1FEWA

Crystal structure of smac/diablo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
SLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELKQKTQEEGEERAESEQEAYLRED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
publication title Structural and biochemical basis of apoptotic activation by Smac/DIABLO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 90
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1fewA00
2XHEB 5M4YA 1BR0A 1FEWA 3C98B 4JEHB 2DNXA 5LG4A 1EZ3A 1FIOA 1HS7A 3LG7A 1S94A 4JEUB 1G73A 4TX5A
chains in the Genus database with same CATH superfamily
1T7SA 2V5CA 4DO0A 3TKLB 2W2UA 1HX1B 3I9WA 2IC6A 4U31A 4KBMB 1G73A 3OYXA 2ODVA 3AEFA 1UX4A 3AEEA 3BQLA 2E9XB 4QXCB 3KBTA 3CVRA 2EHOC 5HXEA 5E0OA 3AXJB 4UIGA 5HEHA 5ABFA 1KNPA 3CQXC 2VVNA 4B3MT 4JI6T 1ZHCA 5LBQB 4EAHA 4LF4T 5AQMB 2X9WA 2XQ9A 3ANWA 1YW0A 3E0ZA 2V26A 4ZEYA 3UUXB 4EB6E 5L3FB 3ZJ2A 2X0LB 4L0RA 4MFRA 2EHOB 4NIQA 1XNQT 3RRWA 4LFAT 1QSDA 3EI0A 3IEEA 2E5LT 4ZXLA 3RIFA 3BK9A 4LF8T 3V5SA 2Y48B 1QLBA 4IDPA 2VQFT 3ZMZB 3SOLA 4AQYT 1BR4A 4EXTA 2ZM2A 4IDOA 3ETVA 1Y64B 2HN1A 2QYWA 5EK4A 4TV9E 1IJ6A 4QH1A 5FY7A 2E5VA 2BG9E 5FNVE 2BS3A 3CQCB 3ZKRA 3AE4A 3FZLB 5LYJE 3T1HT 3KV4A 3RGLA 3RYIE 4UVBB 4DBQA 5HXCA 1XDPA 1FEWA 3FZMB 2X51A 5ETWA 3AB3B 2FJEA 3CIRA 4J2CA 3QUJA 4AKLA 1D0XA 2K3WA 5IHYA 4DMVA 1KFYA 1BR2A 2CWYA 5KXJA 3I0QA 1ZEEA 3RIUC 4TWHA 1KNRA 2BBJA 2D0UA 4O8SA 4NXMT 3N9MA 2AE9A 5L3DB 4ILBA 2R6GF 3RYFE 3VHLA 4DUYT 5CJ5A 3L3PA 4AIUA 3HKDE 4BJNA 2LHNA 3HKEE 3ABVA 3AEAA 2P9BA 4KP3C 4FI5A 5FXVA 1ZP0A 4IL4A 2X67A 2WP9A 1H7CA 1VOMA 1MMNA 2KT9A 4ZOLE 2WM9A 3QOFA 2BKPA 4BJMA 3FBLA 2K24A 4XAXB 2DCFA 2NTYA 3PJAA 4UF0B 2ACZA 5JR9C 3PV0F 4PJJA 4EOZB 4DR3T 1CUNA 1WLXA 3L8RA 5ABGA 1T72A 2XUEA 2XQ4A 3CX7B 2BS2A 2HPJA 4PFPA 4KHPT 2X0YA 3FXDB 2MBGA 1KK7A 4HFEA 1HS7A 3HI2A 4TV8E 3OYZA 3I0OA 1W0BA 2J1DG 3N9PA 3FZFB 1NENA 5JR9B 4X1YE 4JI4T 4AKHA 1IBKT 5LA6E 1XZYA 5ABEA 3GMIA 4YHJA 5FL0A 4E7ZA 4UXNB 3HA4A 2Q9QC 4A97A 4JI1T 3PURA 4ZZBA 1KF6A 1Y01A 2CEAA 1WCRA 3ONLC 1OWAA 4KUMB 1WR0A 3MA9A 2XM1A 4XBFB 5F3JA 2CM0A 3LSVA 3WAKA 1DU2A 4KX6A 2Q9QB 4U3CA 3PJAJ 2VB6A 2PFVA 4Q25A 4GK0E 5LHIB 5AFUL 3KBUA 1X79A 3RC8A 5JDFA 2PJQA 5LP6E 5L3GB 1J5ET 1HFAA 1VCTA 2ODUA 3DP7A 4HTEA 4L5GA 4JEHB 3SWHA 2JQHA 4YTPA 2XQ6A 4EEBA 2YU2A 3CMLA 4UR9A 3RKOA 2UU9T 2DWKA 2XQYA 3ZN1B 1OEDB 5LNKA 3DJBA 4HWDA 2BG9C 4QX7B 5FKYA 5AQPB 3N9QA 2K9AA 4ZI7E 3T8OA 3KVBA 3JCFA 3TLWA 1Z0PA 4O2BE 4AI6A 4H9RC 2MTQA 4KHZF 3AECA 4CN1A 2JQ9A 3AE5A 3S4UA 1UGOA 4HEAA 4WNKA 2X9YA 3K8PC 3PUXF 2XQ5A 