1N34T

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n34T00
4LF7T 4JI1T 4B3TT 1N33T 3T1YT 2UUBT 2UU9T 2VQFT 4GKKT 4AQYT 4JI0T 1HNXT 1N32T 1N36T 2UUAT 4JI4T 5LMUT 4X62T 4JI6T 2UXBT 4B3MT 2ZM6T 4YY3T 4LFBT 1HNWT 1XMOT 4DV3T 3T1HT 4NXNT 4DR1T 1IBMT 4DR6T 2F4VT 4DV7T 1FJGT 4LF4T 4LF6T 4GKJT 4LF8T 3OTOT 4JV5T 4DV0T 1HNZT 1N34T 4DR3T 4X65T 4KHPT 4JI7T 4JYAT 1HR0T 5LMNT 4K0KT 4JI2T 4JI3T 4X64T 1I94T 4DV5T 4DV2T 4DR5T 1J5ET 4DV6T 1XNRT 4DR4T 4LFAT 2VQET 4JI8T 4B3ST 4DUYT 2HHHT 4DUZT 4LFCT 4X66T 1IBKT 2E5LT 4B3RT 4DV1T 4JI5T 5IWAT 1IBLT 2UXCT 4YHHT 2UXDT 5BR8T 2UUCT 4DR7T 4NXMT 1XMQT 4DV4T 4LF9T 4DR2T 4LF5T 4OX9T 1XNQT
chains in the Genus database with same CATH superfamily
1U4QA 3E08A 3KV4A 5CJ5A 3PUAA 2E9XA 5JTGA 4JI1T 1UCUA 3MACA 1WLXA 4PK5A 3UUXB 3WAJA 4DMVA 5JDLA 5AQQB 3B5MA 2XAFB 3GA8A 2IMLA 2V26A 2LRKA 5AQKB 3SS1A 5AQTB 2UUBT 3N2KE 4A56A 4ILUA 1EZ3A 5FNVE 3ZC1A 3HKEE 5AQUB 1B7TA 2XZEA 5AQLB 2NW8A 3KFWX 2E9XB 4CN4A 4DBQA 4HEAA 5LCYA 1HNXT 4JI0T 1N32T 1HS7A 2WDQA 2XQ7A 4GK0E 4I55E 4YJ3E 5FXZA 4A97A 4DNDA 5LMUT 5FVKA 3O1IA 3KBTA 2C5IT 4JI6T 2DHRA 1W0BA 2CE7A 4I43B 4UIGA 2AXDS 2J62A 4HFVA 4EZ4A 2QVAA 4H9NC 3P4PA 3TLSA 2VURA 3E22E 3SOLA 5ABFA 2CCQA 3ZKRA 2WWUA 2ZMAA 1IAPA 4L5GA 5AFUL 4DV3T 3T1HT 2H7OA 1YQ3A 2BG9A 2JRKA 5L3FB 1BR4A 2BS4A 2W0GA 3RH3A 5ABEA 4BA9A 3LBXB 5E0OA 3RIFA 2XSBA 2SPCA 3M65A 3PU3A 4YHJA 4ILBA 4HKAA 4TN7B 4CXYA 2F4VT 4GOUA 1FJGT 4C90A 2V7LA 3AAIA 3IA3A 4ISSA 4LF8T 2IAKA 4AIUA 4HFHA 4AKIA 2MBGA 3ZSSA 4LFCT 5F8PA 4HE8A 3HKCE 3N5LA 1MMAA 2W67A 2FUPA 1OEDB 2C0SA 2LLYA 2XUEA 3C4XA 1JNRA 3ESLA 5HXSA 2BS3A 1R8IA 4HFEA 5HXRA 2BKPA 2W62A 2V7KA 1CUNA 3E0ZA 2FJBA 2WZIA 3EHZA 1Z0PA 2ODUA 1IJ6A 2LEHA 3HI2A 2V7IA 3P4SA 1HG2A 3ZN1B 3FBLA 3B13A 3D0TA 5FXVA 5LB7B 1SA0E 1WRDA 3CIRA 2I59A 2IC6A 4NUVA 2YK0A 3Q9DA 3OJAA 4MHCA 3IF8B 4IDNA 4GYSA 3OBVE 5C2TA 3FZLB 2X51A 4ZOLE 2QGSA 4JI7T 4OYKA 4XAXB 1YKEB 1Z8UA 5EZYE 4JYAT 5LGTB 4CXWA 1HR0T 1G8XA 1T8BA 5LMNT 5BMVE 3CX7B 4IDPA 2YDSA 4TWFA 2PBIA 3OKQA 2V8SV 4HFBA 4L9IA 1J5ET 2Y6XA 3CKDA 4DIDB 3P50A 3N2OA 3JADA 4ZS3A 4ZZBA 1XNRT 5LBMA 3RI5A 3RIUA 1OEDA 3VHLA 3UUMA 4DBRA 4AKHA 3OYXA 4AKRB 2ODVA 3RRCA 5A1LA 5LHIB 2C5KT 3CWZB 3RHWA 3N9LA 3RGLA 3HKDE 4O4HE 5FY7A 4P1NA 2NR4A 2PJQA 5C8YE 4E7SA 4U72A 2BG9C 2E5LT 2ACXA 4U31A 4X5TA 3UU6A 1S94A 1E7PA 4IGUA 4ZXLA 4DV1T 5IWAT 4IDQA 2D0TA 4PFPA 4PK4A 1W9RA 3WAKA 2LSYA 2X9HA 2XHEB 2LT3A 3AAEB 2FJEA 5DJQC 4ERRA 3AVSA 4AXPA 3L3PA 4YJ2E 5ABFB 1NWMX 5BR8T 3KVBA 3N9OA 4NXMT 1QUUA 3AE1A 4BJMA 2HH7A 3SFDA 4LF9T 3SRZA 2IDOB 2XQ4A 2YOEA 4DR2T 4PJMA 5AQNB 3CPZA 3VR9A 4LF7T 1J1JA 1XDPA 4UELA 4IE4A 4B3TT 4QKNA 4QXCB 4V1Av 5AQVB 1T98A 1BR1A 1XDOA 4JUYA 4X20E 3WI3A 2E2AA 3AE8A 2XQ3A 4U2ZA 4UVCB 1KFYA 3T1YT 3AE3A 4HWCA 4TNVA 1HTJF 2H7VC 3N2GE 5HEGA 3ZMTB 2R6GF 1VCSA 4EXTA 1AJ3A 4KHZF 2WWVA 5CA0E 2CXFA 5M4YA 2V7JA 3N9NA 2NW7A 3Q5DA 4BJNA 5FL1A 4GKKT 3G06A 3LJCA 2KZ7B 4YTNA 5GONE 3J7Yq 2LOSA 5F5WA 5HWYA 1M7KA 3KV9A 2WU2A 2QYWA 2UUAT 