1N34T

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n34T00
4JI4T 1N32T 4NXNT 4LFAT 3OTOT 4B3ST 1HR0T 4JI1T 4DR5T 2UU9T 4NXMT 4LF6T 4JI8T 2VQET 4JI3T 4LF8T 4B3TT 1N36T 1XNQT 4B3RT 5IWAT 1FJGT 4JV5T 4DV5T 1N34T 4LFCT 5LMNT 2UXCT 2UUCT 4DV3T 4JI5T 3T1YT 4JYAT 3T1HT 1J5ET 1XNRT 4X62T 4X66T 4AQYT 4LF4T 1IBLT 1I94T 4GKJT 4JI7T 4YHHT 2E5LT 2ZM6T 4K0KT 5BR8T 4DV7T 4DV1T 4DR3T 1XMOT 1HNZT 5LMUT 4GKKT 4X65T 1HNWT 2UUAT 2UXBT 4OX9T 4DV6T 4LFBT 4DV0T 1IBKT 2HHHT 4DV2T 2F4VT 4B3MT 1N33T 1XMQT 2UUBT 4DR1T 4JI6T 2UXDT 1IBMT 4JI0T 4DR4T 4DR6T 4YY3T 4LF9T 4DUYT 2VQFT 4X64T 4LF5T 1HNXT 4KHPT 4DUZT 4DR2T 4LF7T 4JI2T 4DV4T 4DR7T
chains in the Genus database with same CATH superfamily
4X1YE 3K3NA 4NXNT 4B3ST 2MYSA 5FY1A 4QHOA 5LJNA 2KXPB 2HN1A 3AAAB 1WCRA 1W9RA 2V8SV 2MBGA 3FBZA 2D0UA 3O4XE 2D0TA 5FY0A 2ACXA 2K9AA 5DQVA 2NP9A 4HFDA 4HWIB 2YKSA 3RQUA 4KUMB 4DNDA 2BG9A 5L47A 3W15B 2EHOD 3A7MA 5JDMA 1G73A 2E9XB 4U31A 2L9QA 2N9DA 3UU3A 4AI6A 2V7LA 2RA1A 3AA0B 3LK3B 2BVLA 3JC6C 3UQ7A 3JCFA 2PFVA 1HF8A 4OFZA 4NIQA 1WRDA 5KX5E 3KV4A 3RLFF 1YW0A 4IE5A 5JDGA 3NVOA 5FNVE 3R6NA 5M4YA 3ZN0B 4JI0T 3CIRA 2K24A 3M65A 4HWFA 5L4EA 3ETUA 5CJ5A 4BAYB 4DVDA 2XAGB 2CXFA 2XQ8A 3RIFA 2XAJB 3UUBA 2LJLA 3IA3A 4JI1T 4PAGA 2HH7A 5AQMB 3AA6B 4IREA 4QXHB 5HAXA 3PDYA 4CZZB 3OYXA 4Q25A 3VR8A 2D9DA 2BG9E 3SFDA 4JV5T 2WWUA 3E22E 3OPCA 4LFCT 2XSBA 2XUEA 2UXCT 1NWMX 5AQJB 3BK9A 5AQPB 3OJAA 3PUXF 1WYCA 2DWGA 2J47A 1EZ3A 2ZM0A 3PTRB 4QX7B 2WMNA 3UU6A 4CXYA 2VASA 1KNZA 4K0KT 2WCAA 1FIOA 5AQTB 4CN1A 5ABFA 3KVAA 4HFIA 2BKPA 2FBWA 2QVAA 1U5PA 3ZMTB 3RKOA 5AQKB 3GMIA 5LGUB 2FJBA 5F3JA 4O2AE 4OHFA 2CCQA 2WZIA 5HYAA 3I0OA 2W67A 5JRCB 3QOFA 4LF9T 2V7MA 4ILCA 4CI3B 2HN2A 2EHOA 2X0HA 3RF1A 1FMVA 2WDVA 4A97A 2LKHA 5JDFA 3PUGA 3GA8A 1J1JA 2H89A 3AB3B 4ZI3D 2UU9T 2DLRA 3NBXX 2KINB 4QWNB 2J62A 3AAIA 3PJAJ 3ZT5A 5J0ZA 2W63A 2C5JA 4P0BA 3HI2A 1IZNB 2LRKA 4WYVA 3UFGA 2OV9A 2LSJA 2X67A 2NW8A 4U7IA 2D2SA 2CHOA 2KWHA 4NPPA 3AAEB 2XAQB 1JNRA 2IHR1 4QH5A 3L39A 1MMDA 4HE8A 2XQ6A 3GN5A 4GKKT 1HNWT 2UUAT 3IBPA 1ZEEA 2W0GA 5J1GA 3AVSA 1LVFA 3F31A 3EDUA 2XQ7A 4IDPA 2FJEA 5FXWA 1KFYA 4EYYR 2MTQA 4IE0A 3NKZA 4L9IA 1XDPA 5JDHA 4E7ZA 3N2KE 4FI5A 4EV6A 2LRLA 3ANWB 4EEDA 2XPKA 4YSXA 3PE0A 2WSSV 3PUAA 4HFBA 4I43B 4H9QC 4TNVA 5LGNB 5KDMC 4LMJA 3K8PC 2GK9A 3AE3A 4GOUA 4U2ZA 3ZKRA 5FXVA 3T1YT 1M62A 3UU8A 2CE7A 2L3LA 5H6RB 4DIDB 2JPFA 3PU3A 4AISA 4PJLA 2E9XA 4HFHA 2A72A 3FZHB 5FL1A 1HCIA 2YK0A 1JNZA 1LRZA 3TLSA 2X66A 1E7PA 2H3RA 4QH1A 3UULA 3PU8A 5FVKA 5HXSA 1KK7A 2WZHA 3ZCIA 2BS3A 4PW8A 4H9RC 4ANJA 2WU2A 4ZXLA 3H37A 5BMVE 2AE9A 2V5CA 4DR4T 4Z91A 3CX6B 2XQ4A 2CLYB 2K5BB 3LFMA 1IJ5A 1SA0E 3LK2B 4N78D 4PNIA 2XZEA 4HFEA 4UIGA 3PUZF 4PK5A 4DR7T 2XQ3A 4Z90A 3UU5A 4F8HA 3Q5XA 5EK4A 2YOEA 4YJ3E 4AQGA 4LF8T 2LT3A 3RIUA 2JQQA 3X1DA 3WI3A 2BZBA 2LSIA 3K1SA 1N34T 4O8SA 1WR6A 3RYIE 2WDRA 3ZYMA 4H9NC 4JI5T 2B1EA 4GK0E 3HKEE 2BBJA 3VRBA 3AXJB 1BR0A 4B6XA 2JQKA 2G0UA 4XBFB 4KX6A 3B57A 1NAFA 3ZSSA 