4HWCA 2V7MA 3ZCJA 4COFA 3PUAA 2NR4A 3IHRA 4CI1B 2BKNA 3N2KE 4IGUA 1BR0A 2BG9B 2YOEA 4QH4A 4CI3B 4DIDB 1ZKEA 2PTFA 4HWIB 5AQOB 4X1IE 3KV9A 5L2LA 1ZV4X 4U2ZA 3A7MA 5HEOA 4KI0F 2LRLA 3U78A 3J9X1 4DVDA 2XQAA 3KV5A 4CN4A 5LXTE 2WAUA 3UU3A 1MIYA 3Q5DA 2ZMAA 4JI0T 2CLYB 2HPLA 3RKGA 2MPKA 4I55E 2W00A 4WW0A 3GN5B 3UQ4A 5J0ZA 3AAIA 3Q5WA 3KINB 4HFBA 2UUAT 4CXXA 5DQVA 4HFCA 5IWAT 3VR8A 4PK4A 5HWYA 3O1HA 4LMKA 5AQIB 2E9XA 3VU7H 2W62A 2Q9QD 4GOUA 1NWMX 2QA7A 2VKHA 5A1LA 1SA0E 5AQHB 3QB5K 5LBMA 4H9SE 4TNVA 5GONE 3ZEFB 2I6HA 3A8YC 4UELA 3OPCA 5FY1A 1IAPA 5HAXA 5LCYA 2FBWA 3UFGA 2W67A 1T8BA 3M3ZB 2XZEA 5C2TA 3ZMVB 2EHOA 4EEDA 2ACXA 4AQFC 3UUMA 3C50A 4H63H 4DR6T 3MJXA 3N2GE 2WU2A 2ZLYA 3SS1A 2LKHA 3MK7C 4DV5T 3AE6A 5FY0A 4QH5A 2WQYA 5IUXA 4OFZA 1HNZT 3J7Yq 3PUSA 2A2FX 3NBXX 4FJOA 3UU6A 2JPFA 1FJGT 4JYAT 3VKHA 2K5BB 2XAHB 4YT0A 5F8PA 2VKDA 5AQNB 4PNIA 3I9YA 1D1AA 2XSBA 3P4QA 4HWHA 4ZI2D 2LHRA 2DNXA 2H88A 4DBRA 3IA3A 2CXLA 5BMVE 1N36T 2XAJB 5JVDE 3G06A 4HFIA 2BBHA 1IZNB 5HCMA 3T1YT 1SUMB 2IUBA 3AEGA 4AKIA 3A5XA 4P0BA 3K3NA 4ERRA 3NRYA 3LJCA 4LF5T 3ZYLA 2CWOA 1YQ3A 5HXSA 5CGMA 3EDUA 4U7IA 4YTMA 2WDRA 4QKNA 4JI7T 3SFEA 2CHOA 5LMUT 1HNXT 3LK2B 3HL6A 2JMHA 4LMLA 5AQTB 2YINA 3RIAA 4CQIA 2DI4A 4F8HA 4MALA 3RI5A 3NVOA 4WBOA 3PUYF 4U72A 3RIUA 3Q9DA 1LRZA 4HGAA 4I0UA 2V1DB 2D0TA 4WBNE 2UXNB 2XPKA 4X66T 2NW9A 1LVKA 4JI3T 3AA7B 1S35A 4CN6A 3P4PA 4UF0A 4DV7T 2JJ9A 5JRCB 4P1NA 3P50A 4DNDA 3RYCE 2H7OA 5FP3A 1KNZA 2XJ7A 5AQGB 5F5WA 4DV4T 1HR0T 3CPZA 2XY8B 5LGNB 5LJNA 5CA1E 3N9NA 3F57A 3UU8A 1MMAA 5LOVE 1IJ5A 3C4WA 4NPPA 4TZ4C 5FXXA 4EZHA 5JDGA 1T98A 1W9RA 4YTNA 3B5MA 4NUUA 4X62T 3MXZA 2WBLA 1FIOA 2YDSA 3PUVF 1V9DA 2LJLA 3OJAA 5L3CB 2V7LA 1NAFA 2UUBT 2V6XA 2JQKA 4EZ4A 2C5IT 2LLYA 2H7VC 4DR2T 4JV5T 1OXZA 3RQWA 3N9OA 4UEMA 5LJMA 3LDQB 3P7IA 4IE5A 4AQGA 4LFBT 4AKGA 3IBPA 4ADZA 2V6YA 1I6ZA 2WU5A 4V1Av 4PK6A 2F4VT 4ZS2A 2X68A 4X64T 3KDSE 3H3MA 3QNUA 3DTOA 3NZQA 5LGTB 3GWHA 2VURA 2MYSA 4O4IE 2N9DA 1LVFA 1HCIA 2QRXA 3PU3A 4BAYB 3LK3B 3TLVA 3HKBE 1J1JA 2BS4A 4C90A 1X9BA 4KMCA 1OEDA 3Q5EA 2VL8A 4Z90A 1UUSA 4HE8A 1MNEA 4QX8B 5AQSB 3ZMUB 1XMQT 5FXWA 5IYZE 2BVMA 4CI2B 3ZMSB 2UUCT 4N78D 4JEUB 4AKRB 3LK42 3FB2A 3RRCA 1WR6A 1YKHB 4XZCA 1XDOA 3RH3A 2XQ8A 4IE0A 4UVAB 3D0TA 4OYKA 5JREA 3SRZA 1D0ZA 2IAKA 5FYMA 4DR1T 2ZM8A 4U74A 4ZI3D 4JBWF 2OA5A 4GYRA 5TAOA 2CXFA 2WDVA 4ILCA 2X66A 1Z8UA 3AE9A 3QK6A 5AQRB 5L47A 3UT5E 2XSAA 1U4QA 3FZKB 5ABHA 2YN6A 3E08A 3C4XA 3VKGA 3ESLA 2X0HA 2VKJA 3GN5A 1HX8A 4X1KE 2CA5A 4L9IA 3R6NA 1UCUA 4DUZT 2DL1A 2V5DA 2C0SA 3PU8A 5H6QB 