4NXMT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxmT00
4LFBT 2UXBT 5LMNT 4NXMT 4LF6T 4GKKT 2HHHT 2F4VT 4K0KT 4DUZT 2VQFT 2ZM6T 1N36T 4DV3T 3T1HT 4LF4T 4DV6T 1N32T 4LF8T 1XNRT 4JYAT 5BR8T 5IWAT 4JI5T 4JI2T 4DV4T 4DR7T 1XMOT 2UUAT 1XMQT 1HR0T 4DV7T 1HNZT 4AQYT 4GKJT 1J5ET 2UXDT 1HNXT 2VQET 1N34T 4JI3T 4DR3T 4OX9T 2UXCT 1FJGT 4X66T 4JI7T 4B3RT 3OTOT 4JV5T 2UUCT 4X65T 4DV2T 4JI4T 1N33T 3T1YT 4DR2T 2UUBT 4DR4T 4B3TT 1IBMT 4DR1T 2E5LT 4KHPT 1I94T 4LF7T 4YY3T 1IBKT 4LF9T 4B3MT 4JI8T 1IBLT 4B3ST 4NXNT 2UU9T 4LFAT 1HNWT 4X62T 4JI6T 4DV5T 5LMUT 4DR6T 4DV1T 1XNQT 4DUYT 4DR5T 4DV0T 4JI1T 4X64T 4YHHT 4LF5T 4JI0T 4LFCT
chains in the Genus database with same CATH superfamily
2XUEA 5GONE 3CQCB 2RPAA 5CFBA 4BAYB 5JR9B 1D1BA 5LHGB 1EZ3A 2ZM6T 2A3DA 2RA1A 5JVDE 1QSDA 1UK5A 4O4JE 3L09A 5BR8T 4U7IA 5L47A 3B13A 1J1JA 4DR7T 2EHOB 2BG9E 2PJQA 4GKJT 5DJQC 2J4GA 3P8CD 4UVAB 2J1DG 3ZYLA 3ZKRA 2LHNA 2NOXA 4ZOLE 2H3RA 5L3CB 1Y64B 5ABFB 4QH1A 1BR1A 5F8PA 1S35A 2E5LT 3I0QA 2KINB 3N9OA 4AKRB 3KBUA 4LMJA 3CPZA 4ZI2D 4B3MT 2XTLA 2EHOD 1IBLT 5AQSB 3ETUA 1SA0E 4KUMB 4IREA 2E9XA 3RF1A 2W0GA 3CWZB 5FY0A 4U31A 2DI4A 4YHHT 4MFRA 4OYKA 4HEAA 4N78D 5L3BB 4QXBB 4NXMT 2AXDS 1FIOA 2MYSA 3LDQB 5HXEA 2HPJA 4DV3T 3HL6A 4L0RA 1OEDA 2BG9C 4HN9A 1XNRT 3AE1A 4JI5T 4WBNE 4PFOA 2XAQB 4X5TA 3CIRA 2XSBA 2LM9A 4NIQA 4MBQA 2CWOA 4J2CA 2LSKA 4H63H 3M3ZB 5IYZE 3K8PC 2KNDA 3AB3B 3CX8B 2OLTA 5JREA 3P4SA 4PJMA 3LG7A 5IUXA 3N2KE 3GA8A 1KNRA 3RGLA 4YSZA 2IW5B 4ZI3C 3PUWF 3AVRA 5CB4E 4L9IA 3D0TA 1SUMB 1I94T 2NR4A 3ONXA 1CHUA 1HCIA 3A8YC 3C4XA 1ZEEA 4JEUB 2FJAA 3ZSTA 2WU2A 2MPKA 1Y01A 1VCSA 4TWHA 2WMNA 4A56A 3O1JA 2LOSA 1T8BA 2M6BA 4ZI7E 4ISSA 2WDVA 4TV8E 2ODVA 2X68A 1XNQT 3V5UA 2JJ9A 2LOPA 2CA5A 2YDSA 1M62A 2D9DA 3RKOA 4U7YA 2LSGA 4E7ZA 2LSYA 2PBIA 2YINA 2HPLA 3AEBA 2F4VT 4HWHA 3CX7B 3AEAA 3KBTA 1HG2A 3LJCA 2N1GA 1ZKEA 3K3OA 2V7KA 3BQKA 3JC6C 3AE6A 2XASB 3ANWA 2WMOA 2Y48B 2E9XB 3O4XE 2UUAT 2NW8A 5AQVB 1D1AA 1VOMA 3HR0A 5LBQB 2CRBA 2NP9A 3RPUA 5L3GB 1GQEA 4AKIA 3SS1A 1UGOA 3P7IA 4H9SE 3NWIA 5LYJE 2UUBT 5FMNA 3KVBA 4HFCA 3FZMB 1XWMA 1U5PA 1ZP0A 5LP6E 3AXJA 2UXXB 5A1LA 2E9XD 1MIYA 1L0VA 3KVAA 1HFAA 4LFAT 3S4UA 1ZOYA 3IBPA 4U33A 4DV5T 2CMRA 2JQ9A 5FXVA 2BS4A 3EDVA 4HFDA 3AAEB 1WYBA 4TWDA 5JR9C 4WZXA 4HWFA 4PAGA 3RIFA 3CKDA 5L4EA 4CN4A 4EYUA 4CXYA 3ZYKA 5EK4A 3AEDA 4H9RC 5FXWA 5HEGA 1KNZA 1KEYA 4ZI2C 2LHRA 2EHOC 2E8IA 2QYWA 4CZZB 3WAJA 3AEFA 1UX5A 3P50A 2W62A 4HWCA 3RC8A 2I0MA 5EZYE 2XZEA 5F3JA 3QOFA 4DV7T 3P4PA 4CN6A 5CJ5A 4JUYA 4TNWA 5HCMA 4TZ4C 2WZHA 1HX1B 4IDPA 4MLKA 2VL0A 2XAFB 2JMHA 4QX8B 4XBFB 4HGAA 5ABHA 3NVOA 1HTJF 1N33T 1IBMT 5AQMB 3MZKB 2WWUA 3ANWB 3KFWX 2W2UA 3AVSA 3EI0A 5F5WA 3AE5A 4LF9T 2DCFA 4YFSA 4EZ4A 3JADA 4ZS3A 1CUNA 1QLBA 2QA7A 1H7CA 4IE7A 4WYVA 3BQLA 1MNEA 2XM2A 2DL1A 3DTOA 2IIUA 4GYSA 3RYCE 4X64T 5HEJA 3L39A 2LEHA 5AQPB 1HG5A 4Z91A 2WZIA 5KX5E 5LMNT 3WI3A 4IT4A 4IE4A 1O3XA 4ZZCA 5FVKA 4HFIA 4PJLA 1FMWA 2V7MA 4CXXA 3C64A 3NRXA 5HEHA 2DWGA 