2D2SA

Crystal structure of the exo84p c-terminal domains
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
229
structure length
217
Chain Sequence
DMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSLMLLNLISLKIEQRREAISSKLSQSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIVDNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNLSPGSIKSSRKQIDGLKAVGLDFVYKLDEFIKKNSDKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The structures of exocyst subunit Exo70p and the Exo84p C-terminal domains reveal a common motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
molecule keywords Exocyst complex component EXO84
total genus 91
structure length 217
sequence length 229
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16528 Exo84_C Exocyst component 84 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA01
1.20.58.1220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA02
2D2SA
chains in the Genus database with same CATH superfamily
5JRCA 5DQVA 2B76A 2VB6A 2EHOD 2LE8A 4O8SA 5LHHB 4GYSA 2KSRA 1YD8G 2PFVA 3G06A 4HFEA 4DV5T 3CQGB 5FP3A 4LF5T 4HWCA 4ZXLA 2DWKA 2IW5B 3RIUC 2CCQA 3U3IA 1OEDB 1HX1B 3C64A 1MMDA 3OJAA 4YSYA 3KBTA 1YKEB 2X68A 3AE5A 2OLTA 4O2AE 3AA6B 1E7PA 2V7JA 3OYXA 4GK5E 3SOLA 5ABGA 4AIUA 3EDVA 4GKKT 3PJAA 3I0OA 1KNZA 4IE7A 5H6RB 2W63A 1LVKA 3ZCIA 4L5GA 2Y6XA 5L47A 2J1DG 3HL6A 3N9QA 5CB4E 3FZFB 1NEKA 3LK3B 4PFPA 2XQ7A 4G63A 4BAYB 4ERRA 1HG2A 4DR6T 3I0QA 5LB7B 1OWAA 2FBWA 4EB6E 4EIWA 4EAHA 5BMVE 2VKDA 3MKDA 5KXJA 1NWMX 3UUMA 3LK2B 2NR4A 2FUPA 2XAJB 4HTEA 1D0XA 4DV3T 4U31A 2JJ9A 4PAGA 2DCFA 1FMVA 2CBIA 3O1HA 1BR4A 2J62A 4J2CA 4QX7B 5LBMA 4YTPA 1HR0T 3ZEFB 3CK6A 4IE0A 1XMQT 2Q9QB 4ZHQE 2V7MA 3PURA 2MAWA 5DQWA 3PU3A 5HEUA 4ISSA 3TLTA 4E7ZA 1M7KA 4EYUA 4QXHB 5JH7E 4CXYA 1UUSA 3AEFA 3C4ZA 1IJ5A 3B5MA 3VRBA 4HWHA 4QHOA 2LM2A 2WWVA 1KF6A 1Z8UA 5J2UE 4JYAT 2VASA 1WCRA 3AA0B 2RPAA 3ONXA 4JI5T 5JDQA 2XJ7A 3ZSTA 4U7IA 5JQGE 1HFAA 2W61A 4LMLA 4DNDA 2NWBA 3RYHE 1YQ4A 4PNIA 1KFYA 4TNVA 2DLRA 2VVNA 4NIQA 3VR9A 3RH3A 4A97A 4JLEA 4LF6T 4I55E 2YDQA 5M4YA 2CHOA 4PK5A 2W66A 3QNUA 4IREA 4HE8A 5AQKB 2XZEA 2BG9C 2SPCA 2BVMA 1WLXA 4UIGA 4X20E 5HCMA 3RC3A 3ZMZB 1UX4A 5JDNA 4EV6A 3O1JA 5LMNT 3PUWF 4PK4A 3FHNA 2WMNA 4QH4A 4COFA 2QRXA 5L4EA 2N1GA 1N33T 5KDMC 1UGOA 1G73A 2W62A 2KMFA 2WDVA 3GMIA 4DV1T 3ANWA 4JBWF 4X65T 1MNDA 2CM0A 3PV0F 2BKPA 4IDPA 5LOVE 5HXSA 1W0AA 1D1BA 2IDOB 4I43B 2JRKA 3EHZA 3K1SA 5FVKA 5HEGA 3ESLA 2XAGB 4DR4T 4HWIB 1HNWT 5H6QB 4KP3C 3R6NA 3UUXB 4C90A 2LT3A 5L2LA 3KDSE 5ABEA 3P4RA 1OEDA 1YW0A 3UU5A 2V6YB 1XZYA 3A5XA 4EXTA 2CWOA 3N9OA 3J9X1 2G0UA 2MBGA 2R6GF 3P4QA 2JMKA 2X9WA 5E0OA 4CN1A 4TNWA 1OEDC 2X9HA 2BKNA 1VCTA 4KMCA 4WW0A 4CXWA 5J0ZA 1BR2A 2M6BA 2WZIA 3JAFA 3L8RA 3H37A 4YJ2E 2QA7A 2PBIA 2RP4A 5HCJA 4DVDA 1X9BA 2BG9B 4JI4T 5LCYA 2VL8A 3ZYKA 2UU9T 4CN4A 2V7IA 2XUEA 2A9UA 4ASKA 5JTGA 3JCFA 1LVFA 1MNEA 1ZP0A 2BZBA 1IJ6A 2D0UA 4MFRA 5AQJB 3UQ4A 1NAFA 4Z91A 2V5CA 5AQTB 3PUSA 3UU4A 2VVSA 1HX8A 1WR0A 3ZC1A 4EGWA 1D1AA 3GN5A 4DBQA 2WBLA 2IC9A 1OXZA 1H7CA 1SHZC 2FJBA 4QXCB 1HTJF 4ZS2A 1MMGA 2XQAA 5CA0E 4WNKA 3L3PA 3ZLIA 4H9NC 4O4HE 2H88A 2CWYA 3OKQA 4X1IE 2BDEA 2LHNA 4BA9A 4ZI3C 3T1HT 3Q9DA 2CHNA 2N9DA 5LG4A 4IDNA 3FXDB 4YFSA 5KX5E 2CEAA 2JQHA 2CA5A 3C4WA 3RKGA 3KV6A 3LSVA 4EEDA 5LMUT 4O4LE 5L4HA 3ZKRA 3VKHA 3O1IA 5FY0A 5HXRA 4X62T 2X9XA 2GK9A 2C0SA 1X79A 2XQ3A 3N5LA 3NWIA 2CXDA 4UELA 3UU6A 3UU8A 4AQFA 4ZI2D 5LHIB 4YHHT 2X67A 5L3GB 2PJQA 2P9BA 2K3WA 2VKHA 4ZOLE 2YKSA 2YOEA 4IE5A 5JDGA 5LGUB 3AE1A 4AKHA 3KVAA 2H7VC 3AE8A 3LBXB 4JI6T 2LEHA 3Q2MA 4ILUA 4HGAA 4JUYA 4UV8B 1N36T 4ZEYA 4P0BA 2CLYB 2IAKA 3O4XE 4YHJA 5LNKA 5JREA 3AAIA 4WZXA 4ZI3D 1YXRA 3CX7B 4KHPT 1AJ3A 3CPZA 1V9DA 1MIVA 1VOMA 3CWZB 3LG7A 4X64T 1KK7A 4YT0A 5F3JA 2BS4A 1E1HB 1XNRT 3CQXC 1ZV4X 3D0TA 5HWXA 4X66T 2ZM6T 3T1YT 2HHHT 2KZ7B 1YQ3A 2UXNB 3QC9A 2ODUA 2W2UA 3GA8A 4UXNB 2WQYA 4PK6A 4DO0A 4YJ3E 4K0KT 4ZI2C 4DUZT 2WP9A 2ZM2A 4GIWA 2XSBA 4YTMA 4TV9E 3HR0A 4DR5T 3KBUA 2XY8B 3ZJ1A 2LSJA 2LHRA 1W09A 3AEEA 3N2KE 4UF0A 1UX5A 2DWGA 1HF8A 1UURA 4ILBA 3WI3A 5HXEA 3RRWA 3PUQA 3RGLA 3LBXA 2A2FX 5AQIB 2EHOA 3ONLC 5FY7A 2WY2A 1E2AA 3AEBA 2CXLA 4TWFA 3UQ7A 4LF9T 2XHEB 2DI4A 4NXNT 2JQ9A 2BS3A 2WCAA 3AVRA 1FEWA 2ZM8A 5JDHA 1WFDA 2V26A 4H9QC 3MA9A 2KT9A 4HWDA 