2D2SA

Crystal structure of the exo84p c-terminal domains
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
229
structure length
217
Chain Sequence
DMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSLMLLNLISLKIEQRREAISSKLSQSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIVDNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNLSPGSIKSSRKQIDGLKAVGLDFVYKLDEFIKKNSDKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structures of exocyst subunit Exo70p and the Exo84p C-terminal domains reveal a common motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
molecule keywords Exocyst complex component EXO84
total genus 91
structure length 217
sequence length 229
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16528 Exo84_C Exocyst component 84 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA01
1.20.58.1220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA02
2D2SA
chains in the Genus database with same CATH superfamily
2H88A 4EZ4A 2VKHA 2LE8A 2W66A 5LOVE 4DIDB 2LJLA 2VURA 3C98B 4X1YE 2MAWA 2IC6A 2FBWA 2X66A 3P4WA 4C90A 4MALA 5CJ5A 1T8BA 5AQVB 3PJAJ 1I6ZA 2C5IT 2N9DA 2EHOA 2NW8A 4UF0B 5HEHA 2K24A 3CK6A 2BS4A 5FXXA 1Y01A 5HCMA 4PFOA 4YXDA 3IF8B 4HN9A 1LKXA 2C5JA 3P8CD 4ZZBA 5HXSA 2J62A 4B3ST 4ZI3C 5EK2A 3ZJ2A 1E1HB 3H3AA 3ZJ1A 2HN2A 3ZMSB 2WU5A 2E5LT 4AI6A 2LM2A 1D0XA 3GN5B 4TNVA 2M6BA 4BA9A 3QC9A 4EB6E 5JDLA 3MXZA 2NWBA 4TZ4C 1VOMA 4EGWA 1N36T 2AE9A 2X67A 3L39A 1VCTA 2XAHB 4ZZCA 2LSYA 5IUXA 5J1GA 1ZEEA 3H3MA 3K1SA 1LRZA 2IC9A 3AAAB 2BG9E 3LK2B 1HNWT 4QWNB 3X1DA 2YDRA 4BJNA 2CXDA 4V1Av 4TUYE 4YSZA 4AKRB 4HFIA 2DI4A 2DHRA 2EHOB 4AKIA 2UXCT 3CPZA 4IREA 4O4LE 5JDFA 3V5SA 3EUHA 1OEDE 3KDSE 3OPCA 4NPPA 4P0BA 3KV9A 3WAKA 4AXPA 3I9WA 2WDRA 4DR1T 2RP4A 2WWUA 3ETUA 3EVYA 5FY0A 3LK3B 3CQXC 4DMWA 3JAFA 5HCJA 5E0OA 5JDGA 3M3ZB 5DQVA 4JLEA 3VRBA 2W2UA 3RLFF 5JREA 3K3OA 2YN6A 4I55E 4WYVA 2XHEB 3NVOA 4H9NC 2JMKA 2WP9A 4O4IE 3CIRA 3RPUA 2MPKA 4HGAA 4IIJE 3ZSSA 2UUBT 5J2TE 5AQOB 2H3RA 3N9NA 4B6XA 5BMVE 2IDOB 2LSIA 3R84B 2J4GA 4U72A 1S35A 4P1NA 3OBVE 5AQPB 3SOLA 5J2UE 4X1KE 3VR8A 2DCFA 2CRBA 5IWAT 2DWGA 2MOZA 2K3WA 3AVRA 3CQGB 3PUQA 4H9OC 5FL1A 2KSRA 4P0AA 5DQWA 4DR7T 3AE3A 4AQGA 3NKZA 4GK0E 4DV0T 2R6GF 4DR5T 2X0YA 4O8SA 1T7SA 3N9QA 3Q2MA 2CMRA 3AAIA 1N34T 3C51A 2XJ7A 1XZYA 3EI0A 5JDQA 4A56A 4CN1A 1X9BA 4L5GA 4YSXA 2XQ3A 3UU8A 3UUBA 2XAFB 2HH7A 2W00A 2YEVC 5ABGA 2X9WA 4OYJA 5HYAA 3EABA 1BR0A 1L0VA 3FBLA 3UU5A 4UVAB 1VCSA 4IGUA 2XQ6A 4JBWF 2M6IA 1UURA 3EHZA 3UTKA 2LHRA 2X0LB 1JNRA 2W0GA 4ZXLA 1G73A 5L3GB 5LMUT 3GWHA 3N9MA 4AKGA 2I59A 2NW9A 1ZOYA 3MK7C 4YLHA 1OEDC 5ABHA 4I0UA 1ZHCA 2V7MA 2W61A 2WY2A 3GN5A 3Q5EA 4GKJT 4XAXB 3RQUA 1MIVA 2BBJA 1R8IA 2XTLA 3PUXF 2BS3A 4HFEA 1MMAA 1D0ZA 2IMLA 2NW7A 3AAEB 1ZV4X 3CMLA 1XWMA 3FHNA 4ILBA 4QXBB 2N1GA 2NOXA 2YU1A 3FZKB 4L9IA 2WS3A 2XM2A 4F8HA 3I1AA 5HEJA 4U7IA 5JQGE 4DV6T 4B3TT 5CA0E 3FZLB 4N78D 2IIUA 4CI1B 4MBQA 2WDQA 4Z8XA 1DU2A 2UXBT 3AE4A 1WR0A 2XASB 3E0ZA 3RI5A 4J2CA 1NWMX 4ZS2A 5LG3A 3UFEA 3MZKB 3UUMA 4WNKA 2IAKA 2UXXB 1W9RA 1M7KA 2VK9A 1HG5A 2OLTA 2LSKA 2QGSA 3AE8A 5LGNB 5HXEA 4TV8E 4U2YA 1WYCA 2GK9A 5FXZA 4HWDA 1YD8G 5HEGA 2V8SV 2ZLYA 4IE7A 3AA6B 3PUGA 4U74A 3UUNA 1HX8A 3CVRA 2OV9A 3P4QA 3QUJA 4UV9B 1WYBA 2JJ9A 3AEAA 1OXZA 4IDZA 2DL1A 3L8RA 5F5WA 3Q9DA 5L47A 4DUZT 3VKHA 2XQAA 3OJAA 3VKGA 1T98A 2YINA 4LMJA 3J9X1 2QRXA 4DV5T 2XQYA 3O1JA 3I0OA 1HTJF 3HKEE 4IE6A 1CHUA 2LOSA 2ZMAA 5C8YE 4ZI2D 4CN4A 3AE9A 3ZSTA 2J47A 2V6YB 1JNZA 2W4XA 4EYUA 5CFBA 5LNKA 4O2AE 3E08A 3S4UA 5LXTE 4U3CA 2JPFA 3HI2A 4CI3B 5BR8T 4KI0F 4ILUA 5KDMC 4PW8A 3ZCIA 2NTYA 5AQTB 1MMNA 1HS7A 4HE8A 3VRAA 3RRCA 1EZ3A 3K8PC 4DO0A 2K48A 3KV4A 2LSGA 4LF6T 1SA0E 4GOUA 3FZMB 3PU8A 2B76A 4UELA 3A5XA 5LYJE 2WQYA 2ZM8A 4O2BE 4F6RC 4KX6A 4YJ2E 2P9BA 2WMOA 3NZPA 4ZI7E 3ZYKA 4U7YA 2WDVA 3ANWA 1UK5A 3ZT6A 5L4EA 2CE7A 5DABA 5AQLB 5L3BB 4AQYT 1W0AA 2CHNA 4WBNE 4DNDA 4UVCB 4KP3C 1N33T 4UR9A 2E9XC 2KMFA 3H37A 5AQSB 5FXWA 4H9QC 3ZMTB 5CGMA 3A8YC 4WBOA 5FYMA 1HF8A 5H6QB 3JC6C 4JI0T 2ACZA 4KMCA 2XSBA 2IHR1 3LJCA 3PUZF 4JI5T 4JI1T 2CXLA 2NP9A 1LVFA 5C2TA 3GMIA 1MMGA 4GYSA 4Q25A 5ABFA 3UQ7A 4IE0A 4LF7T 2VL8A 1H7CA 2BBHA 3PE0A 3C50A 2ZM6T 4X66T 3AEDA 1ZP0A 3BK9A 2LSJA 3N2OA 3RGLA 5IHYA 4HWIB 4JV5T 5EK3A 4MLKA 3PU3A 3HA4A 4DBQA 