1N34T

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of codon and crystallographically disordered near-cognate transfer rna anticodon stem-loop mismatched at the first codon position
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
molecule tags Ribosome
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n34T00
1HNZT 4B3TT 4LFAT 4JI2T 4YHHT 4JI0T 4DR7T 4DV7T 1HNWT 4DUZT 4B3ST 1XNQT 2UUCT 5LMNT 4OX9T 1HNXT 2UUAT 3T1HT 4JI7T 1N36T 2HHHT 4LF6T 1IBLT 4DV1T 1IBMT 1IBKT 4DR6T 2UXBT 4K0KT 2UXDT 4JI4T 4B3RT 2UU9T 4DR2T 4JYAT 2VQET 4DV2T 4DR1T 2E5LT 4AQYT 1FJGT 4DUYT 4NXMT 4DV4T 4X65T 4DV3T 4GKKT 4DV0T 2UXCT 4DV6T 4JI5T 4NXNT 4B3MT 1N32T 1XMQT 4LF9T 1J5ET 5IWAT 1N34T 4JI1T 3OTOT 5LMUT 4DV5T 3T1YT 4LF7T 4JV5T 4YY3T 4X62T 2ZM6T 4JI3T 4X66T 1XMOT 4KHPT 1I94T 2UUBT 4LFCT 4JI8T 4GKJT 4LFBT 4LF4T 4DR4T 5BR8T 2VQFT 4LF8T 1N33T 4DR3T 1HR0T 4JI6T 4X64T 2F4VT 4LF5T 1XNRT 4DR5T
chains in the Genus database with same CATH superfamily
5JDLA 3I1AA 4ANJA 2NW9A 5F3JA 5AQOB 4HFVA 4QWNB 3CPZA 1MNDA 4OX9T 2XQ9A 5IHYA 4TV8E 5KDMC 2CHOA 3ZMUB 3AE8A 2N1GA 2LSKA 1D1AA 2FJBA 2V5DA 2A72A 2DL1A 5FL0A 2E9XA 1ZEEA 3LK42 4TZ4C 2BKPA 5FY1A 2KT9A 2CXFA 5AQSB 5HXCA 1MIVA 3C64A 4PNIA 4HFBA 2A2FX 3Q5EA 4X65T 3QB5A 2ACZA 4CXWA 1SE7A 3N9MA 1QSDA 2FJEA 3HKBE 2FJAA 2H7OA 2W0GA 4J2CA 2X66A 3NWIA 3OTOT 1DU2A 3C50A 5FKYA 1UURA 3AVRA 4AKGA 3QB5K 3F31A 3IEEA 2RP4A 3UTKA 2NW7A 2ES0A 2BZBA 2X67A 2CLYC 2VL0A 3K3QC 4IREA 2LEHA 1OXZA 1OEDB 2UXXB 4AKHA 1KEYA 4KI0F 2VKHA 1HNXT 3EDUA 3UFEA 2JIWA 3L8RA 2XQ3A 3EABA 4QXHB 3SRZA 2VKDA 2K9AA 3KV4A 5DABA 5CB4E 2CE7A 4XBFB 4ZI3D 2NOXA 1UGOA 3PJAJ 3DP7A 4DV2T 3PV0F 1VCTA 5CGMA 3N5LA 2XY8B 4CQIA 4DV4T 2YKSA 3F2EA 2XQ7A 3K3OA 3SOLA 1KFYA 2W2UA 3N9QA 2W00A 2RA1A 2N2NA 3BQLA 3AE9A 1B7TA 4HEAA 3L09A 1L0VA 5AQRB 4YLHA 5L4HA 3UU4A 4YY3T 4AKRB 3JC6C 3RIFA 2BS4A 5FY7A 5JDMA 3W15B 2L8KA 4BJMA 3AE4A 2BBJA 4U7IA 5L3DB 2DWGA 3UU5A 4ZI2D 5EK4A 4Z90A 1HNZT 1D1BA 1V9DA 2DWKA 3AA7B 3CIRA 5LBQB 4YHHT 4UIGA 4DUZT 3CK6A 3CWZB 3OJAA 4ILUA 4FJOA 3M65A 4MLKA 3RYIE 5FNVE 4QHOA 1YXRA 3RIUC 3NVOA 1OEDA 5L47A 2MYSA 3NRYA 3AEFA 5L3BB 2WAUA 3AVSA 3UFGA 1W9RA 2D0TA 3AEEA 4B6XA 3ABVA 5FY0A 3JADA 4EZ4A 1HG5A 4L9IA 1WCRA 3RQWA 5AFUL 2XM1A 5J2TE 2IIUA 4P09A 5E0OA 2JMHA 4GKKT 2CEAA 4IGUA 3LK3B 5FMNA 4CI2B 3Q5XA 4TWHA 2MAWA 4HWIB 2X9WA 4X1YE 1YQ3A 2D9DA 2ZM6T 3I0OA 4UEMA 4JEHB 1T72A 4O4IE 1HFAA 4JI8T 3MK7C 2WZHA 1CHUA 5LA6E 5ABGA 5HXHA 4JI6T 4PAGA 3AEGA 1R8IA 4EZHA 2C0SA 3KFWX 5GONE 4JLEA 2IDOB 4IE5A 1J5WA 3AE6A 3CQXC 2IAKA 3V5UA 1T98A 1N36T 5KMGP 4H9PC 4DV1T 3PUYF 4X1KE 2SPCA 4ILCA 1VRBA 3ZCIA 2UXBT 3ZCJA 3RH3A 4HFIA 4H9NC 3ZC0A 2WDRA 4IIJE 2LSYA 2W66A 4K0UA 1IAPA 3OVUA 4H63V 3J7Yq 5J2UE 3WAJA 2JQ9A 2VVNA 4EOZB 3MJXA 4DUYT 3KDSE 4GIWA 5LNKA 1D0ZA 3GN5A 3R84B 4ZI3C 5LB7B 4HKAA 1ZP0A 2JMKA 5AQJB 3TLTA 4EGWA 4PJJA 2ZM0A 5IWAT 3AEBA 5J0ZA 4AI6A 3VKHA 1OEDC 2MTQA 4O4JE 1XDPA 1LVKA 1OEDE 2LSGA 2NWBA 4YJ2E 2IMLA 3IF8B 1D1CA 3AXJA 1HCIA 4CI1B 1FIOA 3ZT7A 3Q5WA 4KX6A 4DR3T 