3RF1A 4DV6T 3PE0A 5HCJA 2IIUA 4MHCA 2XAQB 1B7TA 2CE7A 4CXWA 3F2EA 2YDRA 4PJNA 3PUWF 1U5PA 4YXDA 4ZI2C 4TWDA 4BA9A 5C3JA 2ZM0A 4ILAA 4QXHB 3AA1B 3LBXB 1VCSA 4DV2T 2XQ3A 2UXDT 2W0GA 2GK9A 2LSGA 2OLTA 1HG5A 3R84B 2WZHA 4H63V 1IBMT 4UVCB 1WYCA 2D9DA 2YEVC 1XMOT 3P4RA 4IIJE 2NWBA 4WYVA 2NP9A 3O4XE 2LKGA 2N1GA 3IF8B 1JNZA 3EDVA 2JIWA 4B6XA 3L39A 1YQ4A 2PG8A 5HEUA 2D5UA 2KZ7B 3FHNA 4AQFA 3UULA 3FBZA 2HHHT 4P0AA 2L8KA 3RYHE 2WY2A 2E8IA 3UUNA 2LSJA 3ZMTB 4YSXA 3ZYKA 5FL1A 3RQUA 2J47A 2LM9A 3N5LA 2ES0A 2KINB 3RHWA 1UX5A 2Y6XA 3AEDA 2KMFA 3AE1A 5EK2A 2KWIB 4OK0A 4PFOA 4JI5T 5DJQC 3UU4A 4Z8XA 3AE8A 2FJAA 1WFDA 4QXBB 3AXJA 1KEYA 4G2AA 3FXEB 3UU5A 2LSIA 4JI8T 4IE4A 3ZSTA 2CBIA 1E7PA 3N9LA 4AISA 1CHUA 3PTRB 3P8CD 4HN9A 1R8IA 2K48A 4AXPA 5HEGA 5L4HA 2X9XA 2FJDA 2M6IA 5FVLA 5HEJA 4QWNB 5EK3A 4U7YA 3ZC0A 2IMLA 5LMNT 2WS3A 2XHEB 1W09A 3K1SA 1SE7A 3JC6D 2NOXA 1N32T 4YFSA 3C4ZA 1G8XA 3ETUA 4PW8A 2VVSA 4OX9T 5LB7B 3ZT7A 5L3BB 2LEHA 2N2NA 4PAGA 4LF9T 3C64A 2XTLA 4IE7A 4YY3T 1SHZC 5AQUB 4H9OC 5DQWA 5FXZA 4K0KT 2E2AA 2YU1A 3AVSA 1US7B 2DWGA 3ZYMA 4X65T 3RPUA 4GIWA 2VK9A 3OBVE 3CWZB 1YXRA 4TWFA 2A3DA 2L3LA 3O1IA 4TUYE 3X1DA 1AJ3A 4OYJA 3CK6A 3AE7A 3WI3A 1WRDA 4YSYA 4IL9A 2JMKA 3KV6A 4DV0T 3K3OA 2D2SA 4YJ3E 1I94T 4MBQA 5JDNA 4DR5T 2VASA 2J62A 3BQKA 3PDYA 4WZXA 3HR0A 2WCAA 2YK0A 3K3QC 4I50E 2WB5A 1VRBA 4DMWA 2W63A 2W66A 3VR9A 2LRKA 3RX6A 4K0UA 1MMDA 2J4GA 2LE8A 4GKKT 3JADA 1OEDE 4IHJE 2LOPA 4YHHT 4GK5E 4HFDA 4EYUA 4ZI3C 3JAEA 3ZT5A 1M62A 2XASB 3OTOT 1QUUA 1XNRT 2YKSA 4H9QC 5AQQB 2L9QA 2CHNA 5HWXA 2WMOA 5FMNA 2KSRA 2IW5B 5J2TE 4DR7T 1FMVA 4B3RT 2CXDA 5CFBA 3KFWX 5LHHB 5ADXL 3ZCIA 5JR9A 1L0VA 5FVKA 4JLEA 3E22E 2LM2A 3AA0B 4HKAA 2KNDA 3C98B 5JDQA 4YJ2E 2LSYA 3ZN0B 3QB5A 2MAWA 4A56A 4QHOA 1O3XA 5ABFB 4DV1T 3TLTA 1UURA 5HYAA 3GA8A 4O4HE 1J5WA 2DHRA 3ANWB 3ZC1A 4EIWA 1M7KA 1S94A 4ISTA 4E7SA 2RA1A 5KMGP 1D0YA 5CB4E 4G63A 1BR1A 4ILUA 1HNWT 2IDOB 2Q9QA 4HWFA 3VRBA 5J1GA 2E9XD 2XM2A 2H89A 1WYBA 5KDMC 4PK5A 4LF7T 4TN7B 5AQLB 5JDLA 3VRAA 4MLKA 3ZSSA 3C51A 2H3RA 5CA0E 2B76A 2A9UA 2W4XA 2OV9A 3MKDA 2KLQA 1MNDA 3SFDA 3AAAB 2WMNA 4I4TE 3TLUA 5LG3A 5M4YA 5EZYE 4ZZCA 3O1JA 5BR8T 3EVYA 3RLFF 2B1EA 2EHOD 2G0UA 3Q5XA 3U3IA 3FZHB 2NW7A 4YLHA 4ISSA 1XWMA 2KWHA 3LBXA 4O4JE 2LT3A 4IDZA 4I43B 2W61A 2Z6EA 3B57A 5KX5E 2WWUA 2QVAA 3EAMA 1YD8G 3ZJ1A 5DABA 5LHGB 2PBIA 5J2UE 3F31A 3MZKB 3CQGB 3UQ7A 4OHFA 2BG9A 5AQFB 3ZPOA 1MIWA 4DV3T 2CBJA 2QGSA 4NXNT 2VWAA 4A5XA 2CMRA 3UTKA 3CX8B 4O4LE 4Z91A 4U2YA 1LKXA 5H6RB 2HH7A 2V7KA 3I1AA 4EGWA 2V7IA 4IREA 2VKOA 2XQ7A 2M6BA 