2V7KA 3A7MA 3ZMVB 4KUMB 2XAFB 2JQQA 3Q5XA 3FZMB 4XZCA 3AEAA 1CHUA 4GK0E 2IHR1 5AQUB 3UUBA 5LJMA 4O4IE 4HFVA 4BJMA 4HFCA 2KINB 3P7IA 1O3XA 4CXXA 1IBLT 4DR7T 4NUVA 2BVLA 2E5LT 2L3LA 3MXZA 3AECA 1XDPA 5FXVA 4B3RT 3RRCA 2V5DA 1SE7A 5C2TA 4TZ4C 3UT5E 5EK2A 5JR9B 2B1EA 3NRXA 3SRZA 3K3NA 5FMNA 2WZHA 4EZHA 2IMLA 2LSGA 5HEJA 5HEOA 2BKOA 2K5BB 1L0VA 4MHCA 3ETVA 4AKGA 3VR8A 5AQRB 2XM2A 4TUYE 2VKOA 3TLVA 3KV4A 2NTYA 3EI0A 3F57A 3UFGA 4ISTA 2H7OA 4JI2T 5CJ5A 3CQCB 1N34T 4LF7T 2VK9A 4ZZBA 4PJJA 3ZN1B 3ZT5A 5CA1E 4U72A 4L9IA 5ABFB 4AKIA 3AB3B 1JNRA 4YTNA 3R84B 3TKLB 2YDRA 3C98B 3RLFF 3V5SA 1D0YA 5IWAT 2YU1A 4EYYR 2UXCT 3LFMA 4AQYT 5IUXA 1GQEA 1XMOT 3L39A 3SS1A 3ZMTB 1VRBA 3AXJA 3VKGA 4PJLA 2N2NA 4LF4T 3ZJ2A 3VHLA 1HCIA 4OYKA 2QVAA 3BQKA 5AQVB 3U78A 1IBMT 2I0MA 4WYVA 4LMKA 4ZS3A 2DL1A 2E8IA 3X1DA 3RKOA 2K9AA 2V1DB 3K3QC 5HXHA 5IHYA 4CQIA 4H9PC 2VL0A 2X0YA 3T8OA 5JDMA 3NVOA 2UXDT 3KV5A 1BR0A 3Q5DA 5JR9C 3ZT7A 4YXDA 4ZI7E 4JI3T 1S35A 3TLUA 4OFZA 4QXBB 4OX9T 1WR6A 1NENA 1D1CA 2EHOC 2BBJA 2ZLYA 2X0LB 3K8PC 4U2YA 2HPJA 4ADZA 2IUBA 2NW8A 3AE3A 2Q9QC 3Q5WA 3RIUA 5JVDE 2WU5A 4DR3T 4CI3B 4DV2T 4U33A 2W00A 3P50A 2X66A 1I94T 2XSAA 2ACXA 2Y48B 3I9YA 3PUXF 3CX8B 3RIAA 1WYBA 4MALA 3ZMUB 1IAPA 1U5PA 2PG8A 3IF8B 3P8CD 4XBFB 1ZOYA 5DABA 2UUAT 1FMWA 2VQFT 5AQHB 4WBNE 1MIWA 3N9LA 5C3JA 2D5UA 1HG5A 3RHWA 3ZYMA 4KBMB 3QK6A 4F6RC 2K24A 5AFUL 5C8YE 4AKLA 4DV6T 2NW9A 3ONJA 2FJAA 3UUNA 4V1Av 4B3TT 4GKJT 1J5WA 2WAUA 1QSDA 3JADA 4JEHB 5LP6E 4P09A 4O4JE 3AE2A 3BQLA 2LKGA 5CGMA 1WRDA 2WSSV 4UR9A 3RF1A 2W0GA 4AI6A 4Q25A 4H63V 2WS3A 2ZMAA 2K48A 3CKDA 3E0ZA 2LSYA 2LM9A 1S94A 3N2OA 5DJQC 2D2SA 3AE6A 4KX6A 2KLQA 1FIOA 2C5JA 1YKHB 5L3EB 1OEDE 1XDOA 4UVBB 5L3FB 5FKYA 4IL4A 2NTXA 2Q9QD 5FXZA 2LOPA 5HAXA 3TLSA 3ANWB 1SUMB 4AXPA 3AA7B 3HKBE 3OVUA 3LJCA 4OK0A 4PJMA 2D9DA 4IDZA 5LYJE 3EUHA 5AQMB 5ETWA 4DR1T 4TWHA 2C5IT 5GONE 3ZT6A 4TN7B 2LSKA 3PUAA 3GWHA 4F8HA 1MMAA 1T98A 1KNRA 4I50E 3EAMA 3HKDE 2W4XA 3WAKA 3WAJA 2CLYC 1Z0PA 3N2GE 4DIDB 3IEEA 3ETUA 4JI8T 3KVBA 1T72A 4B3ST 4PJNA 4AQFC 2CMRA 4YSZA 3PUVF 4KI0F 5EK4A 2CBJA 2X9YA 2XAHB 2PTFA 2VQET 2LRLA 3PU8A 3FBLA 3RYIE 3VU7H 5ABHA 1DU2A 4TX5A 2IIUA 1IBKT 1XWMA 3MJXA 4ILAA 3O9XA 2BBHA 4BJNA 5JDFA 3ZC0A 3CMLA 5LGTB 3UULA 2EHOB 2MYSA 3OYZA 2UUBT 2XASB 1MIYA 4B6XA 4YLHA 4DMVA 4E7SA 3ZYLA 1WYCA 3J7Yq 3HKEE 4NPPA 1U4QA 4QH5A 5BR8T 1XNQT 2XQ5A 4QWNB 3HA4A 2AE9A 4HN9A 3ZMSB 4P0AA 2IC6A 2WB5A 2J47A 3NKZA 1W0BA 3AAEB 1FJGT 4DV4T 4H9OC 4HEAA 4LMJA 3CX6B 4GOUA 3PDYA 2KXPB 4HFBA 4MBQA 2V8SV 5KMGP 3IA3A 5J2TE 5LXTE 2UUCT 4NXMT 3UFEA 2L9QA 1M62A 3FZLB 5AQOB 4JEUB 1I6ZA 4IHJE 4A98A 4H9SE 2V6YA 4TV8E 4U3CA 4JI1T 2NW7A 3V5UA 2E2AA 4NUUA 4PFOA 4YY3T 5JDLA 4LF8T 2A72A 3RPUA 2WMOA 1T7SA 5LJNA 3FZKB 2HPLA 3KFWX 3NBXX 3ZSSA 1BR1A 3SFDA 5LG3A 5L3BB 4ANJA 3NRYA 5LHGB 2CXFA 2AXDS 2KWIB 3MZKB 4QX8B 5IYZE 4IT4A 5AQPB 2MOZA 1D0ZA 3CIRA 4LFAT 1US7B 2JQKA 2XQ8A 3Q5EA 4U74A 1UK5A 2V6XA 2ODVA 2WDQA 2QGSA 1W9RA 4IE6A 3RIFA 3ZCJA 4UEMA 2XM1A 2CPTA 4A56A 4EOZB 4IE4A 4U2ZA 2BG9A 2W67A 1N32T 4MLKA 2V7LA 2JIWA 1KNPA 3H3AA 3AA1B 2VKJA 1CUNA 2X0HA 2FJEA 2H89A 4DUYT 5AQGB 1T8BA 1HNXT 4K0UA 3BQIA 3BK9A 3PUGA 4ZZCA 4CN6A 4IGUA 5AQQB 3N9NA 2VWAA 1R8IA 3DJBA 3JAEA 2WWUA 1ZKEA 3EVYA 1SA0E 3I9WA 2NP9A 3MK7C 2X51A 4TWDA 5EK3A 3B57A 4X5TA 4KHZF 1J1JA 2FJDA 2ACZA 2BG9E 1B7TA 2YINA 3E22E 3LK42 3SFEA 3C51A 1LKXA 2LRKA 3DTOA 3RQWA 2E5VA 2ES0A 2E9XB 2QYWA 3E08A 3PUYF 2UXXB 3EDUA 2C5KT 3IHRA 4QH1A 5HXCA 5FY1A 5L3DB 3GN5B 4XAXB 2D0TA 4GYRA 2HN2A 3C50A 4X1KE 3AE7A 3FB2A 1QUUA 4AQGA 4HWFA 1G8XA 3RYCE 3KV9A 5HYAA 3TLWA 2XPKA 2F4VT 3JC6C 3OPCA 1Y64B 2Z6EA 3K3OA 3ABVA 4B3MT 3AEGA 4DR2T 3MACA 3AE4A 3PTRB 2KWHA 4G2AA 4EZ4A 3RYFE 3SWHA 2HH7A 2MPKA 2WM9A 2XQ6A 3AE9A 2XQ4A 5HEHA 3I1AA 5LA6E 2L8KA 3UU3A 5ADXL 2XAQB 3N9PA 2Y8DA 3P4PA 2Q9QA 5LBQB 4C91A 4JV5T 1JNZA 4OHFA 2RA1A 5FYMA 1KEYA 5FXWA 2WDRA 5ABFA 2I59A 4IDQA 3KINB 4LFBT 4FJOA 5L3CB 1HS7A 2LKHA 1LRZA 3CVRA 3RC8A 2J4GA 3OBVE 3S4UA 3ZN0B 3RQUA 3M3ZB 3A8YC 3AVSA 5HWYA 4CI2B 4ILCA 3HI2A 3P4WA 5FL1A 4JI7T 3ZPOA 3H3MA 2UXBT 2KNDA 1MMNA 1EZ3A 4UF0B 4HFDA 2M67A 2YN6A 5F5WA 2OA5A 4UVAB 5EZYE 3AEDA 4IL9A 4I0UA 2LLYA 4H63H 4Z90A 5LGNB 4LFCT 2XQYA 3PJAJ 2WU2A 3QOFA 1Y01A 3B13A 4IDOA 4U7YA 2LOSA 5FNVE 5FXXA 4UV9B 1VCSA 2LSIA 3RI5A 4DV0T 4H9RC 4QKNA 