2D2SA

Crystal structure of the exo84p c-terminal domains
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
229
structure length
217
Chain Sequence
DMSSTAQRLKFLDEGVEEIDIELARLRFESAVETLLDIESQLEDLSLMLLNLISLKIEQRREAISSKLSQSILSSNEIVHLKSGTENMIKLGLPEQALDLFLQNRSNFIQDLILQIVDNPTNYLTQLAVIRFQTIKKTVEDFQDIFKELGAKISSILVDWCSDEVDNHFKLIDKQLLNLSPGSIKSSRKQIDGLKAVGLDFVYKLDEFIKKNSDKIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Endocytosis/exocytosis
molecule keywords Exocyst complex component EXO84
publication title The structures of exocyst subunit Exo70p and the Exo84p C-terminal domains reveal a common motif
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 91
structure length 217
sequence length 229
ec nomenclature
pdb deposition date 2005-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16528 Exo84_C Exocyst component 84 C-terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA01
1.20.58.1220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2d2sA02
2D2SA
chains in the Genus database with same CATH superfamily
4X62T 1ZV4X 2XAQB 1GQEA 2E5LT 2WAUA 2V5DA 2L9QA 1UK5A 3M3ZB 5HWYA 4EEDA 5ABFB 3N9PA 4YFSA 3B57A 2VK9A 2BG9C 4PJLA 5C3JA 1Y64B 5FXVA 5J0ZA 3C4XA 1OEDB 5A1LA 2QRXA 3WAJA 4IDZA 1T72A 3ZJ2A 3G06A 3RH3A 4XBFB 1V9DA 3AE3A 3TLVA 2WWVA 3VKHA 1G73A 2NWBA 5L3FB 2G0UA 2X66A 4AQGA 3VHLA 2CM0A 3B13A 4HN9A 5DQWA 3KV6A 1XMQT 4I4TE 3UQ4A 2W4XA 4HFHA 3IBPA 4WBNE 2WZIA 4NUUA 3AEDA 2VKOA 4QXCB 1BR0A 3UUNA 2NTXA 2XUEA 3RYCE 4X1IE 5LJNA 5FL0A 1XNRT 1W9RA 2AXDS 5L47A 4U72A 2A72A 1MNDA 3C64A 1U4QA 3HKEE 4PK5A 4IE6A 4FI5A 4DBRA 5L2LA 5FY1A 3LSVA 3VRBA 4A98A 3L3PA 1M7KA 4DIDB 4GK5E 1S35A 3EI0A 1WR0A 3AXJA 3Q9DA 4DMVA 4PFOA 2YU1A 1DU2A 2MBGA 4EAHA 2XSAA 5AQOB 1WYBA 4O4IE 4WW0A 1Z0PA 1UCUA 1HX8A 2YOEA 3T8OA 3J9X1 5M4YA 2OA5A 3MJXA 2X0LB 5HXCA 5F8PA 4PJJA 5LG3A 3O1HA 4N78D 3JAFA 2KMFA 1LRZA 2XQ9A 3RQUA 4E7ZA 3AE4A 5AQUB 4AISA 1LKXA 5AQLB 1T7SA 3FBZA 2D0UA 3AECA 4YSZA 2LHRA 4TN7B 5L3CB 2V7JA 3CKDA 3CK6A 2F4VT 4F6RC 3EABA 3UTKA 4HFCA 2CWYA 4ASKA 2LKGA 2QVAA 4AKRB 4CXWA 5ABHA 3B5MA 4Z8XA 2H88A 2AE9A 4B3RT 2LE8A 3K8PC 3UU8A 1HCIA 3DJBA 2VQFT 3NRXA 2LHNA 4Z91A 1UX5A 4G63A 4JI2T 1BR2A 3GMIA 3P4SA 2L3LA 4TZ4C 4YTNA 2RA1A 2PBIA 5LHGB 1IBLT 4CN6A 4U7IA 2WZHA 3UU6A 4WZXA 3N5LA 2ZM6T 4AKHA 4AI6A 1US7B 4UF0A 5FKYA 2YKSA 2WU2A 4C90A 2CRBA 5HXSA 1D1CA 3OKQA 1NENA 2XAFB 2LSIA 2CBIA 2XTLA 1HFAA 4KHPT 1XMOT 2CLYB 4YJ3E 3AAAB 4DR4T 2CBJA 2V7KA 1JNRA 3AEBA 2VL0A 2DHRA 4KI0F 1FMWA 4AKIA 1ZP0A 4OYJA 3SFDA 3HKBE 2XQ7A 2RPAA 3ZSTA 3ZMVB 4BJMA 3UULA 2X68A 1W0AA 4ILCA 5AQQB 3BK9A 2H3RA 2UXBT 4JYAT 2VWAA 2X9XA 2CPTA 2H7VC 4A5XA 5HYAA 3JADA 5HEOA 4LF9T 3J7Yq 3KVBA 4ZI3D 2XQ6A 2JMHA 1WRDA 1VCSA 3IA3A 4U7YA 4WNKA 1ZKEA 2CCQA 2LT3A 3DP7A 3CX6B 3RX6A 1NWMX 4EB6E 5C2TA 3AEEA 4EYUA 4B3ST 4KBMB 2BBJA 1HTJF 2BBHA 4COFA 3RRWA 4UXNB 1KK7A 2LKHA 2LSKA 5LGUB 2A9UA 3AXJB 5ABGA 3AE6A 1WYCA 3L8RA 5C8YE 4UIGA 4WBOA 2K9AA 2MOZA 2KLQA 3GWHA 4HWIB 2WCAA 3CPZA 4UVCB 1YD8G 5AQHB 1FEWA 2IHR1 3PURA 4ZZBA 2BVLA 2BS4A 2LRLA 4GK0E 4JI0T 1D1BA 3EAMA 3F57A 4ZI2D 3PV0F 5KXJA 2YDQA 1CUNA 3TLWA 2Y6XA 2LLYA 4CN1A 3N9MA 4XAXB 5LMUT 1UUSA 1SE7A 5ABEA 3UQ7A 3AE2A 2CXDA 3ZLIA 4X5TA 2V6YA 3GA8A 3ZN1B 3OJAA 4QH4A 3SRZA 2C5IT 2KXPB 4DVDA 3LG7A 2V26A 4HFVA 2XAHB 3I0QA 3U78A 2RP4A 1Z8UA 2V7IA 1W09A 4TNWA 2K24A 5ETWA 3BQLA 2NW7A 5F5WA 3AAEB 4DR2T 2WDQA 4JEHB 4YSXA 2X0HA 4MFRA 4UF0B 4YJ2E 4U74A 1B7TA 5LB7B 4Q25A 2CHNA 3Q5XA 2Q9QC 1U5PA 5DABA 1NEKA 2D9DA 4X20E 4P0AA 2UXXB 3X1DA 3MK7C 4X1KE 2BZBA 3QK6A 3AB3B 5L3GB 3CVRA 2JJ9A 2XPKA 4ZZCA 5FVLA 4TWFA 2V1DB 3K3NA 4KMCA 1IJ6A 2CEAA 1HNWT 1YKHB 3QC9A 3ANWA 3FXDB 3MA9A 5KX5E 3RI5A 3EDUA 4MALA 5HXRA 5HEGA 4QXBB 4HWCA 4UR9A 4YHHT 2V7LA 2Y48B 3AE1A 4XZCA 4EGWA 3N9QA 2XQ3A 3PJAJ 3LFMA 4HFIA 1D0YA 4YT0A 4TUYE 2E9XA 5CA0E 2W2UA 5ADXL 4MHCA 3TLTA 1X9BA 3IEEA 2MYSA 5HEHA 1BR4A 5JDFA 1MMNA 1SA0E 2FJBA 2WBLA 4ZHQE 1N33T 5AQKB 2EHOC 4HE8A 3K3QC 2C0SA 3C4WA 4ISTA 2HHHT 4UVBB 5EK3A 2HH7A 4YHJA 4OK0A 4TWHA 5AQVB 5EK4A 3EVYA 3JC6D 1WCRA 5L4HA 3ONJA 4H9RC 5LMNT 2DL1A 2PG8A 1MIYA 2WDRA 3N2GE 2OLTA 4CZZB 1YQ4A 5HEUA 1XDPA 1HG5A 4Z90A 3ZKRA 2V6YB 2ZM2A 3CMLA 2YN6A 5BR8T 4DR6T 3E0ZA 3NWIA 4V1Av 1YXRA 5J1GA 2YDRA 5AFUL 3RPUA 4JV5T 3QNUA 4H9PC 3H3MA 4I43B 4DUZT 3KV9A 4B6XA 1D0XA 2FJDA 