2JQHA

Vps4b mit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
b'NLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associating protein 4B
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 29
structure length 72
sequence length 72
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jqhA00
1WR0A 4CN4A 2RPAA 4U7YA 2CRBA 4U2ZA 5CJ5A 2V6YA 4U33A 2V6YB 3ZSTA 1YXRA 2WWVA 4U2YA 1WCRA 2WY2A 2MPKA 4A5XA 2V6XA 2A9UA 2JQKA 4CN6A 4IT4A 2K3WA 3EABA 2XZEA 3K1SA 4WZXA 2LRKA 5LB7B 3ZSSA 2DL1A 2LRLA 2W2UA 4U3CA 3ZT7A 5CGMA 4CN1A 4ZEYA 2JQHA 2JQ9A 4P1NA 4U7IA 4U31A 4NIQA 3ZT6A 2CPTA 3ZT5A 5FVLA 1WFDA 5FVKA
chains in the Genus database with same CATH superfamily
3AEGA 4U33A 3ETUA 5JREA 5IWAT 3PUVF 4WYVA 4ZXLA 4OK0A 4P0BA 4O4IE 1T7SA 3J7Yq 4IDNA 5HXHA 3HL6A 4I55E 3Q5XA 4IDPA 2XTLA 3QUJA 3FB2A 3CQXC 5LHHB 2X68A 1XMOT 3BQKA 2A9UA 3JAFA 1LRZA 2I6HA 4CN1A 2UUAT 4AIUA 1KFYA 1XNQT 4HWHA 4LMLA 2KINB 4ZS2A 1SUMB 1IBMT 5JDNA 2Z6EA 3AEAA 3PURA 3ZC0A 1OXZA 2YU2A 5C3JA 3NRXA 3L8RA 5AQPB 3WAKA 4MALA 2VQFT 1QUUA 4YSXA 4JI1T 2LT3A 4UVCB 3N9OA 2IIUA 4EEBA 2C5KT 4KHZF 2N1GA 5LG4A 4E7SA 4Z8XA 1BR1A 3K3QC 3UU3A 4L5GA 2KWIB 2NP9A 2GK9A 4AQGA 5ABGA 3C4WA 2CBJA 3RRWA 4CI3B 3JAEA 3UQ7A 4HN9A 2BS2A 1S35A 2ES0A 2ZM0A 3CX6B 2YDRA 4UR9A 2XQ5A 2X0HA 3T8OA 3F57A 5AFUL 4ZS3A 4DV6T 2VL0A 4UXNB 4YT0A 4EZHA 1E2AA 4LF9T 1QSDA 5L3DB 3E22E 3C4XA 4B3MT 4AI6A 2QGSA 4X1IE 4DR6T 3FBZA 4GYSA 1XNRT 2A2FX 3O1HA 3RLFF 2QVAA 2ZM6T 2LKGA 3L09A 4L9IA 1U4QA 3HR0A 3Q5DA 5HXEA 3LDQB 5FVKA 1XWMA 4U7YA 4DV1T 3ETVA 4PAGA 4OX9T 5L4EA 2IC9A 3P4WA 1IZNB 3TKLB 4LMKA 5LHGB 3PDYA 4CN6A 2WQYA 3FZKB 3EHZA 4NUVA 1I94T 3O1JA 5FXVA 1YD8G 4DUYT 3JADA 1KNRA 3LSVA 2WZHA 3N9LA 5H6RB 4K0KT 5LJMA 1YQ3A 2W2UA 1NAFA 5AQMB 1O3XA 5AQTB 4KUMB 3TLTA 4AKHA 2I0MA 2R6GF 3ZYMA 5IUXA 2M67A 4DV2T 2BS4A 1GQEA 3AE5A 2WZIA 2X51A 5HCJA 5H6QB 2W62A 3RYIE 2W61A 3IBPA 3FZMB 4HKAA 2VQET 2Y48B 3H3MA 5L3CB 3ONJA 4AKGA 3PU8A 2VKOA 2I59A 5LG3A 2WMNA 1HNXT 3TLUA 4FI5A 3RYCE 3EABA 3K1SA 4IL4A 4AKLA 4U3CA 3R84B 4PK4A 1SE7A 4HGAA 3BK9A 3UU8A 4PJMA 4UVBB 2ZM8A 2FJAA 4IL9A 5L3GB 3KVAA 2JJ9A 5HEUA 2XM1A 1YW0A 4B3RT 4CZZB 2BKNA 5L3EB 3UT5E 3N9QA 1XZYA 4QX8B 4X66T 5EZYE 2NR4A 2V26A 5DQVA 1DU2A 1D1AA 2XAHB 3N5LA 4U74A 2JQHA 1HR0T 1W0BA 4Z91A 2LKHA 2XAJB 2YDQA 4DMVA 2FJEA 3M3ZB 2BS3A 1J5ET 3KBTA 4ZOLE 2LSJA 2LRKA 2H89A 4PNIA 4F8HA 2CXDA 3ONXA 5ADXL 4ZZBA 1UX4A 1G8XA 4EB6E 2WSSV 1XDOA 4YHJA 2CMRA 3RF1A 4BA9A 3W15B 2XHEB 1T72A 2Y8DA 3TLSA 3F31A 2CPTA 4ZZCA 5JR9A 4CN4A 1UX5A 2ACXA 2XQ7A 4H9PC 3QB5K 3LK42 4I50E 2LM2A 5HYAA 2DLRA 5JR9C 3E0ZA 4TV8E 5HXCA 5GONE 5JR9B 3ANWA 2MAWA 3SRZA 3R6NA 2X0LB 2XY8B 2LOPA 3K3NA 2X9YA 3RGLA 2W63A 2W4XA 3P8CD 1W9RA 5AQQB 3N9NA 2IUBA 2JIWA 2MBGA 2NWBA 2BZBA 3ANWB 4X20E 3KV6A 3SFEA 1R8IA 4N78D 4HFBA 2XAFB 3TLWA 3FZHB 3RH3A 4EZ4A 2BKPA 3KBUA 1N34T 4TX5A 