4JI3T 3Q5XA 3EAMA 5LNKA 2JMKA 3EUHA 5KDMC 4A97A 2HN2A 2PTFA 2IHR1 2Q9QA 4KHPT 4WW0A 4ERRA 3RIUA 4ZXLA 2VURA 2P9BA 1OEDE 2PG8A 2B1EA 1LKXA 2K48A 2IUBA 4B3ST 3FBLA 4DMVA 3HKDE 3NZQA 4GIWA 4O2AE 5H6QB 2L9QA 4DR6T 2CHOA 2W4XA 2VB6A 1YQ3A 2XQ5A 3L8RA 5JRCA 4X20E 1WYCA 4YXDA 4YLHA 2WCAA 3UTKA 3Q9DA 2WSSV 1UCUA 4LF4T 3Q5DA 4A98A 3RLFF 2J62A 4I0UA 3EVYA 2E9XC 2WQYA 2BZBA 3ZT6A 1XMOT 4B6XA 3GWHA 2JIWA 3QB5K 3M65A 1N34T 2VKOA 3VU7H 4DR3T 1W09A 3N9LA 2XPKA 5EK3A 4UXNB 3RH3A 4DR4T 3SFEA 5LXTE 4IL9A 4DR1T 2WAUA 5LHIB 2E2AA 3ZSSA 1IBKT 2BS2A 3P4QA 3AE3A 3ZJ2A 3U3IA 2WDQA 4CN1A 2W67A 5FXXA 4IDQA 2KWHA 1AJ3A 4YJ2E 4EAHA 1T72A 2OA5A 4ZS2A 3C4ZA 4DUYT 4ILAA 2PFVA 2YDQA 5LA6E 3HKEE 2Q9QB 4O4IE 2UXBT 5FYMA 5J2UE 2JRKA 4TN7B 4QH4A 4H9OC 4I55E 4EOZB 4PK4A 5HAXA 4AKLA 2LRLA 3KV4A 3UT5E 2V7LA 5FKYA 3UFGA 4H9NC 2H7VC 3CX6B 2NW9A 4F6RC 2KSRA 1MIWA 5L3FB 1LVKA 4PFPA 2CEAA 3AA6B 5JRCB 4ILUA 2ZMAA 2Q9QD 3MK7C 1FJGT 2LRKA 3AE9A 3MA9A 3SOLA 4EIWA 4JV5T 2HN1A 3UUNA 3FB2A 3LK3B 2BKNA 2D0TA 4LMKA 2HH7A 4CI1B 4IE5A 3RQUA 4EYYR 2RP4A 4XZCA 5LHHB 1YQ4A 4DMWA 3RYFE 4P1NA 4YY3T 3PUQA 2XQ7A 1IAPA 5AQQB 4JI8T 2BKPA 5FP3A 4O8SA 4QHOA 4IDNA 3ZT7A 4KHZF 2Y6XA 2XAGB 4K0UA 4PK6A 2WWVA 3F31A 1W9RA 2XAJB 1D1CA 1XDPA 1BR0A 3A5XA 3N9QA 4UIGA 2D0UA 1MMGA 4QH5A 5AFUL 3DJBA 3CK6A 4JI1T 3I9WA 3AEEA 4JI0T 2KZ7B 4LFBT 3FZKB 2KWIB 5AQHB 2I59A 4GOUA 4DV6T 3QK6A 1D0YA 2WDRA 2CM0A 3OPCA 3VRBA 3K3QC 5IWAT 4XAXB 2X9YA 3E22E 5AQGB 2IMLA 2X0LB 2X67A 5C3JA 4UV8B 2WP9A 4AQYT 1J5WA 1WCRA 5LGTB 1NENA 3KDSE 5LGNB 2DWKA 1G73A 3T8OA 3WAKA 3AECA 2CBIA 3AEGA 3E08A 3OJAA 4P0AA 3UU3A 2C5IT 3T1YT 4UR9A 2DLRA 4BA9A 3ZMUB 1WRDA 2D5UA 2YN6A 3GN5A 4JBWF 4MALA 3RI5A 2QGSA 4M1PA 2CXLA 1OEDB 5JDGA 4P0BA 4UELA 5J2TE 5AQRB 5FNVE 5AQKB 4DR5T 4ASKA 4DV0T 4AISA 4DBQA 2CXDA 4HKAA 2BBHA 4TX5A 4LF6T 4GKKT 3MKDA 5DQVA 2K24A 1ZV4X 2J47A 3CVRA 2XHEB 3LSVA 1YKEB 1MMAA 3LBXA 3OKQA 3J7Yq 3L3PA 2QVAA 4H63V 1XMQT 1HR0T 4TV9E 1LRZA 2YKSA 4FJOA 2FJEA 4WNKA 4HWDA 4U72A 1WFDA 1VRBA 2GK9A 3LFMA 4X66T 2IDOB 4AKHA 2DNXA 2QRXA 5JTGA 4YHJA 4IHJE 2CCQA 4OYJA 4NUVA 2XJ7A 4DO0A 3ZJ1A 4O4HE 4OHFA 5JDFA 4LF7T 1NEKA 2W61A 4UVBB 2CLYB 4EXTA 1BR4A 3AE7A 4KMCA 2OV9A 4DIDB 5KXJA 4IE6A 2UU9T 3FBZA 4I4TE 3PUAA 1WR6A 2ACXA 4IL4A 5LJMA 3BK9A 2Q9QC 4U2ZA 2M6IA 4U3CA 4LF5T 4LFCT 4IE0A 4IDOA 4AQFA 3NRYA 3RIAA 5ETWA 5HXHA 2JQKA 3GN5B 1YKHB 4O2BE 2N2NA 4QX7B 3UUXB 2A2FX 4AKGA 2XSAA 4GK0E 3TKLB 3K3NA 4NPPA 1E1HB 4A5XA 5LCYA 3AXJB 2L3LA 2DHRA 3N2GE 3ZMVB 3HI2A 1HNZT 2VASA 3DP7A 4ZZBA 2R6GF 4YT0A 5JR9A 4CI3B 2WS3A 4EZHA 3H3MA 3SWHA 5L2LA 3PUSA 2BDEA 3J9X1 2H89A 5L3DB 1W0BA 5J0ZA 3PTRB 3AA7B 4YTPA 2Y8DA 3U78A 4L5GA 5TAOA 4H9PC 1U4QA 3LBXB 3CMLA 3AE8A 3PV0F 2IC9A 3P4RA 3MACA 1M7KA 4NXNT 2AE9A 1HNWT 5HXRA 4ZI3D 4G2AA 3I9YA 2W66A 2CPTA 2BBJA 3RYHE 4UEMA 3ZPOA 5LJNA 4HTEA 1IJ6A 3MJXA 4I50E 2ZLYA 1IZNB 2FJDA 2X9XA 4PJJA 4ADZA 1S94A 2KMFA 3EABA 3ZN0B 1T7SA 2HHHT 2W63A 2V6XA 1QUUA 1N36T 2X51A 1UURA 3O1HA 4E7SA 2LKGA 2MOZA 2LM2A 2MTQA 