5KX5E 2V5CA 3MKDA 3M3ZB 3Q9DA 5LBMA 4KUMB 4HE8A 4DV7T 2DNXA 2Y8DA 4AKIA 3TLUA 3HA4A 4TX5A 4EEBA 2IC6A 4C91A 4JI7T 3GA8A 4ZI2C 2XQ6A 2DI4A 2Q9QB 1IBKT 4DR6T 3ONLC 4IE0A 3E22E 3I0QA 2CCQA 3UULA 5C8YE 2WU2A 4WZXA 4ZHQE 2CRBA 4CN1A 3CVRA 5AQPB 4TUYE 2MOZA 2KSRA 3NKZA 2NR4A 4GOUA 3AAAB 4ISTA 4WNKA 4XZCA 5EK3A 4ZXLA 3LK2B 1N32T 3LSVA 4LF9T 2ZM2A 3VKGA 2Z6EA 4HFHA 3TLWA 2CXDA 2I6HA 3ZC1A 4U72A 3QC9A 5AQNB 2C5KT 4JI3T 4KMCA 4OFZA 1E2AA 3WI3A 5AQLB 2E9XD 5ETWA 5JR9B 3P8CD 5ABHA 4QX8B 3CX7B 1WYBA 4I43B 5ABEA 5FP3A 2CXLA 4DBQA 3VR8A 5LGUB 4O8SA 1IJ6A 4QH4A 5ABFA 5L4EA 2C5JA 5EZYE 2HH7A 4U2YA 2IUBA 4IDZA 1MNEA 1S35A 3RI5A 5AQIB 2BDEA 3T1HT 4U74A 1D0XA 5JDFA 4COFA 3LJCA 3E0ZA 4A98A 3SFDA 3H37A 1YD8G 3ZEFB 4H63H 1KF6A 4ZZCA 3IA3A 5CA0E 3NZQA 3FZFB 2UU9T 2WQYA 4DR2T 4TNVA 4IDQA 2YU2A 5DQWA 3EI0A 2KINB 2CMRA 5HXEA 5CFBA 2V6XA 5JH7E 3PUQA 4DMWA 4UVBB 3UU3A 2IHR1 1XMQT 2D5UA 3PU8A 3DJBA 2W61A 3J9X1 2KMFA 1WLXA 3ETUA 4JV5T 5J1GA 3AE7A 4DBRA 3HKDE 1G8XA 4DMVA 4H9QC 3F57A 3LBXB 3P50A 4IE6A 4CZZB 5HEGA 4LF8T 2J62A 2F4VT 2E8IA 3UUMA 3KV9A 4TN7B 5L3EB 1U5PA 2HPLA 3O1HA 5JR9A 5LMNT 2Y48B 3FZHB 1US7B 1NEKA 2CPTA 4U3CA 4ZS3A 2XAJB 4IDNA 4WBOA 3VRBA 1NAFA 3U78A 4ILBA 4HWHA 1UK5A 4TNWA 4B3RT 3K8PC 2L9QA 2JQQA 2VVSA 2G0UA 2WCAA 3PTRB 3PJAA 3H3MA 2YEVC 4YJ3E 2VASA 3RC3A 4Q25A 2OA5A 4C90A 4NXNT 5ADXL 3FZLB 3PUGA 5AQUB 4UF0B 1XZYA 2VWAA 1WFDA 3ZKRA 5HEJA 2R6GF 2HN2A 2DCFA 4GYSA 4QXCB 5LHHB 3BQIA 3O9XA 4X62T 4BA9A 1HG2A 2E2AA 4YSZA 4MHCA 5JDNA 1Y01A 4KHPT 4ZOLE 4LFCT 2BG9B 3CX6B 2VKJA 4OYKA 2K3WA 3Q5DA 5LG3A 2XHEB 4PFPA 1XNRT 1IJ5A 2M6BA 1LVFA 5LHGB 1KNZA 2CWYA 1S94A 5FYMA 4PJLA 3NRXA 2E9XC 4P0AA 1VCSA 2M67A 4EB6E 5L2LA 1ZHCA 3PUWF 1HX1B 5FVKA 1UCUA 3VHLA 4PJMA 2WM9A 2NP9A 4P1NA 4F6RC 3PUSA 4U7YA 5H6QB 5HEOA 4IE7A 1H7CA 2KLQA 2EHOB 2VQET 4IHJE 3OPCA 2LRKA 2P9BA 2VKOA 4GK5E 2X0YA 3AA1B 1HF8A 4YT0A 2XQYA 4ISSA 2J4GA 1YKEB 2JPFA 2YDRA 1FMWA 3EHZA 2WMNA 3OKQA 2ZLYA 4O4LE 5HEHA 3KV5A 4IT4A 3TKLB 3B13A 1W0BA 4LMLA 2YOEA 5LJNA 3CQCB 4UF0A 3FZMB 4NUVA 3FBZA 5LG4A 2KWIB 3AAIA 5LGNB 4X64T 4WYVA 4YHJA 3ESLA 4G2AA 3EAMA 5HXSA 3VR9A 3CKDA 2WBLA 4NPPA 5HAXA 3N9PA 3OYZA 2BG9A 3RRWA 3P4WA 4I55E 3K3NA 4QKNA 2X0LB 5HWYA 4I4TE 2YDSA 4UVAB 5LCYA 2X9HA 3ANWB 3N9OA 2VB6A 2PBIA 2CBJA 2WWVA 2FUPA 5LP6E 4HFCA 4U31A 4O4HE 4EEDA 3DTOA 1HTJF 3AB3B 3AEDA 4KHZF 4YFSA 3P4RA 3N9LA 2UXCT 2QA7A 4DO0A 2EHOA 3AEAA 3R6NA 1Y64B 4ADZA 3UT5E 3OYXA 3PDYA 5AQMB 3RF1A 2LHRA 2KZ7B 4U2ZA 1MIYA 4H9SE 2H89A 3CX8B 4X5TA 3MZKB 4AQGA 1YKHB 4A5XA 5AQQB 4OHFA 4EXTA 2V7KA 2W62A 4GKJT 2UXNB 2A3DA 4EV6A 3QK6A 5HWXA 3RGLA 1N33T 1HR0T 2LSJA 2WDQA 5JDGA 2OV9A 4DR7T 1W0AA 3KV6A 2XZEA 4HTEA 4LMKA 5FXVA 4JBWF 2XAFB 2HHHT 5AQKB 4TWDA 3RRCA 5L3GB 2LM2A 3AE5A 3ZJ1A 2ODVA 3OBVE 2X9YA 2QGSA 4K0KT 4I0UA 1BR2A 3RYHE 4ZI7E 3LDQB 2B76A 2JJ9A 1MMGA 2WMOA 2X9XA 4KP3C 5C3JA 4DR1T 1KNRA 3BK9A 3ZMVB 1FJGT 3AE2A 3AECA 3LG7A 4DV0T 5JVDE 4B3MT 1SUMB 3L3PA 5LXTE 5JQGE 5HYAA 4HGAA 2I0MA 4V1Av 3ZYKA 3PUZF 2LM9A 2W67A 2I59A 2AE9A 2XSAA 3T1YT 2CBIA 