2JQHA

Vps4b mit
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
72
structure length
72
Chain Sequence
NLQKAIDLASKAAQEDKAGNYEEALQLYQHAVQYFLHVVKYEAQGDKAKQSIRAKCTEYLDRAEKLKEYLKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ESCRT-III recognition by VPS4 ATPases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar protein sorting-associating protein 4B
total genus 29
structure length 72
sequence length 72
ec nomenclature ec 3.6.4.6: Vesicle-fusing ATPase.
pdb deposition date 2007-06-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2jqhA00
2RPAA 4U7IA 4CN6A 4U31A 4ZEYA 4NIQA 4WZXA 3ZSSA 2V6YB 1WFDA 2V6XA 3ZT5A 2JQHA 3EABA 2JQKA 4U3CA 2W2UA 4CN1A 2WY2A 3ZT6A 3ZSTA 5CGMA 4IT4A 2JQ9A 4A5XA 1YXRA 4U33A 3K1SA 2V6YA 2CRBA 4U7YA 5FVKA 2A9UA 3ZT7A 2XZEA 1WR0A 4P1NA 1WCRA 2LRKA 2WWVA 5FVLA 5CJ5A 2LRLA 2MPKA 2DL1A 4U2ZA 5LB7B 2CPTA 4U2YA 4CN4A 2K3WA
chains in the Genus database with same CATH superfamily
3ZYLA 4IDQA 1GQEA 4NUUA 3FHNA 3G06A 2W66A 3TLUA 3LBXB 1QUUA 1G73A 2BDEA 2VL8A 3H3MA 2C5IT 4B6XA 3QB5A 4JI5T 2X67A 3QUJA 2KSRA 3I9YA 4HWCA 4YTPA 4UVAB 2JMKA 3LK3B 3TKLB 4I55E 4CI3B 4EYUA 5ABHA 2YU1A 5AFUL 3E08A 3NZQA 4F8HA 3IEEA 2ODVA 5LA6E 2X0LB 3PURA 4JUYA 3UUXB 3HA4A 4HN9A 5LHIB 1FJGT 2BZBA 2CCQA 2KT9A 3QK6A 5L3GB 2XQ6A 1NWMX 3K3QC 1WR6A 4O2AE 3GMIA 4MALA 4GK0E 4AISA 1WYBA 2OV9A 3P4QA 4L5GA 5JDNA 1KFYA 3RKOA 3RX6A 5ABEA 1BR2A 4HWHA 2BG9A 2MTQA 1NENA 2FUPA 5AQGB 1XDPA 2E9XC 2MOZA 2XQ8A 2YKSA 4H63V 3AE5A 4TX5A 3KDSE 4IL9A 1MIYA 3AEGA 4KBMB 3ABVA 3KBTA 2VQFT 5LMNT 4KMCA 1KNZA 3EAMA 1I6ZA 4X5TA 2DNXA 3NBXX 4LMJA 4UIGA 2NOXA 4G2AA 3VKGA 2L9QA 4U72A 5LXTE 4BAYB 3LG7A 2WBLA 5ABFB 3ETUA 3AEFA 5CGMA 3SFDA 3UUMA 1ZP0A 3HKBE 5JDHA 2ACZA 1FEWA 4TV9E 3ZYMA 2K24A 3OYZA 1Z8UA 4X66T 4ILAA 3JAEA 3BQLA 4ZXLA 3RYCE 3EHZA 5JTGA 5LYJE 2ZM6T 4YTNA 3EUHA 3TLWA 2UXBT 4DV5T 1T8BA 4PK6A 2XUEA 3AB3B 3C98B 3RIUC 3ZLIA 3T1HT 2K3WA 4X62T 5FKYA 2CXFA 3ANWB 3W15B 3KV5A 4JEUB 1WLXA 4E7ZA 4AXPA 2XQ5A 3I0QA 2XAFB 5LGTB 2JQHA 2JRKA 4LMLA 4DNDA 3CIRA 1T98A 5IUXA 2W67A 4LF5T 2WM9A 4UF0B 4JI1T 1W0BA 3VR9A 3ZPOA 4PNIA 2E8IA 2V7MA 4DUYT 3N9PA 3NRXA 3KV4A 4ILBA 2IAKA 4DV4T 5KX5E 4X65T 5FNVE 5JDLA 4U7YA 4ZS3A 3KV6A 2V7LA 3F31A 4LF7T 4LFAT 2BVLA 3FB2A 2H7VC 4B3RT 4P1NA 1YD8G 1N34T 4AI6A 1B7TA 4IREA 1LVKA 3A8YC 3PU3A 4UV9B 1MIVA 3AXJA 5FL0A 5JR9A 2RPAA 3ONJA 4U7IA 2UXCT 3H3AA 3Q5DA 4GOUA 4QH5A 2DWKA 2E5LT 1AJ3A 1ZV4X 2N1GA 2DCFA 2HPJA 2WQYA 2ZLYA 2KWIB 4KHZF 1SHZC 2NP9A 1E7PA 3EI0A 3MZKB 4TZ4C 5LOVE 3ZYKA 4EEBA 4ADZA 4DV6T 3CPZA 5ABGA 1MIWA 2YEVC 4ILUA 4ZS2A 1FMVA 1R8IA 3KINB 2MAWA 4YHHT 3AE8A 1UCUA 4TUYE 1US7B 3UU4A 2FJBA 4X20E 2HN2A 2W61A 4MBQA 3T1YT 1BR0A 4PJNA 2VASA 3UTKA 5LHHB 1MMNA 1HR0T 4LF6T 2WDQA 5E0OA 5AQFB 5C8YE 4G63A 4JI6T 2UUCT 5DABA 5AQTB 2IIUA 3RPUA 2XSBA 3HKEE 4HFBA 4UEMA 3RH3A 1IAPA 4ASKA 5LJNA 4AIUA 4YFSA 2LJLA 4EAHA 4QH1A 