1HNZT 3NZQA 3QB5K 3AAAB 3FXEB 4UVCB 3VRAA 4YSXA 5CFBA 3OTOT 2VURA 4DV7T 4JI0T 4DBRA 1J5ET 4Z8XA 2E9XD 3W15B 5JRCB 5J1GA 2H3RA 4IIJE 4HFIA 4A5XA 2JPFA 3EABA 3JC6D 1QLBA 4AISA 2I6HA 2BS2A 2XQ9A 4HFHA 1UCUA 2CE7A 5TAOA 5FVLA 2NOXA 4P1NA 3NZPA 3PE0A 4FI5A 2DHRA 3FZHB 5AQNB 3C4XA 3FBZA 4I4TE 3HKCE 2M6IA 2HN1A 3M65A 3LDQB 5F8PA 2DNXA 1IZNB 3UTKA 3IBPA 2OV9A 2MTQA 3F2EA 3QB5A 3QUJA 2E9XA 4AKRB 4DMWA 2YDSA 3PUZF 4CZZB 5AQFB 2CRBA 4EEBA 2YU2A 2ZM0A 4PW8A 4HKAA 4X1YE 2JMHA 2YK0A 4OYJA 1ZEEA 4L0RA 3DP7A 4M1PA 2E9XC 4WBOA 5AQSB 5FL0A 3N9MA 2XTLA 1ZHCA 3AXJB 5A1LA 4CI1B 3F31A 4O2BE 3RX6A 5AQLB 2YEVC 3L09A 2LJLA 5JR9A 3P4SA 2A3DA 4N78D
chains in the Genus database with same CATH topology
5JRCA 5DQVA 2VB6A 2EHOD 2LE8A 4O8SA 5LHHB 4GYSA 2PFVA 1YD8G 3CQGB 5FP3A 2DWKA 2IW5B 2CCQA 3U3IA 3C64A 1MMDA 3OJAA 3KBTA 1YKEB 2X68A 4O2AE 3AA6B 2V7JA 3OYXA 4GK5E 3SOLA 3EDVA 3I0OA 4IE7A 5H6RB 2W63A 1LVKA 3ZCIA 4L5GA 2Y6XA 2J1DG 3HL6A 3N9QA 5CB4E 4PFPA 3LK3B 4ERRA 4BAYB 4G63A 1HG2A 3I0QA 1OWAA 4EB6E 4EIWA 4EAHA 5BMVE 2VKDA 3MKDA 1NWMX 3UUMA 3LK2B 2XAJB 4HTEA 1D0XA 2JJ9A 4PAGA 2DCFA 1FMVA 3O1HA 4J2CA 1BR4A 4QX7B 5LBMA 3ZEFB 4IE0A 2Q9QB 4ZHQE 2V7MA 3PURA 5DQWA 5LNKA 3PU3A 4ISSA 4E7ZA 4EYUA 4CXYA 4QXHB 5JH7E 3C4ZA 1IJ5A 5J2UE 4QHOA 2VASA 3AA0B 5KDMC 3ONXA 5JQGE 1HFAA 2W61A 4DNDA 2NWBA 3RYHE 4PNIA 2DLRA 3RH3A 4JLEA 4I55E 5M4YA 4PK5A 4HE8A 4X20E 2SPCA 2BVMA 1WLXA 4UIGA 3RC3A 5JDNA 3ZMZB 1UX4A 3O1JA 4PK4A 3FHNA 2WMNA 2N1GA 1G73A 2W62A 2KMFA 3GMIA 3ANWA 1MNDA 2CM0A 5LOVE 5HXSA 1D1BA 4I43B 2JRKA 3ESLA 2XAGB 5H6QB 4KP3C 3R6NA 3UUXB 4C90A 2LT3A 5L2LA 3KDSE 1YW0A 3A5XA 4EXTA 2CWOA 3N9OA 3J9X1 2G0UA 2MBGA 2JMKA 2X9WA 5E0OA 2X9HA 4CXWA 4KMCA 4WW0A 1BR2A 3H37A 4YJ2E 2QA7A 2PBIA 2RP4A 4DVDA 5LCYA 2VL8A 3ZYKA 2V7IA 2XUEA 4ASKA 1LVFA 1MNEA 2BZBA 2D0UA 1IJ6A 4MFRA 5JDQA 1NAFA 3PUSA 3ZC1A 1HX8A 1D1AA 3GN5A 4DBQA 2WBLA 1OXZA 1H7CA 1SHZC 2IC9A 4QXCB 5CA0E 1HTJF 4ZS2A 1MMGA 4WNKA 3L3PA 3ZLIA 4H9NC 4O4HE 3OKQA 2CWYA 4X1IE 2BDEA 2LHNA 4BA9A 4ZI3C 3Q9DA 2N9DA 5LG4A 3FXDB 4YFSA 5KX5E 2CEAA 2CA5A 3C4WA 3VKHA 3KV6A 4O4LE 3O1IA 5FY0A 5HXRA 2X9XA 2GK9A 2C0SA 1X79A 3N5LA 4AQFA 5C8YE 2CXDA 4UELA 4ZI2D 5LHIB 2X67A 5L3GB 2PJQA 2P9BA 2VKHA 4ZOLE 4IE5A 5JDGA 4AKHA 3KVAA 2H7VC 3LBXB 2LEHA 3Q2MA 4ILUA 4HGAA 4JUYA 4UV8B 4P0BA 2CLYB 2IAKA 3O4XE 4YHJA 5JREA 3AAIA 4ZI3D 3CX7B 1AJ3A 3CPZA 1V9DA 1MIVA 1VOMA 3CWZB 3LG7A 1KK7A 5F3JA 1E1HB 3CQXC 1ZV4X 3D0TA 5HWXA 2KZ7B 2UXNB 3QC9A 2ODUA 3GA8A 4UXNB 4PK6A 4DO0A 4YJ3E 4ZI2C 2ZM2A 4GIWA 4TV9E 3HR0A 3KBUA 3ZJ1A 2LSJA 2LHRA 3N2KE 4UF0A 1UX5A 2DWGA 1HF8A 3WI3A 5HXEA 3RRWA 3PUQA 3LBXA 2A2FX 2EHOA 5FY7A 2CXLA 2XHEB 2DI4A 3AVRA 1FEWA 2ZM8A 2V26A 4H9QC 3MA9A 2KT9A 3ZMVB 2V7KA 4KUMB 2XAFB 2JQQA 3Q5XA 4XZCA 4GK0E 5LJMA 4O4IE 4HFVA 4BJMA 2KINB 3P7IA 1O3XA 4CXXA 4NUVA 2BVLA 2L3LA 3MXZA 5FXVA 3RRCA 5EK2A 5JR9B 4TZ4C 3UT5E 2B1EA 3NRXA 3SRZA 3K3NA 5FMNA 4EZHA 2LSGA 2K5BB 4MHCA 3ETVA 4AKGA 4TUYE 2VKOA 3KV4A 2NTYA 3F57A 4ISTA 2H7OA 3CQCB 2VK9A 4PJJA 3ZN1B 5CA1E 4U72A 4L9IA 4AKIA 3AB3B 3R84B 3TKLB 3V5SA 3C98B 1D0YA 2YU1A 4EYYR 3LFMA 3SS1A 3ZMTB 1VRBA 3VKGA 4PJLA 2N2NA 3ZJ2A 3VHLA 1HCIA 4OYKA 3BQKA 3U78A 4ZS3A 2E8IA 3RKOA 2K9AA 2V1DB 3K3QC 5HXHA 5IHYA 4CQIA 4H9PC 5JDMA 3T8OA 1BR0A 3KV5A 5JR9C 4ZI7E 1S35A 4OFZA 4QXBB 1WR6A 1D1CA 2EHOC 2ZLYA 2X0LB 3K8PC 2HPJA 4ADZA 2NW8A 3Q5WA 2Q9QC 5JVDE 4CI3B 2W00A 2X66A 2Y48B 2ACXA 5JDHA 3I9YA 3CX8B 1WYBA 4MALA 3ZMUB 1IAPA 1U5PA 2PG8A 3IF8B 3P8CD 4XBFB 5DABA 1FMWA 4WBNE 1MIWA 3N9LA 2D5UA 1HG5A 3ZYMA 4KBMB 3QK6A 4F6RC 2K24A 5AFUL 4AKLA 2NW9A 3UUNA 4V1Av 2WAUA 1QSDA 4JEHB 5LP6E 4P09A 4O4JE 3BQLA 1WRDA 2WSSV 2W0GA 4AI6A 4H63V 2ZMAA 2K48A 3CKDA 3E0ZA 2LSYA 2LM9A 1S94A 3N2OA 5DJQC 2D2SA 2KLQA 1FIOA 2C5JA 1YKHB 5L3EB 4UVBB 5L3FB 2NTXA 2Q9QD 5FXZA 2LOPA 5HAXA 3ANWB 4AXPA 3AA7B 3HKBE 4OK0A 3LJCA 4PJMA 4IDZA 5LYJE 3EUHA 5ETWA 2C5IT 5GONE 4TN7B 2LSKA 3PUAA 3GWHA 1MMAA 1T98A 4I50E 3HKDE 3WAKA 3WAJA 2CLYC 1Z0PA 3N2GE 3IEEA 3ETUA 3KVBA 4PJNA 4AQFC 2CMRA 5EK4A 2X9YA 2XAHB 3PU8A 3FBLA 3RYIE 3VU7H 4TX5A 3MJXA 3O9XA 4BJNA 5JDFA 3ZC0A 3CMLA 5LGTB 3UULA 2EHOB 2MYSA 3OYZA 2XASB 1MIYA 4B6XA 4YLHA 4DMVA 4E7SA 3ZYLA 1WYCA 3J7Yq 3HKEE 1U4QA 4QWNB 3HA4A 4HN9A 3ZMSB 4P0AA 2IC6A 3AAEB 4H9OC 4HEAA 3CX6B 4GOUA 3PDYA 2KXPB 5KMGP 4MBQA 5LXTE 3UFEA 2L9QA 4JEUB 