4JI4T 2V1DB 4WW0A 5FXXA 3AB3B 4CN6A 4X62T 4IT4A 5HXEA 3CVRA 3ZN0B 4B3MT 2CHOA 4NIQA 3C4WA 1US7B 3ETUA 3JAEA 4WBOA 3DTOA 4PJLA 2WQYA 3ZT6A 2VL0A 1ZEEA 5CFBA 3Q2MA 4MFRA 1XMOT 4WZXA 2EHOA 2VKHA 2X66A 3ANWB 3ZT7A 4DR1T 4O2BE 3QUJA 2IUBA 2YDRA 4TWDA 3DJBA 1WFDA 2IHR1 2XY8B 3BK9A 3C64A 4FI5A 3NRYA 4O4IE 4QX7B 5J2TE 1VRBA 2BBJA 1UX5A 2I6HA 1KNZA 2L3LA 3ABVA 1WYBA 3BQKA 5DABA 5ABHA 3M3ZB 1YW0A 2BG9B 2J4GA 3PDYA 1FMVA 4O4LE 4PAGA 5L3BB 2W66A 3K3OA 4OYJA 3FB2A 4UF0A 2DI4A 4QHOA 5FVLA 2MPKA 2B76A 2DLRA 3MK7C 4IL4A 4ILCA 4U7YA 4YT0A 3IEEA 4NPPA 1X9BA 4UV8B 1OEDC 5IHYA 2LM9A 5JDFA 2CLYB 3BQLA 2WS3A 2CWYA 2UXNB 4ILAA 5L4HA 3ZJ2A 5JR9B 3AEGA 5AQHB 5CB4E 2UXXB 2MTQA 1KEYA 3AE6A 3GWHA 5CGMA 4PJJA 3FXEB 1LKXA 1V9DA 1FEWA 5LGNB 1D1BA 2LOPA 3QB5A 2KT9A 2IIUA 3L09A 3S4UA 2BKNA 4X1IE 4IIJE 4AQFC 5LXTE 2QA7A 4CI3B 4C91A 1MNEA 5L3CB 4G2AA 1WR0A 3OYZA 4QH5A 4DMWA 2FBWA 2VK9A 1YD8G 4ZS2A 5JDQA 4K0KT 2Y48B 4H63V 5HCMA 2NTYA 2NW9A 4JI2T 3UT5E 1I94T 4YLHA 2KWIB 3RYCE 3KV6A 3HKBE 2WMNA 4DV2T 4TZ4C 3U78A 3I9WA 2PTFA 3RYHE 2JPFA 2BBHA 4IE7A 2I0MA 4DV6T 5KMGP 1YKHB 3MA9A 2BG9E 2X9WA 3RQUA 2LSJA 2VB6A 3UFEA 1T72A 2VASA 3EABA 2RP4A 3PJAA 5AQJB 1FIOA 3PV0F 3SWHA 3TKLB 4OFZA 4CQIA 2CRBA 4H9RC 4EIWA 3RF1A 3UULA 2HHHT 4EOZB 4DUZT 1IZNB 3I0QA 2WM9A 3GN5A 3AE9A 3LK2B 3O1HA 4HTEA 3C51A 1E2AA 3UU5A 3HL6A 2X68A 3QOFA 3RIAA 4PK6A 4Z90A 1WR6A 3Q5EA 4EEDA 2PG8A 2X0HA 2X0YA 4DO0A 5L3DB 4HFDA 1SE7A 3EDVA 4HFIA 5J2UE 2MOZA 1HG5A 2CXDA 2UXCT 4K0UA 5AQIB 2OLTA 2WU5A 3UUBA 1KF6A 2HPLA 2OA5A 5DQWA 2Q9QB 5LNKA 2WDRA 2G0UA 4OHFA 2X9XA 2JJ9A 2JQKA 3RKGA 3K3QC 3QNUA 4DV4T 5JRCB 4ZEYA 2XAQB 4A98A 1X79A 3AA7B 4LF5T 2LKGA 3PUZF 3RC3A 4F8HA 2X9YA 2JQ9A 4QH1A 2LM2A 3C50A 3RQWA 4HWFA 5J0ZA 4M1PA 1HF8A 2L8KA 2V6YB 2XTLA 2WDVA 2WBLA 2X0LB 3ZMUB 5CA1E 4PFOA 2BZBA 2LRLA 3OVUA 3AEBA 1W0AA 4L0RA 4WYVA 2M6IA 4EGWA 4AKGA 5IYZE 5JRCA 2Q9QD 2C5JA 2D2SA 5L3EB 5EK3A 4CN1A 4KUMB 2V7MA 5LP6E 2H3RA 1DU2A 4Q25A 2P9BA 3L8RA 5EK2A 5JQGE 3ZJ1A 2WSSV 3QC9A 3FZMB 5HEUA 2W4XA 4ZHQE 5JDMA 3EAMA 2FJAA 4H9QC 3ZMSB 3ONLC 3NVOA 2CBIA 2JMKA 3O9XA 4IREA 3P4RA 3KINB 4EV6A 4IE5A 2WCAA 4U74A 3F31A 2ACZA 3NWIA 5FY1A 2W61A 2Q9QC 4ZI2D 2AE9A 5F3JA 3A7MA 3MZKB 2CM0A 2K5BB 3LK3B 2HN2A 4GIWA 3U3IA 2UXBT 3C98B 1BR0A 4N78D 3RYFE 4JBWF 2ZM6T 4ZI3C 3T8OA 4YY3T 2B1EA 3TLVA 2CEAA 2WZHA 3H3MA 2W63A 3FXDB 4LFBT 3RPUA 2JQQA 1G73A 3VRBA 1HNWT 1OEDE 2LSIA 4ZI2C 2E5VA 3PE0A 2H89A 3ZSTA 4WBNE 2LHNA 5AQOB 3GMIA 4XZCA 5LGUB 2H88A 3C4ZA 1IBMT 4X1KE 1VCTA 5JREA 2DNXA 1MNDA 5FY0A 1UK5A 3GN5B 3IHRA 3O4XE 2OV9A 4IE0A 3QK6A 5AQSB 3FZHB 4QXHB 5FYMA 3PUSA 3A8YC 4CI1B 3A5XA 5AQPB 4LF4T 4LF6T 3AA6B 4GKJT 4Z8XA 2HPJA 3JC6C 3RIUC 3ZLIA 4ZZCA 3AXJA 3NKZA 5HAXA 2WP9A 3OTOT 5LOVE 1LVFA 4H9PC 5JVDE 4JV5T 2EHOD 3ETVA 4JEHB 4COFA 1IJ5A 1N34T 4LMJA 2XJ7A 1O3XA 5LHHB 4UVBB 2NTXA 4PW8A 3NZQA 1HFAA 5KDMC 2XQ5A 3ZPOA 4KMCA 3QB5K 1MIWA 3EI0A 4UXNB 5H6RB 5FP3A 3N9QA 4U2YA 3RKOA 1E1HB 3UQ4A 3ZYLA 2Y8DA 3N9MA 2ZLYA 4QX8B 3TLUA 4DR3T 3CQXC 