3PUGA 2X9HA 5JDHA 3M65A 3ZT6A 3JC6C 4IE6A 3NWIA 1OEDC 2V6YB 5JQGE 5JH7E 4ZS3A 2BZBA 3L09A 3AVRA 3P4WA 2C5JA 4CXYA 2MOZA 4ZHQE 3QC9A 2XAGB 4HFHA 3EUHA 2VQET 2HN2A 3LFMA 1E1HB 5AQVB 2I59A 2CCQA 5C8YE 2LOSA 1D1CA 2NTXA 3EABA 5JDMA 4M1PA 1HF8A 3RC3A 3CKDA 1N34T 4EYYR 4P09A 1N33T 5HXHA 2CPTA 4H9PC 1HTJF 4B3TT 2JQQA 1ZOYA 4GYSA 4A98A 1FMWA 3OKQA 3EHZA 3TLSA 1EZ3A 4F6RC 1YKEB 3MACA 3N2OA 2I0MA 4H9NC 2V7JA 4B3ST 2UXCT 2WSSV 4C91A 3UFEA 1NEKA 4X5TA 4U33A 4CZZB 2CLYC 2WDQA 3HKCE 2RP4A 4ASKA 4LFCT 3LG7A 3H37A 3NKZA 3AEBA 2BVLA 4LF6T 3OVUA 5LG4A 1MIVA 4X20E 4PJLA 3AE2A 4UV9B 5L3EB 1D1BA 2A72A 4PJMA 2SPCA 1E2AA 2V8SV 3UUBA 2WWVA 4IDNA 4YSZA 2CRBA 2KXPB 3PUZF 2LSKA 4DR4T 3H3AA 3ZLIA 2FUPA 2BDEA 3KVAA 2NW8A 2UXBT 3PUQA 2C5KT 3Q2MA 5JTGA 2BKOA 2UXXB 3AAEB 5HXRA 1W0AA 5L4EA 4IDQA 2ZM6T 2M67A 4TNWA 2JRKA 4EV6A 1IBLT 1MMGA 3NRXA 1JNRA 2DLRA 3AE3A 2WZIA 3BQIA 4GKJT 3JAFA 2RPAA 4JUYA 2XAFB 4TX5A 2Y8DA 3O9XA 2IHR1 3CX6B 1UK5A 3B13A 4JI2T 4HFVA 1GQEA 4UV8B 3ONXA 4ANJA 3WAJA 3V5UA 4IT4A 1HG2A 2AXDS 2YDQA 2VL0A 3AA6B 3ONJA 5LGUB 5AQJB 5JRCA 2E9XC 4NUVA 2IC9A 4O2AE 5AQKB 3W15B 3P4SA 2FJBA 4LMJA 3NZPA
chains in the Genus database with same CATH topology
2KNDA 4OYKA 3C98B 3J9X1 5JDQA 5JREA 4DVDA 3SRZA 4DO0A 1D0ZA 2IAKA 5FYMA 3KV5A 3TKLB 4YJ2E 5LXTE 2WAUA 2LSYA 3ZN0B 4A56A 4QHOA 1MIYA 1O3XA 2IC6A 2ZM8A 3I9WA 4U74A 4ZI3D 4KBMB 1G73A 3OYXA 2OA5A 2ODVA 2ZMAA 1UX4A 2CLYB 4GYRA 5TAOA 2HPLA 2CXFA 5HYAA 3BQLA 3GA8A 2E9XB 4O4HE 4QXCB 2DHRA 3KBTA 4I55E 3ANWB 3ZC1A 4EIWA 2X66A 3CVRA 1S94A 2W00A 2EHOC 3GN5B 4ISTA 4WW0A 4E7SA 5HXEA 5E0OA 3QK6A 3AAIA 2RA1A 3Q5WA 3KINB 5KMGP 3UT5E 1D0YA 4UIGA 1U4QA 4CXXA 5DQVA 3CQXC 5CB4E 4G63A 4PK4A 1BR1A 1ZHCA 4ILUA 5HWYA 5LBQB 3O1HA 4EAHA 3E08A 2Q9QA 3C4XA 3VKGA 2E9XA 3VU7H 2X9WA 2W62A 2Q9QD 3ANWA 3ESLA 4GOUA 2E9XD 5J1GA 1NWMX 2QA7A 1YW0A 2VKHA 5A1LA 1SA0E 2VKJA 1WYBA 3E0ZA 3GN5A 2V26A 4PK5A 1HX8A 4H9SE 4X1KE 2CA5A 5LBMA 5KDMC 3UUXB 4L9IA 4EB6E 5GONE 5L3FB 3R6NA 4TN7B 3ZJ2A 1UCUA 5JDLA 2X0LB 4L0RA 3ZEFB 4MFRA 2EHOB 2C0SA 3PU8A 5H6QB 3RRWA 4MLKA 3C51A 3PE0A 2H3RA 5CA0E 4UELA 4MHCA 5FY1A 1IAPA 5HAXA 5LCYA 2XAQB 3MKDA 1B7TA 2KLQA 1QSDA 3IEEA 2CE7A 1MNDA 4CXWA 3F2EA 4PJNA 3BK9A 3AAAB 3V5SA 2WMNA 1U5PA 4I4TE 4ZI2C 4BA9A 5M4YA 3ZMVB 2Y48B 2ZM0A 5EZYE 3O1JA 3ZMZB 2EHOA 3EVYA 2ACXA 3AA1B 3LBXB 4QXHB 3SOLA 2B1EA 4AQFC 3UUMA 3C50A 4H63H 2EHOD 1BR4A 3MJXA 3N2GE 2G0UA 4EXTA 2ZM2A 2ZLYA 3SS1A 3Q5XA 2W0GA 3ETVA 2GK9A 3MK7C 2LSGA 3U3IA 1HG5A 5FY0A 3R84B 4H63V 1Y64B 5EK4A 4OFZA 2NW7A 4TV9E 4YLHA 4UVCB 1IJ6A 4ISSA 1WYCA 5FY7A 2YEVC 