4IHJE 4H9SE 4TV8E 2NW7A 3V5UA 4NUUA 4PFOA 5JDLA 2A72A 3RPUA 2WMOA 5LJNA 2HPLA 3KFWX 3NBXX 1BR1A 5L3BB 4ANJA 3NRYA 5LHGB 2CXFA 2KWIB 3MZKB 4QX8B 2MOZA 1D0ZA 1US7B 4U74A 3ZCJA 2ODVA 2QGSA 4IE6A 4UEMA 4A56A 4EOZB 4IE4A 4MLKA 2V7LA 3H3AA 3AA1B 2VKJA 1CUNA 4K0UA 3BQIA 3BK9A 3PUGA 4IGUA 3N9NA 2VWAA 3DJBA 2WWUA 1ZKEA 3EVYA 1SA0E 3I9WA 2NP9A 3MK7C 2X51A 5EK3A 5IYZE 3B57A 5LGUB 2YINA 3LK42 1B7TA 3E22E 3C51A 1LKXA 3DTOA 2ES0A 2E9XB 3E08A 2UXXB 3EDUA 2C5KT 3IHRA 5HXCA 5FY1A 5L3DB 3GN5B 4XAXB 2D0TA 4GYRA 4AQGA 3C50A 4X1KE 3FB2A 1QUUA 1G8XA 3RYCE 3KV9A 5HYAA 3JC6C 1Y64B 2Z6EA 3K3OA 3MACA 3PTRB 2KWHA 4G2AA 4EZ4A 3RYFE 3SWHA 2HH7A 2WM9A 3I1AA 5LA6E 2L8KA 5ADXL 5J2TE 2XAQB 3N9PA 2Y8DA 2Q9QA 5LBQB 4C91A 4OHFA 2RA1A 5FYMA 5FXWA 2I59A 3KINB 4FJOA 5L3CB 1HS7A 1LRZA 3CVRA 3RC8A 3OBVE 3S4UA 3ZN0B 5HWYA 3AVSA 4CI2B 3HI2A 3ZPOA 2KNDA 1MMNA 1EZ3A 4UF0B 2M67A 2OA5A 4UVAB 5EZYE 4H63H 5LGNB 2XQYA 3B13A 5FNVE 2LOSA 5FXXA 4UV9B 2LSIA 4H9RC 4QKNA 3NZQA 3AAAB 3FXEB 4UVCB 4DBRA 4Z8XA 2E9XD 3W15B 5JRCB 5J1GA 2H3RA 4IIJE 2JPFA 3JC6D 1UCUA 2CE7A 5TAOA 2NOXA 3NZPA 3PE0A 4FI5A 2DHRA 3C4XA 3FBZA 4I4TE 3HKCE 3UTKA 3M65A 5F8PA 2DNXA 1IZNB 4DMWA 3IBPA 2MTQA 3F2EA 3QUJA 1KNZA 4AKRB 2E9XA 4CZZB 2YU2A 2ZM0A 4PW8A 4HKAA 4X1YE 2JMHA 2YK0A 4OYJA 1ZEEA 4L0RA 3DP7A 4M1PA 2E9XC 4WBOA 4CI1B 3N9MA 2XTLA 1ZHCA 5A1LA 3F31A 4O2BE 3RX6A 2YEVC 3L09A 2LJLA 5JR9A 2A3DA 4N78D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2S A; 
#chains in the Genus database with same CATH topology
 5JRC A;  5DQV A;  2B76 A;  2VB6 A;  2EHO D;  2LE8 A;  4O8S A;  5LHH B;  4GYS A;  2KSR A;  1YD8 G;  2PFV A;  3G06 A;  4HFE A;  4DV5 T;  3CQG B;  5FP3 A;  4LF5 T;  4HWC A;  4ZXL A;  2DWK A;  2IW5 B;  3RIU C;  2CCQ A;  3U3I A;  1OED B;  1HX1 B;  3C64 A;  1MMD A;  3OJA A;  4YSY A;  3KBT A;  1YKE B;  2X68 A;  3AE5 A;  2OLT A;  4O2A E;  3AA6 B;  1E7P A;  2V7J A;  3OYX A;  4GK5 E;  3SOL A;  5ABG A;  4AIU A;  3EDV A;  4GKK T;  3PJA A;  3I0O A;  1KNZ A;  4IE7 A;  5H6R B;  2W63 A;  1LVK A;  3ZCI A;  4L5G A;  2Y6X A;  5L47 A;  2J1D G;  3HL6 A;  3N9Q A;  5CB4 E;  3FZF B;  1NEK A;  3LK3 B;  4PFP A;  2XQ7 A;  4G63 A;  4BAY B;  4ERR A;  1HG2 A;  4DR6 T;  3I0Q A;  5LB7 B;  1OWA A;  2FBW A;  4EB6 E;  4EIW A;  4EAH A;  5BMV E;  2VKD A;  3MKD A;  5KXJ A;  1NWM X;  3UUM A;  3LK2 B;  2NR4 A;  2FUP A;  2XAJ B;  4HTE A;  1D0X A;  4DV3 T;  4U31 A;  2JJ9 A;  4PAG A;  2DCF A;  1FMV A;  2CBI A;  3O1H A;  1BR4 A;  2J62 A;  4J2C A;  4QX7 B;  5LBM A;  4YTP A;  1HR0 T;  3ZEF B;  3CK6 A;  4IE0 A;  1XMQ T;  2Q9Q B;  4ZHQ E;  2V7M A;  3PUR A;  2MAW A;  5DQW A;  3PU3 A;  5HEU A;  4ISS A;  3TLT A;  4E7Z A;  1M7K A;  4EYU A;  4QXH B;  5JH7 E;  4CXY A;  1UUS A;  3AEF A;  3C4Z A;  1IJ5 A;  3B5M A;  3VRB A;  4HWH A;  4QHO A;  2LM2 A;  2WWV A;  1KF6 A;  1Z8U A;  5J2U E;  4JYA T;  2VAS A;  1WCR A;  3AA0 B;  2RPA A;  3ONX A;  4JI5 T;  5JDQ A;  2XJ7 A;  3ZST A;  4U7I A;  5JQG E;  1HFA A;  2W61 A;  4LML A;  4DND A;  2NWB A;  3RYH E;  1YQ4 A;  4PNI A;  1KFY A;  4TNV A;  2DLR A;  2VVN A;  4NIQ A;  3VR9 A;  3RH3 A;  4A97 A;  4JLE A;  4LF6 T;  4I55 E;  2YDQ A;  5M4Y A;  2CHO A;  4PK5 A;  2W66 A;  3QNU A;  4IRE A;  4HE8 A;  5AQK B;  2XZE A;  2BG9 C;  2SPC A;  2BVM A;  1WLX A;  4UIG A;  4X20 E;  5HCM A;  3RC3 A;  3ZMZ B;  1UX4 A;  5JDN A;  4EV6 A;  3O1J A;  5LMN T;  3PUW F;  4PK4 A;  3FHN A;  2WMN A;  4QH4 A;  4COF A;  2QRX A;  5L4E A;  2N1G A;  1N33 T;  5KDM C;  1UGO A;  1G73 A;  2W62 A;  2KMF A;  2WDV A;  3GMI A;  4DV1 T;  3ANW A;  4JBW F;  4X65 T;  1MND A;  2CM0 A;  3PV0 F;  2BKP A;  4IDP A;  5LOV E;  5HXS A;  1W0A A;  1D1B A;  2IDO B;  4I43 B;  2JRK A;  3EHZ A;  3K1S A;  5FVK A;  5HEG A;  3ESL A;  2XAG B;  4DR4 T;  4HWI B;  1HNW T;  5H6Q B;  4KP3 C;  3R6N A;  3UUX B;  4C90 A;  2LT3 A;  5L2L A;  3KDS E;  5ABE A;  3P4R A;  1OED A;  1YW0 A;  3UU5 A;  2V6Y B;  1XZY A;  3A5X A;  4EXT A;  2CWO A;  3N9O A;  3J9X 1;  2G0U A;  2MBG A;  2R6G F;  3P4Q A;  2JMK A;  2X9W A;  5E0O A;  4CN1 A;  4TNW A;  1OED C;  2X9H A;  2BKN A;  1VCT A;  4KMC A;  4WW0 A;  4CXW A;  5J0Z A;  1BR2 A;  2M6B A;  2WZI A;  3JAF A;  3L8R A;  3H37 A;  4YJ2 E;  2QA7 A;  2PBI A;  2RP4 A;  5HCJ A;  4DVD A;  1X9B A;  2BG9 B;  4JI4 T;  5LCY A;  2VL8 A;  3ZYK A;  2UU9 T;  4CN4 A;  