3OYZA 2DWGA 4TWDA 1J5WA 1MMDA 3JAEA 3AVSA 3P4PA 2LM9A 1VCTA 2YEVC 3ZCIA 3T1YT 4QXHB 2BG9A 3PU8A 3F31A 3RHWA 1WR6A 4IDOA 4ANJA 1KNRA 2I0MA 4HFEA 2MAWA 1XNQT 3AE8A 2WS3A 4GIWA 5JTGA 4DO0A 2BS2A 4ADZA 1Y01A 1MIVA 4U2ZA 2VKJA 1HG2A 2LSYA 4QWNB 2XQAA 2NP9A 3F2EA 1BR1A 2KWHA 4FJOA 3AA6B 4DV2T 3R6NA 5LBMA 4IREA 2CA5A 2WDVA 5FXXA 3ANWB 2UU9T 2LEHA 3PUZF 4LFAT 2ZLYA 4CXYA 5FVKA 2V5CA 3UT5E 3N9LA 4LFBT 4ZS2A 1R8IA 2JRKA 2A2FX 2E9XD 3KDSE 1KNPA 4YY3T 4P0BA 3C98B 4AIUA 4GOUA 4EYYR 2V7MA 4CI1B 3KV5A 5FMNA 5LBQB 5JDLA 2JQHA 2MPKA 3AE9A 5FY0A 1OEDE 2X51A 1D0ZA 1W0BA 2E9XB 3RLFF 4QKNA 1MMGA 4OYKA 4IL9A 3ZSSA 3N9OA 4H9OC 2XQ4A 2BVMA 2WSSV 3ZCJA 3A5XA 2IC9A 3UUBA 3Q5WA 2XAJB 2QYWA 4L9IA 3ZYLA 2BKPA 5CA1E 4IHJE 2FBWA 4PAGA 2NOXA 5L3DB 3HKDE 4PJMA 5HEJA 2HN2A 4ZEYA 1J1JA 2LOSA 1FMVA 1KEYA 2ACXA 2YINA 1MIWA 1IJ5A 2VKDA 4LF4T 2VL8A 2WM9A 4WYVA 4A56A 2LSJA 1JNZA 3NBXX 4I50E 3ZMZB 2DNXA 5AQTB 2XASB 3ONXA 4BAYB 3VRAA 2IDOB 4YLHA 5AQGB 3DTOA 1OEDC 2W61A 3FHNA 2C5KT 4NUVA 3D0TA 5IWAT 3RC8A 3HL6A 1I94T 2XHEB 4IGUA 2VURA 4DR5T 3CQGB 3UFEA 1FIOA 1VRBA 4JI8T 4DV0T 3VKGA 2I6HA 3EDVA 3NVOA 2CXLA 4LF5T 2SPCA 2NW9A 3JC6C 3KVAA 2DCFA 3RIFA 3MKDA 4NXMT 3OTOT 3H3AA 4OFZA 3ESLA 4PFPA 5FL1A 2LSGA 2WQYA 3ZYKA 3KBTA 3RC3A 2BG9B 3RKOA 3AVRA 5CGMA 1XZYA 4DNDA 2VKHA 2K48A 3FZKB 4IDPA 4X65T 4H63V 2JPFA 3V5UA 2XM2A 4IDQA 4EIWA 3WAKA 2UXCT 2PJQA 2D5UA 2HPJA 4K0KT 3FBLA 3CQXC 2XQYA 4DUYT 4NIQA 5H6QB 3C4ZA 4ISSA 4ZS3A 2XAGB 2CHOA 3P4RA 5F3JA 4E7SA 4JI6T 3SWHA 2KT9A 5HCJA 2V6XA 4UV9B 2C5JA 3N9NA 2XJ7A 2ZMAA 5EZYE 5DJQC 3Q5DA 2UUBT 3OBVE 4JI5T 2LOPA 3T1HT 4QX8B 4AQFC 2DI4A 2VASA 1WFDA 1E7PA 5FY7A 2IW5B 3AAIA 3MACA 2Z6EA 2W63A 1HX1B 2YU2A 4X64T 2PTFA 3L39A 1LVKA 3I9YA 3CWZB 1T98A 4LF6T 2B1EA 2E5VA 3KV4A 3PUGA 2X9WA 3P8CD 2H89A 5JREA 2UUCT 4HFDA 2N1GA 3N2OA 4IE4A 2P9BA 3UUXB 4UELA 2LM2A 2D0TA 4ILBA 2VVSA 2WMOA 4EOZB 2UUAT 4YXDA 3RIUC 3BQIA 4U2YA 3UU3A 2H7OA 3FZHB 3HKCE 1CHUA 3O1JA 3PE0A 2L8KA 2XZEA 4ZXLA 5AQNB 4JI7T 3NKZA 1LVFA 4DV5T 4BA9A 3PUWF 3ABVA 2XQ8A 5JRCA 4U3CA 5LXTE 4P09A 3FZFB 3LDQB 2MTQA 5HXHA 3P50A 2BDEA 3QUJA 1MMAA 2CE7A 2M6BA 1YQ3A 1YW0A 4O2AE 1VOMA 4YTPA 4HWFA 3PUQA 2CLYC 4L0RA 1XDOA 4O4LE 5JQGE 4PK4A 5E0OA 3I0OA 1X79A 4X66T 4UVAB 5JR9A 2W66A 3ZC1A 4K0UA 4MLKA 3I9WA 3V5SA 5TAOA 2CXFA 5FXWA 4IE7A 1ZHCA 4DBQA 3RF1A 3PUAA 5LJMA 4IIJE 3RGLA 4G2AA 5LHIB 2JMKA 4JUYA 3ZMUB 2E2AA 5AQMB 1N32T 4BJNA 2Q9QA 3ONLC 4CQIA 5EK2A 4ZI3C 3QOFA 2JQ9A 1I6ZA 5KMGP 3PUYF 3VR9A 3CX8B 3OYXA 5LGNB 3AEAA 4P1NA 4AXPA 4LF7T 4OHFA 1IBKT 3AEGA 1QUUA 4LMLA 1EZ3A 2J62A 2W00A 4JBWF 3ZYMA 2WP9A 3FZMB 2W0GA 3FXEB 5J2UE 2V8SV 4CXXA 1M62A 1UGOA 1MNEA 3I1AA 2B76A 3RYHE 2WWUA 4JI4T 3ETVA 1IAPA 3JCFA 5LHHB 4I0UA 1KF6A 2WMNA 3ZT6A 1NAFA 2KZ7B 3CIRA 1E1HB 3ZN0B 5IUXA 4DR7T 3A8YC 2IAKA 4EZ4A 3Q2MA 4DV4T 2M6IA 1OWAA 5AQJB 4ZI2C 1UX4A 3GN5A 1ZOYA 4DR1T 5LP6E 2PFVA 4KX6A 5FP3A 4DV3T 4TV8E 2EHOA 1E2AA 2UXDT 1QSDA 4IE5A 4NPPA 4PK6A 1S94A 3IF8B 1IBMT 4CI3B 1HNZT 3A7MA 4H9SE 3SS1A 5JRCB 2J1DG 4IL4A 3N2KE 3LBXA 4JLEA 2N9DA 5AQSB 3CQCB 3R84B 3OPCA 1G8XA 1T8BA 3ZT5A 4F8HA 2KINB 1N34T 3ZC0A 4TX5A 1HR0T 1IZNB 3PU3A 3K3OA 4UV8B 3HA4A 5AQFB 5L3EB 3LJCA 2XY8B 4ILUA 4ILAA 2W67A 5JR9B 5HXEA 2FJAA 2ZM0A 3UU5A 4LF8T 2N2NA 4OX9T 4C91A 1QLBA 2ACZA 5FNVE 3WI3A 3EHZA 4DV1T 4ZOLE 4J2CA 3AEFA 2Q9QD 2YK0A 4GYSA 4HWHA 2I59A 2K5BB 2JIWA 4ZI7E 2YDSA 2KSRA 2BKNA 3NZPA 2KWIB 2XSBA 5KDMC 5BMVE 3ZT7A 4HGAA 2X0YA 2Q9QB 3TLSA 4QHOA 4QX7B 3UFGA 3KBUA 4IT4A 3PUVF 2QA7A 4H9NC 4GKKT 2W62A 3FB2A 4TNVA 1HNXT 3MZKB 3P7IA 4CI2B 4LFCT 2DLRA 1WLXA 3IHRA 3CX7B 4HEAA 3EUHA 3E08A 4HWDA 3OVUA 2KNDA 4JI1T 3P4QA 5LA6E 4U33A 4DMWA 4TV9E 1UURA 3O9XA 2QGSA 1KNZA 3C51A 1L0VA 4O4JE 3ZEFB 5LGTB 3FZLB 5H6RB 2FJEA 1H7CA 4PJNA 4UEMA 2BS3A 3VU7H 5CJ5A 5DQVA 3QB5A 3ZPOA 3UUMA 4LMJA 3AA0B 4PW8A 5HCMA 4AQYT 3Q5EA 2VB6A 2VQET 3O4XE 2EHOD 3RYFE 5IYZE 5HWXA 1OXZA 2NR4A 4M1PA 5CB4E 4B3MT 2R6GF 4JEUB 5J2TE 3AE7A 4I55E 3GN5B 1KFYA 1J5ET 2NW8A 3ETUA 2J4GA 2EHOB 4JI3T 3RKGA 2J47A 2E8IA 5LYJE 1SUMB 2Y8DA 2DWKA 3HI2A 3AA7B 2JQKA 1ZEEA 4NXNT 2FUPA 2OV9A 3LBXB 4HTEA 3RQWA 5AQRB 2A3DA 5L4EA 5ABFA 5AQPB 4DV7T 3LK42 3VR8A 4YSYA 4L5GA 5CFBA 5JDGA 3PJAA 3NRYA 3UU4A 5L3BB 1OEDA 4HKAA 1SHZC 3AA1B 4O8SA 3TLUA 2X9HA 1N36T 3MXZA 4MBQA 3E22E 3L09A 2ODVA 3SOLA 4DV6T 2XQ5A 5JDNA 2ES0A 3U3IA 