4ZZBA 4MFRA 4Z91A 3WAKA 4KBMB 2UUBT 4BAYB 3IBPA 2L3LA 5FXZA 1OWAA 2Q9QD 5DJQC 4YTNA 4JI0T 5H6RB 2XPKA 2KWHA 4FI5A 2XTLA 4H9RC 3RIAA 2X0HA 1X79A 4CN6A 4LF6T 1IBLT 4EYUA 1KK7A 3O4XE 3P4QA 2BVLA 2B1EA 3N2OA 4JI4T 2M6IA 2GK9A 1MMDA 2WDVA 2JRKA 1MIWA 2BS3A 5A1LA 4AQFA 1I6ZA 2NTYA 4AQYT 2V1DB 2ACXA 3H3AA 3HKEE 3KINB 3FZKB 4XAXB 4L0RA 3B5MA 2DLRA 3BQKA 3JAFA 2LT3A 2HN1A 2KNDA 1N34T 3C4WA 3ZN0B 1U4QA 2Q9QA 5AQVB 3P4PA 4F8HA 3RKOA 5DQVA 5FXWA 2X68A 3UUBA 4L5GA 3AE3A 3A7MA 4TWFA 2WP9A 5AQTB 3VU7H 3QUJA 5AQHB 4NIQA 2DHRA 3JAEA 2XJ7A 2LHNA 2LJLA 4LF5T 3SWHA 4IL9A 4LMJA 1LRZA 4B3ST 3PURA 4H9OC 3I9YA 2CHNA 3NBXX 2K24A 2K5BB 1G73A 4TV9E 1IBMT 3EUHA 3P7IA 2QRXA 3SFEA 2PJQA 5BMVE 2V6YB 4O2AE 1T7SA 3PUVF 4JYAT 2YDQA 5FXXA 1J1JA 1ZV4X 3ZPOA 4HN9A 3RIUA 2WY2A 4NXMT 2V7MA 4HWFA 4DV3T 4DV6T 1FMVA 5F5WA 3UU6A 3TLVA 1BR0A 1J5ET 2ODUA 1JNZA 1UUSA 2J1DG 4P0BA 3MACA 3NZPA 3MA9A 2K48A 5LHIB 2MBGA 4YXDA 1E7PA 4X66T 5IUXA 4IDOA 2XAQB 5F8PA 3ONXA 4AQFC 2VQFT 2H88A 2J47A 1QLBA 2BBHA 2LE8A 2RPAA 4LFAT 2D0UA 4AISA 3ZYLA 2WSSV 2AXDS 1BR1A 4UXNB 3FXEB 2WU5A 3A8YC 2XAHB 2ZM8A 2Q9QC 4YTMA 5LJMA 1CUNA 1E1HB 3FXDB 3AA0B 3AAEB 2UXDT 1LKXA 2WS3A 3LBXA 2NW8A 1EZ3A 3TLSA 3ZLIA 4HFEA 4BJNA 2Y6XA 4O2BE 2D2SA 3U3IA 1SA0E 2LKGA 2FBWA 1ZOYA 4AIUA 3UUNA 3GWHA 2V6YA 1SHZC 4I50E 4JI5T 3HKCE 1AJ3A 2NTXA 2WWUA 4CXYA 4ZEYA 4CI3B 4JI1T 4X1IE 5LMUT 5JRCB 2PTFA 3KBTA 4IDPA 4ASKA 2FJDA 3SS1A 2MPKA 5CJ5A 5JR9C 3O1JA 1VOMA 4DR4T 4DR5T 3ONJA 3LFMA 2YINA 2H3RA 4JI2T 3GN5B 2V7LA 3B57A 1XNQT 2XAGB 4IL4A 4PW8A 3RYCE 5FL1A 3V5SA 4YSXA 2W63A 4HWDA 4X20E 2EHOD 3RC8A 3L39A 4U33A 5KXJA 3I9WA 4PJNA 5EK2A 5JDHA 4G63A 3FHNA 1M7KA 3ZMTB 3ZMZB 1Z0PA 1WR0A 3RHWA 4PFOA 3ETVA 3AXJB 3ZYMA 4MALA 4CXXA 2E5LT 3CMLA 4CN4A 1QUUA 2JQHA 1FEWA 4PK6A 4E7SA 2CM0A 4N78D 2LOSA 3D0TA 2E5VA 2IW5B 3EVYA 3UUXB 4PK5A 3CQGB 4Z8XA 3O1IA 5LYJE 2LLYA 3QOFA 1KNPA 1WR6A 2LRLA 3Q2MA 3EDVA 1HS7A 3RQUA 2BS2A 2BKOA 2QYWA 4QX7B 2XQ5A 2BKNA 4OYJA 5JRCA 4AKLA 4JUYA 1YW0A 4A97A 4DIDB 3RX6A 2N9DA 4LF4T 4WBNE 2JQKA 2XQAA 3K1SA 3RYFE 2H7VC 4B3TT 4QH1A 2XSBA 3FBLA 3PU3A 4OK0A 2BVMA 1MMNA 1WRDA 2V7JA 5FVLA 4QXBB 5AQFB 3C4ZA 3ZMSB 4IE4A 4EAHA 2V8SV 4UELA 2UUAT 2V7IA 3C51A 4PK4A 3G06A 4UR9A 2CLYB 2OLTA 3S4UA 1O3XA 3C98B 1GQEA 3HL6A 1T8BA 2IC9A 2YN6A 4NUUA 4QH5A 2VK9A 4UV9B 4GYRA 4HFDA 1BR4A 3A5XA 2VURA 3KVAA 3JCFA 5LGTB 2C5IT 3AE1A 1XWMA 2LSIA 2CWOA 3E08A 1UX5A 3N9NA 5ABFB 3HI2A 2ZMAA 1IZNB 5TAOA 5JREA 2VL8A 5HCJA 4ERRA 3ZSTA 3PUXF 4LF7T 1M62A 3VRAA 3ANWA 2KXPB 3N2GE 1I94T 2BG9C 1NENA 4GK0E 3P4SA 2LOPA 4LFBT 3QNUA 2QVAA 5C2TA 2BG9E 4HWCA 1HX8A 1Z8UA 2A9UA 5HXRA 5HCMA 1W09A 1HNWT 1ZKEA 3AA6B 4AXPA 2UUCT 2E9XB 4EYYR 2YK0A 3RKGA 3N2KE 1NWMX 5IYZE 4ZS2A 2V26A 5M4YA 3KBUA 3ZN1B 3MXZA 4WW0A 4EIWA 4DVDA 2PFVA 3UU8A 3X1DA 2PG8A 2X51A 2EHOC 1WYCA 3UQ7A 3GMIA 4YTPA 5CA1E 4YSYA 3UQ4A 2XQ4A 5AQGB 1UX4A 3ZSSA 1YQ4A 4MBQA 3ZJ2A 2LKHA 1MMAA 4ILAA 2XM2A 5L3CB 4UVCB 3HR0A 3JC6D 4M1PA 5LOVE 4A56A 2WZIA 2CA5A 3FB2A 1JNRA 2XQ8A 3ZT6A 2XASB 1D0YA 4DV5T 3C4XA 5L3FB 2XUEA 3T8OA 3RPUA 2YU1A 3PE0A 4JEUB 2W4XA 3RLFF 3ZT5A 1XMOT 2HPJA 4DNDA 5JDQA 3KVBA 1X9BA 3IHRA 4UV8B 3PUAA 5HEUA 5BR8T 5JTGA 2WB5A 1XDOA 4E7ZA