1IJ5A 5FXVA 4YSXA 2HH7A 5JDMA 3UUBA 5L4EA 2XSAA 4OFZA 4AQYT 4DR6T 4UV8B 3AE9A 4H9PC 2VKJA 1Y01A 2YDSA 2D9DA 5FY0A 2V6XA 4Z91A 2JPFA 2CHOA 2X51A 2G0UA 3P50A 1NEKA 3P4SA 4UF0A 3R6NA 3M65A 2QYWA 1W09A 3O9XA 4PK4A 2KLQA 2BKOA 4EIWA 3OPCA 4YXDA 3AEDA 4IE4A 4CZZB 1HS7A 3C51A 2Y6XA 3K1SA 4BJMA 2ACXA 2LKGA 3PUYF 5EZYE 1XMOT 1HF8A 2R6GF 4TNWA 3AVRA 1CUNA 3FZLB 3TLTA 5LMUT 1YW0A 4QH4A 2NW7A 2XJ7A 5AQRB 3I0OA 4HFHA 4EZ4A 2XY8B 1CHUA 2J62A 2XM2A 4YSZA 4JYAT 1YKEB 5J2TE 3SFEA 2LEHA 2WZHA 5KDMC 5AQLB 5JRCB 4U31A 3E22E 2J1DG 2Y48B 2CWOA 1OEDA 3C64A 3LFMA 5DQWA 3N9LA 2NWBA 2VKOA 3ONXA 5LP6E 4AQGA 2YN6A 4DVDA 3QOFA 4E7SA 2HHHT 1E2AA 4YY3T 1FIOA 1HTJF 3RF1A 1UX4A 2H3RA 1IJ6A 1L0VA 3ZN1B 1OWAA 3K3OA 2IMLA 2VVNA 2Y8DA 3MACA 3RYFE 4ERRA 2Q9QD 1FMWA 1YQ3A 4X1YE 3U3IA 4P0AA 3A7MA 5L3CB 1SUMB 3ZCJA 2IC9A 4NPPA 4EZHA 5JRCA 2IUBA 1W9RA 2X68A 4DV3T 2M6BA 1X79A 2LOSA 2SPCA 2BG9B 2X0HA 3AE4A 1JNRA 4TWDA 4JBWF 4ZI2C 5LG4A 3L09A 2MPKA 3HKCE 3PJAJ 2V8SV 2V7KA 3JAFA 4GYRA 3IHRA 1S94A 4H9RC 2HPLA 4IDZA 5AQJB 4C91A 5AQIB 2KWHA 3OKQA 5JDFA 3RRCA 3ZSSA 3CK6A 3D0TA 3ZC1A 4EYYR 4QWNB 3BQIA 4QXBB 5AQPB 3RLFF 3UUNA 4L0RA 1MNDA 5HXHA 5HXEA 4YJ3E 3V5UA 4EXTA 3QNUA 4PW8A 2CWYA 1HX8A 1S35A 1KK7A 3AE7A 3HI2A 3OVUA 1T7SA 5DJQC 2KXPB 3PUSA 5CB4E 3ZMTB 1BR1A 5KXJA 3JADA 3A5XA 1IZNB 5LHGB 1LVFA 1HX1B 5ETWA 1MMDA 1E1HB 5L2LA 3ZJ1A 3E0ZA 3CKDA 4UVBB 3KVBA 4HTEA 4K0KT 4XBFB 4HFEA 1ZKEA 2XAQB 3C4ZA 4H9QC 2WWUA 2W0GA 2XQYA 4X64T 4B3MT 3O4XE 3LK42 2F4VT 5JR9C 1N32T 1OEDE 3AEBA 5L3DB 1D0YA 1U4QA 2K9AA 2LRLA 3PUWF 2JJ9A 1J5ET 3VKHA 4Z90A 2ZM2A 3C4WA 2FJEA 4IDOA 4V1Av 4CN6A 3N9MA 2LSGA 1JNZA 2WMNA 3ZJ2A 4WW0A 5J1GA 1X9BA 3ZT5A 1ZOYA 1IBLT 4HFIA 4AQFA 4EEDA 3FZHB 2XAJB 2OA5A 3F57A 4UVCB 4UXNB 2UXNB 3B57A 2XQAA 2X9XA 4IE6A 3PTRB 3ZT6A 2C5KT 2GK9A 2VKDA 3AEEA 4HWDA 5AQQB 4DMVA 3P4PA 4PJMA 2BG9C 4DUZT 5AQNB 2Q9QB 4PFPA 5FVKA 4LF4T 2IDOB 4PJLA 2A9UA 2CXDA 2H89A 4NUVA 5HXRA 2W4XA 4BJNA 1OEDC 2LE8A 4I50E 3VHLA 4Q25A 4YSYA 3QC9A 4U74A 1T72A 2EHOC 3AAEB 3AA0B 3EDUA 1QLBA 4GK5E 5HWYA 4AKLA 2E5VA 2V5CA 2WCAA 2J4GA 3X1DA 2I0MA 3RRWA 5LNKA 2XQ3A 2WP9A 3GWHA 1W0AA 3CMLA 3PJAA 4EV6A 3P8CD 3EABA 3VRAA 1Y64B 4QXHB 4DV1T 4ZI3C 4DMWA 2D2SA 5F8PA 1UGOA 2BBHA 1D1AA 5HEGA 2NW9A 3RHWA 1HG5A 5LJMA 1UK5A 5ADXL 3T8OA 4AKGA 3PUZF 4TWHA 4TWFA 5HXCA 4O4LE 3PU8A 3SS1A 2V6YA 2CRBA 1XWMA 3BQKA 3MKDA 5FY1A 2LHNA 2N9DA 3AA1B 4IE7A 4AQFC 2IHR1 4JI3T 2BKPA 5AQKB 3V5SA 3WAKA 1BR4A 2A2FX 2BS4A 2PG8A 2XZEA 2LHRA 2X0YA 3CX7B 4OK0A 2ODUA 3CVRA 4P09A 1N33T 1Z0PA 5CA1E 3O1JA 1V9DA 2DHRA 4A97A 5FMNA 2CM0A 3FXDB 3LK2B 5TAOA 5GONE 4F6RC 4DR3T 2B1EA 2IC6A 3PUVF 5FL1A 1YKHB 1HNZT 3GN5A 2WU5A 4IGUA 4WZXA 4LF8T 2VL0A 2W00A 5JDQA 2NW8A 2ZM8A 4IIJE 2RA1A 3UU8A 2BS3A 2DWGA 3PUAA 2QVAA 5L3EB 2CEAA 3J7Yq 4HEAA 2CMRA 2WDVA 3K8PC 5IHYA 3N2GE 2DLRA 3OBVE 3RIFA 5JR9B 2LSJA 5JREA 1LKXA 2Q9QC 4J2CA 5L4HA 4WBNE 1KNPA 2P9BA 