3RKGA 4IIJE 4DVDA 1JNZA 5LBMA 4DV4T 5ADXL 3OVUA 3SFDA 5HWXA 4KI0F 3UU6A 2C5KT 1J5ET 4HFHA 2VQET 3OYZA 1IJ5A 2V6YA 5LGUB 2D2SA 2X66A 1KNPA 2VVSA 3ZCIA 2NW7A 1ZHCA 2XY8B 4B3TT 3A7MA 5HXSA 3RHWA 3E0ZA 4AIUA 3RQWA 2V7IA 5E0OA 4H9QC 5CA0E 3KV9A 5LB7B 5JDMA 3N2OA 1OEDC 5C2TA 1JNRA 3LK2B 5LMUT 3C50A 5AQOB 4AI6A 4DV1T 2V5DA 2X0HA 3R6NA 3ZMSB 2XQAA 5LG4A 1X9BA 2NTYA 2WB5A 2CBJA 3PJAA 4NUUA 3VHLA 2XQ6A 2VQFT 5HWYA 3AA0B 2V7JA 1X79A 4QKNA 3SRZA 1T98A 3IA3A 3ZCJA 1HX8A 5AQNB 2G0UA 5FL0A 4ISTA 5LG3A 3AE2A 1Z0PA 2LSJA 1XZYA 3VKHA 2V26A 3B5MA 1YW0A 3NBXX 4OX9T 4C91A 3P4WA 3RX6A 4TNVA 5ABGA 3OTOT 1MNDA 3IHRA 3PU8A 2V5CA 4KBMB 4OFZA 2V1DB 3JAEA 5FL1A 2IC6A 1DU2A 3N5LA 3EHZA 2CLYC 3O9XA 2H88A 5L3EB 1KFYA 4ILCA 4CQIA 4X1KE 2B76A 4QXCB 4DNDA 3NKZA 1US7B 2Z6EA 2FUPA 2V6YB 5L4HA 2C0SA 2FBWA 2FJBA 5JDHA 5AQTB 4EEDA 3RC3A 2A72A 5C8YE 4BJNA 2BS3A 1NWMX 2YU1A 3UQ4A 1BR2A 3N9MA 1WLXA 1MMNA 2K3WA 1YXRA 2XAHB 4KX6A 3RRWA 4EB6E 3AAIA 1V9DA 3C98B 4JEHB 1HF8A 3QUJA 1FMVA 4AQGA 2WY2A 3AAAB 4PW8A 4HE8A 4CXWA 2XM1A 3PURA 3PE0A 3BQIA 2UXCT 2CWYA 3RYIE 2ZM8A 3QNUA 5BMVE 3FXDB 2N9DA 2YU2A 4DR2T 3F2EA 4U74A 3ESLA 2JPFA 4IGUA 2IAKA 5IHYA 3ZN1B 4IDZA 1KF6A 3W15B 3FZLB 2WBLA 3ABVA 2LJLA 4YTMA 3V5SA 3H3AA 4X1IE 2BG9A 4O4LE 2M67A 4HWIB 4JI6T 2K5BB 3JCFA 2W00A 4C90A 4UV9B 3CQXC 2SPCA 3IF8B 1MMDA 1FEWA 1R8IA 3AA1B 3OBVE 3RRCA 4COFA 4EV6A 3EDUA 3KINB 4YSXA 2I6HA 3KV6A 1B7TA 4LF8T 4JYAT 4EGWA 4UF0A 4PK5A 3ZMZB 2YDRA 4JI2T 2KLQA 3KV5A 2VWAA 2K9AA 2YOEA 2ACZA 5AQJB 3FXEB 5KMGP 2VKDA 4MHCA 1W0AA 2CHNA 2UXDT 3HKCE 4AQFC 3NZPA 2XQ8A 3PDYA 2LKHA 2KXPB 5HXCA 4B3RT 4TWFA 2VVNA 4LMLA 3ZMTB 3ZYMA 5CA1E 4BJMA 5CGMA 3PUVF 1LVFA 4DBRA 2JQQA 4ZEYA 3B57A 2YK0A 4CI2B 3ZC1A 5M4YA 3UFEA 5HEOA 1OWAA 4EEBA 3ONJA 3ETVA 2BVLA 3ZT5A 1XDOA 2WM9A 2VKHA 2L8KA 2V8SV 1SHZC 4HFBA 1G8XA 4G63A 2CE7A 4GK5E 5H6RB 3UU8A 4YJ3E 4F8HA 3UU5A 3OYXA 2X9HA 4Z90A 2BVMA 3PJAJ 4OK0A 4AXPA 4HFVA 2JQHA 3VR9A 4I43B 1SE7A 1N32T 2WU5A 4JLEA 4PJNA 3ZEFB 3I0OA 3ZC0A 2BG9B 5AQLB 3RIUC 3C51A 2KT9A 2BKOA 3X1DA 5JH7E 2XQ3A 3VRAA 4WBOA 3I1AA 3QB5A 5JDLA 2NWBA 4KP3C 5JDQA 1HNXT 4QWNB 4FI5A 4X1YE 3UULA 3AE4A 1OXZA 3H37A 2YEVC 3LK42 5LOVE 5EK2A 3TLUA 3N9PA 5JDNA 1VCTA 1E7PA 4JI4T 3C4WA 5FY1A 3Q2MA 2MBGA 4TUYE 5FVLA 4UF0B 3PUGA 3PUZF 1D0XA 4P09A 3TLSA 4ILBA 3Q5EA 2CXFA 3K1SA 4Z8XA 2LLYA 2XQ4A 3ZLIA 3UUBA 5FY7A 4ANJA 4X62T 3MXZA 3O1IA 3UUMA 2XQYA 2XQ9A 3CQGB 4YSYA 2EHOA 2VK9A 1KK7A 2VL8A 4QXHB 2C5JA 5DABA 5HCJA 2LE8A 3PUYF 5AQFB 1WR0A 3QC9A 1HS7A 5AQIB 4Q25A 4K0KT 4DUZT 2MAWA 2ZM0A 5FXZA 3TLVA 3FZHB 2UXNB 3UQ7A 3T1HT 3VKGA 3PUXF 4GYRA 5ABFA 3HKBE 1D0ZA 5HYAA 4V1Av 3IEEA 4U2YA 4UVCB 2NTXA 1I6ZA 3Q5WA 2H7OA 2X0YA 2LSIA 1MIVA 3PU3A 3TLWA 3R84B 5AQUB 4JI7T 3TLTA 1UUSA 3N9NA 2UUCT 5DQWA 4X65T 4DV2T 2LT3A 2ES0A 1UX4A 1YD8G 3FZFB 4PNIA 1E2AA 3GMIA 2E5VA 3JC6D 3G06A 4ZHQE 5HEUA 5JQGE 4YTNA 2ZM2A 4HFEA 1NAFA 3FHNA 5ABEA 3ONLC 2ODUA 5J1GA 3UU4A 2X9WA 3JAFA 3HA4A 3F57A 2A9UA 3VR8A 1Z8UA 2VKJA
