2D2SA

Crystal structure of the exo84p c-terminal domains
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
229
structure length
217
Chain Sequence
DMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSLMLLNLISLKIEQRREAISSKLSQSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIVDNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNLSPGSIKSSRKQIDGLKAVGLDFVYKLDEFIKKNSDKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exocyst complex component EXO84
publication title The structures of exocyst subunit Exo70p and the Exo84p C-terminal domains reveal a common motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Endocytosis/exocytosis
total genus 91
structure length 217
sequence length 229
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16528 Exo84_C Exocyst component 84 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA01
1.20.58.1220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA02
2D2SA
chains in the Genus database with same CATH superfamily
1CUNA 3AVSA 3GN5A 3GMIA 2E5LT 2D2SA 2CXFA 4EZ4A 3ZMVB 3A7MA 5AQTB 4X20E 3PE0A 3IF8B 1WCRA 3TLTA 5FXVA 3ONJA 5LA6E 2EHOC 2LRLA 4IL4A 3NZQA 3ZYKA 2AE9A 2WMNA 1QUUA 3K3OA 4IDNA 2G0UA 4TZ4C 4DV0T 2XM2A 4AKRB 2XQ9A 3RGLA 4O4JE 4DIDB 4Z91A 2H89A 5LGUB 2WY2A 5HXHA 4EB6E 3PJAJ 2V5DA 2YINA 3K1SA 4F8HA 2EHOA 3SFEA 4ILBA 2CLYC 2XQ8A 3VHLA 5KXJA 3RIFA 1HX1B 3P7IA 4JI0T 1O3XA 1IZNB 3ZN0B 4U7IA 3H3AA 4XZCA 5AQVB 4TX5A 2CM0A 4ANJA 1ZEEA 4CQIA 2C5JA 2WZIA 1IBKT 2L8KA 5JDMA 1X79A 4K0UA 4NIQA 1WYCA 2I0MA 2LT3A 5ABHA 4WZXA 2A72A 1MIWA 3IEEA 5ABFB 4H9PC 3VU7H 4UVAB 3UU4A 4PK6A 2CBJA 3EAMA 2X67A 3CX6B 3RYCE 4ZZBA 3FZKB 3RYIE 1Y01A 3I9YA 1MNEA 4WBOA 3O1IA 5FY7A 3UULA 2A9UA 2WM9A 2M6BA 2XQYA 2X0YA 3PU3A 4N78D 5AQGB 1VRBA 4DV3T 3V5UA 2VB6A 5L47A 2EHOB 2WSSV 5AQJB 2WMOA 3O9XA 4QKNA 4P1NA 4ILCA 3TKLB 2RP4A 3C4WA 5LHIB 2V7JA 4AQYT 3UQ7A 5LG4A 3C4XA 1BR0A 4PJLA 3OJAA 5HXRA 4DUZT 4ZI3D 1LKXA 2PBIA 2VVSA 2IUBA 3UUXB 1U4QA 2XQ6A 5HXEA 2CLYB 1HTJF 2W00A 1R8IA 2NOXA 2BG9B 3UU3A 2V7KA 1Y64B 4YHJA 2H88A 4HFHA 4LF6T 4HWHA 4F6RC 5JRCB 2KZ7B 3RLFF 3CQCB 5ABGA 3NWIA 3FZLB 3P4WA 4TN7B 4DV5T 1FJGT 4Q25A 1W09A 3EABA 2RPAA 2NWBA 2NW9A 5F5WA 2M67A 2LSYA 4J2CA 4HGAA 4B3MT 2ODVA 3C64A 2E9XC 4IT4A 3UFEA 2VL0A 4Z8XA 3KVBA 3ABVA 4EYYR 2LHRA 3ONXA 2K9AA 3ZT7A 3CQXC 2LOPA 3OPCA 4CN6A 4YT0A 4C91A 2X0HA 5FXZA 4DO0A 1WR6A 1MIYA 2W0GA 3CPZA 1XNRT 2BBJA 4P0AA 2E9XA 4U72A 2R6GF 2XAGB 1KFYA 3ZC0A 4A97A 4ZI2D 3GWHA 4ERRA 1T8BA 3CQGB 5LMUT 4L0RA 5HWXA 3RI5A 1Z8UA 5CB4E 2JQ9A 2IW5B 2VK9A 2DNXA 2K24A 5FL0A 5EK4A 4DMWA 1BR2A 1XWMA 1BR4A 4ISSA 2XPKA 2DI4A 2HN2A 2K48A 4H63H 2CRBA 2OV9A 5IHYA 3ESLA 2CWOA 2W67A 3TLWA 2ES0A 3DTOA 2BKOA 3ZYLA 2ZM0A 3A5XA 2DL1A 2JIWA 2VKHA 4IDOA 4A56A 4ZS2A 3UU8A 4EV6A 4EXTA 3SRZA 3AA0B 3RHWA 2JQHA 4LF9T 3EI0A 4HKAA 1ZKEA 5FY1A 4ZEYA 1OWAA 4EGWA 2CBIA 3DP7A 2X9YA 3J9X1 3BK9A 4I50E 2W4XA 4BA9A 3AAAB 5FKYA 1X9BA 3G06A 1N33T 3AECA 4COFA 4I55E 3LBXA 2ODUA 4ILAA 1NAFA 5HEOA 1SHZC 4MLKA 2LKGA 1HG2A 1DU2A 1MMDA 4JUYA 3K8PC 5FVKA 4AXPA 4NXNT 2WWVA 2XQ7A 3UT5E 1YXRA 1OEDA 5HXSA 2LSJA 3PJAA 4HWFA 3CK6A 1E1HB 5ADXL 3O4XE 1LVFA 2M6IA 3KVAA 2VQFT 2ZM2A 3L39A 4FI5A 5LGNB 4DNDA 2D9DA 2X51A 3OKQA 5LBQB 3EUHA 3FZFB 1I6ZA 2XSAA 2L9QA 3AA6B 2XQ3A 3KDSE 1QSDA 4ISTA 3R84B 4BJMA 4PJJA 1W0AA 5A1LA 3MACA 4AKHA 5HEGA 3ZLIA 2C5KT 2PFVA 4O8SA 3C51A 2Q9QC 5JDFA 1QLBA 5CGMA 3AEEA 3LBXB 4G63A 4JEHB 1T72A 3HKCE 3RX6A 1LVKA 2DLRA 1YD8G 2UUAT 5L3CB 2X0LB 2D0TA 2RA1A 3P4PA 3UU6A 2NP9A 2LE8A 4WNKA 4UVCB 4AKGA 3L09A 3OBVE 1XMOT 2UXDT 2Q9QA 3AE8A 2V7IA 4G2AA 1J1JA 4CZZB 2FUPA 3OYZA 3ZKRA 5AQPB 1HX8A 3NKZA 2J4GA 2YKSA 1US7B 5LOVE 3UTKA 4IIJE 3RKGA 4E7SA 4JLEA 2C5IT 5ABFA 2Z6EA 5FXWA 4LMKA 3ZCJA 3CMLA 4KHZF 4MFRA 3AE3A 1ZV4X 3I0OA 4JYAT 4TNVA 1IAPA 1XDOA 2ZMAA 3M65A 5J0ZA 3RIUC 2WBLA 4U3CA 5LYJE 4X66T 2QA7A 1YQ4A 2BKPA 4HFEA 5JVDE 5HCMA 4GK5E 2JRKA 2Y8DA 5JDHA 3GA8A 2IAKA 2YOEA 1XNQT 3ZC1A 4TV8E 1G73A 2Q9QB 4HFCA 2BG9C 4CN4A 1KNPA 2UXXB 3RIUA 2YU2A 2XHEB 4Z90A 1KNRA 5L3EB 4IL9A 1VCSA 5AFUL 2H7OA 5JTGA 3AEFA 2I6HA 4YTPA 5JR9B 4YJ2E 2MAWA 1JNZA 3CWZB 5AQSB 3SFDA 2CCQA 4IE7A 1UX4A 2LSGA 2BG9A 5J1GA 3QB5A 4OK0A 5C2TA 4YHHT 2W2UA 2V6YB 5LCYA 5JRCA 2CHNA 3PUQA 2A2FX 2C0SA 2VL8A 4PK5A 1D0ZA 3MXZA 3PUVF 3JAFA 3KV9A 2QRXA 3RRCA 4DV4T 