4X5TA 2VKJA 3P50A 2ZM6T 3QNUA 3TLWA 4F6RC 4U2YA 4AKIA 5HXEA 3ZT7A 2H7OA 5AQGB 3E08A 3OKQA 2CLYC 4MLKA 2VURA 4X1IE 4IDNA 2WWVA 1YQ4A 2YU1A 2UXDT 3KDSE 4PJMA 1FEWA 1IBMT 3AEFA 2KT9A 2YN6A 5L2LA 3TLUA 2YU2A 3ZCJA 3AECA 4LF7T 2X9XA 2IDOB 3ZSTA 5C8YE 4GYSA 3JAEA 2DL1A 2CEAA 4LF6T 3F2EA 5JH7E 2CPTA 2V7JA 2LOSA 4IL4A 3P4RA 1Z0PA 4EB6E 2KMFA 4EIWA 4LMLA 3HL6A 3UUXB 2V6YB 2X9WA 3ZLIA 3OVUA 5KXJA 3VU7H 5ABGA 3ETVA 4PK6A 3SOLA 4AQYT 5ABHA 4I55E 3K3OA 3OBVE 1OEDA 2JJ9A 4JI7T 4ILAA 3CQGB 1UCUA 2ODUA 5CGMA 1HNZT 4X65T 4HEAA 1V9DA 3ZMSB 4MHCA 1XZYA 1N33T 4FJOA 3VHLA 3LBXB 4JI6T 1G8XA 2ZM8A 3ZYLA 1D0ZA 4ZI2D 3O1IA 2ZLYA 4AQFA 5F5WA 3QB5A 3S4UA 3RYFE 5FMNA 3O1JA 5LHIB 4WW0A 3PV0F 1HR0T 1T72A 2V6XA 1KNPA 1IJ6A 1ZP0A 2MPKA 1N36T 5FP3A 2V1DB 2RP4A 3RRCA 3TKLB 3ZYKA 3FZMB 1OEDE 3M3ZB 2VVNA 2YDRA 5LMNT 1B7TA 1YQ3A 4IE4A 4COFA 4BA9A 5TAOA 4EZ4A 4HGAA 3KBTA 3O1HA 3I9YA 1E2AA 2R6GF 4CQIA 1SHZC 2Q9QD 3I0QA 2LSGA 4X66T 1IBLT 3U3IA 4CXWA 5JTGA 4IHJE 3MKDA 3IHRA 5AQOB 3GWHA 3JC6D 5AQUB 3WAKA 4DV7T 4DMVA 4ZI7E 1UUSA 4P09A 1YKEB 2VVSA 4IDZA 3UT5E 3UQ4A 5FXXA 4LFBT 3LDQB 4MFRA 2X9HA 4TNWA 3F57A 4X20E 1SE7A 2D5UA 5JR9B 1MMNA 5AQNB 2X0LB 2MAWA 1NENA 5GONE 3DTOA 2BS4A 5LP6E 3N9NA 5LG4A 5L3EB 4TX5A 4YFSA 4C91A 3C4ZA 2HPLA 2NTXA 3IF8B 2DCFA 3C4WA 5IYZE 3T8OA 4H63H 4CXXA 5CA0E 2XAFB 2LKGA 3E0ZA 2IIUA 3Q9DA 4HWHA 3N2GE 3AE7A 4XAXB 1FJGT 1ZHCA 4AKRB 3PUWF 2QGSA 2JQHA 2E9XD 4UXNB 1IAPA 3ZMVB 2B76A 4I0UA 4IDQA 2CMRA 2A9UA 2X68A 1D1AA 4YTNA 3RQWA 3T1HT 2WS3A 3FHNA 2NW9A 3CWZB 3EHZA 3PUVF 4O4JE 2FJDA 4BJMA 2XHEB 2NWBA 5A1LA 3ONXA 4UF0A 5LG3A 2UXBT 5JR9C 4CI2B 3PUSA 3EUHA 2RPAA 3N9QA 4DMWA 1XMQT 5L3BB 4QXBB 4CI1B 1D1BA 5HEOA 5AQLB 2IC6A 4C90A 3AEBA 2KZ7B 5F8PA 2DI4A 1CHUA 3KBUA 4ASKA 2BS2A 2Q9QA 5L3FB 3TLVA 4DUZT 2XAHB 1Z8UA 4AXPA 1HFAA 2OA5A 1N32T 1MNDA 4ZEYA 3QUJA 4JI3T 4JLEA 4KP3C 2W61A 1YD8G 2BG9B 5HEHA 2V26A 3UUNA 2CWYA 3SFEA 4G63A 1UK5A 5FVLA 1VOMA 1HTJF 1MNEA 1J5ET 1XDOA 2BVMA 4ZS3A 3RYCE 4ILUA 4IGUA 3J7Yq 4ISTA 4U3CA 3U78A 4UVCB 1QLBA 3EABA 4TUYE 3RRWA 3Q2MA 4MALA 3A8YC 3CMLA 4V1Av 4YY3T 3MZKB 3RC8A 3I1AA 4G2AA 2VQFT 3ONLC 2CA5A 3ONJA 2JIWA 5JVDE 4AKGA 1X79A 4DV4T 3ZJ1A 4JI4T 2ZM2A 2BG9C 2Z6EA 5JDQA 5J2TE 4MBQA 2WQYA 1QUUA 2XY8B 5HEGA 2QA7A 2PJQA 2VKOA 4UR9A 4JBWF 3AEEA 4L5GA 2XASB 4JEHB 2YDQA 1KNRA 2LSYA 3AE5A 2LM9A 2WY2A 5HCJA 1D0XA 4EYUA 3SS1A 5AQQB 2LEHA 5ABFB 4ZZCA 4KI0F 3N9MA 3LK42 4UELA 3H3AA 2JRKA 1OXZA 3HKBE 2W66A 3P4SA 2KLQA 2KSRA 1US7B 3ZMUB 1T98A 3C50A 2YEVC 3N9PA 3UFEA 2NW7A 3MXZA 4DV6T 4OYJA 2HHHT 2L8KA 4WBOA 1HX8A 1QSDA 3P4PA 2E8IA 5FL0A 2W4XA 3O9XA 4LF5T 2UXXB 4PJNA 3KV9A 1WFDA 3EVYA 3LSVA 4OK0A 2M67A 3NZPA 4HTEA 5ADXL 5JRCA 1WYBA 4QX8B 1D0YA 4H9SE 4ZZBA 3C98B 3RIAA 4NUVA 2CXDA 2SPCA 5HXRA 5AQSB 1U4QA 3QB5K 4IL9A 1UGOA 1S94A 3KINB 1HS7A 2W00A 1VCSA 3KFWX 5IUXA 3P4QA 3GN5B 1SUMB 5HEJA 1HX1B 4HWCA 5LJMA 2QRXA 4EEBA 1XNRT 4YHJA 3EI0A 1LKXA 3PJAA 5HWXA 1I94T 2DHRA 4EAHA 5LHGB 1FMWA 2EHOC 4GIWA 3RX6A 4WZXA 3FZLB 2VWAA 5C2TA 