1N34T

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n34T00
4DUZT 5IWAT 1HNWT 2F4VT 1IBLT 1N36T 4B3MT 2UU9T 4B3TT 3OTOT 5LMNT 1IBMT 4DV2T 4DR6T 4GKKT 4JI3T 2VQFT 4YY3T 1N34T 4LFAT 4B3RT 2UXCT 4DR2T 4X64T 4JI4T 4AQYT 4JI6T 4DV0T 4JYAT 1XNQT 4X66T 4DV4T 4DR7T 4DR4T 2UXDT 4KHPT 4DUYT 1XMOT 1XNRT 4JI1T 4JI2T 4LF7T 1FJGT 1N32T 4NXMT 4JI0T 4LFBT 4DR1T 5BR8T 1IBKT 4DV3T 5LMUT 3T1HT 4LF6T 2UXBT 1I94T 4JI5T 4LF8T 1HNXT 2UUAT 1HR0T 2UUBT 1XMQT 1HNZT 4NXNT 2VQET 4K0KT 2UUCT 4DV1T 4LF4T 4X65T 4DV6T 4X62T 4GKJT 2E5LT 4LFCT 1J5ET 3T1YT 2ZM6T 4DV7T 4JI8T 4YHHT 4DR5T 4LF5T 2HHHT 4JV5T 4OX9T 1N33T 4LF9T 4DR3T 4DV5T 4B3ST 4JI7T
chains in the Genus database with same CATH superfamily
4QKNA 2C0SA 3L3PA 1T8BA 2LRLA 2KSRA 5JDGA 3AE7A 5AQSB 3QUJA 3RF1A 3UU6A 3QB5A 3Q5EA 2UXCT 3RX6A 2BBHA 2LM2A 3VRBA 2KWIB 4EEDA 5FY7A 4HWCA 3VHLA 4DUYT 2K9AA 3LG7A 1G8XA 1FJGT 1MMAA 4JUYA 2YU1A 3OYZA 4UXNB 3ETUA 3L09A 3ZKRA 2N2NA 4V1Av 1UX5A 2YEVC 4LF8T 3KINB 3K8PC 2XUEA 1OEDE 5CA1E 2KZ7B 1WRDA 3HL6A 3N2GE 2X68A 1SE7A 5C8YE 1UURA 3P7IA 1D1BA 3N2OA 1Y64B 3QB5K 4LMKA 2G0UA 4JEUB 4PJNA 3OKQA 3I1AA 4UR9A 4U2YA 2I0MA 3C4XA 1N33T 3RI5A 4QH5A 3LBXB 3P4PA 5J1GA 4ISSA 4ERRA 3KVBA 2CRBA 3BQIA 1QUUA 2LSJA 4DR6T 5TAOA 2CHOA 2W61A 5KX5E 4Z90A 1W09A 4IE0A 4BJMA 3HKCE 3JAFA 4J2CA 3RIUC 5IUXA 3FBLA 3UQ7A 3C4ZA 3MZKB 3IF8B 1MIYA 3VR9A 2V5CA 5L3DB 4GYRA 1IBKT 5HXSA 4H9SE 2IC9A 3T1HT 1HF8A 2RP4A 2MBGA 4TWDA 1I94T 5M4YA 2W62A 5LGTB 3AA6B 3CQCB 2BG9E 4DBQA 3T8OA 3PUZF 2VQET 5IYZE 3SFEA 2MYSA 5ABEA 4ZZCA 5KDMC 4JLEA 2XQ3A 5AQIB 3R84B 4DNDA 5L2LA 2ZM6T 2Y48B 1MMDA 3RHWA 5FL0A 1ZOYA 4HTEA 4TV8E 5DABA 4OX9T 4EOZB 3TLWA 2RA1A 4I4TE 4HWFA 1SA0E 1HNWT 2WU2A 3N9NA 4QX8B 3FZKB 5L4HA 1SUMB 2PTFA 3ONJA 5EZYE 3ZN1B 4CN6A 3QC9A 2H88A 4JI6T 5J0ZA 2WY2A 4O4HE 2LLYA 4IREA 3NZQA 4PJMA 4NPPA 2XQYA 2ACXA 3LSVA 4IL9A 4PFOA 5F8PA 2ZM0A 1MMNA 1XWMA 3ZYKA 4O4LE 3J9X1 1YQ3A 4EZ4A 3Q5DA 2IMLA 3ZC1A 2IHR1 3KFWX 4B6XA 2XQ8A 4HFBA 3C50A 2KINB 5JREA 2J47A 5CJ5A 2P9BA 1W0BA 3ZSTA 3I0OA 3SWHA 2XAFB 2XQ5A 3ETVA 4PNIA 4CN4A 3GWHA 2JPFA 1ZHCA 3BQKA 3MA9A 2WCAA 3ABVA 2BG9B 2QGSA 4E7ZA 1KNPA 2UXNB 1WYCA 3N9OA 1NENA 5AQVB 2X9HA 4K0KT 4LF4T 5HWYA 1M7KA 3LJCA 3K1SA 3AEAA 2YKSA 4E7SA 4A5XA 2VVNA 4M1PA 4TWHA 5EK3A 4HGAA 4U7IA 3VKGA 1YKEB 4LF9T 4FJOA 2LSIA 2F4VT 4WZXA 2CXLA 4YTPA 2I59A 1E2AA 4IE4A 5AQFB 2CCQA 4KMCA 5JRCA 2YOEA 3PUGA 3L8RA 2BBJA 3N9LA 3CQXC 1XNQT 3MKDA 2D0UA 1WFDA 2LRKA 3GN5A 5C2TA 2W0GA 2XTLA 3EDUA 4ILCA 4JI2T 4DVDA 1T7SA 3AXJB 2X0YA 1LRZA 2KWHA 2Q9QB 5H6RB 1D1CA 3B57A 4TV9E 5JDNA 3EHZA 4CXYA 2NW8A 2YN6A 5FNVE 4EGWA 3PUAA 1XZYA 4HEAA 2UUBT 2DI4A 3PUWF 1WCRA 1FEWA 3TLSA 2H7OA 3Q2MA 2E5LT 2CWYA 2ODVA 4QH1A 4C91A 4DV7T 3P4RA 1IJ5A 5GONE 3PUXF 4DR5T 3UUMA 3NVOA 2LHNA 2HHHT 4AQFC 4U31A 4YSZA 2YK0A 4TN7B 1UUSA 3AA0B 5HWXA 2M6IA 3I9WA 3ONXA 4OFZA 3O1IA 3ZT7A 1HG5A 2BKNA 2VKJA 3NZPA 2E5VA 3RKOA 5FXXA 5DQVA 3RIFA 3RQWA 3HR0A 5FVKA 2XPKA 3AE3A 5HEJA 2PBIA 2KMFA 3ZMUB 3R6NA 2HH7A 4L9IA 