2JQQA 4TWHA 3VRBA 4OYJA 5CJ5A 3ZSTA 4DV7T 3I1AA 2YDSA 2KXPB 3RIUA 4HFVA 4PJJA 2MYSA 3P50A 3RHWA 4LFAT 1UGOA 3RRCA 3CK6A 4H63V 1ZV4X 2VKDA 4AKIA 4QH5A 3B13A 2N2NA 4AISA 3UU6A 3AE9A 4ADZA 4AXPA 1CHUA 3N2KE 4X64T 3OTOT 3PUAA 2FJDA 1MMNA 2BBHA 3AEBA 2XQ6A 1ZKEA 3ZT5A 5ABEA 3RC8A 1D0ZA 3VKHA 4WNKA 2LSKA 4B3TT 3HKEE 2NW7A 5KMGP 4O2BE 2E9XD 4I4TE 3CX7B 4P09A 4IT4A 3L39A 4I43B 2VURA 2FBWA 3AE8A 3FXEB 5JTGA 4J2CA 2P9BA 2DNXA 3UUMA 2AE9A 4JYAT 3ZJ1A 4YXDA 2SPCA 1YKEB 1V9DA 2IAKA 5CB4E 3UU4A 1WR0A 2PBIA 1ZOYA 4MHCA 2HN1A 3NVOA 2L3LA 2DWGA 2CLYC 3CKDA 3AVRA 2EHOD 5AQFB 2LRLA 5JDFA 3I9YA 2JMKA 2CXFA 2CLYB 4ILAA 3S4UA 3GWHA 2QA7A 4CXYA 2OV9A 5FVLA 3AEDA 3B57A 1HG2A 3EDUA 5LMNT 2UXXB 3N9MA 2XQ3A 3IF8B 5L3FB 4EIWA 3N2OA 4BJMA 2K48A 5HAXA 3LG7A 4IE4A 4HFEA 5AQNB 5L47A 2X66A 5M4YA 4O4JE 3HI2A 2OA5A 3T1YT 3AA7B 3NZQA 4HWFA 2MTQA 4LF6T 3ZLIA 4EOZB 1E7PA 3CMLA 3RKOA 4BJNA 5J0ZA 4CXXA 3CPZA 5LMUT 2KWHA 3PE0A 2LSIA 4IE7A 2CXLA 2XJ7A 3KINB 3O9XA 4Z90A 5FY0A 4MFRA 3V5SA 5ABHA 2PG8A 1N33T 1MIWA 2D9DA 2NW8A 1UCUA 3IHRA 4AQFA 2WP9A 5CA0E 2LSYA 2VK9A 5J1GA 4DV0T 4AQYT 2CWOA 3WAJA 4LF8T 5JDMA 5L3BB 3P4PA 2XPKA 3CVRA 3ZPOA 2V1DB 4AQFC 2WU2A 3SS1A 4IDZA 3MKDA 4O8SA 3C4ZA 1NWMX 3QB5A 2E9XA 5KX5E 1BR0A 5HEHA 4EYUA 2WAUA 4IREA 3QC9A 3MK7C 5EK4A 2XZEA 4YJ2E 3MZKB 1D1CA 3ZT7A 4COFA 2JPFA 3KDSE 4GIWA 2ZM2A 5FKYA 2CRBA 2E9XC 3Q5EA 5KXJA 3NBXX 3LFMA 3AE3A 4HWIB 2E9XB 2DI4A 4YTPA 4JUYA 4KHPT 2YEVC 1WYCA 4HFCA 4ILBA 5BR8T 4IDOA 3OYZA 5JVDE 2C0SA 3PU3A 4YSZA 4JI4T 3OBVE 2KMFA 3G06A 2UXDT 4CXWA 5FXWA 2EHOA 2DCFA 5L4HA 3P4RA 2Q9QD 4HE8A 4JI7T 3UQ4A 4A56A 1YKHB 4ZI3C 2HPLA 2C5IT 2LOSA 4A97A 3GMIA 4OFZA 1WCRA 2EHOC 3PUGA 4PK5A 1IJ5A 2EHOB 2VKHA 2UXCT 1HCIA 3SFDA 3RYFE 3PUWF 5CGMA 1MMDA 3MACA 2JQ9A 4U72A 2CBIA 4NIQA 3AVSA 2E5VA 4H63H 4TWDA 4JI3T 3Q2MA 2N9DA 2ZLYA 3AAIA 3N2GE 4EGWA 2UUCT 3ZCJA 2V6XA 2HH7A 2UUBT 4C90A 5HWYA 4NXMT 1EZ3A 2HPJA 4CI1B 3UUBA 3A5XA 3RQWA 3Q5WA 3FXDB 2IW5B 3UU5A 2WWUA 3GN5A 2X9WA 2DHRA 4YY3T 5JDGA 3ZN0B 5LBQB 4UELA 4WW0A 5LJNA 4QHOA 2X9XA 3U3IA 3ZEFB 2V7IA 4GKKT 4X62T 3EAMA 3OJAA 1S94A 4DR7T 3WI3A 3ZMZB 2E5LT 5JRCA 4CI2B 3N9PA 3RC3A 4JI8T 4O4HE 3UFEA 3ZMTB 4IGUA 2LEHA 3NKZA 3CIRA 2OLTA 4U2YA 2XQ9A 3ZJ2A 4QX7B 5C8YE 3MA9A 3PTRB 3EVYA 5JRCB 1IBLT 4A98A 4G2AA 1MNEA 3CQCB 2KNDA 2VASA 3NWIA 3ESLA 4YHHT 1UUSA 2ACZA 2LHRA 1ZEEA 2V6YA 4DR2T 1LVFA 2X9HA 4DV4T 2B76A 4E7ZA 2H7VC 3J9X1 2J1DG 3LK3B 2PTFA 2BDEA 4PFPA 4ILUA 2IC6A 3H37A 3ZKRA 2V6YB 5LNKA 2YOEA 4DV5T 4IHJE 5FXZA 2XQ4A 4DUZT 5HEGA 5AQJB 1FMVA 2Q9QA 4ZEYA 3UFGA 2V7LA 3I0OA 1IBKT 1J1JA 5LA6E 4GYRA 3ZN1B 2CWYA 2RP4A 2UXNB 2IMLA 3K8PC 3OKQA 4EV6A 4C91A 2MPKA 5AQRB 2AXDS 2BVLA 2WDVA 2Q9QC 4JEHB 1OEDE 4DR3T 3HKDE 2X0YA 2D5UA 4LF4T 2Q9QB 1ZP0A 1N32T 3C98B 1MMGA 3QNUA 3NZPA 4JI0T 2W67A 4DR1T 5DABA 3NRYA 2V7KA 4H9NC 4TN7B 2FUPA 4YFSA 2WCAA 3AE2A 4JBWF 2VVNA 