2WY2A 3AE5A 3SFEA 4H9QC 2CWOA 4AKGA 4IDNA 5LOVE 4HFBA 5LNKA 5AQIB 3P4WA 4O2BE 4AKLA 1FJGT 5JR9C 2HN1A 2M67A 3O1IA 4DR3T 5GONE 3PTRB 4PNIA 4H63H 3W15B 1O3XA 2GK9A 1YKEB 2E9XC 4EXTA 2UXNB 4EV6A 3LK2B 4U31A 4B3TT 5HAXA 4KUMB 5LG4A 2X9YA 3S4UA 3HR0A 1HF8A 4CN4A 2K3WA 3ZJ1A 3H37A 3LK3B 4ERRA 3K1SA 3PUXF 2IIUA 4QH5A 3PDYA 4O4HE 1XWMA 3KFWX 2NTYA 5JDHA 4GYRA 4LMKA 4GKJT 1HS7A 2HPLA 2WB5A 5IHYA 2BKOA 2BG9E 2IMLA 5JVDE 4AQFA 4EEBA 2XM1A 2ODUA 5FYMA 2WU5A 2JQQA 2CMRA 5LCYA 2VVNA 5JH7E 3TKLB 2ZM8A 1AJ3A 3PUSA 4IE0A 4A97A 4KP3C 4QH1A 2LJLA 3C50A 3ZMSB 5FXZA 2X67A 2IUBA 4KHZF 5JDMA 1D1AA 5JDQA 3ZMTB 3QB5K 3M65A 4YTMA 4EZHA 3RIAA 3RIUA 4X1YE 2LRKA 3BQKA 2IC6A 3KINB 2D2SA 3RYIE 3NZQA 3RRCA
chains in the Genus database with same CATH topology
2XAHB 3DTOA 3R84B 3I0QA 2W61A 1G8XA 3U78A 2RP4A 1ZV4X 2KINB 2XAQB 3FHNA 2C5KT 4NUVA 3D0TA 3ZC0A 3RC8A 3HL6A 2WAUA 2V7IA 4TX5A 2K24A 2L9QA 5ETWA 1IZNB 5HWYA 3PU3A 3BQLA 3N9PA 4YFSA 2NW7A 2XHEB 3B57A 3K3OA 4IGUA 4UV8B 2VK9A 3CQGB 3HA4A 1FIOA 1VRBA 3AAEB 4PJLA 3LJCA 3UFEA 4JEHB 5L3EB 3VKGA 1Y64B 4MFRA 5FXVA 3EDVA 4ILUA 2CXLA 2SPCA 3C4XA 2NW9A 4UF0B 3JC6C 3KVAA 2DCFA 3MKDA 5A1LA 5JR9B 4YJ2E 4U74A 1B7TA 3H3AA 4OFZA 5HXEA 3WAJA 2ZM0A 3ESLA 4PFPA 4IDZA 3ZJ2A 3RH3A 2N2NA 4C91A 3Q5XA 5FNVE 2Q9QC 2LSGA 1U5PA 5DABA 4XBFB 3WI3A 4X20E 1V9DA 4P0AA 3ZYKA 4ZOLE 2UXXB 3VKHA 4J2CA 3KBTA 3RC3A 3RKOA 3MK7C 1G73A 2Q9QD 2YK0A 4GYSA 3AVRA 2I59A 2NWBA 4X1KE 2BZBA 3QK6A 5L3FB 2K5BB 3AB3B 4ZI7E 2G0UA 4DNDA 2X66A 5L3GB 2VKHA 2K48A 4AQGA 3VHLA 3CVRA 2CM0A 2JJ9A 3B13A 4HN9A 5DQWA 2V1DB 3K3NA 4H63V 4KMCA 3KV6A 3NZPA 2JPFA 3V5UA 2KWIB 4I4TE 5KDMC 1IJ6A 4EIWA 5BMVE 3WAKA 4HGAA 2Q9QB 4QHOA 2CEAA 1YKHB 3IBPA 4WBNE 4QX7B 3QC9A 2PJQA 2D5UA 2HPJA 3ANWA 3KBUA 4NUUA 2VKOA 3FXDB 4QXCB 3FBLA 2QA7A 3CQXC 2XQYA 4H9NC 1BR0A 3MA9A 5KX5E 3UUNA 2W62A 3FB2A 2NTXA 2XUEA 5H6QB 3EDUA 3RYCE 4MALA 3C4ZA 5HXRA 4ISSA 4X1IE 4ZS3A 4QXBB 5LJNA 3MZKB 3P7IA 2XAGB 4CI2B 2DLRA 1WLXA 2V7LA 5F3JA 3IHRA 4U72A 2A72A 2Y48B 1MNDA 4E7SA 3C64A 3SWHA 2KT9A 3CX7B 1U4QA 4XZCA 3HKEE 4PK5A 4HEAA 4IE6A 3EUHA 4UV9B 2C5JA 3N9NA 3E08A 2ZMAA 5EZYE 3N9QA 5DJQC 2KNDA 3LFMA 3OBVE 4FI5A 4DBRA 2LOPA 5L2LA 5FY1A 5LA6E 3L3PA 4QX8B 4AQFC 4DMWA 2DI4A 1D0YA 2VASA 4TV9E 4TUYE 2E9XA 5CA0E 3O9XA 5ADXL 4MHCA 2QGSA 4GK5E 5FY7A 2IW5B 3AAIA 1S35A 3MACA 2Z6EA 1KNZA 2W63A 3C51A 3IEEA 3Q9DA 4DMVA 2YU2A 4O4JE 3ZEFB 1LVKA 3I9YA 5LGTB 2MYSA 3CWZB 1T98A 2YU1A 4PFOA 5H6RB 1H7CA 2MBGA 1BR4A 2B1EA 5JDFA 4PJNA 4UEMA 3KV4A 4EAHA 3VU7H 1MMNA 5DQVA 3PUGA 1WYBA 1SA0E 2X9WA 4O4IE 3ZPOA 3UUMA 3AA0B 2WBLA 4PW8A 3P8CD 4WW0A 4ZHQE 1Z0PA 2EHOC 5JREA 4HE8A 1UCUA 1HX8A 3T8OA 3K3QC 3J9X1 2VB6A 5M4YA 2OA5A 2C0SA 2N1GA 3MJXA 3N2OA 4IE4A 3C4WA 3O4XE 2X0LB 4ISTA 5HXCA 2EHOD 4UVBB 3RYFE 2P9BA 4PJJA 5F8PA 3UUXB 5IYZE 5EK3A 5HWXA 1OXZA 4M1PA 5CB4E 4UELA 3O1HA 2D0TA 4N78D 2HH7A 4YHJA 4JEUB 2KMFA 1LRZA 5J2TE 4OK0A 2WMOA 4E7ZA 4I55E 3GN5B 1LKXA 5EK4A 4EOZB 3EVYA 3FBZA 2D0UA 3JC6D 3BQIA 2NW8A 2LHRA 3ETUA 4TN7B 4H9RC 5L3CB 2H7OA 2V7JA 3CKDA 2EHOB 3HKCE 2PG8A 1MIYA 3O1JA 3PE0A 2L8KA 4F6RC 2E8IA 3N2GE 5LYJE 3UTKA 4CZZB 1LVFA 2Y8DA 4BA9A 2CWYA 2DWKA 4ASKA 3HI2A 3AA7B 5JRCA 4AKRB 4CXWA 1HG5A 4Z8XA 5LXTE 1ZEEA 4P09A 2ZM2A 3CMLA 2MTQA 2LE8A 3LBXB 5HXHA 3K8PC 2BDEA 3E0ZA 3QUJA 4V1Av 1MMAA 4HTEA 2CE7A 1HCIA 3DJBA 2A3DA 3NRXA 5J1GA 2LHNA 5AFUL 1YW0A 4O2AE 1UX5A 1VOMA 3RPUA 4G63A 1BR2A 3GMIA 2L3LA 4TZ4C 3LK42 3PUQA 4L5GA 2RA1A 2CLYC 2PBIA 5LHGB 4L0RA 4H9PC 4O4LE 4I43B 5JQGE 4PK4A 3KV9A 4B6XA 3N5LA 5E0OA 4AKHA 3I0OA 1D0XA 5JDGA 4AI6A 1US7B 3OYZA 4UF0A 1X79A 2DWGA 3NRYA 5L3BB 4UVAB 5JR9A 4HKAA 4C90A 1SHZC 5HXSA 3AA1B 1MMDA 4O8SA 1D1CA 3OKQA 3ZC1A 4K0UA 2XAFB 2X9HA 2LSIA 4MLKA 3I9WA 3V5SA 3MXZA 3AVSA 4MBQA 2LM9A 3E22E 5TAOA 3L09A 2XTLA 2CXFA 1HFAA 2YEVC 5FXWA 2ODVA 3ZCIA 4IE7A 3SOLA 1ZHCA 5JDNA 2ES0A 4QXHB 2CLYB 3PU8A 3F31A 4DBQA 1WR6A 3PUAA 4YJ3E 3U3IA 4IIJE 4ANJA 5LJMA 3AAAB 4G2AA 2V7KA 4H9QC 5LHIB 2DHRA 4GIWA 2CWOA 4DO0A 1FMWA 4ADZA 4AKGA 4AKIA 5LOVE 1MIVA 2JMKA 4OYJA 4JUYA 3ZMUB 3HKBE 2VKJA 1HG2A 2LSYA 5LNKA 4BJNA 4QWNB 3ZMVB 4BJMA 2Q9QA 2NP9A 3UULA 2X68A 3F2EA 4CQIA 5EK2A 4O2BE 4YLHA 1BR1A 4AKLA 2KWHA 4FJOA 3AA6B 4ZI3C 3BK9A 2H3RA 3R6NA 2VWAA 2X9XA 5LBMA 2H7VC 5HYAA 5KMGP 2CA5A 5JR9C 2M67A 3KVBA 5FXXA 4ZI3D 3J7Yq 2JMHA 3CX8B 3OYXA 5LGNB 