2A3DA 5HEUA 4H63V 3N2OA 4A56A 2LSKA 2XM1A 5LCYA 1HG2A 4U33A 4TWHA 3VR9A 2K3WA 3L09A 4GYRA 3AEDA 1GQEA 5J2UE 2XQYA 4UEMA 5FYMA 4DUYT 2W2UA 1KF6A 3AVRA 3CPZA 3NRYA 1H7CA 2VL8A 2Y8DA 3QC9A 2BDEA 2CWOA 4DR2T 5EZYE 3DJBA 4JI2T 2CXLA 3BQKA 5E0OA 4JEUB 3OTOT 2M6BA 4KHZF 4PK4A 1X9BA 4U7YA 3LJCA 1XNQT 5JREA 3NWIA 2PG8A 2KNDA 3Q5WA 1BR4A 3MK7C 2V5DA 2Q9QC 2YDSA 3ZN1B 3AE9A 2Y6XA 2NOXA 3ANWA 2K48A 3ESLA 3EAMA 2V7IA 3AE6A 5AFUL 4HWDA 3QK6A 3SRZA 4O2BE 3RPUA 3AEGA 3Q5DA 4A98A 3WAJA 1O3XA 2DNXA 4P1NA 3N9LA 4WNKA 4M1PA 2YINA 1CUNA 5BR8T 3PUQA 3ZMZB 4U72A 3HKCE 3KV6A 3ZT6A 3B5MA 1MIYA 1BR1A 4ISSA 4IE6A 1XWMA 2I59A 3P7IA 2F4VT 4B3MT 3ZJ2A 3DP7A 1L0VA 4YT0A 1T8BA 4YSZA 2I6HA 2ACZA 5LXTE 4DR6T 2WAUA 4I50E 2N1GA 5FY7A 2VB6A 4QKNA 3IEEA 4X64T 2IAKA 5L3DB 2XQ9A 2BBHA 5AQHB 2P9BA 4AKHA 3RYHE 3FBLA 4DO0A 2C0SA 2LHRA 2JMKA 2LE8A 2J1DG 4LFAT 5AQVB 3C51A 2E9XC 2VQET 4ZOLE 4ADZA 2OLTA 4B3TT 3HKDE 2CHNA 3FXEB 4B3RT 4X1KE 4ZI3C 2W62A 2E5VA 3L3PA 1WR0A 1ZOYA 4E7SA 1T7SA 2X51A 4IT4A 2UUCT 4LMKA 4HFCA 5ETWA 5ABEA 1OWAA 3RGLA 2VL0A 3N5LA 3AE1A 2CBIA 2WU5A 3Q5EA 4XZCA 4YLHA 5JDLA 4YJ2E 2E2AA 3CX8B 4DR3T 4EGWA 5LGTB 1XMOT 2CBJA 3RHWA 5HXCA 1J5WA 2C5IT 3AXJA 4UVBB 1MIWA 2XSAA 4DV0T 3LG7A 4DV2T 1E1HB 4HN9A 2UUBT 3RIUC 1HG5A 5DQWA 4IIJE 4EOZB 4QXCB 2JMHA 3PUYF 4YTPA 1ZKEA 3MA9A 2IMLA 3AEAA 3CX7B 4YXDA 3J9X1 4K0UA 3P4WA 4ILBA 4DR5T 3NRXA 2LLYA 2BKOA 4JI8T 2AXDS 1W09A 2HPJA 2Y48B 4A5XA 5L4HA 5DJQC 1OEDB 3C64A 4DBRA 4YSYA 1MMGA 4O4IE 3TLTA 3A5XA 4TV8E 2LOPA 4I4TE 2FJAA 3UUMA 2H7VC 2ODVA 3JAFA 2WM9A 3SWHA 3D0TA 5LHHB 2BKNA 2V6YA 4YHHT 5LB7B 5C3JA 4DV1T 1LVKA 3VKGA 2KWIB 5EK3A 5LBMA 1VCTA 5LMUT 2WP9A 3FXDB 4TWDA 3RKGA 2ES0A 3NZQA 4OX9T 1MMAA 4AIUA 2IW5B 4ZS2A 4KBMB 4L0RA 1VRBA 3RC3A 1YKHB 3HR0A 4UV8B 2DWKA 2LM2A 3B13A 1Y01A 2UXNB 5KMGP 2M6IA 3HA4A 2CRBA 4Z8XA 1UURA 2XQAA 5LOVE 3ZPOA 4CN6A 1HNXT 5AQRB 5JQGE 1ZV4X 2J4GA 3VKHA 4TN7B 3LBXA 4H9OC 4UVAB 4GK5E 1OEDC 1DU2A 3MACA 2X0YA 5HCMA 3ZEFB 5IWAT 3JADA 4TZ4C 2IUBA 5EK2A 2VK9A 4DV5T 5CA1E 4KMCA 5AQIB 2VKDA 3H3MA 3AE4A 3C4XA 4U74A 3ZC1A 4HFVA 1D1CA 4ZHQE 1NEKA 4JYAT 3CKDA 5LA6E 3MJXA 4LF4T 4AQFC 3UTKA 3EDVA 4OYKA 4GKJT 1W0AA 2E5LT 3CVRA 3L8RA 3ZC0A 4NUUA 2QYWA 1W0BA 5LNKA 2C5KT 4WBNE 3OYZA 1S35A 3AE8A 3KVBA 5IHYA 2N2NA 3UU4A 3V5SA 1BR2A 5HWYA 2WBLA 4PFPA 4YTMA 5L3CB 3RH3A 2NR4A 2WB5A 2XTLA 4PFOA 4KHPT 3RI5A 4HKAA 3N9OA 5LBQB 4TWFA 5FXZA 2WDQA 4O4HE 2EHOB 2CM0A 1YXRA 5JR9A 1R8IA 4UV9B 2V7KA 2H88A 5FKYA 4NXMT 3P8CD 3BQLA 2XM2A 2PTFA 4JUYA 3VRAA 4H9PC 1KEYA 3CQXC 3ABVA 5CFBA 2XJ7A 2NTYA 4AKLA 5DABA 3I9WA 3KV5A 2X9YA 4DV3T 4EZHA 4UF0B 3AE2A 1I6ZA 4TV9E 3AA1B 4EXTA 4X62T 1UX5A 4DBQA 3CK6A 3G06A 4O4LE 1Y64B 2ZMAA 4CN4A 3V5UA 3FB2A 2A2FX 2FUPA 5LYJE 3R84B 5H6QB 3AA7B 2VKHA 1UX4A 4J2CA 2XQ5A 3PURA 1M7KA 1AJ3A 2Q9QB 4QH4A 1IBKT 3FZKB 1MIVA 2IC9A 4PJJA 5CB4E 4DR1T 3K3QC 4ERRA 2MOZA 4IE7A 5AQFB 3FZFB 5L3GB 3CQCB 2JQ9A 1WLXA 4P0AA 2WMOA 2PBIA 4ZI2C 5JDNA 2I0MA 5HXHA 2LHNA 4BJNA 3BQIA 4IDOA