2XQ8A 3SRZA 5HXHA 5L4HA 4EAHA 3RIUC 5EK4A 4LMKA 3JAEA 2ODVA 4TV9E 1KFYA 1UCUA 2JIWA 2VL0A 3C4XA 3FB2A 3O1HA 1SHZC 4IDQA 4UIGA 2L8KA 3RHWA 1SUMB 3BQKA 2VKJA 3GA8A 3CX6B 3JCFA 3OYZA 4PJNA 4AKLA 4CXWA 2V5CA 5A1LA 5L3EB 2KNDA 3NBXX 3DP7A 3FXEB 2VVNA 3MKDA 4QH5A 3KV5A 5KX5E 3AA0B 2WM9A 3CWZB 3UU4A 5ABFB 4LFBT 1GQEA 4HFDA 4CI2B 1T72A 3IEEA 1KF6A 5AQHB 4ERRA 1B7TA 4LFAT 4TN7B 4ZI2C 4IHJE 1NENA 2D9DA 5AQNB 3RQWA 4PK5A 3HL6A 3UQ4A 1W0BA 4DMVA 4OFZA 1O3XA 4WW0A 2CWYA 3M65A 3UULA 3RH3A 3ZYMA 5JVDE 4TWFA 4PJMA 4DUYT 3TLWA 2BDEA 1KK7A 2CWOA 3PDYA 4X20E 3TLUA 3ZC0A 1OWAA 1D1BA 3RRWA 2H7OA 4CXYA 3BQLA 4HWCA 4PAGA 4FJOA 3AVSA 3AEEA 1YKEB 2V7LA 2KLQA 4NUUA 4UF0A 5KXJA 5LGTB 2MYSA 3JADA 3ONJA 3T1HT 2PTFA 1WFDA 3ANWB 1G8XA 3PV0F 4E7SA 4DR2T 4XZCA 4EXTA 1BR2A 2A2FX 4PJJA 2Z6EA 3MJXA 1U5PA 4GYRA 2VQET 1KNZA 1FMVA 1S94A 3AE5A 3B57A 4QKNA 3V5UA 2Q9QC 4KHZF 4ISTA 5L3CB 4DR4T 2YK0A 5ABEA 1QUUA 5LHGB 5JR9B 4XBFB 2BVLA 1J1JA 3RIFA 5FMNA 1ZKEA 1QSDA 5HWXA 1UX4A 4BJMA 3AE6A 4JUYA 2QVAA 3AEBA 2A3DA 4KBMB 5JRCB 2SPCA 5AQJB 4O4JE 2QYWA 2V7IA 4EEDA 1KEYA 3B5MA 3IBPA 4H9RC 2AXDS 4YTNA 3AXJA 2BVMA 2M67A 2PFVA 3RYFE 4CQIA 3DJBA 3Q5XA 1MIYA 3RYCE 5LGUB 4UXNB 5LP6E 3RKOA 4LF9T 3KBUA 5FXVA 2XAGB 3ZPOA 2JQ9A 4OYKA 4ZEYA 2LT3A 2YDQA 3MACA 3JC6D 4YHJA 4JI6T 2WU2A 2KT9A 2V7KA 1HX1B 2KINB 2YOEA 4I50E 4H63H 3SS1A 3LG7A 5EZYE 5C3JA 3I0QA 2CBIA 1D0YA 2E5VA 2LKGA 4I4TE 4EEBA 4G2AA 3I9YA 3LFMA 4HFBA 4HFCA 2LKHA 4IT4A 4KUMB 1FEWA 4GIWA 3RF1A 2RPAA 3PUWF 4G63A 5AQUB 4AKHA 4ILCA 4U33A 4HEAA 4AQFA 2UXDT 3FXDB 1V9DA 1I94T 1XDOA 3KBTA 4PNIA 2L9QA 3FBZA 1HCIA 2YU2A 4OHFA 2WBLA 1YKHB 5FKYA 2V7JA 2XUEA 4DV1T 5FL0A 4DVDA 2FJBA 2EHOD 3N2GE 5FVKA 2FJEA 2HN1A 5AQKB 5LCYA 4UEMA 3AA1B 2JQQA 2BKNA 2CBJA 2L3LA 2X9XA 2BG9A 2WZHA 3LDQB 2WZIA 2XAJB 5JH7E 2E9XA 2D5UA 3FZFB 2FUPA 2E9XB 2UU9T 2Q9QA 4PK4A 4QX7B 5M4YA 4LMLA 2LHNA 2B1EA 3EDUA 5JDNA 1FJGT 2XQ7A 3QOFA 2C0SA 3VHLA 1IJ6A 4OK0A 4YY3T 4IL9A 1J5WA 4X62T 3J7Yq 2ZM0A 3N9LA 2XPKA 3UT5E 5F3JA 2N2NA 2VKOA 3OKQA 3ETVA 4TX5A 4X1IE 5AQGB 3T1YT 1UGOA 3CKDA 4YT0A 5HEOA 4ISSA 4EOZB 4X64T 2CCQA 4BAYB 4PK6A 2J1DG 3PTRB 3N2KE 2XQ4A 4AISA 3P7IA 3DTOA 2V1DB 2CPTA 4YJ3E 3RYIE 4HTEA 3RC8A 3KFWX 3RIUA 4WZXA 2CXFA 3KVAA 4HWHA 4Z91A 4YHHT 1Z0PA 3WAJA 3PURA 1MIWA 3O4XE 3UFGA 2WAUA 1D1CA 3PUVF 5J0ZA 3F31A 3ESLA 3TLSA 2Q9QB 4X5TA 1FMWA 2MBGA 3ZT7A 5ADXL 2X9YA 2W63A 2DWKA 4ANJA 1IBMT 2D0TA 4YFSA 2YKSA 3P4SA 4GK5E 5L3DB 1IBKT 2I6HA 2WCAA 1U4QA 2BKOA 2Y8DA 3AXJB 3T8OA 3UU3A 4ASKA 5KMGP 2VQFT 3AECA 2BZBA 4UV8B 4B3MT 3RYHE 3O9XA 5LA6E 1N32T 4HKAA 3PUSA 4IDOA 5HWYA 1WCRA 4CZZB 5AQIB 1Y64B 3LK42 2CLYC 1WRDA 3NRYA 2WMNA 1LVKA 2V6XA 2VKDA 5HXCA 4QXHB 4HWFA 3BQIA 3KV6A 2BG9C 3RKGA 1MNEA 3CX8B 4KHPT 2WB5A 4JEHB 4I43B 2KXPB 2IW5B 4CN6A 2UUCT 1XNQT 3U3IA 1CUNA 2E2AA 1YQ3A 3VR9A 4YSYA 5LMNT 2ZM2A 3IHRA 3QNUA 3D0TA 5IYZE 2D2SA 3QB5K 3SWHA 2JMHA 2WSSV 4DV7T 3K3QC 3QK6A 2XAQB 4H9PC 4HFHA 4IDNA 4QX8B 4U31A 3ZMVB 3CQCB 2K9AA 1WLXA 4QXCB 4LF8T 1XNRT 3KINB 2BS2A 2CM0A 4U2ZA 1XDPA 2HPLA 3N9OA 1BR1A 3AE7A 4DR6T 4IE5A 2VVSA 4YTMA 4IL4A 5ETWA 3G06A 4FI5A 4NIQA 5LBQB 3ZN1B 2Y48B 2E8IA 3R6NA 5JTGA 3ZEFB 3AEFA 1MMDA 3E22E 3WI3A 2E9XD 5JR9C 5LJNA 3ZT5A 3PJAA 1US7B 4TWHA 4DV4T 4NUVA 1J5ET 4K0KT 5H6RB 5L3FB 3L09A 1MNDA 2PBIA 5DJQC 4EV6A 3RC3A 4A97A 2XM1A 5HXRA 2LM9A 1NAFA 2X68A 1NEKA 2Y6XA 5JDHA 2G0UA 3EDVA 4LFCT 2F4VT 4EZHA 1HG2A 3HKCE 2IUBA 5LJMA 3MA9A 3ONXA 2DNXA 5FY7A 4ZHQE 3LBXB 5CA1E 4DV2T 3KVBA 3ABVA 3ZN0B 4ZI3D 2JRKA 4YTPA 1E2AA 3HR0A 1HNZT 4O4HE 2NTXA 3AEGA 1IBLT 5AQFB 4NXMT 3N5LA 3NWIA 2V6YA 3VU7H 2VWAA 1X79A 2FJDA 3FZHB 3ZYLA 3NRXA 3ZKRA 2YDSA 4A98A 4CXXA 3OVUA 5HAXA 3ZLIA 5FNVE 1BR4A 4H9SE 2H7VC 5LB7B 4AQFC 4LF4T 4GKKT 3K3NA 2X9HA 3OYXA 4DR3T 3C4WA 2ACXA 3QB5A 3ZC1A 3ZCJA 1YXRA 4E7ZA 1UX5A 2CEAA 3HKBE 4JEUB 3F2EA 1FIOA 2LOPA 4JI7T 1WR6A 3L3PA 2LRKA 5L2LA 4M1PA 4X65T 3SFDA 4DV3T 1SE7A 5FP3A 3A7MA 5AQRB 3U78A 3ZMZB 2LLYA 4K0UA 3P4RA 4QH4A 3HKDE 3Q5DA 4IE4A 5GONE 3RX6A 1D1AA 2JQKA 2XSAA 2HPJA 4C91A 3Q5WA 5HEUA 5FVLA 2H89A 3P4PA 5AQQB 3AE1A 5F8PA 5FY1A 4ZOLE 1YQ4A 4PFPA 5LG4A 2CLYB 3AE2A 4QH1A 1XMOT 3W15B 2XY8B 3PUAA 3OTOT 2A9UA 2KZ7B 1XMQT 2W62A 3ZMUB 2HHHT 3F57A 5JR9A 4ADZA 2V26A 4JI8T 4B3RT 2EHOC 3LSVA 5AQMB 2WWVA 3TLVA 1VRBA 2OA5A 2QA7A 3CX7B 3LBXA 4A5XA 2ES0A 1E7PA 