1WRDA 3O1IA 3ANWB 5GONE 4WNKA 3PTRB 1ZKEA 2LEHA 4PNIA 4H63H 2CCQA 2LT3A 2ZLYA 3W15B 4AXPA 3DP7A 3CX6B 1O3XA 2GK9A 1YKEB 4OHFA 4CXYA 2E9XC 4EXTA 2UXNB 3RX6A 1NWMX 3UT5E 4EB6E 3LK2B 1QUUA 3N9LA 4ZS2A 1EZ3A 2W00A 5HAXA 2JRKA 2A2FX 4KUMB 2E9XD 4EYUA 3KDSE 3ZYMA 5LG4A 2X9YA 3S4UA 4KBMB 3HR0A 4P0BA 1HF8A 1HTJF 3ZJ1A 3C98B 3H37A 3LK3B 4GOUA 4ERRA 2W0GA 4EYYR 2V7MA 4CI1B 3KV5A 5FMNA 3RRWA 5LBQB 5JDLA 4UXNB 1KK7A 3PDYA 4O4HE 3KFWX 3FXEB 5FY0A 2X51A 2NTYA 5J2UE 1D0ZA 2E9XB 4CXXA 2LSKA 4QKNA 5LGUB 5JDHA 1MMGA 1MNEA 3I1AA 3RYHE 4OYKA 2WWUA 4GYRA 3ETVA 1IAPA 3N9OA 1HS7A 2HPLA 1WYCA 5LHHB 5C8YE 4UIGA 5IHYA 4WBOA 2WMNA 1NAFA 4H9OC 2K9AA 2KZ7B 5JVDE 4AQFA 2BVMA 2WSSV 2ODUA 3ZCJA 2MOZA 5FYMA 3A5XA 2IC9A 2KLQA 3Q5WA 1E1HB 3GWHA 3ZN0B 2JQQA 2CMRA 2XAJB 2IAKA 5LCYA 4L9IA 4EZ4A 3CPZA 3Q2MA 3ZYLA 4UVCB 1YD8G 5CA1E 1FEWA 4IHJE 3PURA 5JH7E 1OWAA 3TKLB 2BVLA 4PAGA 2NOXA 2ZM8A 4ZI2C 5L3DB 4GK0E 3HKDE 4PJMA 1D1BA 1UX4A 1AJ3A 3GN5A 3F57A 3PUSA 4IE0A 5LP6E 2PFVA 4KP3C 4ZI2D 5FP3A 4TV8E 2LOSA 1FMVA 1CUNA 2EHOA 2LJLA 2ACXA 3C50A 3ZMSB 2YINA 5FXZA 2X67A 1MIWA 1IJ5A 2VKDA 2Y6XA 1QSDA 2VL8A 4IE5A 2WM9A 3N9MA 4PK6A 1S94A 4XAXB 4A56A 5JDMA 1D1AA 2LSJA 3IF8B 5JDQA 3NBXX 4I50E 4CI3B 3ZMTB 2CXDA 4H9SE 3SS1A 3M65A 3ZMZB 2DNXA 3ZLIA 4EZHA 4X1YE 3GA8A 3BQKA 2XASB 5JRCB 2J1DG 2IC6A 3KINB 3LBXA 3N2KE 3ZN1B 2D2SA 3OJAA 3RYIE 4JLEA 3ONXA 2N9DA 3SRZA 2C5IT 2KXPB 4BAYB 4DVDA 3LG7A 2V26A 3NZQA 3RRCA 4HFVA 3CQCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2S A; 
#chains in the Genus database with same CATH topology
 4X62 T;  1ZV4 X;  2XAQ B;  1GQE A;  2E5L T;  2WAU A;  2V5D A;  2L9Q A;  1UK5 A;  3M3Z B;  5HWY A;  4EED A;  5ABF B;  3N9P A;  4YFS A;  3B57 A;  2VK9 A;  2BG9 C;  4PJL A;  5C3J A;  1Y64 B;  5FXV A;  5J0Z A;  3C4X A;  1OED B;  5A1L A;  2QRX A;  3WAJ A;  4IDZ A;  1T72 A;  3ZJ2 A;  3G06 A;  3RH3 A;  4XBF B;  1V9D A;  3AE3 A;  3TLV A;  2WWV A;  3VKH A;  1G73 A;  2NWB A;  5L3F B;  2G0U A;  2X66 A;  4AQG A;  3VHL A;  2CM0 A;  3B13 A;  4HN9 A;  5DQW A;  3KV6 A;  1XMQ T;  4I4T E;  3UQ4 A;  2W4X A;  4HFH A;  3IBP A;  4WBN E;  2WZI A;  4NUU A;  3AED A;  2VKO A;  4QXC B;  1BR0 A;  3UUN A;  2NTX A;  2XUE A;  3RYC E;  4X1I E;  5LJN A;  5FL0 A;  1XNR T;  1W9R A;  2AXD S;  5L47 A;  4U72 A;  2A72 A;  1MND A;  3C64 A;  1U4Q A;  3HKE E;  4PK5 A;  4IE6 A;  4FI5 A;  4DBR A;  5L2L A;  5FY1 A;  3LSV A;  3VRB A;  4A98 A;  3L3P A;  1M7K A;  4DID B;  4GK5 E;  1S35 A;  3EI0 A;  1WR0 A;  3AXJ A;  3Q9D A;  4DMV A;  4PFO A;  2YU1 A;  1DU2 A;  2MBG A;  4EAH A;  2XSA A;  5AQO B;  1WYB A;  4O4I E;  4WW0 A;  1Z0P A;  1UCU A;  1HX8 A;  2YOE A;  3T8O A;  3J9X 1;  5M4Y A;  2OA5 A;  3MJX A;  2X0L B;  5HXC A;  5F8P A;  4PJJ A;  5LG3 A;  3O1H A;  4N78 D;  3JAF A;  2KMF A;  1LRZ A;  2XQ9 A;  3RQU A;  4E7Z A;  3AE4 A;  5AQU B;  4AIS A;  1LKX A;  5AQL B;  1T7S A;  3FBZ A;  2D0U A;  3AEC A;  4YSZ A;  2LHR A;  4TN7 B;  5L3C B;  2V7J A;  3CKD A;  3CK6 A;  2F4V T;  4F6R C;  3EAB A;  3UTK A;  4HFC A;  2CWY A;  4ASK A;  2LKG A;  2QVA A;  4AKR B;  4CXW A;  5ABH A;  3B5M A;  4Z8X A;  2H88 A;  2AE9 A;  4B3R T;  2LE8 A;  3K8P C;  3UU8 A;  1HCI A;  3DJB A;  2VQF T;  3NRX A;  2LHN A;  4Z91 A;  1UX5 A;  4G63 A;  4JI2 T;  1BR2 A;  3GMI A;  3P4S A;  2L3L A;  4TZ4 C;  4YTN A;  2RA1 A;  2PBI A;  5LHG B;  1IBL T;  4CN6 A;  4U7I A;  2WZH A;  3UU6 A;  4WZX A;  3N5L A;  2ZM6 T;  4AKH A;  4AI6 A;  1US7 B;  4UF0 A;  5FKY A;  2YKS A;  2WU2 A;  4C90 A;  2CRB A;  5HXS A;  1D1C A;  3OKQ A;  1NEN A;  2XAF B;  2LSI A;  2CBI A;  2XTL A;  1HFA A;  4KHP T;  1XMO T;  2CLY B;  4YJ3 E;  3AAA B;  4DR4 T;  2CBJ A;  2V7K A;  1JNR A;  3AEB A;  2VL0 A;  2DHR A;  4KI0 F;  1FMW A;  4AKI A;  1ZP0 A;  4OYJ A;  3SFD A;  3HKB E;  2XQ7 A;  2RPA A;  3ZST A;  3ZMV B;  4BJM A;  3UUL A;  2X68 A;  1W0A A;  4ILC A;  5AQQ B;  3BK9 A;  2H3R A;  2UXB T;  4JYA T;  2VWA A;  2X9X A;  2CPT A;  2H7V C;  4A5X A;  5HYA A;  3JAD A;  5HEO A;  4LF9 T;  3J7Y q;  3KVB A;  4ZI3 D;  2XQ6 A;  2JMH A;  1WRD A;  1VCS A;  3IA3 A;  4U7Y A;  4WNK A;  1ZKE A;  2CCQ A;  2LT3 A;  3DP7 A;  3CX6 B;  3RX6 A;  1NWM X;  4EB6 E;  5C2T A;  3AEE A;  4EYU A;  4B3S T;  4KBM B;  2BBJ A;  1HTJ F;  2BBH A;  4COF A;  3RRW A;  4UXN B;  1KK7 A;  2LKH A;  2LSK A;  5LGU B;  2A9U A;  3AXJ B;  