2V7I A;  2XUE A;  2A9U A;  4ASK A;  5JTG A;  3JCF A;  1LVF A;  1MNE A;  1ZP0 A;  2BZB A;  1IJ6 A;  2D0U A;  4MFR A;  5AQJ B;  3UQ4 A;  1NAF A;  4Z91 A;  2V5C A;  5AQT B;  3PUS A;  3UU4 A;  2VVS A;  1HX8 A;  1WR0 A;  3ZC1 A;  4EGW A;  1D1A A;  3GN5 A;  4DBQ A;  2WBL A;  2IC9 A;  1OXZ A;  1H7C A;  1SHZ C;  2FJB A;  4QXC B;  1HTJ F;  4ZS2 A;  1MMG A;  2XQA A;  5CA0 E;  4WNK A;  3L3P A;  3ZLI A;  4H9N C;  4O4H E;  2H88 A;  2CWY A;  3OKQ A;  4X1I E;  2BDE A;  2LHN A;  4BA9 A;  4ZI3 C;  3T1H T;  3Q9D A;  2CHN A;  2N9D A;  5LG4 A;  4IDN A;  3FXD B;  4YFS A;  5KX5 E;  2CEA A;  2JQH A;  2CA5 A;  3C4W A;  3RKG A;  3KV6 A;  3LSV A;  4EED A;  5LMU T;  4O4L E;  5L4H A;  3ZKR A;  3VKH A;  3O1I A;  5FY0 A;  5HXR A;  4X62 T;  2X9X A;  2GK9 A;  2C0S A;  1X79 A;  2XQ3 A;  3N5L A;  3NWI A;  2CXD A;  4UEL A;  3UU6 A;  3UU8 A;  4AQF A;  4ZI2 D;  5LHI B;  4YHH T;  2X67 A;  5L3G B;  2PJQ A;  2P9B A;  2K3W A;  2VKH A;  4ZOL E;  2YKS A;  2YOE A;  4IE5 A;  5JDG A;  5LGU B;  3AE1 A;  4AKH A;  3KVA A;  2H7V C;  3AE8 A;  3LBX B;  4JI6 T;  2LEH A;  3Q2M A;  4ILU A;  4HGA A;  4JUY A;  4UV8 B;  1N36 T;  4ZEY A;  4P0B A;  2CLY B;  2IAK A;  3O4X E;  4YHJ A;  5LNK A;  5JRE A;  3AAI A;  4WZX A;  4ZI3 D;  1YXR A;  3CX7 B;  4KHP T;  1AJ3 A;  3CPZ A;  1V9D A;  1MIV A;  1VOM A;  3CWZ B;  3LG7 A;  4X64 T;  1KK7 A;  4YT0 A;  5F3J A;  2BS4 A;  1E1H B;  1XNR T;  3CQX C;  1ZV4 X;  3D0T A;  5HWX A;  4X66 T;  2ZM6 T;  3T1Y T;  2HHH T;  2KZ7 B;  1YQ3 A;  2UXN B;  3QC9 A;  2ODU A;  2W2U A;  3GA8 A;  4UXN B;  2WQY A;  4PK6 A;  4DO0 A;  4YJ3 E;  4K0K T;  4ZI2 C;  4DUZ T;  2WP9 A;  2ZM2 A;  4GIW A;  2XSB A;  4YTM A;  4TV9 E;  3HR0 A;  4DR5 T;  3KBU A;  2XY8 B;  3ZJ1 A;  2LSJ A;  2LHR A;  1W09 A;  3AEE A;  3N2K E;  4UF0 A;  1UX5 A;  2DWG A;  1HF8 A;  1UUR A;  4ILB A;  3WI3 A;  5HXE A;  3RRW A;  3PUQ A;  3RGL A;  3LBX A;  2A2F X;  5AQI B;  2EHO A;  3ONL C;  5FY7 A;  2WY2 A;  1E2A A;  3AEB A;  2CXL A;  4TWF A;  3UQ7 A;  4LF9 T;  2XHE B;  2DI4 A;  4NXN T;  2JQ9 A;  2BS3 A;  2WCA A;  3AVR A;  1FEW A;  2ZM8 A;  5JDH A;  1WFD A;  2V26 A;  4H9Q C;  3MA9 A;  2KT9 A;  4HWD A;  2V7K A;  3A7M A;  3ZMV B;  4KUM B;  2XAF B;  2JQQ A;  3Q5X A;  3FZM B;  4XZC A;  3AEA A;  1CHU A;  4GK0 E;  2IHR 1;  5AQU B;  3UUB A;  5LJM A;  4O4I E;  4HFV A;  4BJM A;  4HFC A;  2KIN B;  3P7I A;  1O3X A;  4CXX A;  1IBL T;  4DR7 T;  4NUV A;  2BVL A;  2E5L T;  2L3L A;  3MXZ A;  3AEC A;  1XDP A;  5FXV A;  4B3R T;  3RRC A;  2V5D A;  1SE7 A;  5C2T A;  4TZ4 C;  3UT5 E;  5EK2 A;  5JR9 B;  2B1E A;  3NRX A;  3SRZ A;  3K3N A;  5FMN A;  2WZH A;  4EZH A;  2IML A;  2LSG A;  5HEJ A;  5HEO A;  2BKO A;  2K5B B;  1L0V A;  4MHC A;  3ETV A;  4AKG A;  3VR8 A;  5AQR B;  2XM2 A;  4TUY E;  2VKO A;  3TLV A;  3KV4 A;  2NTY A;  3EI0 A;  3F57 A;  3UFG A;  4IST A;  2H7O A;  4JI2 T;  5CJ5 A;  3CQC B;  1N34 T;  4LF7 T;  2VK9 A;  4ZZB A;  4PJJ A;  3ZN1 B;  3ZT5 A;  5CA1 E;  4U72 A;  4L9I A;  5ABF B;  4AKI A;  3AB3 B;  1JNR A;  4YTN A;  3R84 B;  3TKL B;  2YDR A;  3C98 B;  3RLF F;  3V5S A;  1D0Y A;  5IWA T;  2YU1 A;  4EYY R;  2UXC T;  3LFM A;  4AQY T;  5IUX A;  1GQE A;  1XMO T;  3L39 A;  3SS1 A;  3ZMT B;  1VRB A;  3AXJ A;  3VKG A;  4PJL A;  2N2N A;  4LF4 T;  3ZJ2 A;  3VHL A;  1HCI A;  4OYK A;  2QVA A;  3BQK A;  5AQV B;  3U78 A;  1IBM T;  2I0M A;  4WYV A;  4LMK A;  4ZS3 A;  2DL1 A;  2E8I A;  3X1D A;  3RKO A;  2K9A A;  2V1D B;  3K3Q C;  5HXH A;  5IHY A;  4CQI A;  4H9P C;  2VL0 A;  2X0Y A;  3T8O A;  5JDM A;  3NVO A;  2UXD T;  3KV5 A;  1BR0 A;  3Q5D A;  5JR9 C;  3ZT7 A;  4YXD A;  4ZI7 E;  4JI3 T;  1S35 A;  3TLU A;  4OFZ A;  4QXB B;  4OX9 T;  1WR6 A;  1NEN A;  1D1C A;  2EHO C;  2BBJ A;  2ZLY A;  2X0L B;  3K8P C;  4U2Y A;  2HPJ A;  4ADZ A;  2IUB A;  2NW8 A;  3AE3 A;  2Q9Q C;  3Q5W A;  3RIU A;  5JVD E;  2WU5 A;  4DR3 T;  4CI3 B;  4DV2 T;  4U33 A;  2W00 A;  3P50 A;  2X66 A;  1I94 T;  2XSA A;  2ACX A;  2Y48 B;  3I9Y A;  3PUX F;  3CX8 B;  3RIA A;  1WYB A;  4MAL A;  3ZMU B;  1IAP A;  1U5P A;  2PG8 A;  3IF8 B;  3P8C D;  4XBF B;  1ZOY A;  5DAB A;  2UUA T;  1FMW A;  2VQF T;  5AQH B;  4WBN E;  1MIW A;  3N9L A;  5C3J A;  2D5U A;  1HG5 A;  3RHW A;  3ZYM A;  4KBM B;  3QK6 A;  4F6R C;  2K24 A;  5AFU L;  5C8Y E;  4AKL A;  4DV6 T;  2NW9 A;  3ONJ A;  2FJA