3ONLC 3P50A 2CHOA 4HFVA 4LF5T 1KNRA 1YW0A 4MFRA 4DBRA 5JRCA 1HFAA 2VB6A 2KWHA 4NXNT 1IAPA 3UU6A 4EYYR 2C5KT 2I0MA 3RIAA 1OEDB 3PUYF 4JI4T 5CB4E 1OEDA 2BKPA 4IDPA 1KNPA 5JDMA 2XZEA 2X51A 4JYAT 3EAMA 2X0HA 1QLBA 2ODUA 5LBMA 4JI2T 4L0RA 5AFUL 3O1IA 2V5DA 3IA3A 1IZNB 2LRLA 4TNWA 5LHHB 2UXNB 2VASA 3NZQA 3UUXB 1HR0T 2JQHA 4H63V 4PJLA 3TLTA 4COFA 2MTQA 3AB3B 3C64A 4ZS3A 1W09A 2XQ9A 4TWDA 2KWIB 1M62A 5LHIB 1HNXT 4JI3T 2A72A 5TAOA 2CA5A 4ILAA 2D0UA 3SFEA 4UVBB 3N9PA 1IJ5A 2PG8A 2XQ5A 3AA7B 4EIWA 2LEHA 2UUAT 1AJ3A 2K5BB 2W67A 3B13A 1UUSA 3TKLB 4QHOA 2FJAA 2DLRA 4P09A 1Z8UA 2BG9B 4Z90A 4AIUA 2PJQA 4OX9T 4MHCA 2NR4A 2RA1A 2Q9QD 3C4ZA
chains in the Genus database with same CATH topology
4EZ4A 2VKHA 2LE8A 5LOVE 2LJLA 3C98B 4X1YE 2IC6A 2X66A 4C90A 4MALA 2C5IT 2N9DA 2EHOA 2NW8A 4UF0B 4ZHQE 2K24A 5FXXA 4PFOA 3IF8B 4HN9A 1LKXA 2C5JA 3P8CD 5HXSA 4ZI3C 5EK2A 3ZJ2A 1E1HB 3H3AA 3ZJ1A 3ZMSB 4AI6A 1D0XA 3GN5B 4EB6E 4BA9A 3QC9A 5JDLA 3MXZA 2NWBA 4TZ4C 1VOMA 2X67A 2XAHB 2LSYA 5J1GA 1ZEEA 1LRZA 2IC9A 3AAAB 3LK2B 4QWNB 4BJNA 2CXDA 4V1Av 4TUYE 4AKRB 2DI4A 2DHRA 2EHOB 4AKIA 3CPZA 4O4LE 5JDFA 3V5SA 3EUHA 3KDSE 4P0BA 3WAKA 4AXPA 3KV9A 3I9WA 2RP4A 2WWUA 3ETUA 3EVYA 5FY0A 3LK3B 3CQXC 5E0OA 5JDGA 5DQVA 4JLEA 5JREA 3K3OA 4I55E 2XHEB 4H9NC 2JMKA 3RPUA 4O4IE 4IIJE 4HGAA 5J2TE 2H3RA 3N9NA 4B6XA 5BMVE 2LSIA 3R84B 4U72A 3SOLA 1S35A 5J2UE 3OBVE 2DCFA 2DWGA 2MOZA 3CQGB 3AVRA 3PUQA 4H9OC 4P0AA 5DQWA 4AQGA 4GK0E 4O8SA 3N9QA 3Q2MA 2CMRA 3AAIA 3C51A 5JDQA 4A56A 4L5GA 2XAFB 2HH7A 2W00A 2YEVC 5HYAA 2X9WA 4OYJA 1BR0A 3FBLA 4UVAB 4IGUA 3UTKA 2LHRA 2X0LB 2W0GA 1G73A 5L3GB 3GWHA 3N9MA 4AKGA 2I59A 2NW9A 3MK7C 4YLHA 1ZHCA 2V7MA 2W61A 3GN5A 4XAXB 1MIVA 4IE5A 2XTLA 5JRCB 1MMAA 3CMLA 1D0ZA 2NW7A 3AAEB 3FHNA 1ZV4X 4QXBB 4X1KE 2N1GA 2NOXA 2YU1A 4L9IA 3I1AA 5JQGE 5CA0E 4N78D 4CI1B 4MBQA 4Z8XA 3E0ZA 2XASB 4J2CA 1NWMX 4ZS2A 3UFEA 3MZKB 3UUMA 4WNKA 2IAKA 2UXXB 2VK9A 1HG5A 2QGSA 2LSKA 5LGNB 5HXEA 4TV8E 1WYCA 2GK9A 5FXZA 4DMWA 1YD8G 2ZLYA 4IE7A 3AA6B 3PUGA 4U74A 3UUNA 1HX8A 3CVRA 3QUJA 4UV9B 1WYBA 2JJ9A 1OXZA 4IDZA 3Q9DA 3VKHA 3OJAA 3VKGA 1T98A 2YINA 3J9X1 2XQYA 3O1JA 3I0OA 1HTJF 3HKEE 4IE6A 2LOSA 2ZMAA 5C8YE 4ZI2D 5LNKA 4EYUA 4O2AE 3E08A 3S4UA 5LXTE 2JPFA 3HI2A 4CI3B 4ILUA 5KDMC 4PW8A 3ZCIA 2NTYA 1HS7A 1MMNA 4HE8A 3RRCA 1EZ3A 3K8PC 4DO0A 2K48A 3KV4A 2LSGA 1SA0E 4GOUA 3PU8A 4UELA 3A5XA 5LYJE 4O2BE 2ZM8A 4F6RC 4YJ2E 2P9BA 2WMOA 3NZPA 4ZI7E 3ZYKA 3ANWA 2CE7A 5DABA 5L3BB 4WBNE 4DNDA 4UVCB 4KP3C 2E9XC 2KMFA 3H37A 5FXWA 4H9QC 3ZMTB 4WBOA 5FYMA 1HF8A 5H6QB 3JC6C 4KMCA 3LJCA 2CXLA 2NP9A 1LVFA 3GMIA 1MMGA 4GYSA 4IE0A 2VL8A 1H7CA 3PE0A 3C50A 3BK9A 2LSJA 3N2OA 5IHYA 5EK3A 4MLKA 3PU3A 3HA4A 4DBQA 3SRZA 5HXHA 4EAHA 5EK4A 2ODVA 4TV9E 1UCUA 3C4XA 3FB2A 3O1HA 1SHZC 4UIGA 2L8KA 4AKLA 3BQKA 2VKJA 3GA8A 3CX6B 4CXWA 3OYZA 4PJNA 5A1LA 5L3EB 2KNDA 3NBXX 3DP7A 3FXEB 3MKDA 3KV5A 5KX5E 3AA0B 2WM9A 3CWZB 4CI2B 3IEEA 4ERRA 1B7TA 4TN7B 4ZI2C 4IHJE 4PK5A 3HL6A 4DMVA 4OFZA 1O3XA 4WW0A 2CWYA 3M65A 3UULA 3RH3A 3ZYMA 5JVDE 4PJMA 2BDEA 1KK7A 2CWOA 3PDYA 4X20E 3ZC0A 1OWAA 1D1BA 3RRWA 2H7OA 4CXYA 3BQLA 4PAGA 4FJOA 3AVSA 1YKEB 2V7LA 2KLQA 4NUUA 4UF0A 2MYSA 3ANWB 4E7SA 1G8XA 4XZCA 4EXTA 1BR2A 2A2FX 4PJJA 2Z6EA 3MJXA 1U5PA 4GYRA 1KNZA 1FMVA 1S94A 4QKNA 3B57A 3V5UA 2Q9QC 4ISTA 5L3CB 2YK0A 1QUUA 5LHGB 5JR9B 4XBFB 2BVLA 5FMNA 1ZKEA 1QSDA 5HWXA 1UX4A 4BJMA 4JUYA 2A3DA 4KBMB 2SPCA 4O4JE 2V7IA 3IBPA 4H9RC 5LGTB 2BVMA 2M67A 2PFVA 3RYFE 4CQIA 3DJBA 3Q5XA 1MIYA 3RYCE 5LGUB 4UXNB 5LP6E 3RKOA 3KBUA 5FXVA 2XAGB 3ZPOA 4OYKA 2LT3A 3MACA 3JC6D 4YHJA 2KT9A 2V7KA 2KINB 4I50E 4H63H 3SS1A 3LG7A 5EZYE 3I0QA 1D0YA 4I4TE 4G2AA 3I9YA 3LFMA 4KUMB 1FEWA 4GIWA 4AKHA 4G63A 4AQFA 4HEAA 3FXDB 1V9DA 4PNIA 3KBTA 2L9QA 3FBZA 1HCIA 2YU2A 4OHFA 2WBLA 1YKHB 2V7JA 2XUEA 4DVDA 2EHOD 3N2GE 5LCYA 4UEMA 3AA1B 2JQQA 2L3LA 2X9XA 5JH7E 2XAJB 2E9XA 2D5UA 2E9XB 2Q9QA 4PK4A 4QX7B 5M4YA 2LHNA 2B1EA 3EDUA 5JDNA 3VHLA 2C0SA 1IJ6A 4OK0A 3J7Yq 2ZM0A 3N9LA 3UT5E 5F3JA 2N2NA 2VKOA 3OKQA 3ETVA 4TX5A 4X1IE 3CKDA 4ISSA 4EOZB 2CCQA 4BAYB 4PK6A 2J1DG 3PTRB 3N2KE 3P7IA 3DTOA 2V1DB 4YJ3E 3RYIE 3RC8A 4HTEA 3KFWX 2CXFA 3KVAA 1Z0PA 3WAJA 3PURA 1MIWA 3O4XE 2WAUA 1D1CA 3F31A 3ESLA 2Q9QB 1FMWA 2MBGA 5ADXL 2X9YA 2W63A 2DWKA 2D0TA 4YFSA 4GK5E 5L3DB 1U4QA 3T8OA 2Y8DA 4ASKA 5KMGP 4UV8B 