2KWHA 3LBXA 4O4JE 3J7Yq 5FNVE 2LT3A 4IDZA 3PUSA 4I43B 2W61A 4IIJE 2NWBA 2A2FX 3NBXX 2NP9A 3O4XE 2N1GA 3CQCB 2Z6EA 3B57A 5KX5E 4FJOA 3IF8B 2WWUA 2JPFA 3VKHA 2K5BB 1YD8G 3ZJ1A 5DABA 5LYJE 3EDVA 5LHGB 2XAHB 2PBIA 3KV4A 4B6XA 5F8PA 5J2UE 2VKDA 3RYIE 3F31A 3MZKB 4PNIA 3CQGB 2PG8A 4UVBB 3I9YA 4DBQA 1D1AA 4OHFA 2D5UA 2KZ7B 5HXCA 1FEWA 3ZPOA 1MIWA 4ZI2D 3FHNA 2X51A 5ETWA 2QGSA 2LHRA 3AB3B 2DNXA 4AQFA 3UULA 3FBZA 4DBRA 4J2CA 4P0AA 2L8KA 3QUJA 4AKLA 3RYHE 2VWAA 1D0XA 2CXLA 2CMRA 5IHYA 4DMVA 5BMVE 3UTKA 3CX8B 4O4LE 2E8IA 3UUNA 2XAJB 2LSJA 5JVDE 1LKXA 1IZNB 3ZMTB 3ZYKA 1BR2A 2CWYA 2LM9A 5H6RB 3N5LA 2ES0A 2KINB 3I0QA 1UX5A 4AKIA 1ZEEA 2Y6XA 3A5XA 3U78A 2KMFA 2HH7A 5EK2A 2V7KA 2KWIB 4OK0A 4P0BA 3I1AA 3K3NA 4PFOA 4ERRA 2D0UA 5DJQC 4O8SA 3NRYA 3LJCA 2V7IA 3ZYLA 3N9MA 5L3DB 4Z8XA 2CWOA 2VKOA 5HXSA 3EDUA 3PUGA 2X9HA 5JDHA 3M65A 3RYFE 3JC6C 4IE6A 3VHLA 4QXBB 4G2AA 4QKNA 3L3PA 3FXEB 5JQGE 3HKDE 5JH7E 4ZS3A 2LSIA 4BJNA 2BZBA 2LHNA 3HKEE 3L09A 3LK2B 3AVRA 2P9BA 2C5JA 4KP3C 4FI5A 3HL6A 5FXVA 4CXYA 2JMHA 2MOZA 4IE4A 2YINA 4ZHQE 2X67A 3N9LA 1H7CA 1VOMA 3QC9A 2XAGB 1MMNA 2KT9A 4ZOLE 4CQIA 3PTRB 3EUHA 2DI4A 3P8CD 2WM9A 3LFMA 4BJMA 4HN9A 1E1HB 4MALA 3FBLA 2K24A 4XAXB 2DCFA 2I59A 2CCQA 2NTYA 2K48A 5C8YE 4AXPA 2LOSA 4UF0B 1D1CA 2NTXA 4WBOA 4U72A 5JR9C 5JDMA 2X9XA 4M1PA 3Q9DA 1LRZA 4PJJA 4HGAA 4EOZB 2V1DB 4QWNB 5EK3A 1HF8A 2D0TA 1CUNA 4WBNE 1WLXA 3RC3A 3ZC0A 2UXNB 3CKDA 4EYYR 2XHEB 2NW9A 1LVKA 4P09A 3AA7B 1S35A 2XUEA 5HXHA 3CX7B 4H9PC 1HTJF 4UF0A 2HPJA 4PFPA 3JC6D 2NOXA 3FXDB 2JJ9A 1KK7A 2MBGA 2JQQA 1HS7A 4GYSA 1FMWA 3C4ZA 3HI2A 1G8XA 3OKQA 3OYZA 4TV8E 2H7OA 4YFSA 3RYCE 4DNDA 3ETUA 3I0OA 5FP3A 2J1DG 1KNZA 1EZ3A 4PW8A 4F6RC 1YKEB 3MACA 3N9PA 3N2OA 5JR9B 5L3BB 3CPZA 4H9NC 4X1YE 4AKHA 2V7JA 5LGNB 5LJNA 5CA1E 5LA6E 2WSSV 2LEHA 2N2NA 3N9NA 3F57A 4PAGA 4C91A 3UFEA 3C64A 4CZZB 3GMIA 2XTLA 1MMAA 2CLYC 4YHJA 4IE7A 4E7ZA 4UXNB 3HA4A 5LOVE 1SHZC 2Q9QC 2RP4A 3HKCE 4ASKA 3PURA 3LG7A 4H9OC 3H37A 1IJ5A 5DQWA 5FXZA 3C4WA 2BVLA 2CEAA 5LG4A 1MIVA 2YU1A 1OWAA 4TZ4C 3AVSA 1US7B 5FXXA 2DWGA 3ZYMA 4X20E 4KUMB 4PJLA 4EZHA 5JDGA 1T98A 3RPUA 4GIWA 2VK9A 3MA9A 3OBVE 3CWZB 4UV9B 4NUUA 5L3EB 3MXZA 1D1BA 2WBLA 2A3DA 2A72A 5F3JA 4XBFB 2L3LA 2CM0A 1FIOA 3WAKA 4PJMA 3O1IA 2SPCA 4TUYE 2Q9QB 1AJ3A 1V9DA 2LJLA 2KXPB 4OYJA 2VB6A 3OJAA 2LSKA 2PFVA 3H3AA 3ZLIA 5L3CB 2V7LA 2BDEA 3KVAA 3WI3A 1WRDA 4GK0E 5AFUL 5LHIB 1NAFA 3KBUA 2NW8A 1X79A 3RC8A 5JDFA 2PJQA 5LP6E 5JRCB 2JMKA 3KV6A 3PUQA 2C5KT 4EZ4A 3K3OA 3Q2MA 2C5IT 5L3GB 1HFAA 2UXXB 2D2SA 2H7VC 3AAEB 2ODUA 1OXZA 3DP7A 4YJ3E 