A;  3UUN A;  4V1A v;  4B3T T;  4GKJ T;  1J5W A;  2WAU A;  1QSD A;  3JAD A;  4JEH B;  5LP6 E;  4P09 A;  4O4J E;  3AE2 A;  3BQL A;  2LKG A;  5CGM A;  1WRD A;  2WSS V;  4UR9 A;  3RF1 A;  2W0G A;  4AI6 A;  4Q25 A;  4H63 V;  2WS3 A;  2ZMA A;  2K48 A;  3CKD A;  3E0Z A;  2LSY A;  2LM9 A;  1S94 A;  3N2O A;  5DJQ C;  2D2S A;  3AE6 A;  4KX6 A;  2KLQ A;  1FIO A;  2C5J A;  1YKH B;  5L3E B;  1OED E;  1XDO A;  4UVB B;  5L3F B;  5FKY A;  4IL4 A;  2NTX A;  2Q9Q D;  5FXZ A;  2LOP A;  5HAX A;  3TLS A;  3ANW B;  1SUM B;  4AXP A;  3AA7 B;  3HKB E;  3OVU A;  3LJC A;  4OK0 A;  4PJM A;  2D9D A;  4IDZ A;  5LYJ E;  3EUH A;  5AQM B;  5ETW A;  4DR1 T;  4TWH A;  2C5I T;  5GON E;  3ZT6 A;  4TN7 B;  2LSK A;  3PUA A;  3GWH A;  4F8H A;  1MMA A;  1T98 A;  1KNR A;  4I50 E;  3EAM A;  3HKD E;  2W4X A;  3WAK A;  3WAJ A;  2CLY C;  1Z0P A;  3N2G E;  4DID B;  3IEE A;  3ETU A;  4JI8 T;  3KVB A;  1T72 A;  4B3S T;  4PJN A;  4AQF C;  2CMR A;  4YSZ A;  3PUV F;  4KI0 F;  5EK4 A;  2CBJ A;  2X9Y A;  2XAH B;  2PTF A;  2VQE T;  2LRL A;  3PU8 A;  3FBL A;  3RYI E;  3VU7 H;  5ABH A;  1DU2 A;  4TX5 A;  2IIU A;  1IBK T;  1XWM A;  3MJX A;  4ILA A;  3O9X A;  2BBH A;  4BJN A;  5JDF A;  3ZC0 A;  3CML A;  5LGT B;  3UUL A;  2EHO B;  2MYS A;  3OYZ A;  2UUB T;  2XAS B;  1MIY A;  4B6X A;  4YLH A;  4DMV A;  4E7S A;  3ZYL A;  1WYC A;  3J7Y q;  3HKE E;  4NPP A;  1U4Q A;  4QH5 A;  5BR8 T;  1XNQ T;  2XQ5 A;  4QWN B;  3HA4 A;  2AE9 A;  4HN9 A;  3ZMS B;  4P0A A;  2IC6 A;  2WB5 A;  2J47 A;  3NKZ A;  1W0B A;  3AAE B;  1FJG T;  4DV4 T;  4H9O C;  4HEA A;  4LMJ A;  3CX6 B;  4GOU A;  3PDY A;  2KXP B;  4HFB A;  4MBQ A;  2V8S V;  5KMG P;  3IA3 A;  5J2T E;  5LXT E;  2UUC T;  4NXM T;  3UFE A;  2L9Q A;  1M62 A;  3FZL B;  5AQO B;  4JEU B;  1I6Z A;  4IHJ E;  4A98 A;  4H9S E;  2V6Y A;  4TV8 E;  4U3C A;  4JI1 T;  2NW7 A;  3V5U A;  2E2A A;  4NUU A;  4PFO A;  4YY3 T;  5JDL A;  4LF8 T;  2A72 A;  3RPU A;  2WMO A;  1T7S A;  5LJN A;  3FZK B;  2HPL A;  3KFW X;  3NBX X;  3ZSS A;  1BR1 A;  3SFD A;  5LG3 A;  5L3B B;  4ANJ A;  3NRY A;  5LHG B;  2CXF A;  2AXD S;  2KWI B;  3MZK B;  4QX8 B;  5IYZ E;  4IT4 A;  5AQP B;  2MOZ A;  1D0Z A;  3CIR A;  4LFA T;  1US7 B;  2JQK A;  2XQ8 A;  3Q5E A;  4U74 A;  1UK5 A;  2V6X A;  2ODV A;  2WDQ A;  2QGS A;  1W9R A;  4IE6 A;  3RIF A;  3ZCJ A;  4UEM A;  2XM1 A;  2CPT A;  4A56 A;  4EOZ B;  4IE4 A;  4U2Z A;  2BG9 A;  2W67 A;  1N32 T;  4MLK A;  2V7L A;  2JIW A;  1KNP A;  3H3A A;  3AA1 B;  2VKJ A;  1CUN A;  2X0H A;  2FJE A;  2H89 A;  4DUY T;  5AQG B;  1T8B A;  1HNX T;  4K0U A;  3BQI A;  3BK9 A;  3PUG A;  4ZZC A;  4CN6 A;  4IGU A;  5AQQ B;  3N9N A;  2VWA A;  1R8I A;  3DJB A;  3JAE A;  2WWU A;  1ZKE A;  3EVY A;  1SA0 E;  3I9W A;  2NP9 A;  3MK7 C;  2X51 A;  4TWD A;  5EK3 A;  3B57 A;  4X5T A;  4KHZ F;  1J1J A;  2FJD A;  2ACZ A;  2BG9 E;  1B7T A;  2YIN A;  3E22 E;  3LK4 2;  3SFE A;  3C51 A;  1LKX A;  2LRK A;  3DTO A;  3RQW A;  2E5V A;  2ES0 A;  2E9X B;  2QYW A;  3E08 A;  3PUY F;  2UXX B;  3EDU A;  2C5K T;  3IHR A;  4QH1 A;  5HXC A;  5FY1 A;  5L3D B;  3GN5 B;  4XAX B;  2D0T A;  4GYR A;  2HN2 A;  3C50 A;  4X1K E;  3AE7 A;  3FB2 A;  1QUU A;  4AQG A;  4HWF A;  1G8X A;  3RYC E;  3KV9 A;  5HYA A;  3TLW A;  2XPK A;  2F4V T;  3JC6 C;  3OPC A;  1Y64 B;  2Z6E A;  3K3O A;  3ABV A;  4B3M T;  3AEG A;  4DR2 T;  3MAC A;  3AE4 A;  3PTR B;  2KWH A;  4G2A A;  4EZ4 A;  3RYF E;  3SWH A;  2HH7 A;  2MPK A;  2WM9 A;  2XQ6 A;  3AE9 A;  2XQ4 A;  5HEH A;  3I1A A;  5LA6 E;  2L8K A;  3UU3 A;  5ADX L;  2XAQ B;  3N9P A;  2Y8D A;  3P4P A;  2Q9Q A;  5LBQ B;  4C91 A;  4JV5 T;  1JNZ A;  4OHF A;  2RA1 A;  5FYM A;  1KEY A;  5FXW A;  2WDR A;  5ABF A;  2I59 A;  4IDQ A;  3KIN B;  4LFB T;  4FJO A;  5L3C B;  1HS7 A;  2LKH A;  1LRZ A;  3CVR A;  3RC8 A;  2J4G A;  3OBV E;  3S4U A;  3ZN0 B;  3RQU A;  3M3Z B;  3A8Y C;  3AVS A;  5HWY A;  4CI2 B;  4ILC A;  3HI2 A;  3P4W A;  5FL1 A;  4JI7 T;  3ZPO A;  3H3M A;  2UXB T;  2KND A;  1MMN A;  1EZ3 A;  4UF0 B;  4HFD A;  2M67 A;  2YN6 A;  5F5W A;  2OA5 A;  4UVA B;  5EZY E;  3AED A;  4IL9 A;  4I0U A;  2LLY A;  4H63 H;  4Z90 A;  5LGN B;  4LFC T;  2XQY A;  3PJA J;  2WU2 A;  3QOF A;  1Y01 A;  3B13 A;  4IDO A;  4U7Y A;  2LOS A;  5FNV E;  5FXX A;  4UV9 B;  1VCS A;  2LSI A;  3RI5 A;  4DV0 T;  4H9R C;  