chains in the Genus database with same CATH topology
4JI4T 1N32T 4NXNT 4LFAT 3OTOT 4B3ST 1HR0T 4JI1T 4DR5T 2UU9T 4NXMT 4LF6T 4JI8T 2VQET 4JI3T 4LF8T 4B3TT 1N36T 1XNQT 4B3RT 5IWAT 1FJGT 4JV5T 4DV5T 1N34T 4LFCT 5LMNT 2UXCT 2UUCT 4DV3T 4JI5T 3T1YT 4JYAT 3T1HT 1J5ET 1XNRT 4X62T 4X66T 4AQYT 4LF4T 1IBLT 1I94T 4GKJT 4JI7T 4YHHT 2E5LT 2ZM6T 4K0KT 5BR8T 4DV7T 4DV1T 4DR3T 1XMOT 1HNZT 5LMUT 4GKKT 4X65T 1HNWT 2UUAT 2UXBT 4OX9T 4DV6T 4LFBT 4DV0T 1IBKT 2HHHT 4DV2T 2F4VT 4B3MT 1N33T 1XMQT 2UUBT 4DR1T 4JI6T 2UXDT 1IBMT 4JI0T 4DR4T 4DR6T 4YY3T 4LF9T 4DUYT 2VQFT 4X64T 4LF5T 1HNXT 4KHPT 4DUZT 4DR2T 4LF7T 4JI2T 4DV4T 4DR7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 T;  1N32 T;  4NXN T;  4LFA T;  3OTO T;  4B3S T;  1HR0 T;  4JI1 T;  4DR5 T;  2UU9 T;  4NXM T;  4LF6 T;  4JI8 T;  2VQE T;  4JI3 T;  4LF8 T;  4B3T T;  1N36 T;  1XNQ T;  4B3R T;  5IWA T;  1FJG T;  4JV5 T;  4DV5 T;  1N34 T;  4LFC T;  5LMN T;  2UXC T;  2UUC T;  4DV3 T;  4JI5 T;  3T1Y T;  4JYA T;  3T1H T;  1J5E T;  1XNR T;  4X62 T;  4X66 T;  4AQY T;  4LF4 T;  1IBL T;  1I94 T;  4GKJ T;  4JI7 T;  4YHH T;  2E5L T;  2ZM6 T;  4K0K T;  5BR8 T;  4DV7 T;  4DV1 T;  4DR3 T;  1XMO T;  1HNZ T;  5LMU T;  4GKK T;  4X65 T;  1HNW T;  2UUA T;  2UXB T;  4OX9 T;  4DV6 T;  4LFB T;  4DV0 T;  1IBK T;  2HHH T;  4DV2 T;  2F4V T;  4B3M T;  1N33 T;  1XMQ T;  2UUB T;  4DR1 T;  4JI6 T;  2UXD T;  1IBM T;  4JI0 T;  4DR4 T;  4DR6 T;  4YY3 T;  4LF9 T;  4DUY T;  2VQF T;  4X64 T;  4LF5 T;  1HNX T;  4KHP T;  4DUZ T;  4DR2 T;  4LF7 T;  4JI2 T;  4DV4 T;  4DR7 T; 
#chains in the Genus database with same CATH topology
 4X1Y E;  3K3N A;  4NXN T;  4B3S T;  2MYS A;  5FY1 A;  4QHO A;  5LJN A;  2KXP B;  2HN1 A;  3AAA B;  1WCR A;  1W9R A;  2V8S V;  2MBG A;  3FBZ A;  2D0U A;  3O4X E;  2D0T A;  5FY0 A;  2ACX A;  2K9A A;  5DQV A;  2NP9 A;  4HFD A;  4HWI B;  2YKS A;  3RQU A;  4KUM B;  4DND A;  2BG9 A;  5L47 A;  3W15 B;  2EHO D;  3A7M A;  5JDM A;  1G73 A;  2E9X B;  4U31 A;  2L9Q A;  2N9D A;  3UU3 A;  4AI6 A;  2V7L A;  2RA1 A;  3AA0 B;  3LK3 B;  2BVL A;  3JC6 C;  3UQ7 A;  3JCF A;  2PFV A;  1HF8 A;  4OFZ A;  4NIQ A;  1WRD A;  5KX5 E;  3KV4 A;  3RLF F;  1YW0 A;  4IE5 A;  5JDG A;  3NVO A;  5FNV E;  3R6N A;  5M4Y A;  3ZN0 B;  4JI0 T;  3CIR A;  2K24 A;  3M65 A;  4HWF A;  5L4E A;  3ETU A;  5CJ5 A;  4BAY B;  4DVD A;  2XAG B;  2CXF A;  2XQ8 A;  3RIF A;  2XAJ B;  3UUB A;  2LJL A;  3IA3 A;  4JI1 T;  4PAG A;  2HH7 A;  5AQM B;  3AA6 B;  4IRE A;  4QXH B;  5HAX A;  3PDY A;  4CZZ B;  3OYX A;  4Q25 A;  3VR8 A;  2D9D A;  2BG9 E;  3SFD A;  4JV5 T;  2WWU A;  3E22 E;  3OPC A;  4LFC T;  2XSB A;  2XUE A;  2UXC T;  1NWM X;  5AQJ B;  3BK9 A;  5AQP B;  3OJA A;  3PUX F;  1WYC A;  2DWG A;  2J47 A;  1EZ3 A;  2ZM0 A;  3PTR B;  4QX7 B;  2WMN A;  3UU6 A;  4CXY A;  2VAS A;  1KNZ A;  4K0K T;  2WCA A;  1FIO A;  5AQT B;  4CN1 A;  5ABF A;  3KVA A;  4HFI A;  2BKP A;  2FBW A;  2QVA A;  1U5P A;  3ZMT B;  3RKO A;  5AQK B;  3GMI A;  5LGU B;  2FJB A;  5F3J A;  4O2A