4X1IE 4IE7A 5JDLA 3F57A 2B76A 4HWIB 2IC6A 2XQAA 3RIUA 3NRYA 3M3ZB 2DWGA 4L0RA 3X1DA 3UT5E 1KEYA 4LF6T 2CPTA 2NTYA 3AAEB 3RLFF 1WLXA 3PJAA 5LBQB 1BR0A 5FXVA 2XM1A 3N5LA 5CFBA 1MMGA 3DJBA 3FZHB 2LOPA 4DV1T 2V26A 3O9XA 2XSAA 2LM9A 3RKGA 3HKBE 3MK7C 4BAYB 5L3CB 2DNXA 2JQ9A 3Q5XA 3ZC0A 5ABFA 3ZSSA 2ODUA 4NIQA 4OYKA 2V1DB 2FUPA 2D2SA 3PV0F 1J1JA 3O1JA 2HPJA 1D0ZA 2VASA 4QXCB 1IBMT 3BK9A 5HXRA 5AQGB 3M65A 3EAMA 3PTRB 4DR2T 4X64T 5L3BB 4ZZBA 4Z8XA 2WMOA 4TUYE 2GK9A 4O2BE 2V6YB 3AEEA 3OPCA 2JQKA 4DR4T 4AI6A 5KMGP 2BG9C 1D1AA 1IZNB 3MACA 5LBMA 4HKAA 3WI3A 1FMVA 2NWBA 2LSYA 3ZEFB 3VR8A 2L9QA 3RGLA 4WBNE 3HKEE 4PW8A 3GMIA 4QH4A 2LSGA 3B13A 4ZEYA 4EYUA 2BDEA 2NW9A 3P4QA 2UUAT 5LYJE 4AKLA 5J2TE 3UUXB 3S4UA 3V5UA 4U3CA 4K0UA 4ZI3C 5JDMA 5AQUB 2XY8B 2N9DA 3KBUA 4ILBA 2XQ7A 2E9XB 4JBWF 1LVKA 4H9QC 5LA6E 4O8SA 4I55E 4ASKA 4LF5T 2PJQA 4XBFB 4JV5T 4X5TA 2LEHA 4ZI3D 3CIRA 5FMNA 3Q5WA 4Q25A 4X1KE 5EK4A 2VWAA 5LNKA 4IL4A 4UELA 2WWVA 5AQRB 4PK6A 2BVLA 3QK6A 1VCSA 2Q9QC 3P50A 1CHUA 2L8KA 2BS2A 2VL0A 3SFDA 4X66T 5FXWA 1MIWA 4JI1T 2XAJB 2Q9QD 4TNVA 5AQNB 4GOUA 4OK0A 4IDPA 5JR9A 3RIAA 3RQUA 4U72A 1X9BA 5L4EA 3PJAJ 2W66A 2FJDA 2BVMA 4XAXB 4N78D 2WS3A 3B5MA 1KNRA 2LT3A 2JIWA 4O2AE 1OWAA 2Y6XA 4C90A 4ZI7E 2XAGB 2WSSV 2WB5A 4EYYR 4AISA 5C3JA 4UF0A 2CBJA 5BMVE 2YU2A 2DL1A 5L47A 4DMVA 2E2AA 4G63A 3HA4A 2V7LA 1MIVA 4ZHQE 4DR3T 1SHZC 2JRKA 2ZM8A 4OHFA 1D0YA 2XQ4A 5LOVE 2V7KA 4CI1B 5CA0E 1L0VA 2LE8A 4YT0A 5FVLA 2AXDS 5AQTB 4AQFA 4CXXA 2ZM2A 5LGUB 1X79A 1VOMA 2K3WA 3GA8A 2EHOD 3KV4A 3RC3A 2X9WA 1S94A 5AQQB 3L39A 1IJ6A 2JJ9A 1WR0A 3RYHE 5LB7B 2MAWA 2V5DA 4YJ3E 2LSKA 4P0BA 3ZCIA 2V7MA 1R8IA 4NXMT 2BS4A 1OEDA 4PK4A 5BR8T 4PAGA 3FZFB 4IGUA 2CLYB 4DV3T 3CKDA 3N9PA 5JTGA 2IDOB 4JI5T 4Z91A 4YTNA 1LVFA 5KXJA 2VVSA 2N1GA 4EEBA 4H63H 2NOXA 4X62T 1BR1A 3AB3B 3VU7H 2DWKA 3SRZA 4P1NA 4YSYA 1KK7A 4AIUA 1W0AA 3UU5A 2CXFA 2KXPB 1HCIA 4FI5A 4CZZB 2IW5B 3PUSA 2YDQA 5AQJB 3IBPA 3H3AA 4DV5T 4B3ST 5IWAT 4AKRB 2J4GA 4QHOA 3E08A 5JRCB 3AEBA 4F8HA 2KT9A 4LMJA 4I0UA 3PDYA 4TWFA 5HEHA 2QYWA 1MNDA 4LFAT 4WW0A 1WYBA 3J7Yq 5ADXL 2FBWA 1BR2A 3P4SA 3AEFA 1E1HB 2A2FX 4KHPT 3ANWA 5AQLB 2X66A 4EAHA 3PUYF 4YHJA 4LF7T 4ZI2C 4H9RC 2A9UA 4HFHA 1IAPA 4IHJE 3C4WA 3EUHA 2WDVA 2BG9A 3V5SA 2E9XC 4PFPA 3I0QA 1NAFA 3CX7B 3KDSE 5A1LA 2XAHB 3PU3A 4ZI2D 2XASB 2QRXA 5IHYA 4U33A 4QX7B 1Z8UA 3UFGA 4QWNB 3FB2A 3RPUA 2E9XD 1XMQT 3PU8A 4DV6T 5HEUA 2Y8DA 5HEOA 4WYVA 1T98A 4UVBB 2OLTA 2XQ9A 3FXEB 5HAXA 1BR4A 2IIUA 4HWHA 4KBMB 2AE9A 3CWZB 3RRCA 3ZN0B 3KV5A 2DCFA 3A7MA 2CM0A 2YDSA 4O4JE 4EXTA 3AVRA 4JI4T 4YTMA 4JYAT 3PUQA 4HWDA 3U78A 4EB6E 1W9RA 3I9YA 1EZ3A 3AE1A 1XNRT 3F31A 1YQ4A 3AE2A 3P4WA 2L3LA 3C64A 3RYFE 4EIWA 4X1YE 4KHZF 3UULA 4ANJA 2BKPA 2WZHA 4DR1T 2CWOA 2K24A 2K5BB 5L3FB 3ZLIA 2OA5A 3ZT6A 4PK5A 2EHOB 4DIDB 2UXBT 2KLQA 1HR0T 5LXTE 5FYMA 4NXNT 3CVRA 2J62A 4GYSA 1KNZA 1KFYA 1S35A 1T72A 5HCJA 2WDQA 5ABFB 3RH3A 4JI8T 4TX5A 2PG8A 2CE7A 3ZJ2A 3KV6A 2QVAA 2C5JA 4JI7T 3CK6A 4MALA 1H7CA 3TLUA 