2D2SA

Crystal structure of the exo84p c-terminal domains
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
229
structure length
217
Chain Sequence
b'DMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSLMLLNLISLKIEQRREAISSKLSQSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIVDNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNLSPGSIKSSRKQIDGLKAVGLDFVYKLDEFIKKNSDKIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exocyst complex component EXO84
publication title The structures of exocyst subunit Exo70p and the Exo84p C-terminal domains reveal a common motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
total genus 91
structure length 217
sequence length 229
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16528 Exo84_C Exocyst component 84 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA01
1.20.58.1220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA02
2D2SA
chains in the Genus database with same CATH superfamily
3IEEA 2H3RA 3V5SA 1LKXA 5JDQA 2LM9A 4KUMB 2FJEA 4OYKA 1HNXT 4TNWA 5JRCA 5LJNA 2QYWA 3OVUA 2P9BA 4UVBB 3LBXA 1E2AA 4YHJA 4AI6A 4AQYT 3NZQA 3ZPOA 2Y8DA 1HTJF 4IDNA 4MHCA 1LRZA 2V5DA 3CMLA 1VCSA 3CK6A 2AXDS 1YQ3A 3ZSTA 2D9DA 2Y48B 3ZJ1A 1L0VA 1OWAA 1IJ6A 3AEGA 2UXDT 5FNVE 5L3FB 4I55E 4NIQA 1D1CA 1CUNA 1MIWA 3ZYKA 2ZLYA 3ONJA 2BKNA 2XQ4A 3EDVA 1BR1A 3EABA 3HR0A 3UULA 1D1BA 3FZFB 4BAYB 2LRKA 3EUHA 5LGUB 4EZ4A 4YSXA 4TV9E 2WBLA 2B1EA 3LK3B 4HFEA 4IDQA 5AQKB 1OEDB 5C8YE 4TX5A 3RQWA 3RLFF 1WCRA 4DR4T 4PK6A 3L8RA 2CLYB 4JYAT 1X79A 1T72A 2JQ9A 4HFIA 2E2AA 3TLWA 4LFCT 4UIGA 3U78A 2LHRA 4GYRA 2ACXA 2CHOA 4H63H 3P4SA 4X1YE 5HEGA 2MOZA 4EEBA 2XQYA 3KV6A 4F8HA 3H3MA 2ODUA 1IAPA 1OEDE 5H6QB 3RYCE 1BR0A 4M1PA 4C91A 3FBLA 2UXNB 2UXBT 4CI1B 4LFAT 2C5KT 5FMNA 1S94A 4CN6A 3AE8A 1OEDC 2BDEA 5LHGB 3DP7A 4B3RT 4LF5T 2PJQA 2CLYC 2VL0A 1IBKT 4EYYR 4DBQA 3O1HA 3IBPA 1FMWA 2LKGA 3KVAA 1KEYA 3MK7C 1MIYA 1VRBA 3EVYA 4U74A 4O4HE 2WQYA 1XWMA 5FYMA 2XY8B 2SPCA 2VK9A 4PK4A 5HEHA 3O1JA 3CQXC 2NW8A 4OYJA 5AQSB 3QB5A 3A5XA 4GK5E 3ZMZB 5GONE 2VQET 3HKDE 4DV5T 4TUYE 5FXXA 3AEFA 3PUZF 4HFVA 2LSGA 3ETUA 2NP9A 5FXZA 1MIVA 1YQ4A 1HX1B 3NWIA 2J4GA 1WLXA 3P4RA 1XNRT 4LF6T 3KBUA 5EK4A 1FMVA 4HTEA 1UCUA 4AISA 3M65A 3WI3A 4DV6T 3SFDA 4H9SE 2VB6A 4ZS3A 5FY1A 4TWFA 1HNZT 1J1JA 4DBRA 2XQAA 5AFUL 4X5TA 2E5VA 3Q9DA 4O2AE 3RHWA 5FL1A 4DR5T 4QXHB 1HX8A 5JH7E 4YTMA 5AQJB 5EK2A 1XMOT 4X1IE 1OEDA 3N9PA 2C0SA 2DL1A 2FJDA 3OJAA 3CVRA 2DNXA 4YTNA 1M62A 1T98A 3AB3B 2X9HA 5L4HA 2HHHT 4CI3B 4NXMT 4HE8A 3CX8B 5FY0A 3BQIA 1ZP0A 3E22E 3JC6C 4X65T 2BS3A 1IBMT 1LVFA 2D0UA 5JTGA 2YEVC 5AQTB 2A2FX 3F31A 1YKHB 5LBQB 3GA8A 3VHLA 2A72A 4CZZB 3L09A 2C5IT 1IJ5A 5LB7B 4WW0A 4HFBA 2DI4A 4DV4T 4YXDA 1NEKA 4CQIA 1UX4A 4HKAA 4JI3T 5KX5E 1T8BA 3HKCE 3UUBA 4WBNE 1YW0A 4P09A 3ZSSA 1VOMA 4AQGA 4PFOA 3VR8A 4JI1T 2MTQA 4PFPA 3AEDA 4ZI3C 1N36T 2WM9A 3ZC0A 2V8SV 2X67A 4JI7T 5LGNB 3O1IA 4GOUA 3G06A 3FHNA 4HN9A 2LHNA 2MBGA 2V7LA 1SA0E 4MFRA 1KNPA 3ONLC 2XAFB 3ZN0B 2X9YA 4X62T 4IDOA 3C51A 3AEEA 1XMQT 2V26A 5LHHB 3TLSA 3ZN1B 4QX8B 2VKOA 3LBXB 4B3ST 2DCFA 5LYJE 2IAKA 3N9MA 5HEUA 2BBJA 2XAQB 2JRKA 4O8SA 3PUVF 5C2TA 3AEBA 3HL6A 3FZMB 4IHJE 1U5PA 5KXJA 5LXTE 4ZI3D 1N34T 3R84B 2A9UA 2WB5A 2ZM8A 1FJGT 4OHFA 2UU9T 4B3MT 3KV4A 5HXEA 3C4ZA 3SOLA 3MA9A 2QVAA 3PJAA 3ZLIA 3I0QA 2WCAA 2HN1A 2VKHA 4DNDA 4ANJA 5AQOB 3Q5DA 2YKSA 1MMDA 2EHOB 3B5MA 2WZHA 4TNVA 4HEAA 4PAGA 2CHNA 3K1SA 5JDGA 2XAGB 3PV0F 2KSRA 2LOPA 3FZKB 5AQNB 2LSJA 3ZT6A 4AKLA 3VR9A 3PUSA 2V7JA 4AKGA 3J7Yq 5AQQB 2DHRA 3ZKRA 2V7KA 3RF1A 2X9WA 3W15B 4ISSA 4TN7B 2KLQA 3NZPA 2AE9A 4H9OC 2QRXA 4AQFA 2EHOC 2CA5A 3SS1A 2J47A 4ZOLE 2F4VT 3QB5K 4CXXA 3N9LA 5FKYA 2IC6A 1QLBA 1SUMB 2K48A 5F8PA 1XDOA 5FVKA 3RKGA 4ZI2C 3I1AA 3OBVE 3PUXF 2NWBA 2I0MA 5HCJA 3RPUA 4QXBB 1WYCA 1S35A 2LKHA 4U33A 4LMLA 2A3DA 3AE3A 5LA6E 2N9DA 4UELA 3EAMA 4A98A 2XQ5A 5J0ZA 1IZNB 4DIDB 2KZ7B 2Z6EA 5AQHB 4Z91A 5JDHA 4JI2T 3PUWF 3MJXA 4YFSA 5FP3A 3SWHA 3QOFA 2CWYA 4O4IE 4NUUA 2YDSA 5E0OA 2EHOD 4EYUA 2JQKA 4UV9B 4Q25A 3CX6B 1NWMX 4JI5T 4Z8XA 4DR6T 3UU8A 4IE6A 4ILUA 4ZEYA 4ILAA 2WAUA 2XAJB 4ZI2D 3NVOA 3A8YC 3RYIE 2OA5A 5FY7A 2D5UA 5BMVE 3PDYA 3Q2MA 1XDPA 2EHOA 3C4WA 2CBJA 3AE5A 1G8XA 4I0UA 3VRBA 4YY3T 5HXSA 5HYAA 4G2AA 4HGAA 1HG2A 2FBWA 1J5WA 2XSBA 4DUYT 