2HN2A 1XMQT 4ZI2D 4NUUA 4DNDA 3BQIA 3AECA 2PFVA 4HFHA 1FEWA 4ASKA 4U31A 5LHIB 3C50A 2UXBT 4GK5E 1W0AA 3U78A 4EAHA 4A5XA 2XQ8A 5J2TE 2CEAA 2WDQA 2M6BA 5LGNB 3RQUA 1UK5A 3UUNA 3BQLA 2XQYA 3ZMVB 2CHNA 2NOXA 2YN6A 5A1LA 3H3AA 1SA0E 4KX6A 3PUXF 4MLKA 5C2TA 4DVDA 4G63A 4DV3T 3RIUC 2JQKA 1T8BA 3RIAA 3OPCA 2LLYA 3L3PA 2WBLA 1CUNA 5FY1A 4WBOA 2QRXA 3LK2B 3ONLC 4O2AE 1JNRA 4LFCT 4QXCB 4PK6A 1U5PA 2V7JA 3UULA 2BG9A 2L8KA 1KNPA 1MIYA 1MMAA 5JDHA 1AJ3A 1HX8A 5FXXA 4JI5T 5F3JA 2LSGA 3VHLA 2XAGB 2VL8A 3X1DA 1MNDA 1Y64B 2MOZA 3SWHA 3ABVA 5AQUB 3IA3A 4L0RA 1N36T 2QYWA 3AE6A 5EK2A 1LKXA 3EUHA 3T1HT 4K0UA 4DR5T 5FL1A 2A3DA 2G0UA 3K3OA 3D0TA 4TZ4C 3QK6A 5AQSB 5KDMC 1LVKA 1FIOA 1D1BA 1WLXA 2V8SV 4FJOA 1HFAA 2YK0A 2ODUA 3VKGA 2WY2A 4ZI3D 3CQGB 3FZLB 2J47A 3ZYKA 2LE8A 3P7IA 4H9OC 1SHZC 2XSBA 4CQIA 5JH7E 5AQVB 2A72A 4HEAA 2K5BB 3MXZA 2WWVA 2H88A 2LHNA 4DIDB 2JMHA 3AXJA 2Y6XA 5F5WA 2DWKA 2ZMAA 3DJBA 4KP3C 5HCMA 1G73A 2WB5A 2B1EA 5HXSA 2NW9A 4V1Av 4DMWA 1T98A 5F8PA 4BAYB 4UVAB 1VCSA 3OVUA 3PJAA 4HFDA 3AXJB 4LF5T 5JQGE 5AQGB 4B3ST 4UF0A 1Z0PA 4GOUA 4JI2T 4ZI2C 4ISSA 4KMCA 4TNVA 3UUXB 3JCFA 1H7CA 1X9BA 3UTKA 4QXHB 2J62A 3MJXA 5BMVE 2V5DA 5LP6E 2LM9A 3KV4A 1WRDA 2NTYA 4QKNA 4UF0B 1D0XA 2RPAA 3P4SA 3KV9A 2KT9A 2XAQB 3CWZB 3KVBA 4LMJA 2W00A 5LOVE 2WU5A 4LF7T 2E2AA 3EI0A 4DBRA 3I0QA 3LJCA 2KZ7B 4JEUB 2W0GA 3VRAA 3AAEB 2XSAA 3Q9DA 5FL0A 2H7OA 3VR9A 2XASB 4IE6A 1FJGT 2BG9E 3VR8A 4QH1A 3JC6D 2XM2A 5HEJA 2M6IA 4XZCA 3AEEA 4PJNA 3TLVA 3RPUA 1KEYA 5JDQA 4ERRA 4P0AA 1IAPA 1Z8UA 3RYHE 2XUEA 4X1KE 3AB3B 3AA1B 4X5TA 1W09A 1KF6A 3IEEA 3QOFA 5TAOA 2HHHT 5LGUB 3HKCE 4DR4T 2WS3A 1HG5A 3AA0B 1KNZA 4I0UA 1M62A 3RX6A 4TV9E 1VCTA 5AQKB 2CM0A 4U7IA 2L9QA 3AA6B 3M65A 4GKJT 4DBQA 2BVMA 2VWAA 4UV9B 3GA8A 4HFIA 1D0YA 1OEDA 3PUZF 5LXTE 4TWFA 3V5UA 1NENA 1VOMA 2WMOA 2NTXA 4H9RC 5CFBA 1NEKA 1J5WA 3O1IA 1HS7A 2KSRA 3KFWX 5DQWA 4IIJE 5L2LA 1OEDC 5FY7A 1YXRA 1OEDB 2KLQA 2VB6A 2CHOA 3B5MA 4IDQA 5LBMA 4P1NA 2RA1A 5FNVE 5LCYA 3F2EA 2VVSA 2YINA 4TNWA 5EK3A 4PW8A 5AQIB 2PJQA 2K9AA 1HNZT 5HWXA 4LFBT 3PUQA 4KBMB 4GK0E 2WM9A 1JNZA 4OYKA 4M1PA 4JV5T 4YTMA 4UIGA 2ODVA 4QH4A 4X65T 4EYYR 1UURA 3AEFA 1ZHCA 2YU1A 5IHYA 3GN5B 2FJBA 4X1YE 5ABFA 5E0OA 5LGTB 3KV5A 2XQAA 4ZHQE 3PUYF 3LBXA 2W66A 3C64A 3PUSA 3HA4A 2LJLA 4IE0A 1QLBA 5ABFB 2C5JA 4TUYE 3O4XE 2JRKA 3ZMUB 3DP7A 3JC6C 2CA5A 3LBXB 3OYXA 2BKOA 2H3RA 4F6RC 4JI6T 3C51A 4PFOA 2BBJA 1Y01A 4YLHA 1KK7A 3RKGA 4YJ3E 4U2ZA 3E08A 3CX8B 1HTJF 1VRBA 3FHNA 4AKRB 3EDVA 3FBLA 4IE5A 2WDRA 5JDLA 3AE1A 4ISTA 4HTEA 3A8YC 4DO0A 1OWAA 2D0UA 1US7B 2X67A 3ZYLA 4ANJA 3RIFA 3ZSSA 2VKJA 2UU9T 5ETWA 1FMWA 4H9SE 5FP3A 4JLEA 5HEOA 3ZC1A 3P4QA 4YSYA 2K24A 4QXBB 4WZXA 1HF8A 4XAXB 3A7MA 4HWCA 3I9WA 4UEMA 4QWNB 4NXNT 2V5CA 1X79A 4O4LE 5CA1E 4ZI7E 1BR4A 1BR2A 4XBFB 5AQOB 2J4GA 4MBQA 5DJQC 4Q25A 1E1HB 3ZT6A 1MIVA 2D0TA 4KI0F 5J2UE 1WR6A 3RI5A 2YKSA 2IHR1 1I6ZA 3PV0F 3AE7A 1WYBA 3AE4A 1B7TA 5HXRA 2DL1A 4B6XA 3AAAB 1HX1B 3ZMSB 4WBNE 1WFDA 5LYJE 4UV8B 3SOLA 5FYMA 2F4VT 5AQHB 5AQLB 1IJ6A 5FMNA 3VU7H 4H9QC 2K3WA 3ZCIA 4PJLA 4ILCA 1YQ4A 2V7MA 4NPPA 4EEDA 4EXTA 2CE7A 3FZFB 1XDPA 2E8IA 2BG9C 5IYZE 4HWDA 4YTNA 4OHFA 3DTOA 2BG9B 3PJAJ 1M7KA 5LB7B 1HNWT 1L0VA 2D2SA 3HKBE 2IDOB 2CCQA