3UFGA 3NBXX 5JDLA 2KLQA 2LLYA 4DR7T 3N9LA 2DHRA 4PFOA 2MYSA 3AEBA 1HG5A 2PG8A 4QHOA 2BS3A 4AKIA 3VKGA 3TLUA 2PJQA 4DMVA 2ACZA 3RQUA 2WDRA 3KV6A 2KMFA 3O1HA 2BZBA 3AEAA 4O4IE 3ZMUB 2VURA 2KSRA 5L3FB 4K0KT 3H37A 2NR4A 3ETUA 4KMCA 3EDVA 3VRAA 4HWCA 2VASA 3FBZA 4JV5T 3ZT6A 3N2OA 4IDPA 5HWYA 2CA5A 4DBRA 4DR3T 4QWNB 4QH4A 4XAXB 5AQIB 3AE4A 1HFAA 2YEVC 4IE6A 1HNWT 4LFAT 4AQFC 1XDPA 4HN9A 4L9IA 5AQFB 2YDRA 5HAXA 2BS2A 1WR0A 3AXJA 3F31A 2V7LA 4B3ST 2XQAA 1FEWA 3PTRB 2NTXA 4X1KE 4ZXLA 4JI2T 2E5VA 3JAEA 3VRBA 5ABEA 3CKDA 5AQLB 4KUMB 2FBWA 4UEMA 5TAOA 2XUEA 3Q9DA 5J2TE 4LFBT 4DV7T 3N9NA 4GYSA 4QH5A 4HEAA 2UXCT 1NEKA 4DV6T 3AE7A 5F8PA 3N2GE 1UURA 3ANWB 3IA3A 1ZP0A 2KT9A 4ZS3A 3NZPA 4LF4T 2XQ5A 4LMJA 1UX5A 1UUSA 2Y6XA 1D0XA 1XZYA 4HFVA 4PJNA 5CA1E 4EYUA 4AKLA 3RF1A 2WCAA 3JC6D 3SWHA 3ONLC 3KINB 1HNZT 4E7ZA 4GK0E 3ZMSB 2V1DB 4TWFA 2FJEA 4ZI3C 4JI1T 4B3TT 1OEDE 3AB3B 5C3JA 5LMNT 3AXJB 2UXBT 4U2YA 2VVNA 5DABA 5KDMC 4TV9E 4V1Av 3ZPOA 5KX5E 3CVRA 4YSYA 3SS1A 2CXLA 3K3QC 3PDYA 4GKJT 5AQNB 2XAFB 3N9MA 4I0UA 1U5PA 5H6RB 2J47A 3P4SA 3MJXA 4CN1A 3AE9A 1FMWA 3L8RA 5C8YE 4CI2B 2ZM8A 3B57A 3ZJ1A 5FP3A 4QH1A 1N34T 1MMAA 2X66A 2LRKA 4DBQA 2OA5A 4JI5T 1UGOA 4IGUA 4PK4A 4EEDA 3N9PA 2IC9A 3EHZA 3NRXA 4OYKA 4O2AE 4CI3B 3IHRA 3VR9A 2V26A 5LB7B 2YU1A 5JQGE 2X9XA 2WWUA 4H9OC 5FMNA 2YDSA 3HKDE 2CE7A 2UU9T 3UQ4A 2B1EA 3HA4A 4DR6T 3FHNA 4DR4T 1VCTA 3PUAA 4IE4A 4X5TA 4WBNE 1D1CA 4B3RT 4QX7B 2VKDA 3Q5EA 5CFBA 2WU5A 4HTEA 5L3BB 4X62T 1ZHCA 4X1YE 2N2NA 5LBMA 2AXDS 3T1HT 4NPPA 4ZI2C 4PJMA 3SOLA 4JI7T 4UVBB 3KFWX 2CXDA 3BQKA 4H63V 3JADA 3AE5A 1LRZA 2WZHA 3F2EA 1MNDA 4IE5A 2HPJA 4OYJA 2JPFA 5LJNA 3RIAA 2EHOD 4AQGA 2QYWA 4HFIA 5HEJA 4HFDA 4UIGA 4DV1T 5LXTE 3RKOA 5LG3A 2JQKA 3LG7A 1IJ6A 4TUYE 3OYXA 3Q5DA 2XQ4A 4IHJE 5H6QB 3JCFA 4IREA 4YSXA 2V5CA 3KV5A 4X1IE 2V8SV 5M4YA 3P4QA 2LM9A 4EOZB 2V6XA 5DQWA 2DCFA 2P9BA 5L4HA 3BQLA 3C50A 4UV9B 1N36T 5JH7E 5JR9C 2WS3A 3KBUA 3FXDB 1D1AA 2MBGA 5AQUB 5GONE 5EK2A 2ACXA 3CX7B 2W66A 2NW7A 5FYMA 4ZI7E 5AQHB 2LSKA 2WQYA 2BG9E 2HH7A 3TLVA 2LEHA 4OFZA 4HWIB 2KWIB 2WAUA 5JR9A 1SA0E 2J62A 5DQVA 4ZHQE 4KHPT 5JDGA 1E7PA 3WAJA 4JI8T 4NUUA 3VKHA 2BBHA 4DR2T 2V6YA 2KINB 4H9SE 2CPTA 2BDEA 3MKDA 4JI3T 2F4VT 2OLTA 3B5MA 4DR1T 5AQMB 3AE2A 3K3NA 5L2LA 1J5ET 5F3JA 5CJ5A 3LK42 2VWAA 2MTQA 5LNKA 3FZHB 1G8XA 5LP6E 4UF0B 2DWGA 4DR5T 4U33A 2VKOA 4BAYB 2XY8B 1KK7A 2LM2A 4XBFB 1KEYA 5KMGP 1OXZA 2NW8A 3ZT5A 2BKNA 4C90A 3KV4A 4EIWA 3R6NA 4M1PA 5BMVE 1D0YA 3PUXF 5HYAA 4ILUA 3LK3B 2FJAA 5DJQC 2KNDA 2MOZA 3RRWA 4DV2T 3AEGA 4YJ3E 2V7MA 3FZMB 2LSIA 4U31A 2JMKA 5JDQA 1VOMA 2VQET 4YXDA 2LJLA 4HWDA 1HS7A 3ZEFB 5AQRB 4BJNA 5J2UE 2BVLA 3S4UA 3ZYMA 3X1DA 5HCJA 2J1DG 5AQKB 3P8CD 2D5UA 5ETWA 3AA7B 2H3RA 4O4HE 2E2AA 4YFSA 2UUCT 1E2AA 1T98A 3DJBA 4LMLA 1S35A 3GN5B 3LK2B 4U7YA 4I4TE 4PFPA 4CI1B 1WFDA 1D1BA 1AJ3A 3NRYA 3RYFE 4QX8B 4O4LE 2XTLA 1UK5A 4NXMT 2JJ9A 3LFMA 5AQQB 5EK3A 2IDOB 3N5LA 1IBMT 3M3ZB 2E9XD 3Q5WA 3ZSSA 4KX6A 4GYRA 3CIRA 4ADZA 4EAHA 1J5WA 1NENA 2YK0A 1Z0PA 2GK9A 3AAEB 5FXXA 2I59A 3RPUA 4PW8A 5FL1A 4YTMA 3ANWA 3U78A 2DWKA 1WLXA 4PNIA 1JNRA 5BR8T 2WP9A 4CXYA 3CX8B 4LF5T 3AE1A 2QGSA 4U74A 4UXNB 4MBQA 3HI2A 1HR0T 1IBLT 4FJOA 3RC8A 4U2ZA 3FBLA 2X9HA 4GIWA 2XAHB 1IJ5A 3AAIA 4QXHB 2IC6A 2WB5A 4HFBA 4KP3C 3UUBA 3QK6A 2K3WA 1YW0A 4O2BE 4IE0A 3MK7C 3QOFA 1N32T 5AQOB 3OTOT 4CXXA 1MMGA 2IIUA 4UV8B 2BS4A 2IHR1 4ASKA 3B13A 1KF6A 2CHOA 3E08A 3E22E 5L4EA 5L3DB 1T7SA 3PV0F 2N1GA 3HKEE 3VR8A 1HNXT 1YKHB 3RYHE 3UUNA 4AQFA 4WYVA 3QB5K 2SPCA 2W62A 3C4ZA 1I94T 4NUVA 3AE6A 3OVUA 2XJ7A 3N9QA 4I43B 1GQEA 2YDQA 2XAQB 5FY0A 1NWMX 4DVDA 3KBTA 3N2KE 2MPKA 1WYBA 2XASB 4H9NC 4P09A 3EDUA 4X64T 3UU5A 1WRDA 5LHHB 4AI6A 3QC9A 3PUWF 3LSVA 4YSZA 3ETVA 5JDNA 5E0OA 2QVAA 5HEHA 2CEAA 4WW0A 4MALA 2PTFA 2X68A 5LJMA 4YLHA 4OX9T 4JI4T 1M62A 2ZLYA 5HEUA 3U3IA 4AISA 2E8IA 2N9DA 1MMNA 4LF8T 3I1AA 4TWDA 3WI3A 2XM1A 4JBWF 2HHHT 3PUYF 4X65T 4ZOLE 3QNUA 5FVLA 3E0ZA 3BQIA 3D0TA 2H7VC 2VKJA 4MHCA 1SE7A 2A3DA 5HXCA 4AIUA 2FJDA 3V5SA 1SUMB 2IMLA 4IDQA 4UR9A 3FXEB 3ZMZB 3W15B 3PUSA 5LHGB 2WDQA 5CA0E 4EEBA 2W63A 4H9QC 2KWHA 3Q2MA 2Q9QD 4L5GA 2X9WA 2LOSA 4KBMB 4HE8A 3AVRA 3EVYA 2FJBA 2XAJB 3RC3A 5L3GB 1M7KA 3ZSTA 3A8YC 5IWAT 3RQWA 3I0QA 4TNWA 3MZKB 3PUGA 3RH3A 2E9XB 1ZOYA 1B7TA 1FIOA 2K5BB 1HCIA 2UUBT 1W0BA 2L3LA 