3AVRA 1KFYA 2H89A 2MPKA 4CN1A 2LSKA 3RX6A 2E8IA 2KT9A 4JLEA 3VU7H 5HEOA 4CI2B 5HWXA 3N9OA 1YXRA 2XHEB 2CXLA 2KMFA 3RIUC 4EEDA 2XM1A 2YDRA 3EDUA 2LE8A 3AECA 2X0YA 1O3XA 5FL0A 3NRYA 2CRBA 4CN4A 5L3CB 3KFWX 5L3GB 4H9PC 3H3AA 2QA7A 1U4QA 5ABHA 2CPTA 1MNEA 2LOSA 2W66A 2X66A 4UVAB 3UU6A 3X1DA 3QK6A 3C98B 4G63A 4J2CA 4BJMA 4F6RC 2H7OA 3VRAA 4I43B 2M6IA 4IT4A 4IDPA 3AAEB 2W2UA 5LNKA 4HWHA 2Y6XA 3TKLB 4P1NA 4AXPA 2V6XA 4QWNB 1KNRA 2YK0A 3B57A 4PJMA 4CXYA 3GMIA 3KVBA 1OXZA 2BBHA 4UR9A 4GKKT 2WY2A 2JMHA 4JI6T 5L2LA 4PK5A 2VKJA 5AQVB 2FJAA 5JREA 2DWGA 3NKZA 1I94T 4DUZT 2N2NA 2JQQA 1DU2A 3KDSE 4JEUB 2XM2A 4JI4T 1YD8G 2K5BB 1HR0T 3RKOA 1D0XA 5EK3A 3RRWA 4UEMA 5DQVA 4QH1A 5JR9B 5LHIB 5CJ5A 3UQ7A 2WU5A 2YU2A 4GYSA 1E7PA 4HWDA 4ASKA 3HI2A 4KP3C 3NBXX 4QKNA 3U3IA 1MMNA 5AQFB 3QC9A 4EIWA 5HEJA 4DV1T 3ZMVB 1I6ZA 5IWAT 3LDQB 4LMKA 3AEAA 3AVSA 4KMCA 3LK42 5AQGB 5JDMA 5CA0E 2V7IA 4IL9A 4WZXA 1UURA 2I59A 3RYHE 4KI0F 3P7IA 3N2OA 3RRCA 2X68A 1XZYA 5JR9C 4FI5A 1ZOYA 3KV9A 1W09A 2BS4A 2KINB 3ZYLA 2ZMAA 3JAFA 4U31A 5CGMA 2W4XA 4HWIB 2PTFA 2XSAA 4PW8A 2ZM6T 2G0UA 2YINA 2WZIA 4L0RA 3RI5A 2KXPB 3T1YT 2GK9A 4O2BE 1HG5A 1HCIA 5JDNA 4EAHA 4BA9A 4UF0B 1VCTA 1G73A 4V1Av 3FZHB 2WP9A 3ZMUB 4GIWA 2WMNA 1JNZA 2V7MA 4IE5A 3V5UA 4Z90A 4LF7T 5A1LA 4IE7A 3BQLA 3GN5B 4IE0A 3F57A 5LGTB 3LSVA 3UTKA 5JDFA 1MNDA 4UV8B 3CPZA 3C64A 2LRLA 2B76A 4ZS2A 4H9RC 3UUNA 3ZEFB 2K3WA 1WFDA 3FBZA 3EHZA 2ES0A 1X9BA 3QNUA 1W0BA 3RQUA 4LF4T 3OPCA 4UXNB 1Y01A 1KK7A 5AQUB 1GQEA 5JR9A 1FIOA 5AQRB 2JQHA 2VVSA 4PJNA 2LSIA 2BKOA 3UU4A 3VKGA 2LSYA 5ABEA 3JCFA 3MKDA 4DR1T 2D0TA 1YKEB 2H7VC 3AA1B 4ZI7E 4H9QC 4QX7B 2QGSA 4FJOA 2OV9A 2CBIA 2XTLA 3E0ZA 5EZYE 5LJMA 5J2TE 4A56A 3M3ZB 2NTYA 5FVLA 3PE0A 3L39A 4JI0T 3VKHA 3AA7B 2FUPA 2LEHA 1KF6A 5DQWA 2L9QA 3Q5XA 3PURA 2W67A 4H9NC 3OTOT 2XASB 2VURA 2J1DG 2L3LA 3I0OA 4HWCA 2IDOB 1NAFA 2WWUA 2WU2A 4EOZB 2IW5B 1SE7A 1ZEEA 4E7ZA 1ZKEA 3I9WA 3ZCJA 3PUYF 2YOEA 2CM0A 4HFHA 3K3NA 2CXDA 3MXZA 3D0TA 4I4TE 4ILCA 4JEHB 5F3JA 1ZV4X 3PJAJ 4EXTA 4UF0A 2BS2A 3RC8A 2K9AA 5F5WA 2I6HA 2DWKA 5LCYA 1QUUA 3N2GE 2BG9B 3T8OA 5JVDE 3O9XA 3ESLA 3GN5A 1M7KA 1V9DA 3AE6A 3ZJ2A 4ZHQE 3OYXA 4QH4A 5JQGE 2OLTA 5IHYA 3FXDB 1N32T 2N1GA 2E9XB 2XUEA 4HFDA 1N33T 3LK2B 2WSSV 1KNZA 4DV3T 1QSDA 3AE4A 5ABGA 4DR7T 4HFCA 4JUYA 4EGWA 2BG9E 2KWHA 5LMUT 1R8IA 4QXCB 1HFAA 1UUSA 4LF9T 2BG9C 4XBFB 2WDRA 2X0HA 3AXJB 3UU5A 2NR4A 5ABFB 3PUQA 2VASA 5HXHA 3BQKA 3E08A 2LT3A 3AE7A 2KNDA 3ANWB 2Q9QC 5DJQC 2E9XC 5L3EB 3N2KE 4PJLA 3HA4A 5LBMA 5L3BB 4JI8T 3DJBA 3FB2A 2YU1A 4GKJT 1MMAA 5FXVA 1HNWT 4CXWA 2NW7A 3F2EA 4U3CA 5LG3A 2L8KA 2XZEA 5IYZE 3TLUA 2ACZA 4ISTA 1SHZC 5AQPB 2JPFA 3I9YA 5IUXA 4KHPT 4DV0T 3EI0A 1XNQT 4JBWF 2RP4A 4XAXB 4YT0A 5DABA 5KMGP 1D0ZA 4K0UA 3TLVA 2YDQA 4LFBT 2M6BA 5AQMB 4WBOA 3CQCB 3RH3A 1AJ3A 3DTOA 3NRXA 3AA6B 4LF8T 1E1HB 2Q9QD 2E9XD 3N9NA 2X0LB 4QH5A 5AQLB 3AE9A 3C50A 2E5LT 2IMLA 2BG9A 3HKBE 1BR2A 3B13A 2W00A 2WDVA 1W0AA 2W62A 3MZKB 3OKQA 1D0YA 1JNRA 3J9X1 4HWFA 2UUAT 4XZCA 1MMGA 4OK0A 2D2SA 2Q9QA 3PUAA 5HWYA 2E9XA 2PG8A 3ZYMA 2WDQA 5FXWA 3BK9A 1CHUA 3RGLA 2WWVA 2J62A 5LG4A 2NOXA 4E7SA 3ONXA 1J5ET 2XQ8A 4UVCB 3WAKA 4A97A 3CQGB 3ZMSB 2W63A 2FJBA 1Z8UA 4DMVA 4P0BA 5KDMC 3ZT7A 4YJ2E 3K8PC 1HS7A 3AXJA 3RIFA 1UK5A 5ABFA 3LFMA 3TLTA 3ZMTB 4OX9T 3RIUA 5L47A 2UUBT 3KV5A 4QHOA 4DR3T 1HF8A 3AE2A 3ANWA 4AKHA 3N9QA 3P4WA 2XQ9A 3Q5EA 2CMRA 2X51A 4KBMB 2ODVA 3AA0B 3K3OA 2ZM0A 4AKIA 3UQ4A 4ILBA 4NUVA 4MALA 4A5XA 1T7SA 2XQ7A 4TWHA 4EV6A 3S4UA 2VKDA 3RC3A 2VVNA 4IDZA 2UXCT 3GWHA 3KBTA 3AE1A 5ADXL 3UFGA 3JAEA 4N78D 3Q5WA 2YN6A 2K24A 1US7B 2IC9A 5JDLA 2V6YB 1H7CA 2JJ9A 2HPJA 2CEAA 3P50A 1ZHCA 5HXRA 5CFBA 4AIUA 3UT5E 2V1DB 3IA3A 3UFEA 2BVLA 4LMJA 2IIUA 4WYVA 4JV5T 1WYBA 5L3DB 4U2YA 4YHHT 3ZCIA 3R6NA 4IGUA 4YTPA 3IF8B 4YSZA 4DMWA 4X1KE 1NENA 2UUCT 4TWDA 4KX6A 2R6GF 3PTRB 5HCMA 4YSYA 4DV2T 1W9RA 3OYZA 3JADA 5J2UE 1FEWA 1UX5A 2CCQA 2LLYA 3LJCA 2HN2A 4O4JE 5LP6E 5CB4E 4I50E 3LG7A 3P4PA 2PBIA 4TV8E 5ETWA 3RIAA 1BR4A 5LOVE 5H6RB 4EZHA 4GK0E 4PNIA 1WR6A 4H63V 3UUMA 4U7IA 4YLHA 4O4LE 4MBQA 4X66T 2C5JA 2NW9A 1LVKA 3MACA 3PUGA 3JC6D 3CX7B 3K3QC 4COFA 4X64T 2KWIB 5L4EA 4P0AA 5C3JA 4NXNT 2UXXB 4B3TT 2VQFT 5JRCB 2X9XA 3H37A 4ERRA 5M4YA 2CXFA 3C4XA 4AQFC 2WS3A 3P8CD 2XPKA 3SRZA 4U72A 5CA1E 3CKDA 2BZBA 4L9IA 4YJ3E 