4MBQA 5HXRA 5JDNA 2VASA 3BQKA 3PDYA 4HTEA 4L5GA 3HR0A 3K3QC 2YK0A 4I50E 4JEHB 3SWHA 3N9OA 2M67A 4UEMA 5LJMA 1VRBA 4DMWA 2W63A 2JRKA 3P7IA 4IE5A 4AQGA 4AKGA 3IBPA 4ADZA 2YU2A 3RX6A 4V1Av 3CMLA 4K0UA 4PK6A 1MMDA 2LE8A 1MMGA 3NRXA 2DLRA 4ZS2A 2X68A 3RKOA 3KDSE 2DWKA 2XQYA 3ZN1B 3DTOA 5LNKA 4IHJE 2LOPA 3DJBA 3NZQA 5LGTB 3BQIA 4QX7B 3GWHA 4GK5E 4EYUA 3N9QA 4JUYA 2K9AA 2XAFB 4TX5A 2MYSA 4O4IE 4ZI7E 2N9DA 1LVFA 3KVBA 3T8OA 1HCIA 4ZI3C 1Z0PA 3PU3A 4O2BE 2Y8DA 4BAYB 4AI6A 3O9XA 3LK3B 4H9RC 2MTQA 2XASB 3CX6B 3HKBE 3B13A 4C90A 4HFVA 4KMCA 3S4UA 4HEAA 4WNKA 1QUUA 2X9YA 3K8PC 4UV8B 2VL8A 3ONXA 2V7MA 4ANJA 3WAJA 3V5UA 4H9QC 4HE8A 1MNEA 1HG2A 2L9QA 3ZCJA 3PUAA 4QX8B 3ZMUB 3IHRA 5FXWA 4CI1B 2WMOA 5HWXA 5IYZE 3N2KE 4IGUA 1BR0A 2BVMA 5FMNA 4CI2B 3ZMSB 2IW5B 4N78D 5J2TE 4JEUB 3AA6B 5LGUB 1FMVA 4CI3B 1ZKEA 4AKRB 2CXDA 5JRCA 3LK42 2E9XC 3KFWX 4X1IE 3FB2A 3KV9A 5LHHB 3RRCA 1WR6A 5ADXL 5L2LA 1YKHB 4XZCA 4NUVA 3RH3A 2IC9A 4O2AE 1ZV4X 3ZCIA 5JR9A 4IE0A 4UVAB 4JLEA 3E22E 3W15B 3NZPA 3AA0B 4HKAA 3D0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHE B;  5M4Y A;  1BR0 A;  1FEW A;  3C98 B;  4JEH B;  2DNX A;  5LG4 A;  1EZ3 A;  1FIO A;  1HS7 A;  3LG7 A;  1S94 A;  4JEU B;  1G73 A;  4TX5 A; 
#chains in the Genus database with same CATH topology
 1T7S A;  2V5C A;  4DO0 A;  3TKL B;  2W2U A;  1HX1 B;  3I9W A;  2IC6 A;  4U31 A;  4KBM B;  1G73 A;  3OYX A;  2ODV A;  3AEF A;  1UX4 A;  3AEE A;  3BQL A;  2E9X B;  4QXC B;  3KBT A;  3CVR A;  2EHO C;  5HXE A;  5E0O A;  3AXJ B;  4UIG A;  5HEH A;  5ABF A;  1KNP A;  3CQX C;  2VVN A;  4B3M T;  4JI6 T;  1ZHC A;  5LBQ B;  4EAH A;  4LF4 T;  5AQM B;  2X9W A;  2XQ9 A;  3ANW A;  1YW0 A;  3E0Z A;  2V26 A;  4ZEY A;  3UUX B;  4EB6 E;  5L3F B;  3ZJ2 A;  2X0L B;  4L0R A;  4MFR A;  2EHO B;  4NIQ A;  1XNQ T;  3RRW A;  4LFA T;  1QSD A;  3EI0 A;  3IEE A;  2E5L T;  4ZXL A;  3RIF A;  3BK9 A;  4LF8 T;  3V5S A;  2Y48 B;  1QLB A;  4IDP A;  2VQF T;  3ZMZ B;  3SOL A;  4AQY T;  1BR4 A;  4EXT A;  2ZM2 A;  4IDO A;  3ETV A;  1Y64 B;  2HN1 A;  2QYW A;  5EK4 A;  4TV9 E;  1IJ6 A;  4QH1 A;  5FY7 A;  2E5V A;  2BG9 E;  5FNV E;  2BS3 A;  3CQC B;  3ZKR A;  3AE4 A;  3FZL B;  5LYJ E;  3T1H T;  3KV4 A;  3RGL A;  3RYI E;  4UVB B;  4DBQ A;  5HXC A;  1XDP A;  1FEW A;  3FZM B;  2X51 A;  5ETW A;  3AB3 B;  2FJE A;  3CIR A;  4J2C A;  3QUJ A;  4AKL A;  1D0X A;  2K3W A;  5IHY A;  4DMV A;  1KFY A;  1BR2 A;  2CWY A;  5KXJ A;  3I0Q A;  1ZEE A;  3RIU C;  4TWH A;  1KNR A;  2BBJ A;  2D0U A;  4O8S A;  4NXM T;  3N9M A;  2AE9 A;  5L3D B;  4ILB A;  2R6G