2LKHA 3HL6A 3O1JA 4A5XA 2D0UA 5IYZE 4JEUB 2XSBA 1OEDC 3JC6C 4ZZCA 4KI0F 1YQ3A 1BR1A 2B76A 2W61A 4QXBB 3UUMA 2JQQA 4PAGA 1FMVA 3LJCA 3P4RA 2BVMA 5LGTB 4LF7T 1CHUA 4YTNA 4CXWA 3IBPA 4EZHA 3F57A 4GOUA 1S94A 3NVOA 3AA1B 3T1YT 1UCUA 1H7CA 3FB2A 3PUZF 2CMRA 3QUJA 3P50A 4IDZA 3ZCIA 1L0VA 4QXCB 3H3MA 3TLSA 4UF0A 4P0BA 2HPLA 5FNVE 3HR0A 2HN1A 2YN6A 4OHFA 3WAKA 3J7Yq 4UELA 3PU8A 3AEDA 4B6XA 4GKKT 2WDVA 3T8OA 1YKEB 2XZEA 5IUXA 4JI6T 2NTYA 2UXNB 2WU2A 2ZM6T 3MA9A 2JMHA 3I9WA 3PURA 1EZ3A 4YY3T 3ZJ2A 1HF8A 5JREA 1MIVA 4LFCT 3Q5XA 2LHNA 5EZYE 1V9DA 1XMQT 3L3PA 4H9RC 2KXPB 3N9OA 3ZN1B 3ZMTB 4DUYT 1KNZA 3HKBE 2CWYA 4TWHA 1W9RA 1OEDB 3C98B 2Y48B 4A98A 3LDQB
chains in the Genus database with same CATH topology
1CUNA 1UX5A 3AVSA 3GN5A 4GYRA 3GMIA 4ADZA 1SHZC 2Y6XA 1D0XA 4EAHA 4HFVA 4MLKA 4PJNA 5CA1E 1HG2A 2YK0A 2D2SA 1Z0PA 4EYUA 2CXFA 2GK9A 3AAEB 4AKLA 1MMDA 5FXXA 4EZ4A 2I59A 3JC6D 3RPUA 4PW8A 4JUYA 3ZMVB 3SWHA 3K8PC 3KINB 4AXPA 4X20E 3PE0A 3ANWA 3UT5E 4E7ZA 3IF8B 3U78A 2DWKA 5HXSA 5FXVA 2LSJA 4GK0E 5LA6E 3ZMSB 1WLXA 2V1DB 4PNIA 2EHOC 4CXYA 3CX8B 3NZQA 4ZI3C 3ZYKA 2QGSA 2WMNA 4U74A 4UXNB 1E1HB 1QUUA 3AB3B 3O4XE 3K3OA 5ADXL 4MBQA 3HI2A 1LVFA 2G0UA 3KVAA 4FJOA 2ZM2A 3RC8A 4TZ4C 4FI5A 5DABA 4AKRB 5LGNB 4DNDA 5KDMC 4TV9E 4V1Av 3ZPOA 5KX5E 2X51A 3OKQA 5LBQB 3EUHA 3FBLA 2X9HA 3CVRA 3SS1A 4GIWA 2CXLA 3K3QC 3PDYA 2XAHB 4O4JE 1IJ5A 3AAIA 2XAFB 4QXHB 2L9QA 2IC6A 3AA6B 3N9MA 5LGUB 4KP3C 3KDSE 1QSDA 1U5PA 5H6RB 3QK6A 4ISTA 3MJXA 3R84B 4EB6E 5HXHA 2YINA 1YW0A 4BJMA 4PJJA 1FMWA 2EHOA 5A1LA 5C8YE 4O2BE 4IE0A 3MACA 3MK7C 4AKHA 4CI2B 2CLYC 2ZM8A 3ZLIA 2C5KT 2PFVA 3B57A 3ZJ1A 4CXXA 5FP3A 3VHLA 4O8SA 1MMGA 4UV8B 1MMAA 2X66A 3C51A 4DBQA 2Q9QC 4ASKA 5JDFA 3LBXB 3B13A 2OA5A 3P7IA 4G63A 4JEHB 3HKCE 3E08A 1O3XA 3RX6A 1IZNB 1LVKA 4IGUA 3ZN0B 4PK4A 3E22E 2DLRA 3H3AA 3N9PA 5L3DB 1YD8G 2IC9A 4XZCA 4TX5A 2CM0A 5L3CB 2N1GA 3HKEE 3NRXA 4OYKA 4ANJA 1ZEEA 4O2AE 4CI3B 2X0LB 4CQIA 3IHRA 1YKHB 2D0TA 2RA1A 2V26A 3RYHE 2NP9A 3UUNA 2LE8A 4AQFA 2C5JA 2YU1A 5JQGE 2X9XA 2SPCA 2WWUA 2W62A 3C4ZA 4WNKA 2L8KA 4H9OC 4UVCB 4AKGA 5FMNA 3HKDE 3L09A 2CE7A 3OBVE 5JDMA 4NUVA 2Q9QA 1X79A 2B1EA 4K0UA 1WYCA 2LT3A 3HA4A 3FHNA 2A72A 1MIWA 2V7IA 3IEEA 3N9QA 4H9PC 3VU7H 4UVAB 4I43B 3PUAA 2XAQB 4G2AA 4CZZB 5FY0A 4IE4A 1NWMX 4WBNE 4DVDA 4PK6A 1D1CA 3KBTA 3N2KE 3OYZA 4QX7B 1HX8A 2X67A 2VKDA 3CX6B 1WYBA 3RYCE 2XASB 3RYIE 4H9NC 4P09A 3EDUA 1US7B 4HTEA 5LOVE 1ZHCA 5L3BB 4X1YE 3UTKA 2N2NA 1WRDA 5LBMA 3I9YA 5LHHB 3QC9A 4AI6A 5JDNA 3ETVA 4ZI2C 5E0OA 1MNEA 4WBOA 4PJMA 3O1IA 4IIJE 5FY7A 3UULA 3SOLA 2CEAA 4UVBB 2WM9A 4WW0A 4E7SA 2XQYA 3PU3A 3KFWX 4MALA 4N78D 4JLEA 2C5IT 2X68A 5LJMA 4YLHA 1VRBA 2Z6EA 5FXWA 2ZLYA 3ZCJA 2CXDA 3BQKA 3V5UA 2VB6A 4H63V 3CMLA 2EHOB 2WSSV 4MFRA 3U3IA 1LRZA 1ZV4X 2WMOA 3F2EA 1MNDA 3I0OA 3O9XA 4QKNA 4IE5A 2E8IA 2HPJA 3TKLB 2N9DA 1MMNA 2RP4A 1IAPA 3C4WA 4OYJA 5LHIB 2ZMAA 3M65A 3I1AA 2V7JA 3WI3A 5LG4A 3C4XA 1BR0A 4PJLA 3OJAA 5HXRA 2JPFA 2WBLA 5LJNA 2EHOD 5LYJE 2QA7A 4AQGA 4ZI3D 1LKXA 4ZOLE 2PBIA 5JVDE 4UIGA 3UUXB 1U4QA 3E0ZA 3BQIA 3D0TA 4GK5E 5LXTE 3RKOA 2JRKA 2Y8DA 5JDHA 3GA8A 5HXEA 2H7VC 2VKJA 3LG7A 1IJ6A 4MHCA 4TUYE 2IAKA 2CLYB 3OYXA 3ZC1A 1HTJF 2W00A 2A3DA 5HXCA 2NOXA 4IHJE 4TV8E 5H6QB 1G73A 2Q9QB 2V7KA 3V5SA 1Y64B 4YHJA 2UXXB 3FXEB 4F6RC 5JRCB 2KZ7B 3ZMZB 3KV5A 4X1IE 3W15B 3PUSA 5LHGB 2YU2A 2XHEB 5L3EB 5M4YA 3CQCB 5AFUL 5CA0E 2LM9A 4EOZB 5DQWA 2W63A 4H9QC 2H7OA 4TN7B 2KWHA 2DCFA 3Q2MA 2Q9QD 2P9BA 2X9WA 2LOSA 4KBMB 4L5GA 4HE8A 3AVRA 3EVYA 3BQLA 3C50A 4YJ2E 4UV9B 5JR9B 2XAJB 3CWZB 2NWBA 5JH7E 5JR9C 3KBUA 3FXDB 3RC3A 5L3GB 1D1AA 2MBGA 2CCQA 4IE7A 1UX4A 2LSGA 2NW9A 5J1GA 2M67A 2LSYA 5GONE 4OK0A 4J2CA 5EK2A 2ACXA 3CX7B 4HGAA 2NW7A 5FYMA 3I0QA 5LCYA 3MZKB 5JRCA 3PUGA 3RH3A 2E9XB 4ZI7E 2ODVA 3C64A 2LSKA 2E9XC 3UFEA 2HH7A 4Z8XA 3PUQA 1B7TA 2A2FX 3KVBA 2C0SA 1FIOA 2LEHA 4EYYR 2VL8A 2LHRA 2K5BB 4PK5A 1D0ZA 1HCIA 2K9AA 3MXZA 3ONXA 4OFZA 2L3LA 3CQXC 3HL6A 3KV9A 3O1JA 2KWIB 2LOPA 2WAUA 3RRCA 5JR9A 3NBXX 4C91A 5JDLA 1SA0E 5DQVA 4ZHQE 5JDGA 2D0UA 2KLQA 5IYZE 4JEUB 3JC6C 5FXZA 1BR1A 4DO0A 3WAJA 1WR6A 3N9LA 2W61A 4NUUA 2DHRA 4QXBB 3VKHA 1MIYA 2KINB 2W0GA 3CPZA 4PFOA 2MYSA 3UUMA 4P0AA 1HG5A 4H9SE 2E9XA 4U72A 2PG8A 2JQQA 2BDEA 4QHOA 3MKDA 4PAGA 2XAGB 3ZC0A 4AKIA 3VKGA 1FMVA 3K3NA 3LJCA 2PJQA 5L2LA 