4BJNA 5LCYA 2CHNA 3DTOA 5LMNT 3KVAA 1XDPA 3PURA 1NEKA 3AEGA 2V7JA 3UU3A 2VQFT 4B3RT 1FIOA 4I43B 2CLYC 2J1DG 4DV0T 2X9XA 3IHRA 1HX8A 5E0OA 5LG4A 5JDHA 5LHHB 4CN1A 3FBZA 5FY0A 4O4IE 2LKGA 2JMKA 2X9YA 4WNKA 5LGNB 5J2UE 3HI2A 1N32T 3TLTA 4JI0T 5JH7E 2W63A 4LFBT 4X20E 2KNDA 2MTQA 2A3DA 5H6QB 1V9DA 2WZIA 3O4XE 2VURA 2JMHA 4YFSA 4F6RC 3EI0A 3OJAA 3P8CD 5L3EB 1FMWA 2UXXB 3CX8B 5AQMB 3QOFA 3JC6C 4IDZA 3JAEA 5JVDE 4AKGA 3E0ZA 1I6ZA 3N2KE 2RPAA 2JQQA 4LMLA 3G06A 1HFAA 2CA5A 4EV6A 4QXBB 4YXDA 3N9MA 1YW0A 2MPKA 4ZOLE 3JC6D 2LJLA 1IBLT 1N36T 3RYIE 2V6YA 2R6GF 4IDNA 1DU2A 2X0LB 3RRWA 4U2ZA 1JNZA 2WP9A 1HG2A 5FY1A 3UUBA 4A98A 3WAJA 1Z0PA 5AQHB 4DV4T 2XM2A 3FZMB 4ZS2A 3MJXA 3SOLA 2D5UA 3EVYA 4MFRA 2W2UA 5LJNA 3KV9A 2LKHA 5JR9B 1GQEA 4HFCA 3WAKA 1WR6A 2HN1A 2ZLYA 2WWUA 4H63V 5ABGA 2WQYA 1YKHB 4GK5E 4I50E 3EABA 3OYXA 3AAAB 4BA9A 2E9XA 4ILAA 3VKHA 3SS1A 2CBIA 2XQ6A 4MHCA 2VK9A 4UF0B 4YLHA 5HXCA 3LK42 4P09A 3AECA 4WBOA 3AAIA 4MBQA 4KP3C 2ACZA 1JNRA 3W15B 4YJ2E 2YINA 4UEMA 4DMWA 2W4XA 4G2AA 4L5GA 3CMLA 4HE8A 3EDVA 3ZMSB 3D0TA 2HN2A 1J5WA 1UX4A 3IA3A 1OXZA 2BKOA 2V8SV 1M62A 2XJ7A 3LK2B 5LHGB 4B3MT 4HFVA 4B3TT 2I6HA 3CX6B 3LBXA 2H7VC 5LG3A 5HCMA 1Y01A 4HFDA 2X67A 4COFA 4UV9B 1N34T 3IEEA 3VRAA 4AQYT 3TKLB 2EHOC 1XDOA 4DR7T 1CUNA 4TNWA 3UUNA 3BQLA 4HFIA 1NWMX 3MXZA 3H3MA 1ZP0A 2CMRA 1OEDB 2CEAA 2D9DA 3LK3B 4KI0F 2FJAA 3TLVA 1LKXA 3FHNA 2VL8A 2XZEA 2OV9A 2WBLA 1HS7A 1QLBA 1VCTA 2HPLA 2JQHA 4YSXA 4AKHA 3AE4A 2WM9A 4NUUA 2E8IA 1HNZT 3CPZA 4P0AA 3NBXX 1YXRA 2UUCT 4GKJT 2IUBA 1VRBA 2ES0A 2X51A 3HKDE 5LHIB 3UU8A 2XSBA 5CB4E 1MNEA 3AA7B 2VKHA 4GK0E 5FL1A 1O3XA 4A56A 4U74A 3ZYMA 3Q9DA 4JI3T 4HN9A 4YY3T 2C5IT 5AQPB 1KF6A 2SPCA 3UQ4A 1ZEEA 3ANWB 2LHRA 2PFVA 4UVAB 3O1HA 3LFMA 2UXDT 5HXHA 2YDRA 3FXDB 3ESLA 4MLKA 2QA7A 4QXHB 3AE8A 3DP7A 4ZXLA 3GN5B 5AFUL 2V6XA 5LMUT 5FXZA 3H37A 1HX1B 1G73A 4ZS3A 4UIGA 2M6BA 1HNXT 4H9NC 2WDRA 4ILUA 5HEGA 2W00A 5CGMA 1QSDA 3A5XA 3ONLC 3JADA 4CXWA 3UFEA 2Z6EA 3RC8A 1B7TA 4AXPA 4YHHT 4JEHB 4OYJA 3ZJ1A 5ETWA 3F2EA 3RYCE 3PE0A 2DHRA 1US7B 5JR9C 4GKKT 5HXEA 4CQIA 2NW7A 4EZHA 5EK2A 3K3QC 4ISTA 3ZYLA 5JQGE 4XZCA 3K3OA 2B1EA 3NKZA 2H89A 2MOZA 1U4QA 5ABHA 5JDQA 3N9QA 4AQGA 3K3NA 2VB6A 4H9PC 3JCFA 4IIJE 1YD8G 3QNUA 3LDQB 3AXJA 3ZT5A 2V7IA 2M67A 2FJBA 4CI2B 5LP6E 3ZMVB 5JDFA 3ZCJA 2Q9QA 5DJQC 4ADZA 4IE5A 3AE6A 1U5PA 4U7YA 3OVUA 5AQKB 3A8YC 3KBTA 1HTJF 3ZPOA 4HFEA 4CI3B 4X65T 4DO0A 4LFCT 1J5ET 2IAKA 3PUVF 3T1YT 2NTXA 4H9OC 1ZKEA 3CQGB 4IT4A 5F5WA 4IDQA 3C98B 2K48A 2XHEB 3C51A 3UU4A 4UV8B 3FZLB 4DUZT 3UTKA 4PJJA 1UGOA 2UU9T 4KX6A 3OTOT 1ZV4X 5L3GB 1E7PA 1OEDC 2BS3A 1UCUA 2LOSA 4NUVA 4DV2T 3OBVE 2ZMAA 2H3RA 2X0HA 2W67A 5FKYA 3ZMZB 2C5KT 5F3JA 1D0XA 2VKOA 3NRXA 2WMNA 4IE6A 1XMOT 2D0TA 5FP3A 2EHOA 2NR4A 3AEDA 3E22E 1AJ3A 2A72A 2NP9A 2XAQB 3U3IA 4AKIA 2DLRA 5LJMA 4GIWA 2WU5A 4UVCB 2BZBA 4TZ4C 4IDOA 4DBRA 3AE5A 5HYAA 3AVSA 2CXDA 5AQOB 3ZMTB 4A97A 2FJEA 3AA1B 3AE9A 4KUMB 2VKDA 1UK5A 5DQWA 4PJLA 2WAUA 3NWIA