2XQ8A 4XBFB 2EHOC 2LJLA 1YXRA 3LSVA 1XZYA 5FL0A 4Z91A 1D1CA 2LE8A 2K3WA 3LFMA 5KX5E 5LG4A 3UQ7A 1KK7A 2D9DA 2NWBA 3CQGB 4H63H 3EUHA 4E7ZA 1ZV4X 3I0OA 2VWAA 2XQAA 1MIVA 2ZM8A 4YSYA 4DV5T 4DR5T 4FJOA 3PU8A 4HN9A 3AA1B 3RRWA 5AQRB 1ZHCA 2LKHA 3O1JA 5DQVA 4YTPA 2DL1A 2KLQA 5HEJA 1LVKA 2N2NA 2RA1A 1UURA 1D0XA 3PUGA 3AEDA 3AXJB 4IDZA 4MBQA 3NRXA 4NUUA 4YFSA 2KMFA 2XQ9A 5FXWA 4B3ST 4JI8T 5LHGB 4G63A 3CQCB 2DWGA 2VL8A 2XQ6A 3W15B 3ZYKA 5HXHA 3NBXX 3H3AA 3PUQA 2CLYC 1KNRA 4UV9B 4O2AE 4YTMA 4EEBA 5IUXA 3HA4A 4TV8E 1IBKT 2YINA 3EDUA 1U5PA 2JQHA 4EAHA 3ZEFB 1NENA 2CPTA 4JI5T 5KXJA 3RC8A 3N9PA 3VKHA 4B6XA 2BVMA 2XASB 2YU1A 4YHHT 3AEEA 2VVNA 1KNPA 2A72A 3P4WA 2QRXA 3PUWF 4QH4A 3LBXA 4QXBB 1D0YA 3PURA 4U7IA 5JDNA 5L47A 1XMQT 1JNZA 3UU8A 2JMHA 3ONJA 2NP9A 3LDQB 3CMLA 3ZCJA 3ZMZB 4YSXA 5FMNA 5ABGA 2BVLA 2V5DA 2J1DG 4H9SE 3UU3A 1W09A 1NEKA 3AE7A 5ADXL 3F2EA 4ISTA 4P0BA 1XNQT 5HWXA 2V5CA 2XM2A 4TX5A 3PUVF 4BAYB 3BQIA 4HWIB 1S35A 5LJMA 4ANJA 3KBUA 1N33T 4EYYR 2CXLA 2YEVC 2XM1A 1CHUA 5AQGB 4U3CA 2KNDA 4YSZA 2UU9T 2PFVA 4IHJE 2VQET 3R84B 2JIWA 2VQFT 3P4QA 5HEOA 4TV9E 3VKGA 3H37A 1MMDA 4AQYT 1MIYA 5AQFB 1QSDA 2CHNA 1N36T 3JAFA 1HX8A 3AEAA 5LBQB 2XQYA 3PUXF 3F57A 4HFCA 4UEMA 2YN6A 3Q5XA 2W2UA 3JCFA 4I50E 2WY2A 2YU2A 4OX9T 2BDEA 3ONXA 4EZHA 1MMNA 2N1GA 2D0UA 4TNWA 1J5WA 1MMGA 3VU7H 2J47A 2XAHB 4I4TE 4UVAB 2EHOB 3ANWA 4MALA 2IW5B 1SUMB 2E8IA 3B57A 5C3JA 2Q9QA 3OPCA 3AAAB 3PTRB 4OK0A 1VOMA 5EK4A 3J9X1 4F6RC 3Q5WA 3EVYA 1SHZC 2FJDA 2KSRA 4I0UA 3CX8B 2L9QA 4JLEA 4NXNT 1UGOA 4KX6A 3UFGA 3ZYMA 3FZKB 2KWHA 5ETWA 5HYAA 2V6XA 2K9AA 2VVSA 2X67A 4J2CA 3VR8A 4HWHA 3UTKA 3VRAA 4DR6T 2E9XD 2KINB 2RPAA 4AKLA 4EB6E 4UF0B 4DV7T 2KXPB 3HR0A 3CX6B 1LRZA 2BKOA 4UR9A 3V5SA 4AISA 3P8CD 3ZCIA 2XSAA 1ZKEA 1OWAA 2DWKA 3X1DA 3P7IA 4A5XA 5JR9C 5HXCA 4O8SA 2IC9A 4TWHA 2A3DA 2A2FX 2BS2A 2CWOA 4DV0T 2XAJB 4HGAA 4PNIA 3DP7A 1HNZT 3KVAA 4P09A 4GYRA 2XAGB 4ZI7E 2VKJA 2M6BA 3TLTA 3AE4A 4WNKA 4CI2B 1Y01A 2N9DA 4P0AA 4U33A 2WAUA 3I1AA 1I6ZA 1ZOYA 1HX1B 2NOXA 3IBPA 3TLWA 3PUYF 4AQFA 4ASKA 1FMWA 3R6NA 4KBMB 3AE2A 3K3NA 5LA6E 1UX4A 2A9UA 1D1AA 5J1GA 4X65T 4AI6A 4EYUA 3K8PC 5HCJA 3AA0B 5AQMB 5JH7E 4KHPT 1H7CA 4QWNB 2CBJA 3CK6A 5L4EA 2Z6EA 4HWDA 4IDOA 4GK5E 2ZM0A 4MLKA 2WB5A 4X1YE 3KV5A 3ZMVB 3UU4A 2XPKA 3AEFA 3FHNA 5L3GB 4X64T 4JI3T 1T7SA 2GK9A 2LHRA 5JR9A 1GQEA 2V6YA 3MJXA 4JEUB 3PJAJ 1WCRA 1HCIA 4IL9A 4DR4T 4KP3C 5LYJE 3NZPA 3FZFB 4LFAT 4O4JE 4CXXA 4ZI3D 3AVRA 3FBZA 3LG7A 3ZC0A 3ZT5A 2MAWA 2ZM2A 5H6QB 1NAFA 1QLBA 2WMOA 3V5UA 4DUYT 1M62A 2HN1A 2CMRA 1BR2A 2LSGA 3AECA 3MKDA 4LMLA 4LMKA 4H9OC 2DCFA 5FKYA 1YQ4A 3AE5A 2VKOA 3LK42 1D0ZA 2VKDA 1L0VA 4AQGA 4DVDA 4X66T 4B3RT 3I9YA 3SFEA 5LG3A 1IBLT 4KI0F 2W00A 5TAOA 4PJNA 2D5UA 2E9XC 4YXDA 2YKSA 4ADZA 5L2LA 3RX6A 5JDGA 4IE6A 5LJNA 2UXDT 1OXZA 4TUYE 2UUCT 2CA5A 3JC6D 4DR7T 1WYCA 2K24A 2YDQA 1UUSA 1Y64B 2ES0A 3KDSE 4CZZB 3RLFF 3MXZA 2K48A 2M67A 3L39A 3RYIE 2LSKA 3K1SA 5HEHA 2MYSA 1XWMA 3UUNA 5JDHA 1ZP0A