chains in the Genus database with same CATH topology
1HNZT 4B3TT 4LFAT 4JI2T 4YHHT 4JI0T 4DR7T 4DV7T 1HNWT 4DUZT 4B3ST 1XNQT 2UUCT 5LMNT 4OX9T 1HNXT 2UUAT 3T1HT 4JI7T 1N36T 2HHHT 4LF6T 1IBLT 4DV1T 1IBMT 1IBKT 4DR6T 2UXBT 4K0KT 2UXDT 4JI4T 4B3RT 2UU9T 4DR2T 4JYAT 2VQET 4DV2T 4DR1T 2E5LT 4AQYT 1FJGT 4DUYT 4NXMT 4DV4T 4X65T 4DV3T 4GKKT 4DV0T 2UXCT 4DV6T 4JI5T 4NXNT 4B3MT 1N32T 1XMQT 4LF9T 1J5ET 5IWAT 1N34T 4JI1T 3OTOT 5LMUT 4DV5T 3T1YT 4LF7T 4JV5T 4YY3T 4X62T 2ZM6T 4JI3T 4X66T 1XMOT 4KHPT 1I94T 2UUBT 4LFCT 4JI8T 4GKJT 4LFBT 4LF4T 4DR4T 5BR8T 2VQFT 4LF8T 1N33T 4DR3T 1HR0T 4JI6T 4X64T 2F4VT 4LF5T 1XNRT 4DR5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  4B3T T;  4LFA T;  4JI2 T;  4YHH T;  4JI0 T;  4DR7 T;  4DV7 T;  1HNW T;  4DUZ T;  4B3S T;  1XNQ T;  2UUC T;  5LMN T;  4OX9 T;  1HNX T;  2UUA T;  3T1H T;  4JI7 T;  1N36 T;  2HHH T;  4LF6 T;  1IBL T;  4DV1 T;  1IBM T;  1IBK T;  4DR6 T;  2UXB T;  4K0K T;  2UXD T;  4JI4 T;  4B3R T;  2UU9 T;  4DR2 T;  4JYA T;  2VQE T;  4DV2 T;  4DR1 T;  2E5L T;  4AQY T;  1FJG T;  4DUY T;  4NXM T;  4DV4 T;  4X65 T;  4DV3 T;  4GKK T;  4DV0 T;  2UXC T;  4DV6 T;  4JI5 T;  4NXN T;  4B3M T;  1N32 T;  1XMQ T;  4LF9 T;  1J5E T;  5IWA T;  1N34 T;  4JI1 T;  3OTO T;  5LMU T;  4DV5 T;  3T1Y T;  4LF7 T;  4JV5 T;  4YY3 T;  4X62 T;  2ZM6 T;  4JI3 T;  4X66 T;  1XMO T;  4KHP T;  1I94 T;  2UUB T;  4LFC T;  4JI8 T;  4GKJ T;  4LFB T;  4LF4 T;  4DR4 T;  5BR8 T;  2VQF T;  4LF8 T;  1N33 T;  4DR3 T;  1HR0 T;  4JI6 T;  4X64 T;  2F4V T;  4LF5 T;  1XNR T;  4DR5 T; 
#chains in the Genus database with same CATH topology
 5JDL A;  3I1A A;  4ANJ A;  2NW9 A;  5F3J A;  5AQO B;  4HFV A;  4QWN B;  3CPZ A;  1MND A;  4OX9 T;  2XQ9 A;  5IHY A;  4TV8 E;  5KDM C;  2CHO A;  3ZMU B;  3AE8 A;  2N1G A;  2LSK A;  1D1A A;  2FJB A;  2V5D A;  2A72 A;  2DL1 A;  5FL0 A;  2E9X A;  1ZEE A;  3LK4 2;  4TZ4 C;  2BKP A;  5FY1 A;  2KT9 A;  2CXF A;  5AQS B;  5HXC A;  1MIV A;  3C64 A;  4PNI A;  4HFB A;  2A2F X;  3Q5E A;  4X65 T;  3QB5 A;  2ACZ A;  4CXW A;  1SE7 A;  3N9M A;  1QSD A;  2FJE A;  3HKB E;  2FJA A;  2H7O A;  2W0G A;  4J2C A;  2X66 A;  3NWI A;  3OTO T;  1DU2 A;  3C50 A;  5FKY A;  1UUR A;  3AVR A;  4AKG A;  3QB5 K;  3F31 A;  3IEE A;  2RP4 A;  3UTK A;  2NW7 A;  2ES0 A;  2BZB A;  2X67 A;  2CLY C;  2VL0 A;  3K3Q C;  4IRE A;  2LEH A;  1OXZ A;  1OED B;  2UXX B;  4AKH A;  1KEY A;  4KI0 F;  2VKH A;  1HNX T;  3EDU A;  3UFE A;  2JIW A;  3L8R A;  2XQ3 A;  3EAB A;  4QXH B;  3SRZ A;  2VKD A;  2K9A A;  3KV4 A;  5DAB A;  5CB4 E;  2CE7 A;  4XBF B;  4ZI3 D;  2NOX A;  1UGO A;  3PJA J;  3DP7 A;  4DV2 T;  3PV0 F;  1VCT A;  5CGM A;  3N5L A;  2XY8 B;  4CQI A;  4DV4 T;  2YKS A;  3F2E A;  2XQ7 A;  3K3O A;  3SOL A;  1KFY A;  2W2U A;  3N9Q A;  2W00 A;  2RA1 A;  2N2N A;  3BQL A;  3AE9 A;  1B7T A;  4HEA A;  3L09 A;  1L0V A;  5AQR B;  