4NXMT

Crystal structure of the 30s ribosomal subunit from a gidb (rsmg) mutant of thermus thermophilus (hb8)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4nxmT00
4JYAT 4DR6T 4LF8T 1N36T 4LF7T 1XNQT 4NXNT 4X64T 5BR8T 5LMNT 2UUAT 4GKJT 4LF9T 1IBMT 4YY3T 4JI8T 4DR5T 3OTOT 4B3ST 4DR1T 4DR3T 4JI3T 4JI2T 4GKKT 4LFBT 4DV6T 4LFAT 4DV4T 1HNXT 4DV2T 4JI4T 1HNWT 1J5ET 1HNZT 2UXBT 2UUBT 4B3MT 4JI5T 4DV7T 4LFCT 1IBLT 4JV5T 1FJGT 4X65T 4YHHT 4DV5T 4AQYT 2UXDT 4DUYT 4NXMT 4DV0T 2HHHT 4K0KT 1HR0T 4DR2T 2VQFT 4DR7T 4KHPT 4JI1T 3T1YT 2E5LT 4JI6T 1XNRT 2ZM6T 4JI7T 1N33T 4JI0T 4LF6T 4X62T 1N32T 3T1HT 4B3RT 4X66T 1XMQT 1I94T 4B3TT 5LMUT 2UU9T 1XMOT 4DV3T 4DUZT 4LF5T 5IWAT 2UXCT 2F4VT 4DV1T 4DR4T 1IBKT 2VQET 2UUCT 1N34T 4OX9T 4LF4T
chains in the Genus database with same CATH superfamily
3ZN1B 3V5UA 4JUYA 3S4UA 4JYAT 3I0QA 3NZPA 2X9XA 4WYVA 4GYSA 4H9OC 2BG9A 4A97A 4CN1A 3ZT5A 4BJMA 3ZPOA 3AXJA 4IDQA 1T7SA 2CLYC 1IZNB 4MALA 3UTKA 3ZMTB 3N2OA 2XM2A 3RIUC 5EK4A 2LM2A 4IHJE 5HYAA 2BS3A 2X9WA 2D2SA 5L3CB 4JV5T 2Y48B 2XHEB 1EZ3A 1OEDA 1IAPA 4ZEYA 4UIGA 2NR4A 2ACXA 2OLTA 3AE1A 2CRBA 1KNZA 5IHYA 1XNRT 2YN6A 3O1IA 3N2GE 3KVBA 5LGUB 2VWAA 2CMRA 3KDSE 2KNDA 4ILAA 4HFEA 5HXHA 2L9QA 4ILUA 4YT0A 4LF5T 5JREA 3ZLIA 2AE9A 2V7IA 2BKPA 5EZYE 2H88A 4PJLA 3ZEFB 2PJQA 1G8XA 1KNRA 1Y01A 3I9WA 3FBZA 4NUUA 3GN5B 4X64T 5BR8T 5LMNT 4L5GA 1LRZA 5HEUA 2XPKA 4ZI3D 1UX4A 5JQGE 5HEOA 3RRCA 2VASA 4U2ZA 4B3ST 5CFBA 2VKDA 3M65A 1D0XA 4I4TE 4ZS2A 1D1BA 2MAWA 3PU8A 5HWYA 1G73A 2KXPB 1L0VA 2D9DA 5AQJB 2CM0A 2V6XA 4X65T 4TWFA 3IA3A 2KWIB 3GWHA 5L4HA 1HTJF 2WAUA 3AEDA 3KVAA 3ZYLA 2Q9QD 4DR2T 2QRXA 2V7JA 4MFRA 3UU6A 2ZM6T 4YTNA 4NUVA 2HH7A 3AECA 3QOFA 1J1JA 4IE0A 2D5UA 3WI3A 4I0UA 2CBJA 4WZXA 4L0RA 3ONLC 2W62A 2M6BA 1VOMA 3TLVA 2UUCT 2H7VC 3AE9A 2LSIA 2JRKA 3ZC0A 1E7PA 4PJMA 3LK3B 1US7B 2VK9A 3PUQA 5FP3A 4GKJT 4X1YE 1NWMX 2V1DB 5FXWA 2LM9A 3K8PC 3B5MA 2X9YA 2WDQA 2EHOC 5IYZE 3IEEA 3I9YA 3HKCE 3CQXC 4GYRA 3RIAA 2W67A 2K48A 3SS1A 4U2YA 4JI5T 4UXNB 4JEHB 4QH1A 2CXLA 2I0MA 4KP3C 5AQLB 5HCJA 4JLEA 4EZHA 5HEJA 5AQKB 2WS3A 2LT3A 3P7IA 1KFYA 3HKDE 2XAJB 3AEFA 3J7Yq 5LNKA 3FZMB 2WB5A 2W63A 3T1HT 4B3RT 4HGAA 2VVNA 2ES0A 2W66A 2XQ8A 2CEAA 3L39A 3VR9A 3JAEA 3O1HA 4PW8A 5C8YE 5JRCA 3LBXA 3RHWA 5ADXL 2UXXB 3OYXA 3SFDA 4PNIA 2LKHA 5HEGA 2IMLA 3UU3A 2DWGA 2LSJA 2W00A 4UEMA 4EEBA 4I55E 4E7ZA 5LBMA 5J0ZA 4EB6E 2HPJA 2X9HA 4QH4A 4AKGA 2J62A 4ISSA 2BS2A 2PG8A 3IF8B 3N9QA 3N9PA 4JI2T 4TNWA 1D0ZA 4H63H 2JMHA 2ZLYA 3RKOA 1X9BA 1ZV4X 1LVFA 4AKLA 5AQPB 3UUMA 2Q9QB 4JI4T 3P50A 3RKGA 3EDUA 5FKYA 2ACZA 1W0BA 3VKHA 3OYZA 2JQQA 3ZYKA 2CXFA 5ETWA 3CK6A 1WFDA 1HR0T 3UFEA 5KDMC 3EHZA 4HFCA 1S94A 4H9PC 5HXCA 2J47A 4HE8A 2JMKA 5CA0E 1U4QA 3KBUA 3ANWB 2A2FX 2AXDS 4ZHQE 3EDVA 1XMQT 2XSBA 2XASB 2YDRA 2LHNA 4DUZT 3PTRB 4O2AE 2CXDA 2B1EA 3O9XA 4EV6A 5CGMA 3B57A 5LP6E 3LFMA 2DLRA 5JDMA 3AE6A 3K3NA 2WWUA 3LK2B 2ODUA 2WDRA 2K24A 4HWFA 2E9XA 5L3BB 2NOXA 4ILBA 3QB5K 1WCRA 3UUBA 3U78A 5FL1A 3G06A 3UFGA 3ONJA 