chains in the Genus database with same CATH topology
1WR0A 4CN4A 2RPAA 4U7YA 2CRBA 4U2ZA 5CJ5A 2V6YA 4U33A 2V6YB 3ZSTA 1YXRA 2WWVA 4U2YA 1WCRA 2WY2A 2MPKA 4A5XA 2V6XA 2A9UA 2JQKA 4CN6A 4IT4A 2K3WA 3EABA 2XZEA 3K1SA 4WZXA 2LRKA 5LB7B 3ZSSA 2DL1A 2LRLA 2W2UA 4U3CA 3ZT7A 5CGMA 4CN1A 4ZEYA 2JQHA 2JQ9A 4P1NA 4U7IA 4U31A 4NIQA 3ZT6A 2CPTA 3ZT5A 5FVLA 1WFDA 5FVKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR0 A;  4CN4 A;  2RPA A;  4U7Y A;  2CRB A;  4U2Z A;  5CJ5 A;  2V6Y A;  4U33 A;  2V6Y B;  3ZST A;  1YXR A;  2WWV A;  4U2Y A;  1WCR A;  2WY2 A;  2MPK A;  4A5X A;  2V6X A;  2A9U A;  2JQK A;  4CN6 A;  4IT4 A;  2K3W A;  3EAB A;  2XZE A;  3K1S A;  4WZX A;  2LRK A;  5LB7 B;  3ZSS A;  2DL1 A;  2LRL A;  2W2U A;  4U3C A;  3ZT7 A;  5CGM A;  4CN1 A;  4ZEY A;  2JQH A;  2JQ9 A;  4P1N A;  4U7I A;  4U31 A;  4NIQ A;  3ZT6 A;  2CPT A;  3ZT5 A;  5FVL A;  1WFD A;  5FVK A; 
#chains in the Genus database with same CATH topology
 3AEG A;  4U33 A;  3ETU A;  5JRE A;  5IWA T;  3PUV F;  4WYV A;  4ZXL A;  4OK0 A;  4P0B A;  4O4I E;  1T7S A;  3J7Y q;  4IDN A;  5HXH A;  3HL6 A;  4I55 E;  3Q5X A;  4IDP A;  2XTL A;  3QUJ A;  3FB2 A;  3CQX C;  5LHH B;  2X68 A;  1XMO T;  3BQK A;  2A9U A;  3JAF A;  1LRZ A;  2I6H A;  4CN1 A;  2UUA T;  4AIU A;  1KFY A;  1XNQ T;  4HWH A;  4LML A;  2KIN B;  4ZS2 A;  1SUM B;  1IBM T;  5JDN A;  2Z6E A;  3AEA A;  3PUR A;  3ZC0 A;  1OXZ A;  2YU2 A;  5C3J A;  3NRX A;  3L8R A;  5AQP B;  3WAK A;  4MAL A;  2VQF T;  1QUU A;  4YSX A;  4JI1 T;  2LT3 A;  4UVC B;  3N9O A;  2IIU A;  4EEB A;  2C5K T;  4KHZ F;  2N1G A;  5LG4 A;  4E7S A;  4Z8X A;  1BR1 A;  3K3Q C;  3UU3 A;  4L5G A;  2KWI B;  2NP9 A;  2GK9 A;  4AQG A;  5ABG A;  3C4W A;  2CBJ A;  3RRW A;  4CI3 B;  3JAE A;  3UQ7 A;  4HN9 A;  2BS2 A;  1S35 A;  2ES0 A;  2ZM0 A;  3CX6 B;  2YDR A;  4UR9 A;  2XQ5 A;  2X0H A;  3T8O A;  3F57 A;  5AFU L;  4ZS3 A;  4DV6 T;  2VL0 A;  4UXN B;  4YT0 A;  4EZH A;  1E2A A;  4LF9 T;  1QSD A;  5L3D B;  3E22 E;  3C4X A;  4B3M T;  4AI6 A;  2QGS A;  4X1I E;  4DR6 T;  3FBZ A;  4GYS A;  1XNR T;  2A2F X;  3O1H A;  3RLF F;  2QVA A;  2ZM6 T;  2LKG A;  3L09 A;  4L9I A;  1U4Q A;  3HR0 A;  3Q5D A;  5HXE A;  3LDQ B;  5FVK A;  1XWM A;  4U7Y A;  4DV1 T;  3ETV A;  4PAG A;  4OX9 T;  5L4E A;  2IC9 A;  3P4W A;  1IZN B;  3TKL B;  4LMK A;  5LHG B;  3PDY A;  4CN6 A;  2WQY A;  3FZK B;  3EHZ A;  4NUV A;  1I94 T;  3O1J A;  5FXV A;  1YD8 G;  4DUY T;  3JAD A;  1KNR A;  3LSV A;  2WZH A;  3N9L A;  