4ZZCA 4JI4T 1LRZA 4ZI2D 4LF9T 3ZCIA 3H37A 3SOLA 2X9YA 1VOMA 2I59A 4DBRA 2UXDT 1YXRA 2A3DA 1M62A 1MMAA 1OEDB 2K48A 4U33A 3ZEFB 1UURA 3MXZA 4YHJA 3FZMB 1I94T 5AQOB 4DR5T 3L8RA 5HYAA 3CX6B 4LFCT 2VWAA 3UFGA 3EDVA 2WS3A 3JCFA 5FXWA 2K5BB 2LRKA 3CX8B 4MLKA 4N78D 3Q2MA 4DIDB 3UULA 4U2ZA 1OXZA 2L3LA 2A72A 2YDRA 3C50A 4KX6A 1WYCA 2KZ7B 4PFOA 4FI5A 3PUXF 4CN4A 1VRBA 3AE1A 4PAGA 4DV2T 2AE9A 5FY7A 5HEJA 1IBKT 3ANWA 4CI1B 4L9IA 1WFDA 2JIWA 3R84B 1IBMT 4B3ST 5LGUB 3AXJB 2WMOA 3P7IA 4JI0T 4XAXB 1D0ZA 5EK3A 3F2EA 4IL4A 3N9QA 3P4WA 2WY2A 2PFVA 4HFCA 3ETVA 4JI2T 4YJ2E 4DO0A 2C5JA 1HNWT 5HWXA 2XQ4A 2EHOD 4DV0T 3AAIA 3LBXA 3FXEB 2E9XA 2LSKA 2CLYC 3RYHE 3MA9A 3Q5XA 1UUSA 1XZYA 2YDQA 2VK9A 3U78A 5CFBA 2EHOA 4I4TE 5ABFA 2V5DA 2N2NA 4KP3C 5J0ZA 4DR4T 3NRYA 4A98A 2UXXB 2WDRA 2XQ7A 5AQSB 4DBQA 3UT5E 4UELA 4O4IE 4TV8E 1G8XA 1KEYA 4O8SA 4WYVA 4ILCA 1HCIA 2YU2A 3N5LA 3N9NA 5AQMB 5AQUB 3O1IA 4TN7B 5FXXA 5H6RB 4QKNA 2BKNA 2VVSA 5C3JA 2QA7A 2YINA 1HFAA 3RQWA 3HKDE 4KI0F 3Q9DA 5JH7E 3J9X1 3UQ4A 2CXLA 5J2UE 3RC8A 3N9OA 4IHJE 4OYKA 2FJDA 4H9OC 3N2OA 1D0XA 1KNRA 2I6HA 2V7IA 1O3XA 2YOEA 3ZSTA 5L47A 2UU9T 4H63H 4IT4A 2JQ9A 4A5XA 2C0SA 3AA7B 1YQ4A 2VB6A 2BG9E 4HKAA 5LCYA 1N36T 4H9NC 1J1JA 4COFA 5IYZE 4GKKT 3RC3A 1MMGA 1MNEA 1H7CA 3KV9A 3NWIA 2ES0A 4AKRB 1J5WA 4TNVA 1WR0A 4JI7T 2H7OA 1WCRA 2M67A 2WWVA 3UU5A 3AAAB 3PDYA 3P4RA 5FVLA 3VU7H 5CJ5A 4QX7B 4DV7T 4JV5T 4JI8T 4O2BE 3ZMVB 2KINB 2PBIA 2XAHB 4KHPT 4WBOA 4HWIB 1XDOA 2XM1A 1HG2A 2E2AA 4NIQA 3LSVA 2AXDS 3ONLC 5F5WA 2LLYA 2XHEB 3DJBA 3Q5WA 4UR9A 2IW5B 4CXYA 3NZPA 4FJOA 2D5UA 2NR4A 3RKGA 3UFEA 4K0UA 2JMHA 3DP7A 3DTOA 5EK4A 2W2UA 5IWAT 1HNXT 3GA8A 1XNQT 3UU3A 3IA3A 5FYMA 4DR1T 2V7JA 4CQIA 2VKHA 4ZOLE 4ZI7E 4LMKA 2RP4A 4CI2B 4ZZBA 1ZEEA 4OHFA 3PUQA 3S4UA 5F3JA 2NTYA 2V1DB 3C4XA 4OYJA 3TLVA 5L3FB 3SRZA 1VCTA 5DQVA 5LB7B 5LBMA 4ANJA 4CN1A 5HEUA 2CBIA 2WZIA 3AECA 3BK9A 4IDPA 4PJJA 2VQET 2LSIA 3KBUA 1EZ3A 3B13A 2UUAT 2LKHA 5L3BB 1NAFA 2KMFA 2QRXA 2PTFA 5EK2A 4B3TT 3KFWX 2JQKA 2LSYA 3FBLA 5LBQB 5AQHB 4OX9T 4GKJT 3NKZA 2CHNA 2ZM0A 3AEAA 3KVAA 3NVOA 4IDNA 5M4YA 5BR8T 2EHOB 3EVYA 4QX8B 3CQGB 5HEHA 3ZMSB 2B76A 4HE8A 5HCMA 4CXXA 4I0UA 3ESLA 5H6QB 3AE2A 4GIWA 3ZKRA 5HXSA 2UUBT 4NXMT 4HFVA 2BVMA 3HL6A 2CE7A 2FBWA 4Z8XA 1XNRT 2LT3A 5JQGE 1XMQT 4LFBT 3OJAA 5FP3A 4EB6E 2CBJA 3HR0A 3MK7C 3AE6A 2XPKA 2WU2A 4JLEA 3SWHA 3OTOT 1U5PA 2DL1A 2E9XD 1SA0E 2D0TA 3PE0A 4P0BA 5LG3A 4H9SE 2WSSV 2LM9A 4QXCB 3PUGA 4M1PA 3CQCB 4ZEYA 5KMGP 4X1KE 4EGWA 2FJAA 1VCSA 2V6YB 3CWZB 4PK5A 4DR7T 4ZI3D 2KNDA 2BBJA 2WAUA 3LJCA 3MJXA 4HGAA 2CLYB 4YLHA 5FXZA 5JVDE 2NTXA 3OYXA 2BS2A 3ZMUB 4IE5A 2H88A 2V26A 4O4HE 2J47A 4X1IE 5JDGA 4DR2T 4AKIA 3FZKB 3I1AA 4NXNT 3AA6B 3VRBA 3ZMZB 4ISTA 2W62A 2VURA 4O4JE 3WAJA 4A56A 2LOPA 1KF6A 4JEHB 4WNKA 5AQVB 3VR8A 4HWFA 5HAXA 2PJQA 5LGNB 3ZT7A 3UU6A 2XTLA 2WB5A 4CXWA 3ZC0A 5HEOA 1UX5A 3LDQB 3PV0F 4YTMA 5HCJA 