4EIWA 2MTQA 2FJEA 5L3DB 4ZI3C 3N9NA 3NRYA 3RIFA 5AQHB 2J4GA 3AA0B 3MA9A 4COFA 2IAKA 4ZXLA 3TKLB 3FBLA 1MNEA 2E5VA 4DBRA 1O3XA 2QA7A 2BS4A 4NXMT 2NW8A 3QK6A 3AVSA 5ABFA 5LB7B 2VB6A 2VQFT 4EYUA 2DNXA 1W9RA 2JJ9A 3M3ZB 2IC6A 4HEAA 3LSVA 4QXHB 5LJNA 4AXPA 4JI0T 3KFWX 3MJXA 5HXSA 1Z8UA 4XBFB 4HFHA 3AXJB 2Q9QC 1YQ4A 4ILCA 5L4EA 2LEHA 5HXEA 1HX8A 4DV1T 4DR4T 1SA0E 4CZZB 2V6YA 3RIUA 2DWKA 3RPUA 1Z0PA 3FZFB 3VU7H 2BKOA 3LJCA 1S35A 3P4PA 4TX5A 2IC9A 4HFVA 4JI8T 4PJNA 3NBXX 1Y64B 4JI3T 5FMNA 3E08A 1B7TA 1OEDB 4KBMB 4H63V 3H37A 2QVAA 2BBJA 5FYMA 5CB4E 2FBWA 2XAFB 2XSAA 3Q2MA 5AQNB 4U3CA 3ZJ2A 3CX6B 2B76A 3N2KE 4U33A 4DUYT 1DU2A 4CI3B 1HF8A 2GK9A 4ZI7E 5ABHA 4EZ4A 1U5PA 3RF1A 2LE8A 3ZKRA 1XDOA 4MLKA 4X62T 4KMCA 3PV0F 4IGUA 4O4LE 2A72A 4PFOA 4YTPA 5HEHA 3SOLA 2MOZA 5JDFA 2W2UA 2YKSA 2XQ3A 1OEDE 4YSZA 1YW0A 4WBOA 5LG3A 4Z8XA 3ZC1A 1I6ZA 4ANJA 5L3FB 2RA1A 2FJAA 3CIRA 4HFIA 3HKBE 4M1PA 4HFDA 4DIDB 2YEVC 4YLHA 4N78D 2IHR1 3IHRA 5AQSB 3RYIE 3A5XA 3BK9A 4WNKA 1W09A 3NRXA 1UK5A 2UXNB 3PU3A 5FY7A 5LG4A 4IREA 4C91A 5A1LA 3AE2A 2R6GF 4A56A 3ZT7A 5LHHB 4IDNA 1KEYA 2LSKA 1J5ET 2CBIA 4XAXB 2UUBT 3UT5E 2YK0A 3JCFA 4TNVA 2Y6XA 4EEDA 4QKNA 4H9SE 3E22E 4DO0A 1YQ3A 4G2AA 3ZSSA 1IJ6A 4K0KT 2ZM0A 3AE8A 4MHCA 3ZMSB 5JR9C 2YOEA 2C5JA 3DP7A 2V5DA 2X67A 2LHRA 2D0UA 2XQ9A 3AA6B 1HS7A 1WYBA 3WAKA 1N32T 4X1IE 4X66T 4CQIA 3RYFE 4B3TT 4E7SA 4UVAB 3RGLA 3VKGA 3C4XA 2EHOA 1VCTA 1SUMB 1VCSA 2NTXA 3ETUA 3T8OA 1FMVA 3AEBA 2XQAA 4LF7T 4LMKA 5LYJE 4KHZF 2H3RA 2MYSA 3GN5A 4UELA 4DR1T 4HWDA 4G63A 3DTOA 1H7CA 3H3MA 2XY8B 3H3AA 4AIUA 2UXBT 4XZCA 3OKQA 2Z6EA 4OFZA 4ZI2C 4U7IA 4PK4A 4U74A 1M62A 1FJGT 2Y8DA 3ESLA 4AQYT 2M67A 5JRCB 3QB5A 4UVBB 3LBXB 3MKDA 4YTMA 1KF6A 2XAHB 2J1DG 4P09A 3T1YT 2JQKA 2PTFA 5EK2A 1UGOA 5EK3A 1HCIA 2I59A 3RLFF 5FY1A 3TLTA 3SRZA 5LHGB 2LLYA 1FIOA 5KX5E 1QLBA 3PUYF 3FZKB 4HTEA 3KV9A 2F4VT 1T72A 2LOSA 2X66A 1ZP0A 3BQLA 4HN9A 2XQYA 3TLSA 3JC6C 3U3IA 5AQQB 1N36T 4NXNT 2KMFA 1HFAA 3N9MA 1WRDA 3FZHB 4ZZBA 2KZ7B 4IL4A 5FVLA 3CX8B 2WMOA 4QXBB 1ZHCA 2VL0A 4PJJA 3HL6A 5AQMB 5HAXA 2WQYA 3EAMA 4X20E 4I43B 5FXXA 5C3JA 4DV7T 4L9IA 3Q5XA 2LKGA 2V7LA 2RPAA 3R6NA 1WR0A 4HWIB 3CQCB 3ZSTA 2I6HA 4TUYE 2YDSA 4I50E 4DNDA 3BQIA 1CUNA 2BBHA 4O4IE 5ABGA 4AISA 1N33T 3AEGA 2WP9A 4IE6A 2K3WA 5AQVB 2XQ4A 2JPFA 3VHLA 4QH5A 4OYKA 4ISTA 3Q5DA 4IDOA 2ODVA 5FL0A 3L8RA 4GOUA 3HKEE 1WLXA 3ZMUB 2X51A 4CXYA 2UUAT 3ONXA 4O2BE 4IE5A 5AQOB 3SWHA 3TLWA 3JAFA 4FI5A 2G0UA 3CX7B 4YY3T 1OWAA 4DR3T 5AQTB 3PE0A 1MIVA 3VRBA 1MMAA 3OPCA 4ADZA 1ZEEA 1ZOYA 2VKOA 4U31A 2M6IA 4DV2T 4IIJE 1WYCA 5E0OA 2W0GA 4Q25A 5J1GA 2XZEA 3MK7C 2PBIA 4CN6A 2H7OA 4YHHT 4P0BA 5H6RB 1KNPA 3B13A 1UUSA 4LMJA 4IE7A 2V6YB 1BR4A 3PUZF 2WZIA 3UU5A 4UF0B 4JI7T 3ZMVB 2KT9A 1QSDA 5F5WA 5FNVE 2EHOD 2HPLA 3AE4A 1E1HB 2HN1A 2BKNA 2L8KA 2CHOA 3JADA 4PAGA 3CVRA 3ABVA 1IBKT 5LXTE 2BDEA 3PJAJ 5HXRA 1YXRA 5L2LA 1SE7A 5DQWA 2BG9B 4HWCA 3OBVE 3ZMZB 5AQIB 2CA5A 3L09A 3P4QA 4YXDA 5JTGA 4GK5E 1IBMT 4CI2B 4AQFC 2LRLA 3UQ4A 3O4XE 4BA9A 