E;  4OHF A;  2CCQ A;  2WZI A;  5HYA A;  3I0O A;  2W67 A;  5JRC B;  3QOF A;  4LF9 T;  2V7M A;  4ILC A;  4CI3 B;  2HN2 A;  2EHO A;  2X0H A;  3RF1 A;  1FMV A;  2WDV A;  4A97 A;  2LKH A;  5JDF A;  3PUG A;  3GA8 A;  1J1J A;  2H89 A;  3AB3 B;  4ZI3 D;  2UU9 T;  2DLR A;  3NBX X;  2KIN B;  4QWN B;  2J62 A;  3AAI A;  3PJA J;  3ZT5 A;  5J0Z A;  2W63 A;  2C5J A;  4P0B A;  3HI2 A;  1IZN B;  2LRK A;  4WYV A;  3UFG A;  2OV9 A;  2LSJ A;  2X67 A;  2NW8 A;  4U7I A;  2D2S A;  2CHO A;  2KWH A;  4NPP A;  3AAE B;  2XAQ B;  1JNR A;  2IHR 1;  4QH5 A;  3L39 A;  1MMD A;  4HE8 A;  2XQ6 A;  3GN5 A;  4GKK T;  1HNW T;  2UUA T;  3IBP A;  1ZEE A;  2W0G A;  5J1G A;  3AVS A;  1LVF A;  3F31 A;  3EDU A;  2XQ7 A;  4IDP A;  2FJE A;  5FXW A;  1KFY A;  4EYY R;  2MTQ A;  4IE0 A;  3NKZ A;  4L9I A;  1XDP A;  5JDH A;  4E7Z A;  3N2K E;  4FI5 A;  4EV6 A;  2LRL A;  3ANW B;  4EED A;  2XPK A;  4YSX A;  3PE0 A;  2WSS V;  3PUA A;  4HFB A;  4I43 B;  4H9Q C;  4TNV A;  5LGN B;  5KDM C;  4LMJ A;  3K8P C;  2GK9 A;  3AE3 A;  4GOU A;  4U2Z A;  3ZKR A;  5FXV A;  3T1Y T;  1M62 A;  3UU8 A;  2CE7 A;  2L3L A;  5H6R B;  4DID B;  2JPF A;  3PU3 A;  4AIS A;  4PJL A;  2E9X A;  4HFH A;  2A72 A;  3FZH B;  5FL1 A;  1HCI A;  2YK0 A;  1JNZ A;  1LRZ A;  3TLS A;  2X66 A;  1E7P A;  2H3R A;  4QH1 A;  3UUL A;  3PU8 A;  5FVK A;  5HXS A;  1KK7 A;  2WZH A;  3ZCI A;  2BS3 A;  4PW8 A;  4H9R C;  4ANJ A;  2WU2 A;  4ZXL A;  3H37 A;  5BMV E;  2AE9 A;  2V5C A;  4DR4 T;  4Z91 A;  3CX6 B;  2XQ4 A;  2CLY B;  2K5B B;  3LFM A;  1IJ5 A;  1SA0 E;  3LK2 B;  4N78 D;  4PNI A;  2XZE A;  4HFE A;  4UIG A;  3PUZ F;  4PK5 A;  4DR7 T;  2XQ3 A;  4Z90 A;  3UU5 A;  4F8H A;  3Q5X A;  5EK4 A;  2YOE A;  4YJ3 E;  4AQG A;  4LF8 T;  2LT3 A;  3RIU A;  2JQQ A;  3X1D A;  3WI3 A;  2BZB A;  2LSI A;  3K1S A;  1N34 T;  4O8S A;  1WR6 A;  3RYI E;  2WDR A;  3ZYM A;  4H9N C;  4JI5 T;  2B1E A;  4GK0 E;  3HKE E;  2BBJ A;  3VRB A;  3AXJ B;  1BR0 A;  4B6X A;  2JQK A;  2G0U A;  4XBF B;  4KX6 A;  3B57 A;  1NAF A;  3ZSS A;  4X5T A;  2VKJ A;  3P50 A;  2ZM6 T;  3QNU A;  3TLW A;  4F6R C;  4U2Y A;  4AKI A;  5HXE A;  3ZT7 A;  2H7O A;  5AQG B;  3E08 A;  3OKQ A;  2CLY C;  4MLK A;  2VUR A;  4X1I E;  4IDN A;  2WWV A;  1YQ4 A;  2YU1 A;  2UXD T;  3KDS E;  4PJM A;  1FEW A;  1IBM T;  3AEF A;  2KT9 A;  2YN6 A;  5L2L A;  3TLU A;  2YU2 A;  3ZCJ A;  3AEC A;  4LF7 T;  2X9X A;  2IDO B;  3ZST A;  5C8Y E;  4GYS A;  3JAE A;  2DL1 A;  2CEA A;  4LF6 T;  3F2E A;  5JH7 E;  2CPT A;  2V7J A;  2LOS A;  4IL4 A;  3P4R A;  1Z0P A;  4EB6 E;  2KMF A;  4EIW A;  4LML A;  3HL6 A;  3UUX B;  2V6Y B;  2X9W A;  3ZLI A;  3OVU A;  5KXJ A;  3VU7 H;  5ABG A;  3ETV A;  4PK6 A;  3SOL A;  4AQY T;  5ABH A;  4I55 E;  3K3O A;  3OBV E;  1OED A;  2JJ9 A;  4JI7 T;  4ILA A;  3CQG B;  1UCU A;  2ODU A;  5CGM A;  1HNZ T;  4X65 T;  4HEA A;  1V9D A;  3ZMS B;  4MHC A;  1XZY A;  1N33 T;  4FJO A;  3VHL A;  3LBX B;  4JI6 T;  1G8X A;  2ZM8 A;  3ZYL A;  1D0Z A;  4ZI2 D;  3O1I A;  2ZLY A;  