chains in the Genus database with same CATH topology
4DUZT 5IWAT 1HNWT 2F4VT 1IBLT 1N36T 4B3MT 2UU9T 4B3TT 3OTOT 5LMNT 1IBMT 4DV2T 4DR6T 4GKKT 4JI3T 2VQFT 4YY3T 1N34T 4LFAT 4B3RT 2UXCT 4DR2T 4X64T 4JI4T 4AQYT 4JI6T 4DV0T 4JYAT 1XNQT 4X66T 4DV4T 4DR7T 4DR4T 2UXDT 4KHPT 4DUYT 1XMOT 1XNRT 4JI1T 4JI2T 4LF7T 1FJGT 1N32T 4NXMT 4JI0T 4LFBT 4DR1T 5BR8T 1IBKT 4DV3T 5LMUT 3T1HT 4LF6T 2UXBT 1I94T 4JI5T 4LF8T 1HNXT 2UUAT 1HR0T 2UUBT 1XMQT 1HNZT 4NXNT 2VQET 4K0KT 2UUCT 4DV1T 4LF4T 4X65T 4DV6T 4X62T 4GKJT 2E5LT 4LFCT 1J5ET 3T1YT 2ZM6T 4DV7T 4JI8T 4YHHT 4DR5T 4LF5T 2HHHT 4JV5T 4OX9T 1N33T 4LF9T 4DR3T 4DV5T 4B3ST 4JI7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DUZ T;  5IWA T;  1HNW T;  2F4V T;  1IBL T;  1N36 T;  4B3M T;  2UU9 T;  4B3T T;  3OTO T;  5LMN T;  1IBM T;  4DV2 T;  4DR6 T;  4GKK T;  4JI3 T;  2VQF T;  4YY3 T;  1N34 T;  4LFA T;  4B3R T;  2UXC T;  4DR2 T;  4X64 T;  4JI4 T;  4AQY T;  4JI6 T;  4DV0 T;  4JYA T;  1XNQ T;  4X66 T;  4DV4 T;  4DR7 T;  4DR4 T;  2UXD T;  4KHP T;  4DUY T;  1XMO T;  1XNR T;  4JI1 T;  4JI2 T;  4LF7 T;  1FJG T;  1N32 T;  4NXM T;  4JI0 T;  4LFB T;  4DR1 T;  5BR8 T;  1IBK T;  4DV3 T;  5LMU T;  3T1H T;  4LF6 T;  2UXB T;  1I94 T;  4JI5 T;  4LF8 T;  1HNX T;  2UUA T;  1HR0 T;  2UUB T;  1XMQ T;  1HNZ T;  4NXN T;  2VQE T;  4K0K T;  2UUC T;  4DV1 T;  4LF4 T;  4X65 T;  4DV6 T;  4X62 T;  4GKJ T;  2E5L T;  4LFC T;  1J5E T;  3T1Y T;  2ZM6 T;  4DV7 T;  4JI8 T;  4YHH T;  4DR5 T;  4LF5 T;  2HHH T;  4JV5 T;  4OX9 T;  1N33 T;  4LF9 T;  4DR3 T;  4DV5 T;  4B3S T;  4JI7 T; 
#chains in the Genus database with same CATH topology
 4QKN A;  2C0S A;  3L3P A;  1T8B A;  2LRL A;  2KSR A;  5JDG A;  3AE7 A;  5AQS B;  3QUJ A;  3RF1 A;  3UU6 A;  3QB5 A;  3Q5E A;  2UXC T;  3RX6 A;  2BBH A;  2LM2 A;  3VRB A;  2KWI B;  4EED A;  5FY7 A;  4HWC A;  3VHL A;  4DUY T;  2K9A A;  3LG7 A;  1G8X A;  1FJG T;  1MMA A;  4JUY A;  2YU1 A;  3OYZ A;  4UXN B;  3ETU A;  3L09 A;  3ZKR A;  2N2N A;  4V1A v;  1UX5 A;  2YEV C;  4LF8 T;  3KIN B;  3K8P C;  2XUE A;  1OED E;  5CA1 E;  2KZ7 B;  1WRD A;  3HL6 A;  3N2G E;  2X68 A;  1SE7 A;  5C8Y E;  1UUR A;  3P7I A;  1D1B A;  3N2O A;  1Y64 B;  3QB5 K;  4LMK A;  2G0U A;  4JEU B;  4PJN A;  3OKQ A;  3I1A A;  4UR9 A;  4U2Y A;  2I0M A;  3C4X A;  1N33 T;  3RI5 A;  4QH5 A;  3LBX B;  3P4P A;  5J1G A;  4ISS A;  4ERR A;  3KVB A;  2CRB A;  3BQI A;  1QUU A;  2LSJ A;  4DR6 T;  5TAO A;  2CHO A;  2W61 A;  5KX5 E;  4Z90 A;  1W09 A;  4IE0 A;  4BJM A;  3HKC E;  3JAF A;  4J2C A;  3RIU C;  5IUX A;  3FBL A;  3UQ7 A;  3C4Z A;  3MZK B;  3IF8 B;  1MIY A;  3VR9 A;  2V5C A;  5L3D B;  4GYR A;  1IBK T;  5HXS A;  4H9S E;  2IC9 A;  3T1H T;  1HF8 A;  2RP4 A;  2MBG A;  4TWD A;  1I94 T;  5M4Y A;  2W62 A;  5LGT B;  3AA6 B;  3CQC B;  2BG9 E;  4DBQ A;  3T8O A;  3PUZ F;  2VQE T;  5IYZ E;  3SFE A;  2MYS A;  5ABE A;  4ZZC A;  5KDM C;  4JLE A;  2XQ3 A;  5AQI B;  3R84 B;  4DND A;  5L2L A;  2ZM6 T;  2Y48 B;  1MMD A;  3RHW A;  5FL0 A;  1ZOY A;  4HTE A;  