2WU5A 3RQWA 2W61A 5JDHA 4HKAA 2KWHA 4Z91A 2K9AA 2KLQA 1T98A 4LFBT 5HWXA 4QXCB 4AI6A 2K5BB 4BJNA 3AA1B 1HNXT 1MMGA 1HNWT 5CJ5A 4TV9E 1GQEA 3AE7A 3CQGB 2XJ7A 4F6RC 2WU2A 2WDVA 2ZMAA 1ZKEA 3K3QC 3O1JA 3KBTA 4AKRB 4P1NA 4KI0F 4X1KE 4YFSA 5H6QB 5C2TA 2BG9E 4LF6T 1SHZC 2LJLA 2UU9T 1XMOT 2CCQA 4DV3T 1AJ3A 4F8HA 3EI0A 5IWAT 1UURA 3HI2A 1YKEB 1N34T 5F3JA 3EABA 4LF4T 5IUXA 4AKHA 2DCFA 2CPTA 4DR6T 1IJ5A 3AA7B 5DQVA 3AAAB 3C98B 2LRKA 4TN7B 1D1AA 4ERRA 2VVSA 4GK0E 2V8SV 3UU8A 3C4ZA 1JNZA 4KX6A 5JR9A 4GKKT 4AKIA 2JQ9A 4PK6A 2A3DA 2A9UA 3C50A 3EVYA 3R84B 5AQRB 2WWVA 3LK42 5DABA 5HCMA 2OV9A 2VURA 4UV9B 2OA5A 4EXTA 3F57A 4H9RC 2BG9C 3EUHA 2EHOB 4OYJA 3ZJ1A 1UX5A 5L3EB 3P8CD 1M7KA 3CKDA 3PUVF 1HG5A 3UUNA 2E5LT 3CWZB 4BAYB 3RH3A 2WMNA 2MBGA 2CHNA 4P0AA 4C90A 4OK0A 3N5LA 3KV6A 1FEWA 1BR2A 3Q5EA 4A98A 2YDQA 1OEDC 3A7MA 3QNUA 5BMVE 4PFPA 4YJ3E 5AFUL 1KK7A 4YJ2E 1WR6A 2SPCA 3NZQA 1XNQT 4GIWA 5TAOA 4QWNB 3RYCE 2FJBA 3OTOT 2E9XD 5JVDE 1V9DA 2IIUA 5LJMA 2DI4A 2ZM8A 2YU1A 4X5TA 3UQ7A 5JDGA 2WY2A 2YU2A 2WBLA 1J5WA 3FZLB 4B3MT 3Q5WA 3QC9A 2NTYA 4A5XA 4LFCT 1IBLT 5LGTB 3X1DA 2XQ5A 4ZOLE 5LA6E 5M4YA 4DV5T 3F31A 5FVKA 3PUXF 3LG7A 3VRAA 2NWBA 2QGSA 3RC3A 3N9LA 2BZBA 5FXVA 4U7YA 3K1SA 3AAEB 2V26A 2N9DA 5KXJA 4CN4A 4EGWA 1FMWA 3MZKB 4CXWA 2E2AA 2KSRA 5LMUT 1VRBA 3AEEA 2IUBA 4HFBA 3J9X1 2VKHA 2FJDA 3RI5A 1JNRA 4TWDA 2MPKA 2VQET 2QYWA 3V5SA 2BVLA 2VL8A 2VKJA 4TV8E 2E8IA 5L3GB 3C4WA 3GA8A 2ZM2A 2W4XA 1CHUA 4DR5T 5AQFB 3KV4A 3OJAA 1MIYA 2LSGA 3A8YC 3HR0A 3NVOA 3ZCIA 4K0UA 3FXEB 4UR9A 1D1CA 1T8BA 2LSYA 5LCYA 1XZYA 3D0TA 5AQGB 4TWHA 3AB3B 4WBNE 3C51A 3RYHE 2X0LB 4QHOA 2WSSV 4IT4A 2P9BA 3C64A 2UXDT 4CXXA 2V5CA 4JEUB 1YKHB 2XUEA 4YSYA 1UCUA 5KMGP 1MMNA 1BR1A 1W0AA 3QUJA 2D0TA 3VR8A 1E2AA 3AAIA 3GMIA 4ASKA 3CPZA 2RP4A 2X68A 3AE5A 4CI1B 3E0ZA 4UV8B 3OVUA 3W15B 2BVMA 4O8SA 5ABEA 2XM1A 3RQUA 3P4SA 2V7KA 2E9XB 2KINB 3MXZA 5DJQC 3AEAA 4IDZA 3TLUA 4LF8T 5JDQA 2V7MA 2NP9A 2IW5B 4IL9A 4Z90A 4LF9T 2XTLA 2N2NA 3WAJA 4DMVA 3ZYMA 2WM9A 3KINB 4QX8B 3I1AA 4H9NC 1BR0A 1LKXA 3FXDB 3ZCJA 1R8IA 5LBQB 3P4RA 4FJOA 2DL1A 4YSXA 1XDPA 4LFAT 2FUPA 2H89A 2L3LA 2XAGB 4EYYR 3MACA 4ZS3A 3PUSA 5AQUB 5CA1E 2NW9A 4DMWA 1HX1B 5ABFB 3PURA 5LHIB 4DV0T 5J2TE 2HHHT 3F2EA 2C0SA 4OHFA 4HWHA 4PK5A 3PDYA 3PUGA 4DBQA 4JI1T 4MBQA 2WZHA 4J2CA 3ZN0B 4JI6T 5J2UE 2Q9QA 4B6XA 2CLYB 1MNDA 3AE3A 4IE4A 4V1Av 1I94T 4AQFA 4JBWF 5F8PA 5L47A 5JH7E 3L3PA 3HA4A 2X0HA 4U72A 1QUUA 4NIQA 3PJAA 4NPPA 4ZI2D 3CMLA 2YINA 4YHJA 3PUWF 3N9OA 1X79A 1XWMA 3KV5A 2CWYA 3ANWA 3PUAA 1YD8G 3Q9DA 3RC8A 2PFVA 3RX6A 2XAQB 5FY0A 1OXZA 2JQHA 3FB2A 4O4HE 2N1GA 3UUXB 1NENA 2X0YA 5LOVE 4DV6T 4H9QC 3UULA 3AVRA 4LMLA 4DV4T 3NWIA 2IDOB 3LDQB 3UU4A 4TZ4C 4DVDA 1HNZT 1LVKA 4WW0A 4O4JE 2JIWA 3SFEA 2CWOA 4KUMB 2XQ6A 1MMDA 2HN2A 2E9XC 1MIWA 4AQGA 3BQKA 5FXZA 2LOPA 5JDNA 2CE7A 3JC6D 3P4WA 2DHRA 3RRWA 4EOZB 3FHNA 1HG2A 5GONE 3ETVA 3ZT6A 3NKZA 2C5IT 4DR7T 4KHPT 3DJBA 4QX7B 2WCAA 2XQ7A 3K3OA 4UVCB 1D0YA 3I0OA 4UF0A 5LGNB 4ZZCA 4IDPA 2C5KT 4EAHA 1NEKA 2NW7A 5JR9B 2UXCT 3IBPA 1NAFA 4OX9T 5JDLA