4AQF A;  5F5W A;  3QB5 A;  3S4U A;  3RYF E;  5FMN A;  3O1J A;  5LHI B;  4WW0 A;  3PV0 F;  1HR0 T;  1T72 A;  2V6X A;  1KNP A;  1IJ6 A;  1ZP0 A;  2MPK A;  1N36 T;  5FP3 A;  2V1D B;  2RP4 A;  3RRC A;  3TKL B;  3ZYK A;  3FZM B;  1OED E;  3M3Z B;  2VVN A;  2YDR A;  5LMN T;  1B7T A;  1YQ3 A;  4IE4 A;  4COF A;  4BA9 A;  5TAO A;  4EZ4 A;  4HGA A;  3KBT A;  3O1H A;  3I9Y A;  1E2A A;  2R6G F;  4CQI A;  1SHZ C;  2Q9Q D;  3I0Q A;  2LSG A;  4X66 T;  1IBL T;  3U3I A;  4CXW A;  5JTG A;  4IHJ E;  3MKD A;  3IHR A;  5AQO B;  3GWH A;  3JC6 D;  5AQU B;  3WAK A;  4DV7 T;  4DMV A;  4ZI7 E;  1UUS A;  4P09 A;  1YKE B;  2VVS A;  4IDZ A;  3UT5 E;  3UQ4 A;  5FXX A;  4LFB T;  3LDQ B;  4MFR A;  2X9H A;  4TNW A;  3F57 A;  4X20 E;  1SE7 A;  2D5U A;  5JR9 B;  1MMN A;  5AQN B;  2X0L B;  2MAW A;  1NEN A;  5GON E;  3DTO A;  2BS4 A;  5LP6 E;  3N9N A;  5LG4 A;  5L3E B;  4TX5 A;  4YFS A;  4C91 A;  3C4Z A;  2HPL A;  2NTX A;  3IF8 B;  2DCF A;  3C4W A;  5IYZ E;  3T8O A;  4H63 H;  4CXX A;  5CA0 E;  2XAF B;  2LKG A;  3E0Z A;  2IIU A;  3Q9D A;  4HWH A;  3N2G E;  3AE7 A;  4XAX B;  1FJG T;  1ZHC A;  4AKR B;  3PUW F;  2QGS A;  2JQH A;  2E9X D;  4UXN B;  1IAP A;  3ZMV B;  2B76 A;  4I0U A;  4IDQ A;  2CMR A;  2A9U A;  2X68 A;  1D1A A;  4YTN A;  3RQW A;  3T1H T;  2WS3 A;  3FHN A;  2NW9 A;  3CWZ B;  3EHZ A;  3PUV F;  4O4J E;  2FJD A;  4BJM A;  2XHE B;  2NWB A;  5A1L A;  3ONX A;  4UF0 A;  5LG3 A;  2UXB T;  5JR9 C;  4CI2 B;  3PUS A;  3EUH A;  2RPA A;  3N9Q A;  4DMW A;  1XMQ T;  5L3B B;  4QXB B;  4CI1 B;  1D1B A;  5HEO A;  5AQL B;  2IC6 A;  4C90 A;  3AEB A;  2KZ7 B;  5F8P A;  2DI4 A;  1CHU A;  3KBU A;  4ASK A;  2BS2 A;  2Q9Q A;  5L3F B;  3TLV A;  4DUZ T;  2XAH B;  1Z8U A;  4AXP A;  1HFA A;  2OA5 A;  1N32 T;  1MND A;  4ZEY A;  3QUJ A;  4JI3 T;  4JLE A;  4KP3 C;  2W61 A;  1YD8 G;  2BG9 B;  5HEH A;  2V26 A;  3UUN A;  2CWY A;  3SFE A;  4G63 A;  1UK5 A;  5FVL A;  1VOM A;  1HTJ F;  1MNE A;  1J5E T;  1XDO A;  2BVM A;  4ZS3 A;  3RYC E;  4ILU A;  4IGU A;  3J7Y q;  4IST A;  4U3C A;  3U78 A;  4UVC B;  1QLB A;  3EAB A;  4TUY E;  3RRW A;  3Q2M A;  4MAL A;  3A8Y C;  3CML A;  4V1A v;  4YY3 T;  3MZK B;  3RC8 A;  3I1A A;  4G2A A;  2VQF T;  3ONL C;  2CA5 A;  3ONJ A;  2JIW A;  5JVD E;  4AKG A;  1X79 A;  4DV4 T;  3ZJ1 A;  4JI4 T;  2ZM2 A;  2BG9 C;  2Z6E A;  5JDQ A;  5J2T E;  4MBQ A;  2WQY A;  1QUU A;  2XY8 B;  5HEG A;  2QA7 A;  2PJQ A;  2VKO A;  4UR9 A;  4JBW F;  3AEE A;  4L5G A;  2XAS B;  4JEH B;  2YDQ A;  1KNR A;  2LSY A;  3AE5 A;  2LM9 A;  2WY2 A;  5HCJ A;  1D0X A;  4EYU A;  3SS1 A;  5AQQ B;  2LEH A;  5ABF B;  4ZZC A;  4KI0 F;  3N9M A;  3LK4 2;  4UEL A;  3H3A A;  2JRK A;  1OXZ A;  3HKB E;  2W66 A;  3P4S A;  2KLQ A;  2KSR A;  1US7 B;  3ZMU B;  1T98 A;  3C50 A;  2YEV C;  3N9P A;  3UFE A;  2NW7 A;  3MXZ A;  4DV6 T;  4OYJ A;  2HHH T;  2L8K A;  4WBO A;  1HX8 A;  1QSD A;  3P4P A;  2E8I A;  5FL0 A;  2W4X A;  3O9X A;  4LF5 T;  2UXX B;  4PJN A;  3KV9 A;  1WFD A;  3EVY A;  3LSV