4YT0A 4C90A 4EOZB 1D1BA 5C2TA 2CPTA 2MYSA 3N2KE 3FZFB 2X66A 4IE0A 2YK0A 1D1CA 3TLSA 1QSDA 3FBZA 4ISSA 4AKHA 2Q9QA 3GN5B 2OLTA 2XQ9A 3JC6C 2X9WA 2QGSA 3CQXC 3QB5K 3IBPA 2HN1A 4HFDA 3WI3A 4U3CA 3RQUA 3K3NA 3RIAA 2XASB 4ZHQE 1WRDA 4I43B 2D0UA 1DU2A 1SE7A 4MFRA 4KUMB 3RI5A 3B5MA 3ZN0B 2XAGB 2W63A 4MHCA 3AE3A 3RGLA 2L8KA 2ZMAA 2DI4A 3I9WA 2Z6EA 4BA9A 1ZHCA 3RYIE 4QHOA 2JQQA 3JC6D 3RIUA 5A1LA 5BMVE 3AVSA 3O1HA 4GYSA 3UQ7A 3M3ZB 4XZCA 3Q5EA 2MBGA 2X9HA 2LM2A 3IF8B 3L3PA 1M7KA 2M6IA 2CA5A 5CA0E 4U2YA 3L39A 2E9XB
chains in the Genus database with same CATH topology
2RPAA 4U7IA 4CN6A 4U31A 4ZEYA 4NIQA 4WZXA 3ZSSA 2V6YB 1WFDA 2V6XA 3ZT5A 2JQHA 3EABA 2JQKA 4U3CA 2W2UA 4CN1A 2WY2A 3ZT6A 3ZSTA 5CGMA 4IT4A 2JQ9A 4A5XA 1YXRA 4U33A 3K1SA 2V6YA 2CRBA 4U7YA 5FVKA 2A9UA 3ZT7A 2XZEA 1WR0A 4P1NA 1WCRA 2LRKA 2WWVA 5FVLA 5CJ5A 2LRLA 2MPKA 2DL1A 4U2ZA 5LB7B 2CPTA 4U2YA 4CN4A 2K3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RPA A;  4U7I A;  4CN6 A;  4U31 A;  4ZEY A;  4NIQ A;  4WZX A;  3ZSS A;  2V6Y B;  1WFD A;  2V6X A;  3ZT5 A;  2JQH A;  3EAB A;  2JQK A;  4U3C A;  2W2U A;  4CN1 A;  2WY2 A;  3ZT6 A;  3ZST A;  5CGM A;  4IT4 A;  2JQ9 A;  4A5X A;  1YXR A;  4U33 A;  3K1S A;  2V6Y A;  2CRB A;  4U7Y A;  5FVK A;  2A9U A;  3ZT7 A;  2XZE A;  1WR0 A;  4P1N A;  1WCR A;  2LRK A;  2WWV A;  5FVL A;  5CJ5 A;  2LRL A;  2MPK A;  2DL1 A;  4U2Z A;  5LB7 B;  2CPT A;  4U2Y A;  4CN4 A;  2K3W A; 
#chains in the Genus database with same CATH topology
 3ZYL A;  4IDQ A;  1GQE A;  4NUU A;  3FHN A;  3G06 A;  2W66 A;  3TLU A;  3LBX B;  1QUU A;  1G73 A;  2BDE A;  2VL8 A;  3H3M A;  2C5I T;  4B6X A;  3QB5 A;  4JI5 T;  2X67 A;  3QUJ A;  2KSR A;  3I9Y A;  4HWC A;  4YTP A;  4UVA B;  2JMK A;  3LK3 B;  3TKL B;  4I55 E;  4CI3 B;  4EYU A;  5ABH A;  2YU1 A;  5AFU L;  3E08 A;  3NZQ A;  4F8H A;  3IEE A;  2ODV A;  5LA6 E;  2X0L B;  3PUR A;  4JUY A;  3UUX B;  3HA4 A;  4HN9 A;  5LHI B;  1FJG T;  2BZB A;  2CCQ A;  2KT9 A;  3QK6 A;  5L3G B;  2XQ6 A;  1NWM X;  3K3Q C;  1WR6 A;  4O2A E;  3GMI A;  4MAL A;  4GK0 E;  4AIS A;  1WYB A;  2OV9 A;  3P4Q A;  4L5G A;  5JDN A;  1KFY A;  3RKO A;  3RX6 A;  5ABE A;  1BR2 A;  4HWH A;  2BG9 A;  2MTQ A;  1NEN A;  2FUP A;  5AQG B;  1XDP A;  2E9X C;  2MOZ A;  2XQ8 A;  2YKS A;  4H63 V;  3AE5 A;  4TX5 A;  3KDS E;  4IL9 A;  1MIY A;  3AEG A;  4KBM B;  3ABV A;  3KBT A;  2VQF T;  5LMN T;  4KMC A;  1KNZ A;  3EAM A;  1I6Z A;  4X5T A;  2DNX A;  3NBX X;  4LMJ A;  4UIG A;  2NOX A;  4G2A A;  3VKG A;  2L9Q A;  4U72 A;  5LXT E;  4BAY B;  3LG7 A;  2WBL A;  5ABF B;  3ETU A;  3AEF A;  5CGM A;  3SFD A;  3UUM A;  1ZP0 A;  3HKB E;  5JDH A;  2ACZ A;  1FEW A;  4TV9 E;  3ZYM A;  2K24 A;  3OYZ A;  1Z8U A;  4X66 T;  4ILA A;  3JAE A;  3BQL A;  4ZXL A;  3RYC E;  3EHZ A;  5JTG A;  5LYJ E;  2ZM6 T;  4YTN A;  3EUH A;  3TLW A;  2UXB T;  4DV5 T;  1T8B A;  4PK6 A;  2XUE A;  