5BR8T 4ZZCA 3QUJA 3PU3A 2XQ6A 2ZM2A 4IIJE 2MAWA 4ZXLA 3P4QA 4WNKA 3FXEB 5J1GA 2RPAA 2LM2A 2M67A 2XJ7A 2IUBA 1Z0PA 2VWAA 4DVDA 3SFEA 1WR0A 4C90A 2H88A 4K0KT 5TAOA 3CIRA 2RA1A 2W61A 4DV7T 3UU3A 3T1HT 4IL4A 4KHZF 3AAAB 3PU8A 2BVMA 4PJJA 3AAIA 2CWOA 5HAXA 4U7YA 4U2ZA 4EB6E 2V6YA 4AKRB 3UUXB 3ZC1A 2JIWA 4TZ4C 2BKPA 4NPPA 1D1AA 4MLKA 3ETVA 1UGOA 4DR2T 2CE7A 2DLRA 2XAHB 4ZZBA 5LMNT 3HKEE 3O4XE 4DO0A 3KINB 2NTXA 2MYSA 3FZLB 3WAJA 2JMKA 4X20E 4L5GA 4IE4A 3L3PA 1WRDA 3ZT5A 3ABVA 2VL8A 2V5CA 2LJLA 2XQ3A 2WMOA 3CWZB 1Y64B 4OFZA 4BJNA 2W0GA 3RYFE 2PFVA 3N5LA 2HH7A 5HXCA 4IREA 5AQIB 1EZ3A 4ADZA 4B6XA 1B7TA 1IBLT 2IHR1 2Q9QB 3IHRA 3A7MA 2HPLA
chains in the Genus database with same CATH topology
2I59A 2X0LB 3RYHE 3C50A 3IEEA 3HL6A 4E7ZA 2H3RA 3V5SA 1LKXA 5JDQA 2LM9A 4KUMB 3P7IA 3N2OA 4IHJE 4OYKA 1U5PA 3RRCA 2X68A 3HKBE 1BR2A 5LXTE 4ZI3D 5JR9C 5JRCA 3B13A 3R84B 2W00A 2ZM8A 4FI5A 4OHFA 3KV9A 3KV4A 5HXEA 5LJNA 2P9BA 2KINB 4UVBB 2W62A 3C4ZA 3MZKB 3OKQA 3SOLA 1D0YA 3LBXA 3ZYLA 2ZMAA 3J9X1 3MA9A 4YHJA 4AI6A 3ZLIA 3I0QA 3NZQA 3ZPOA 2VKHA 2Y8DA 4XZCA 1HTJF 1MMGA 4DNDA 4MHCA 4ANJA 1LRZA 4OK0A 4PW8A 2D2SA 2Q9QA 1MMDA 3CMLA 3PUAA 2EHOB 5HWYA 2G0UA 2E9XA 2PG8A 3ZYMA 2YINA 5FXWA 4L0RA 3BK9A 4HEAA 4PAGA 5LG4A 2KXPB 2NOXA 5JDGA 4E7SA 3ONXA 2XAGB 2GK9A 4UVCB 2Y48B 3ZJ1A 2LOPA 3WAKA 1OWAA 2LSJA 3CQGB 1IJ6A 4O2BE 3ZMSB 1HG5A 2W63A 1HCIA 5FNVE 4AKLA 5L3FB 5JDNA 4EAHA 4I55E 4BA9A 3PUSA 4UF0B 2V7JA 4DMVA 4AKGA 4P0BA 1D1CA 5KDMC 3J7Yq 1CUNA 1G73A 4V1Av 1MIWA 4YJ2E 3ZYKA 2ZLYA 3K8PC 3ZMUB 1HS7A 2DHRA 4GIWA 2WMNA 2V7KA 3EDVA 1BR1A 3HR0A 3UULA 2V7MA 4IE5A 3V5UA 1D1BA 5A1LA 3LFMA 4BAYB 3ZMTB 4IE7A 2X9WA 3W15B 4ISSA 3EUHA 3KV5A 3BQLA 3GN5B 4IE0A 4QHOA 3F57A 4TN7B 5LGTB 1HF8A 3ANWA 2KLQA 3NZPA 3UTKA 5LGUB 4AKHA 3N9QA 5JDFA 4H9OC 2CMRA 4AQFA 4EZ4A 4TV9E 2X51A 1MNDA 2WBLA 2B1EA 3LK3B 4KBMB 2EHOC 2CA5A 4UV8B 2ODVA 3CPZA 3AA0B 3SS1A 3C64A 3K3OA 5C8YE 4ZOLE 4TX5A 4CXXA 4ZS2A 4PK6A 2ZM0A 4AKIA 2CLYB 4H9RC 3UUNA 1X79A 3N9LA 2IC6A 3FBZA 3ZEFB 4NUVA 5F8PA 2K48A 2ES0A 4MALA 4UIGA 3U78A 2LHRA 4GYRA 4ZI2C 2ACXA 3I1AA 4H63H 3OBVE 2NWBA 4X1YE 2VKDA 3S4UA 4UXNB 3RC3A 1KK7A 2MOZA 4IDZA 2XQYA 5JR9A 3RPUA 4QXBB 1FIOA 1WYCA 3KV6A 3GWHA 1S35A 4PJNA 2LSIA 3KBTA 2A3DA 5ADXL 3VKGA 2LSYA 2ODUA 4N78D 1IAPA 3Q5WA 5H6QB 5LA6E 2N9DA 3MKDA 4UELA 3RYCE 4M1PA 4C91A 1BR0A 3FBLA 2UXNB 2D0TA 1YKEB 4CI1B 2K24A 1US7B 2C5KT 2H7VC 3AA1B 4ZI7E 4H9QC 4QX7B 2IC9A 5JDLA 1IZNB 2QGSA 4FJOA 5FMNA 1S94A 2BDEA 1H7CA 5LHGB 2KZ7B 2Z6EA 2XTLA 5JDHA 3DP7A 3E0ZA 5EZYE 5LJMA 5J2TE 2JJ9A 2PJQA 2HPJA 2CEAA 1ZHCA 5HXRA 3MJXA 2CLYC 4YFSA 3UT5E 4A56A 2V1DB 5FP3A 3SWHA 3UFEA 4O4IE 2BVLA 2CWYA 4NUUA 2NTYA 1WYBA 5E0OA 5L3DB 4EYYR 3PE0A 2EHOD 4DBQA 4EYUA 3O1HA 3VKHA 3IBPA 3AA7B 1FMWA 3ZCIA 4UV9B 3KVAA 3R6NA 3MK7C 1MIYA 4IGUA 1VRBA 3EVYA 4U74A 4O4HE 2LEHA 3CX6B 3IF8B 1NWMX 5FYMA 5DQWA 2L9QA 3Q5XA 2SPCA 3PURA 4DMWA 4Z8XA 4X1KE 4H9NC 2VK9A 4PK4A 2XASB 3O1JA 3CQXC 2J1DG 4IE6A 4ILUA 2WAUA 2XAJB 2L3LA 4ZI2D 3I0OA 2NW8A 4OYJA 3RYIE 1NAFA 2OA5A 2WWUA 3A5XA 3PTRB 5FY7A 2D5UA 4GK5E 3ZMZB 5BMVE 5GONE 4EOZB 3OYZA 3PDYA 3HKDE 5J2UE 3Q2MA 1FEWA 2IW5B 1UX5A 2CCQA 4TUYE 3LJCA 2EHOA 1ZEEA 3C4WA 4O4JE 5FXXA 1ZKEA 4I50E 3I9WA 3LG7A 5CB4E 1G8XA 2PBIA 5LP6E 3ZCJA 4TV8E 5ETWA 5HXSA 1BR4A 5HYAA 5LOVE 4G2AA 5H6RB 4HFVA 2CM0A 2LSGA 3ETUA 4EZHA 2NP9A 3K3NA 4HGAA 4GK0E 1HG2A 5FXZA 4PNIA 2CXDA 3MXZA 1WR6A 3D0TA 4H63V 3UUMA 3AVRA 4I4TE 1MIVA 4YLHA 4JEHB 4O4LE 5F3JA 1ZV4X 1WLXA 4EXTA 2LSKA 4UF0A 3RX6A 3RC8A 4MBQA 3KBUA 5EK4A 1FMVA 2K9AA 2C5JA 2E8IA 2NW9A 1LVKA 3MACA 2DWKA 3PUGA 4HTEA 5LCYA 1UCUA 3JC6D 2KT9A 3CX7B 3M65A 4JLEA 1QUUA 3K3QC 3VU7H 3WI3A 4CI2B 5HWXA 3N9OA 4H9SE 2VB6A 4ZS3A 2XHEB 5FY1A 2KWIB 4P0AA 2CXLA 3N2GE 3T8OA 2KMFA 2UXXB 5JRCB 5JVDE 2X9XA 3H37A 4DBRA 3O9XA 4ERRA 3ESLA 5M4YA 3EDUA 2CXFA 3C4XA 3GN5A 4AQFC 2LE8A 5AFUL 3P8CD 1V9DA 1O3XA 3Q9DA 4O2AE 4QXHB 1HX8A 3NRYA 5JH7E 3SRZA 5EK2A 4U72A 5CA1E 3CKDA 4X1IE 3ZJ2A 4ZHQE 3N9PA 3OYXA 2BZBA 5L3CB 2C0SA 3KFWX 4L9IA 3OJAA 5JQGE 4YJ3E 5L3GB 3QUJA 4H9PC 3H3AA 2QA7A 5IHYA 1U4QA 3CVRA 3FXDB 3PU3A 2DNXA 2N1GA 2E9XB 2ZM2A 2XUEA 4IIJE 1T98A 3AB3B 3LK2B 1MNEA 2LOSA 2X66A 2WSSV 4UVAB 4WNKA 2X9HA 1KNZA 1QSDA 3FXEB 4CI3B 4HE8A 5J1GA 4JUYA 3CX8B 5FY0A 3QK6A 3BQIA 3E22E 3JC6C 2KWHA 3C98B 2M67A 4G63A 4J2CA 