F;  3RYF E;  3VHL A;  4DUY T;  5CJ5 A;  3L3P A;  4AIU A;  3HKD E;  4BJN A;  2LHN A;  3HKE E;  3ABV A;  3AEA A;  2P9B A;  4KP3 C;  4FI5 A;  5FXV A;  1ZP0 A;  4IL4 A;  2X67 A;  2WP9 A;  1H7C A;  1VOM A;  1MMN A;  2KT9 A;  4ZOL E;  2WM9 A;  3QOF A;  2BKP A;  4BJM A;  3FBL A;  2K24 A;  4XAX B;  2DCF A;  2NTY A;  3PJA A;  4UF0 B;  2ACZ A;  5JR9 C;  3PV0 F;  4PJJ A;  4EOZ B;  4DR3 T;  1CUN A;  1WLX A;  3L8R A;  5ABG A;  1T72 A;  2XUE A;  2XQ4 A;  3CX7 B;  2BS2 A;  2HPJ A;  4PFP A;  4KHP T;  2X0Y A;  3FXD B;  2MBG A;  1KK7 A;  4HFE A;  1HS7 A;  3HI2 A;  4TV8 E;  3OYZ A;  3I0O A;  1W0B A;  2J1D G;  3N9P A;  3FZF B;  1NEN A;  5JR9 B;  4X1Y E;  4JI4 T;  4AKH A;  1IBK T;  5LA6 E;  1XZY A;  5ABE A;  3GMI A;  4YHJ A;  5FL0 A;  4E7Z A;  4UXN B;  3HA4 A;  2Q9Q C;  4A97 A;  4JI1 T;  3PUR A;  4ZZB A;  1KF6 A;  1Y01 A;  2CEA A;  1WCR A;  3ONL C;  1OWA A;  4KUM B;  1WR0 A;  3MA9 A;  2XM1 A;  4XBF B;  5F3J A;  2CM0 A;  3LSV A;  3WAK A;  1DU2 A;  4KX6 A;  2Q9Q B;  4U3C A;  3PJA J;  2VB6 A;  2PFV A;  4Q25 A;  4GK0 E;  5LHI B;  5AFU L;  3KBU A;  1X79 A;  3RC8 A;  5JDF A;  2PJQ A;  5LP6 E;  5L3G B;  1J5E T;  1HFA A;  1VCT A;  2ODU A;  3DP7 A;  4HTE A;  4L5G A;  4JEH B;  3SWH A;  2JQH A;  4YTP A;  2XQ6 A;  4EEB A;  2YU2 A;  3CML A;  4UR9 A;  3RKO A;  2UU9 T;  2DWK A;  2XQY A;  3ZN1 B;  1OED B;  5LNK A;  3DJB A;  4HWD A;  2BG9 C;  4QX7 B;  5FKY A;  5AQP B;  3N9Q A;  2K9A A;  4ZI7 E;  3T8O A;  3KVB A;  3JCF A;  3TLW A;  1Z0P A;  4O2B E;  4AI6 A;  4H9R C;  2MTQ A;  4KHZ F;  3AEC A;  4CN1 A;  2JQ9 A;  3AE5 A;  3S4U A;  1UGO A;  4HEA A;  4WNK A;  2X9Y A;  3K8P C;  3PUX F;  2XQ5 A;  4HWC A;  2V7M A;  3ZCJ A;  4COF A;  3PUA A;  2NR4 A;  3IHR A;  4CI1 B;  2BKN A;  3N2K E;  4IGU A;  1BR0 A;  2BG9 B;  2YOE A;  4QH4 A;  4CI3 B;  4DID B;  1ZKE A;  2PTF A;  4HWI B;  5AQO B;  4X1I E;  3KV9 A;  5L2L A;  1ZV4 X;  4U2Z A;  3A7M A;  5HEO A;  4KI0 F;  2LRL A;  3U78 A;  3J9X 1;  4DVD A;  2XQA A;  3KV5 A;  4CN4 A;  5LXT E;  2WAU A;  3UU3 A;  1MIY A;  3Q5D A;  2ZMA A;  4JI0 T;  2CLY B;  2HPL A;  3RKG A;  2MPK A;  4I55 E;  2W00 A;  4WW0 A;  3GN5 B;  3UQ4 A;  5J0Z A;  3AAI A;  3Q5W A;  3KIN B;  4HFB A;  2UUA T;  4CXX A;  5DQV A;  4HFC A;  5IWA T;  3VR8 A;  4PK4 A;  5HWY A;  3O1H A;  4LMK A;  5AQI B;  2E9X A;  3VU7 H;  2W62 A;  2Q9Q D;  4GOU A;  1NWM X;  2QA7 A;  2VKH A;  5A1L A;  1SA0 E;  5AQH B;  3QB5 K;  5LBM A;  4H9S E;  4TNV A;  5GON E;  3ZEF B;  2I6H A;  3A8Y C;  4UEL A;  3OPC A;  5FY1 A;  1IAP A;  5HAX A;  5LCY A;  2FBW A;  3UFG A;  2W67 A;  1T8B