chains in the Genus database with same CATH topology
4LF7T 4JI1T 4B3TT 1N33T 3T1YT 2UUBT 2UU9T 2VQFT 4GKKT 4AQYT 4JI0T 1HNXT 1N32T 1N36T 2UUAT 4JI4T 5LMUT 4X62T 4JI6T 2UXBT 4B3MT 2ZM6T 4YY3T 4LFBT 1HNWT 1XMOT 4DV3T 3T1HT 4NXNT 4DR1T 1IBMT 4DR6T 2F4VT 4DV7T 1FJGT 4LF4T 4LF6T 4GKJT 4LF8T 3OTOT 4JV5T 4DV0T 1HNZT 1N34T 4DR3T 4X65T 4KHPT 4JI7T 4JYAT 1HR0T 5LMNT 4K0KT 4JI2T 4JI3T 4X64T 1I94T 4DV5T 4DV2T 4DR5T 1J5ET 4DV6T 1XNRT 4DR4T 4LFAT 2VQET 4JI8T 4B3ST 4DUYT 2HHHT 4DUZT 4LFCT 4X66T 1IBKT 2E5LT 4B3RT 4DV1T 4JI5T 5IWAT 1IBLT 2UXCT 4YHHT 2UXDT 5BR8T 2UUCT 4DR7T 4NXMT 1XMQT 4DV4T 4LF9T 4DR2T 4LF5T 4OX9T 1XNQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF7 T;  4JI1 T;  4B3T T;  1N33 T;  3T1Y T;  2UUB T;  2UU9 T;  2VQF T;  4GKK T;  4AQY T;  4JI0 T;  1HNX T;  1N32 T;  1N36 T;  2UUA T;  4JI4 T;  5LMU T;  4X62 T;  4JI6 T;  2UXB T;  4B3M T;  2ZM6 T;  4YY3 T;  4LFB T;  1HNW T;  1XMO T;  4DV3 T;  3T1H T;  4NXN T;  4DR1 T;  1IBM T;  4DR6 T;  2F4V T;  4DV7 T;  1FJG T;  4LF4 T;  4LF6 T;  4GKJ T;  4LF8 T;  3OTO T;  4JV5 T;  4DV0 T;  1HNZ T;  1N34 T;  4DR3 T;  4X65 T;  4KHP T;  4JI7 T;  4JYA T;  1HR0 T;  5LMN T;  4K0K T;  4JI2 T;  4JI3 T;  4X64 T;  1I94 T;  4DV5 T;  4DV2 T;  4DR5 T;  1J5E T;  4DV6 T;  1XNR T;  4DR4 T;  4LFA T;  2VQE T;  4JI8 T;  4B3S T;  4DUY T;  2HHH T;  4DUZ T;  4LFC T;  4X66 T;  1IBK T;  2E5L T;  4B3R T;  4DV1 T;  4JI5 T;  5IWA T;  1IBL T;  2UXC T;  4YHH T;  2UXD T;  5BR8 T;  2UUC T;  4DR7 T;  4NXM T;  1XMQ T;  4DV4 T;  4LF9 T;  4DR2 T;  4LF5 T;  4OX9 T;  1XNQ T; 
#chains in the Genus database with same CATH topology
 1U4Q A;  3E08 A;  3KV4 A;  5CJ5 A;  3PUA A;  2E9X A;  5JTG A;  4JI1 T;  1UCU A;  3MAC A;  1WLX A;  4PK5 A;  3UUX B;  3WAJ A;  4DMV A;  5JDL A;  5AQQ B;  3B5M A;  2XAF B;  3GA8 A;  2IML A;  2V26 A;  2LRK A;  5AQK B;  3SS1 A;  5AQT B;  2UUB T;  3N2K E;  4A56 A;  4ILU A;  1EZ3 A;  5FNV E;  3ZC1 A;  3HKE E;  5AQU B;  1B7T A;  2XZE A;  5AQL B;  2NW8 A;  3KFW X;  2E9X B;  4CN4 A;  4DBQ A;  4HEA A;  5LCY A;  1HNX T;  4JI0 T;  1N32 T;  1HS7 A;  2WDQ A;  2XQ7 A;  4GK0 E;  4I55 E;  4YJ3 E;  5FXZ A;  4A97 A;  4DND A;  5LMU T;  5FVK A;  3O1I A;  3KBT A;  2C5I T;  4JI6 T;  2DHR A;  1W0B A;  2CE7 A;  4I43 B;  4UIG A;  2AXD S;  2J62 A;  4HFV A;  4EZ4 A;  2QVA A;  4H9N C;  3P4P A;  3TLS A;  2VUR A;  3E22 E;  3SOL A;  5ABF A;  2CCQ A;  3ZKR A;  2WWU A;  2ZMA A;  1IAP A;  4L5G A;  5AFU L;  4DV3 T;  3T1H T;  2H7O A;  1YQ3 A;  2BG9 A;  2JRK A;  5L3F B;  1BR4 A;  2BS4 A;  2W0G A;  3RH3 A;  5ABE A;  4BA9 A;  3LBX B;  5E0O A;  3RIF A;  2XSB A;  2SPC A;  3M65 A;  3PU3 A;  4YHJ A;  4ILB A;  4HKA A;  4TN7 B;  4CXY A;  2F4V T;  4GOU A;  1FJG T;  4C90 A;  2V7L A;  3AAI A;  3IA3 A;  4ISS A;  4LF8 T;  2IAK A;  4AIU A;  4HFH A;  4AKI A;  2MBG A;  3ZSS A;  4LFC T;  5F8P A;  4HE8 A;  3HKC E;  3N5L A;  1MMA A;  2W67 A;  2FUP A;  1OED B;  2C0S A;  2LLY A;  2XUE A;  3C4X A;  1JNR A;  3ESL A;  5HXS A;  2BS3 A;  1R8I A;  4HFE A;  5HXR