chains in the Genus database with same CATH topology
4LFBT 2UXBT 5LMNT 4NXMT 4LF6T 4GKKT 2HHHT 2F4VT 4K0KT 4DUZT 2VQFT 2ZM6T 1N36T 4DV3T 3T1HT 4LF4T 4DV6T 1N32T 4LF8T 1XNRT 4JYAT 5BR8T 5IWAT 4JI5T 4JI2T 4DV4T 4DR7T 1XMOT 2UUAT 1XMQT 1HR0T 4DV7T 1HNZT 4AQYT 4GKJT 1J5ET 2UXDT 1HNXT 2VQET 1N34T 4JI3T 4DR3T 4OX9T 2UXCT 1FJGT 4X66T 4JI7T 4B3RT 3OTOT 4JV5T 2UUCT 4X65T 4DV2T 4JI4T 1N33T 3T1YT 4DR2T 2UUBT 4DR4T 4B3TT 1IBMT 4DR1T 2E5LT 4KHPT 1I94T 4LF7T 4YY3T 1IBKT 4LF9T 4B3MT 4JI8T 1IBLT 4B3ST 4NXNT 2UU9T 4LFAT 1HNWT 4X62T 4JI6T 4DV5T 5LMUT 4DR6T 4DV1T 1XNQT 4DUYT 4DR5T 4DV0T 4JI1T 4X64T 4YHHT 4LF5T 4JI0T 4LFCT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB T;  2UXB T;  5LMN T;  4NXM T;  4LF6 T;  4GKK T;  2HHH T;  2F4V T;  4K0K T;  4DUZ T;  2VQF T;  2ZM6 T;  1N36 T;  4DV3 T;  3T1H T;  4LF4 T;  4DV6 T;  1N32 T;  4LF8 T;  1XNR T;  4JYA T;  5BR8 T;  5IWA T;  4JI5 T;  4JI2 T;  4DV4 T;  4DR7 T;  1XMO T;  2UUA T;  1XMQ T;  1HR0 T;  4DV7 T;  1HNZ T;  4AQY T;  4GKJ T;  1J5E T;  2UXD T;  1HNX T;  2VQE T;  1N34 T;  4JI3 T;  4DR3 T;  4OX9 T;  2UXC T;  1FJG T;  4X66 T;  4JI7 T;  4B3R T;  3OTO T;  4JV5 T;  2UUC T;  4X65 T;  4DV2 T;  4JI4 T;  1N33 T;  3T1Y T;  4DR2 T;  2UUB T;  4DR4 T;  4B3T T;  1IBM T;  4DR1 T;  2E5L T;  4KHP T;  1I94 T;  4LF7 T;  4YY3 T;  1IBK T;  4LF9 T;  4B3M T;  4JI8 T;  1IBL T;  4B3S T;  4NXN T;  2UU9 T;  4LFA T;  1HNW T;  4X62 T;  4JI6 T;  4DV5 T;  5LMU T;  4DR6 T;  4DV1 T;  1XNQ T;  4DUY T;  4DR5 T;  4DV0 T;  4JI1 T;  4X64 T;  4YHH T;  4LF5 T;  4JI0 T;  4LFC T; 
#chains in the Genus database with same CATH topology
 2XUE A;  5GON E;  3CQC B;  2RPA A;  5CFB A;  4BAY B;  5JR9 B;  1D1B A;  5LHG B;  1EZ3 A;  2ZM6 T;  2A3D A;  2RA1 A;  5JVD E;  1QSD A;  1UK5 A;  4O4J E;  3L09 A;  5BR8 T;  4U7I A;  5L47 A;  3B13 A;  1J1J A;  4DR7 T;  2EHO B;  2BG9 E;  2PJQ A;  4GKJ T;  5DJQ C;  2J4G A;  3P8C D;  4UVA B;  2J1D G;  3ZYL A;  3ZKR A;  2LHN A;  2NOX A;  4ZOL E;  2H3R A;  5L3C B;  1Y64 B;  5ABF B;  4QH1 A;  1BR1 A;  5F8P A;  1S35 A;  2E5L T;  3I0Q A;  2KIN B;  3N9O A;  4AKR B;  3KBU A;  4LMJ A;  3CPZ A;  4ZI2 D;  4B3M T;  2XTL A;  2EHO D;  1IBL T;  5AQS B;  3ETU A;  1SA0 E;  4KUM B;  4IRE A;  2E9X A;  3RF1 A;  2W0G A;  3CWZ B;  5FY0 A;  4U31 A;  2DI4 A;  4YHH T;  4MFR A;  4OYK A;  4HEA A;  4N78 D;  5L3B B;  4QXB B;  4NXM T;  2AXD S;  1FIO A;  2MYS A;  3LDQ B;  5HXE A;  2HPJ A;  4DV3 T;  3HL6 A;  4L0R A;  1OED A;  2BG9 C;  4HN9 A;  1XNR T;  3AE1 A;  4JI5 T;  4WBN E;  4PFO A;  2XAQ B;  4X5T A;  3CIR A;  2XSB A;  2LM9 A;  4NIQ A;  4MBQ A;  2CWO A;  4J2C A;  2LSK A;  4H63 H;  3M3Z B;  5IYZ E;  3K8P C;  2KND A;  3AB3 B;  3CX8 B;  2OLT A;  5JRE A;  3P4S A;  4PJM A;  3LG7 A;  5IUX A;  3N2K E;  3GA8 A;  1KNR A;  3RGL A;  4YSZ A;  2IW5 B;  4ZI3 C;  3PUW F;  3AVR A;  5CB4 E;  4L9I A;  3D0T A;  1SUM B;  1I94 T;  2NR4 A;  3ONX A;  1CHU A;  1HCI A;  3A8Y C;  3C4X A;  1ZEE A;  4JEU B;  2FJA A;  3ZST A;  2WU2 A;  2MPK A;  1Y01 A;  1VCS