A;  4OK0 A;  2M67 A;  3NZP A;  4HTE A;  5ADX L;  5JRC A;  1WYB A;  4QX8 B;  1D0Y A;  4H9S E;  4ZZB A;  3C98 B;  3RIA A;  4NUV A;  2CXD A;  2SPC A;  5HXR A;  5AQS B;  1U4Q A;  3QB5 K;  4IL9 A;  1UGO A;  1S94 A;  3KIN B;  1HS7 A;  2W00 A;  1VCS A;  3KFW X;  5IUX A;  3P4Q A;  3GN5 B;  1SUM B;  5HEJ A;  1HX1 B;  4HWC A;  5LJM A;  2QRX A;  4EEB A;  1XNR T;  4YHJ A;  3EI0 A;  1LKX A;  3PJA A;  5HWX A;  1I94 T;  2DHR A;  4EAH A;  5LHG B;  1FMW A;  2EHO C;  4GIW A;  3RX6 A;  4WZX A;  3FZL B;  2VWA A;  5C2T A;  2A3D A;  5HEU A;  4H63 V;  3N2O A;  4A56 A;  2LSK A;  2XM1 A;  5LCY A;  1HG2 A;  4U33 A;  4TWH A;  3VR9 A;  2K3W A;  3L09 A;  4GYR A;  3AED A;  1GQE A;  5J2U E;  2XQY A;  4UEM A;  5FYM A;  4DUY T;  2W2U A;  1KF6 A;  3AVR A;  3CPZ A;  3NRY A;  1H7C A;  2VL8 A;  2Y8D A;  3QC9 A;  2BDE A;  2CWO A;  4DR2 T;  5EZY E;  3DJB A;  4JI2 T;  2CXL A;  3BQK A;  5E0O A;  4JEU B;  3OTO T;  2M6B A;  4KHZ F;  4PK4 A;  1X9B A;  4U7Y A;  3LJC A;  1XNQ T;  5JRE A;  3NWI A;  2PG8 A;  2KND A;  3Q5W A;  1BR4 A;  3MK7 C;  2V5D A;  2Q9Q C;  2YDS A;  3ZN1 B;  3AE9 A;  2Y6X A;  2NOX A;  3ANW A;  2K48 A;  3ESL A;  3EAM A;  2V7I A;  3AE6 A;  5AFU L;  4HWD A;  3QK6 A;  3SRZ A;  4O2B E;  3RPU A;  3AEG A;  3Q5D A;  4A98 A;  3WAJ A;  1O3X A;  2DNX A;  4P1N A;  3N9L A;  4WNK A;  4M1P A;  2YIN A;  1CUN A;  5BR8 T;  3PUQ A;  3ZMZ B;  4U72 A;  3HKC E;  3KV6 A;  3ZT6 A;  3B5M A;  1MIY A;  1BR1 A;  4ISS A;  4IE6 A;  1XWM A;  2I59 A;  3P7I A;  2F4V T;  4B3M T;  3ZJ2 A;  3DP7 A;  1L0V A;  4YT0 A;  1T8B A;  4YSZ A;  2I6H A;  2ACZ A;  5LXT E;  4DR6 T;  2WAU A;  4I50 E;  2N1G A;  5FY7 A;  2VB6 A;  4QKN A;  3IEE A;  4X64 T;  2IAK A;  5L3D B;  2XQ9 A;  2BBH A;  5AQH B;  2P9B A;  4AKH A;  3RYH E;  3FBL A;  4DO0 A;  2C0S A;  2LHR A;  2JMK A;  2LE8 A;  2J1D G;  4LFA T;  5AQV B;  3C51 A;  2E9X C;  2VQE T;  4ZOL E;  4ADZ A;  2OLT A;  4B3T T;  3HKD E;  2CHN A;  3FXE B;  4B3R T;  4X1K E;  4ZI3 C;  2W62 A;  2E5V A;  3L3P A;  1WR0 A;  1ZOY A;  4E7S A;  1T7S A;  2X51 A;  4IT4 A;  2UUC T;  4LMK A;  4HFC A;  5ETW A;  5ABE A;  1OWA A;  3RGL A;  2VL0 A;  3N5L A;  3AE1 A;  2CBI A;  2WU5 A;  3Q5E A;  4XZC A;  4YLH A;  5JDL A;  4YJ2 E;  2E2A A;  3CX8 B;  4DR3 T;  4EGW A;  5LGT B;  1XMO T;  2CBJ A;  3RHW A;  5HXC A;  1J5W A;  2C5I T;  3AXJ A;  4UVB B;  1MIW A;  2XSA A;  4DV0 T;  3LG7 A;  4DV2 T;  1E1H B;  4HN9 A;  2UUB T;  3RIU C;  1HG5 A;  5DQW A;  4IIJ E;  4EOZ B;  4QXC B;  2JMH A;  3PUY F;  4YTP A;  1ZKE A;  3MA9 A;  2IML A;  3AEA A;  3CX7 B;  4YXD A;  3J9X 1;  4K0U A;  3P4W A;  4ILB A;  4DR5 T;  3NRX A;  2LLY A;  2BKO A;  4JI8 T;  2AXD S;  1W09 A;  2HPJ A;  2Y48 B;  4A5X A;  5L4H A;  5DJQ C;  1OED B;  3C64 A;  4DBR A;  4YSY A;  1MMG A;  4O4I E;  3TLT A;  3A5X A;  4TV8 E;  2LOP A;  4I4T E;  2FJA A;  3UUM A;  2H7V C;  2ODV A;  3JAF A;  2WM9 A;  3SWH A;  3D0T A;  5LHH B;  2BKN A;  2V6Y A;  4YHH T;  5LB7 B;  5C3J A;  4DV1 T;  1LVK A;  3VKG A;  2KWI B;  5EK3 A;  