A;  2BKP A;  2W62 A;  2V7K A;  1CUN A;  3E0Z A;  2FJB A;  2WZI A;  3EHZ A;  1Z0P A;  2ODU A;  1IJ6 A;  2LEH A;  3HI2 A;  2V7I A;  3P4S A;  1HG2 A;  3ZN1 B;  3FBL A;  3B13 A;  3D0T A;  5FXV A;  5LB7 B;  1SA0 E;  1WRD A;  3CIR A;  2I59 A;  2IC6 A;  4NUV A;  2YK0 A;  3Q9D A;  3OJA A;  4MHC A;  3IF8 B;  4IDN A;  4GYS A;  3OBV E;  5C2T A;  3FZL B;  2X51 A;  4ZOL E;  2QGS A;  4JI7 T;  4OYK A;  4XAX B;  1YKE B;  1Z8U A;  5EZY E;  4JYA T;  5LGT B;  4CXW A;  1HR0 T;  1G8X A;  1T8B A;  5LMN T;  5BMV E;  3CX7 B;  4IDP A;  2YDS A;  4TWF A;  2PBI A;  3OKQ A;  2V8S V;  4HFB A;  4L9I A;  1J5E T;  2Y6X A;  3CKD A;  4DID B;  3P50 A;  3N2O A;  3JAD A;  4ZS3 A;  4ZZB A;  1XNR T;  5LBM A;  3RI5 A;  3RIU A;  1OED A;  3VHL A;  3UUM A;  4DBR A;  4AKH A;  3OYX A;  4AKR B;  2ODV A;  3RRC A;  5A1L A;  5LHI B;  2C5K T;  3CWZ B;  3RHW A;  3N9L A;  3RGL A;  3HKD E;  4O4H E;  5FY7 A;  4P1N A;  2NR4 A;  2PJQ A;  5C8Y E;  4E7S A;  4U72 A;  2BG9 C;  2E5L T;  2ACX A;  4U31 A;  4X5T A;  3UU6 A;  1S94 A;  1E7P A;  4IGU A;  4ZXL A;  4DV1 T;  5IWA T;  4IDQ A;  2D0T A;  4PFP A;  4PK4 A;  1W9R A;  3WAK A;  2LSY A;  2X9H A;  2XHE B;  2LT3 A;  3AAE B;  2FJE A;  5DJQ C;  4ERR A;  3AVS A;  4AXP A;  3L3P A;  4YJ2 E;  5ABF B;  1NWM X;  5BR8 T;  3KVB A;  3N9O A;  4NXM T;  1QUU A;  3AE1 A;  4BJM A;  2HH7 A;  3SFD A;  4LF9 T;  3SRZ A;  2IDO B;  2XQ4 A;  2YOE A;  4DR2 T;  4PJM A;  5AQN B;  3CPZ A;  3VR9 A;  4LF7 T;  1J1J A;  1XDP A;  4UEL A;  4IE4 A;  4B3T T;  4QKN A;  4QXC B;  4V1A v;  5AQV B;  1T98 A;  1BR1 A;  1XDO A;  4JUY A;  4X20 E;  3WI3 A;  2E2A A;  3AE8 A;  2XQ3 A;  4U2Z A;  4UVC B;  1KFY A;  3T1Y T;  3AE3 A;  4HWC A;  4TNV A;  1HTJ F;  2H7V C;  3N2G E;  5HEG A;  3ZMT B;  2R6G F;  1VCS A;  4EXT A;  1AJ3 A;  4KHZ F;  2WWV A;  5CA0 E;  2CXF A;  5M4Y A;  2V7J A;  3N9N A;  2NW7 A;  3Q5D A;  4BJN A;  5FL1 A;  4GKK T;  3G06 A;  3LJC A;  2KZ7 B;  4YTN A;  5GON E;  3J7Y q;  2LOS A;  5F5W A;  5HWY A;  1M7K A;  3KV9 A;  2WU2 A;  2QYW A;  2UUA T;  4JI4 T;  2V1D B;  4WW0 A;  5FXX A;  3AB3 B;  4CN6 A;  4X62 T;  4IT4 A;  5HXE A;  3CVR A;  3ZN0 B;  4B3M T;  2CHO A;  4NIQ A;  3C4W A;  1US7 B;  3ETU A;  3JAE A;  4WBO A;  3DTO A;  4PJL A;  2WQY A;  3ZT6 A;  2VL0 A;  1ZEE A;  5CFB A;  3Q2M A;  4MFR A;  1XMO T;  4WZX A;  2EHO A;  2VKH A;  2X66 A;  3ANW B;  3ZT7 A;  4DR1 T;  4O2B E;  3QUJ A;  2IUB A;  2YDR A;  4TWD A;  3DJB A;  1WFD A;  2IHR 1;  2XY8 B;  3BK9 A;  3C64 A;  4FI5 A;  3NRY A;  4O4I E;  4QX7 B;  5J2T E;  1VRB A;  2BBJ A;  1UX5 A;  2I6H A;  1KNZ A;  2L3L A;  3ABV A;  1WYB A;  3BQK A;  5DAB A;  5ABH A;  3M3Z B;  1YW0 A;  2BG9 B;  2J4G A;  3PDY A;  1FMV A;  4O4L E;  4PAG A;  5L3B B;  2W66 A;  3K3O A;  4OYJ A;  3FB2 A;  4UF0 A;  2DI4 A;  4QHO A;  5FVL A;  2MPK A;  2B76 A;  2DLR A;  3MK7 C;  4IL4 A;  4ILC A;  4U7Y A;  4YT0 A;  3IEE A;  4NPP A;  1X9B A;  4UV8 B;  1OED C;  5IHY A;  2LM9 A;  5JDF A;  2CLY B;  3BQL A;  2WS3 A;  2CWY A;  2UXN B;  4ILA A;  