1Z0PA 4BJMA 4F6RC 1LVFA 2H7OA 2VWAA 4DVDA 4QXCB 4C90A 2D0UA 4I43B 1HFAA 2YEVC 5TAOA 3AAEB 4XBFB 2RA1A 2W61A 2A2FX 5LNKA 2Y6XA 3F31A 1YKHB 5LBQB 3TKLB 3GA8A 3VHLA 3AAAB 4AXPA 3PU8A 2A72A 2BVMA 4PJJA 3AAIA 2CWOA 4QWNB 3B57A 2YK0A 4PJMA 4CZZB 5HAXA 3PUQA 3L09A 2C5IT 1IJ5A 4WW0A 4CXYA 3GMIA 3KVBA 2VASA 4EB6E 5HXHA 3BQKA 3E08A 1OXZA 2DI4A 2LT3A 2KNDA 3ANWB 2JMHA 4AKRB 3UUXB 4CQIA 2Q9QC 5DJQC 3ZC1A 5L2LA 4PK5A 1UX4A 4HKAA 2E9XC 5L3EB 2VKJA 4TZ4C 3N2KE 1D1AA 4PJLA 5KX5E 3HA4A 4MLKA 3HKCE 5JREA 2DWGA 3ETVA 5LBMA 4WBNE 1YW0A 4P09A 5L3BB 3DJBA 3FB2A 2N2NA 1VOMA 2JQQA 2CE7A 2YU1A 4AQGA 4PFOA 2DLRA 2XAHB 1MMAA 2MTQA 5FXVA 4PFPA 4CXWA 2NW7A 3F2EA 3KDSE 4ZI3C 4JEUB 2WM9A 3ZC0A 2X67A 2L8KA 3HKEE 3O4XE 1YD8G 4DO0A 3KINB 2K5BB 5LGNB 3RKOA 1D0XA 3O1IA 4GOUA 5IYZE 2NTXA 4ISTA 5EK3A 3RRWA 1SHZC 3FHNA 4HN9A 4UEMA 5DQVA 2LHNA 2MYSA 2JPFA 2MBGA 3I9YA 5JR9B 3WAJA 2V7LA 5LHIB 1SA0E 4MFRA 2JMKA 2RP4A 2YU2A 4X20E 4L5GA 4IE4A 3L3PA 1WRDA 4GYSA 4XAXB 2XAFB 4ASKA 3HI2A 5DABA 4KP3C 5KMGP 1D0ZA 3ZN0B 2X9YA 3NBXX 4K0UA 2VL8A 3C51A 4QKNA 2LJLA 2V26A 3U3IA 5LHHB 2WMOA 3CWZB 1MMNA 1Y64B 3ZN1B 4QX8B 2VKOA 4OFZA 2W0GA 3LBXB 4BJNA 3RYFE 2PFVA 3QC9A 3N5LA 4EIWA 2HH7A 4WBOA 5HXCA 2DCFA 3CQCB 3ZMVB 5LYJE 1EZ3A 3RH3A 2IAKA 4ADZA 1AJ3A 4B6XA 3N9MA 3DTOA 3NRXA 3AA6B 3AVSA 1B7TA 4KMCA 3LK42 1E1HB 5JDMA 2XAQB 5CA0E 2Q9QB 2V7IA 2Q9QD 3IHRA 2JRKA 4O8SA 2E9XD 3N9NA 2HPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2S A; 
#chains in the Genus database with same CATH topology
 3IEE A;  2H3R A;  3V5S A;  1LKX A;  5JDQ A;  2LM9 A;  4KUM B;  2FJE A;  4OYK A;  1HNX T;  4TNW A;  5JRC A;  5LJN A;  2QYW A;  3OVU A;  2P9B A;  4UVB B;  3LBX A;  1E2A A;  4YHJ A;  4AI6 A;  4AQY T;  3NZQ A;  3ZPO A;  2Y8D A;  1HTJ F;  4IDN A;  4MHC A;  1LRZ A;  2V5D A;  3CML A;  1VCS A;  3CK6 A;  2AXD S;  1YQ3 A;  3ZST A;  2D9D A;  2Y48 B;  3ZJ1 A;  1L0V A;  1OWA A;  1IJ6 A;  3AEG A;  2UXD T;  5FNV E;  5L3F B;  4I55 E;  4NIQ A;  1D1C A;  1CUN A;  1MIW A;  3ZYK A;  2ZLY A;  3ONJ A;  2BKN A;  2XQ4 A;  3EDV A;  1BR1 A;  3EAB A;  3HR0 A;  3UUL A;  1D1B A;  3FZF B;  4BAY B;  2LRK A;  3EUH A;  5LGU B;  4EZ4 A;  4YSX A;  4TV9 E;  2WBL A;  2B1E A;  3LK3 B;  4HFE A;  4IDQ A;  5AQK B;  1OED B;  5C8Y E;  4TX5 A;  3RQW A;  3RLF F;  1WCR A;  4DR4 T;  4PK6 A;  3L8R A;  2CLY B;  4JYA T;  1X79 A;  1T72 A;  2JQ9 A;  4HFI A;  2E2A A;  3TLW A;  4LFC T;  4UIG A;  3U78 A;  2LHR A;  4GYR A;  2ACX A;  2CHO A;  4H63 H;  3P4S A;  4X1Y E;  5HEG A;  2MOZ A;  4EEB A;  2XQY A;  3KV6 A;  4F8H A;  3H3M A;  2ODU A;  1IAP A;  1OED E;  5H6Q B;  3RYC E;  1BR0 A;  4M1P A;  4C91 A;  3FBL A;  2UXN B;  2UXB T;  4CI1 B;  4LFA T;  2C5K T;  5FMN A;  1S94 A;  4CN6 A;  3AE8 A;  1OED C;  2BDE A;  5LHG B;  3DP7 A;  4B3R T;  4LF5 T;  2PJQ A;  2CLY C;  2VL0 A;  1IBK T;  4EYY R;  4DBQ A;  3O1H A;  3IBP A;  1FMW A;  2LKG A;  3KVA A;  1KEY A;  3MK7 C;  1MIY A;  1VRB A;  3EVY A;  4U74 A;  4O4H E;  2WQY A;  1XWM A;  5FYM A;  2XY8 B;  2SPC A;  2VK9 A;  4PK4 A;  5HEH A;  3O1J A;  3CQX C;  2NW8 A;  4OYJ A;  5AQS B;  3QB5 A;  3A5X A;  4GK5 E;  3ZMZ B;  5GON E;  2VQE T;  3HKD E;  4DV5 T;  4TUY E;  5FXX A;  3AEF A;  3PUZ F;  4HFV A;  2LSG A;  3ETU A;  2NP9 A;  5FXZ A;  1MIV A;  1YQ4 A;  1HX1 B;  3NWI A;  2J4G A;  1WLX A;  3P4R A;  1XNR T;  4LF6 T;  3KBU A;  5EK4 A;  1FMV A;  4HTE A;  1UCU A;  4AIS A;  3M65 A;  3WI3 A;  4DV6 T;  3SFD A;  4H9S E;  2VB6 A;  4ZS3 A;  5FY1 A;  4TWF A;  1HNZ T;  1J1J A;  4DBR A;  2XQA A;  5AFU L;  4X5T A;  2E5V A;  3Q9D A;  4O2A E;  3RHW A;  5FL1 A;  4DR5 T;  4QXH B;  1HX8 A;  5JH7 E;  4YTM A;  5AQJ B;  5EK2 A;  1XMO T;  4X1I E;  1OED A;  3N9P A;  2C0S A;  2DL1 A;  2FJD A;  3OJA A;  3CVR A;  2DNX A;  4YTN A;  1M62 A;  1T98 A;  3AB3 B;  2X9H A;  5L4H A;  2HHH T;  4CI3 B;  4NXM T;  4HE8 A;  3CX8 B;  5FY0 A;  3BQI A;  1ZP0 A;  3E22 E;  3JC6 C;  4X65 T;  2BS3 A;  1IBM T;  1LVF A;  2D0U A;  5JTG A;  2YEV C;  5AQT B;  2A2F X;  3F31 A;  1YKH B;  5LBQ B;  3GA8 A;  3VHL A;  2A72 A;  4CZZ B;  3L09 A;  2C5I T;  1IJ5 A;  5LB7 B;  4WW0 A;  4HFB A;  2DI4 A;  4DV4 T;  4YXD A;  1NEK A;  4CQI A;  1UX4 A;  4HKA A;  4JI3 T;  5KX5 E;  1T8B A;  3HKC E;  3UUB A;  4WBN E;  1YW0 A;  4P09 A;  3ZSS A;  1VOM A;  4AQG A;  4PFO A;  3VR8 A;  4JI1 