5LBM A;  1VCT A;  5LMU T;  2WP9 A;  3FXD B;  4TWD A;  3RKG A;  2ES0 A;  3NZQ A;  4OX9 T;  1MMA A;  4AIU A;  2IW5 B;  4ZS2 A;  4KBM B;  4L0R A;  1VRB A;  3RC3 A;  1YKH B;  3HR0 A;  4UV8 B;  2DWK A;  2LM2 A;  3B13 A;  1Y01 A;  2UXN B;  5KMG P;  2M6I A;  3HA4 A;  2CRB A;  4Z8X A;  1UUR A;  2XQA A;  5LOV E;  3ZPO A;  4CN6 A;  1HNX T;  5AQR B;  5JQG E;  1ZV4 X;  2J4G A;  3VKH A;  4TN7 B;  3LBX A;  4H9O C;  4UVA B;  4GK5 E;  1OED C;  1DU2 A;  3MAC A;  2X0Y A;  5HCM A;  3ZEF B;  5IWA T;  3JAD A;  4TZ4 C;  2IUB A;  5EK2 A;  2VK9 A;  4DV5 T;  5CA1 E;  4KMC A;  5AQI B;  2VKD A;  3H3M A;  3AE4 A;  3C4X A;  4U74 A;  3ZC1 A;  4HFV A;  1D1C A;  4ZHQ E;  1NEK A;  4JYA T;  3CKD A;  5LA6 E;  3MJX A;  4LF4 T;  4AQF C;  3UTK A;  3EDV A;  4OYK A;  4GKJ T;  1W0A A;  2E5L T;  3CVR A;  3L8R A;  3ZC0 A;  4NUU A;  2QYW A;  1W0B A;  5LNK A;  2C5K T;  4WBN E;  3OYZ A;  1S35 A;  3AE8 A;  3KVB A;  5IHY A;  2N2N A;  3UU4 A;  3V5S A;  1BR2 A;  5HWY A;  2WBL A;  4PFP A;  4YTM A;  5L3C B;  3RH3 A;  2NR4 A;  2WB5 A;  2XTL A;  4PFO A;  4KHP T;  3RI5 A;  4HKA A;  3N9O A;  5LBQ B;  4TWF A;  5FXZ A;  2WDQ A;  4O4H E;  2EHO B;  2CM0 A;  1YXR A;  5JR9 A;  1R8I A;  4UV9 B;  2V7K A;  2H88 A;  5FKY A;  4NXM T;  3P8C D;  3BQL A;  2XM2 A;  2PTF A;  4JUY A;  3VRA A;  4H9P C;  1KEY A;  3CQX C;  3ABV A;  5CFB A;  2XJ7 A;  2NTY A;  4AKL A;  5DAB A;  3I9W A;  3KV5 A;  2X9Y A;  4DV3 T;  4EZH A;  4UF0 B;  3AE2 A;  1I6Z A;  4TV9 E;  3AA1 B;  4EXT A;  4X62 T;  1UX5 A;  4DBQ A;  3CK6 A;  3G06 A;  4O4L E;  1Y64 B;  2ZMA A;  4CN4 A;  3V5U A;  3FB2 A;  2A2F X;  2FUP A;  5LYJ E;  3R84 B;  5H6Q B;  3AA7 B;  2VKH A;  1UX4 A;  4J2C A;  2XQ5 A;  3PUR A;  1M7K A;  1AJ3 A;  2Q9Q B;  4QH4 A;  1IBK T;  3FZK B;  1MIV A;  2IC9 A;  4PJJ A;  5CB4 E;  4DR1 T;  3K3Q C;  4ERR A;  2MOZ A;  4IE7 A;  5AQF B;  3FZF B;  5L3G B;  3CQC B;  2JQ9 A;  1WLX A;  4P0A A;  2WMO A;  2PBI A;  4ZI2 C;  5JDN A;  2I0M A;  5HXH A;  2LHN A;  4BJN A;  3BQI A;  4IDO A; 
#chains in the Genus database with same CATH homology
 4JI4 T;  1N32 T;  4NXN T;  4LFA T;  3OTO T;  4B3S T;  1HR0 T;  4JI1 T;  4DR5 T;  2UU9 T;  4NXM T;  4LF6 T;  4JI8 T;  2VQE T;  4JI3 T;  4LF8 T;  4B3T T;  1N36 T;  1XNQ T;  4B3R T;  5IWA T;  1FJG T;  4JV5 T;  4DV5 T;  1N34 T;  4LFC T;  5LMN T;  2UXC T;  2UUC T;  4DV3 T;  4JI5 T;  3T1Y T;  4JYA T;  3T1H T;  1J5E T;  1XNR T;  4X62 T;  4X66 T;  4AQY T;  4LF4 T;  1IBL T;  1I94 T;  4GKJ T;  4JI7 T;  4YHH T;  2E5L T;  2ZM6 T;  4K0K T;  5BR8 T;  4DV7 T;  4DV1 T;  4DR3 T;  1XMO T;  1HNZ T;  5LMU T;  4GKK T;  4X65 T;  1HNW T;  2UUA T;  2UXB T;  4OX9 T;  4DV6 T;  4LFB T;  4DV0 T;  1IBK T;  2HHH T;  4DV2 T;  2F4V T;  4B3M T;  1N33 T;  1XMQ T;  2UUB T;  4DR1 T;  4JI6 T;  2UXD T;  1IBM T;  4JI0 T;  4DR4 T;  4DR6 T;  4YY3 T;  4LF9 T;  4DUY T;  2VQF T;  4X64 T;  4LF5 T;  1HNX T;  4KHP T;  4DUZ T;  4DR2 T;  4LF7 T;  4JI2 T;  4DV4 T;  4DR7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...