4YLH A;  5L4H A;  3UU4 A;  4YY3 T;  4AKR B;  3JC6 C;  3RIF A;  2BS4 A;  5FY7 A;  5JDM A;  3W15 B;  2L8K A;  4BJM A;  3AE4 A;  2BBJ A;  4U7I A;  5L3D B;  2DWG A;  3UU5 A;  4ZI2 D;  5EK4 A;  4Z90 A;  1HNZ T;  1D1B A;  1V9D A;  2DWK A;  3AA7 B;  3CIR A;  5LBQ B;  4YHH T;  4UIG A;  4DUZ T;  3CK6 A;  3CWZ B;  3OJA A;  4ILU A;  4FJO A;  3M65 A;  4MLK A;  3RYI E;  5FNV E;  4QHO A;  1YXR A;  3RIU C;  3NVO A;  1OED A;  5L47 A;  2MYS A;  3NRY A;  3AEF A;  5L3B B;  2WAU A;  3AVS A;  3UFG A;  1W9R A;  2D0T A;  3AEE A;  4B6X A;  3ABV A;  5FY0 A;  3JAD A;  4EZ4 A;  1HG5 A;  4L9I A;  1WCR A;  3RQW A;  5AFU L;  2XM1 A;  5J2T E;  2IIU A;  4P09 A;  5E0O A;  2JMH A;  4GKK T;  2CEA A;  4IGU A;  3LK3 B;  5FMN A;  4CI2 B;  3Q5X A;  4TWH A;  2MAW A;  4HWI B;  2X9W A;  4X1Y E;  1YQ3 A;  2D9D A;  2ZM6 T;  3I0O A;  4UEM A;  4JEH B;  1T72 A;  4O4I E;  1HFA A;  4JI8 T;  3MK7 C;  2WZH A;  1CHU A;  5LA6 E;  5ABG A;  5HXH A;  4JI6 T;  4PAG A;  3AEG A;  1R8I A;  4EZH A;  2C0S A;  3KFW X;  5GON E;  4JLE A;  2IDO B;  4IE5 A;  1J5W A;  3AE6 A;  3CQX C;  2IAK A;  3V5U A;  1T98 A;  1N36 T;  5KMG P;  4H9P C;  4DV1 T;  3PUY F;  4X1K E;  2SPC A;  4ILC A;  1VRB A;  3ZCI A;  2UXB T;  3ZCJ A;  3RH3 A;  4HFI A;  4H9N C;  3ZC0 A;  2WDR A;  4IIJ E;  2LSY A;  2W66 A;  4K0U A;  1IAP A;  3OVU A;  4H63 V;  3J7Y q;  5J2U E;  3WAJ A;  2JQ9 A;  2VVN A;  4EOZ B;  3MJX A;  4DUY T;  3KDS E;  4GIW A;  5LNK A;  1D0Z A;  3GN5 A;  3R84 B;  4ZI3 C;  5LB7 B;  4HKA A;  1ZP0 A;  2JMK A;  5AQJ B;  3TLT A;  4EGW A;  4PJJ A;  2ZM0 A;  5IWA T;  3AEB A;  5J0Z A;  4AI6 A;  3VKH A;  1OED C;  2MTQ A;  4O4J E;  1XDP A;  1LVK A;  1OED E;  2LSG A;  2NWB A;  4YJ2 E;  2IML A;  3IF8 B;  1D1C A;  3AXJ A;  1HCI A;  4CI1 B;  1FIO A;  3ZT7 A;  3Q5W A;  4KX6 A;  4DR3 T;  5KX5 E;  2V5C A;  3MKD A;  3M3Z B;  3Q9D A;  5LBM A;  4KUM B;  4HE8 A;  4DV7 T;  2DNX A;  2Y8D A;  4AKI A;  3TLU A;  3HA4 A;  4TX5 A;  4EEB A;  2IC6 A;  4C91 A;  4JI7 T;  3GA8 A;  4ZI2 C;  2XQ6 A;  2DI4 A;  2Q9Q B;  1IBK T;  4DR6 T;  3ONL C;  4IE0 A;  3E22 E;  3I0Q A;  2CCQ A;  3UUL A;  5C8Y E;  2WU2 A;  4WZX A;  4ZHQ E;  2CRB A;  4CN1 A;  3CVR A;  5AQP B;  4TUY E;  2MOZ A;  2KSR A;  3NKZ A;  2NR4 A;  4GOU A;  3AAA B;  4IST A;  4WNK A;  4XZC A;  5EK3 A;  4ZXL A;  3LK2 B;  1N32 T;  3LSV A;  4LF9 T;  2ZM2 A;  3VKG A;  2Z6E A;  4HFH A;  3TLW A;  2CXD A;  2I6H A;  3ZC1 A;  4U72 A;  3QC9 A;  5AQN B;  2C5K T;  4JI3 T;  4KMC A;  4OFZ A;  1E2A A;  3WI3 A;  5AQL B;  2E9X D;  5ETW A;  5JR9 B;  3P8C D;  5ABH A;  4QX8 B;  3CX7 B;  1WYB A;  4I43 B;  5ABE A;  5FP3 A;  2CXL A;  4DBQ A;  3VR8 A;  5LGU B;  4O8S A;  1IJ6 A;  4QH4 A;  5ABF A;  5L4E A;  2C5J A;  5EZY E;  2HH7 A;  4U2Y A;  2IUB A;  4IDZ A;  1MNE A;  1S35 A;  3RI5 A;  5AQI B;  2BDE A;  3T1H T;  4U74 A;  1D0X A;  5JDF A;  4COF A;  3LJC A;  3E0Z A;  4A98 A;  3SFD A;  3H37 A;  1YD8 G;  3ZEF B;  4H63 H;  1KF6 A;  4ZZC A;  3IA3 A;  5CA0 E;  3NZQ A;  3FZF B;  2UU9 T;  2WQY A;  4DR2 T;  4TNV A;  4IDQ A;  2YU2 