2BZBA 3RYHE 3O9XA 5LA6E 4HKAA 3PUSA 5HWYA 4CZZB 1Y64B 3LK42 2CLYC 1WRDA 3NRYA 2WMNA 1LVKA 2VKDA 5HXCA 4QXHB 3BQIA 3KV6A 1MNEA 3CX8B 4JEHB 4I43B 2KXPB 2IW5B 3U3IA 1CUNA 2ZM2A 3IHRA 5IYZE 3D0TA 2D2SA 3SWHA 2JMHA 2WSSV 3K3QC 3QK6A 2XAQB 4H9PC 4QX8B 3ZMVB 4ANJA 3CQCB 2K9AA 1WLXA 4QXCB 3KINB 2CM0A 2HPLA 3N9OA 1BR1A 5ETWA 4FI5A 5LBQB 3ZN1B 2Y48B 2E8IA 3R6NA 3ZEFB 1MMDA 3E22E 3WI3A 2E9XD 5JR9C 5LJNA 1US7B 4NUVA 5H6RB 5L3FB 3L09A 1MNDA 2PBIA 5DJQC 3RC3A 5HXRA 2LM9A 1NAFA 2X68A 2Y6XA 5JDHA 2G0UA 3EDVA 4EZHA 1HG2A 3HKCE 5LJMA 3MA9A 3ONXA 2DNXA 5FY7A 5CA1E 3LBXB 3KVBA 3ZN0B 4ZI3D 2JRKA 3HR0A 4O4HE 2NTXA 3N5LA 3ZYLA 3VU7H 2VWAA 1X79A 4CXXA 3NRXA 5HAXA 3ZLIA 5FNVE 1BR4A 4H9SE 2H7VC 4AQFC 3K3NA 2X9HA 3OYXA 3C4WA 2ACXA 4E7ZA 3ZC1A 3ZCJA 1UX5A 2CEAA 3HKBE 4JEUB 3F2EA 1FIOA 2LOPA 1WR6A 3L3PA 5L2LA 4M1PA 5FP3A 3U78A 3ZMZB 4K0UA 3HKDE 4IE4A 5GONE 3RX6A 1D1AA 2HPJA 4C91A 3Q5WA 5F8PA 5FY1A 4ZOLE 4PFPA 5LG4A 2CLYB 3W15B 3PUAA 2KZ7B 2W62A 3ZMUB 3F57A 5JR9A 4ADZA 2V26A 2EHOC 1VRBA 2OA5A 2QA7A 3CX7B 3LBXA 2ES0A 4HFVA 4MFRA 1YW0A 4DBRA 5JRCA 1HFAA 2VB6A 2KWHA 1IAPA 4EYYR 2C5KT 5CB4E 5JDMA 2X51A 2ODUA 5LBMA 4L0RA 5AFUL 3O1IA 1IZNB 5LHHB 2UXNB 2VASA 3NZQA 3UUXB 4H63V 4PJLA 2MTQA 3AB3B 3C64A 4ZS3A 2KWIB 5LHIB 2A72A 5TAOA 2CA5A 2D0UA 4UVBB 3N9PA 1IJ5A 2PG8A 3AA7B 4EIWA 1AJ3A 2LEHA 2K5BB 3B13A 3TKLB 4QHOA 4P09A 2DLRA 2PJQA 4MHCA 2RA1A 2Q9QD 3C4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2S A; 
#chains in the Genus database with same CATH topology
 2H88 A;  4EZ4 A;  2VKH A;  2LE8 A;  2W66 A;  5LOV E;  4DID B;  2LJL A;  2VUR A;  3C98 B;  4X1Y E;  2MAW A;  2IC6 A;  2FBW A;  2X66 A;  3P4W A;  4C90 A;  4MAL A;  5CJ5 A;  1T8B A;  5AQV B;  3PJA J;  1I6Z A;  2C5I T;  2N9D A;  2EHO A;  2NW8 A;  4UF0 B;  5HEH A;  2K24 A;  3CK6 A;  2BS4 A;  5FXX A;  1Y01 A;  5HCM A;  4PFO A;  4YXD A;  3IF8 B;  4HN9 A;  1LKX A;  2C5J A;  3P8C D;  4ZZB A;  5HXS A;  2J62 A;  4B3S T;  4ZI3 C;  5EK2 A;  3ZJ2 A;  1E1H B;  3H3A A;  3ZJ1 A;  2HN2 A;  3ZMS B;  2WU5 A;  2E5L T;  4AI6 A;  2LM2 A;  1D0X A;  3GN5 B;  4TNV A;  2M6B A;  4BA9 A;  3QC9 A;  4EB6 E;  5JDL A;  3MXZ A;  2NWB A;  4TZ4 C;  1VOM A;  4EGW A;  1N36 T;  2AE9 A;  2X67 A;  3L39 A;  1VCT A;  2XAH B;  4ZZC A;  2LSY A;  5IUX A;  5J1G A;  1ZEE A;  3H3M A;  3K1S A;  1LRZ A;  2IC9 A;  3AAA B;  2BG9 E;  3LK2 B;  1HNW T;  4QWN B;  3X1D A;  2YDR A;  4BJN A;  2CXD A;  4V1A v;  4TUY E;  4YSZ A;  4AKR B;  4HFI A;  2DI4 A;  2DHR A;  2EHO B;  4AKI A;  2UXC T;  3CPZ A;  4IRE A;  4O4L E;  5JDF A;  3V5S A;  3EUH A;  1OED E;  3KDS E;  3OPC A;  4NPP A;  4P0B A;  3KV9 A;  3WAK A;  4AXP A;  3I9W A;  2WDR A;  4DR1 T;  2RP4 A;  2WWU A;  3ETU A;  3EVY A;  5FY0 A;  3LK3 B;  3CQX C;  4DMW A;  3JAF A;  5HCJ A;  5E0O A;  5JDG A;  3M3Z B;  5DQV A;  4JLE A;  3VRB A;  2W2U A;  3RLF F;  5JRE A;  3K3O A;  2YN6 A;  4I55 E;  4WYV A;  2XHE B;  3NVO A;  4H9N C;  2JMK A;  2WP9 A;  4O4I E;  3CIR A;  3RPU A;  2MPK A;  4HGA A;  4IIJ E;  3ZSS A;  2UUB T;  5J2T E;  5AQO B;  2H3R A;  3N9N A;  4B6X A;  5BMV E;  2IDO B;  2LSI A;  3R84 B;  2J4G A;  4U72 A;  1S35 A;  4P1N A;  3OBV E;  5AQP B;  3SOL A;  5J2U E;  4X1K E;  3VR8 A;  2DCF A;  2CRB A;  5IWA T;  2DWG A;  2MOZ A;  2K3W A;  3AVR A;  3CQG B;  3PUQ A;  4H9O C;  5FL1 A;  2KSR A;  4P0A A;  5DQW A;  4DR7 T;  3AE3 A;  4AQG A;  3NKZ A;  4GK0 E;  4DV0 T;  2R6G F;  4DR5 T;  2X0Y A;  4O8S A;  1T7S A;  3N9Q A;  3Q2M A;  2CMR A;  3AAI A;  1N34 T;  3C51 A;  2XJ7 A;  1XZY A;  3EI0 A;  5JDQ A;  4A56 A;  4CN1 A;  1X9B A;  4L5G A;  4YSX A;  2XQ3 A;  3UU8 A;  3UUB A;  2XAF B;  2HH7 A;  2W00 A;  2YEV C;  5ABG A;  2X9W A;  4OYJ A;  5HYA A;  3EAB A;  1BR0 A;  1L0V A;  3FBL A;  3UU5 A;  4UVA B;  1VCS A;  4IGU A;  2XQ6 A;  4JBW F;  2M6I A;  1UUR A;  3EHZ A;  3UTK A;  2LHR A;  2X0L B;  1JNR A;  2W0G A;  4ZXL A;  1G73 A;  5L3G B;  5LMU T;  3GWH A;  3N9M A;  4AKG A;  2I59 A;  2NW9 A;  1ZOY A;  3MK7 C;  4YLH A;  1OED C;  5ABH A;  4I0U A;  1ZHC A;  2V7M A;  2W61 A;  2WY2 A;  3GN5 A;  3Q5E A;  4GKJ T;  4XAX B;  3RQU A;  1MIV A;  2BBJ A;  1R8I A;  2XTL A;  3PUX F;  2BS3 A;  4HFE A;  1MMA A;  1D0Z A;  2IML A;  2NW7 A;  3AAE B;  1ZV4 X;  3CML A;  1XWM A;  3FHN A;  4ILB A;  4QXB B;  2N1G A;  2NOX A;  2YU1 A;  3FZK B;  4L9I A;  