5L4H A;  3ZJ2 A;  5JR9 B;  3AEG A;  5AQH B;  5CB4 E;  2UXX B;  2MTQ A;  1KEY A;  3AE6 A;  3GWH A;  5CGM A;  4PJJ A;  3FXE B;  1LKX A;  1V9D A;  1FEW A;  5LGN B;  1D1B A;  2LOP A;  3QB5 A;  2KT9 A;  2IIU A;  3L09 A;  3S4U A;  2BKN A;  4X1I E;  4IIJ E;  4AQF C;  5LXT E;  2QA7 A;  4CI3 B;  4C91 A;  1MNE A;  5L3C B;  4G2A A;  1WR0 A;  3OYZ A;  4QH5 A;  4DMW A;  2FBW A;  2VK9 A;  1YD8 G;  4ZS2 A;  5JDQ A;  4K0K T;  2Y48 B;  4H63 V;  5HCM A;  2NTY A;  2NW9 A;  4JI2 T;  3UT5 E;  1I94 T;  4YLH A;  2KWI B;  3RYC E;  3KV6 A;  3HKB E;  2WMN A;  4DV2 T;  4TZ4 C;  3U78 A;  3I9W A;  2PTF A;  3RYH E;  2JPF A;  2BBH A;  4IE7 A;  2I0M A;  4DV6 T;  5KMG P;  1YKH B;  3MA9 A;  2BG9 E;  2X9W A;  3RQU A;  2LSJ A;  2VB6 A;  3UFE A;  1T72 A;  2VAS A;  3EAB A;  2RP4 A;  3PJA A;  5AQJ B;  1FIO A;  3PV0 F;  3SWH A;  3TKL B;  4OFZ A;  4CQI A;  2CRB A;  4H9R C;  4EIW A;  3RF1 A;  3UUL A;  2HHH T;  4EOZ B;  4DUZ T;  1IZN B;  3I0Q A;  2WM9 A;  3GN5 A;  3AE9 A;  3LK2 B;  3O1H A;  4HTE A;  3C51 A;  1E2A A;  3UU5 A;  3HL6 A;  2X68 A;  3QOF A;  3RIA A;  4PK6 A;  4Z90 A;  1WR6 A;  3Q5E A;  4EED A;  2PG8 A;  2X0H A;  2X0Y A;  4DO0 A;  5L3D B;  4HFD A;  1SE7 A;  3EDV A;  4HFI A;  5J2U E;  2MOZ A;  1HG5 A;  2CXD A;  2UXC T;  4K0U A;  5AQI B;  2OLT A;  2WU5 A;  3UUB A;  1KF6 A;  2HPL A;  2OA5 A;  5DQW A;  2Q9Q B;  5LNK A;  2WDR A;  2G0U A;  4OHF A;  2X9X A;  2JJ9 A;  2JQK A;  3RKG A;  3K3Q C;  3QNU A;  4DV4 T;  5JRC B;  4ZEY A;  2XAQ B;  4A98 A;  1X79 A;  3AA7 B;  4LF5 T;  2LKG A;  3PUZ F;  3RC3 A;  4F8H A;  2X9Y A;  2JQ9 A;  4QH1 A;  2LM2 A;  3C50 A;  3RQW A;  4HWF A;  5J0Z A;  4M1P A;  1HF8 A;  2L8K A;  2V6Y B;  2XTL A;  2WDV A;  2WBL A;  2X0L B;  3ZMU B;  5CA1 E;  4PFO A;  2BZB A;  2LRL A;  3OVU A;  3AEB A;  1W0A A;  4L0R A;  4WYV A;  2M6I A;  4EGW A;  4AKG A;  5IYZ E;  5JRC A;  2Q9Q D;  2C5J A;  2D2S A;  5L3E B;  5EK3 A;  4CN1 A;  4KUM B;  2V7M A;  5LP6 E;  2H3R A;  1DU2 A;  4Q25 A;  2P9B A;  3L8R A;  5EK2 A;  5JQG E;  3ZJ1 A;  2WSS V;  3QC9 A;  3FZM B;  5HEU A;  2W4X A;  4ZHQ E;  5JDM A;  3EAM A;  2FJA A;  4H9Q C;  3ZMS B;  3ONL C;  3NVO A;  2CBI A;  2JMK A;  3O9X A;  4IRE A;  3P4R A;  3KIN B;  4EV6 A;  4IE5 A;  2WCA A;  4U74 A;  3F31 A;  2ACZ A;  3NWI A;  5FY1 A;  2W61 A;  2Q9Q C;  4ZI2 D;  2AE9 A;  5F3J A;  3A7M A;  3MZK B;  2CM0 A;  2K5B B;  3LK3 B;  2HN2 A;  4GIW A;  3U3I A;  2UXB T;  3C98 B;  1BR0 A;  4N78 D;  3RYF E;  4JBW F;  2ZM6 T;  4ZI3 C;  3T8O A;  4YY3 T;  2B1E A;  3TLV A;  2CEA A;  2WZH A;  3H3M A;  2W63 A;  3FXD B;  4LFB T;  3RPU A;  2JQQ A;  1G73 A;  3VRB A;  1HNW T;  1OED E;  2LSI A;  4ZI2 C;  2E5V A;  3PE0 A;  2H89 A;  3ZST A;  4WBN E;  2LHN A;  5AQO B;  3GMI A;  4XZC A;  5LGU B;  2H88 A;  3C4Z A;  1IBM T;  4X1K E;  1VCT A;  5JRE A;  2DNX A;  1MND A;  5FY0 A;  1UK5 A;  3GN5 B;  3IHR A;  3O4X E;  2OV9 A;  4IE0 A;  3QK6 A;  5AQS B;  3FZH B;  4QXH B;  5FYM A;  3PUS A;  3A8Y C;  4CI1 B;  3A5X A;  5AQP B;  4LF4 T;  4LF6 