3AB3 B;  3C98 B;  3RIU C;  3ZLI A;  3T1H T;  2K3W A;  4X62 T;  5FKY A;  2CXF A;  3ANW B;  3W15 B;  3KV5 A;  4JEU B;  1WLX A;  4E7Z A;  4AXP A;  2XQ5 A;  3I0Q A;  2XAF B;  5LGT B;  2JQH A;  2JRK A;  4LML A;  4DND A;  3CIR A;  1T98 A;  5IUX A;  2W67 A;  4LF5 T;  2WM9 A;  4UF0 B;  4JI1 T;  1W0B A;  3VR9 A;  3ZPO A;  4PNI A;  2E8I A;  2V7M A;  4DUY T;  3N9P A;  3NRX A;  3KV4 A;  4ILB A;  2IAK A;  4DV4 T;  5KX5 E;  4X65 T;  5FNV E;  5JDL A;  4U7Y A;  4ZS3 A;  3KV6 A;  2V7L A;  3F31 A;  4LF7 T;  4LFA T;  2BVL A;  3FB2 A;  2H7V C;  4B3R T;  4P1N A;  1YD8 G;  1N34 T;  4AI6 A;  1B7T A;  4IRE A;  1LVK A;  3A8Y C;  3PU3 A;  4UV9 B;  1MIV A;  3AXJ A;  5FL0 A;  5JR9 A;  2RPA A;  3ONJ A;  4U7I A;  2UXC T;  3H3A A;  3Q5D A;  4GOU A;  4QH5 A;  2DWK A;  2E5L T;  1AJ3 A;  1ZV4 X;  2N1G A;  2DCF A;  2HPJ A;  2WQY A;  2ZLY A;  2KWI B;  4KHZ F;  1SHZ C;  2NP9 A;  1E7P A;  3EI0 A;  3MZK B;  4TZ4 C;  5LOV E;  3ZYK A;  4EEB A;  4ADZ A;  4DV6 T;  3CPZ A;  5ABG A;  1MIW A;  2YEV C;  4ILU A;  4ZS2 A;  1FMV A;  1R8I A;  3KIN B;  2MAW A;  4YHH T;  3AE8 A;  1UCU A;  4TUY E;  1US7 B;  3UU4 A;  2FJB A;  4X20 E;  2HN2 A;  2W61 A;  4MBQ A;  3T1Y T;  1BR0 A;  4PJN A;  2VAS A;  3UTK A;  5LHH B;  1MMN A;  1HR0 T;  4LF6 T;  2WDQ A;  5E0O A;  5AQF B;  5C8Y E;  4G63 A;  4JI6 T;  2UUC T;  5DAB A;  5AQT B;  2IIU A;  3RPU A;  2XSB A;  3HKE E;  4HFB A;  4UEM A;  3RH3 A;  1IAP A;  4ASK A;  5LJN A;  4AIU A;  4YFS A;  2LJL A;  4EAH A;  4QH1 A;  1IJ5 A;  5FXV A;  4YSX A;  2HH7 A;  5JDM A;  3UUB A;  5L4E A;  2XSA A;  4OFZ A;  4AQY T;  4DR6 T;  4UV8 B;  3AE9 A;  4H9P C;  2VKJ A;  1Y01 A;  2YDS A;  2D9D A;  5FY0 A;  2V6X A;  4Z91 A;  2JPF A;  2CHO A;  2X51 A;  2G0U A;  3P50 A;  1NEK A;  3P4S A;  4UF0 A;  3R6N A;  3M65 A;  2QYW A;  1W09 A;  3O9X A;  4PK4 A;  2KLQ A;  2BKO A;  4EIW A;  3OPC A;  4YXD A;  3AED A;  4IE4 A;  4CZZ B;  1HS7 A;  3C51 A;  2Y6X A;  3K1S A;  4BJM A;  2ACX A;  2LKG A;  3PUY F;  5EZY E;  1XMO T;  1HF8 A;  2R6G F;  4TNW A;  3AVR A;  1CUN A;  3FZL B;  3TLT A;  5LMU T;  1YW0 A;  4QH4 A;  2NW7 A;  2XJ7 A;  5AQR B;  3I0O A;  4HFH A;  4EZ4 A;  2XY8 B;  1CHU A;  2J62 A;  2XM2 A;  4YSZ A;  4JYA T;  1YKE B;  5J2T E;  3SFE A;  2LEH A;  2WZH A;  5KDM C;  5AQL B;  5JRC B;  4U31 A;  3E22 E;  2J1D G;  2Y48 B;  2CWO A;  1OED A;  3C64 A;  3LFM A;  5DQW A;  3N9L A;  2NWB A;  2VKO A;  3ONX A;  5LP6 E;  4AQG A;  2YN6 A;  4DVD A;  3QOF A;  4E7S A;  2HHH T;  1E2A A;  4YY3 T;  1FIO A;  1HTJ F;  3RF1 A;  1UX4 A;  2H3R A;  1IJ6 A;  1L0V A;  3ZN1 B;  1OWA A;  3K3O A;  2IML A;  2VVN A;  2Y8D A;  3MAC A;  3RYF E;  4ERR A;  2Q9Q D;  1FMW A;  1YQ3 A;  4X1Y E;  3U3I A;  4P0A A;  3A7M A;  5L3C B;  1SUM B;  3ZCJ A;  2IC9 A;  4NPP A;  4EZH A;  5JRC A;  2IUB A;  1W9R A;  2X68 A;  4DV3 T;  2M6B A;  1X79 A;  2LOS A;  2SPC A;  2BG9 B;  2X0H A;  3AE4 A;  1JNR A;  4TWD A;  