A;  5DQW A;  3EI0 A;  2KIN B;  2CMR A;  5HXE A;  5CFB A;  2V6X A;  5JH7 E;  3PUQ A;  4DMW A;  4UVB B;  3UU3 A;  2IHR 1;  1XMQ T;  2D5U A;  3PU8 A;  3DJB A;  2W61 A;  3J9X 1;  2KMF A;  1WLX A;  3ETU A;  4JV5 T;  5J1G A;  3AE7 A;  4DBR A;  3HKD E;  1G8X A;  4DMV A;  4H9Q C;  3F57 A;  3LBX B;  3P50 A;  4IE6 A;  4CZZ B;  5HEG A;  4LF8 T;  2J62 A;  2F4V T;  2E8I A;  3UUM A;  3KV9 A;  4TN7 B;  5L3E B;  1U5P A;  2HPL A;  3O1H A;  5JR9 A;  5LMN T;  2Y48 B;  3FZH B;  1US7 B;  1NEK A;  2CPT A;  4U3C A;  4ZS3 A;  2XAJ B;  4IDN A;  4WBO A;  3VRB A;  1NAF A;  3U78 A;  4ILB A;  4HWH A;  1UK5 A;  4TNW A;  4B3R T;  3K8P C;  2L9Q A;  2JQQ A;  2VVS A;  2G0U A;  2WCA A;  3PTR B;  3PJA A;  3H3M A;  2YEV C;  4YJ3 E;  2VAS A;  3RC3 A;  4Q25 A;  2OA5 A;  4C90 A;  4NXN T;  5ADX L;  3FZL B;  3PUG A;  5AQU B;  4UF0 B;  1XZY A;  2VWA A;  1WFD A;  3ZKR A;  5HEJ A;  2R6G F;  2HN2 A;  2DCF A;  4GYS A;  4QXC B;  5LHH B;  3BQI A;  3O9X A;  4X62 T;  4BA9 A;  1HG2 A;  2E2A A;  4YSZ A;  4MHC A;  5JDN A;  1Y01 A;  4KHP T;  4ZOL E;  4LFC T;  2BG9 B;  3CX6 B;  2VKJ A;  4OYK A;  2K3W A;  3Q5D A;  5LG3 A;  2XHE B;  4PFP A;  1XNR T;  1IJ5 A;  2M6B A;  1LVF A;  5LHG B;  1KNZ A;  2CWY A;  1S94 A;  5FYM A;  4PJL A;  3NRX A;  2E9X C;  4P0A A;  1VCS A;  2M67 A;  4EB6 E;  5L2L A;  1ZHC A;  3PUW F;  1HX1 B;  5FVK A;  1UCU A;  3VHL A;  4PJM A;  2WM9 A;  2NP9 A;  4P1N A;  4F6R C;  3PUS A;  4U7Y A;  5H6Q B;  5HEO A;  4IE7 A;  1H7C A;  2KLQ A;  2EHO B;  2VQE T;  4IHJ E;  3OPC A;  2LRK A;  2P9B A;  2VKO A;  4GK5 E;  2X0Y A;  3AA1 B;  1HF8 A;  4YT0 A;  2XQY A;  4ISS A;  2J4G A;  1YKE B;  2JPF A;  2YDR A;  1FMW A;  3EHZ A;  2WMN A;  3OKQ A;  2ZLY A;  4O4L E;  5HEH A;  3KV5 A;  4IT4 A;  3TKL B;  3B13 A;  1W0B A;  4LML A;  2YOE A;  5LJN A;  3CQC B;  4UF0 A;  3FZM B;  4NUV A;  3FBZ A;  5LG4 A;  2KWI B;  3AAI A;  5LGN B;  4X64 T;  4WYV A;  4YHJ A;  3ESL A;  4G2A A;  3EAM A;  5HXS A;  3VR9 A;  3CKD A;  2WBL A;  4NPP A;  5HAX A;  3N9P A;  3OYZ A;  2BG9 A;  3RRW A;  3P4W A;  4I55 E;  3K3N A;  4QKN A;  2X0L B;  5HWY A;  4I4T E;  2YDS A;  4UVA B;  5LCY A;  2X9H A;  3ANW B;  3N9O A;  2VB6 A;  2PBI A;  2CBJ A;  2WWV A;  2FUP A;  5LP6 E;  4HFC A;  4U31 A;  4O4H E;  4EED A;  3DTO A;  1HTJ F;  3AB3 B;  3AED A;  4KHZ F;  4YFS A;  3P4R A;  3N9L A;  2UXC T;  2QA7 A;  4DO0 A;  2EHO A;  3AEA A;  3R6N A;  1Y64 B;  4ADZ A;  3UT5 E;  3OYX A;  3PDY A;  5AQM B;  3RF1 A;  2LHR A;  2KZ7 B;  4U2Z A;  1MIY A;  4H9S E;  2H89 A;  3CX8 B;  4X5T A;  3MZK B;  4AQG A;  1YKH B;  4A5X A;  5AQQ B;  4OHF A;  4EXT A;  2V7K A;  2W62 A;  4GKJ T;  2UXN B;  2A3D A;  4EV6 A;  3QK6 A;  5HWX A;  3RGL A;  1N33 T;  1HR0 T;  2LSJ A;  2WDQ A;  5JDG A;  2OV9 A;  4DR7 T;  1W0A A;  3KV6 A;  2XZE A;  4HTE A;  4LMK A;  5FXV A;  4JBW F;  2XAF B;  2HHH T;  5AQK B;  4TWD A;  3RRC A;  5L3G B;  2LM2 A;  3AE5 A;  3ZJ1 A;  2ODV A;  3OBV E;  2X9Y A;  2QGS A;  4K0K T;  4I0U A;  1BR2 A;  3RYH E;  4ZI7 E;  3LDQ B;  2B76 A;  2JJ9 A;  1MMG A;  2WMO