5H6R B;  4K0K T;  5LJM A;  1YQ3 A;  2W2U A;  1NAF A;  5AQM B;  1O3X A;  5AQT B;  4KUM B;  3TLT A;  4AKH A;  2I0M A;  2R6G F;  3ZYM A;  5IUX A;  2M67 A;  4DV2 T;  2BS4 A;  1GQE A;  3AE5 A;  2WZI A;  2X51 A;  5HCJ A;  5H6Q B;  2W62 A;  3RYI E;  2W61 A;  3IBP A;  3FZM B;  4HKA A;  2VQE T;  2Y48 B;  3H3M A;  5L3C B;  3ONJ A;  4AKG A;  3PU8 A;  2VKO A;  2I59 A;  5LG3 A;  2WMN A;  1HNX T;  3TLU A;  4FI5 A;  3RYC E;  3EAB A;  3K1S A;  4IL4 A;  4AKL A;  4U3C A;  3R84 B;  4PK4 A;  1SE7 A;  4HGA A;  3BK9 A;  3UU8 A;  4PJM A;  4UVB B;  2ZM8 A;  2FJA A;  4IL9 A;  5L3G B;  3KVA A;  2JJ9 A;  5HEU A;  2XM1 A;  1YW0 A;  4B3R T;  4CZZ B;  2BKN A;  5L3E B;  3UT5 E;  3N9Q A;  1XZY A;  4QX8 B;  4X66 T;  5EZY E;  2NR4 A;  2V26 A;  5DQV A;  1DU2 A;  1D1A A;  2XAH B;  3N5L A;  4U74 A;  2JQH A;  1HR0 T;  1W0B A;  4Z91 A;  2LKH A;  2XAJ B;  2YDQ A;  4DMV A;  2FJE A;  3M3Z B;  2BS3 A;  1J5E T;  3KBT A;  4ZOL E;  2LSJ A;  2LRK A;  2H89 A;  4PNI A;  4F8H A;  2CXD A;  3ONX A;  5ADX L;  4ZZB A;  1UX4 A;  1G8X A;  4EB6 E;  2WSS V;  1XDO A;  4YHJ A;  2CMR A;  3RF1 A;  4BA9 A;  3W15 B;  2XHE B;  1T72 A;  2Y8D A;  3TLS A;  3F31 A;  2CPT A;  4ZZC A;  5JR9 A;  4CN4 A;  1UX5 A;  2ACX A;  2XQ7 A;  4H9P C;  3QB5 K;  3LK4 2;  4I50 E;  2LM2 A;  5HYA A;  2DLR A;  5JR9 C;  3E0Z A;  4TV8 E;  5HXC A;  5GON E;  5JR9 B;  3ANW A;  2MAW A;  3SRZ A;  3R6N A;  2X0L B;  2XY8 B;  2LOP A;  3K3N A;  2X9Y A;  3RGL A;  2W63 A;  2W4X A;  3P8C D;  1W9R A;  5AQQ B;  3N9N A;  2IUB A;  2JIW A;  2MBG A;  2NWB A;  2BZB A;  3ANW B;  4X20 E;  3KV6 A;  3SFE A;  1R8I A;  4N78 D;  4HFB A;  2XAF B;  3TLW A;  3FZH B;  3RH3 A;  4EZ4 A;  2BKP A;  3KBU A;  1N34 T;  4TX5 A;  2JQQ A;  4TWH A;  3VRB A;  4OYJ A;  5CJ5 A;  3ZST A;  4DV7 T;  3I1A A;  2YDS A;  2KXP B;  3RIU A;  4HFV A;  4PJJ A;  2MYS A;  3P50 A;  3RHW A;  4LFA T;  1UGO A;  3RRC A;  3CK6 A;  4H63 V;  1ZV4 X;  2VKD A;  4AKI A;  4QH5 A;  3B13 A;  2N2N A;  4AIS A;  3UU6 A;  3AE9 A;  4ADZ A;  4AXP A;  1CHU A;  3N2K E;  4X64 T;  3OTO T;  3PUA A;  2FJD A;  1MMN A;  2BBH A;  3AEB A;  2XQ6 A;  1ZKE A;  3ZT5 A;  5ABE A;  3RC8 A;  1D0Z A;  3VKH A;  4WNK A;  2LSK A;  4B3T T;  3HKE E;  2NW7 A;  5KMG P;  4O2B E;  2E9X D;  4I4T E;  3CX7 B;  4P09 A;  4IT4 A;  3L39 A;  4I43 B;  2VUR A;  2FBW A;  3AE8 A;  3FXE B;  5JTG A;  4J2C A;  2P9B A;  2DNX A;  3UUM A;  2AE9 A;  4JYA T;  3ZJ1 A;  4YXD A;  2SPC A;  1YKE B;  1V9D A;  2IAK A;  5CB4 E;  3UU4 A;  1WR0 A;  2PBI A;  1ZOY A;  4MHC A;  2HN1 A;  3NVO A;  2L3L A;  2DWG A;  2CLY C;  3CKD A;  3AVR A;  2EHO D;  5AQF B;  2LRL A;  5JDF A;  3I9Y A;  2JMK A;  2CXF A;  2CLY B;  4ILA A;  3S4U A;  3GWH A;  2QA7 A;  4CXY A;  2OV9 A;  5FVL A;  3AED A;  3B57 A;  1HG2 A;  3EDU A;  5LMN T;  2UXX B;  3N9M A;  2XQ3 A;  3IF8 B;  5L3F B;  4EIW A;  3N2O A;  4BJM A;  2K48 A;  5HAX