chains in the Genus database with same CATH topology
4JYAT 4DR6T 4LF8T 1N36T 4LF7T 1XNQT 4NXNT 4X64T 5BR8T 5LMNT 2UUAT 4GKJT 4LF9T 1IBMT 4YY3T 4JI8T 4DR5T 3OTOT 4B3ST 4DR1T 4DR3T 4JI3T 4JI2T 4GKKT 4LFBT 4DV6T 4LFAT 4DV4T 1HNXT 4DV2T 4JI4T 1HNWT 1J5ET 1HNZT 2UXBT 2UUBT 4B3MT 4JI5T 4DV7T 4LFCT 1IBLT 4JV5T 1FJGT 4X65T 4YHHT 4DV5T 4AQYT 2UXDT 4DUYT 4NXMT 4DV0T 2HHHT 4K0KT 1HR0T 4DR2T 2VQFT 4DR7T 4KHPT 4JI1T 3T1YT 2E5LT 4JI6T 1XNRT 2ZM6T 4JI7T 1N33T 4JI0T 4LF6T 4X62T 1N32T 3T1HT 4B3RT 4X66T 1XMQT 1I94T 4B3TT 5LMUT 2UU9T 1XMOT 4DV3T 4DUZT 4LF5T 5IWAT 2UXCT 2F4VT 4DV1T 4DR4T 1IBKT 2VQET 2UUCT 1N34T 4OX9T 4LF4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JYA T;  4DR6 T;  4LF8 T;  1N36 T;  4LF7 T;  1XNQ T;  4NXN T;  4X64 T;  5BR8 T;  5LMN T;  2UUA T;  4GKJ T;  4LF9 T;  1IBM T;  4YY3 T;  4JI8 T;  4DR5 T;  3OTO T;  4B3S T;  4DR1 T;  4DR3 T;  4JI3 T;  4JI2 T;  4GKK T;  4LFB T;  4DV6 T;  4LFA T;  4DV4 T;  1HNX T;  4DV2 T;  4JI4 T;  1HNW T;  1J5E T;  1HNZ T;  2UXB T;  2UUB T;  4B3M T;  4JI5 T;  4DV7 T;  4LFC T;  1IBL T;  4JV5 T;  1FJG T;  4X65 T;  4YHH T;  4DV5 T;  4AQY T;  2UXD T;  4DUY T;  4NXM T;  4DV0 T;  2HHH T;  4K0K T;  1HR0 T;  4DR2 T;  2VQF T;  4DR7 T;  4KHP T;  4JI1 T;  3T1Y T;  2E5L T;  4JI6 T;  1XNR T;  2ZM6 T;  4JI7 T;  1N33 T;  4JI0 T;  4LF6 T;  4X62 T;  1N32 T;  3T1H T;  4B3R T;  4X66 T;  1XMQ T;  1I94 T;  4B3T T;  5LMU T;  2UU9 T;  1XMO T;  4DV3 T;  4DUZ T;  4LF5 T;  5IWA T;  2UXC T;  2F4V T;  4DV1 T;  4DR4 T;  1IBK T;  2VQE T;  2UUC T;  1N34 T;  4OX9 T;  4LF4 T; 
#chains in the Genus database with same CATH topology
 3ZN1 B;  3V5U A;  4JUY A;  3S4U A;  4JYA T;  3I0Q A;  3NZP A;  2X9X A;  4WYV A;  4GYS A;  4H9O C;  2BG9 A;  4A97 A;  4CN1 A;  3ZT5 A;  4BJM A;  3ZPO A;  3AXJ A;  4IDQ A;  1T7S A;  2CLY C;  1IZN B;  4MAL A;  3UTK A;  3ZMT B;  3N2O A;  2XM2 A;  3RIU C;  5EK4 A;  2LM2 A;  4IHJ E;  5HYA A;  2BS3 A;  2X9W A;  2D2S A;  5L3C B;  4JV5 T;  2Y48 B;  2XHE B;  1EZ3 A;  1OED A;  1IAP A;  4ZEY A;  4UIG A;  2NR4 A;  2ACX A;  2OLT A;  3AE1 A;  2CRB A;  1KNZ A;  5IHY A;  1XNR T;  2YN6 A;  3O1I A;  3N2G E;  3KVB A;  5LGU B;  2VWA A;  2CMR A;  3KDS E;  2KND A;  4ILA A;  4HFE A;  5HXH A;  2L9Q A;  4ILU A;  4YT0 A;  4LF5 T;  5JRE A;  3ZLI A;  2AE9 A;  2V7I A;  2BKP A;  5EZY E;  2H88 A;  4PJL A;  3ZEF B;  2PJQ A;  1G8X A;  1KNR A;  1Y01 A;  3I9W A;  3FBZ A;  4NUU A;  3GN5 B;  4X64 T;  5BR8 T;  5LMN T;  4L5G A;  1LRZ A;  5HEU A;  2XPK A;  4ZI3 D;  1UX4 A;  5JQG E;  5HEO A;  3RRC A;  2VAS A;  4U2Z A;  4B3S T;  5CFB A;  2VKD A;  3M65 A;  1D0X A;  4I4T E;  4ZS2 A;  1D1B A;  2MAW A;  3PU8 A;  5HWY A;  1G73 A;  2KXP B;  1L0V A;  2D9D A;  5AQJ B;  2CM0 A;  2V6X A;  4X65 T;  4TWF A;  3IA3 A;  2KWI B;  3GWH A;  5L4H A;  1HTJ F;  2WAU A;  3AED A;  3KVA A;  3ZYL A;  2Q9Q D;  4DR2 T;  2QRX A;  2V7J A;  4MFR A;  3UU6 A;  2ZM6 T;  4YTN A;  4NUV A;  2HH7 A;  3AEC A;  3QOF A;  1J1J