4TV8 E;  5DAB A;  4OX9 T;  4EOZ B;  3TLW A;  2RA1 A;  4I4T E;  4HWF A;  1SA0 E;  1HNW T;  2WU2 A;  3N9N A;  4QX8 B;  3FZK B;  5L4H A;  1SUM B;  2PTF A;  3ONJ A;  5EZY E;  3ZN1 B;  4CN6 A;  3QC9 A;  2H88 A;  4JI6 T;  5J0Z A;  2WY2 A;  4O4H E;  2LLY A;  4IRE A;  3NZQ A;  4PJM A;  4NPP A;  2XQY A;  2ACX A;  3LSV A;  4IL9 A;  4PFO A;  5F8P A;  2ZM0 A;  1MMN A;  1XWM A;  3ZYK A;  4O4L E;  3J9X 1;  1YQ3 A;  4EZ4 A;  3Q5D A;  2IML A;  3ZC1 A;  2IHR 1;  3KFW X;  4B6X A;  2XQ8 A;  4HFB A;  3C50 A;  2KIN B;  5JRE A;  2J47 A;  5CJ5 A;  2P9B A;  1W0B A;  3ZST A;  3I0O A;  3SWH A;  2XAF B;  2XQ5 A;  3ETV A;  4PNI A;  4CN4 A;  3GWH A;  2JPF A;  1ZHC A;  3BQK A;  3MA9 A;  2WCA A;  3ABV A;  2BG9 B;  2QGS A;  4E7Z A;  1KNP A;  2UXN B;  1WYC A;  3N9O A;  1NEN A;  5AQV B;  2X9H A;  4K0K T;  4LF4 T;  5HWY A;  1M7K A;  3LJC A;  3K1S A;  3AEA A;  2YKS A;  4E7S A;  4A5X A;  2VVN A;  4M1P A;  4TWH A;  5EK3 A;  4HGA A;  4U7I A;  3VKG A;  1YKE B;  4LF9 T;  4FJO A;  2LSI A;  2F4V T;  4WZX A;  2CXL A;  4YTP A;  2I59 A;  1E2A A;  4IE4 A;  5AQF B;  2CCQ A;  4KMC A;  5JRC A;  2YOE A;  3PUG A;  3L8R A;  2BBJ A;  3N9L A;  3CQX C;  1XNQ T;  3MKD A;  2D0U A;  1WFD A;  2LRK A;  3GN5 A;  5C2T A;  2W0G A;  2XTL A;  3EDU A;  4ILC A;  4JI2 T;  4DVD A;  1T7S A;  3AXJ B;  2X0Y A;  1LRZ A;  2KWH A;  2Q9Q B;  5H6R B;  1D1C A;  3B57 A;  4TV9 E;  5JDN A;  3EHZ A;  4CXY A;  2NW8 A;  2YN6 A;  5FNV E;  4EGW A;  3PUA A;  1XZY A;  4HEA A;  2UUB T;  2DI4 A;  3PUW F;  1WCR A;  1FEW A;  3TLS A;  2H7O A;  3Q2M A;  2E5L T;  2CWY A;  2ODV A;  4QH1 A;  4C91 A;  4DV7 T;  3P4R A;  1IJ5 A;  5GON E;  3PUX F;  4DR5 T;  3UUM A;  3NVO A;  2LHN A;  2HHH T;  4AQF C;  4U31 A;  4YSZ A;  2YK0 A;  4TN7 B;  1UUS A;  3AA0 B;  5HWX A;  2M6I A;  3I9W A;  3ONX A;  4OFZ A;  3O1I A;  3ZT7 A;  1HG5 A;  2BKN A;  2VKJ A;  3NZP A;  2E5V A;  3RKO A;  5FXX A;  5DQV A;  3RIF A;  3RQW A;  3HR0 A;  5FVK A;  2XPK A;  3AE3 A;  5HEJ A;  2PBI A;  2KMF A;  3ZMU B;  3R6N A;  2HH7 A;  4L9I A;  4X1I E;  4IE7 A;  5JDL A;  3F57 A;  2B76 A;  4HWI B;  2IC6 A;  2XQA A;  3RIU A;  3NRY A;  3M3Z B;  2DWG A;  4L0R A;  3X1D A;  3UT5 E;  1KEY A;  4LF6 T;  2CPT A;  2NTY A;  3AAE B;  3RLF F;  1WLX A;  3PJA A;  5LBQ B;  1BR0 A;  5FXV A;  2XM1 A;  3N5L A;  5CFB A;  1MMG A;  3DJB A;  3FZH B;  2LOP A;  4DV1 T;  2V26 A;  3O9X A;  2XSA A;  2LM9 A;  3RKG A;  3HKB E;  3MK7 C;  4BAY B;  5L3C B;  2DNX A;  2JQ9 A;  3Q5X A;  3ZC0 A;  5ABF A;  3ZSS A;  2ODU A;  4NIQ A;  4OYK A;  2V1D B;  2FUP A;  2D2S A;  3PV0 F;  1J1J A;  3O1J A;  2HPJ A;  1D0Z A;  2VAS A;  4QXC B;  1IBM T;  3BK9 A;  5HXR A;  5AQG B;  3M65 A;  3EAM A;  3PTR B;  4DR2 T;  4X64 T;  5L3B B;  4ZZB A;  4Z8X A;  2WMO A;  4TUY E;  2GK9 A;  4O2B E;  2V6Y B;  3AEE A;  3OPC A;  2JQK A;  4DR4 T;  4AI6 A;  5KMG P;  2BG9 C;  1D1A A;  1IZN B;  3MAC A;  5LBM A;  4HKA A;  3WI3 A;  1FMV A;  2NWB A;  2LSY A;  3ZEF B;  3VR8 A;  2L9Q A;  3RGL A;  4WBN E;  3HKE E;  4PW8 A;  