4JBW F;  4ZI2 C;  5LG4 A;  3L09 A;  2MPK A;  3HKC E;  3PJA J;  2V8S V;  2V7K A;  3JAF A;  4GYR A;  3IHR A;  1S94 A;  4H9R C;  2HPL A;  4IDZ A;  5AQJ B;  4C91 A;  5AQI B;  2KWH A;  3OKQ A;  5JDF A;  3RRC A;  3ZSS A;  3CK6 A;  3D0T A;  3ZC1 A;  4EYY R;  4QWN B;  3BQI A;  4QXB B;  5AQP B;  3RLF F;  3UUN A;  4L0R A;  1MND A;  5HXH A;  5HXE A;  4YJ3 E;  3V5U A;  4EXT A;  3QNU A;  4PW8 A;  2CWY A;  1HX8 A;  1S35 A;  1KK7 A;  3AE7 A;  3HI2 A;  3OVU A;  1T7S A;  5DJQ C;  2KXP B;  3PUS A;  5CB4 E;  3ZMT B;  1BR1 A;  5KXJ A;  3JAD A;  3A5X A;  1IZN B;  5LHG B;  1LVF A;  1HX1 B;  5ETW A;  1MMD A;  1E1H B;  5L2L A;  3ZJ1 A;  3E0Z A;  3CKD A;  4UVB B;  3KVB A;  4HTE A;  4K0K T;  4XBF B;  4HFE A;  1ZKE A;  2XAQ B;  3C4Z A;  4H9Q C;  2WWU A;  2W0G A;  2XQY A;  4X64 T;  4B3M T;  3O4X E;  3LK4 2;  2F4V T;  5JR9 C;  1N32 T;  1OED E;  3AEB A;  5L3D B;  1D0Y A;  1U4Q A;  2K9A A;  2LRL A;  3PUW F;  2JJ9 A;  1J5E T;  3VKH A;  4Z90 A;  2ZM2 A;  3C4W A;  2FJE A;  4IDO A;  4V1A v;  4CN6 A;  3N9M A;  2LSG A;  1JNZ A;  2WMN A;  3ZJ2 A;  4WW0 A;  5J1G A;  1X9B A;  3ZT5 A;  1ZOY A;  1IBL T;  4HFI A;  4AQF A;  4EED A;  3FZH B;  2XAJ B;  2OA5 A;  3F57 A;  4UVC B;  4UXN B;  2UXN B;  3B57 A;  2XQA A;  2X9X A;  4IE6 A;  3PTR B;  3ZT6 A;  2C5K T;  2GK9 A;  2VKD A;  3AEE A;  4HWD A;  5AQQ B;  4DMV A;  3P4P A;  4PJM A;  2BG9 C;  4DUZ T;  5AQN B;  2Q9Q B;  4PFP A;  5FVK A;  4LF4 T;  2IDO B;  4PJL A;  2A9U A;  2CXD A;  2H89 A;  4NUV A;  5HXR A;  2W4X A;  4BJN A;  1OED C;  2LE8 A;  4I50 E;  3VHL A;  4Q25 A;  4YSY A;  3QC9 A;  4U74 A;  1T72 A;  2EHO C;  3AAE B;  3AA0 B;  3EDU A;  1QLB A;  4GK5 E;  5HWY A;  4AKL A;  2E5V A;  2V5C A;  2WCA A;  2J4G A;  3X1D A;  2I0M A;  3RRW A;  5LNK A;  2XQ3 A;  2WP9 A;  3GWH A;  1W0A A;  3CML A;  3PJA A;  4EV6 A;  3P8C D;  3EAB A;  3VRA A;  1Y64 B;  4QXH B;  4DV1 T;  4ZI3 C;  4DMW A;  2D2S A;  5F8P A;  1UGO A;  2BBH A;  1D1A A;  5HEG A;  2NW9 A;  3RHW A;  1HG5 A;  5LJM A;  1UK5 A;  5ADX L;  3T8O A;  4AKG A;  3PUZ F;  4TWH A;  4TWF A;  5HXC A;  4O4L E;  3PU8 A;  3SS1 A;  2V6Y A;  2CRB A;  1XWM A;  3BQK A;  3MKD A;  5FY1 A;  2LHN A;  2N9D A;  3AA1 B;  4IE7 A;  4AQF C;  2IHR 1;  4JI3 T;  2BKP A;  5AQK B;  3V5S A;  3WAK A;  1BR4 A;  2A2F X;  2BS4 A;  2PG8 A;  2XZE A;  2LHR A;  2X0Y A;  3CX7 B;  4OK0 A;  2ODU A;  3CVR A;  4P09 A;  1N33 T;  1Z0P A;  5CA1 E;  3O1J A;  1V9D A;  2DHR A;  4A97 A;  5FMN A;  2CM0 A;  3FXD B;  3LK2 B;  5TAO A;  5GON E;  4F6R C;  4DR3 T;  2B1E A;  2IC6 A;  3PUV F;  5FL1 A;  1YKH B;  1HNZ T;  3GN5 A;  2WU5 A;  4IGU A;  4WZX A;  4LF8 T;  2VL0 A;  2W00 A;  5JDQ A;  2NW8 A;  2ZM8 A;  4IIJ E;  2RA1 A;  3UU8 A;  2BS3 A;  2DWG A;  3PUA A;  2QVA A;  5L3E B;  2CEA A;  3J7Y q;  4HEA A;  2CMR A;  2WDV A;  3K8P C;  5IHY A;  3N2G E;  2DLR A;  3OBV E;  3RIF A;  5JR9 B;  2LSJ A;  5JRE A;  1LKX A;  2Q9Q C;  