4QKN A;  1HNZ T;  3NZQ A;  3QB5 K;  3AAA B;  3FXE B;  4UVC B;  3VRA A;  4YSX A;  5CFB A;  3OTO T;  2VUR A;  4DV7 T;  4JI0 T;  4DBR A;  1J5E T;  4Z8X A;  2E9X D;  3W15 B;  5JRC B;  5J1G A;  2H3R A;  4IIJ E;  4HFI A;  4A5X A;  2JPF A;  3EAB A;  3JC6 D;  1QLB A;  4AIS A;  2I6H A;  2BS2 A;  2XQ9 A;  4HFH A;  1UCU A;  2CE7 A;  5TAO A;  5FVL A;  2NOX A;  4P1N A;  3NZP A;  3PE0 A;  4FI5 A;  2DHR A;  3FZH B;  5AQN B;  3C4X A;  3FBZ A;  4I4T E;  3HKC E;  2M6I A;  2HN1 A;  3M65 A;  3LDQ B;  5F8P A;  2DNX A;  1IZN B;  3UTK A;  3IBP A;  2OV9 A;  2MTQ A;  3F2E A;  3QB5 A;  3QUJ A;  2E9X A;  4AKR B;  4DMW A;  2YDS A;  3PUZ F;  4CZZ B;  5AQF B;  2CRB A;  4EEB A;  2YU2 A;  2ZM0 A;  4PW8 A;  4HKA A;  4X1Y E;  2JMH A;  2YK0 A;  4OYJ A;  1ZEE A;  4L0R A;  3DP7 A;  4M1P A;  2E9X C;  4WBO A;  5AQS B;  5FL0 A;  3N9M A;  2XTL A;  1ZHC A;  3AXJ B;  5A1L A;  4CI1 B;  3F31 A;  4O2B E;  3RX6 A;  5AQL B;  2YEV C;  3L09 A;  2LJL A;  5JR9 A;  3P4S A;  2A3D A;  4N78 D; 
#chains in the Genus database with same CATH homology
 5JRC A;  5DQV A;  2VB6 A;  2EHO D;  2LE8 A;  4O8S A;  5LHH B;  4GYS A;  2PFV A;  1YD8 G;  3CQG B;  5FP3 A;  2DWK A;  2IW5 B;  2CCQ A;  3U3I A;  3C64 A;  1MMD A;  3OJA A;  3KBT A;  1YKE B;  2X68 A;  4O2A E;  3AA6 B;  2V7J A;  3OYX A;  4GK5 E;  3SOL A;  3EDV A;  3I0O A;  4IE7 A;  5H6R B;  2W63 A;  1LVK A;  3ZCI A;  4L5G A;  2Y6X A;  2J1D G;  3HL6 A;  3N9Q A;  5CB4 E;  4PFP A;  3LK3 B;  4ERR A;  4BAY B;  4G63 A;  1HG2 A;  3I0Q A;  1OWA A;  4EB6 E;  4EIW A;  4EAH A;  5BMV E;  2VKD A;  3MKD A;  1NWM X;  3UUM A;  3LK2 B;  2XAJ B;  4HTE A;  1D0X A;  2JJ9 A;  4PAG A;  2DCF A;  1FMV A;  3O1H A;  4J2C A;  1BR4 A;  4QX7 B;  5LBM A;  3ZEF B;  4IE0 A;  2Q9Q B;  4ZHQ E;  2V7M A;  3PUR A;  5DQW A;  5LNK A;  3PU3 A;  4ISS A;  4E7Z A;  4EYU A;  4CXY A;  4QXH B;  5JH7 E;  3C4Z A;  1IJ5 A;  5J2U E;  4QHO A;  2VAS A;  3AA0 B;  5KDM C;  3ONX A;  5JQG E;  1HFA A;  2W61 A;  4DND A;  2NWB A;  3RYH E;  4PNI A;  2DLR A;  3RH3 A;  4JLE A;  4I55 E;  5M4Y A;  4PK5 A;  4HE8 A;  4X20 E;  2SPC A;  2BVM A;  1WLX A;  4UIG A;  3RC3 A;  5JDN A;  3ZMZ B;  1UX4 A;  3O1J A;  4PK4 A;  3FHN A;  2WMN A;  2N1G A;  1G73 A;  2W62 A;  2KMF A;  3GMI A;  3ANW A;  1MND A;  2CM0 A;  5LOV E;  5HXS A;  1D1B A;  4I43 B;  2JRK A;  3ESL A;  2XAG B;  5H6Q B;  4KP3 C;  3R6N A;  3UUX B;  4C90 A;  2LT3 A;  5L2L A;  3KDS E;  1YW0 A;  3A5X A;  4EXT A;  2CWO A;  3N9O A;  3J9X 1;  2G0U A;  2MBG A;  2JMK A;  2X9W A;  5E0O A;  2X9H A;  4CXW A;  4KMC A;  4WW0 A;  1BR2 A;  3H37 A;  4YJ2 E;  2QA7 A;  2PBI A;  2RP4 A;  4DVD A;  5LCY A;  2VL8 A;  3ZYK A;  2V7I A;  2XUE A;  4ASK A;  1LVF A;  1MNE A;  2BZB A;  2D0U A;  1IJ6 A;  4MFR A;  5JDQ A;  1NAF A;  3PUS A;  3ZC1 A;  1HX8 A;  1D1A A;  3GN5 A;  4DBQ A;  2WBL A;  1OXZ A;  1H7C A;  1SHZ C;  2IC9 A;  4QXC B;  5CA0 E;  1HTJ F;  4ZS2 A;  1MMG A;  4WNK A;  3L3P A;  3ZLI A;  4H9N C;  4O4H E;  3OKQ A;  2CWY A;  4X1I E;  2BDE A;  2LHN A;  4BA9 A;  4ZI3 C;  3Q9D A;  2N9D A;  5LG4 A;  3FXD B;  4YFS A;  5KX5 E;  2CEA A;  2CA5 A;  3C4W A;  3VKH A;  3KV6 A;  4O4L E;  3O1I A;  5FY0 A;  5HXR A;  2X9X A;  2GK9 A;  2C0S A;  1X79 A;  3N5L A;  4AQF A;  5C8Y E;  2CXD A;  4UEL A;  4ZI2 D;  5LHI B;  2X67 A;  5L3G B;  2PJQ A;  2P9B A;  2VKH A;  4ZOL E;  4IE5 A;  5JDG A;  4AKH A;  3KVA A;  2H7V C;  3LBX B;  2LEH A;  3Q2M A;  4ILU A;  4HGA A;  4JUY A;  4UV8 B;  4P0B A;  2CLY B;  2IAK A;  3O4X E;  4YHJ A;  5JRE A;  3AAI A;  4ZI3 D;  3CX7 B;  1AJ3 A;  3CPZ A;  1V9D A;  1MIV A;  1VOM A;  3CWZ B;  3LG7 A;  1KK7 A;  5F3J A;  1E1H B;  3CQX C;  1ZV4 X;  3D0T A;  5HWX A;  2KZ7 B;  2UXN B;  3QC9 A;  2ODU A;  3GA8 A;  4UXN B;  4PK6 A;  4DO0 A;  4YJ3 E;  4ZI2 C;  2ZM2 A;  4GIW A;  4TV9 E;  3HR0 A;  3KBU A;  3ZJ1 A;  2LSJ A;  2LHR A;  3N2K E;  4UF0 A;  1UX5 A;  2DWG A;  1HF8 A;  3WI3 A;  5HXE A;  3RRW A;  3PUQ A;  3LBX A;  2A2F X;  2EHO A;  5FY7 A;  2CXL A;  2XHE B;  2DI4 A;  3AVR A;  1FEW A;  2ZM8 A;  2V26 A;  4H9Q C;  3MA9 A;  2KT9 A;  3ZMV B;  2V7K A;  4KUM B;  2XAF B;  2JQQ A;  3Q5X A;  4XZC A;  4GK0 E;  5LJM A;  4O4I E;  4HFV A;  4BJM A;  2KIN B;  3P7I A;  1O3X A;  4CXX A;  4NUV A;  2BVL A;  2L3L A;  3MXZ A;  5FXV A;  3RRC A;  5EK2 A;  5JR9 B;  4TZ4 C;  3UT5 E;  2B1E A;  3NRX