A;  4IE0 A;  2D5U A;  3WI3 A;  4I0U A;  2CBJ A;  4WZX A;  4L0R A;  3ONL C;  2W62 A;  2M6B A;  1VOM A;  3TLV A;  2UUC T;  2H7V C;  3AE9 A;  2LSI A;  2JRK A;  3ZC0 A;  1E7P A;  4PJM A;  3LK3 B;  1US7 B;  2VK9 A;  3PUQ A;  5FP3 A;  4GKJ T;  4X1Y E;  1NWM X;  2V1D B;  5FXW A;  2LM9 A;  3K8P C;  3B5M A;  2X9Y A;  2WDQ A;  2EHO C;  5IYZ E;  3IEE A;  3I9Y A;  3HKC E;  3CQX C;  4GYR A;  3RIA A;  2W67 A;  2K48 A;  3SS1 A;  4U2Y A;  4JI5 T;  4UXN B;  4JEH B;  4QH1 A;  2CXL A;  2I0M A;  4KP3 C;  5AQL B;  5HCJ A;  4JLE A;  4EZH A;  5HEJ A;  5AQK B;  2WS3 A;  2LT3 A;  3P7I A;  1KFY A;  3HKD E;  2XAJ B;  3AEF A;  3J7Y q;  5LNK A;  3FZM B;  2WB5 A;  2W63 A;  3T1H T;  4B3R T;  4HGA A;  2VVN A;  2ES0 A;  2W66 A;  2XQ8 A;  2CEA A;  3L39 A;  3VR9 A;  3JAE A;  3O1H A;  4PW8 A;  5C8Y E;  5JRC A;  3LBX A;  3RHW A;  5ADX L;  2UXX B;  3OYX A;  3SFD A;  4PNI A;  2LKH A;  5HEG A;  2IML A;  3UU3 A;  2DWG A;  2LSJ A;  2W00 A;  4UEM A;  4EEB A;  4I55 E;  4E7Z A;  5LBM A;  5J0Z A;  4EB6 E;  2HPJ A;  2X9H A;  4QH4 A;  4AKG A;  2J62 A;  4ISS A;  2BS2 A;  2PG8 A;  3IF8 B;  3N9Q A;  3N9P A;  4JI2 T;  4TNW A;  1D0Z A;  4H63 H;  2JMH A;  2ZLY A;  3RKO A;  1X9B A;  1ZV4 X;  1LVF A;  4AKL A;  5AQP B;  3UUM A;  2Q9Q B;  4JI4 T;  3P50 A;  3RKG A;  3EDU A;  5FKY A;  2ACZ A;  1W0B A;  3VKH A;  3OYZ A;  2JQQ A;  3ZYK A;  2CXF A;  5ETW A;  3CK6 A;  1WFD A;  1HR0 T;  3UFE A;  5KDM C;  3EHZ A;  4HFC A;  1S94 A;  4H9P C;  5HXC A;  2J47 A;  4HE8 A;  2JMK A;  5CA0 E;  1U4Q A;  3KBU A;  3ANW B;  2A2F X;  2AXD S;  4ZHQ E;  3EDV A;  1XMQ T;  2XSB A;  2XAS B;  2YDR A;  2LHN A;  4DUZ T;  3PTR B;  4O2A E;  2CXD A;  2B1E A;  3O9X A;  4EV6 A;  5CGM A;  3B57 A;  5LP6 E;  3LFM A;  2DLR A;  5JDM A;  3AE6 A;  3K3N A;  2WWU A;  3LK2 B;  2ODU A;  2WDR A;  2K24 A;  4HWF A;  2E9X A;  5L3B B;  2NOX A;  4ILB A;  3QB5 K;  1WCR A;  3UUB A;  3U78 A;  5FL1 A;  3G06 A;  3UFG A;  3ONJ A;  4EIW A;  2MTQ A;  2FJE A;  5L3D B;  4ZI3 C;  3N9N A;  3NRY A;  3RIF A;  5AQH B;  2J4G A;  3AA0 B;  3MA9 A;  4COF A;  2IAK A;  4ZXL A;  3TKL B;  3FBL A;  1MNE A;  2E5V A;  4DBR A;  1O3X A;  2QA7 A;  2BS4 A;  4NXM T;  2NW8 A;  3QK6 A;  3AVS A;  5ABF A;  5LB7 B;  2VB6 A;  2VQF T;  4EYU A;  2DNX A;  1W9R A;  2JJ9 A;  3M3Z B;  2IC6 A;  4HEA A;  3LSV A;  4QXH B;  5LJN A;  4AXP A;  4JI0 T;  3KFW X;  3MJX A;  5HXS A;  1Z8U A;  4XBF B;  4HFH A;  3AXJ B;  2Q9Q C;  1YQ4 A;  4ILC A;  5L4E A;  2LEH A;  5HXE A;  1HX8 A;  4DV1 T;  4DR4 T;  1SA0 E;  4CZZ B;  2V6Y A;  3RIU A;  2DWK A;  3RPU A;  1Z0P A;  3FZF B;  3VU7 H;  2BKO A;  3LJC A;  1S35 A;  3P4P A;  4TX5 A;  2IC9 A;  4HFV A;  4JI8 T;  4PJN A;  3NBX X;  1Y64 B;  4JI3 T;  5FMN A;  3E08 A;  1B7T A;  1OED B;  4KBM B;  4H63 V;  3H37 A;  2QVA A;  2BBJ A;  5FYM A;  5CB4 E;  2FBW A;  2XAF B;  2XSA A;  3Q2M A;  5AQN B;  4U3C A;  3ZJ2 A;  3CX6 B;  2B76 A;  3N2K E;  4U33 A;  4DUY T;  1DU2 A;  4CI3 B;  1HF8 A;  2GK9 A;  4ZI7 E;  5ABH A;  4EZ4 A;  1U5P A;  3RF1 A;  2LE8 