4J2C A;  5L4H A;  4WBN E;  1KNP A;  2P9B A;  4ZZC A;  4JI4 T;  1LRZ A;  4ZI2 D;  4LF9 T;  3ZCI A;  3H37 A;  3SOL A;  2X9Y A;  1VOM A;  2I59 A;  4DBR A;  2UXD T;  1YXR A;  2A3D A;  1M62 A;  1MMA A;  1OED B;  2K48 A;  4U33 A;  3ZEF B;  1UUR A;  3MXZ A;  4YHJ A;  3FZM B;  1I94 T;  5AQO B;  4DR5 T;  3L8R A;  5HYA A;  3CX6 B;  4LFC T;  2VWA A;  3UFG A;  3EDV A;  2WS3 A;  3JCF A;  5FXW A;  2K5B B;  2LRK A;  3CX8 B;  4MLK A;  4N78 D;  3Q2M A;  4DID B;  3UUL A;  4U2Z A;  1OXZ A;  2L3L A;  2A72 A;  2YDR A;  3C50 A;  4KX6 A;  1WYC A;  2KZ7 B;  4PFO A;  4FI5 A;  3PUX F;  4CN4 A;  1VRB A;  3AE1 A;  4PAG A;  4DV2 T;  2AE9 A;  5FY7 A;  5HEJ A;  1IBK T;  3ANW A;  4CI1 B;  4L9I A;  1WFD A;  2JIW A;  3R84 B;  1IBM T;  4B3S T;  5LGU B;  3AXJ B;  2WMO A;  3P7I A;  4JI0 T;  4XAX B;  1D0Z A;  5EK3 A;  3F2E A;  4IL4 A;  3N9Q A;  3P4W A;  2WY2 A;  2PFV A;  4HFC A;  3ETV A;  4JI2 T;  4YJ2 E;  4DO0 A;  2C5J A;  1HNW T;  5HWX A;  2XQ4 A;  2EHO D;  4DV0 T;  3AAI A;  3LBX A;  3FXE B;  2E9X A;  2LSK A;  2CLY C;  3RYH E;  3MA9 A;  3Q5X A;  1UUS A;  1XZY A;  2YDQ A;  2VK9 A;  3U78 A;  5CFB A;  2EHO A;  4I4T E;  5ABF A;  2V5D A;  2N2N A;  4KP3 C;  5J0Z A;  4DR4 T;  3NRY A;  4A98 A;  2UXX B;  2WDR A;  2XQ7 A;  5AQS B;  4DBQ A;  3UT5 E;  4UEL A;  4O4I E;  4TV8 E;  1G8X A;  1KEY A;  4O8S A;  4WYV A;  4ILC A;  1HCI A;  2YU2 A;  3N5L A;  3N9N A;  5AQM B;  5AQU B;  3O1I A;  4TN7 B;  5FXX A;  5H6R B;  4QKN A;  2BKN A;  2VVS A;  5C3J A;  2QA7 A;  2YIN A;  1HFA A;  3RQW A;  3HKD E;  4KI0 F;  3Q9D A;  5JH7 E;  3J9X 1;  3UQ4 A;  2CXL A;  5J2U E;  3RC8 A;  3N9O A;  4IHJ E;  4OYK A;  2FJD A;  4H9O C;  3N2O A;  1D0X A;  1KNR A;  2I6H A;  2V7I A;  1O3X A;  2YOE A;  3ZST A;  5L47 A;  2UU9 T;  4H63 H;  4IT4 A;  2JQ9 A;  4A5X A;  2C0S A;  3AA7 B;  1YQ4 A;  2VB6 A;  2BG9 E;  4HKA A;  5LCY A;  1N36 T;  4H9N C;  1J1J A;  4COF A;  5IYZ E;  4GKK T;  3RC3 A;  1MMG A;  1MNE A;  1H7C A;  3KV9 A;  3NWI A;  2ES0 A;  4AKR B;  1J5W A;  4TNV A;  1WR0 A;  4JI7 T;  2H7O A;  1WCR A;  2M67 A;  2WWV A;  3UU5 A;  3AAA B;  3PDY A;  3P4R A;  5FVL A;  3VU7 H;  5CJ5 A;  4QX7 B;  4DV7 T;  4JV5 T;  4JI8 T;  4O2B E;  3ZMV B;  2KIN B;  2PBI A;  2XAH B;  4KHP T;  4WBO A;  4HWI B;  1XDO A;  2XM1 A;  1HG2 A;  2E2A A;  4NIQ A;  3LSV A;  2AXD S;  3ONL C;  5F5W A;  2LLY A;  2XHE B;  3DJB A;  3Q5W A;  4UR9 A;  2IW5 B;  4CXY A;  3NZP A;  4FJO A;  2D5U A;  2NR4 A;  3RKG A;  3UFE A;  4K0U A;  2JMH A;  3DP7 A;  3DTO A;  5EK4 A;  2W2U A;  5IWA T;  1HNX T;  3GA8 A;  1XNQ T;  3UU3 A;  3IA3 A;  5FYM A;  4DR1 T;  2V7J A;  4CQI A;  2VKH A;  4ZOL E;  4ZI7 E;  4LMK A;  2RP4 A;  4CI2 B;  4ZZB A;  1ZEE A;  4OHF A;  3PUQ A;  3S4U A;  5F3J A;  2NTY A;  2V1D B;  3C4X A;  4OYJ A;  3TLV A;  5L3F B;  3SRZ A;  1VCT A;  5DQV A;  5LB7 B;  5LBM A;  4ANJ A;  4CN1 A;  5HEU A;  2CBI A;  2WZI A;  3AEC A;  3BK9 