A;  3LG7 A;  4IE4 A;  4HFE A;  5AQN B;  5L47 A;  2X66 A;  5M4Y A;  4O4J E;  3HI2 A;  2OA5 A;  3T1Y T;  3AA7 B;  3NZQ A;  4HWF A;  2MTQ A;  4LF6 T;  3ZLI A;  4EOZ B;  1E7P A;  3CML A;  3RKO A;  4BJN A;  5J0Z A;  4CXX A;  3CPZ A;  5LMU T;  2KWH A;  3PE0 A;  2LSI A;  4IE7 A;  2CXL A;  2XJ7 A;  3KIN B;  3O9X A;  4Z90 A;  5FY0 A;  4MFR A;  3V5S A;  5ABH A;  2PG8 A;  1N33 T;  1MIW A;  2D9D A;  2NW8 A;  1UCU A;  3IHR A;  4AQF A;  2WP9 A;  5CA0 E;  2LSY A;  2VK9 A;  5J1G A;  4DV0 T;  4AQY T;  2CWO A;  3WAJ A;  4LF8 T;  5JDM A;  5L3B B;  3P4P A;  2XPK A;  3CVR A;  3ZPO A;  2V1D B;  4AQF C;  2WU2 A;  3SS1 A;  4IDZ A;  3MKD A;  4O8S A;  3C4Z A;  1NWM X;  3QB5 A;  2E9X A;  5KX5 E;  1BR0 A;  5HEH A;  4EYU A;  2WAU A;  4IRE A;  3QC9 A;  3MK7 C;  5EK4 A;  2XZE A;  4YJ2 E;  3MZK B;  1D1C A;  3ZT7 A;  4COF A;  2JPF A;  3KDS E;  4GIW A;  2ZM2 A;  5FKY A;  2CRB A;  2E9X C;  3Q5E A;  5KXJ A;  3NBX X;  3LFM A;  3AE3 A;  4HWI B;  2E9X B;  2DI4 A;  4YTP A;  4JUY A;  4KHP T;  2YEV C;  1WYC A;  4HFC A;  4ILB A;  5BR8 T;  4IDO A;  3OYZ A;  5JVD E;  2C0S A;  3PU3 A;  4YSZ A;  4JI4 T;  3OBV E;  2KMF A;  3G06 A;  2UXD T;  4CXW A;  5FXW A;  2EHO A;  2DCF A;  5L4H A;  3P4R A;  2Q9Q D;  4HE8 A;  4JI7 T;  3UQ4 A;  4A56 A;  1YKH B;  4ZI3 C;  2HPL A;  2C5I T;  2LOS A;  4A97 A;  3GMI A;  4OFZ A;  1WCR A;  2EHO C;  3PUG A;  4PK5 A;  1IJ5 A;  2EHO B;  2VKH A;  2UXC T;  1HCI A;  3SFD A;  3RYF E;  3PUW F;  5CGM A;  1MMD A;  3MAC A;  2JQ9 A;  4U72 A;  2CBI A;  4NIQ A;  3AVS A;  2E5V A;  4H63 H;  4TWD A;  4JI3 T;  3Q2M A;  2N9D A;  2ZLY A;  3AAI A;  3N2G E;  4EGW A;  2UUC T;  3ZCJ A;  2V6X A;  2HH7 A;  2UUB T;  4C90 A;  5HWY A;  4NXM T;  1EZ3 A;  2HPJ A;  4CI1 B;  3UUB A;  3A5X A;  3RQW A;  3Q5W A;  3FXD B;  2IW5 B;  3UU5 A;  2WWU A;  3GN5 A;  2X9W A;  2DHR A;  4YY3 T;  5JDG A;  3ZN0 B;  5LBQ B;  4UEL A;  4WW0 A;  5LJN A;  4QHO A;  2X9X A;  3U3I A;  3ZEF B;  2V7I A;  4GKK T;  4X62 T;  3EAM A;  3OJA A;  1S94 A;  4DR7 T;  3WI3 A;  3ZMZ B;  2E5L T;  5JRC A;  4CI2 B;  3N9P A;  3RC3 A;  4JI8 T;  4O4H E;  3UFE A;  3ZMT B;  4IGU A;  2LEH A;  3NKZ A;  3CIR A;  2OLT A;  4U2Y A;  2XQ9 A;  3ZJ2 A;  4QX7 B;  5C8Y E;  3MA9 A;  3PTR B;  3EVY A;  5JRC B;  1IBL T;  4A98 A;  4G2A A;  1MNE A;  3CQC B;  2KND A;  2VAS A;  3NWI A;  3ESL A;  4YHH T;  1UUS A;  2ACZ A;  2LHR A;  1ZEE A;  2V6Y A;  4DR2 T;  1LVF A;  2X9H A;  4DV4 T;  2B76 A;  4E7Z A;  2H7V C;  3J9X 1;  2J1D G;  3LK3 B;  2PTF A;  2BDE A;  4PFP A;  4ILU A;  2IC6 A;  3H37 A;  3ZKR A;  2V6Y B;  5LNK A;  2YOE A;  4DV5 T;  4IHJ E;  5FXZ A;  2XQ4 A;  4DUZ T;  5HEG A;  5AQJ B;  1FMV A;  2Q9Q A;  4ZEY A;  3UFG A;  2V7L A;  3I0O A;  1IBK T;  1J1J A;  5LA6 E;  4GYR A;  3ZN1 B;  2CWY A;  2RP4 A;  2UXN B;  2IML A;  3K8P C;  3OKQ A;  4EV6 A;  4C91 A;  2MPK A;  5AQR B;  2AXD S;  2BVL A;  