A;  3ZKR A;  1XDO A;  4MLK A;  4X62 T;  4KMC A;  3PV0 F;  4IGU A;  4O4L E;  2A72 A;  4PFO A;  4YTP A;  5HEH A;  3SOL A;  2MOZ A;  5JDF A;  2W2U A;  2YKS A;  2XQ3 A;  1OED E;  4YSZ A;  1YW0 A;  4WBO A;  5LG3 A;  4Z8X A;  3ZC1 A;  1I6Z A;  4ANJ A;  5L3F B;  2RA1 A;  2FJA A;  3CIR A;  4HFI A;  3HKB E;  4M1P A;  4HFD A;  4DID B;  2YEV C;  4YLH A;  4N78 D;  2IHR 1;  3IHR A;  5AQS B;  3RYI E;  3A5X A;  3BK9 A;  4WNK A;  1W09 A;  3NRX A;  1UK5 A;  2UXN B;  3PU3 A;  5FY7 A;  5LG4 A;  4IRE A;  4C91 A;  5A1L A;  3AE2 A;  2R6G F;  4A56 A;  3ZT7 A;  5LHH B;  4IDN A;  1KEY A;  2LSK A;  1J5E T;  2CBI A;  4XAX B;  2UUB T;  3UT5 E;  2YK0 A;  3JCF A;  4TNV A;  2Y6X A;  4EED A;  4QKN A;  4H9S E;  3E22 E;  4DO0 A;  1YQ3 A;  4G2A A;  3ZSS A;  1IJ6 A;  4K0K T;  2ZM0 A;  3AE8 A;  4MHC A;  3ZMS B;  5JR9 C;  2YOE A;  2C5J A;  3DP7 A;  2V5D A;  2X67 A;  2LHR A;  2D0U A;  2XQ9 A;  3AA6 B;  1HS7 A;  1WYB A;  3WAK A;  1N32 T;  4X1I E;  4X66 T;  4CQI A;  3RYF E;  4B3T T;  4E7S A;  4UVA B;  3RGL A;  3VKG A;  3C4X A;  2EHO A;  1VCT A;  1SUM B;  1VCS A;  2NTX A;  3ETU A;  3T8O A;  1FMV A;  3AEB A;  2XQA A;  4LF7 T;  4LMK A;  5LYJ E;  4KHZ F;  2H3R A;  2MYS A;  3GN5 A;  4UEL A;  4DR1 T;  4HWD A;  4G63 A;  3DTO A;  1H7C A;  3H3M A;  2XY8 B;  3H3A A;  4AIU A;  2UXB T;  4XZC A;  3OKQ A;  2Z6E A;  4OFZ A;  4ZI2 C;  4U7I A;  4PK4 A;  4U74 A;  1M62 A;  1FJG T;  2Y8D A;  3ESL A;  4AQY T;  2M67 A;  5JRC B;  3QB5 A;  4UVB B;  3LBX B;  3MKD A;  4YTM A;  1KF6 A;  2XAH B;  2J1D G;  4P09 A;  3T1Y T;  2JQK A;  2PTF A;  5EK2 A;  1UGO A;  5EK3 A;  1HCI A;  2I59 A;  3RLF F;  5FY1 A;  3TLT A;  3SRZ A;  5LHG B;  2LLY A;  1FIO A;  5KX5 E;  1QLB A;  3PUY F;  3FZK B;  4HTE A;  3KV9 A;  2F4V T;  1T72 A;  2LOS A;  2X66 A;  1ZP0 A;  3BQL A;  4HN9 A;  2XQY A;  3TLS A;  3JC6 C;  3U3I A;  5AQQ B;  1N36 T;  4NXN T;  2KMF A;  1HFA A;  3N9M A;  1WRD A;  3FZH B;  4ZZB A;  2KZ7 B;  4IL4 A;  5FVL A;  3CX8 B;  2WMO A;  4QXB B;  1ZHC A;  2VL0 A;  4PJJ A;  3HL6 A;  5AQM B;  5HAX A;  2WQY A;  3EAM A;  4X20 E;  4I43 B;  5FXX A;  5C3J A;  4DV7 T;  4L9I A;  3Q5X A;  2LKG A;  2V7L A;  2RPA A;  3R6N A;  1WR0 A;  4HWI B;  3CQC B;  3ZST A;  2I6H A;  4TUY E;  2YDS A;  4I50 E;  4DND A;  3BQI A;  1CUN A;  2BBH A;  4O4I E;  5ABG A;  4AIS A;  1N33 T;  3AEG A;  2WP9 A;  4IE6 A;  2K3W A;  5AQV B;  2XQ4 A;  2JPF A;  3VHL A;  4QH5 A;  4OYK A;  4IST A;  3Q5D A;  4IDO A;  2ODV A;  5FL0 A;  3L8R A;  4GOU A;  3HKE E;  1WLX A;  3ZMU B;  2X51 A;  4CXY A;  2UUA T;  3ONX A;  4O2B E;  4IE5 A;  5AQO B;  3SWH A;  3TLW A;  3JAF A;  4FI5 A;  2G0U A;  3CX7 B;  4YY3 T;  1OWA A;  4DR3 T;  5AQT B;  3PE0 A;  1MIV A;  3VRB A;  1MMA A;  3OPC A;  4ADZ A;  1ZEE A;  1ZOY A;  2VKO A;  4U31 A;  2M6I A;  4DV2 T;  4IIJ E;  1WYC A;  5E0O A;  2W0G A;  4Q25 A;  5J1G A;  2XZE A;  3MK7 C;  2PBI A;  4CN6 A;  2H7O A;  4YHH T;  4P0B A;  5H6R B;  1KNP A;  3B13 A;  1UUS A;  4LMJ A;  4IE7 A;  2V6Y B;  1BR4 A;  3PUZ F;  2WZI A;  3UU5 