2WS3 A;  2XM2 A;  4F8H A;  3I1A A;  5HEJ A;  4U7I A;  5JQG E;  4DV6 T;  4B3T T;  5CA0 E;  3FZL B;  4N78 D;  2IIU A;  4CI1 B;  4MBQ A;  2WDQ A;  4Z8X A;  1DU2 A;  2UXB T;  3AE4 A;  1WR0 A;  2XAS B;  3E0Z A;  3RI5 A;  4J2C A;  1NWM X;  4ZS2 A;  5LG3 A;  3UFE A;  3MZK B;  3UUM A;  4WNK A;  2IAK A;  2UXX B;  1W9R A;  1M7K A;  2VK9 A;  1HG5 A;  2OLT A;  2LSK A;  2QGS A;  3AE8 A;  5LGN B;  5HXE A;  4TV8 E;  4U2Y A;  1WYC A;  2GK9 A;  5FXZ A;  4HWD A;  1YD8 G;  5HEG A;  2V8S V;  2ZLY A;  4IE7 A;  3AA6 B;  3PUG A;  4U74 A;  3UUN A;  1HX8 A;  3CVR A;  2OV9 A;  3P4Q A;  3QUJ A;  4UV9 B;  1WYB A;  2JJ9 A;  3AEA A;  1OXZ A;  4IDZ A;  2DL1 A;  3L8R A;  5F5W A;  3Q9D A;  5L47 A;  4DUZ T;  3VKH A;  2XQA A;  3OJA A;  3VKG A;  1T98 A;  2YIN A;  4LMJ A;  3J9X 1;  2QRX A;  4DV5 T;  2XQY A;  3O1J A;  3I0O A;  1HTJ F;  3HKE E;  4IE6 A;  1CHU A;  2LOS A;  2ZMA A;  5C8Y E;  4ZI2 D;  4CN4 A;  3AE9 A;  3ZST A;  2J47 A;  2V6Y B;  1JNZ A;  2W4X A;  4EYU A;  5CFB A;  5LNK A;  4O2A E;  3E08 A;  3S4U A;  5LXT E;  4U3C A;  2JPF A;  3HI2 A;  4CI3 B;  5BR8 T;  4KI0 F;  4ILU A;  5KDM C;  4PW8 A;  3ZCI A;  2NTY A;  5AQT B;  1MMN A;  1HS7 A;  4HE8 A;  3VRA A;  3RRC A;  1EZ3 A;  3K8P C;  4DO0 A;  2K48 A;  3KV4 A;  2LSG A;  4LF6 T;  1SA0 E;  4GOU A;  3FZM B;  3PU8 A;  2B76 A;  4UEL A;  3A5X A;  5LYJ E;  2WQY A;  2ZM8 A;  4O2B E;  4F6R C;  4KX6 A;  4YJ2 E;  2P9B A;  2WMO A;  3NZP A;  4ZI7 E;  3ZYK A;  4U7Y A;  2WDV A;  3ANW A;  1UK5 A;  3ZT6 A;  5L4E A;  2CE7 A;  5DAB A;  5AQL B;  5L3B B;  4AQY T;  1W0A A;  2CHN A;  4WBN E;  4DND A;  4UVC B;  4KP3 C;  1N33 T;  4UR9 A;  2E9X C;  2KMF A;  3H37 A;  5AQS B;  5FXW A;  4H9Q C;  3ZMT B;  5CGM A;  3A8Y C;  4WBO A;  5FYM A;  1HF8 A;  5H6Q B;  3JC6 C;  4JI0 T;  2ACZ A;  4KMC A;  2XSB A;  2IHR 1;  3LJC A;  3PUZ F;  4JI5 T;  4JI1 T;  2CXL A;  2NP9 A;  1LVF A;  5C2T A;  3GMI A;  1MMG A;  4GYS A;  4Q25 A;  5ABF A;  3UQ7 A;  4IE0 A;  4LF7 T;  2VL8 A;  1H7C A;  2BBH A;  3PE0 A;  3C50 A;  2ZM6 T;  4X66 T;  3AED A;  1ZP0 A;  3BK9 A;  2LSJ A;  3N2O A;  3RGL A;  5IHY A;  4HWI B;  4JV5 T;  5EK3 A;  4MLK A;  3PU3 A;  3HA4 A;  4DBQ A;  2XQ8 A;  3SRZ A;  5HXH A;  5L4H A;  4EAH A;  3RIU C;  5EK4 A;  4LMK A;  3JAE A;  2ODV A;  4TV9 E;  1KFY A;  1UCU A;  2JIW A;  2VL0 A;  3C4X A;  3FB2 A;  3O1H A;  1SHZ C;  4IDQ A;  4UIG A;  2L8K A;  3RHW A;  1SUM B;  3BQK A;  2VKJ A;  3GA8 A;  3CX6 B;  3JCF A;  3OYZ A;  4PJN A;  4AKL A;  4CXW A;  2V5C A;  5A1L A;  5L3E B;  2KND A;  3NBX X;  3DP7 A;  3FXE B;  2VVN A;  3MKD A;  4QH5 A;  3KV5 A;  5KX5 E;  3AA0 B;  2WM9 A;  3CWZ B;  3UU4 A;  5ABF B;  4LFB T;  1GQE A;  4HFD A;  4CI2 B;  1T72 A;  3IEE A;  1KF6 A;  5AQH B;  4ERR A;  1B7T A;  4LFA T;  4TN7 B;  4ZI2 C;  4IHJ E;  1NEN A;  2D9D A;  5AQN B;  3RQW A;  4PK5 A;  3HL6 A;  3UQ4 A;  1W0B A;  4DMV A;  4OFZ A;  1O3X A;  4WW0 A;  2CWY A;  3M65 A;  3UUL A;  3RH3 A;  3ZYM A;  5JVD E;  4TWF A;  4PJM A;  4DUY T;  3TLW A;  2BDE A;  1KK7 A;  2CWO A;  3PDY A;  4X20 E;  3TLU A;  3ZC0 A;  1OWA A;  1D1B A;  3RRW A;  2H7O A;  4CXY A;  3BQL A;  4HWC A;  4PAG A;  4FJO A;  3AVS A;  3AEE A;  1YKE B;  2V7L A;  2KLQ A;  4NUU A;  4UF0 A;  5KXJ A;  5LGT B;  2MYS A;  3JAD A;  3ONJ A;  3T1H T;  2PTF A;  1WFD A;  3ANW B;  1G8X A;  3PV0 F;  4E7S A;  4DR2 T;  4XZC A;  4EXT A;  1BR2 A;  2A2F X;  4PJJ A;  2Z6E A;  3MJX A;  1U5P A;  4GYR A;  2VQE T;  1KNZ A;  1FMV A;  1S94 A;  3AE5 A;  3B57 A;  4QKN A;  3V5U A;  2Q9Q C;  4KHZ F;  4IST A;  5L3C B;  4DR4 T;  2YK0 A;  5ABE A;  1QUU A;  5LHG B;  5JR9 B;  4XBF B;  2BVL A;  1J1J A;  3RIF A;  5FMN A;  1ZKE A;  1QSD A;  5HWX A;  1UX4 A;  4BJM A;  3AE6 A;  4JUY A;  2QVA A;  3AEB A;  2A3D A;  4KBM B;  5JRC B;  2SPC A;  5AQJ B;  4O4J E;  2QYW A;  2V7I A;  4EED A;  1KEY A;  3B5M A;  3IBP A;  4H9R C;  2AXD S;  4YTN A;  3AXJ A;  2BVM A;  2M67 A;  2PFV A;  3RYF E;  4CQI A;  3DJB A;  3Q5X A;  1MIY A;  3RYC E;  5LGU B;  4UXN B;  5LP6 E;  3RKO A;  4LF9 T;  3KBU A;  5FXV A;  2XAG B;  3ZPO A;  2JQ9 A;  4OYK A;  4ZEY A;  2LT3 A;  2YDQ A;  3MAC A;  3JC6 D;  4YHJ A;  4JI6 T;  2WU2 A;  2KT9 A;  2V7K A;  1HX1 B;  2KIN B;  2YOE A;  4I50 E;  4H63 H;  3SS1 A;  3LG7 A;  5EZY E;  5C3J A;  3I0Q A;  2CBI A;  1D0Y A;  2E5V A;  2LKG A;  4I4T E;  4EEB A;  4G2A