T;  2MTQ A;  4PFP A;  3AED A;  4ZI3 C;  1N36 T;  2WM9 A;  3ZC0 A;  2V8S V;  2X67 A;  4JI7 T;  5LGN B;  3O1I A;  4GOU A;  3G06 A;  3FHN A;  4HN9 A;  2LHN A;  2MBG A;  2V7L A;  1SA0 E;  4MFR A;  1KNP A;  3ONL C;  2XAF B;  3ZN0 B;  2X9Y A;  4X62 T;  4IDO A;  3C51 A;  3AEE A;  1XMQ T;  2V26 A;  5LHH B;  3TLS A;  3ZN1 B;  4QX8 B;  2VKO A;  3LBX B;  4B3S T;  2DCF A;  5LYJ E;  2IAK A;  3N9M A;  5HEU A;  2BBJ A;  2XAQ B;  2JRK A;  4O8S A;  3PUV F;  5C2T A;  3AEB A;  3HL6 A;  3FZM B;  4IHJ E;  1U5P A;  5KXJ A;  5LXT E;  4ZI3 D;  1N34 T;  3R84 B;  2A9U A;  2WB5 A;  2ZM8 A;  1FJG T;  4OHF A;  2UU9 T;  4B3M T;  3KV4 A;  5HXE A;  3C4Z A;  3SOL A;  3MA9 A;  2QVA A;  3PJA A;  3ZLI A;  3I0Q A;  2WCA A;  2HN1 A;  2VKH A;  4DND A;  4ANJ A;  5AQO B;  3Q5D A;  2YKS A;  1MMD A;  2EHO B;  3B5M A;  2WZH A;  4TNV A;  4HEA A;  4PAG A;  2CHN A;  3K1S A;  5JDG A;  2XAG B;  3PV0 F;  2KSR A;  2LOP A;  3FZK B;  5AQN B;  2LSJ A;  3ZT6 A;  4AKL A;  3VR9 A;  3PUS A;  2V7J A;  4AKG A;  3J7Y q;  5AQQ B;  2DHR A;  3ZKR A;  2V7K A;  3RF1 A;  2X9W A;  3W15 B;  4ISS A;  4TN7 B;  2KLQ A;  3NZP A;  2AE9 A;  4H9O C;  2QRX A;  4AQF A;  2EHO C;  2CA5 A;  3SS1 A;  2J47 A;  4ZOL E;  2F4V T;  3QB5 K;  4CXX A;  3N9L A;  5FKY A;  2IC6 A;  1QLB A;  1SUM B;  2K48 A;  5F8P A;  1XDO A;  5FVK A;  3RKG A;  4ZI2 C;  3I1A A;  3OBV E;  3PUX F;  2NWB A;  2I0M A;  5HCJ A;  3RPU A;  4QXB B;  1WYC A;  1S35 A;  2LKH A;  4U33 A;  4LML A;  2A3D A;  3AE3 A;  5LA6 E;  2N9D A;  4UEL A;  3EAM A;  4A98 A;  2XQ5 A;  5J0Z A;  1IZN B;  4DID B;  2KZ7 B;  2Z6E A;  5AQH B;  4Z91 A;  5JDH A;  4JI2 T;  3PUW F;  3MJX A;  4YFS A;  5FP3 A;  3SWH A;  3QOF A;  2CWY A;  4O4I E;  4NUU A;  2YDS A;  5E0O A;  2EHO D;  4EYU A;  2JQK A;  4UV9 B;  4Q25 A;  3CX6 B;  1NWM X;  4JI5 T;  4Z8X A;  4DR6 T;  3UU8 A;  4IE6 A;  4ILU A;  4ZEY A;  4ILA A;  2WAU A;  2XAJ B;  4ZI2 D;  3NVO A;  3A8Y C;  3RYI E;  2OA5 A;  5FY7 A;  2D5U A;  5BMV E;  3PDY A;  3Q2M A;  1XDP A;  2EHO A;  3C4W A;  2CBJ A;  3AE5 A;  1G8X A;  4I0U A;  3VRB A;  4YY3 T;  5HXS A;  5HYA A;  4G2A A;  4HGA A;  1HG2 A;  2FBW A;  1J5W A;  2XSB A;  4DUY T;  3AVR A;  1KFY A;  2H89 A;  2MPK A;  4CN1 A;  2LSK A;  3RX6 A;  2E8I A;  2KT9 A;  4JLE A;  3VU7 H;  5HEO A;  4CI2 B;  5HWX A;  3N9O A;  1YXR A;  2XHE B;  2CXL A;  2KMF A;  3RIU C;  4EED A;  2XM1 A;  2YDR A;  3EDU A;  2LE8 A;  3AEC A;  2X0Y A;  1O3X A;  5FL0 A;  3NRY A;  2CRB A;  4CN4 A;  5L3C B;  3KFW X;  5L3G B;  4H9P C;  3H3A A;  2QA7 A;  1U4Q A;  5ABH A;  2CPT A;  1MNE A;  2LOS A;  2W66 A;  2X66 A;  4UVA B;  3UU6 A;  3X1D A;  3QK6 A;  3C98 B;  4G63 A;  4J2C A;  4BJM A;  4F6R C;  2H7O A;  3VRA A;  4I43 B;  2M6I A;  4IT4 A;  4IDP A;  3AAE B;  2W2U A;  5LNK A;  4HWH A;  2Y6X A;  3TKL B;  4P1N A;  4AXP A;  2V6X A;  4QWN B;  1KNR A;  2YK0 A;  3B57 A;  4PJM A;  4CXY A;  3GMI A;  3KVB A;  1OXZ A;  2BBH A;  4UR9 A;  4GKK T;  2WY2 A;  2JMH A;  4JI6 T;  5L2L A;  4PK5 A;  2VKJ A;  5AQV B;  2FJA A;  5JRE A;  2DWG A;  3NKZ A;  1I94 T;  4DUZ T;  2N2N A;  2JQQ A;  1DU2 A;  3KDS E;  4JEU B;  2XM2 A;  4JI4 T;  1YD8 G;  2K5B B;  1HR0 T;  3RKO A;  1D0X A;  5EK3 A;  3RRW A;  4UEM A;  5DQV A;  4QH1 A;  5JR9 B;  5LHI B;  5CJ5 A;  3UQ7 A;  2WU5 A;  2YU2 A;  4GYS A;  1E7P A;  4HWD A;  4ASK A;  3HI2 A;  4KP3 C;  3NBX X;  4QKN A;  3U3I A;  1MMN A;  5AQF B;  3QC9 A;  4EIW A;  5HEJ A;  4DV1 T;  3ZMV B;  1I6Z A;  5IWA T;  3LDQ B;  4LMK A;  3AEA A;  3AVS A;  4KMC A;  3LK4 2;  5AQG B;  5JDM A;  5CA0 E;  2V7I A;  4IL9 A;  4WZX A;  1UUR A;  2I59 A;  3RYH E;  4KI0 F;  3P7I A;  3N2O A;  3RRC A;  2X68 A;  1XZY A;  5JR9 C;  4FI5 A;  1ZOY A;  3KV9 A;  1W09 A;  2BS4 A;  2KIN B;  3ZYL A;  2ZMA A;  3JAF A;  4U31 A;  5CGM A;  2W4X A;  4HWI B;  2PTF A;  2XSA A;  4PW8 A;  2ZM6 T;  2G0U A;  2YIN A;  2WZI A;  4L0R A;  3RI5 A;  2KXP B;  3T1Y T;  2GK9 A;  4O2B E;  1HG5 A;  1HCI A;  5JDN A;  4EAH A;  4BA9 A;  4UF0 B;  1VCT A;  1G73 A;  4V1A v;  3FZH B;  2WP9 A;  3ZMU B;  4GIW A;  2WMN A;  1JNZ A;  2V7M A;  4IE5 A;  3V5U A;  4Z90 A;  4LF7 T;  5A1L A;  4IE7 A;  3BQL A;  3GN5 B;  4IE0 A;  3F57 A;  5LGT B;  3LSV A;  3UTK A;  5JDF A;  1MND A;  4UV8 B;  3CPZ A;  3C64 A;  2LRL A;  2B76 A;  4ZS2 A;  4H9R C;  3UUN A;  3ZEF B;  2K3W A;  1WFD A;  3FBZ A;  