A;  4IDP A;  4PJJ A;  2VQE T;  2LSI A;  3KBU A;  1EZ3 A;  3B13 A;  2UUA T;  2LKH A;  5L3B B;  1NAF A;  2KMF A;  2QRX A;  2PTF A;  5EK2 A;  4B3T T;  3KFW X;  2JQK A;  2LSY A;  3FBL A;  5LBQ B;  5AQH B;  4OX9 T;  4GKJ T;  3NKZ A;  2CHN A;  2ZM0 A;  3AEA A;  3KVA A;  3NVO A;  4IDN A;  5M4Y A;  5BR8 T;  2EHO B;  3EVY A;  4QX8 B;  3CQG B;  5HEH A;  3ZMS B;  2B76 A;  4HE8 A;  5HCM A;  4CXX A;  4I0U A;  3ESL A;  5H6Q B;  3AE2 A;  4GIW A;  3ZKR A;  5HXS A;  2UUB T;  4NXM T;  4HFV A;  2BVM A;  3HL6 A;  2CE7 A;  2FBW A;  4Z8X A;  1XNR T;  2LT3 A;  5JQG E;  1XMQ T;  4LFB T;  3OJA A;  5FP3 A;  4EB6 E;  2CBJ A;  3HR0 A;  3MK7 C;  3AE6 A;  2XPK A;  2WU2 A;  4JLE A;  3SWH A;  3OTO T;  1U5P A;  2DL1 A;  2E9X D;  1SA0 E;  2D0T A;  3PE0 A;  4P0B A;  5LG3 A;  4H9S E;  2WSS V;  2LM9 A;  4QXC B;  3PUG A;  4M1P A;  3CQC B;  4ZEY A;  5KMG P;  4X1K E;  4EGW A;  2FJA A;  1VCS A;  2V6Y B;  3CWZ B;  4PK5 A;  4DR7 T;  4ZI3 D;  2KND A;  2BBJ A;  2WAU A;  3LJC A;  3MJX A;  4HGA A;  2CLY B;  4YLH A;  5FXZ A;  5JVD E;  2NTX A;  3OYX A;  2BS2 A;  3ZMU B;  4IE5 A;  2H88 A;  2V26 A;  4O4H E;  2J47 A;  4X1I E;  5JDG A;  4DR2 T;  4AKI A;  3FZK B;  3I1A A;  4NXN T;  3AA6 B;  3VRB A;  3ZMZ B;  4IST A;  2W62 A;  2VUR A;  4O4J E;  3WAJ A;  4A56 A;  2LOP A;  1KF6 A;  4JEH B;  4WNK A;  5AQV B;  3VR8 A;  4HWF A;  5HAX A;  2PJQ A;  5LGN B;  3ZT7 A;  3UU6 A;  2XTL A;  2WB5 A;  4CXW A;  3ZC0 A;  5HEO A;  1UX5 A;  3LDQ B;  3PV0 F;  4YTM A;  5HCJ A;  4YT0 A;  4C90 A;  4EOZ B;  1D1B A;  5C2T A;  2CPT A;  2MYS A;  3N2K E;  3FZF B;  2X66 A;  4IE0 A;  2YK0 A;  1D1C A;  3TLS A;  1QSD A;  3FBZ A;  4ISS A;  4AKH A;  2Q9Q A;  3GN5 B;  2OLT A;  2XQ9 A;  3JC6 C;  2X9W A;  2QGS A;  3CQX C;  3QB5 K;  3IBP A;  2HN1 A;  4HFD A;  3WI3 A;  4U3C A;  3RQU A;  3K3N A;  3RIA A;  2XAS B;  4ZHQ E;  1WRD A;  4I43 B;  2D0U A;  1DU2 A;  1SE7 A;  4MFR A;  4KUM B;  3RI5 A;  3B5M A;  3ZN0 B;  2XAG B;  2W63 A;  4MHC A;  3AE3 A;  3RGL A;  2L8K A;  2ZMA A;  2DI4 A;  3I9W A;  2Z6E A;  4BA9 A;  1ZHC A;  3RYI E;  4QHO A;  2JQQ A;  3JC6 D;  3RIU A;  5A1L A;  5BMV E;  3AVS A;  3O1H A;  4GYS A;  3UQ7 A;  3M3Z B;  4XZC A;  3Q5E A;  2MBG A;  2X9H A;  2LM2 A;  3IF8 B;  3L3P A;  1M7K A;  2M6I A;  2CA5 A;  5CA0 E;  4U2Y A;  3L39 A;  2E9X B; 
#chains in the Genus database with same CATH homology
 2RPA A;  4U7I A;  4CN6 A;  4U31 A;  4ZEY A;  4NIQ A;  4WZX A;  3ZSS A;  2V6Y B;  1WFD A;  2V6X A;  3ZT5 A;  2JQH A;  3EAB A;  2JQK A;  4U3C A;  2W2U A;  4CN1 A;  2WY2 A;  3ZT6 A;  3ZST A;  5CGM A;  4IT4 A;  2JQ9 A;  4A5X A;  1YXR A;  4U33 A;  3K1S A;  2V6Y A;  2CRB A;  4U7Y A;  5FVK A;  2A9U A;  3ZT7 A;  2XZE A;  1WR0 A;  4P1N A;  1WCR A;  2LRK A;  2WWV A;  5FVL A;  5CJ5 A;  2LRL A;  2MPK A;  2DL1 A;  4U2Z A;  5LB7 B;  2CPT A;  4U2Y A;  4CN4 A;  2K3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...