5ABG A;  3AE6 A;  1WYC A;  3L8R A;  5C8Y E;  4UIG A;  4WBO A;  2K9A A;  2MOZ A;  2KLQ A;  3GWH A;  4HWI B;  2WCA A;  3CPZ A;  4UVC B;  1YD8 G;  5AQH B;  1FEW A;  2IHR 1;  3PUR A;  4ZZB A;  2BVL A;  2BS4 A;  2LRL A;  4GK0 E;  4JI0 T;  1D1B A;  3EAM A;  3F57 A;  4ZI2 D;  3PV0 F;  5KXJ A;  2YDQ A;  1CUN A;  3TLW A;  2Y6X A;  2LLY A;  4CN1 A;  3N9M A;  4XAX B;  5LMU T;  1UUS A;  1SE7 A;  5ABE A;  3UQ7 A;  3AE2 A;  2CXD A;  3ZLI A;  4X5T A;  2V6Y A;  3GA8 A;  3ZN1 B;  3OJA A;  4QH4 A;  3SRZ A;  2C5I T;  2KXP B;  4DVD A;  3LG7 A;  2V26 A;  4HFV A;  2XAH B;  3I0Q A;  3U78 A;  2RP4 A;  1Z8U A;  2V7I A;  1W09 A;  4TNW A;  2K24 A;  5ETW A;  3BQL A;  2NW7 A;  5F5W A;  3AAE B;  4DR2 T;  2WDQ A;  4JEH B;  4YSX A;  2X0H A;  4MFR A;  4UF0 B;  4YJ2 E;  4U74 A;  1B7T A;  5LB7 B;  4Q25 A;  2CHN A;  3Q5X A;  2Q9Q C;  1U5P A;  5DAB A;  1NEK A;  2D9D A;  4X20 E;  4P0A A;  2UXX B;  3X1D A;  3MK7 C;  4X1K E;  2BZB A;  3QK6 A;  3AB3 B;  5L3G B;  3CVR A;  2JJ9 A;  2XPK A;  4ZZC A;  5FVL A;  4TWF A;  2V1D B;  3K3N A;  4KMC A;  1IJ6 A;  2CEA A;  1HNW T;  1YKH B;  3QC9 A;  3ANW A;  3FXD B;  3MA9 A;  5KX5 E;  3RI5 A;  3EDU A;  4MAL A;  5HXR A;  5HEG A;  4QXB B;  4HWC A;  4UR9 A;  4YHH T;  2V7L A;  2Y48 B;  3AE1 A;  4XZC A;  4EGW A;  3N9Q A;  2XQ3 A;  3PJA J;  3LFM A;  4HFI A;  1D0Y A;  4YT0 A;  4TUY E;  2E9X A;  5CA0 E;  2W2U A;  5ADX L;  4MHC A;  3TLT A;  1X9B A;  3IEE A;  2MYS A;  5HEH A;  1BR4 A;  5JDF A;  1MMN A;  1SA0 E;  2FJB A;  2WBL A;  4ZHQ E;  1N33 T;  5AQK B;  2EHO C;  4HE8 A;  3K3Q C;  2C0S A;  3C4W A;  4IST A;  2HHH T;  4UVB B;  5EK3 A;  2HH7 A;  4YHJ A;  4OK0 A;  4TWH A;  5AQV B;  5EK4 A;  3EVY A;  3JC6 D;  1WCR A;  5L4H A;  3ONJ A;  4H9R C;  5LMN T;  2DL1 A;  2PG8 A;  1MIY A;  2WDR A;  3N2G E;  2OLT A;  4CZZ B;  1YQ4 A;  5HEU A;  1XDP A;  1HG5 A;  4Z90 A;  3ZKR A;  2V6Y B;  2ZM2 A;  3CML A;  2YN6 A;  5BR8 T;  4DR6 T;  3E0Z A;  3NWI A;  4V1A v;  1YXR A;  5J1G A;  2YDR A;  5AFU L;  3RPU A;  4JV5 T;  3QNU A;  4H9P C;  3H3M A;  4I43 B;  4DUZ T;  3KV9 A;  4B6X A;  1D0X A;  2FJD A;  3OYZ A;  2DWG A;  4TWD A;  1J5W A;  1MMD A;  3JAE A;  3AVS A;  3P4P A;  2LM9 A;  1VCT A;  2YEV C;  3ZCI A;  3T1Y T;  4QXH B;  2BG9 A;  3PU8 A;  3F31 A;  3RHW A;  1WR6 A;  4IDO A;  4ANJ A;  1KNR A;  2I0M A;  4HFE A;  2MAW A;  1XNQ T;  3AE8 A;  2WS3 A;  4GIW A;  5JTG A;  4DO0 A;  2BS2 A;  4ADZ A;  1Y01 A;  1MIV A;  4U2Z A;  2VKJ A;  1HG2 A;  2LSY A;  4QWN B;  2XQA A;  2NP9 A;  3F2E A;  1BR1 A;  2KWH A;  4FJO A;  3AA6 B;  4DV2 T;  3R6N A;  5LBM A;  4IRE A;  2CA5 A;  2WDV A;  5FXX A;  3ANW B;  2UU9 T;  2LEH A;  3PUZ F;  4LFA T;  2ZLY A;  4CXY A;  5FVK A;  2V5C A;  3UT5 E;  3N9L A;  4LFB T;  4ZS2 A;  1R8I A;  2JRK A;  2A2F X;  2E9X D;  3KDS E;  1KNP A;  4YY3 T;  4P0B A;  3C98 B;  4AIU A;  4GOU A;  4EYY R;  2V7M A;  4CI1 B;  3KV5 A;  5FMN A;  5LBQ B;  5JDL A;  2JQH A;  2MPK A;  3AE9 A;  5FY0 A;  1OED E;  2X51 A;  1D0Z A;  1W0B A;  2E9X B;  3RLF F;  4QKN A;  1MMG A;  4OYK A;  4IL9 A;  3ZSS A;  3N9O A;  4H9O C;  2XQ4 A;  2BVM A;  2WSS V;  3ZCJ A;  3A5X A;  2IC9 A;  3UUB A;  3Q5W A;  2XAJ B;  2QYW A;  4L9I A;  3ZYL A;  2BKP A;  5CA1 E;  4IHJ E;  2FBW A;  4PAG A;  2NOX A;  5L3D B;  3HKD E;  4PJM A;  5HEJ A;  2HN2 A;  4ZEY A;  1J1J A;  2LOS A;  1FMV A;  1KEY A;  2ACX A;  2YIN A;  1MIW A;  1IJ5 A;  2VKD A;  4LF4 T;  2VL8 A;  2WM9 A;  4WYV A;  4A56 A;  2LSJ A;  1JNZ A;  3NBX X;  4I50 E;  3ZMZ B;  2DNX A;  5AQT B;  2XAS B;  3ONX A;  4BAY B;  3VRA A;  2IDO B;  4YLH A;  5AQG B;  3DTO A;  1OED C;  2W61 A;  3FHN A;  2C5K T;  4NUV A;  3D0T A;  5IWA T;  3RC8 A;  3HL6 A;  1I94 T;  2XHE B;  4IGU A;  2VUR A;  4DR5 T;  3CQG B;  3UFE A;  1FIO A;  1VRB A;  4JI8 T;  4DV0 T;  3VKG A;  2I6H A;  3EDV A;  3NVO A;  2CXL A;  4LF5 T;  2SPC A;  2NW9 A;  3JC6 C;  3KVA A;  2DCF A;  3RIF A;  3MKD A;  4NXM T;  3OTO T;  3H3A A;  4OFZ A;  3ESL A;  4PFP A;  5FL1 A;  2LSG A;  2WQY A;  3ZYK A;  3KBT A;  3RC3 A;  2BG9 B;  3RKO A;  3AVR A;  5CGM A;  1XZY A;  4DND A;  2VKH A;  2K48 A;  3FZK B;  4IDP A;  4X65 T;  4H63 V;  2JPF A;  3V5U A;  2XM2 A;  4IDQ A;  4EIW A;  3WAK A;  2UXC T;  2PJQ A;  2D5U A;  2HPJ A;  4K0K T;  3FBL A;  3CQX C;  2XQY A;  4DUY T;  4NIQ A;  5H6Q B;  3C4Z A;  4ISS A;  4ZS3 A;  2XAG B;  2CHO