A;  2X9X A;  4KP3 C;  5C3J A;  4DR1 T;  1KNR A;  3BK9 A;  3ZMV B;  1FJG T;  3AE2 A;  3AEC A;  3LG7 A;  4DV0 T;  5JVD E;  4B3M T;  1SUM B;  3L3P A;  5LXT E;  5JQG E;  5HYA A;  4HGA A;  2I0M A;  4V1A v;  3ZYK A;  3PUZ F;  2LM9 A;  2W67 A;  2I59 A;  2AE9 A;  2XSA A;  3T1Y T;  2CBI A;  4ZZB A;  4MFR A;  4Z91 A;  3WAK A;  4KBM B;  2UUB T;  4BAY B;  3IBP A;  2L3L A;  5FXZ A;  1OWA A;  2Q9Q D;  5DJQ C;  4YTN A;  4JI0 T;  5H6R B;  2XPK A;  2KWH A;  4FI5 A;  2XTL A;  4H9R C;  3RIA A;  2X0H A;  1X79 A;  4CN6 A;  4LF6 T;  1IBL T;  4EYU A;  1KK7 A;  3O4X E;  3P4Q A;  2BVL A;  2B1E A;  3N2O A;  4JI4 T;  2M6I A;  2GK9 A;  1MMD A;  2WDV A;  2JRK A;  1MIW A;  2BS3 A;  5A1L A;  4AQF A;  1I6Z A;  2NTY A;  4AQY T;  2V1D B;  2ACX A;  3H3A A;  3HKE E;  3KIN B;  3FZK B;  4XAX B;  4L0R A;  3B5M A;  2DLR A;  3BQK A;  3JAF A;  2LT3 A;  2HN1 A;  2KND A;  1N34 T;  3C4W A;  3ZN0 B;  1U4Q A;  2Q9Q A;  5AQV B;  3P4P A;  4F8H A;  3RKO A;  5DQV A;  5FXW A;  2X68 A;  3UUB A;  4L5G A;  3AE3 A;  3A7M A;  4TWF A;  2WP9 A;  5AQT B;  3VU7 H;  3QUJ A;  5AQH B;  4NIQ A;  2DHR A;  3JAE A;  2XJ7 A;  2LHN A;  2LJL A;  4LF5 T;  3SWH A;  4IL9 A;  4LMJ A;  1LRZ A;  4B3S T;  3PUR A;  4H9O C;  3I9Y A;  2CHN A;  3NBX X;  2K24 A;  2K5B B;  1G73 A;  4TV9 E;  1IBM T;  3EUH A;  3P7I A;  2QRX A;  3SFE A;  2PJQ A;  5BMV E;  2V6Y B;  4O2A E;  1T7S A;  3PUV F;  4JYA T;  2YDQ A;  5FXX A;  1J1J A;  1ZV4 X;  3ZPO A;  4HN9 A;  3RIU A;  2WY2 A;  4NXM T;  2V7M A;  4HWF A;  4DV3 T;  4DV6 T;  1FMV A;  5F5W A;  3UU6 A;  3TLV A;  1BR0 A;  1J5E T;  2ODU A;  1JNZ A;  1UUS A;  2J1D G;  4P0B A;  3MAC A;  3NZP A;  3MA9 A;  2K48 A;  5LHI B;  2MBG A;  4YXD A;  1E7P A;  4X66 T;  5IUX A;  4IDO A;  2XAQ B;  5F8P A;  3ONX A;  4AQF C;  2VQF T;  2H88 A;  2J47 A;  1QLB A;  2BBH A;  2LE8 A;  2RPA A;  4LFA T;  2D0U A;  4AIS A;  3ZYL A;  2WSS V;  2AXD S;  1BR1 A;  4UXN B;  3FXE B;  2WU5 A;  3A8Y C;  2XAH B;  2ZM8 A;  2Q9Q C;  4YTM A;  5LJM A;  1CUN A;  1E1H B;  3FXD B;  3AA0 B;  3AAE B;  2UXD T;  1LKX A;  2WS3 A;  3LBX A;  2NW8 A;  1EZ3 A;  3TLS A;  3ZLI A;  4HFE A;  4BJN A;  2Y6X A;  4O2B E;  2D2S A;  3U3I A;  1SA0 E;  2LKG A;  2FBW A;  1ZOY A;  4AIU A;  3UUN A;  3GWH A;  2V6Y A;  1SHZ C;  4I50 E;  4JI5 T;  3HKC E;  1AJ3 A;  2NTX A;  2WWU A;  4CXY A;  4ZEY A;  4CI3 B;  4JI1 T;  4X1I E;  5LMU T;  5JRC B;  2PTF A;  3KBT A;  4IDP A;  4ASK A;  2FJD A;  3SS1 A;  2MPK A;  5CJ5 A;  5JR9 C;  3O1J A;  1VOM A;  4DR4 T;  4DR5 T;  3ONJ A;  3LFM A;  2YIN A;  2H3R A;  4JI2 T;  3GN5 B;  2V7L A;  3B57 A;  1XNQ T;  2XAG B;  4IL4 A;  4PW8 A;  3RYC E;  5FL1 A;  3V5S A;  4YSX A;  2W63 A;  4HWD A;  4X20 E;  2EHO D;  3RC8 A;  3L39 A;  4U33 A;  5KXJ A;  3I9W A;  4PJN A;  5EK2 A;  5JDH A;  4G63 A;  3FHN A;  1M7K A;  3ZMT B;  3ZMZ B;  1Z0P A;  1WR0 A;  3RHW A;  4PFO A;  3ETV A;  3AXJ B;  3ZYM A;  4MAL A;  4CXX A;  2E5L T;  3CML A;  4CN4 A;  1QUU A;  2JQH A;  1FEW A;  4PK6 A;  4E7S A;  2CM0 A;  4N78 D;  2LOS A;  3D0T A;  2E5V A;  2IW5 