A;  4TWH A;  2WMN A;  4A56 A;  3O1J A;  2LOS A;  1T8B A;  2M6B A;  4ZI7 E;  4ISS A;  2WDV A;  4TV8 E;  2ODV A;  2X68 A;  1XNQ T;  3V5U A;  2JJ9 A;  2LOP A;  2CA5 A;  2YDS A;  1M62 A;  2D9D A;  3RKO A;  4U7Y A;  2LSG A;  4E7Z A;  2LSY A;  2PBI A;  2YIN A;  2HPL A;  3AEB A;  2F4V T;  4HWH A;  3CX7 B;  3AEA A;  3KBT A;  1HG2 A;  3LJC A;  2N1G A;  1ZKE A;  3K3O A;  2V7K A;  3BQK A;  3JC6 C;  3AE6 A;  2XAS B;  3ANW A;  2WMO A;  2Y48 B;  2E9X B;  3O4X E;  2UUA T;  2NW8 A;  5AQV B;  1D1A A;  1VOM A;  3HR0 A;  5LBQ B;  2CRB A;  2NP9 A;  3RPU A;  5L3G B;  1GQE A;  4AKI A;  3SS1 A;  1UGO A;  3P7I A;  4H9S E;  3NWI A;  5LYJ E;  2UUB T;  5FMN A;  3KVB A;  4HFC A;  3FZM B;  1XWM A;  1U5P A;  1ZP0 A;  5LP6 E;  3AXJ A;  2UXX B;  5A1L A;  2E9X D;  1MIY A;  1L0V A;  3KVA A;  1HFA A;  4LFA T;  3S4U A;  1ZOY A;  3IBP A;  4U33 A;  4DV5 T;  2CMR A;  2JQ9 A;  5FXV A;  2BS4 A;  3EDV A;  4HFD A;  3AAE B;  1WYB A;  4TWD A;  5JR9 C;  4WZX A;  4HWF A;  4PAG A;  3RIF A;  3CKD A;  5L4E A;  4CN4 A;  4EYU A;  4CXY A;  3ZYK A;  5EK4 A;  3AED A;  4H9R C;  5FXW A;  5HEG A;  1KNZ A;  1KEY A;  4ZI2 C;  2LHR A;  2EHO C;  2E8I A;  2QYW A;  4CZZ B;  3WAJ A;  3AEF A;  1UX5 A;  3P50 A;  2W62 A;  4HWC A;  3RC8 A;  2I0M A;  5EZY E;  2XZE A;  5F3J A;  3QOF A;  4DV7 T;  3P4P A;  4CN6 A;  5CJ5 A;  4JUY A;  4TNW A;  5HCM A;  4TZ4 C;  2WZH A;  1HX1 B;  4IDP A;  4MLK A;  2VL0 A;  2XAF B;  2JMH A;  4QX8 B;  4XBF B;  4HGA A;  5ABH A;  3NVO A;  1HTJ F;  1N33 T;  1IBM T;  5AQM B;  3MZK B;  2WWU A;  3ANW B;  3KFW X;  2W2U A;  3AVS A;  3EI0 A;  5F5W A;  3AE5 A;  4LF9 T;  2DCF A;  4YFS A;  4EZ4 A;  3JAD A;  4ZS3 A;  1CUN A;  1QLB A;  2QA7 A;  1H7C A;  4IE7 A;  4WYV A;  3BQL A;  1MNE A;  2XM2 A;  2DL1 A;  3DTO A;  2IIU A;  4GYS A;  3RYC E;  4X64 T;  5HEJ A;  3L39 A;  2LEH A;  5AQP B;  1HG5 A;  4Z91 A;  2WZI A;  5KX5 E;  5LMN T;  3WI3 A;  4IT4 A;  4IE4 A;  1O3X A;  4ZZC A;  5FVK A;  4HFI A;  4PJL A;  1FMW A;  2V7M A;  4CXX A;  3C64 A;  3NRX A;  5HEH A;  2DWG A;  4JI3 T;  3Q5X A;  3EAM A;  5LNK A;  2JMK A;  3EUH A;  5KDM C;  4A97 A;  2HN2 A;  2PTF A;  2IHR 1;  2Q9Q A;  4KHP T;  4WW0 A;  4ERR A;  3RIU A;  4ZXL A;  2VUR A;  2P9B A;  1OED E;  2PG8 A;  2B1E A;  1LKX A;  2K48 A;  2IUB A;  4B3S T;  3FBL A;  4DMV A;  3HKD E;  3NZQ A;  4GIW A;  4O2A E;  5H6Q B;  2L9Q A;  4DR6 T;  2CHO A;  2W4X A;  2VB6 A;  1YQ3 A;  2XQ5 A;  3L8R A;  5JRC A;  4X20 E;  1WYC A;  4YXD A;  4YLH A;  2WCA A;  3UTK A;  3Q9D A;  2WSS V;  1UCU A;  4LF4 T;  3Q5D A;  4A98 A;  3RLF F;  2J62 A;  4I0U A;  3EVY A;  2E9X C;  2WQY A;  2BZB A;  3ZT6 A;  1XMO T;  4B6X A;  3GWH A;  2JIW A;  3QB5 K;  3M65 A;  1N34 T;  2VKO A;  3VU7 H;  4DR3 T;  1W09 A;  3N9L A;  2XPK A;  5EK3 A;  4UXN B;  3RH3 A;  4DR4 T;  3SFE A;  5LXT E;  4IL9 A;  4DR1 T;  2WAU A;  5LHI B;  2E2A A;  3ZSS A;  1IBK T;  2BS2 A;  3P4Q A;  3AE3 A;  3ZJ2 A;  3U3I A;  2WDQ A;  4CN1 A;  2W67 A;  5FXX A;  4IDQ A;  2KWH A;  1AJ3 A;  4YJ2 E;  