A;  3SRZ A;  3K3N A;  5FMN A;  4EZH A;  2LSG A;  2K5B B;  4MHC A;  3ETV A;  4AKG A;  4TUY E;  2VKO A;  3KV4 A;  2NTY A;  3F57 A;  4IST A;  2H7O A;  3CQC B;  2VK9 A;  4PJJ A;  3ZN1 B;  5CA1 E;  4U72 A;  4L9I A;  4AKI A;  3AB3 B;  3R84 B;  3TKL B;  3V5S A;  3C98 B;  1D0Y A;  2YU1 A;  4EYY R;  3LFM A;  3SS1 A;  3ZMT B;  1VRB A;  3VKG A;  4PJL A;  2N2N A;  3ZJ2 A;  3VHL A;  1HCI A;  4OYK A;  3BQK A;  3U78 A;  4ZS3 A;  2E8I A;  3RKO A;  2K9A A;  2V1D B;  3K3Q C;  5HXH A;  5IHY A;  4CQI A;  4H9P C;  5JDM A;  3T8O A;  1BR0 A;  3KV5 A;  5JR9 C;  4ZI7 E;  1S35 A;  4OFZ A;  4QXB B;  1WR6 A;  1D1C A;  2EHO C;  2ZLY A;  2X0L B;  3K8P C;  2HPJ A;  4ADZ A;  2NW8 A;  3Q5W A;  2Q9Q C;  5JVD E;  4CI3 B;  2W00 A;  2X66 A;  2Y48 B;  2ACX A;  5JDH A;  3I9Y A;  3CX8 B;  1WYB A;  4MAL A;  3ZMU B;  1IAP A;  1U5P A;  2PG8 A;  3IF8 B;  3P8C D;  4XBF B;  5DAB A;  1FMW A;  4WBN E;  1MIW A;  3N9L A;  2D5U A;  1HG5 A;  3ZYM A;  4KBM B;  3QK6 A;  4F6R C;  2K24 A;  5AFU L;  4AKL A;  2NW9 A;  3UUN A;  4V1A v;  2WAU A;  1QSD A;  4JEH B;  5LP6 E;  4P09 A;  4O4J E;  3BQL A;  1WRD A;  2WSS V;  2W0G A;  4AI6 A;  4H63 V;  2ZMA A;  2K48 A;  3CKD A;  3E0Z A;  2LSY A;  2LM9 A;  1S94 A;  3N2O A;  5DJQ C;  2D2S A;  2KLQ A;  1FIO A;  2C5J A;  1YKH B;  5L3E B;  4UVB B;  5L3F B;  2NTX A;  2Q9Q D;  5FXZ A;  2LOP A;  5HAX A;  3ANW B;  4AXP A;  3AA7 B;  3HKB E;  4OK0 A;  3LJC A;  4PJM A;  4IDZ A;  5LYJ E;  3EUH A;  5ETW A;  2C5I T;  5GON E;  4TN7 B;  2LSK A;  3PUA A;  3GWH A;  1MMA A;  1T98 A;  4I50 E;  3HKD E;  3WAK A;  3WAJ A;  2CLY C;  1Z0P A;  3N2G E;  3IEE A;  3ETU A;  3KVB A;  4PJN A;  4AQF C;  2CMR A;  5EK4 A;  2X9Y A;  2XAH B;  3PU8 A;  3FBL A;  3RYI E;  3VU7 H;  4TX5 A;  3MJX A;  3O9X A;  4BJN A;  5JDF A;  3ZC0 A;  3CML A;  5LGT B;  3UUL A;  2EHO B;  2MYS A;  3OYZ A;  2XAS B;  1MIY A;  4B6X A;  4YLH A;  4DMV A;  4E7S A;  3ZYL A;  1WYC A;  3J7Y q;  3HKE E;  1U4Q A;  4QWN B;  3HA4 A;  4HN9 A;  3ZMS B;  4P0A A;  2IC6 A;  3AAE B;  4H9O C;  4HEA A;  3CX6 B;  4GOU A;  3PDY A;  2KXP B;  5KMG P;  4MBQ A;  5LXT E;  3UFE A;  2L9Q A;  4JEU B;  4IHJ E;  4H9S E;  4TV8 E;  2NW7 A;  3V5U A;  4NUU A;  4PFO A;  5JDL A;  2A72 A;  3RPU A;  2WMO A;  5LJN A;  2HPL A;  3KFW X;  3NBX X;  1BR1 A;  5L3B B;  4ANJ A;  3NRY A;  5LHG B;  2CXF A;  2KWI B;  3MZK B;  4QX8 B;  2MOZ A;  1D0Z A;  1US7 B;  4U74 A;  3ZCJ A;  2ODV A;  2QGS A;  4IE6 A;  4UEM A;  4A56 A;  4EOZ B;  4IE4 A;  4MLK A;  2V7L A;  3H3A A;  3AA1 B;  2VKJ A;  1CUN A;  4K0U A;  3BQI A;  3BK9 A;  3PUG A;  4IGU A;  3N9N A;  2VWA A;  3DJB A;  2WWU A;  1ZKE A;  3EVY A;  1SA0 E;  3I9W A;  2NP9 A;  3MK7 C;  2X51 A;  5EK3 A;  5IYZ E;  3B57 A;  5LGU B;  2YIN A;  3LK4 2;  1B7T A;  3E22 E;  3C51 A;  1LKX A;  3DTO A;  2ES0 A;  2E9X B;  3E08 A;  2UXX B;  3EDU A;  2C5K T;  3IHR A;  5HXC A;  5FY1 A;  5L3D B;  3GN5 B;  4XAX B;  2D0T A;  4GYR A;  4AQG A;  3C50 A;  4X1K E;  3FB2 A;  1QUU A;  1G8X A;  3RYC E;  3KV9 A;  5HYA A;  3JC6 C;  1Y64 B;  2Z6E A;  3K3O A;  3MAC A;  3PTR B;  2KWH A;  4G2A A;  4EZ4 A;  3RYF E;  3SWH A;  2HH7 A;  2WM9 A;  3I1A A;  5LA6 E;  2L8K A;  5ADX L;  5J2T E;  2XAQ B;  3N9P A;  2Y8D A;  2Q9Q A;  5LBQ B;  4C91 A;  4OHF A;  2RA1 A;  5FYM A;  5FXW A;  2I59 A;  3KIN B;  4FJO A;  5L3C B;  1HS7 A;  1LRZ A;  3CVR A;  3RC8 A;  3OBV E;  3S4U A;  3ZN0 B;  5HWY A;  3AVS A;  4CI2 B;  3HI2 A;  3ZPO A;  2KND A;  1MMN A;  1EZ3 A;  4UF0 B;  2M67 A;  2OA5 A;  4UVA B;  5EZY E;  4H63 H;  5LGN B;  2XQY A;  3B13 A;  5FNV E;  2LOS A;  5FXX A;  4UV9 B;  2LSI A;  4H9R C;  4QKN A;  3NZQ A;  3AAA B;  3FXE B;  4UVC B;  4DBR A;  4Z8X A;  2E9X D;  3W15 B;  5JRC B;  5J1G A;  2H3R A;  4IIJ E;  2JPF A;  3JC6 D;  1UCU A;  2CE7 A;  5TAO A;  2NOX A;  3NZP A;  3PE0 A;  4FI5 A;  2DHR A;  3C4X A;  3FBZ A;  4I4T E;  3HKC E;  3UTK A;  3M65 A;  5F8P A;  2DNX A;  1IZN B;  4DMW A;  3IBP A;  2MTQ A;  3F2E A;  3QUJ A;  1KNZ A;  4AKR B;  2E9X A;  4CZZ B;  2YU2 A;  2ZM0 A;  4PW8 A;  4HKA A;  4X1Y E;  2JMH A;  2YK0 A;  4OYJ A;  1ZEE A;  4L0R A;  3DP7 A;  4M1P A;  2E9X C;  4WBO A;  4CI1 B;  3N9M A;  2XTL A;  1ZHC A;  5A1L A;  3F31 A;  4O2B E;  3RX6 A;  2YEV C;  3L09 A;  2LJL A;  5JR9 A;  2A3D A;  4N78 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...