3EHZ A;  2ES0 A;  1X9B A;  3QNU A;  1W0B A;  3RQU A;  4LF4 T;  3OPC A;  4UXN B;  1Y01 A;  1KK7 A;  5AQU B;  1GQE A;  5JR9 A;  1FIO A;  5AQR B;  2JQH A;  2VVS A;  4PJN A;  2LSI A;  2BKO A;  3UU4 A;  3VKG A;  2LSY A;  5ABE A;  3JCF A;  3MKD A;  4DR1 T;  2D0T A;  1YKE B;  2H7V C;  3AA1 B;  4ZI7 E;  4H9Q C;  4QX7 B;  2QGS A;  4FJO A;  2OV9 A;  2CBI A;  2XTL A;  3E0Z A;  5EZY E;  5LJM A;  5J2T E;  4A56 A;  3M3Z B;  2NTY A;  5FVL A;  3PE0 A;  3L39 A;  4JI0 T;  3VKH A;  3AA7 B;  2FUP A;  2LEH A;  1KF6 A;  5DQW A;  2L9Q A;  3Q5X A;  3PUR A;  2W67 A;  4H9N C;  3OTO T;  2XAS B;  2VUR A;  2J1D G;  2L3L A;  3I0O A;  4HWC A;  2IDO B;  1NAF A;  2WWU A;  2WU2 A;  4EOZ B;  2IW5 B;  1SE7 A;  1ZEE A;  4E7Z A;  1ZKE A;  3I9W A;  3ZCJ A;  3PUY F;  2YOE A;  2CM0 A;  4HFH A;  3K3N A;  2CXD A;  3MXZ A;  3D0T A;  4I4T E;  4ILC A;  4JEH B;  5F3J A;  1ZV4 X;  3PJA J;  4EXT A;  4UF0 A;  2BS2 A;  3RC8 A;  2K9A A;  5F5W A;  2I6H A;  2DWK A;  5LCY A;  1QUU A;  3N2G E;  2BG9 B;  3T8O A;  5JVD E;  3O9X A;  3ESL A;  3GN5 A;  1M7K A;  1V9D A;  3AE6 A;  3ZJ2 A;  4ZHQ E;  3OYX A;  4QH4 A;  5JQG E;  2OLT A;  5IHY A;  3FXD B;  1N32 T;  2N1G A;  2E9X B;  2XUE A;  4HFD A;  1N33 T;  3LK2 B;  2WSS V;  1KNZ A;  4DV3 T;  1QSD A;  3AE4 A;  5ABG A;  4DR7 T;  4HFC A;  4JUY A;  4EGW A;  2BG9 E;  2KWH A;  5LMU T;  1R8I A;  4QXC B;  1HFA A;  1UUS A;  4LF9 T;  2BG9 C;  4XBF B;  2WDR A;  2X0H A;  3AXJ B;  3UU5 A;  2NR4 A;  5ABF B;  3PUQ A;  2VAS A;  5HXH A;  3BQK A;  3E08 A;  2LT3 A;  3AE7 A;  2KND A;  3ANW B;  2Q9Q C;  5DJQ C;  2E9X C;  5L3E B;  3N2K E;  4PJL A;  3HA4 A;  5LBM A;  5L3B B;  4JI8 T;  3DJB A;  3FB2 A;  2YU1 A;  4GKJ T;  1MMA A;  5FXV A;  1HNW T;  4CXW A;  2NW7 A;  3F2E A;  4U3C A;  5LG3 A;  2L8K A;  2XZE A;  5IYZ E;  3TLU A;  2ACZ A;  4IST A;  1SHZ C;  5AQP B;  2JPF A;  3I9Y A;  5IUX A;  4KHP T;  4DV0 T;  3EI0 A;  1XNQ T;  4JBW F;  2RP4 A;  4XAX B;  4YT0 A;  5DAB A;  5KMG P;  1D0Z A;  4K0U A;  3TLV A;  2YDQ A;  4LFB T;  2M6B A;  5AQM B;  4WBO A;  3CQC B;  3RH3 A;  1AJ3 A;  3DTO A;  3NRX A;  3AA6 B;  4LF8 T;  1E1H B;  2Q9Q D;  2E9X D;  3N9N A;  2X0L B;  4QH5 A;  5AQL B;  3AE9 A;  3C50 A;  2E5L T;  2IML A;  2BG9 A;  3HKB E;  1BR2 A;  3B13 A;  2W00 A;  2WDV A;  1W0A A;  2W62 A;  3MZK B;  3OKQ A;  1D0Y A;  1JNR A;  3J9X 1;  4HWF A;  2UUA T;  4XZC A;  1MMG A;  4OK0 A;  2D2S A;  2Q9Q A;  3PUA A;  5HWY A;  2E9X A;  2PG8 A;  3ZYM A;  2WDQ A;  5FXW A;  3BK9 A;  1CHU A;  3RGL A;  2WWV A;  2J62 A;  5LG4 A;  2NOX A;  4E7S A;  3ONX A;  1J5E T;  2XQ8 A;  4UVC B;  3WAK A;  4A97 A;  3CQG B;  3ZMS B;  2W63 A;  2FJB A;  1Z8U A;  4DMV A;  4P0B A;  5KDM C;  3ZT7 A;  4YJ2 E;  3K8P C;  1HS7 A;  3AXJ A;  3RIF A;  1UK5 A;  5ABF A;  3LFM A;  3TLT A;  3ZMT B;  4OX9 T;  3RIU A;  5L47 A;  2UUB T;  3KV5 A;  4QHO A;  4DR3 T;  1HF8 A;  3AE2 A;  3ANW A;  4AKH A;  3N9Q A;  3P4W A;  2XQ9 A;  3Q5E A;  2CMR A;  2X51 A;  4KBM B;  2ODV A;  3AA0 B;  3K3O A;  2ZM0 A;  4AKI A;  3UQ4 A;  4ILB A;  4NUV A;  4MAL A;  4A5X A;  1T7S A;  2XQ7 A;  4TWH A;  4EV6 A;  3S4U A;  2VKD A;  3RC3 A;  2VVN A;  4IDZ A;  2UXC T;  3GWH A;  3KBT A;  3AE1 A;  5ADX L;  3UFG A;  3JAE A;  4N78 D;  3Q5W A;  2YN6 A;  2K24 A;  1US7 B;  2IC9 A;  5JDL A;  2V6Y B;  1H7C A;  2JJ9 A;  2HPJ A;  2CEA A;  3P50 A;  1ZHC A;  5HXR A;  5CFB A;  4AIU A;  3UT5 E;  2V1D B;  3IA3 A;  3UFE A;  2BVL A;  4LMJ A;  2IIU A;  4WYV A;  4JV5 T;  1WYB A;  5L3D B;  4U2Y A;  4YHH T;  3ZCI A;  3R6N A;  4IGU A;  4YTP A;  3IF8 B;  4YSZ A;  4DMW A;  4X1K E;  1NEN A;  2UUC T;  4TWD A;  4KX6 A;  2R6G F;  3PTR B;  5HCM A;  4YSY A;  4DV2 T;  1W9R A;  3OYZ A;  3JAD A;  5J2U E;  1FEW A;  1UX5 A;  2CCQ A;  2LLY A;  3LJC A;  2HN2 A;  4O4J E;  5LP6 E;  5CB4 E;  4I50 E;  3LG7 A;  3P4P A;  2PBI A;  4TV8 E;  5ETW A;  3RIA A;  1BR4 A;  5LOV E;  5H6R B;  4EZH A;  4GK0 E;  4PNI A;  1WR6 A;  4H63 V;  3UUM A;  4U7I A;  4YLH A;  4O4L E;  4MBQ A;  4X66 T;  2C5J A;  2NW9 A;  1LVK A;  3MAC A;  3PUG A;  3JC6 D;  3CX7 B;  3K3Q C;  4COF A;  4X64 T;  2KWI B;  5L4E A;  4P0A A;  5C3J A;  4NXN T;  2UXX B;  4B3T T;  2VQF T;  5JRC B;  2X9X A;  3H37 A;  4ERR A;  5M4Y A;  2CXF A;  3C4X A;  4AQF C;  2WS3 A;  3P8C D;  2XPK A;  3SRZ A;  4U72 A;  5CA1 E;  3CKD A;  2BZB A;  4L9I A;  4YJ3 