2WDV A;  2Q9Q C;  4JEH B;  1OED E;  4DR3 T;  3HKD E;  2X0Y A;  2D5U A;  4LF4 T;  2Q9Q B;  1ZP0 A;  1N32 T;  3C98 B;  1MMG A;  3QNU A;  3NZP A;  4JI0 T;  2W67 A;  4DR1 T;  5DAB A;  3NRY A;  2V7K A;  4H9N C;  4TN7 B;  2FUP A;  4YFS A;  2WCA A;  3AE2 A;  4JBW F;  2VVN A;  2HN2 A;  1XMQ T;  4ZI2 D;  4NUU A;  4DND A;  3BQI A;  3AEC A;  2PFV A;  4HFH A;  1FEW A;  4ASK A;  4U31 A;  5LHI B;  3C50 A;  2UXB T;  4GK5 E;  1W0A A;  3U78 A;  4EAH A;  4A5X A;  2XQ8 A;  5J2T E;  2CEA A;  2WDQ A;  2M6B A;  5LGN B;  3RQU A;  1UK5 A;  3UUN A;  3BQL A;  2XQY A;  3ZMV B;  2CHN A;  2NOX A;  2YN6 A;  5A1L A;  3H3A A;  1SA0 E;  4KX6 A;  3PUX F;  4MLK A;  5C2T A;  4DVD A;  4G63 A;  4DV3 T;  3RIU C;  2JQK A;  1T8B A;  3RIA A;  3OPC A;  2LLY A;  3L3P A;  2WBL A;  1CUN A;  5FY1 A;  4WBO A;  2QRX A;  3LK2 B;  3ONL C;  4O2A E;  1JNR A;  4LFC T;  4QXC B;  4PK6 A;  1U5P A;  2V7J A;  3UUL A;  2BG9 A;  2L8K A;  1KNP A;  1MIY A;  1MMA A;  5JDH A;  1AJ3 A;  1HX8 A;  5FXX A;  4JI5 T;  5F3J A;  2LSG A;  3VHL A;  2XAG B;  2VL8 A;  3X1D A;  1MND A;  1Y64 B;  2MOZ A;  3SWH A;  3ABV A;  5AQU B;  3IA3 A;  4L0R A;  1N36 T;  2QYW A;  3AE6 A;  5EK2 A;  1LKX A;  3EUH A;  3T1H T;  4K0U A;  4DR5 T;  5FL1 A;  2A3D A;  2G0U A;  3K3O A;  3D0T A;  4TZ4 C;  3QK6 A;  5AQS B;  5KDM C;  1LVK A;  1FIO A;  1D1B A;  1WLX A;  2V8S V;  4FJO A;  1HFA A;  2YK0 A;  2ODU A;  3VKG A;  2WY2 A;  4ZI3 D;  3CQG B;  3FZL B;  2J47 A;  3ZYK A;  2LE8 A;  3P7I A;  4H9O C;  1SHZ C;  2XSB A;  4CQI A;  5JH7 E;  5AQV B;  2A72 A;  4HEA A;  2K5B B;  3MXZ A;  2WWV A;  2H88 A;  2LHN A;  4DID B;  2JMH A;  3AXJ A;  2Y6X A;  5F5W A;  2DWK A;  2ZMA A;  3DJB A;  4KP3 C;  5HCM A;  1G73 A;  2WB5 A;  2B1E A;  5HXS A;  2NW9 A;  4V1A v;  4DMW A;  1T98 A;  5F8P A;  4BAY B;  4UVA B;  1VCS A;  3OVU A;  3PJA A;  4HFD A;  3AXJ B;  4LF5 T;  5JQG E;  5AQG B;  4B3S T;  4UF0 A;  1Z0P A;  4GOU A;  4JI2 T;  4ZI2 C;  4ISS A;  4KMC A;  4TNV A;  3UUX B;  3JCF A;  1H7C A;  1X9B A;  3UTK A;  4QXH B;  2J62 A;  3MJX A;  5BMV E;  2V5D A;  5LP6 E;  2LM9 A;  3KV4 A;  1WRD A;  2NTY A;  4QKN A;  4UF0 B;  1D0X A;  2RPA A;  3P4S A;  3KV9 A;  2KT9 A;  2XAQ B;  3CWZ B;  3KVB A;  4LMJ A;  2W00 A;  5LOV E;  2WU5 A;  4LF7 T;  2E2A A;  3EI0 A;  4DBR A;  3I0Q A;  3LJC A;  2KZ7 B;  4JEU B;  2W0G A;  3VRA A;  3AAE B;  2XSA A;  3Q9D A;  5FL0 A;  2H7O A;  3VR9 A;  2XAS B;  4IE6 A;  1FJG T;  2BG9 E;  3VR8 A;  4QH1 A;  3JC6 D;  2XM2 A;  5HEJ A;  2M6I A;  4XZC A;  3AEE A;  4PJN A;  3TLV A;  3RPU A;  1KEY A;  5JDQ A;  4ERR A;  4P0A A;  1IAP A;  1Z8U A;  3RYH E;  2XUE A;  4X1K E;  3AB3 B;  3AA1 B;  4X5T A;  1W09 A;  1KF6 A;  3IEE A;  3QOF A;  5TAO A;  2HHH T;  5LGU B;  3HKC E;  4DR4 T;  2WS3 A;  1HG5 A;  3AA0 B;  1KNZ A;  4I0U A;  1M62 A;  3RX6 A;  4TV9 E;  1VCT A;  5AQK B;  2CM0 A;  4U7I A;  2L9Q A;  3AA6 