4DMVA 4ZI2D 2BVMA 5LGTB 3GWHA 5F3JA 3LK42 2VWAA 2MTQA 3KV6A 4ERRA 5LNKA 3CQGB 1G8XA 5LP6E 2KMFA 4UF0B 2DWGA 4CXWA 3IBPA 3O1HA 4L0RA 5HWXA 2BZBA 2VKOA 4BAYB 4O4IE 5CB4E 3ZMUB 2IW5B 1KK7A 4XBFB 4EZHA 5KMGP 5L3FB 1OXZA 3F57A 2NW8A 2VK9A 3H37A 4GOUA 1S94A 2DNXA 4C90A 2K24A 3KV4A 5EK4A 4EIWA 3ETUA 3R6NA 4M1PA 4DMWA 3AA1B 5BMVE 1BR2A 4KMCA 3EDVA 1UCUA 1D0YA 1BR4A 1H7CA 3FB2A 5HYAA 2VASA 4ISSA 3FBZA 2CMRA 2DI4A 3QUJA 4ILUA 2K48A 3LK3B 4IDZA 3N2OA 4H63H 3ZCIA 5HWYA 5DJQC 2CA5A 5IHYA 3ESLA 2KNDA 2CWOA 2MOZA 3RRWA 4QXCB 4DBRA 4QWNB 2ES0A 3DTOA 4UF0A 4XAXB 4P0BA 4YJ3E 2V7MA 3ZYLA 2ZM0A 3A5XA 2LSIA 2HPLA 1HFAA 2VKHA 2YEVC 2JMKA 3HR0A 4IE6A 5FNVE 4A56A 4ZS2A 5JDQA 1VOMA 4OHFA 4AQFC 4HN9A 4EXTA 4L9IA 3SRZA 2LJLA 1HS7A 3WAKA 3ZEFB 4UELA 3PU8A 3J7Yq 5HAXA 4B6XA 4BJNA 5J2UE 2BVLA 3S4UA 3ZYMA 3T8OA 1YKEB 3AA0B 3F31A 2V7LA 2J1DG 2NTYA 1FEWA 3PTRB 2NTXA 3P8CD 2D5UA 5ETWA 3AA7B 4X1KE 2UXNB 4HKAA 1ZKEA 2H3RA 4O4HE 4YFSA 3MA9A 2JMHA 1T98A 3DJBA 3I9WA 3PURA 1S35A 1EZ3A 3GN5B 3LK2B 5FY1A 3ZJ2A 1HF8A 3CKDA 4I4TE 5JREA 4PFPA 1OWAA 4KUMB 4CI1B 1MIVA 1D1BA 4UEMA 1AJ3A 5TAOA 2XUEA 3Q9DA 5J2TE 3DP7A 2X9YA 3NRYA 3RYFE 3Q5XA 3J9X1 2LHNA 4QX8B 5EZYE 3BK9A 4I50E 4O4LE 2XTLA 3N9NA 3AAAB 1V9DA 4BA9A 4GYSA 3L3PA 4H9RC 2KXPB 2JJ9A 3N9OA 3LFMA 4HEAA 5EK3A 4I55E 3ZN1B 5F8PA 3LBXA 3ZMTB 2ODUA 3N2GE 3N5LA 1KNZA 3HKBE 3ANWB 2CWYA 2E9XD 3Q5WA 3C98B 2KT9A 4ZS3A 3NZPA 2Y48B 1NAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2S A; 
#chains in the Genus database with same CATH topology
 1CUN A;  3AVS A;  3GN5 A;  3GMI A;  2E5L T;  2D2S A;  2CXF A;  4EZ4 A;  3ZMV B;  3A7M A;  5AQT B;  4X20 E;  3PE0 A;  3IF8 B;  1WCR A;  3TLT A;  5FXV A;  3ONJ A;  5LA6 E;  2EHO C;  2LRL A;  4IL4 A;  3NZQ A;  3ZYK A;  2AE9 A;  2WMN A;  1QUU A;  3K3O A;  4IDN A;  2G0U A;  4TZ4 C;  4DV0 T;  2XM2 A;  4AKR B;  2XQ9 A;  3RGL A;  4O4J E;  4DID B;  4Z91 A;  2H89 A;  5LGU B;  2WY2 A;  5HXH A;  4EB6 E;  3PJA J;  2V5D A;  2YIN A;  3K1S A;  4F8H A;  2EHO A;  3SFE A;  4ILB A;  2CLY C;  2XQ8 A;  3VHL A;  5KXJ A;  3RIF A;  1HX1 B;  3P7I A;  4JI0 T;  1O3X A;  1IZN B;  3ZN0 B;  4U7I A;  3H3A A;  4XZC A;  5AQV B;  4TX5 A;  2CM0 A;  4ANJ A;  1ZEE A;  4CQI A;  2C5J A;  2WZI A;  1IBK T;  2L8K A;  5JDM A;  1X79 A;  4K0U A;  4NIQ A;  1WYC A;  2I0M A;  2LT3 A;  5ABH A;  4WZX A;  2A72 A;  1MIW A;  3IEE A;  5ABF B;  4H9P C;  3VU7 H;  4UVA B;  3UU4 A;  4PK6 A;  2CBJ A;  3EAM A;  2X67 A;  3CX6 B;  3RYC E;  4ZZB A;  3FZK B;  3RYI E;  1Y01 A;  3I9Y A;  1MNE A;  4WBO A;  3O1I A;  5FY7 A;  3UUL A;  2A9U A;  2WM9 A;  2M6B A;  2XQY A;  2X0Y A;  3PU3 A;  4N78 D;  5AQG B;  1VRB A;  4DV3 T;  3V5U A;  2VB6 A;  5L47 A;  2EHO B;  2WSS V;  5AQJ B;  2WMO A;  3O9X A;  4QKN A;  4P1N A;  4ILC A;  3TKL B;  2RP4 A;  3C4W A;  5LHI B;  2V7J A;  4AQY T;  3UQ7 A;  5LG4 A;  3C4X A;  1BR0 A;  4PJL A;  3OJA A;  5HXR A;  4DUZ T;  4ZI3 D;  1LKX A;  2PBI A;  2VVS A;  2IUB A;  3UUX B;  1U4Q A;  2XQ6 A;  5HXE A;  2CLY B;  1HTJ F;  2W00 A;  1R8I A;  2NOX A;  2BG9 B;  3UU3 A;  2V7K A;  1Y64 B;  4YHJ A;  2H88 A;  4HFH A;  4LF6 T;  4HWH A;  4F6R C;  5JRC B;  2KZ7 B;  3RLF F;  3CQC B;  5ABG A;  3NWI A;  3FZL B;  3P4W A;  4TN7 B;  4DV5 T;  1FJG T;  4Q25 A;  1W09 A;  3EAB A;  2RPA A;  2NWB A;  2NW9 A;  5F5W A;  2M67 A;  2LSY A;  4J2C A;  4HGA A;  4B3M T;  2ODV A;  3C64 A;  2E9X C;  4IT4 A;  3UFE A;  2VL0 A;  4Z8X A;  3KVB A;  3ABV A;  4EYY R;  2LHR A;  3ONX A;  2K9A A;  3ZT7 A;  3CQX C;  2LOP A;  3OPC A;  4CN6 A;  4YT0 A;  4C91 A;  2X0H A;  5FXZ A;  4DO0 A;  1WR6 A;  1MIY A;  2W0G A;  3CPZ A;  1XNR T;  2BBJ A;  4P0A A;  2E9X A;  4U72 A;  2R6G F;  2XAG B;  1KFY A;  3ZC0 A;  4A97 A;  4ZI2 D;  3GWH A;  4ERR A;  1T8B A;  3CQG B;  5LMU T;  4L0R A;  5HWX A;  3RI5 A;  1Z8U A;  5CB4 E;  2JQ9 A;  2IW5 B;  2VK9 A;  2DNX A;  2K24 A;  5FL0 A;  5EK4 A;  4DMW A;  1BR2 A;  1XWM A;  1BR4 A;  4ISS A;  2XPK A;  2DI4 A;  2HN2 A;  2K48 A;  4H63 H;  2CRB A;  2OV9 A;  5IHY A;  3ESL A;  2CWO A;  2W67 A;  3TLW A;  2ES0 A;  3DTO A;  2BKO A;  3ZYL A;  2ZM0 A;  3A5X A;  2DL1 A;  2JIW A;  2VKH A;  4IDO A;  4A56 A;  4ZS2 A;  3UU8 A;  4EV6 A;  4EXT A;  3SRZ A;  3AA0 B;  3RHW A;  2JQH A;  4LF9 T;  3EI0 A;  4HKA A;  1ZKE A;  5FY1 A;  4ZEY A;  1OWA A;  4EGW A;  2CBI A;  3DP7 