T;  3AA6 B;  4GKJ T;  4Z8X A;  2HPJ A;  3JC6 C;  3RIU C;  3ZLI A;  4ZZC A;  3AXJ A;  3NKZ A;  5HAX A;  2WP9 A;  3OTO T;  5LOV E;  1LVF A;  4H9P C;  5JVD E;  4JV5 T;  2EHO D;  3ETV A;  4JEH B;  4COF A;  1IJ5 A;  1N34 T;  4LMJ A;  2XJ7 A;  1O3X A;  5LHH B;  4UVB B;  2NTX A;  4PW8 A;  3NZQ A;  1HFA A;  5KDM C;  2XQ5 A;  3ZPO A;  4KMC A;  3QB5 K;  1MIW A;  3EI0 A;  4UXN B;  5H6R B;  5FP3 A;  3N9Q A;  4U2Y A;  3RKO A;  1E1H B;  3UQ4 A;  3ZYL A;  2Y8D A;  3N9M A;  2ZLY A;  4QX8 B;  3TLU A;  4DR3 T;  3CQX C;  2XQ8 A;  4XBF B;  2EHO C;  2LJL A;  1YXR A;  3LSV A;  1XZY A;  5FL0 A;  4Z91 A;  1D1C A;  2LE8 A;  2K3W A;  3LFM A;  5KX5 E;  5LG4 A;  3UQ7 A;  1KK7 A;  2D9D A;  2NWB A;  3CQG B;  4H63 H;  3EUH A;  4E7Z A;  1ZV4 X;  3I0O A;  2VWA A;  2XQA A;  1MIV A;  2ZM8 A;  4YSY A;  4DV5 T;  4DR5 T;  4FJO A;  3PU8 A;  4HN9 A;  3AA1 B;  3RRW A;  5AQR B;  1ZHC A;  2LKH A;  3O1J A;  5DQV A;  4YTP A;  2DL1 A;  2KLQ A;  5HEJ A;  1LVK A;  2N2N A;  2RA1 A;  1UUR A;  1D0X A;  3PUG A;  3AED A;  3AXJ B;  4IDZ A;  4MBQ A;  3NRX A;  4NUU A;  4YFS A;  2KMF A;  2XQ9 A;  5FXW A;  4B3S T;  4JI8 T;  5LHG B;  4G63 A;  3CQC B;  2DWG A;  2VL8 A;  2XQ6 A;  3W15 B;  3ZYK A;  5HXH A;  3NBX X;  3H3A A;  3PUQ A;  2CLY C;  1KNR A;  4UV9 B;  4O2A E;  4YTM A;  4EEB A;  5IUX A;  3HA4 A;  4TV8 E;  1IBK T;  2YIN A;  3EDU A;  1U5P A;  2JQH A;  4EAH A;  3ZEF B;  1NEN A;  2CPT A;  4JI5 T;  5KXJ A;  3RC8 A;  3N9P A;  3VKH A;  4B6X A;  2BVM A;  2XAS B;  2YU1 A;  4YHH T;  3AEE A;  2VVN A;  1KNP A;  2A72 A;  3P4W A;  2QRX A;  3PUW F;  4QH4 A;  3LBX A;  4QXB B;  1D0Y A;  3PUR A;  4U7I A;  5JDN A;  5L47 A;  1XMQ T;  1JNZ A;  3UU8 A;  2JMH A;  3ONJ A;  2NP9 A;  3LDQ B;  3CML A;  3ZCJ A;  3ZMZ B;  4YSX A;  5FMN A;  5ABG A;  2BVL A;  2V5D A;  2J1D G;  4H9S E;  3UU3 A;  1W09 A;  1NEK A;  3AE7 A;  5ADX L;  3F2E A;  4IST A;  4P0B A;  1XNQ T;  5HWX A;  2V5C A;  2XM2 A;  4TX5 A;  3PUV F;  4BAY B;  3BQI A;  4HWI B;  1S35 A;  5LJM A;  4ANJ A;  3KBU A;  1N33 T;  4EYY R;  2CXL A;  2YEV C;  2XM1 A;  1CHU A;  5AQG B;  4U3C A;  2KND A;  4YSZ A;  2UU9 T;  2PFV A;  4IHJ E;  2VQE T;  3R84 B;  2JIW A;  2VQF T;  3P4Q A;  5HEO A;  4TV9 E;  3VKG A;  3H37 A;  1MMD A;  4AQY T;  1MIY A;  5AQF B;  1QSD A;  2CHN A;  1N36 T;  3JAF A;  1HX8 A;  3AEA A;  5LBQ B;  2XQY A;  3PUX F;  3F57 A;  4HFC A;  4UEM A;  2YN6 A;  3Q5X A;  2W2U A;  3JCF A;  4I50 E;  2WY2 A;  2YU2 A;  4OX9 T;  2BDE A;  3ONX A;  4EZH A;  1MMN A;  2N1G A;  2D0U A;  4TNW A;  1J5W A;  1MMG A;  3VU7 H;  2J47 A;  2XAH B;  4I4T E;  4UVA B;  2EHO B;  3ANW A;  4MAL A;  2IW5 B;  1SUM B;  2E8I A;  3B57 A;  5C3J A;  2Q9Q A;  3OPC A;  3AAA B;  3PTR B;  4OK0 A;  1VOM A;  5EK4 A;  3J9X 1;  4F6R C;  3Q5W A;  3EVY A;  1SHZ C;  2FJD A;  2KSR A;  4I0U A;  3CX8 B;  2L9Q A;  4JLE A;  4NXN T;  1UGO A;  4KX6 A;  3UFG A;  3ZYM A;  3FZK B;  2KWH A;  5ETW A;  5HYA A;  2V6X A;  2K9A A;  2VVS A;  2X67 A;  4J2C A;  3VR8 A;  4HWH A;  3UTK A;  