B;  3M65 A;  4GKJ T;  4DBQ A;  2BVM A;  2VWA A;  4UV9 B;  3GA8 A;  4HFI A;  1D0Y A;  1OED A;  3PUZ F;  5LXT E;  4TWF A;  3V5U A;  1NEN A;  1VOM A;  2WMO A;  2NTX A;  4H9R C;  5CFB A;  1NEK A;  1J5W A;  3O1I A;  1HS7 A;  2KSR A;  3KFW X;  5DQW A;  4IIJ E;  5L2L A;  1OED C;  5FY7 A;  1YXR A;  1OED B;  2KLQ A;  2VB6 A;  2CHO A;  3B5M A;  4IDQ A;  5LBM A;  4P1N A;  2RA1 A;  5FNV E;  5LCY A;  3F2E A;  2VVS A;  2YIN A;  4TNW A;  5EK3 A;  4PW8 A;  5AQI B;  2PJQ A;  2K9A A;  1HNZ T;  5HWX A;  4LFB T;  3PUQ A;  4KBM B;  4GK0 E;  2WM9 A;  1JNZ A;  4OYK A;  4M1P A;  4JV5 T;  4YTM A;  4UIG A;  2ODV A;  4QH4 A;  4X65 T;  4EYY R;  1UUR A;  3AEF A;  1ZHC A;  2YU1 A;  5IHY A;  3GN5 B;  2FJB A;  4X1Y E;  5ABF A;  5E0O A;  5LGT B;  3KV5 A;  2XQA A;  4ZHQ E;  3PUY F;  3LBX A;  2W66 A;  3C64 A;  3PUS A;  3HA4 A;  2LJL A;  4IE0 A;  1QLB A;  5ABF B;  2C5J A;  4TUY E;  3O4X E;  2JRK A;  3ZMU B;  3DP7 A;  3JC6 C;  2CA5 A;  3LBX B;  3OYX A;  2BKO A;  2H3R A;  4F6R C;  4JI6 T;  3C51 A;  4PFO A;  2BBJ A;  1Y01 A;  4YLH A;  1KK7 A;  3RKG A;  4YJ3 E;  4U2Z A;  3E08 A;  3CX8 B;  1HTJ F;  1VRB A;  3FHN A;  4AKR B;  3EDV A;  3FBL A;  4IE5 A;  2WDR A;  5JDL A;  3AE1 A;  4IST A;  4HTE A;  3A8Y C;  4DO0 A;  1OWA A;  2D0U A;  1US7 B;  2X67 A;  3ZYL A;  4ANJ A;  3RIF A;  3ZSS A;  2VKJ A;  2UU9 T;  5ETW A;  1FMW A;  4H9S E;  5FP3 A;  4JLE A;  5HEO A;  3ZC1 A;  3P4Q A;  4YSY A;  2K24 A;  4QXB B;  4WZX A;  1HF8 A;  4XAX B;  3A7M A;  4HWC A;  3I9W A;  4UEM A;  4QWN B;  4NXN T;  2V5C A;  1X79 A;  4O4L E;  5CA1 E;  4ZI7 E;  1BR4 A;  1BR2 A;  4XBF B;  5AQO B;  2J4G A;  4MBQ A;  5DJQ C;  4Q25 A;  1E1H B;  3ZT6 A;  1MIV A;  2D0T A;  4KI0 F;  5J2U E;  1WR6 A;  3RI5 A;  2YKS A;  2IHR 1;  1I6Z A;  3PV0 F;  3AE7 A;  1WYB A;  3AE4 A;  1B7T A;  5HXR A;  2DL1 A;  4B6X A;  3AAA B;  1HX1 B;  3ZMS B;  4WBN E;  1WFD A;  5LYJ E;  4UV8 B;  3SOL A;  5FYM A;  2F4V T;  5AQH B;  5AQL B;  1IJ6 A;  5FMN A;  3VU7 H;  4H9Q C;  2K3W A;  3ZCI A;  4PJL A;  4ILC A;  1YQ4 A;  2V7M A;  4NPP A;  4EED A;  4EXT A;  2CE7 A;  3FZF B;  1XDP A;  2E8I A;  2BG9 C;  5IYZ E;  4HWD A;  4YTN A;  4OHF A;  3DTO A;  2BG9 B;  3PJA J;  1M7K A;  5LB7 B;  1HNW T;  1L0V A;  2D2S A;  3HKB E;  2IDO B;  2CCQ A; 
#chains in the Genus database with same CATH homology
 1WR0 A;  4CN4 A;  2RPA A;  4U7Y A;  2CRB A;  4U2Z A;  5CJ5 A;  2V6Y A;  4U33 A;  2V6Y B;  3ZST A;  1YXR A;  2WWV A;  4U2Y A;  1WCR A;  2WY2 A;  2MPK A;  4A5X A;  2V6X A;  2A9U A;  2JQK A;  4CN6 A;  4IT4 A;  2K3W A;  3EAB A;  2XZE A;  3K1S A;  4WZX A;  2LRK A;  5LB7 B;  3ZSS A;  2DL1 A;  2LRL A;  2W2U A;  4U3C A;  3ZT7 A;  5CGM A;  4CN1 A;  4ZEY A;  2JQH A;  2JQ9 A;  4P1N A;  4U7I A;  4U31 A;  4NIQ A;  3ZT6 A;  2CPT A;  3ZT5 A;  5FVL A;  1WFD A;  5FVK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...