A;  2X9Y A;  3J9X 1;  3BK9 A;  4I50 E;  2W4X A;  4BA9 A;  3AAA B;  5FKY A;  1X9B A;  3G06 A;  1N33 T;  3AEC A;  4COF A;  4I55 E;  3LBX A;  2ODU A;  4ILA A;  1NAF A;  5HEO A;  1SHZ C;  4MLK A;  2LKG A;  1HG2 A;  1DU2 A;  1MMD A;  4JUY A;  3K8P C;  5FVK A;  4AXP A;  4NXN T;  2WWV A;  2XQ7 A;  3UT5 E;  1YXR A;  1OED A;  5HXS A;  2LSJ A;  3PJA A;  4HWF A;  3CK6 A;  1E1H B;  5ADX L;  3O4X E;  1LVF A;  2M6I A;  3KVA A;  2VQF T;  2ZM2 A;  3L39 A;  4FI5 A;  5LGN B;  4DND A;  2D9D A;  2X51 A;  3OKQ A;  5LBQ B;  3EUH A;  3FZF B;  1I6Z A;  2XSA A;  2L9Q A;  3AA6 B;  2XQ3 A;  3KDS E;  1QSD A;  4IST A;  3R84 B;  4BJM A;  4PJJ A;  1W0A A;  5A1L A;  3MAC A;  4AKH A;  5HEG A;  3ZLI A;  2C5K T;  2PFV A;  4O8S A;  3C51 A;  2Q9Q C;  5JDF A;  1QLB A;  5CGM A;  3AEE A;  3LBX B;  4G63 A;  4JEH B;  1T72 A;  3HKC E;  3RX6 A;  1LVK A;  2DLR A;  1YD8 G;  2UUA T;  5L3C B;  2X0L B;  2D0T A;  2RA1 A;  3P4P A;  3UU6 A;  2NP9 A;  2LE8 A;  4WNK A;  4UVC B;  4AKG A;  3L09 A;  3OBV E;  1XMO T;  2UXD T;  2Q9Q A;  3AE8 A;  2V7I A;  4G2A A;  1J1J A;  4CZZ B;  2FUP A;  3OYZ A;  3ZKR A;  5AQP B;  1HX8 A;  3NKZ A;  2J4G A;  2YKS A;  1US7 B;  5LOV E;  3UTK A;  4IIJ E;  3RKG A;  4E7S A;  4JLE A;  2C5I T;  5ABF A;  2Z6E A;  5FXW A;  4LMK A;  3ZCJ A;  3CML A;  4KHZ F;  4MFR A;  3AE3 A;  1ZV4 X;  3I0O A;  4JYA T;  4TNV A;  1IAP A;  1XDO A;  2ZMA A;  3M65 A;  5J0Z A;  3RIU C;  2WBL A;  4U3C A;  5LYJ E;  4X66 T;  2QA7 A;  1YQ4 A;  2BKP A;  4HFE A;  5JVD E;  5HCM A;  4GK5 E;  2JRK A;  2Y8D A;  5JDH A;  3GA8 A;  2IAK A;  2YOE A;  1XNQ T;  3ZC1 A;  4TV8 E;  1G73 A;  2Q9Q B;  4HFC A;  2BG9 C;  4CN4 A;  1KNP A;  2UXX B;  3RIU A;  2YU2 A;  2XHE B;  4Z90 A;  1KNR A;  5L3E B;  4IL9 A;  1VCS A;  5AFU L;  2H7O A;  5JTG A;  3AEF A;  2I6H A;  4YTP A;  5JR9 B;  4YJ2 E;  2MAW A;  1JNZ A;  3CWZ B;  5AQS B;  3SFD A;  2CCQ A;  4IE7 A;  1UX4 A;  2LSG A;  2BG9 A;  5J1G A;  3QB5 A;  4OK0 A;  5C2T A;  4YHH T;  2W2U A;  2V6Y B;  5LCY A;  5JRC A;  2CHN A;  3PUQ A;  2A2F X;  2C0S A;  2VL8 A;  4PK5 A;  1D0Z A;  3MXZ A;  3PUV F;  3JAF A;  3KV9 A;  2QRX A;  3RRC A;  4DV4 T;  3UFG A;  3NBX X;  5JDL A;  2KLQ A;  2LLY A;  4DR7 T;  3N9L A;  2DHR A;  4PFO A;  2MYS A;  3AEB A;  1HG5 A;  2PG8 A;  4QHO A;  2BS3 A;  4AKI A;  3VKG A;  3TLU A;  2PJQ A;  4DMV A;  2ACZ A;  3RQU A;  2WDR A;  3KV6 A;  2KMF A;  3O1H A;  2BZB A;  3AEA A;  4O4I E;  3ZMU B;  2VUR A;  2KSR A;  5L3F B;  4K0K T;  3H37 A;  2NR4 A;  3ETU A;  4KMC A;  3EDV A;  3VRA A;  4HWC A;  2VAS A;  3FBZ A;  4JV5 T;  3ZT6 A;  3N2O A;  4IDP A;  5HWY A;  2CA5 A;  4DBR A;  4DR3 T;  4QWN B;  4QH4 A;  4XAX B;  5AQI B;  3AE4 A;  1HFA A;  2YEV C;  4IE6 A;  1HNW T;  4LFA T;  4AQF C;  1XDP A;  4HN9 A;  4L9I A;  5AQF B;  2YDR A;  5HAX A;  2BS2 A;  1WR0 A;  3AXJ A;  3F31 A;  2V7L A;  4B3S T;  2XQA A;  1FEW A;  3PTR B;  2NTX A;  4X1K E;  4ZXL A;  4JI2 T;  2E5V A;  3JAE A;  3VRB A;  5ABE A;  3CKD A;  5AQL B;  4KUM B;  2FBW A;  4UEM A;  5TAO A;  2XUE A;  3Q9D A;  5J2T E;  4LFB T;  4DV7 T;  3N9N A;  4GYS A;  4QH5 A;  4HEA A;  2UXC T;  1NEK A;  4DV6 T;  3AE7 A;  5F8P A;  3N2G E;  1UUR A;  3ANW B;  3IA3 A;  1ZP0 A;  2KT9 A;  4ZS3 A;  3NZP A;  4LF4 T;  2XQ5 A;  4LMJ A;  1UX5 A;  1UUS A;  2Y6X A;  1D0X A;  1XZY A;  4HFV A;  4PJN A;  5CA1 E;  4EYU A;  4AKL A;  3RF1 A;  2WCA A;  3JC6 D;  3SWH A;  3ONL C;  3KIN B;  1HNZ T;  4E7Z A;  4GK0 E;  3ZMS B;  2V1D B;  4TWF A;  2FJE A;  4ZI3 C;  4JI1 T;  4B3T T;  1OED E;  3AB3 B;  5C3J A;  5LMN T;  3AXJ B;  2UXB T;  4U2Y A;  2VVN A;  5DAB A;  5KDM C;  4TV9 E;  4V1A v;  3ZPO A;  5KX5 E;  3CVR A;  4YSY A;  3SS1 A;  2CXL A;  3K3Q C;  3PDY A;  4GKJ T;  5AQN B;  2XAF B;  3N9M A;  4I0U A;  1U5P A;  5H6R B;  2J47 A;  3P4S A;  3MJX A;  4CN1 A;  3AE9 A;  1FMW A;  3L8R A;  5C8Y E;  4CI2 B;  2ZM8 A;  3B57 A;  3ZJ1 A;  5FP3 A;  4QH1 A;  1N34 T;  1MMA A;  2X66 A;  2LRK A;  4DBQ A;  2OA5 A;  4JI5 T;  1UGO A;  4IGU A;  4PK4 A;  4EED A;  3N9P A;  2IC9 A;  3EHZ A;  3NRX A;  4OYK A;  4O2A E;  4CI3 B;  3IHR A;  3VR9 A;  2V26 A;  5LB7 B;  2YU1 A;  5JQG E;  2X9X A;  2WWU A;  4H9O C;  5FMN A;  2YDS A;  3HKD E;  2CE7 A;  2UU9 T;  3UQ4 A;  2B1E A;  3HA4 A;  4DR6 T;  3FHN A;  4DR4 T;  1VCT A;  3PUA A;  4IE4 A;  4X5T A;  4WBN E;  1D1C A;  4B3R T;  4QX7 