3VRA A;  4DR6 T;  2E9X D;  2KIN B;  2RPA A;  4AKL A;  4EB6 E;  4UF0 B;  4DV7 T;  2KXP B;  3HR0 A;  3CX6 B;  1LRZ A;  2BKO A;  4UR9 A;  3V5S A;  4AIS A;  3P8C D;  3ZCI A;  2XSA A;  1ZKE A;  1OWA A;  2DWK A;  3X1D A;  3P7I A;  4A5X A;  5JR9 C;  5HXC A;  4O8S A;  2IC9 A;  4TWH A;  2A3D A;  2A2F X;  2BS2 A;  2CWO A;  4DV0 T;  2XAJ B;  4HGA A;  4PNI A;  3DP7 A;  1HNZ T;  3KVA A;  4P09 A;  4GYR A;  2XAG B;  4ZI7 E;  2VKJ A;  2M6B A;  3TLT A;  3AE4 A;  4WNK A;  4CI2 B;  1Y01 A;  2N9D A;  4P0A A;  4U33 A;  2WAU A;  3I1A A;  1I6Z A;  1ZOY A;  1HX1 B;  2NOX A;  3IBP A;  3TLW A;  3PUY F;  4AQF A;  4ASK A;  1FMW A;  3R6N A;  4KBM B;  3AE2 A;  3K3N A;  5LA6 E;  1UX4 A;  2A9U A;  1D1A A;  5J1G A;  4X65 T;  4AI6 A;  4EYU A;  3K8P C;  5HCJ A;  3AA0 B;  5AQM B;  5JH7 E;  4KHP T;  1H7C A;  4QWN B;  2CBJ A;  3CK6 A;  5L4E A;  2Z6E A;  4HWD A;  4IDO A;  4GK5 E;  2ZM0 A;  4MLK A;  2WB5 A;  4X1Y E;  3KV5 A;  3ZMV B;  3UU4 A;  2XPK A;  3AEF A;  3FHN A;  5L3G B;  4X64 T;  4JI3 T;  1T7S A;  2GK9 A;  2LHR A;  5JR9 A;  1GQE A;  2V6Y A;  3MJX A;  4JEU B;  3PJA J;  1WCR A;  1HCI A;  4IL9 A;  4DR4 T;  4KP3 C;  5LYJ E;  3NZP A;  3FZF B;  4LFA T;  4O4J E;  4CXX A;  4ZI3 D;  3AVR A;  3FBZ A;  3LG7 A;  3ZC0 A;  3ZT5 A;  2MAW A;  2ZM2 A;  5H6Q B;  1NAF A;  1QLB A;  2WMO A;  3V5U A;  4DUY T;  1M62 A;  2HN1 A;  2CMR A;  1BR2 A;  2LSG A;  3AEC A;  3MKD A;  4LML A;  4LMK A;  4H9O C;  2DCF A;  5FKY A;  1YQ4 A;  3AE5 A;  2VKO A;  3LK4 2;  1D0Z A;  2VKD A;  1L0V A;  4AQG A;  4DVD A;  4X66 T;  4B3R T;  3I9Y A;  3SFE A;  5LG3 A;  1IBL T;  4KI0 F;  2W00 A;  5TAO A;  4PJN A;  2D5U A;  2E9X C;  4YXD A;  2YKS A;  4ADZ A;  5L2L A;  3RX6 A;  5JDG A;  4IE6 A;  5LJN A;  2UXD T;  1OXZ A;  4TUY E;  2UUC T;  2CA5 A;  3JC6 D;  4DR7 T;  1WYC A;  2K24 A;  2YDQ A;  1UUS A;  1Y64 B;  2ES0 A;  3KDS E;  4CZZ B;  3RLF F;  3MXZ A;  2K48 A;  2M67 A;  3L39 A;  3RYI E;  2LSK A;  3K1S A;  5HEH A;  2MYS A;  1XWM A;  3UUN A;  5JDH A;  1ZP0 A; 
#chains in the Genus database with same CATH homology
 4LF7 T;  4JI1 T;  4B3T T;  1N33 T;  3T1Y T;  2UUB T;  2UU9 T;  2VQF T;  4GKK T;  4AQY T;  4JI0 T;  1HNX T;  1N32 T;  1N36 T;  2UUA T;  4JI4 T;  5LMU T;  4X62 T;  4JI6 T;  2UXB T;  4B3M T;  2ZM6 T;  4YY3 T;  4LFB T;  1HNW T;  1XMO T;  4DV3 T;  3T1H T;  4NXN T;  4DR1 T;  1IBM T;  4DR6 T;  2F4V T;  4DV7 T;  1FJG T;  4LF4 T;  4LF6 T;  4GKJ T;  4LF8 T;  3OTO T;  4JV5 T;  4DV0 T;  1HNZ T;  1N34 T;  4DR3 T;  4X65 T;  4KHP T;  4JI7 T;  4JYA T;  1HR0 T;  5LMN T;  4K0K T;  4JI2 T;  4JI3 T;  4X64 T;  1I94 T;  4DV5 T;  4DV2 T;  4DR5 T;  1J5E T;  4DV6 T;  1XNR T;  4DR4 T;  4LFA T;  2VQE T;  4JI8 T;  4B3S T;  4DUY T;  2HHH T;  4DUZ T;  4LFC T;  4X66 T;  1IBK T;  2E5L T;  4B3R T;  4DV1 T;  4JI5 T;  5IWA T;  1IBL T;  2UXC T;  4YHH T;  2UXD T;  5BR8 T;  2UUC T;  4DR7 T;  4NXM T;  1XMQ T;  4DV4 T;  4LF9 T;  4DR2 T;  4LF5 T;  4OX9 T;  1XNQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...