A;  3I9Y A;  3LFM A;  4HFB A;  4HFC A;  2LKH A;  4IT4 A;  4KUM B;  1FEW A;  4GIW A;  3RF1 A;  2RPA A;  3PUW F;  4G63 A;  5AQU B;  4AKH A;  4ILC A;  4U33 A;  4HEA A;  4AQF A;  2UXD T;  3FXD B;  1V9D A;  1I94 T;  1XDO A;  3KBT A;  4PNI A;  2L9Q A;  3FBZ A;  1HCI A;  2YU2 A;  4OHF A;  2WBL A;  1YKH B;  5FKY A;  2V7J A;  2XUE A;  4DV1 T;  5FL0 A;  4DVD A;  2FJB A;  2EHO D;  3N2G E;  5FVK A;  2FJE A;  2HN1 A;  5AQK B;  5LCY A;  4UEM A;  3AA1 B;  2JQQ A;  2BKN A;  2CBJ A;  2L3L A;  2X9X A;  2BG9 A;  2WZH A;  3LDQ B;  2WZI A;  2XAJ B;  5JH7 E;  2E9X A;  2D5U A;  3FZF B;  2FUP A;  2E9X B;  2UU9 T;  2Q9Q A;  4PK4 A;  4QX7 B;  5M4Y A;  4LML A;  2LHN A;  2B1E A;  3EDU A;  5JDN A;  1FJG T;  2XQ7 A;  3QOF A;  2C0S A;  3VHL A;  1IJ6 A;  4OK0 A;  4YY3 T;  4IL9 A;  1J5W A;  4X62 T;  3J7Y q;  2ZM0 A;  3N9L A;  2XPK A;  3UT5 E;  5F3J A;  2N2N A;  2VKO A;  3OKQ A;  3ETV A;  4TX5 A;  4X1I E;  5AQG B;  3T1Y T;  1UGO A;  3CKD A;  4YT0 A;  5HEO A;  4ISS A;  4EOZ B;  4X64 T;  2CCQ A;  4BAY B;  4PK6 A;  2J1D G;  3PTR B;  3N2K E;  2XQ4 A;  4AIS A;  3P7I A;  3DTO A;  2V1D B;  2CPT A;  4YJ3 E;  3RYI E;  4HTE A;  3RC8 A;  3KFW X;  3RIU A;  4WZX A;  2CXF A;  3KVA A;  4HWH A;  4Z91 A;  4YHH T;  1Z0P A;  3WAJ A;  3PUR A;  1MIW A;  3O4X E;  3UFG A;  2WAU A;  1D1C A;  3PUV F;  5J0Z A;  3F31 A;  3ESL A;  3TLS A;  2Q9Q B;  4X5T A;  1FMW A;  2MBG A;  3ZT7 A;  5ADX L;  2X9Y A;  2W63 A;  2DWK A;  4ANJ A;  1IBM T;  2D0T A;  4YFS A;  2YKS A;  3P4S A;  4GK5 E;  5L3D B;  1IBK T;  2I6H A;  2WCA A;  1U4Q A;  2BKO A;  2Y8D A;  3AXJ B;  3T8O A;  3UU3 A;  4ASK A;  5KMG P;  2VQF T;  3AEC A;  2BZB A;  4UV8 B;  4B3M T;  3RYH E;  3O9X A;  5LA6 E;  1N32 T;  4HKA A;  3PUS A;  4IDO A;  5HWY A;  1WCR A;  4CZZ B;  5AQI B;  1Y64 B;  3LK4 2;  2CLY C;  1WRD A;  3NRY A;  2WMN A;  1LVK A;  2V6X A;  2VKD A;  5HXC A;  4QXH B;  4HWF A;  3BQI A;  3KV6 A;  2BG9 C;  3RKG A;  1MNE A;  3CX8 B;  4KHP T;  2WB5 A;  4JEH B;  4I43 B;  2KXP B;  2IW5 B;  4CN6 A;  2UUC T;  1XNQ T;  3U3I A;  1CUN A;  2E2A A;  1YQ3 A;  3VR9 A;  4YSY A;  5LMN T;  2ZM2 A;  3IHR A;  3QNU A;  3D0T A;  5IYZ E;  2D2S A;  3QB5 K;  3SWH A;  2JMH A;  2WSS V;  4DV7 T;  3K3Q C;  3QK6 A;  2XAQ B;  4H9P C;  4HFH A;  4IDN A;  4QX8 B;  4U31 A;  3ZMV B;  3CQC B;  2K9A A;  1WLX A;  4QXC B;  4LF8 T;  1XNR T;  3KIN B;  2BS2 A;  2CM0 A;  4U2Z A;  1XDP A;  2HPL A;  3N9O A;  1BR1 A;  3AE7 A;  4DR6 T;  4IE5 A;  2VVS A;  4YTM A;  4IL4 A;  5ETW A;  3G06 A;  4FI5 A;  4NIQ A;  5LBQ B;  3ZN1 B;  2Y48 B;  2E8I A;  3R6N A;  5JTG A;  3ZEF B;  3AEF A;  1MMD A;  3E22 E;  3WI3 A;  2E9X D;  5JR9 C;  5LJN A;  3ZT5 A;  3PJA A;  1US7 B;  4TWH A;  4DV4 T;  4NUV A;  1J5E T;  4K0K T;  5H6R B;  5L3F B;  3L09 A;  1MND A;  2PBI A;  5DJQ C;  4EV6 A;  3RC3 A;  4A97 A;  2XM1 A;  5HXR A;  2LM9 A;  1NAF A;  2X68 A;  1NEK A;  2Y6X A;  5JDH A;  2G0U A;  3EDV A;  4LFC T;  2F4V T;  4EZH A;  1HG2 A;  3HKC E;  2IUB A;  5LJM A;  3MA9 A;  3ONX A;  2DNX A;  5FY7 A;  4ZHQ E;  3LBX B;  5CA1 E;  4DV2 T;  3KVB A;  3ABV A;  3ZN0 B;  4ZI3 D;  2JRK A;  4YTP A;  1E2A A;  3HR0 A;  1HNZ T;  4O4H E;  2NTX A;  3AEG A;  1IBL T;  5AQF B;  4NXM T;  3N5L A;  3NWI A;  2V6Y A;  3VU7 H;  2VWA A;  1X79 A;  2FJD A;  3FZH B;  3ZYL A;  3NRX A;  3ZKR A;  2YDS A;  4A98 A;  4CXX A;  3OVU A;  5HAX A;  3ZLI A;  5FNV E;  1BR4 A;  4H9S E;  2H7V C;  5LB7 B;  4AQF C;  4LF4 T;  4GKK T;  3K3N A;  2X9H A;  3OYX A;  4DR3 T;  3C4W A;  2ACX A;  3QB5 A;  3ZC1 A;  3ZCJ A;  1YXR A;  4E7Z A;  1UX5 A;  2CEA A;  3HKB E;  4JEU B;  3F2E A;  1FIO A;  2LOP A;  4JI7 T;  1WR6 A;  3L3P A;  2LRK A;  5L2L A;  4M1P A;  4X65 T;  3SFD A;  4DV3 T;  1SE7 A;  5FP3 A;  3A7M A;  5AQR B;  3U78 A;  3ZMZ B;  2LLY A;  4K0U A;  3P4R A;  4QH4 A;  3HKD E;  3Q5D A;  4IE4 A;  5GON E;  3RX6 A;  1D1A A;  2JQK A;  2XSA A;  2HPJ A;  4C91 A;  3Q5W A;  5HEU A;  5FVL A;  2H89 A;  3P4P A;  5AQQ B;  3AE1 A;  5F8P A;  5FY1 A;  4ZOL E;  1YQ4 A;  4PFP A;  5LG4 A;  2CLY B;  3AE2 A;  4QH1 A;  1XMO T;  3W15 B;  2XY8 B;  3PUA A;  3OTO T;  2A9U A;  2KZ7 B;  1XMQ T;  2W62 A;  3ZMU B;  2HHH T;  3F57 A;  5JR9 A;  4ADZ A;  2V26 A;  4JI8 T;  4B3R T;  2EHO C;  3LSV A;  5AQM B;  2WWV A;  3TLV A;  1VRB A;  2OA5 A;  2QA7 A;  3CX7 B;  3LBX A;  4A5X A;  2ES0 A;  