3GMI A;  4QH4 A;  2LSG A;  3B13 A;  4ZEY A;  4EYU A;  2BDE A;  2NW9 A;  3P4Q A;  2UUA T;  5LYJ E;  4AKL A;  5J2T E;  3UUX B;  3S4U A;  3V5U A;  4U3C A;  4K0U A;  4ZI3 C;  5JDM A;  5AQU B;  2XY8 B;  2N9D A;  3KBU A;  4ILB A;  2XQ7 A;  2E9X B;  4JBW F;  1LVK A;  4H9Q C;  5LA6 E;  4O8S A;  4I55 E;  4ASK A;  4LF5 T;  2PJQ A;  4XBF B;  4JV5 T;  4X5T A;  2LEH A;  4ZI3 D;  3CIR A;  5FMN A;  3Q5W A;  4Q25 A;  4X1K E;  5EK4 A;  2VWA A;  5LNK A;  4IL4 A;  4UEL A;  2WWV A;  5AQR B;  4PK6 A;  2BVL A;  3QK6 A;  1VCS A;  2Q9Q C;  3P50 A;  1CHU A;  2L8K A;  2BS2 A;  2VL0 A;  3SFD A;  4X66 T;  5FXW A;  1MIW A;  4JI1 T;  2XAJ B;  2Q9Q D;  4TNV A;  5AQN B;  4GOU A;  4OK0 A;  4IDP A;  5JR9 A;  3RIA A;  3RQU A;  4U72 A;  1X9B A;  5L4E A;  3PJA J;  2W66 A;  2FJD A;  2BVM A;  4XAX B;  4N78 D;  2WS3 A;  3B5M A;  1KNR A;  2LT3 A;  2JIW A;  4O2A E;  1OWA A;  2Y6X A;  4C90 A;  4ZI7 E;  2XAG B;  2WSS V;  2WB5 A;  4EYY R;  4AIS A;  5C3J A;  4UF0 A;  2CBJ A;  5BMV E;  2YU2 A;  2DL1 A;  5L47 A;  4DMV A;  2E2A A;  4G63 A;  3HA4 A;  2V7L A;  1MIV A;  4ZHQ E;  4DR3 T;  1SHZ C;  2JRK A;  2ZM8 A;  4OHF A;  1D0Y A;  2XQ4 A;  5LOV E;  2V7K A;  4CI1 B;  5CA0 E;  1L0V A;  2LE8 A;  4YT0 A;  5FVL A;  2AXD S;  5AQT B;  4AQF A;  4CXX A;  2ZM2 A;  5LGU B;  1X79 A;  1VOM A;  2K3W A;  3GA8 A;  2EHO D;  3KV4 A;  3RC3 A;  2X9W A;  1S94 A;  5AQQ B;  3L39 A;  1IJ6 A;  2JJ9 A;  1WR0 A;  3RYH E;  5LB7 B;  2MAW A;  2V5D A;  4YJ3 E;  2LSK A;  4P0B A;  3ZCI A;  2V7M A;  1R8I A;  4NXM T;  2BS4 A;  1OED A;  4PK4 A;  5BR8 T;  4PAG A;  3FZF B;  4IGU A;  2CLY B;  4DV3 T;  3CKD A;  3N9P A;  5JTG A;  2IDO B;  4JI5 T;  4Z91 A;  4YTN A;  1LVF A;  5KXJ A;  2VVS A;  2N1G A;  4EEB A;  4H63 H;  2NOX A;  4X62 T;  1BR1 A;  3AB3 B;  3VU7 H;  2DWK A;  3SRZ A;  4P1N A;  4YSY A;  1KK7 A;  4AIU A;  1W0A A;  3UU5 A;  2CXF A;  2KXP B;  1HCI A;  4FI5 A;  4CZZ B;  2IW5 B;  3PUS A;  2YDQ A;  5AQJ B;  3IBP A;  3H3A A;  4DV5 T;  4B3S T;  5IWA T;  4AKR B;  2J4G A;  4QHO A;  3E08 A;  5JRC B;  3AEB A;  4F8H A;  2KT9 A;  4LMJ A;  4I0U A;  3PDY A;  4TWF A;  5HEH A;  2QYW A;  1MND A;  4LFA T;  4WW0 A;  1WYB A;  3J7Y q;  5ADX L;  2FBW A;  1BR2 A;  3P4S A;  3AEF A;  1E1H B;  2A2F X;  4KHP T;  3ANW A;  5AQL B;  2X66 A;  4EAH A;  3PUY F;  4YHJ A;  4LF7 T;  4ZI2 C;  4H9R C;  2A9U A;  4HFH A;  1IAP A;  4IHJ E;  3C4W A;  3EUH A;  2WDV A;  2BG9 A;  3V5S A;  2E9X C;  4PFP A;  3I0Q A;  1NAF A;  3CX7 B;  3KDS E;  5A1L A;  2XAH B;  3PU3 A;  4ZI2 D;  2XAS B;  2QRX A;  5IHY A;  4U33 A;  4QX7 B;  1Z8U A;  3UFG A;  4QWN B;  3FB2 A;  3RPU A;  2E9X D;  1XMQ T;  3PU8 A;  4DV6 T;  5HEU A;  2Y8D A;  5HEO A;  4WYV A;  1T98 A;  4UVB B;  2OLT A;  2XQ9 A;  3FXE B;  5HAX A;  1BR4 A;  2IIU A;  4HWH A;  4KBM B;  2AE9 A;  3CWZ B;  3RRC A;  3ZN0 B;  3KV5 A;  2DCF A;  3A7M A;  2CM0 A;  2YDS A;  4O4J E;  4EXT A;  3AVR A;  4JI4 T;  4YTM A;  4JYA T;  3PUQ A;  4HWD A;  3U78 A;  4EB6 E;  1W9R A;  3I9Y A;  1EZ3 A;  3AE1 