4EAH A;  1T72 A;  2OA5 A;  4ZS2 A;  3C4Z A;  4DUY T;  4ILA A;  2PFV A;  2YDQ A;  5LA6 E;  3HKE E;  2Q9Q B;  4O4I E;  2UXB T;  5FYM A;  5J2U E;  2JRK A;  4TN7 B;  4QH4 A;  4H9O C;  4I55 E;  4EOZ B;  4PK4 A;  5HAX A;  4AKL A;  2LRL A;  3KV4 A;  3UT5 E;  2V7L A;  5FKY A;  3UFG A;  4H9N C;  2H7V C;  3CX6 B;  2NW9 A;  4F6R C;  2KSR A;  1MIW A;  5L3F B;  1LVK A;  4PFP A;  2CEA A;  3AA6 B;  5JRC B;  4ILU A;  2ZMA A;  2Q9Q D;  3MK7 C;  1FJG T;  2LRK A;  3AE9 A;  3MA9 A;  3SOL A;  4EIW A;  4JV5 T;  2HN1 A;  3UUN A;  3FB2 A;  3LK3 B;  2BKN A;  2D0T A;  4LMK A;  2HH7 A;  4CI1 B;  4IE5 A;  3RQU A;  4EYY R;  2RP4 A;  4XZC A;  5LHH B;  1YQ4 A;  4DMW A;  3RYF E;  4P1N A;  4YY3 T;  3PUQ A;  2XQ7 A;  1IAP A;  5AQQ B;  4JI8 T;  2BKP A;  5FP3 A;  4O8S A;  4QHO A;  4IDN A;  3ZT7 A;  4KHZ F;  2Y6X A;  2XAG B;  4K0U A;  4PK6 A;  2WWV A;  3F31 A;  1W9R A;  2XAJ B;  1D1C A;  1XDP A;  1BR0 A;  3A5X A;  3N9Q A;  4UIG A;  2D0U A;  1MMG A;  4QH5 A;  5AFU L;  3DJB A;  3CK6 A;  4JI1 T;  3I9W A;  3AEE A;  4JI0 T;  2KZ7 B;  4LFB T;  3FZK B;  2KWI B;  5AQH B;  2I59 A;  4GOU A;  4DV6 T;  3QK6 A;  1D0Y A;  2WDR A;  2CM0 A;  3OPC A;  3VRB A;  3K3Q C;  5IWA T;  4XAX B;  2X9Y A;  3E22 E;  5AQG B;  2IML A;  2X0L B;  2X67 A;  5C3J A;  4UV8 B;  2WP9 A;  4AQY T;  1J5W A;  1WCR A;  5LGT B;  1NEN A;  3KDS E;  5LGN B;  2DWK A;  1G73 A;  3T8O A;  3WAK A;  3AEC A;  2CBI A;  3AEG A;  3E08 A;  3OJA A;  4P0A A;  3UU3 A;  2C5I T;  3T1Y T;  4UR9 A;  2DLR A;  4BA9 A;  3ZMU B;  1WRD A;  2D5U A;  2YN6 A;  3GN5 A;  4JBW F;  4MAL A;  3RI5 A;  2QGS A;  4M1P A;  2CXL A;  1OED B;  5JDG A;  4P0B A;  4UEL A;  5J2T E;  5AQR B;  5FNV E;  5AQK B;  4DR5 T;  4ASK A;  4DV0 T;  4AIS A;  4DBQ A;  2CXD A;  4HKA A;  2BBH A;  4TX5 A;  4LF6 T;  4GKK T;  3MKD A;  5DQV A;  2K24 A;  1ZV4 X;  2J47 A;  3CVR A;  2XHE B;  3LSV A;  1YKE B;  1MMA A;  3LBX A;  3OKQ A;  3J7Y q;  3L3P A;  2QVA A;  4H63 V;  1XMQ T;  1HR0 T;  4TV9 E;  1LRZ A;  2YKS A;  4FJO A;  2FJE A;  4WNK A;  4HWD A;  4U72 A;  1WFD A;  1VRB A;  2GK9 A;  3LFM A;  4X66 T;  2IDO B;  4AKH A;  2DNX A;  2QRX A;  5JTG A;  4YHJ A;  4IHJ E;  2CCQ A;  4OYJ A;  4NUV A;  2XJ7 A;  4DO0 A;  3ZJ1 A;  4O4H E;  4OHF A;  5JDF A;  4LF7 T;  1NEK A;  2W61 A;  4UVB B;  2CLY B;  4EXT A;  1BR4 A;  3AE7 A;  4KMC A;  2OV9 A;  4DID B;  5KXJ A;  4IE6 A;  2UU9 T;  3FBZ A;  4I4T E;  3PUA A;  1WR6 A;  2ACX A;  4IL4 A;  5LJM A;  3BK9 A;  2Q9Q C;  4U2Z A;  2M6I A;  4U3C A;  4LF5 T;  4LFC T;  4IE0 A;  4IDO A;  4AQF A;  3NRY A;  3RIA A;  5ETW A;  5HXH A;  2JQK A;  3GN5 B;  1YKH B;  4O2B E;  2N2N A;  4QX7 B;  3UUX B;  2A2F X;  4AKG A;  2XSA A;  4GK0 E;  3TKL B;  3K3N A;  4NPP A;  1E1H B;  4A5X A;  5LCY A;  3AXJ B;  2L3L A;  2DHR A;  3N2G E;  3ZMV B;  3HI2 A;  1HNZ T;  2VAS A;  3DP7 A;  4ZZB A;  2R6G F;  4YT0 A;  5JR9 A;  4CI3 B;  2WS3 A;  4EZH A;  3H3M A;  3SWH A;  5L2L A;  3PUS A;  2BDE A;  3J9X 1;  2H89 A;  5L3D B;  1W0B A;  5J0Z A;  3PTR B;  3AA7 B;  