1E7P A;  3ONL C;  3P50 A;  2CHO A;  4HFV A;  4LF5 T;  1KNR A;  1YW0 A;  4MFR A;  4DBR A;  5JRC A;  1HFA A;  2VB6 A;  2KWH A;  4NXN T;  1IAP A;  3UU6 A;  4EYY R;  2C5K T;  2I0M A;  3RIA A;  1OED B;  3PUY F;  4JI4 T;  5CB4 E;  1OED A;  2BKP A;  4IDP A;  1KNP A;  5JDM A;  2XZE A;  2X51 A;  4JYA T;  3EAM A;  2X0H A;  1QLB A;  2ODU A;  5LBM A;  4JI2 T;  4L0R A;  5AFU L;  3O1I A;  2V5D A;  3IA3 A;  1IZN B;  2LRL A;  4TNW A;  5LHH B;  2UXN B;  2VAS A;  3NZQ A;  3UUX B;  1HR0 T;  2JQH A;  4H63 V;  4PJL A;  3TLT A;  4COF A;  2MTQ A;  3AB3 B;  3C64 A;  4ZS3 A;  1W09 A;  2XQ9 A;  4TWD A;  2KWI B;  1M62 A;  5LHI B;  1HNX T;  4JI3 T;  2A72 A;  5TAO A;  2CA5 A;  4ILA A;  2D0U A;  3SFE A;  4UVB B;  3N9P A;  1IJ5 A;  2PG8 A;  2XQ5 A;  3AA7 B;  4EIW A;  2LEH A;  2UUA T;  1AJ3 A;  2K5B B;  2W67 A;  3B13 A;  1UUS A;  3TKL B;  4QHO A;  2FJA A;  2DLR A;  4P09 A;  1Z8U A;  2BG9 B;  4Z90 A;  4AIU A;  2PJQ A;  4OX9 T;  4MHC A;  2NR4 A;  2RA1 A;  2Q9Q D;  3C4Z A; 
#chains in the Genus database with same CATH homology
 4EZ4 A;  2VKH A;  2LE8 A;  5LOV E;  2LJL A;  3C98 B;  4X1Y E;  2IC6 A;  2X66 A;  4C90 A;  4MAL A;  2C5I T;  2N9D A;  2EHO A;  2NW8 A;  4UF0 B;  4ZHQ E;  2K24 A;  5FXX A;  4PFO A;  3IF8 B;  4HN9 A;  1LKX A;  2C5J A;  3P8C D;  5HXS A;  4ZI3 C;  5EK2 A;  3ZJ2 A;  1E1H B;  3H3A A;  3ZJ1 A;  3ZMS B;  4AI6 A;  1D0X A;  3GN5 B;  4EB6 E;  4BA9 A;  3QC9 A;  5JDL A;  3MXZ A;  2NWB A;  4TZ4 C;  1VOM A;  2X67 A;  2XAH B;  2LSY A;  5J1G A;  1ZEE A;  1LRZ A;  2IC9 A;  3AAA B;  3LK2 B;  4QWN B;  4BJN A;  2CXD A;  4V1A v;  4TUY E;  4AKR B;  2DI4 A;  2DHR A;  2EHO B;  4AKI A;  3CPZ A;  4O4L E;  5JDF A;  3V5S A;  3EUH A;  3KDS E;  4P0B A;  3WAK A;  4AXP A;  3KV9 A;  3I9W A;  2RP4 A;  2WWU A;  3ETU A;  3EVY A;  5FY0 A;  3LK3 B;  3CQX C;  5E0O A;  5JDG A;  5DQV A;  4JLE A;  5JRE A;  3K3O A;  4I55 E;  2XHE B;  4H9N C;  2JMK A;  3RPU A;  4O4I E;  4IIJ E;  4HGA A;  5J2T E;  2H3R A;  3N9N A;  4B6X A;  5BMV E;  2LSI A;  3R84 B;  4U72 A;  3SOL A;  1S35 A;  5J2U E;  3OBV E;  2DCF A;  2DWG A;  2MOZ A;  3CQG B;  3AVR A;  3PUQ A;  4H9O C;  4P0A A;  5DQW A;  4AQG A;  4GK0 E;  4O8S A;  3N9Q A;  3Q2M A;  2CMR A;  3AAI A;  3C51 A;  5JDQ A;  4A56 A;  4L5G A;  2XAF B;  2HH7 A;  2W00 A;  2YEV C;  5HYA A;  2X9W A;  4OYJ A;  1BR0 A;  3FBL A;  4UVA B;  4IGU A;  3UTK A;  2LHR A;  2X0L B;  2W0G A;  1G73 A;  5L3G B;  3GWH A;  3N9M A;  4AKG A;  2I59 A;  2NW9 A;  3MK7 C;  4YLH A;  1ZHC A;  2V7M A;  2W61 A;  3GN5 A;  4XAX B;  1MIV A;  4IE5 A;  2XTL A;  5JRC B;  1MMA A;  3CML A;  1D0Z A;  2NW7 A;  3AAE B;  3FHN A;  1ZV4 X;  4QXB B;  4X1K E;  2N1G A;  2NOX A;  2YU1 A;  4L9I A;  3I1A A;  5JQG E;  5CA0 E;  4N78 D;  4CI1 B;  4MBQ A;  4Z8X A;  3E0Z A;  2XAS B;  4J2C A;  1NWM X;  4ZS2 A;  3UFE A;  3MZK B;  3UUM A;  4WNK A;  2IAK A;  2UXX B;  2VK9 A;  1HG5 A;  2QGS A;  2LSK A;  5LGN B;  5HXE A;  4TV8 E;  1WYC A;  2GK9 A;  5FXZ A;  4DMW A;  1YD8 G;  2ZLY A;  4IE7 A;  3AA6 B;  3PUG A;  4U74 A;  3UUN A;  1HX8 A;  3CVR A;  3QUJ A;  4UV9 B;  1WYB A;  2JJ9 A;  1OXZ A;  4IDZ A;  3Q9D A;  3VKH A;  3OJA A;  3VKG A;  1T98 A;  2YIN A;  3J9X 1;  2XQY A;  3O1J A;  3I0O A;  1HTJ F;  3HKE E;  4IE6 A;  2LOS A;  2ZMA A;  5C8Y E;  4ZI2 D;  5LNK A;  4EYU A;  4O2A E;  3E08 A;  3S4U A;  5LXT E;  2JPF A;  3HI2 A;  4CI3 B;  4ILU A;  5KDM C;  4PW8 A;  3ZCI A;  2NTY A;  1HS7 A;  1MMN A;  4HE8 A;  3RRC A;  1EZ3 A;  3K8P C;  4DO0 A;  2K48 A;  3KV4 A;  2LSG A;  1SA0 E;  4GOU A;  3PU8 A;  4UEL A;  3A5X A;  5LYJ E;  4O2B E;  2ZM8 A;  4F6R C;  4YJ2 E;  2P9B A;  2WMO A;  3NZP A;  4ZI7 E;  3ZYK A;  3ANW A;  2CE7 A;  5DAB A;  5L3B B;  4WBN E;  4DND A;  4UVC B;  4KP3 C;  2E9X C;  2KMF A;  3H37 A;  5FXW A;  4H9Q C;  3ZMT B;  4WBO A;  5FYM A;  1HF8 A;  5H6Q B;  3JC6 C;  4KMC A;  3LJC A;  2CXL A;  2NP9 A;  1LVF A;  3GMI A;  1MMG A;  4GYS A;  4IE0 A;  2VL8 A;  1H7C A;  3PE0 A;  3C50 A;  3BK9 A;  2LSJ A;  3N2O A;  5IHY A;  5EK3 A;  4MLK A;  3PU3 A;  3HA4 A;  4DBQ A;  3SRZ A;  5HXH A;  4EAH A;  5EK4 A;  2ODV A;  4TV9 E;  1UCU A;  3C4X A;  3FB2 A;  3O1H A;  1SHZ C;  4UIG A;  2L8K A;  4AKL A;  3BQK A;  2VKJ A;  3GA8 A;  3CX6 B;  4CXW A;  3OYZ A;  4PJN A;  5A1L A;  5L3E B;  2KND A;  3NBX X;  3DP7 A;  3FXE B;  3MKD A;  