A;  1XNR T;  3F31 A;  1YQ4 A;  3AE2 A;  3P4W A;  2L3L A;  3C64 A;  3RYF E;  4EIW A;  4X1Y E;  4KHZ F;  3UUL A;  4ANJ A;  2BKP A;  2WZH A;  4DR1 T;  2CWO A;  2K24 A;  2K5B B;  5L3F B;  3ZLI A;  2OA5 A;  3ZT6 A;  4PK5 A;  2EHO B;  4DID B;  2UXB T;  2KLQ A;  1HR0 T;  5LXT E;  5FYM A;  4NXN T;  3CVR A;  2J62 A;  4GYS A;  1KNZ A;  1KFY A;  1S35 A;  1T72 A;  5HCJ A;  2WDQ A;  5ABF B;  3RH3 A;  4JI8 T;  4TX5 A;  2PG8 A;  2CE7 A;  3ZJ2 A;  3KV6 A;  2QVA A;  2C5J A;  4JI7 T;  3CK6 A;  4MAL A;  1H7C A;  3TLU A;  4BJN A;  5LCY A;  2CHN A;  3DTO A;  5LMN T;  3KVA A;  1XDP A;  3PUR A;  1NEK A;  3AEG A;  2V7J A;  3UU3 A;  2VQF T;  4B3R T;  1FIO A;  4I43 B;  2CLY C;  2J1D G;  4DV0 T;  2X9X A;  3IHR A;  1HX8 A;  5E0O A;  5LG4 A;  5JDH A;  5LHH B;  4CN1 A;  3FBZ A;  5FY0 A;  4O4I E;  2LKG A;  2JMK A;  2X9Y A;  4WNK A;  5LGN B;  5J2U E;  3HI2 A;  1N32 T;  3TLT A;  4JI0 T;  5JH7 E;  2W63 A;  4LFB T;  4X20 E;  2KND A;  2MTQ A;  2A3D A;  5H6Q B;  1V9D A;  2WZI A;  3O4X E;  2VUR A;  2JMH A;  4YFS A;  4F6R C;  3EI0 A;  3OJA A;  3P8C D;  5L3E B;  1FMW A;  2UXX B;  3CX8 B;  5AQM B;  3QOF A;  3JC6 C;  4IDZ A;  3JAE A;  5JVD E;  4AKG A;  3E0Z A;  1I6Z A;  3N2K E;  2RPA A;  2JQQ A;  4LML A;  3G06 A;  1HFA A;  2CA5 A;  4EV6 A;  4QXB B;  4YXD A;  3N9M A;  1YW0 A;  2MPK A;  4ZOL E;  3JC6 D;  2LJL A;  1IBL T;  1N36 T;  3RYI E;  2V6Y A;  2R6G F;  4IDN A;  1DU2 A;  2X0L B;  3RRW A;  4U2Z A;  1JNZ A;  2WP9 A;  1HG2 A;  5FY1 A;  3UUB A;  4A98 A;  3WAJ A;  1Z0P A;  5AQH B;  4DV4 T;  2XM2 A;  3FZM B;  4ZS2 A;  3MJX A;  3SOL A;  2D5U A;  3EVY A;  4MFR A;  2W2U A;  5LJN A;  3KV9 A;  2LKH A;  5JR9 B;  1GQE A;  4HFC A;  3WAK A;  1WR6 A;  2HN1 A;  2ZLY A;  2WWU A;  4H63 V;  5ABG A;  2WQY A;  1YKH B;  4GK5 E;  4I50 E;  3EAB A;  3OYX A;  3AAA B;  4BA9 A;  2E9X A;  4ILA A;  3VKH A;  3SS1 A;  2CBI A;  2XQ6 A;  4MHC A;  2VK9 A;  4UF0 B;  4YLH A;  5HXC A;  3LK4 2;  4P09 A;  3AEC A;  4WBO A;  3AAI A;  4MBQ A;  4KP3 C;  2ACZ A;  1JNR A;  3W15 B;  4YJ2 E;  2YIN A;  4UEM A;  4DMW A;  2W4X A;  4G2A A;  4L5G A;  3CML A;  4HE8 A;  3EDV A;  3ZMS B;  3D0T A;  2HN2 A;  1J5W A;  1UX4 A;  3IA3 A;  1OXZ A;  2BKO A;  2V8S V;  1M62 A;  2XJ7 A;  3LK2 B;  5LHG B;  4B3M T;  4HFV A;  4B3T T;  2I6H A;  3CX6 B;  3LBX A;  2H7V C;  5LG3 A;  5HCM A;  1Y01 A;  4HFD A;  2X67 A;  4COF A;  4UV9 B;  1N34 T;  3IEE A;  3VRA A;  4AQY T;  3TKL B;  2EHO C;  1XDO A;  4DR7 T;  1CUN A;  4TNW A;  3UUN A;  3BQL A;  4HFI A;  1NWM X;  3MXZ A;  3H3M A;  1ZP0 A;  2CMR A;  1OED B;  2CEA A;  2D9D A;  3LK3 B;  4KI0 F;  2FJA A;  3TLV A;  1LKX A;  3FHN A;  2VL8 A;  2XZE A;  2OV9 A;  2WBL A;  1HS7 A;  1QLB A;  1VCT A;  2HPL A;  2JQH A;  4YSX A;  4AKH A;  3AE4 A;  2WM9 A;  4NUU A;  2E8I A;  1HNZ T;  3CPZ A;  4P0A A;  3NBX X;  1YXR A;  2UUC T;  4GKJ T;  2IUB A;  1VRB A;  2ES0 A;  2X51 A;  3HKD E;  5LHI B;  3UU8 A;  2XSB A;  5CB4 E;  1MNE A;  3AA7 B;  2VKH A;  4GK0 E;  5FL1 A;  1O3X A;  4A56 A;  