E;  5BR8 T;  4ZZC A;  3QUJ A;  3PU3 A;  2XQ6 A;  2ZM2 A;  4IIJ E;  2MAW A;  4ZXL A;  3P4Q A;  4WNK A;  3FXE B;  5J1G A;  2RPA A;  2LM2 A;  2M67 A;  2XJ7 A;  2IUB A;  1Z0P A;  2VWA A;  4DVD A;  3SFE A;  1WR0 A;  4C90 A;  2H88 A;  4K0K T;  5TAO A;  3CIR A;  2RA1 A;  2W61 A;  4DV7 T;  3UU3 A;  3T1H T;  4IL4 A;  4KHZ F;  3AAA B;  3PU8 A;  2BVM A;  4PJJ A;  3AAI A;  2CWO A;  5HAX A;  4U7Y A;  4U2Z A;  4EB6 E;  2V6Y A;  4AKR B;  3UUX B;  3ZC1 A;  2JIW A;  4TZ4 C;  2BKP A;  4NPP A;  1D1A A;  4MLK A;  3ETV A;  1UGO A;  4DR2 T;  2CE7 A;  2DLR A;  2XAH B;  4ZZB A;  5LMN T;  3HKE E;  3O4X E;  4DO0 A;  3KIN B;  2NTX A;  2MYS A;  3FZL B;  3WAJ A;  2JMK A;  4X20 E;  4L5G A;  4IE4 A;  3L3P A;  1WRD A;  3ZT5 A;  3ABV A;  2VL8 A;  2V5C A;  2LJL A;  2XQ3 A;  2WMO A;  3CWZ B;  1Y64 B;  4OFZ A;  4BJN A;  2W0G A;  3RYF E;  2PFV A;  3N5L A;  2HH7 A;  5HXC A;  4IRE A;  5AQI B;  1EZ3 A;  4ADZ A;  4B6X A;  1B7T A;  1IBL T;  2IHR 1;  2Q9Q B;  3IHR A;  3A7M A;  2HPL A; 
#chains in the Genus database with same CATH homology
 2I59 A;  2X0L B;  3RYH E;  3C50 A;  3IEE A;  3HL6 A;  4E7Z A;  2H3R A;  3V5S A;  1LKX A;  5JDQ A;  2LM9 A;  4KUM B;  3P7I A;  3N2O A;  4IHJ E;  4OYK A;  1U5P A;  3RRC A;  2X68 A;  3HKB E;  1BR2 A;  5LXT E;  4ZI3 D;  5JR9 C;  5JRC A;  3B13 A;  3R84 B;  2W00 A;  2ZM8 A;  4FI5 A;  4OHF A;  3KV9 A;  3KV4 A;  5HXE A;  5LJN A;  2P9B A;  2KIN B;  4UVB B;  2W62 A;  3C4Z A;  3MZK B;  3OKQ A;  3SOL A;  1D0Y A;  3LBX A;  3ZYL A;  2ZMA A;  3J9X 1;  3MA9 A;  4YHJ A;  4AI6 A;  3ZLI A;  3I0Q A;  3NZQ A;  3ZPO A;  2VKH A;  2Y8D A;  4XZC A;  1HTJ F;  1MMG A;  4DND A;  4MHC A;  4ANJ A;  1LRZ A;  4OK0 A;  4PW8 A;  2D2S A;  2Q9Q A;  1MMD A;  3CML A;  3PUA A;  2EHO B;  5HWY A;  2G0U A;  2E9X A;  2PG8 A;  3ZYM A;  2YIN A;  5FXW A;  4L0R A;  3BK9 A;  4HEA A;  4PAG A;  5LG4 A;  2KXP B;  2NOX A;  5JDG A;  4E7S A;  3ONX A;  2XAG B;  2GK9 A;  4UVC B;  2Y48 B;  3ZJ1 A;  2LOP A;  3WAK A;  1OWA A;  2LSJ A;  3CQG B;  1IJ6 A;  4O2B E;  3ZMS B;  1HG5 A;  2W63 A;  1HCI A;  5FNV E;  4AKL A;  5L3F B;  5JDN A;  4EAH A;  4I55 E;  4BA9 A;  3PUS A;  4UF0 B;  2V7J A;  4DMV A;  4AKG A;  4P0B A;  1D1C A;  5KDM C;  3J7Y q;  1CUN A;  1G73 A;  4V1A v;  1MIW A;  4YJ2 E;  3ZYK A;  2ZLY A;  3K8P C;  3ZMU B;  1HS7 A;  2DHR A;  4GIW A;  2WMN A;  2V7K A;  3EDV A;  1BR1 A;  3HR0 A;  3UUL A;  2V7M A;  4IE5 A;  3V5U A;  1D1B A;  5A1L A;  3LFM A;  4BAY B;  3ZMT B;  4IE7 A;  2X9W A;  3W15 B;  4ISS A;  3EUH A;  3KV5 A;  3BQL A;  3GN5 B;  4IE0 A;  4QHO A;  3F57 A;  4TN7 B;  5LGT B;  1HF8 A;  3ANW A;  2KLQ A;  3NZP A;  3UTK A;  5LGU B;  4AKH A;  3N9Q A;  5JDF A;  4H9O C;  2CMR A;  4AQF A;  4EZ4 A;  4TV9 E;  2X51 A;  1MND A;  2WBL A;  2B1E A;  3LK3 B;  4KBM B;  2EHO C;  2CA5 A;  4UV8 B;  2ODV A;  3CPZ A;  3AA0 B;  3SS1 A;  3C64 A;  3K3O A;  5C8Y E;  4ZOL E;  4TX5 A;  4CXX A;  4ZS2 A;  4PK6 A;  2ZM0 A;  4AKI A;  2CLY B;  4H9R C;  3UUN A;  1X79 A;  3N9L A;  2IC6 A;  3FBZ A;  3ZEF B;  4NUV A;  5F8P A;  2K48 A;  2ES0 A;  4MAL A;  4UIG A;  3U78 A;  2LHR A;  4GYR A;  4ZI2 C;  2ACX A;  3I1A A;  4H63 H;  3OBV E;  2NWB A;  4X1Y E;  2VKD A;  3S4U A;  4UXN B;  3RC3 A;  1KK7 A;  2MOZ A;  4IDZ A;  2XQY A;  5JR9 A;  3RPU A;  4QXB B;  1FIO A;  1WYC A;  3KV6 A;  3GWH A;  1S35 A;  4PJN A;  2LSI A;  3KBT A;  2A3D A;  5ADX L;  3VKG A;  2LSY A;  2ODU A;  4N78 D;  1IAP A;  3Q5W A;  5H6Q B;  5LA6 E;  2N9D A;  3MKD A;  4UEL A;  3RYC E;  4M1P A;  4C91 A;  1BR0 A;  3FBL A;  2UXN B;  2D0T A;  1YKE B;  4CI1 B;  2K24 A;  1US7 B;  2C5K T;  2H7V C;  3AA1 B;  4ZI7 E;  4H9Q C;  4QX7 B;  2IC9 A;  5JDL A;  1IZN B;  2QGS A;  4FJO A;  5FMN A;  1S94 A;  2BDE A;  1H7C A;  5LHG B;  2KZ7 B;  2Z6E A;  2XTL A;  5JDH A;  3DP7 A;  3E0Z A;  5EZY E;  5LJM A;  5J2T E;  2JJ9 A;  2PJQ A;  2HPJ A;  2CEA A;  1ZHC A;  5HXR A;  3MJX A;  2CLY C;  4YFS A;  3UT5 E;  4A56 A;  2V1D B;  5FP3 A;  3SWH A;  3UFE A;  4O4I E;  2BVL A;  2CWY A;  4NUU A;  2NTY A;  1WYB A;  5E0O A;  5L3D B;  4EYY R;  3PE0 A;  2EHO D;  4DBQ A;  4EYU A;  3O1H A;  3VKH A;  3IBP A;  3AA7 B;  1FMW A;  3ZCI A;  4UV9 B;  3KVA A;  3R6N A;  3MK7 C;  1MIY A;  4IGU A;  1VRB A;  3EVY A;  4U74 A;  4O4H E;  2LEH A;  3CX6 B;  3IF8 B;  1NWM X;  5FYM A;  5DQW A;  2L9Q A;  3Q5X A;  