3KV5 A;  5KX5 E;  3AA0 B;  2WM9 A;  3CWZ B;  4CI2 B;  3IEE A;  4ERR A;  1B7T A;  4TN7 B;  4ZI2 C;  4IHJ E;  4PK5 A;  3HL6 A;  4DMV A;  4OFZ A;  1O3X A;  4WW0 A;  2CWY A;  3M65 A;  3UUL A;  3RH3 A;  3ZYM A;  5JVD E;  4PJM A;  2BDE A;  1KK7 A;  2CWO A;  3PDY A;  4X20 E;  3ZC0 A;  1OWA A;  1D1B A;  3RRW A;  2H7O A;  4CXY A;  3BQL A;  4PAG A;  4FJO A;  3AVS A;  1YKE B;  2V7L A;  2KLQ A;  4NUU A;  4UF0 A;  2MYS A;  3ANW B;  4E7S A;  1G8X A;  4XZC A;  4EXT A;  1BR2 A;  2A2F X;  4PJJ A;  2Z6E A;  3MJX A;  1U5P A;  4GYR A;  1KNZ A;  1FMV A;  1S94 A;  4QKN A;  3B57 A;  3V5U A;  2Q9Q C;  4IST A;  5L3C B;  2YK0 A;  1QUU A;  5LHG B;  5JR9 B;  4XBF B;  2BVL A;  5FMN A;  1ZKE A;  1QSD A;  5HWX A;  1UX4 A;  4BJM A;  4JUY A;  2A3D A;  4KBM B;  2SPC A;  4O4J E;  2V7I A;  3IBP A;  4H9R C;  5LGT B;  2BVM A;  2M67 A;  2PFV A;  3RYF E;  4CQI A;  3DJB A;  3Q5X A;  1MIY A;  3RYC E;  5LGU B;  4UXN B;  5LP6 E;  3RKO A;  3KBU A;  5FXV A;  2XAG B;  3ZPO A;  4OYK A;  2LT3 A;  3MAC A;  3JC6 D;  4YHJ A;  2KT9 A;  2V7K A;  2KIN B;  4I50 E;  4H63 H;  3SS1 A;  3LG7 A;  5EZY E;  3I0Q A;  1D0Y A;  4I4T E;  4G2A A;  3I9Y A;  3LFM A;  4KUM B;  1FEW A;  4GIW A;  4AKH A;  4G63 A;  4AQF A;  4HEA A;  3FXD B;  1V9D A;  4PNI A;  3KBT A;  2L9Q A;  3FBZ A;  1HCI A;  2YU2 A;  4OHF A;  2WBL A;  1YKH B;  2V7J A;  2XUE A;  4DVD A;  2EHO D;  3N2G E;  5LCY A;  4UEM A;  3AA1 B;  2JQQ A;  2L3L A;  2X9X A;  5JH7 E;  2XAJ B;  2E9X A;  2D5U A;  2E9X B;  2Q9Q A;  4PK4 A;  4QX7 B;  5M4Y A;  2LHN A;  2B1E A;  3EDU A;  5JDN A;  3VHL A;  2C0S A;  1IJ6 A;  4OK0 A;  3J7Y q;  2ZM0 A;  3N9L A;  3UT5 E;  5F3J A;  2N2N A;  2VKO A;  3OKQ A;  3ETV A;  4TX5 A;  4X1I E;  3CKD A;  4ISS A;  4EOZ B;  2CCQ A;  4BAY B;  4PK6 A;  2J1D G;  3PTR B;  3N2K E;  3P7I A;  3DTO A;  2V1D B;  4YJ3 E;  3RYI E;  3RC8 A;  4HTE A;  3KFW X;  2CXF A;  3KVA A;  1Z0P A;  3WAJ A;  3PUR A;  1MIW A;  3O4X E;  2WAU A;  1D1C A;  3F31 A;  3ESL A;  2Q9Q B;  1FMW A;  2MBG A;  5ADX L;  2X9Y A;  2W63 A;  2DWK A;  2D0T A;  4YFS A;  4GK5 E;  5L3D B;  1U4Q A;  3T8O A;  2Y8D A;  4ASK A;  5KMG P;  4UV8 B;  2BZB A;  3RYH E;  3O9X A;  5LA6 E;  4HKA A;  3PUS A;  5HWY A;  4CZZ B;  1Y64 B;  3LK4 2;  2CLY C;  1WRD A;  3NRY A;  2WMN A;  1LVK A;  2VKD A;  5HXC A;  4QXH B;  3BQI A;  3KV6 A;  1MNE A;  3CX8 B;  4JEH B;  4I43 B;  2KXP B;  2IW5 B;  3U3I A;  1CUN A;  2ZM2 A;  3IHR A;  5IYZ E;  3D0T A;  2D2S A;  3SWH A;  2JMH A;  2WSS V;  3K3Q C;  3QK6 A;  2XAQ B;  4H9P C;  4QX8 B;  3ZMV B;  4ANJ A;  3CQC B;  2K9A A;  1WLX A;  4QXC B;  3KIN B;  2CM0 A;  2HPL A;  3N9O A;  1BR1 A;  5ETW A;  4FI5 A;  5LBQ B;  3ZN1 B;  2Y48 B;  2E8I A;  3R6N A;  3ZEF B;  1MMD A;  3E22 E;  3WI3 A;  2E9X D;  5JR9 C;  5LJN A;  1US7 B;  4NUV A;  5H6R B;  5L3F B;  3L09 A;  1MND A;  2PBI A;  5DJQ C;  3RC3 A;  5HXR A;  2LM9 A;  1NAF A;  2X68 A;  2Y6X A;  5JDH A;  2G0U A;  3EDV A;  4EZH A;  1HG2 A;  3HKC E;  5LJM A;  3MA9 A;  3ONX A;  2DNX A;  5FY7 A;  5CA1 E;  3LBX B;  3KVB A;  3ZN0 B;  4ZI3 D;  2JRK A;  3HR0 A;  4O4H E;  2NTX A;  3N5L A;  3ZYL A;  3VU7 H;  2VWA A;  1X79 A;  4CXX A;  3NRX A;  5HAX A;  3ZLI A;  5FNV E;  1BR4 A;  4H9S E;  2H7V C;  4AQF C;  3K3N A;  2X9H A;  3OYX A;  3C4W A;  2ACX A;  4E7Z A;  3ZC1 A;  3ZCJ A;  1UX5 A;  2CEA A;  3HKB E;  4JEU B;  3F2E A;  1FIO A;  2LOP A;  1WR6 A;  3L3P A;  5L2L A;  4M1P A;  5FP3 A;  3U78 A;  3ZMZ B;  4K0U A;  3HKD E;  4IE4 A;  5GON E;  3RX6 A;  1D1A A;  2HPJ A;  4C91 A;  3Q5W A;  5F8P A;  5FY1 A;  4ZOL E;  4PFP A;  5LG4 A;  2CLY B;  3W15 B;  3PUA A;  2KZ7 B;  2W62 A;  3ZMU B;  3F57 A;  5JR9 A;  4ADZ A;  2V26 A;  2EHO C;  1VRB A;  2OA5 A;  2QA7 A;  3CX7 B;  3LBX A;  2ES0 A;  4HFV A;  4MFR A;  1YW0 A;  4DBR A;  5JRC A;  1HFA A;  2VB6 A;  2KWH A;  1IAP A;  4EYY R;  2C5K T;  5CB4 E;  5JDM A;  2X51 A;  2ODU A;  5LBM A;  4L0R A;  5AFU L;  3O1I A;  1IZN B;  5LHH B;  2UXN B;  2VAS A;  3NZQ A;  3UUX B;  4H63 V;  4PJL A;  2MTQ A;  3AB3 B;  3C64 A;  4ZS3 A;  2KWI B;  5LHI B;  2A72 A;  5TAO A;  2CA5 A;  2D0U A;  4UVB B;  3N9P A;  1IJ5 A;  2PG8 A;  3AA7 B;  4EIW A;  1AJ3 A;  2LEH A;  2K5B B;  3B13 A;  3TKL B;  4QHO A;  4P09 A;  2DLR A;  2PJQ A;  4MHC A;  2RA1 A;  2Q9Q D;  3C4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...