B;  2VKD A;  3Q5E A;  5CFB A;  2WU5 A;  4HTE A;  5L3B B;  4X62 T;  1ZHC A;  4X1Y E;  2N2N A;  5LBM A;  2AXD S;  3T1H T;  4NPP A;  4ZI2 C;  4PJM A;  3SOL A;  4JI7 T;  4UVB B;  3KFW X;  2CXD A;  3BQK A;  4H63 V;  3JAD A;  3AE5 A;  1LRZ A;  2WZH A;  3F2E A;  1MND A;  4IE5 A;  2HPJ A;  4OYJ A;  2JPF A;  5LJN A;  3RIA A;  2EHO D;  4AQG A;  2QYW A;  4HFI A;  5HEJ A;  4HFD A;  4UIG A;  4DV1 T;  5LXT E;  3RKO A;  5LG3 A;  2JQK A;  3LG7 A;  1IJ6 A;  4TUY E;  3OYX A;  3Q5D A;  2XQ4 A;  4IHJ E;  5H6Q B;  3JCF A;  4IRE A;  4YSX A;  2V5C A;  3KV5 A;  4X1I E;  2V8S V;  5M4Y A;  3P4Q A;  2LM9 A;  4EOZ B;  2V6X A;  5DQW A;  2DCF A;  2P9B A;  5L4H A;  3BQL A;  3C50 A;  4UV9 B;  1N36 T;  5JH7 E;  5JR9 C;  2WS3 A;  3KBU A;  3FXD B;  1D1A A;  2MBG A;  5AQU B;  5GON E;  5EK2 A;  2ACX A;  3CX7 B;  2W66 A;  2NW7 A;  5FYM A;  4ZI7 E;  5AQH B;  2LSK A;  2WQY A;  2BG9 E;  2HH7 A;  3TLV A;  2LEH A;  4OFZ A;  4HWI B;  2KWI B;  2WAU A;  5JR9 A;  1SA0 E;  2J62 A;  5DQV A;  4ZHQ E;  4KHP T;  5JDG A;  1E7P A;  3WAJ A;  4JI8 T;  4NUU A;  3VKH A;  2BBH A;  4DR2 T;  2V6Y A;  2KIN B;  4H9S E;  2CPT A;  2BDE A;  3MKD A;  4JI3 T;  2F4V T;  2OLT A;  3B5M A;  4DR1 T;  5AQM B;  3AE2 A;  3K3N A;  5L2L A;  1J5E T;  5F3J A;  5CJ5 A;  3LK4 2;  2VWA A;  2MTQ A;  5LNK A;  3FZH B;  1G8X A;  5LP6 E;  4UF0 B;  2DWG A;  4DR5 T;  4U33 A;  2VKO A;  4BAY B;  2XY8 B;  1KK7 A;  2LM2 A;  4XBF B;  1KEY A;  5KMG P;  1OXZ A;  2NW8 A;  3ZT5 A;  2BKN A;  4C90 A;  3KV4 A;  4EIW A;  3R6N A;  4M1P A;  5BMV E;  1D0Y A;  3PUX F;  5HYA A;  4ILU A;  3LK3 B;  2FJA A;  5DJQ C;  2KND A;  2MOZ A;  3RRW A;  4DV2 T;  3AEG A;  4YJ3 E;  2V7M A;  3FZM B;  2LSI A;  4U31 A;  2JMK A;  5JDQ A;  1VOM A;  2VQE T;  4YXD A;  2LJL A;  4HWD A;  1HS7 A;  3ZEF B;  5AQR B;  4BJN A;  5J2U E;  2BVL A;  3S4U A;  3ZYM A;  3X1D A;  5HCJ A;  2J1D G;  5AQK B;  3P8C D;  2D5U A;  5ETW A;  3AA7 B;  2H3R A;  4O4H E;  2E2A A;  4YFS A;  2UUC T;  1E2A A;  1T98 A;  3DJB A;  4LML A;  1S35 A;  3GN5 B;  3LK2 B;  4U7Y A;  4I4T E;  4PFP A;  4CI1 B;  1WFD A;  1D1B A;  1AJ3 A;  3NRY A;  3RYF E;  4QX8 B;  4O4L E;  2XTL A;  1UK5 A;  4NXM T;  2JJ9 A;  3LFM A;  5AQQ B;  5EK3 A;  2IDO B;  3N5L A;  1IBM T;  3M3Z B;  2E9X D;  3Q5W A;  3ZSS A;  4KX6 A;  4GYR A;  3CIR A;  4ADZ A;  4EAH A;  1J5W A;  1NEN A;  2YK0 A;  1Z0P A;  2GK9 A;  3AAE B;  5FXX A;  2I59 A;  3RPU A;  4PW8 A;  5FL1 A;  4YTM A;  3ANW A;  3U78 A;  2DWK A;  1WLX A;  4PNI A;  1JNR A;  5BR8 T;  2WP9 A;  4CXY A;  3CX8 B;  4LF5 T;  3AE1 A;  2QGS A;  4U74 A;  4UXN B;  4MBQ A;  3HI2 A;  1HR0 T;  1IBL T;  4FJO A;  3RC8 A;  4U2Z A;  3FBL A;  2X9H A;  4GIW A;  2XAH B;  1IJ5 A;  3AAI A;  4QXH B;  2IC6 A;  2WB5 A;  4HFB A;  4KP3 C;  3UUB A;  3QK6 A;  2K3W A;  1YW0 A;  4O2B E;  4IE0 A;  3MK7 C;  3QOF A;  1N32 T;  5AQO B;  3OTO T;  4CXX A;  1MMG A;  2IIU A;  4UV8 B;  2BS4 A;  2IHR 1;  4ASK A;  3B13 A;  1KF6 A;  2CHO A;  3E08 A;  3E22 E;  5L4E A;  5L3D B;  1T7S A;  3PV0 F;  2N1G A;  3HKE E;  3VR8 A;  1HNX T;  1YKH B;  3RYH E;  3UUN A;  4AQF A;  4WYV A;  3QB5 K;  2SPC A;  2W62 A;  3C4Z A;  1I94 T;  4NUV A;  3AE6 A;  3OVU A;  2XJ7 A;  3N9Q A;  4I43 B;  1GQE A;  2YDQ A;  2XAQ B;  5FY0 A;  1NWM X;  4DVD A;  3KBT A;  3N2K E;  2MPK A;  1WYB A;  2XAS B;  4H9N C;  4P09 A;  3EDU A;  4X64 T;  3UU5 A;  1WRD A;  5LHH B;  4AI6 A;  3QC9 A;  3PUW F;  3LSV A;  4YSZ A;  3ETV A;  5JDN A;  5E0O A;  2QVA A;  5HEH A;  2CEA A;  4WW0 A;  4MAL A;  2PTF A;  2X68 A;  5LJM A;  4YLH A;  4OX9 T;  4JI4 T;  1M62 A;  2ZLY A;  5HEU A;  3U3I A;  4AIS A;  2E8I A;  2N9D A;  1MMN A;  4LF8 T;  3I1A A;  4TWD A;  3WI3 A;  2XM1 A;  4JBW F;  2HHH T;  3PUY F;  4X65 T;  4ZOL E;  3QNU A;  5FVL A;  3E0Z A;  3BQI A;  3D0T A;  2H7V C;  2VKJ A;  4MHC A;  1SE7 A;  2A3D A;  5HXC A;  4AIU A;  2FJD A;  3V5S A;  1SUM B;  2IML A;  4IDQ A;  4UR9 A;  3FXE B;  3ZMZ B;  3W15 B;  3PUS A;  5LHG B;  2WDQ A;  5CA0 E;  4EEB A;  2W63 A;  4H9Q C;  2KWH A;  3Q2M A;  2Q9Q D;  4L5G A;  2X9W A;  2LOS A;  4KBM B;  4HE8 A;  3AVR A;  3EVY A;  2FJB A;  2XAJ B;  3RC3 A;  5L3G B;  1M7K A;  3ZST A;  3A8Y C;  5IWA T;  3RQW A;  3I0Q A;  4TNW A;  3MZK B;  3PUG A;  3RH3 A;  2E9X B;  1ZOY A;  1B7T A;  1FIO A;  2K5B B;  1HCI A;  2UUB T;  1W0B A;  2L3L A;  2LKH A;  