4U74 A;  3ZYM A;  3Q9D A;  4JI3 T;  4HN9 A;  4YY3 T;  2C5I T;  5AQP B;  1KF6 A;  2SPC A;  3UQ4 A;  1ZEE A;  3ANW B;  2LHR A;  2PFV A;  4UVA B;  3O1H A;  3LFM A;  2UXD T;  5HXH A;  2YDR A;  3FXD B;  3ESL A;  4MLK A;  2QA7 A;  4QXH B;  3AE8 A;  3DP7 A;  4ZXL A;  3GN5 B;  5AFU L;  2V6X A;  5LMU T;  5FXZ A;  3H37 A;  1HX1 B;  1G73 A;  4ZS3 A;  4UIG A;  2M6B A;  1HNX T;  4H9N C;  2WDR A;  4ILU A;  5HEG A;  2W00 A;  5CGM A;  1QSD A;  3A5X A;  3ONL C;  3JAD A;  4CXW A;  3UFE A;  2Z6E A;  3RC8 A;  1B7T A;  4AXP A;  4YHH T;  4JEH B;  4OYJ A;  3ZJ1 A;  5ETW A;  3F2E A;  3RYC E;  3PE0 A;  2DHR A;  1US7 B;  5JR9 C;  4GKK T;  5HXE A;  4CQI A;  2NW7 A;  4EZH A;  5EK2 A;  3K3Q C;  4IST A;  3ZYL A;  5JQG E;  4XZC A;  3K3O A;  2B1E A;  3NKZ A;  2H89 A;  2MOZ A;  1U4Q A;  5ABH A;  5JDQ A;  3N9Q A;  4AQG A;  3K3N A;  2VB6 A;  4H9P C;  3JCF A;  4IIJ E;  1YD8 G;  3QNU A;  3LDQ B;  3AXJ A;  3ZT5 A;  2V7I A;  2M67 A;  2FJB A;  4CI2 B;  5LP6 E;  3ZMV B;  5JDF A;  3ZCJ A;  2Q9Q A;  5DJQ C;  4ADZ A;  4IE5 A;  3AE6 A;  1U5P A;  4U7Y A;  3OVU A;  5AQK B;  3A8Y C;  3KBT A;  1HTJ F;  3ZPO A;  4HFE A;  4CI3 B;  4X65 T;  4DO0 A;  4LFC T;  1J5E T;  2IAK A;  3PUV F;  3T1Y T;  2NTX A;  4H9O C;  1ZKE A;  3CQG B;  4IT4 A;  5F5W A;  4IDQ A;  3C98 B;  2K48 A;  2XHE B;  3C51 A;  3UU4 A;  4UV8 B;  3FZL B;  4DUZ T;  3UTK A;  4PJJ A;  1UGO A;  2UU9 T;  4KX6 A;  3OTO T;  1ZV4 X;  5L3G B;  1E7P A;  1OED C;  2BS3 A;  1UCU A;  2LOS A;  4NUV A;  4DV2 T;  3OBV E;  2ZMA A;  2H3R A;  2X0H A;  2W67 A;  5FKY A;  3ZMZ B;  2C5K T;  5F3J A;  1D0X A;  2VKO A;  3NRX A;  2WMN A;  4IE6 A;  1XMO T;  2D0T A;  5FP3 A;  2EHO A;  2NR4 A;  3AED A;  3E22 E;  1AJ3 A;  2A72 A;  2NP9 A;  2XAQ B;  3U3I A;  4AKI A;  2DLR A;  5LJM A;  4GIW A;  2WU5 A;  4UVC B;  2BZB A;  4TZ4 C;  4IDO A;  4DBR A;  3AE5 A;  5HYA A;  3AVS A;  2CXD A;  5AQO B;  3ZMT B;  4A97 A;  2FJE A;  3AA1 B;  3AE9 A;  4KUM B;  2VKD A;  1UK5 A;  5DQW A;  4PJL A;  2WAU A;  3NWI A; 
#chains in the Genus database with same CATH homology
 4DUZ T;  5IWA T;  1HNW T;  2F4V T;  1IBL T;  1N36 T;  4B3M T;  2UU9 T;  4B3T T;  3OTO T;  5LMN T;  1IBM T;  4DV2 T;  4DR6 T;  4GKK T;  4JI3 T;  2VQF T;  4YY3 T;  1N34 T;  4LFA T;  4B3R T;  2UXC T;  4DR2 T;  4X64 T;  4JI4 T;  4AQY T;  4JI6 T;  4DV0 T;  4JYA T;  1XNQ T;  4X66 T;  4DV4 T;  4DR7 T;  4DR4 T;  2UXD T;  4KHP T;  4DUY T;  1XMO T;  1XNR T;  4JI1 T;  4JI2 T;  4LF7 T;  1FJG T;  1N32 T;  4NXM T;  4JI0 T;  4LFB T;  4DR1 T;  5BR8 T;  1IBK T;  4DV3 T;  5LMU T;  3T1H T;  4LF6 T;  2UXB T;  1I94 T;  4JI5 T;  4LF8 T;  1HNX T;  2UUA T;  1HR0 T;  2UUB T;  1XMQ T;  1HNZ T;  4NXN T;  2VQE T;  4K0K T;  2UUC T;  4DV1 T;  4LF4 T;  4X65 T;  4DV6 T;  4X62 T;  4GKJ T;  2E5L T;  4LFC T;  1J5E T;  3T1Y T;  2ZM6 T;  4DV7 T;  4JI8 T;  4YHH T;  4DR5 T;  4LF5 T;  2HHH T;  4JV5 T;  4OX9 T;  1N33 T;  4LF9 T;  4DR3 T;  4DV5 T;  4B3S T;  4JI7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...