B;  3EVY A;  3UUX B;  4PK5 A;  3CQG B;  4Z8X A;  3O1I A;  5LYJ E;  2LLY A;  3QOF A;  1KNP A;  1WR6 A;  2LRL A;  3Q2M A;  3EDV A;  1HS7 A;  3RQU A;  2BS2 A;  2BKO A;  2QYW A;  4QX7 B;  2XQ5 A;  2BKN A;  4OYJ A;  5JRC A;  4AKL A;  4JUY A;  1YW0 A;  4A97 A;  4DID B;  3RX6 A;  2N9D A;  4LF4 T;  4WBN E;  2JQK A;  2XQA A;  3K1S A;  3RYF E;  2H7V C;  4B3T T;  4QH1 A;  2XSB A;  3FBL A;  3PU3 A;  4OK0 A;  2BVM A;  1MMN A;  1WRD A;  2V7J A;  5FVL A;  4QXB B;  5AQF B;  3C4Z A;  3ZMS B;  4IE4 A;  4EAH A;  2V8S V;  4UEL A;  2UUA T;  2V7I A;  3C51 A;  4PK4 A;  3G06 A;  4UR9 A;  2CLY B;  2OLT A;  3S4U A;  1O3X A;  3C98 B;  1GQE A;  3HL6 A;  1T8B A;  2IC9 A;  2YN6 A;  4NUU A;  4QH5 A;  2VK9 A;  4UV9 B;  4GYR A;  4HFD A;  1BR4 A;  3A5X A;  2VUR A;  3KVA A;  3JCF A;  5LGT B;  2C5I T;  3AE1 A;  1XWM A;  2LSI A;  2CWO A;  3E08 A;  1UX5 A;  3N9N A;  5ABF B;  3HI2 A;  2ZMA A;  1IZN B;  5TAO A;  5JRE A;  2VL8 A;  5HCJ A;  4ERR A;  3ZST A;  3PUX F;  4LF7 T;  1M62 A;  3VRA A;  3ANW A;  2KXP B;  3N2G E;  1I94 T;  2BG9 C;  1NEN A;  4GK0 E;  3P4S A;  2LOP A;  4LFB T;  3QNU A;  2QVA A;  5C2T A;  2BG9 E;  4HWC A;  1HX8 A;  1Z8U A;  2A9U A;  5HXR A;  5HCM A;  1W09 A;  1HNW T;  1ZKE A;  3AA6 B;  4AXP A;  2UUC T;  2E9X B;  4EYY R;  2YK0 A;  3RKG A;  3N2K E;  1NWM X;  5IYZ E;  4ZS2 A;  2V26 A;  5M4Y A;  3KBU A;  3ZN1 B;  3MXZ A;  4WW0 A;  4EIW A;  4DVD A;  2PFV A;  3UU8 A;  3X1D A;  2PG8 A;  2X51 A;  2EHO C;  1WYC A;  3UQ7 A;  3GMI A;  4YTP A;  5CA1 E;  4YSY A;  3UQ4 A;  2XQ4 A;  5AQG B;  1UX4 A;  3ZSS A;  1YQ4 A;  4MBQ A;  3ZJ2 A;  2LKH A;  1MMA A;  4ILA A;  2XM2 A;  5L3C B;  4UVC B;  3HR0 A;  3JC6 D;  4M1P A;  5LOV E;  4A56 A;  2WZI A;  2CA5 A;  3FB2 A;  1JNR A;  2XQ8 A;  3ZT6 A;  2XAS B;  1D0Y A;  4DV5 T;  3C4X A;  5L3F B;  2XUE A;  3T8O A;  3RPU A;  2YU1 A;  3PE0 A;  4JEU B;  2W4X A;  3RLF F;  3ZT5 A;  1XMO T;  2HPJ A;  4DND A;  5JDQ A;  3KVB A;  1X9B A;  3IHR A;  4UV8 B;  3PUA A;  5HEU A;  5BR8 T;  5JTG A;  2WB5 A;  1XDO A;  4E7Z A; 
#chains in the Genus database with same CATH homology
 1HNZ T;  4B3T T;  4LFA T;  4JI2 T;  4YHH T;  4JI0 T;  4DR7 T;  4DV7 T;  1HNW T;  4DUZ T;  4B3S T;  1XNQ T;  2UUC T;  5LMN T;  4OX9 T;  1HNX T;  2UUA T;  3T1H T;  4JI7 T;  1N36 T;  2HHH T;  4LF6 T;  1IBL T;  4DV1 T;  1IBM T;  1IBK T;  4DR6 T;  2UXB T;  4K0K T;  2UXD T;  4JI4 T;  4B3R T;  2UU9 T;  4DR2 T;  4JYA T;  2VQE T;  4DV2 T;  4DR1 T;  2E5L T;  4AQY T;  1FJG T;  4DUY T;  4NXM T;  4DV4 T;  4X65 T;  4DV3 T;  4GKK T;  4DV0 T;  2UXC T;  4DV6 T;  4JI5 T;  4NXN T;  4B3M T;  1N32 T;  1XMQ T;  4LF9 T;  1J5E T;  5IWA T;  1N34 T;  4JI1 T;  3OTO T;  5LMU T;  4DV5 T;  3T1Y T;  4LF7 T;  4JV5 T;  4YY3 T;  4X62 T;  2ZM6 T;  4JI3 T;  4X66 T;  1XMO T;  4KHP T;  1I94 T;  2UUB T;  4LFC T;  4JI8 T;  4GKJ T;  4LFB T;  4LF4 T;  4DR4 T;  5BR8 T;  2VQF T;  4LF8 T;  1N33 T;  4DR3 T;  1HR0 T;  4JI6 T;  4X64 T;  2F4V T;  4LF5 T;  1XNR T;  4DR5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...