4YTP A;  2Y8D A;  3U78 A;  4L5G A;  5TAO A;  4H9P C;  1U4Q A;  3LBX B;  3CML A;  3AE8 A;  3PV0 F;  2IC9 A;  3P4R A;  3MAC A;  1M7K A;  4NXN T;  2AE9 A;  1HNW T;  5HXR A;  4ZI3 D;  4G2A A;  3I9Y A;  2W66 A;  2CPT A;  2BBJ A;  3RYH E;  4UEM A;  3ZPO A;  5LJN A;  4HTE A;  1IJ6 A;  3MJX A;  4I50 E;  2ZLY A;  1IZN B;  2FJD A;  2X9X A;  4PJJ A;  4ADZ A;  1S94 A;  2KMF A;  3EAB A;  3ZN0 B;  1T7S A;  2HHH T;  2W63 A;  2V6X A;  1QUU A;  1N36 T;  2X51 A;  1UUR A;  3O1H A;  4E7S A;  2LKG A;  2MOZ A;  2LM2 A;  2MTQ A;  3RKG A;  4IIJ E;  4DVD A;  1JNZ A;  5LBM A;  4DV4 T;  5ADX L;  3OVU A;  3SFD A;  5HWX A;  4KI0 F;  3UU6 A;  2C5K T;  1J5E T;  4HFH A;  2VQE T;  3OYZ A;  1IJ5 A;  2V6Y A;  5LGU B;  2D2S A;  2X66 A;  1KNP A;  2VVS A;  3ZCI A;  2NW7 A;  1ZHC A;  2XY8 B;  4B3T T;  3A7M A;  5HXS A;  3RHW A;  3E0Z A;  4AIU A;  3RQW A;  2V7I A;  5E0O A;  4H9Q C;  5CA0 E;  3KV9 A;  5LB7 B;  5JDM A;  3N2O A;  1OED C;  5C2T A;  1JNR A;  3LK2 B;  5LMU T;  3C50 A;  5AQO B;  4AI6 A;  4DV1 T;  2V5D A;  2X0H A;  3R6N A;  3ZMS B;  2XQA A;  5LG4 A;  1X9B A;  2NTY A;  2WB5 A;  2CBJ A;  3PJA A;  4NUU A;  3VHL A;  2XQ6 A;  2VQF T;  5HWY A;  3AA0 B;  2V7J A;  1X79 A;  4QKN A;  3SRZ A;  1T98 A;  3IA3 A;  3ZCJ A;  1HX8 A;  5AQN B;  2G0U A;  5FL0 A;  4IST A;  5LG3 A;  3AE2 A;  1Z0P A;  2LSJ A;  1XZY A;  3VKH A;  2V26 A;  3B5M A;  1YW0 A;  3NBX X;  4OX9 T;  4C91 A;  3P4W A;  3RX6 A;  4TNV A;  5ABG A;  3OTO T;  1MND A;  3IHR A;  3PU8 A;  2V5C A;  4KBM B;  4OFZ A;  2V1D B;  3JAE A;  5FL1 A;  2IC6 A;  1DU2 A;  3N5L A;  3EHZ A;  2CLY C;  3O9X A;  2H88 A;  5L3E B;  1KFY A;  4ILC A;  4CQI A;  4X1K E;  2B76 A;  4QXC B;  4DND A;  3NKZ A;  1US7 B;  2Z6E A;  2FUP A;  2V6Y B;  5L4H A;  2C0S A;  2FBW A;  2FJB A;  5JDH A;  5AQT B;  4EED A;  3RC3 A;  2A72 A;  5C8Y E;  4BJN A;  2BS3 A;  1NWM X;  2YU1 A;  3UQ4 A;  1BR2 A;  3N9M A;  1WLX A;  1MMN A;  2K3W A;  1YXR A;  2XAH B;  4KX6 A;  3RRW A;  4EB6 E;  3AAI A;  1V9D A;  3C98 B;  4JEH B;  1HF8 A;  3QUJ A;  1FMV A;  4AQG A;  2WY2 A;  3AAA B;  4PW8 A;  4HE8 A;  4CXW A;  2XM1 A;  3PUR A;  3PE0 A;  3BQI A;  2UXC T;  2CWY A;  3RYI E;  2ZM8 A;  3QNU A;  5BMV E;  3FXD B;  2N9D A;  2YU2 A;  4DR2 T;  3F2E A;  4U74 A;  3ESL A;  2JPF A;  4IGU A;  2IAK A;  5IHY A;  3ZN1 B;  4IDZ A;  1KF6 A;  3W15 B;  3FZL B;  2WBL A;  3ABV A;  2LJL A;  4YTM A;  3V5S A;  3H3A A;  4X1I E;  2BG9 A;  4O4L E;  2M67 A;  4HWI B;  4JI6 T;  2K5B B;  3JCF A;  2W00 A;  4C90 A;  4UV9 B;  3CQX C;  2SPC A;  3IF8 B;  1MMD A;  1FEW A;  1R8I A;  3AA1 B;  3OBV E;  3RRC A;  4COF A;  4EV6 A;  3EDU A;  3KIN B;  4YSX A;  2I6H A;  3KV6 A;  1B7T A;  4LF8 T;  4JYA T;  4EGW A;  4UF0 A;  4PK5 A;  3ZMZ B;  2YDR A;  4JI2 T;  2KLQ A;  3KV5 A;  2VWA A;  2K9A A;  2YOE A;  2ACZ A;  5AQJ B;  3FXE B;  5KMG P;  2VKD A;  4MHC A;  1W0A A;  2CHN A;  2UXD T;  3HKC E;  4AQF C;  3NZP A;  2XQ8 A;  3PDY A;  2LKH A;  2KXP B;  5HXC A;  4B3R T;  4TWF A;  2VVN A;  4LML A;  3ZMT