  2J47 A;  3AED A;  4PK5 A;  4QWN B;  4UV8 B;  4PAG A;  2XHE B;  3RIF A;  3VR8 A;  4X1I E;  5AQG B;  3MZK B;  3PU3 A;  3PUS A;  5LHH B;  3ZEF B;  3FB2 A;  2H3R A;  3UUL A;  1EZ3 A;  4YSZ A;  5CJ5 A;  3V5U A;  3AEG A;  4PJJ A;  2D9D A;  4UXN B;  5HWY A;  2IHR 1;  4E7Z A;  3AE5 A;  3OPC A;  3QB5 K;  2IAK A;  5JDN A;  5ABE A;  3HA4 A;  5JDF A;  4Z91 A;  4AQG A;  4P1N A;  3VU7 H;  3OKQ A;  2BKO A;  4DR5 T;  1XMO T;  3ETU A;  3NRY A;  4DV7 T;  4TUY E;  4XZC A;  1HCI A;  1HG5 A;  2PBI A;  3IF8 B;  3KVA A;  3P50 A;  3H37 A;  1HX1 B;  2WU5 A;  5E0O A;  3VR9 A;  3GMI A;  1U4Q A;  3ZJ2 A;  3IEE A;  4HFI A;  5FXX A;  4CXW A;  1XMQ T;  2YU1 A;  2WDQ A;  3DJB A;  3GN5 A;  4DV3 T;  2JQH A;  2YDS A;  4FJO A;  4P0B A;  3AEA A;  4M1P A;  4EZ4 A;  5AQO B;  3RF1 A;  5LGT B;  3IBP A;  3NWI A;  2V7I A;  2UXX B;  1H7C A;  3F57 A;  3N5L A;  1BR0 A;  3N9O A;  2CPT A;  1JNR A;  3MXZ A;  2XAJ B;  3K8P C;  1NAF A;  4HWI B;  2K5B B;  4YJ2 E;  5L3E B;  1W9R A;  4BA9 A;  3RC8 A;  4QKN A;  3A5X A;  4DVD A;  2KXP B;  5L2L A;  4L0R A;  5HYA A;  4X65 T;  1G73 A;  1I6Z A;  2QVA A;  2SPC A;  2IC9 A;  1U5P A;  2CHN A;  2ES0 A;  2LOS A;  3FBZ A;  1KK7 A;  4HN9 A;  3FZH B;  4TWD A;  3FBL A;  3UU5 A;  5GON E;  3RLF F;  3RYC E;  3CQC B;  3MKD A;  3WAJ A;  4JI3 T;  1W0B A;  1WR0 A;  3PUV F;  4ANJ A;  4XBF B;  2MTQ A;  4DBR A;  2Y6X A;  2BBH A;  4UVC B;  4DBQ A;  1WLX A;  5L3C B;  2FJB A;  4Z8X A;  3ZC0 A;  2C5I T;  4HFC A;  1FJG T;  3CX7 B;  3LG7 A;  2NWB A;  4DND A;  4GIW A; 
#chains in the Genus database with same CATH homology
 4K0K T;  1HNW T;  2UUA T;  4DV6 T;  4LF6 T;  4JI5 T;  4OX9 T;  4LF5 T;  4JI6 T;  1N36 T;  4X64 T;  4DV0 T;  1J5E T;  5LMU T;  4DR4 T;  4JI2 T;  4LF8 T;  4DR1 T;  2HHH T;  4DR3 T;  4YY3 T;  5IWA T;  4B3R T;  1N33 T;  1XNR T;  4NXM T;  4YHH T;  2UXC T;  2UXB T;  4DV4 T;  1HNX T;  4LFA T;  2UUC T;  1XNQ T;  1HNZ T;  4DR2 T;  4JI8 T;  3OTO T;  3T1H T;  4DV5 T;  4LF7 T;  4X62 T;  4LFB T;  1N32 T;  4B3S T;  4DR6 T;  4B3T T;  2E5L T;  4X66 T;  5BR8 T;  2UUB T;  2F4V T;  2UU9 T;  5LMN T;  2VQE T;  1IBL T;  2UXD T;  4DUY T;  4JV5 T;  1XMO T;  4DR5 T;  4DV7 T;  4JI0 T;  4DUZ T;  4JI7 T;  2VQF T;  1IBK T;  4JI4 T;  1IBM T;  4DV3 T;  1N34 T;  1XMQ T;  2ZM6 T;  4JI1 T;  4DR7 T;  4NXN T;  4LF9 T;  1HR0 T;  3T1Y T;  4X65 T;  1I94 T;  4GKJ T;  4JYA T;  4JI3 T;  4KHP T;  4AQY T;  4LF4 T;  4LFC T;  4B3M T;  4DV2 T;  4GKK T;  4DV1 T;  1FJG T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...