A;  3P4R A;  5F3J A;  4E7S A;  4JI6 T;  3SWH A;  2KT9 A;  5HCJ A;  2V6X A;  4UV9 B;  2C5J A;  3N9N A;  2XJ7 A;  2ZMA A;  5EZY E;  5DJQ C;  3Q5D A;  2UUB T;  3OBV E;  4JI5 T;  2LOP A;  3T1H T;  4QX8 B;  4AQF C;  2DI4 A;  2VAS A;  1WFD A;  1E7P A;  5FY7 A;  2IW5 B;  3AAI A;  3MAC A;  2Z6E A;  2W63 A;  1HX1 B;  2YU2 A;  4X64 T;  2PTF A;  3L39 A;  1LVK A;  3I9Y A;  3CWZ B;  1T98 A;  4LF6 T;  2B1E A;  2E5V A;  3KV4 A;  3PUG A;  2X9W A;  3P8C D;  2H89 A;  5JRE A;  2UUC T;  4HFD A;  2N1G A;  3N2O A;  4IE4 A;  2P9B A;  3UUX B;  4UEL A;  2LM2 A;  2D0T A;  4ILB A;  2VVS A;  2WMO A;  4EOZ B;  2UUA T;  4YXD A;  3RIU C;  3BQI A;  4U2Y A;  3UU3 A;  2H7O A;  3FZH B;  3HKC E;  1CHU A;  3O1J A;  3PE0 A;  2L8K A;  2XZE A;  4ZXL A;  5AQN B;  4JI7 T;  3NKZ A;  1LVF A;  4DV5 T;  4BA9 A;  3PUW F;  3ABV A;  2XQ8 A;  5JRC A;  4U3C A;  5LXT E;  4P09 A;  3FZF B;  3LDQ B;  2MTQ A;  5HXH A;  3P50 A;  2BDE A;  3QUJ A;  1MMA A;  2CE7 A;  2M6B A;  1YQ3 A;  1YW0 A;  4O2A E;  1VOM A;  4YTP A;  4HWF A;  3PUQ A;  2CLY C;  4L0R A;  1XDO A;  4O4L E;  5JQG E;  4PK4 A;  5E0O A;  3I0O A;  1X79 A;  4X66 T;  4UVA B;  5JR9 A;  2W66 A;  3ZC1 A;  4K0U A;  4MLK A;  3I9W A;  3V5S A;  5TAO A;  2CXF A;  5FXW A;  4IE7 A;  1ZHC A;  4DBQ A;  3RF1 A;  3PUA A;  5LJM A;  4IIJ E;  3RGL A;  4G2A A;  5LHI B;  2JMK A;  4JUY A;  3ZMU B;  2E2A A;  5AQM B;  1N32 T;  4BJN A;  2Q9Q A;  3ONL C;  4CQI A;  5EK2 A;  4ZI3 C;  3QOF A;  2JQ9 A;  1I6Z A;  5KMG P;  3PUY F;  3VR9 A;  3CX8 B;  3OYX A;  5LGN B;  3AEA A;  4P1N A;  4AXP A;  4LF7 T;  4OHF A;  1IBK T;  3AEG A;  1QUU A;  4LML A;  1EZ3 A;  2J62 A;  2W00 A;  4JBW F;  3ZYM A;  2WP9 A;  3FZM B;  2W0G A;  3FXE B;  5J2U E;  2V8S V;  4CXX A;  1M62 A;  1UGO A;  1MNE A;  3I1A A;  2B76 A;  3RYH E;  2WWU A;  4JI4 T;  3ETV A;  1IAP A;  3JCF A;  5LHH B;  4I0U A;  1KF6 A;  2WMN A;  3ZT6 A;  1NAF A;  2KZ7 B;  3CIR A;  1E1H B;  3ZN0 B;  5IUX A;  4DR7 T;  3A8Y C;  2IAK A;  4EZ4 A;  3Q2M A;  4DV4 T;  2M6I A;  1OWA A;  5AQJ B;  4ZI2 C;  1UX4 A;  3GN5 A;  1ZOY A;  4DR1 T;  5LP6 E;  2PFV A;  4KX6 A;  5FP3 A;  4DV3 T;  4TV8 E;  2EHO A;  1E2A A;  2UXD T;  1QSD A;  4IE5 A;  4NPP A;  4PK6 A;  1S94 A;  3IF8 B;  1IBM T;  4CI3 B;  1HNZ T;  3A7M A;  4H9S E;  3SS1 A;  5JRC B;  2J1D G;  4IL4 A;  3N2K E;  3LBX A;  4JLE A;  2N9D A;  5AQS B;  3CQC B;  3R84 B;  3OPC A;  1G8X A;  1T8B A;  3ZT5 A;  4F8H A;  2KIN B;  1N34 T;  3ZC0 A;  4TX5 A;  1HR0 T;  1IZN B;  3PU3 A;  3K3O A;  4UV8 B;  3HA4 A;  5AQF B;  5L3E B;  3LJC A;  2XY8 B;  4ILU A;  4ILA A;  2W67 A;  5JR9 B;  5HXE A;  2FJA A;  2ZM0 A;  3UU5 A;  4LF8 T;  2N2N A;  4OX9 T;  4C91 A;  1QLB A;  2ACZ A;  5FNV E;  3WI3 A;  3EHZ A;  4DV1 T;  4ZOL E;  4J2C A;  3AEF A;  2Q9Q D;  2YK0 A;  4GYS A;  4HWH A;  2I59 A;  2K5B B;  2JIW A;  4ZI7 E;  2YDS A;  2KSR A;  2BKN A;  3NZP A;  2KWI B;  2XSB A;  5KDM C;  5BMV E;  3ZT7 A;  4HGA A;  2X0Y A;  2Q9Q B;  3TLS A;  4QHO A;  4QX7 B;  3UFG A;  3KBU A;  4IT4 A;  3PUV F;  2QA7 A;  4H9N C;  4GKK T;  2W62 A;  3FB2 A;  4TNV A;  1HNX T;  3MZK B;  3P7I A;  4CI2 B;  4LFC T;  2DLR A;  1WLX A;  3IHR A;  3CX7 B;  4HEA A;  3EUH A;  3E08 A;  4HWD A;  3OVU A;  2KND A;  4JI1 T;  3P4Q A;  5LA6 E;  4U33 A;  4DMW A;  4TV9 E;  1UUR A;  3O9X A;  2QGS A;  1KNZ A;  3C51 A;  1L0V A;  4O4J E;  3ZEF B;  5LGT B;  3FZL B;  5H6R B;  2FJE A;  1H7C A;  4PJN A;  4UEM A;  2BS3 A;  3VU7 H;  5CJ5 A;  5DQV A;  3QB5 A;  3ZPO A;  3UUM A;  4LMJ A;  3AA0 B;  4PW8 A;  5HCM A;  4AQY T;  3Q5E A;  2VB6 A;  2VQE T;  3O4X E;  2EHO D;  3RYF E;  5IYZ E;  5HWX A;  1OXZ A;  2NR4 A;  4M1P A;  5CB4 E;  4B3M T;  2R6G F;  4JEU B;  5J2T E;  3AE7 A;  4I55 E;  3GN5 B;  1KFY A;  1J5E T;  2NW8 A;  3ETU A;  2J4G A;  2EHO B;  4JI3 T;  3RKG A;  2J47 A;  2E8I A;  5LYJ E;  1SUM B;  2Y8D A;  2DWK A;  3HI2 A;  3AA7 B;  2JQK A;  1ZEE A;  4NXN T;  2FUP A;  2OV9 A;  3LBX B;  4HTE A;  3RQW A;  5AQR B;  2A3D A;  5L4E A;  5ABF A;  5AQP B;  4DV7 T;  3LK4 2;  3VR8 A;  4YSY A;  4L5G A;  5CFB A;  5JDG A;  3PJA A;  3NRY A;  3UU4 A;  5L3B B;  1OED A;  4HKA A;  1SHZ C;  3AA1 B;  4O8S A;  3TLU A;  2X9H A;  1N36 T;  3MXZ A;  4MBQ A;  3E22 E;  3L09 A;  2ODV A;  3SOL A;  4DV6 T;  2XQ5 A;  5JDN A;  2ES0 A;  3U3I A;  2WY2 A;  3AE5 A;  3SFE A;  4H9Q C;  2CWO A;  4AKG A;  