3HL6 A;  3O1J A;  4A5X A;  2D0U A;  5IYZ E;  4JEU B;  2XSB A;  1OED C;  3JC6 C;  4ZZC A;  4KI0 F;  1YQ3 A;  1BR1 A;  2B76 A;  2W61 A;  4QXB B;  3UUM A;  2JQQ A;  4PAG A;  1FMV A;  3LJC A;  3P4R A;  2BVM A;  5LGT B;  4LF7 T;  1CHU A;  4YTN A;  4CXW A;  3IBP A;  4EZH A;  3F57 A;  4GOU A;  1S94 A;  3NVO A;  3AA1 B;  3T1Y T;  1UCU A;  1H7C A;  3FB2 A;  3PUZ F;  2CMR A;  3QUJ A;  3P50 A;  4IDZ A;  3ZCI A;  1L0V A;  4QXC B;  3H3M A;  3TLS A;  4UF0 A;  4P0B A;  2HPL A;  5FNV E;  3HR0 A;  2HN1 A;  2YN6 A;  4OHF A;  3WAK A;  3J7Y q;  4UEL A;  3PU8 A;  3AED A;  4B6X A;  4GKK T;  2WDV A;  3T8O A;  1YKE B;  2XZE A;  5IUX A;  4JI6 T;  2NTY A;  2UXN B;  2WU2 A;  2ZM6 T;  3MA9 A;  2JMH A;  3I9W A;  3PUR A;  1EZ3 A;  4YY3 T;  3ZJ2 A;  1HF8 A;  5JRE A;  1MIV A;  4LFC T;  3Q5X A;  2LHN A;  5EZY E;  1V9D A;  1XMQ T;  3L3P A;  4H9R C;  2KXP B;  3N9O A;  3ZN1 B;  3ZMT B;  4DUY T;  1KNZ A;  3HKB E;  2CWY A;  4TWH A;  1W9R A;  1OED B;  3C98 B;  2Y48 B;  4A98 A;  3LDQ B; 
#chains in the Genus database with same CATH homology
 1CUN A;  1UX5 A;  3AVS A;  3GN5 A;  4GYR A;  3GMI A;  4ADZ A;  1SHZ C;  2Y6X A;  1D0X A;  4EAH A;  4HFV A;  4MLK A;  4PJN A;  5CA1 E;  1HG2 A;  2YK0 A;  2D2S A;  1Z0P A;  4EYU A;  2CXF A;  2GK9 A;  3AAE B;  4AKL A;  1MMD A;  5FXX A;  4EZ4 A;  2I59 A;  3JC6 D;  3RPU A;  4PW8 A;  4JUY A;  3ZMV B;  3SWH A;  3K8P C;  3KIN B;  4AXP A;  4X20 E;  3PE0 A;  3ANW A;  3UT5 E;  4E7Z A;  3IF8 B;  3U78 A;  2DWK A;  5HXS A;  5FXV A;  2LSJ A;  4GK0 E;  5LA6 E;  3ZMS B;  1WLX A;  2V1D B;  4PNI A;  2EHO C;  4CXY A;  3CX8 B;  3NZQ A;  4ZI3 C;  3ZYK A;  2QGS A;  2WMN A;  4U74 A;  4UXN B;  1E1H B;  1QUU A;  3AB3 B;  3O4X E;  3K3O A;  5ADX L;  4MBQ A;  3HI2 A;  1LVF A;  2G0U A;  3KVA A;  4FJO A;  2ZM2 A;  3RC8 A;  4TZ4 C;  4FI5 A;  5DAB A;  4AKR B;  5LGN B;  4DND A;  5KDM C;  4TV9 E;  4V1A v;  3ZPO A;  5KX5 E;  2X51 A;  3OKQ A;  5LBQ B;  3EUH A;  3FBL A;  2X9H A;  3CVR A;  3SS1 A;  4GIW A;  2CXL A;  3K3Q C;  3PDY A;  2XAH B;  4O4J E;  1IJ5 A;  3AAI A;  2XAF B;  4QXH B;  2L9Q A;  2IC6 A;  3AA6 B;  3N9M A;  5LGU B;  4KP3 C;  3KDS E;  1QSD A;  1U5P A;  5H6R B;  3QK6 A;  4IST A;  3MJX A;  3R84 B;  4EB6 E;  5HXH A;  2YIN A;  1YW0 A;  4BJM A;  4PJJ A;  1FMW A;  2EHO A;  5A1L A;  5C8Y E;  4O2B E;  4IE0 A;  3MAC A;  3MK7 C;  4AKH A;  4CI2 B;  2CLY C;  2ZM8 A;  3ZLI A;  2C5K T;  2PFV A;  3B57 A;  3ZJ1 A;  4CXX A;  5FP3 A;  3VHL A;  4O8S A;  1MMG A;  4UV8 B;  1MMA A;  2X66 A;  3C51 A;  4DBQ A;  2Q9Q C;  4ASK A;  5JDF A;  3LBX B;  3B13 A;  2OA5 A;  3P7I A;  4G63 A;  4JEH B;  3HKC E;  3E08 A;  1O3X A;  3RX6 A;  1IZN B;  1LVK A;  4IGU A;  3ZN0 B;  4PK4 A;  3E22 E;  2DLR A;  3H3A A;  3N9P A;  5L3D B;  1YD8 G;  2IC9 A;  4XZC A;  4TX5 A;  2CM0 A;  5L3C B;  2N1G A;  3HKE E;  3NRX A;  4OYK A;  4ANJ A;  1ZEE A;  4O2A E;  4CI3 B;  2X0L B;  4CQI A;  3IHR A;  1YKH B;  2D0T A;  2RA1 A;  2V26 A;  3RYH E;  2NP9 A;  3UUN A;  2LE8 A;  4AQF A;  2C5J A;  2YU1 A;  5JQG E;  2X9X A;  2SPC A;  2WWU A;  2W62 A;  3C4Z A;  4WNK A;  2L8K A;  4H9O C;  4UVC B;  4AKG A;  5FMN A;  3HKD E;  3L09 A;  2CE7 A;  3OBV E;  5JDM A;  4NUV A;  2Q9Q A;  1X79 A;  2B1E A;  4K0U A;  1WYC A;  2LT3 A;  3HA4 A;  3FHN A;  2A72 A;  1MIW A;  2V7I A;  3IEE A;  3N9Q A;  4H9P C;  3VU7 H;  4UVA B;  4I43 B;  3PUA A;  2XAQ B;  4G2A A;  4CZZ B;  5FY0 A;  4IE4 A;  1NWM X;  4WBN E;  4DVD A;  4PK6 A;  1D1C A;  3KBT A;  3N2K E;  3OYZ A;  4QX7 B;  1HX8 A;  2X67 A;  2VKD A;  3CX6 B;  1WYB A;  3RYC E;  2XAS B;  3RYI E;  4H9N C;  4P09 A;  3EDU A;  1US7 B;  4HTE A;  5LOV E;  1ZHC A;  5L3B B;  4X1Y E;  3UTK A;  2N2N A;  1WRD A;  5LBM A;  3I9Y A;  5LHH B;  3QC9 A;  4AI6 A;  5JDN A;  3ETV A;  4ZI2 C;  5E0O A;  1MNE A;  4WBO A;  4PJM A;  3O1I A;  4IIJ E;  5FY7 A;  3UUL A;  3SOL A;  2CEA A;  4UVB B;  2WM9 A;  4WW0 A;  4E7S A;  2XQY A;  3PU3 A;  3KFW X;  4MAL A;  4N78 D;  4JLE A;  2C5I T;  2X68 A;  5LJM A;  4YLH A;  1VRB A;  2Z6E A;  5FXW A;  2ZLY A;  3ZCJ A;  2CXD A;  3BQK A;  3V5U A;  2VB6 A;  4H63 V;  3CML A;  2EHO B;  2WSS V;  4MFR A;  3U3I A;  1LRZ A;  1ZV4 X;  2WMO A;  3F2E A;  1MND A;  3I0O A;  3O9X A;  4QKN A;  4IE5 A;  2E8I A;  2HPJ A;  3TKL B;  2N9D A;  1MMN A;  2RP4 A;  1IAP A;  3C4W A;  4OYJ A;  5LHI B;  2ZMA A;  