2SPC A;  3PUR A;  4DMW A;  4Z8X A;  4X1K E;  4H9N C;  2VK9 A;  4PK4 A;  2XAS B;  3O1J A;  3CQX C;  2J1D G;  4IE6 A;  4ILU A;  2WAU A;  2XAJ B;  2L3L A;  4ZI2 D;  3I0O A;  2NW8 A;  4OYJ A;  3RYI E;  1NAF A;  2OA5 A;  2WWU A;  3A5X A;  3PTR B;  5FY7 A;  2D5U A;  4GK5 E;  3ZMZ B;  5BMV E;  5GON E;  4EOZ B;  3OYZ A;  3PDY A;  3HKD E;  5J2U E;  3Q2M A;  1FEW A;  2IW5 B;  1UX5 A;  2CCQ A;  4TUY E;  3LJC A;  2EHO A;  1ZEE A;  3C4W A;  4O4J E;  5FXX A;  1ZKE A;  4I50 E;  3I9W A;  3LG7 A;  5CB4 E;  1G8X A;  2PBI A;  5LP6 E;  3ZCJ A;  4TV8 E;  5ETW A;  5HXS A;  1BR4 A;  5HYA A;  5LOV E;  4G2A A;  5H6R B;  4HFV A;  2CM0 A;  2LSG A;  3ETU A;  4EZH A;  2NP9 A;  3K3N A;  4HGA A;  4GK0 E;  1HG2 A;  5FXZ A;  4PNI A;  2CXD A;  3MXZ A;  1WR6 A;  3D0T A;  4H63 V;  3UUM A;  3AVR A;  4I4T E;  1MIV A;  4YLH A;  4JEH B;  4O4L E;  5F3J A;  1ZV4 X;  1WLX A;  4EXT A;  2LSK A;  4UF0 A;  3RX6 A;  3RC8 A;  4MBQ A;  3KBU A;  5EK4 A;  1FMV A;  2K9A A;  2C5J A;  2E8I A;  2NW9 A;  1LVK A;  3MAC A;  2DWK A;  3PUG A;  4HTE A;  5LCY A;  1UCU A;  3JC6 D;  2KT9 A;  3CX7 B;  3M65 A;  4JLE A;  1QUU A;  3K3Q C;  3VU7 H;  3WI3 A;  4CI2 B;  5HWX A;  3N9O A;  4H9S E;  2VB6 A;  4ZS3 A;  2XHE B;  5FY1 A;  2KWI B;  4P0A A;  2CXL A;  3N2G E;  3T8O A;  2KMF A;  2UXX B;  5JRC B;  5JVD E;  2X9X A;  3H37 A;  4DBR A;  3O9X A;  4ERR A;  3ESL A;  5M4Y A;  3EDU A;  2CXF A;  3C4X A;  3GN5 A;  4AQF C;  2LE8 A;  5AFU L;  3P8C D;  1V9D A;  1O3X A;  3Q9D A;  4O2A E;  4QXH B;  1HX8 A;  3NRY A;  5JH7 E;  3SRZ A;  5EK2 A;  4U72 A;  5CA1 E;  3CKD A;  4X1I E;  3ZJ2 A;  4ZHQ E;  3N9P A;  3OYX A;  2BZB A;  5L3C B;  2C0S A;  3KFW X;  4L9I A;  3OJA A;  5JQG E;  4YJ3 E;  5L3G B;  3QUJ A;  4H9P C;  3H3A A;  2QA7 A;  5IHY A;  1U4Q A;  3CVR A;  3FXD B;  3PU3 A;  2DNX A;  2N1G A;  2E9X B;  2ZM2 A;  2XUE A;  4IIJ E;  1T98 A;  3AB3 B;  3LK2 B;  1MNE A;  2LOS A;  2X66 A;  2WSS V;  4UVA B;  4WNK A;  2X9H A;  1KNZ A;  1QSD A;  3FXE B;  4CI3 B;  4HE8 A;  5J1G A;  4JUY A;  3CX8 B;  5FY0 A;  3QK6 A;  3BQI A;  3E22 E;  3JC6 C;  2KWH A;  3C98 B;  2M67 A;  4G63 A;  4J2C A;  1Z0P A;  4BJM A;  4F6R C;  1LVF A;  2H7O A;  2VWA A;  4DVD A;  4QXC B;  4C90 A;  2D0U A;  4I43 B;  1HFA A;  2YEV C;  5TAO A;  3AAE B;  4XBF B;  2RA1 A;  2W61 A;  2A2F X;  5LNK A;  2Y6X A;  3F31 A;  1YKH B;  5LBQ B;  3TKL B;  3GA8 A;  3VHL A;  3AAA B;  4AXP A;  3PU8 A;  2A72 A;  2BVM A;  4PJJ A;  3AAI A;  2CWO A;  4QWN B;  3B57 A;  2YK0 A;  4PJM A;  4CZZ B;  5HAX A;  3PUQ A;  3L09 A;  2C5I T;  1IJ5 A;  4WW0 A;  4CXY A;  3GMI A;  3KVB A;  2VAS A;  4EB6 E;  5HXH A;  3BQK A;  3E08 A;  1OXZ A;  2DI4 A;  2LT3 A;  2KND A;  3ANW B;  2JMH A;  4AKR B;  3UUX B;  4CQI A;  2Q9Q C;  5DJQ C;  3ZC1 A;  5L2L A;  4PK5 A;  1UX4 A;  4HKA A;  2E9X C;  5L3E B;  2VKJ A;  4TZ4 C;  3N2K E;  1D1A A;  4PJL A;  5KX5 E;  3HA4 A;  4MLK A;  3HKC E;  5JRE A;  2DWG A;  3ETV A;  5LBM A;  4WBN E;  1YW0 A;  4P09 A;  5L3B B;  3DJB A;  3FB2 A;  2N2N A;  1VOM A;  2JQQ A;  2CE7 A;  2YU1 A;  4AQG A;  4PFO A;  2DLR A;  2XAH B;  1MMA A;  2MTQ A;  5FXV A;  4PFP A;  4CXW A;  2NW7 A;  3F2E A;  3KDS E;  4ZI3 C;  4JEU B;  2WM9 A;  3ZC0 A;  2X67 A;  2L8K A;  3HKE E;  3O4X E;  1YD8 G;  4DO0 A;  3KIN B;  2K5B B;  5LGN B;  3RKO A;  1D0X A;  3O1I A;  4GOU A;  5IYZ E;  2NTX A;  4IST A;  5EK3 A;  3RRW A;  1SHZ C;  3FHN A;  4HN9 A;  4UEM A;  5DQV A;  2LHN A;  2MYS A;  2JPF A;  2MBG A;  3I9Y A;  5JR9 B;  3WAJ A;  2V7L A;  5LHI B;  1SA0 E;  4MFR A;  2JMK A;  2RP4 A;  2YU2 A;  4X20 E;  4L5G A;  4IE4 A;  3L3P A;  1WRD A;  4GYS A;  4XAX B;  2XAF B;  4ASK A;  3HI2 A;  5DAB A;  4KP3 C;  5KMG P;  1D0Z A;  3ZN0 B;  2X9Y A;  3NBX X;  4K0U A;  2VL8 A;  3C51 A;  4QKN A;  2LJL A;  2V26 A;  3U3I A;  5LHH B;  2WMO A;  3CWZ B;  1MMN A;  1Y64 B;  3ZN1 B;  4QX8 B;  2VKO A;  4OFZ A;  2W0G A;  3LBX B;  4BJN A;  3RYF E;  2PFV A;  3QC9 A;  3N5L A;  4EIW A;  2HH7 A;  4WBO A;  5HXC A;  2DCF A;  3CQC B;  3ZMV B;  5LYJ E;  1EZ3 A;  3RH3 A;  2IAK A;  4ADZ A;  1AJ3 A;  4B6X A;  3N9M A;  3DTO A;  3NRX A;  3AA6 B;  3AVS A;  1B7T A;  4KMC A;  3LK4 2;  1E1H B;  5JDM A;  2XAQ B;  5CA0 E;  2Q9Q B;  2V7I A;  2Q9Q D;  3IHR A;  2JRK A;  4O8S A;  2E9X D;  3N9N A;  2HPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...