4IDN A;  5LOV E;  4HFB A;  5LNK A;  5AQI B;  3P4W A;  4O2B E;  4AKL A;  1FJG T;  5JR9 C;  2HN1 A;  2M67 A;  3O1I A;  4DR3 T;  5GON E;  3PTR B;  4PNI A;  4H63 H;  3W15 B;  1O3X A;  2GK9 A;  1YKE B;  2E9X C;  4EXT A;  2UXN B;  4EV6 A;  3LK2 B;  4U31 A;  4B3T T;  5HAX A;  4KUM B;  5LG4 A;  2X9Y A;  3S4U A;  3HR0 A;  1HF8 A;  4CN4 A;  2K3W A;  3ZJ1 A;  3H37 A;  3LK3 B;  4ERR A;  3K1S A;  3PUX F;  2IIU A;  4QH5 A;  3PDY A;  4O4H E;  1XWM A;  3KFW X;  2NTY A;  5JDH A;  4GYR A;  4LMK A;  4GKJ T;  1HS7 A;  2HPL A;  2WB5 A;  5IHY A;  2BKO A;  2BG9 E;  2IML A;  5JVD E;  4AQF A;  4EEB A;  2XM1 A;  2ODU A;  5FYM A;  2WU5 A;  2JQQ A;  2CMR A;  5LCY A;  2VVN A;  5JH7 E;  3TKL B;  2ZM8 A;  1AJ3 A;  3PUS A;  4IE0 A;  4A97 A;  4KP3 C;  4QH1 A;  2LJL A;  3C50 A;  3ZMS B;  5FXZ A;  2X67 A;  2IUB A;  4KHZ F;  5JDM A;  1D1A A;  5JDQ A;  3ZMT B;  3QB5 K;  3M65 A;  4YTM A;  4EZH A;  3RIA A;  3RIU A;  4X1Y E;  2LRK A;  3BQK A;  2IC6 A;  3KIN B;  2D2S A;  3RYI E;  3NZQ A;  3RRC A; 
#chains in the Genus database with same CATH homology
 2XAH B;  3DTO A;  3R84 B;  3I0Q A;  2W61 A;  1G8X A;  3U78 A;  2RP4 A;  1ZV4 X;  2KIN B;  2XAQ B;  3FHN A;  2C5K T;  4NUV A;  3D0T A;  3ZC0 A;  3RC8 A;  3HL6 A;  2WAU A;  2V7I A;  4TX5 A;  2K24 A;  2L9Q A;  5ETW A;  1IZN B;  5HWY A;  3PU3 A;  3BQL A;  3N9P A;  4YFS A;  2NW7 A;  2XHE B;  3B57 A;  3K3O A;  4IGU A;  4UV8 B;  2VK9 A;  3CQG B;  3HA4 A;  1FIO A;  1VRB A;  3AAE B;  4PJL A;  3LJC A;  3UFE A;  4JEH B;  5L3E B;  3VKG A;  1Y64 B;  4MFR A;  5FXV A;  3EDV A;  4ILU A;  2CXL A;  2SPC A;  3C4X A;  2NW9 A;  4UF0 B;  3JC6 C;  3KVA A;  2DCF A;  3MKD A;  5A1L A;  5JR9 B;  4YJ2 E;  4U74 A;  1B7T A;  3H3A A;  4OFZ A;  5HXE A;  3WAJ A;  2ZM0 A;  3ESL A;  4PFP A;  4IDZ A;  3ZJ2 A;  3RH3 A;  2N2N A;  4C91 A;  3Q5X A;  5FNV E;  2Q9Q C;  2LSG A;  1U5P A;  5DAB A;  4XBF B;  3WI3 A;  4X20 E;  1V9D A;  4P0A A;  3ZYK A;  4ZOL E;  2UXX B;  3VKH A;  4J2C A;  3KBT A;  3RC3 A;  3RKO A;  3MK7 C;  1G73 A;  2Q9Q D;  2YK0 A;  4GYS A;  3AVR A;  2I59 A;  2NWB A;  4X1K E;  2BZB A;  3QK6 A;  5L3F B;  2K5B B;  3AB3 B;  4ZI7 E;  2G0U A;  4DND A;  2X66 A;  5L3G B;  2VKH A;  2K48 A;  4AQG A;  3VHL A;  3CVR A;  2CM0 A;  2JJ9 A;  3B13 A;  4HN9 A;  5DQW A;  2V1D B;  3K3N A;  4H63 V;  4KMC A;  3KV6 A;  3NZP A;  2JPF A;  3V5U A;  2KWI B;  4I4T E;  5KDM C;  1IJ6 A;  4EIW A;  5BMV E;  3WAK A;  4HGA A;  2Q9Q B;  4QHO A;  2CEA A;  1YKH B;  3IBP A;  4WBN E;  4QX7 B;  3QC9 A;  2PJQ A;  2D5U A;  2HPJ A;  3ANW A;  3KBU A;  4NUU A;  2VKO A;  3FXD B;  4QXC B;  3FBL A;  2QA7 A;  3CQX C;  2XQY A;  4H9N C;  1BR0 A;  3MA9 A;  5KX5 E;  3UUN A;  2W62 A;  3FB2 A;  2NTX A;  2XUE A;  5H6Q B;  3EDU A;  3RYC E;  4MAL A;  3C4Z A;  5HXR A;  4ISS A;  4X1I E;  4ZS3 A;  4QXB B;  5LJN A;  3MZK B;  3P7I A;  2XAG B;  4CI2 B;  2DLR A;  1WLX A;  2V7L A;  5F3J A;  3IHR A;  4U72 A;  2A72 A;  2Y48 B;  1MND A;  4E7S A;  3C64 A;  3SWH A;  2KT9 A;  3CX7 B;  1U4Q A;  4XZC A;  3HKE E;  4PK5 A;  4HEA A;  4IE6 A;  3EUH A;  4UV9 B;  2C5J A;  3N9N A;  3E08 A;  2ZMA A;  5EZY E;  3N9Q A;  5DJQ C;  2KND A;  3LFM A;  3OBV E;  4FI5 A;  4DBR A;  2LOP A;  5L2L A;  5FY1 A;  5LA6 E;  3L3P A;  4QX8 B;  4AQF C;  4DMW A;  2DI4 A;  1D0Y A;  2VAS A;  4TV9 E;  4TUY E;  2E9X A;  5CA0 E;  3O9X A;  5ADX L;  4MHC A;  2QGS A;  4GK5 E;  5FY7 A;  2IW5 B;  3AAI A;  1S35 A;  3MAC A;  2Z6E A;  1KNZ A;  2W63 A;  3C51 A;  3IEE A;  3Q9D A;  4DMV A;  2YU2 A;  4O4J E;  3ZEF B;  1LVK A;  3I9Y A;  5LGT B;  2MYS A;  3CWZ B;  1T98 A;  2YU1 A;  4PFO A;  5H6R B;  1H7C A;  2MBG A;  1BR4 A;  2B1E A;  5JDF A;  4PJN A;  4UEM A;  3KV4 A;  4EAH A;  3VU7 H;  1MMN A;  5DQV A;  3PUG A;  1WYB A;  1SA0 E;  2X9W A;  4O4I E;  3ZPO A;  3UUM A;  3AA0 B;  2WBL A;  4PW8 A;  3P8C D;  4WW0 A;  4ZHQ E;  1Z0P A;  2EHO C;  5JRE A;  4HE8 A;  1UCU A;  1HX8 A;  3T8O A;  3K3Q C;  3J9X 1;  2VB6 A;  5M4Y A;  2OA5 A;  2C0S A;  2N1G A;  3MJX A;  3N2O A;  4IE4 A;  3C4W A;  3O4X E;  2X0L B;  4IST A;  5HXC A;  2EHO D;  4UVB B;  3RYF E;  2P9B A;  4PJJ A;  5F8P A;  3UUX B;  5IYZ E;  5EK3 A;  5HWX A;  1OXZ A;  4M1P A;  5CB4 E;  4UEL A;  3O1H A;  2D0T A;  4N78 D;  2HH7 A;  4YHJ A;  4JEU B;  2KMF A;  1LRZ A;  5J2T E;  4OK0 A;  2WMO A;  4E7Z A;  4I55 E;  3GN5 B;  