3M65 A;  3I1A A;  2V7J A;  3WI3 A;  5LG4 A;  3C4X A;  1BR0 A;  4PJL A;  3OJA A;  5HXR A;  2JPF A;  2WBL A;  5LJN A;  2EHO D;  5LYJ E;  2QA7 A;  4AQG A;  4ZI3 D;  1LKX A;  4ZOL E;  2PBI A;  5JVD E;  4UIG A;  3UUX B;  1U4Q A;  3E0Z A;  3BQI A;  3D0T A;  4GK5 E;  5LXT E;  3RKO A;  2JRK A;  2Y8D A;  5JDH A;  3GA8 A;  5HXE A;  2H7V C;  2VKJ A;  3LG7 A;  1IJ6 A;  4MHC A;  4TUY E;  2IAK A;  2CLY B;  3OYX A;  3ZC1 A;  1HTJ F;  2W00 A;  2A3D A;  5HXC A;  2NOX A;  4IHJ E;  4TV8 E;  5H6Q B;  1G73 A;  2Q9Q B;  2V7K A;  3V5S A;  1Y64 B;  4YHJ A;  2UXX B;  3FXE B;  4F6R C;  5JRC B;  2KZ7 B;  3ZMZ B;  3KV5 A;  4X1I E;  3W15 B;  3PUS A;  5LHG B;  2YU2 A;  2XHE B;  5L3E B;  5M4Y A;  3CQC B;  5AFU L;  5CA0 E;  2LM9 A;  4EOZ B;  5DQW A;  2W63 A;  4H9Q C;  2H7O A;  4TN7 B;  2KWH A;  2DCF A;  3Q2M A;  2Q9Q D;  2P9B A;  2X9W A;  2LOS A;  4KBM B;  4L5G A;  4HE8 A;  3AVR A;  3EVY A;  3BQL A;  3C50 A;  4YJ2 E;  4UV9 B;  5JR9 B;  2XAJ B;  3CWZ B;  2NWB A;  5JH7 E;  5JR9 C;  3KBU A;  3FXD B;  3RC3 A;  5L3G B;  1D1A A;  2MBG A;  2CCQ A;  4IE7 A;  1UX4 A;  2LSG A;  2NW9 A;  5J1G A;  2M67 A;  2LSY A;  5GON E;  4OK0 A;  4J2C A;  5EK2 A;  2ACX A;  3CX7 B;  4HGA A;  2NW7 A;  5FYM A;  3I0Q A;  5LCY A;  3MZK B;  5JRC A;  3PUG A;  3RH3 A;  2E9X B;  4ZI7 E;  2ODV A;  3C64 A;  2LSK A;  2E9X C;  3UFE A;  2HH7 A;  4Z8X A;  3PUQ A;  1B7T A;  2A2F X;  3KVB A;  2C0S A;  1FIO A;  2LEH A;  4EYY R;  2VL8 A;  2LHR A;  2K5B B;  4PK5 A;  1D0Z A;  1HCI A;  2K9A A;  3MXZ A;  3ONX A;  4OFZ A;  2L3L A;  3CQX C;  3HL6 A;  3KV9 A;  3O1J A;  2KWI B;  2LOP A;  2WAU A;  3RRC A;  5JR9 A;  3NBX X;  4C91 A;  5JDL A;  1SA0 E;  5DQV A;  4ZHQ E;  5JDG A;  2D0U A;  2KLQ A;  5IYZ E;  4JEU B;  3JC6 C;  5FXZ A;  1BR1 A;  4DO0 A;  3WAJ A;  1WR6 A;  3N9L A;  2W61 A;  4NUU A;  2DHR A;  4QXB B;  3VKH A;  1MIY A;  2KIN B;  2W0G A;  3CPZ A;  4PFO A;  2MYS A;  3UUM A;  4P0A A;  1HG5 A;  4H9S E;  2E9X A;  4U72 A;  2PG8 A;  2JQQ A;  2BDE A;  4QHO A;  3MKD A;  4PAG A;  2XAG B;  3ZC0 A;  4AKI A;  3VKG A;  1FMV A;  3K3N A;  3LJC A;  2PJQ A;  5L2L A;  4DMV A;  4ZI2 D;  2BVM A;  5LGT B;  3GWH A;  5F3J A;  3LK4 2;  2VWA A;  2MTQ A;  3KV6 A;  4ERR A;  5LNK A;  3CQG B;  1G8X A;  5LP6 E;  2KMF A;  4UF0 B;  2DWG A;  4CXW A;  3IBP A;  3O1H A;  4L0R A;  5HWX A;  2BZB A;  2VKO A;  4BAY B;  4O4I E;  5CB4 E;  3ZMU B;  2IW5 B;  1KK7 A;  4XBF B;  4EZH A;  5KMG P;  5L3F B;  1OXZ A;  3F57 A;  2NW8 A;  2VK9 A;  3H37 A;  4GOU A;  1S94 A;  2DNX A;  4C90 A;  2K24 A;  3KV4 A;  5EK4 A;  4EIW A;  3ETU A;  3R6N A;  4M1P A;  4DMW A;  3AA1 B;  5BMV E;  1BR2 A;  4KMC A;  3EDV A;  1UCU A;  1D0Y A;  1BR4 A;  1H7C A;  3FB2 A;  5HYA A;  2VAS A;  4ISS A;  3FBZ A;  2CMR A;  2DI4 A;  3QUJ A;  4ILU A;  2K48 A;  3LK3 B;  4IDZ A;  3N2O A;  4H63 H;  3ZCI A;  5HWY A;  5DJQ C;  2CA5 A;  5IHY A;  3ESL A;  2KND A;  2CWO A;  2MOZ A;  3RRW A;  4QXC B;  4DBR A;  4QWN B;  2ES0 A;  3DTO A;  4UF0 A;  4XAX B;  4P0B A;  4YJ3 E;  2V7M A;  3ZYL A;  2ZM0 A;  3A5X A;  2LSI A;  2HPL A;  1HFA A;  2VKH A;  2YEV C;  2JMK A;  3HR0 A;  4IE6 A;  5FNV E;  4A56 A;  4ZS2 A;  5JDQ A;  1VOM A;  4OHF A;  4AQF C;  4HN9 A;  4EXT A;  4L9I A;  3SRZ A;  2LJL A;  1HS7 A;  3WAK A;  3ZEF B;  4UEL A;  3PU8 A;  3J7Y q;  5HAX A;  4B6X A;  4BJN A;  5J2U E;  2BVL A;  3S4U A;  3ZYM A;  3T8O A;  1YKE B;  3AA0 B;  3F31 A;  2V7L A;  2J1D G;  2NTY A;  1FEW A;  3PTR B;  2NTX A;  3P8C D;  2D5U A;  5ETW A;  3AA7 B;  4X1K E;  2UXN B;  4HKA A;  1ZKE A;  2H3R A;  4O4H E;  4YFS A;  3MA9 A;  2JMH A;  1T98 A;  3DJB A;  3I9W A;  3PUR A;  1S35 A;  1EZ3 A;  3GN5 B;  3LK2 B;  5FY1 A;  3ZJ2 A;  1HF8 A;  3CKD A;  4I4T E;  5JRE A;  4PFP A;  1OWA A;  4KUM B;  4CI1 B;  1MIV A;  1D1B A;  4UEM A;  1AJ3 A;  5TAO A;  2XUE A;  3Q9D A;  5J2T E;  3DP7 A;  2X9Y A;  3NRY A;  3RYF E;  3Q5X A;  3J9X 1;  2LHN A;  4QX8 B;  5EZY E;  3BK9 A;  4I50 E;  4O4L E;  2XTL A;  3N9N A;  3AAA B;  1V9D A;  4BA9 A;  4GYS A;  3L3P A;  4H9R C;  2KXP B;  2JJ9 A;  3N9O A;  3LFM A;  4HEA A;  5EK3 A;  4I55 E;  3ZN1 B;  5F8P A;  3LBX A;  3ZMT B;  2ODU A;  3N2G E;  3N5L A;  1KNZ A;  3HKB E;  3ANW B;  2CWY A;  2E9X D;  3Q5W A;  3C98 B;  2KT9 A;  4ZS3 A;  3NZP A;  2Y48 B;  1NAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...