A;  4UF0 B;  4JI7 T;  3ZMV B;  2KT9 A;  1QSD A;  5F5W A;  5FNV E;  2EHO D;  2HPL A;  3AE4 A;  1E1H B;  2HN1 A;  2BKN A;  2L8K A;  2CHO A;  3JAD A;  4PAG A;  3CVR A;  3ABV A;  1IBK T;  5LXT E;  2BDE A;  3PJA J;  5HXR A;  1YXR A;  5L2L A;  1SE7 A;  5DQW A;  2BG9 B;  4HWC A;  3OBV E;  3ZMZ B;  5AQI B;  2CA5 A;  3L09 A;  3P4Q A;  4YXD A;  5JTG A;  4GK5 E;  1IBM T;  4CI2 B;  4AQF C;  2LRL A;  3UQ4 A;  3O4X E;  4BA9 A;  2WU5 A;  3RQW A;  2W61 A;  5JDH A;  4HKA A;  2KWH A;  4Z91 A;  2K9A A;  2KLQ A;  1T98 A;  4LFB T;  5HWX A;  4QXC B;  4AI6 A;  2K5B B;  4BJN A;  3AA1 B;  1HNX T;  1MMG A;  1HNW T;  5CJ5 A;  4TV9 E;  1GQE A;  3AE7 A;  3CQG B;  2XJ7 A;  4F6R C;  2WU2 A;  2WDV A;  2ZMA A;  1ZKE A;  3K3Q C;  3O1J A;  3KBT A;  4AKR B;  4P1N A;  4KI0 F;  4X1K E;  4YFS A;  5H6Q B;  5C2T A;  2BG9 E;  4LF6 T;  1SHZ C;  2LJL A;  2UU9 T;  1XMO T;  2CCQ A;  4DV3 T;  1AJ3 A;  4F8H A;  3EI0 A;  5IWA T;  1UUR A;  3HI2 A;  1YKE B;  1N34 T;  5F3J A;  3EAB A;  4LF4 T;  5IUX A;  4AKH A;  2DCF A;  2CPT A;  4DR6 T;  1IJ5 A;  3AA7 B;  5DQV A;  3AAA B;  3C98 B;  2LRK A;  4TN7 B;  1D1A A;  4ERR A;  2VVS A;  4GK0 E;  2V8S V;  3UU8 A;  3C4Z A;  1JNZ A;  4KX6 A;  5JR9 A;  4GKK T;  4AKI A;  2JQ9 A;  4PK6 A;  2A3D A;  2A9U A;  3C50 A;  3EVY A;  3R84 B;  5AQR B;  2WWV A;  3LK4 2;  5DAB A;  5HCM A;  2OV9 A;  2VUR A;  4UV9 B;  2OA5 A;  4EXT A;  3F57 A;  4H9R C;  2BG9 C;  3EUH A;  2EHO B;  4OYJ A;  3ZJ1 A;  1UX5 A;  5L3E B;  3P8C D;  1M7K A;  3CKD A;  3PUV F;  1HG5 A;  3UUN A;  2E5L T;  3CWZ B;  4BAY B;  3RH3 A;  2WMN A;  2MBG A;  2CHN A;  4P0A A;  4C90 A;  4OK0 A;  3N5L A;  3KV6 A;  1FEW A;  1BR2 A;  3Q5E A;  4A98 A;  2YDQ A;  1OED C;  3A7M A;  3QNU A;  5BMV E;  4PFP A;  4YJ3 E;  5AFU L;  1KK7 A;  4YJ2 E;  1WR6 A;  2SPC A;  3NZQ A;  1XNQ T;  4GIW A;  5TAO A;  4QWN B;  3RYC E;  2FJB A;  3OTO T;  2E9X D;  5JVD E;  1V9D A;  2IIU A;  5LJM A;  2DI4 A;  2ZM8 A;  2YU1 A;  4X5T A;  3UQ7 A;  5JDG A;  2WY2 A;  2YU2 A;  2WBL A;  1J5W A;  3FZL B;  4B3M T;  3Q5W A;  3QC9 A;  2NTY A;  4A5X A;  4LFC T;  1IBL T;  5LGT B;  3X1D A;  2XQ5 A;  4ZOL E;  5LA6 E;  5M4Y A;  4DV5 T;  3F31 A;  5FVK A;  3PUX F;  3LG7 A;  3VRA A;  2NWB A;  2QGS A;  3RC3 A;  3N9L A;  2BZB A;  5FXV A;  4U7Y A;  3K1S A;  3AAE B;  2V26 A;  2N9D A;  5KXJ A;  4CN4 A;  4EGW A;  1FMW A;  3MZK B;  4CXW A;  2E2A A;  2KSR A;  5LMU T;  1VRB A;  3AEE A;  2IUB A;  4HFB A;  3J9X 1;  2VKH A;  2FJD A;  3RI5 A;  1JNR A;  4TWD A;  2MPK A;  2VQE T;  2QYW A;  3V5S A;  2BVL A;  2VL8 A;  2VKJ A;  4TV8 E;  2E8I A;  5L3G B;  3C4W A;  3GA8 A;  2ZM2 A;  2W4X A;  1CHU A;  4DR5 T;  5AQF B;  3KV4 A;  3OJA A;  1MIY A;  2LSG A;  3A8Y C;  3HR0 A;  3NVO A;  3ZCI A;  4K0U A;  3FXE B;  4UR9 A;  1D1C A;  1T8B A;  2LSY A;  5LCY A;  1XZY A;  3D0T A;  5AQG B;  4TWH A;  3AB3 B;  4WBN E;  3C51 A;  3RYH E;  2X0L B;  4QHO A;  2WSS V;  4IT4 A;  2P9B A;  3C64 A;  2UXD T;  4CXX A;  2V5C A;  4JEU B;  1YKH B;  2XUE A;  4YSY A;  1UCU A;  5KMG