1LKX A;  5EK4 A;  4EOZ B;  3EVY A;  3FBZ A;  2D0U A;  3JC6 D;  3BQI A;  2NW8 A;  2LHR A;  3ETU A;  4TN7 B;  4H9R C;  5L3C B;  2H7O A;  2V7J A;  3CKD A;  2EHO B;  3HKC E;  2PG8 A;  1MIY A;  3O1J A;  3PE0 A;  2L8K A;  4F6R C;  2E8I A;  3N2G E;  5LYJ E;  3UTK A;  4CZZ B;  1LVF A;  2Y8D A;  4BA9 A;  2CWY A;  2DWK A;  4ASK A;  3HI2 A;  3AA7 B;  5JRC A;  4AKR B;  4CXW A;  1HG5 A;  4Z8X A;  5LXT E;  1ZEE A;  4P09 A;  2ZM2 A;  3CML A;  2MTQ A;  2LE8 A;  3LBX B;  5HXH A;  3K8P C;  2BDE A;  3E0Z A;  3QUJ A;  4V1A v;  1MMA A;  4HTE A;  2CE7 A;  1HCI A;  3DJB A;  2A3D A;  3NRX A;  5J1G A;  2LHN A;  5AFU L;  1YW0 A;  4O2A E;  1UX5 A;  1VOM A;  3RPU A;  4G63 A;  1BR2 A;  3GMI A;  2L3L A;  4TZ4 C;  3LK4 2;  3PUQ A;  4L5G A;  2RA1 A;  2CLY C;  2PBI A;  5LHG B;  4L0R A;  4H9P C;  4O4L E;  4I43 B;  5JQG E;  4PK4 A;  3KV9 A;  4B6X A;  3N5L A;  5E0O A;  4AKH A;  3I0O A;  1D0X A;  5JDG A;  4AI6 A;  1US7 B;  3OYZ A;  4UF0 A;  1X79 A;  2DWG A;  3NRY A;  5L3B B;  4UVA B;  5JR9 A;  4HKA A;  4C90 A;  1SHZ C;  5HXS A;  3AA1 B;  1MMD A;  4O8S A;  1D1C A;  3OKQ A;  3ZC1 A;  4K0U A;  2XAF B;  2X9H A;  2LSI A;  4MLK A;  3I9W A;  3V5S A;  3MXZ A;  3AVS A;  4MBQ A;  2LM9 A;  3E22 E;  5TAO A;  3L09 A;  2XTL A;  2CXF A;  1HFA A;  2YEV C;  5FXW A;  2ODV A;  3ZCI A;  4IE7 A;  3SOL A;  1ZHC A;  5JDN A;  2ES0 A;  4QXH B;  2CLY B;  3PU8 A;  3F31 A;  4DBQ A;  1WR6 A;  3PUA A;  4YJ3 E;  3U3I A;  4IIJ E;  4ANJ A;  5LJM A;  3AAA B;  4G2A A;  2V7K A;  4H9Q C;  5LHI B;  2DHR A;  4GIW A;  2CWO A;  4DO0 A;  1FMW A;  4ADZ A;  4AKG A;  4AKI A;  5LOV E;  1MIV A;  2JMK A;  4OYJ A;  4JUY A;  3ZMU B;  3HKB E;  2VKJ A;  1HG2 A;  2LSY A;  5LNK A;  4BJN A;  4QWN B;  3ZMV B;  4BJM A;  2Q9Q A;  2NP9 A;  3UUL A;  2X68 A;  3F2E A;  4CQI A;  5EK2 A;  4O2B E;  4YLH A;  1BR1 A;  4AKL A;  2KWH A;  4FJO A;  3AA6 B;  4ZI3 C;  3BK9 A;  2H3R A;  3R6N A;  2VWA A;  2X9X A;  5LBM A;  2H7V C;  5HYA A;  5KMG P;  2CA5 A;  5JR9 C;  2M67 A;  3KVB A;  5FXX A;  4ZI3 D;  3J7Y q;  2JMH A;  3CX8 B;  3OYX A;  5LGN B;  1WRD A;  3O1I A;  3ANW B;  5GON E;  4WNK A;  3PTR B;  1ZKE A;  2LEH A;  4PNI A;  4H63 H;  2CCQ A;  2LT3 A;  2ZLY A;  3W15 B;  4AXP A;  3DP7 A;  3CX6 B;  1O3X A;  2GK9 A;  1YKE B;  4OHF A;  4CXY A;  2E9X C;  4EXT A;  2UXN B;  3RX6 A;  1NWM X;  3UT5 E;  4EB6 E;  3LK2 B;  1QUU A;  3N9L A;  4ZS2 A;  1EZ3 A;  2W00 A;  5HAX A;  2JRK A;  2A2F X;  4KUM B;  2E9X D;  4EYU A;  3KDS E;  3ZYM A;  5LG4 A;  2X9Y A;  3S4U A;  4KBM B;  3HR0 A;  4P0B A;  1HF8 A;  1HTJ F;  3ZJ1 A;  3C98 B;  3H37 A;  3LK3 B;  4GOU A;  4ERR A;  2W0G A;  4EYY R;  2V7M A;  4CI1 B;  3KV5 A;  5FMN A;  3RRW A;  5LBQ B;  5JDL A;  4UXN B;  1KK7 A;  3PDY A;  4O4H E;  3KFW X;  3FXE B;  5FY0 A;  2X51 A;  2NTY A;  5J2U E;  1D0Z A;  2E9X B;  4CXX A;  2LSK A;  4QKN A;  5LGU B;  5JDH A;  1MMG A;  1MNE A;  3I1A A;  3RYH E;  4OYK A;  2WWU A;  4GYR A;  3ETV A;  1IAP A;  3N9O A;  1HS7 A;  2HPL A;  1WYC A;  5LHH B;  5C8Y E;  4UIG A;  5IHY A;  4WBO A;  2WMN A;  1NAF A;  4H9O C;  2K9A A;  2KZ7 B;  5JVD E;  4AQF A;  2BVM A;  2WSS V;  2ODU A;  3ZCJ A;  2MOZ A;  5FYM A;  3A5X A;  2IC9 A;  2KLQ A;  3Q5W A;  1E1H B;  3GWH A;  3ZN0 B;  2JQQ A;  2CMR A;  2XAJ B;  2IAK A;  5LCY A;  4L9I A;  4EZ4 A;  3CPZ A;  3Q2M A;  3ZYL A;  4UVC B;  1YD8 G;  5CA1 E;  1FEW A;  4IHJ E;  3PUR A;  5JH7 E;  1OWA A;  3TKL B;  2BVL A;  4PAG A;  2NOX A;  2ZM8 A;  4ZI2 C;  5L3D B;  4GK0 E;  3HKD E;  4PJM A;  1D1B A;  1UX4 A;  1AJ3 A;  3GN5 A;  3F57 A;  3PUS A;  4IE0 A;  5LP6 E;  2PFV A;  4KP3 C;  4ZI2 D;  5FP3 A;  4TV8 E;  2LOS A;  1FMV A;  1CUN A;  2EHO A;  2LJL A;  2ACX A;  3C50 A;  3ZMS B;  2YIN A;  5FXZ A;  2X67 A;  1MIW A;  1IJ5 A;  2VKD A;  2Y6X A;  1QSD A;  2VL8 A;  4IE5 A;  2WM9 A;  3N9M A;  4PK6 A;  1S94 A;  4XAX B;  4A56 A;  5JDM A;  1D1A A;  2LSJ A;  3IF8 B;  5JDQ A;  3NBX X;  4I50 E;  4CI3 B;  3ZMT B;  2CXD A;  4H9S E;  3SS1 A;  3M65 A;  3ZMZ B;  2DNX A;  3ZLI A;  4EZH A;  4X1Y E;  3GA8 A;  3BQK A;  2XAS B;  5JRC B;  2J1D G;  2IC6 A;  3KIN B;  3LBX A;  3N2K E;  3ZN1 B;  2D2S A;  3OJA A;  3RYI E;  4JLE A;  3ONX A;  2N9D A;  3SRZ A;  2C5I T;  2KXP B;  4BAY B;  4DVD A;  3LG7 A;  2V26 A;  3NZQ A;  3RRC A;  4HFV A;  3CQC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...