B;  3ZYM A;  5CA1 E;  4BJM A;  5CGM A;  3PUV F;  1LVF A;  4DBR A;  2JQQ A;  4ZEY A;  3B57 A;  2YK0 A;  4CI2 B;  3ZC1 A;  5M4Y A;  3UFE A;  5HEO A;  1OWA A;  4EEB A;  3ONJ A;  3ETV A;  2BVL A;  3ZT5 A;  1XDO A;  2WM9 A;  2VKH A;  2L8K A;  2V8S V;  1SHZ C;  4HFB A;  1G8X A;  4G63 A;  2CE7 A;  4GK5 E;  5H6R B;  3UU8 A;  4YJ3 E;  4F8H A;  3UU5 A;  3OYX A;  2X9H A;  4Z90 A;  2BVM A;  3PJA J;  4OK0 A;  4AXP A;  4HFV A;  2JQH A;  3VR9 A;  4I43 B;  1SE7 A;  1N32 T;  2WU5 A;  4JLE A;  4PJN A;  3ZEF B;  3I0O A;  3ZC0 A;  2BG9 B;  5AQL B;  3RIU C;  3C51 A;  2KT9 A;  2BKO A;  3X1D A;  5JH7 E;  2XQ3 A;  3VRA A;  4WBO A;  3I1A A;  3QB5 A;  5JDL A;  2NWB A;  4KP3 C;  5JDQ A;  1HNX T;  4QWN B;  4FI5 A;  4X1Y E;  3UUL A;  3AE4 A;  1OXZ A;  3H37 A;  2YEV C;  3LK4 2;  5LOV E;  5EK2 A;  3TLU A;  3N9P A;  5JDN A;  1VCT A;  1E7P A;  4JI4 T;  3C4W A;  5FY1 A;  3Q2M A;  2MBG A;  4TUY E;  5FVL A;  4UF0 B;  3PUG A;  3PUZ F;  1D0X A;  4P09 A;  3TLS A;  4ILB A;  3Q5E A;  2CXF A;  3K1S A;  4Z8X A;  2LLY A;  2XQ4 A;  3ZLI A;  3UUB A;  5FY7 A;  4ANJ A;  4X62 T;  3MXZ A;  3O1I A;  3UUM A;  2XQY A;  2XQ9 A;  3CQG B;  4YSY A;  2EHO A;  2VK9 A;  1KK7 A;  2VL8 A;  4QXH B;  2C5J A;  5DAB A;  5HCJ A;  2LE8 A;  3PUY F;  5AQF B;  1WR0 A;  3QC9 A;  1HS7 A;  5AQI B;  4Q25 A;  4K0K T;  4DUZ T;  2MAW A;  2ZM0 A;  5FXZ A;  3TLV A;  3FZH B;  2UXN B;  3UQ7 A;  3T1H T;  3VKG A;  3PUX F;  4GYR A;  5ABF A;  3HKB E;  1D0Z A;  5HYA A;  4V1A v;  3IEE A;  4U2Y A;  4UVC B;  2NTX A;  1I6Z A;  3Q5W A;  2H7O A;  2X0Y A;  2LSI A;  1MIV A;  3PU3 A;  3TLW A;  3R84 B;  5AQU B;  4JI7 T;  3TLT A;  1UUS A;  3N9N A;  2UUC T;  5DQW A;  4X65 T;  4DV2 T;  2LT3 A;  2ES0 A;  1UX4 A;  1YD8 G;  3FZF B;  4PNI A;  1E2A A;  3GMI A;  2E5V A;  3JC6 D;  3G06 A;  4ZHQ E;  5HEU A;  5JQG E;  4YTN A;  2ZM2 A;  4HFE A;  1NAF A;  3FHN A;  5ABE A;  3ONL C;  2ODU A;  5J1G A;  3UU4 A;  2X9W A;  3JAF A;  3HA4 A;  3F57 A;  2A9U A;  3VR8 A;  1Z8U A;  2VKJ A; 
#chains in the Genus database with same CATH homology
 4LFB T;  2UXB T;  5LMN T;  4NXM T;  4LF6 T;  4GKK T;  2HHH T;  2F4V T;  4K0K T;  4DUZ T;  2VQF T;  2ZM6 T;  1N36 T;  4DV3 T;  3T1H T;  4LF4 T;  4DV6 T;  1N32 T;  4LF8 T;  1XNR T;  4JYA T;  5BR8 T;  5IWA T;  4JI5 T;  4JI2 T;  4DV4 T;  4DR7 T;  1XMO T;  2UUA T;  1XMQ T;  1HR0 T;  4DV7 T;  1HNZ T;  4AQY T;  4GKJ T;  1J5E T;  2UXD T;  1HNX T;  2VQE T;  1N34 T;  4JI3 T;  4DR3 T;  4OX9 T;  2UXC T;  1FJG T;  4X66 T;  4JI7 T;  4B3R T;  3OTO T;  4JV5 T;  2UUC T;  4X65 T;  4DV2 T;  4JI4 T;  1N33 T;  3T1Y T;  4DR2 T;  2UUB T;  4DR4 T;  4B3T T;  1IBM T;  4DR1 T;  2E5L T;  4KHP T;  1I94 T;  4LF7 T;  4YY3 T;  1IBK T;  4LF9 T;  4B3M T;  4JI8 T;  1IBL T;  4B3S T;  4NXN T;  2UU9 T;  4LFA T;  1HNW T;  4X62 T;  4JI6 T;  4DV5 T;  5LMU T;  4DR6 T;  4DV1 T;  1XNQ T;  4DUY T;  4DR5 T;  4DV0 T;  4JI1 T;  4X64 T;  4YHH T;  4LF5 T;  4JI0 T;  4LFC T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...