P;  1MMN A;  1BR1 A;  1W0A A;  3QUJ A;  2D0T A;  3VR8 A;  1E2A A;  3AAI A;  3GMI A;  4ASK A;  3CPZ A;  2RP4 A;  2X68 A;  3AE5 A;  4CI1 B;  3E0Z A;  4UV8 B;  3OVU A;  3W15 B;  2BVM A;  4O8S A;  5ABE A;  2XM1 A;  3RQU A;  3P4S A;  2V7K A;  2E9X B;  2KIN B;  3MXZ A;  5DJQ C;  3AEA A;  4IDZ A;  3TLU A;  4LF8 T;  5JDQ A;  2V7M A;  2NP9 A;  2IW5 B;  4IL9 A;  4Z90 A;  4LF9 T;  2XTL A;  2N2N A;  3WAJ A;  4DMV A;  3ZYM A;  2WM9 A;  3KIN B;  4QX8 B;  3I1A A;  4H9N C;  1BR0 A;  1LKX A;  3FXD B;  3ZCJ A;  1R8I A;  5LBQ B;  3P4R A;  4FJO A;  2DL1 A;  4YSX A;  1XDP A;  4LFA T;  2FUP A;  2H89 A;  2L3L A;  2XAG B;  4EYY R;  3MAC A;  4ZS3 A;  3PUS A;  5AQU B;  5CA1 E;  2NW9 A;  4DMW A;  1HX1 B;  5ABF B;  3PUR A;  5LHI B;  4DV0 T;  5J2T E;  2HHH T;  3F2E A;  2C0S A;  4OHF A;  4HWH A;  4PK5 A;  3PDY A;  3PUG A;  4DBQ A;  4JI1 T;  4MBQ A;  2WZH A;  4J2C A;  3ZN0 B;  4JI6 T;  5J2U E;  2Q9Q A;  4B6X A;  2CLY B;  1MND A;  3AE3 A;  4IE4 A;  4V1A v;  1I94 T;  4AQF A;  4JBW F;  5F8P A;  5L47 A;  5JH7 E;  3L3P A;  3HA4 A;  2X0H A;  4U72 A;  1QUU A;  4NIQ A;  3PJA A;  4NPP A;  4ZI2 D;  3CML A;  2YIN A;  4YHJ A;  3PUW F;  3N9O A;  1X79 A;  1XWM A;  3KV5 A;  2CWY A;  3ANW A;  3PUA A;  1YD8 G;  3Q9D A;  3RC8 A;  2PFV A;  3RX6 A;  2XAQ B;  5FY0 A;  1OXZ A;  2JQH A;  3FB2 A;  4O4H E;  2N1G A;  3UUX B;  1NEN A;  2X0Y A;  5LOV E;  4DV6 T;  4H9Q C;  3UUL A;  3AVR A;  4LML A;  4DV4 T;  3NWI A;  2IDO B;  3LDQ B;  3UU4 A;  4TZ4 C;  4DVD A;  1HNZ T;  1LVK A;  4WW0 A;  4O4J E;  2JIW A;  3SFE A;  2CWO A;  4KUM B;  2XQ6 A;  1MMD A;  2HN2 A;  2E9X C;  1MIW A;  4AQG A;  3BQK A;  5FXZ A;  2LOP A;  5JDN A;  2CE7 A;  3JC6 D;  3P4W A;  2DHR A;  3RRW A;  4EOZ B;  3FHN A;  1HG2 A;  5GON E;  3ETV A;  3ZT6 A;  3NKZ A;  2C5I T;  4DR7 T;  4KHP T;  3DJB A;  4QX7 B;  2WCA A;  2XQ7 A;  3K3O A;  4UVC B;  1D0Y A;  3I0O A;  4UF0 A;  5LGN B;  4ZZC A;  4IDP A;  2C5K T;  4EAH A;  1NEK A;  2NW7 A;  5JR9 B;  2UXC T;  3IBP A;  1NAF A;  4OX9 T;  5JDL A; 
#chains in the Genus database with same CATH homology
 4JYA T;  4DR6 T;  4LF8 T;  1N36 T;  4LF7 T;  1XNQ T;  4NXN T;  4X64 T;  5BR8 T;  5LMN T;  2UUA T;  4GKJ T;  4LF9 T;  1IBM T;  4YY3 T;  4JI8 T;  4DR5 T;  3OTO T;  4B3S T;  4DR1 T;  4DR3 T;  4JI3 T;  4JI2 T;  4GKK T;  4LFB T;  4DV6 T;  4LFA T;  4DV4 T;  1HNX T;  4DV2 T;  4JI4 T;  1HNW T;  1J5E T;  1HNZ T;  2UXB T;  2UUB T;  4B3M T;  4JI5 T;  4DV7 T;  4LFC T;  1IBL T;  4JV5 T;  1FJG T;  4X65 T;  4YHH T;  4DV5 T;  4AQY T;  2UXD T;  4DUY T;  4NXM T;  4DV0 T;  2HHH T;  4K0K T;  1HR0 T;  4DR2 T;  2VQF T;  4DR7 T;  4KHP T;  4JI1 T;  3T1Y T;  2E5L T;  4JI6 T;  1XNR T;  2ZM6 T;  4JI7 T;  1N33 T;  4JI0 T;  4LF6 T;  4X62 T;  1N32 T;  3T1H T;  4B3R T;  4X66 T;  1XMQ T;  1I94 T;  4B3T T;  5LMU T;  2UU9 T;  1XMO T;  4DV3 T;  4DUZ T;  4LF5 T;  5IWA T;  2UXC T;  2F4V T;  4DV1 T;  4DR4 T;  1IBK T;  2VQE T;  2UUC T;  1N34 T;  4OX9 T;  4LF4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...