A;  3M3Z B;  2XZE A;  5C2T A;  3ZMV B;  2EHO A;  4EED A;  2ACX A;  4AQF C;  3UUM A;  3C50 A;  4H63 H;  4DR6 T;  3MJX A;  3N2G E;  2WU2 A;  2ZLY A;  3SS1 A;  2LKH A;  3MK7 C;  4DV5 T;  3AE6 A;  5FY0 A;  4QH5 A;  2WQY A;  5IUX A;  4OFZ A;  1HNZ T;  3J7Y q;  3PUS A;  2A2F X;  3NBX X;  4FJO A;  3UU6 A;  2JPF A;  1FJG T;  4JYA T;  3VKH A;  2K5B B;  2XAH B;  4YT0 A;  5F8P A;  2VKD A;  5AQN B;  4PNI A;  3I9Y A;  1D1A A;  2XSB A;  3P4Q A;  4HWH A;  4ZI2 D;  2LHR A;  2DNX A;  2H88 A;  4DBR A;  3IA3 A;  2CXL A;  5BMV E;  1N36 T;  2XAJ B;  5JVD E;  3G06 A;  4HFI A;  2BBH A;  1IZN B;  5HCM A;  3T1Y T;  1SUM B;  2IUB A;  3AEG A;  4AKI A;  3A5X A;  4P0B A;  3K3N A;  4ERR A;  3NRY A;  3LJC A;  4LF5 T;  3ZYL A;  2CWO A;  1YQ3 A;  5HXS A;  5CGM A;  3EDU A;  4U7I A;  4YTM A;  2WDR A;  4QKN A;  4JI7 T;  3SFE A;  2CHO A;  5LMU T;  1HNX T;  3LK2 B;  3HL6 A;  2JMH A;  4LML A;  5AQT B;  2YIN A;  3RIA A;  4CQI A;  2DI4 A;  4F8H A;  4MAL A;  3RI5 A;  3NVO A;  4WBO A;  3PUY F;  4U72 A;  3RIU A;  3Q9D A;  1LRZ A;  4HGA A;  4I0U A;  2V1D B;  2D0T A;  4WBN E;  2UXN B;  2XPK A;  4X66 T;  2NW9 A;  1LVK A;  4JI3 T;  3AA7 B;  1S35 A;  4CN6 A;  3P4P A;  4UF0 A;  4DV7 T;  2JJ9 A;  5JRC B;  4P1N A;  3P50 A;  4DND A;  3RYC E;  2H7O A;  5FP3 A;  1KNZ A;  2XJ7 A;  5AQG B;  5F5W A;  4DV4 T;  1HR0 T;  3CPZ A;  2XY8 B;  5LGN B;  5LJN A;  5CA1 E;  3N9N A;  3F57 A;  3UU8 A;  1MMA A;  5LOV E;  1IJ5 A;  3C4W A;  4NPP A;  4TZ4 C;  5FXX A;  4EZH A;  5JDG A;  1T98 A;  1W9R A;  4YTN A;  3B5M A;  4NUU A;  4X62 T;  3MXZ A;  2WBL A;  1FIO A;  2YDS A;  3PUV F;  1V9D A;  2LJL A;  3OJA A;  5L3C B;  2V7L A;  1NAF A;  2UUB T;  2V6X A;  2JQK A;  4EZ4 A;  2C5I T;  2LLY A;  2H7V C;  4DR2 T;  4JV5 T;  1OXZ A;  3RQW A;  3N9O A;  4UEM A;  5LJM A;  3LDQ B;  3P7I A;  4IE5 A;  4AQG A;  4LFB T;  4AKG A;  3IBP A;  4ADZ A;  2V6Y A;  1I6Z A;  2WU5 A;  4V1A v;  4PK6 A;  2F4V T;  4ZS2 A;  2X68 A;  4X64 T;  3KDS E;  3H3M A;  3QNU A;  3DTO A;  3NZQ A;  5LGT B;  3GWH A;  2VUR A;  2MYS A;  4O4I E;  2N9D A;  1LVF A;  1HCI A;  2QRX A;  3PU3 A;  4BAY B;  3LK3 B;  3TLV A;  3HKB E;  1J1J A;  2BS4 A;  4C90 A;  1X9B A;  4KMC A;  1OED A;  3Q5E A;  2VL8 A;  4Z90 A;  1UUS A;  4HE8 A;  1MNE A;  4QX8 B;  5AQS B;  3ZMU B;  1XMQ T;  5FXW A;  5IYZ E;  2BVM A;  4CI2 B;  3ZMS B;  2UUC T;  4N78 D;  4JEU B;  4AKR B;  3LK4 2;  3FB2 A;  3RRC A;  1WR6 A;  1YKH B;  4XZC A;  1XDO A;  3RH3 A;  2XQ8 A;  4IE0 A;  4UVA B;  3D0T A;  4OYK A;  5JRE A;  3SRZ A;  1D0Z A;  2IAK A;  5FYM A;  4DR1 T;  2ZM8 A;  4U74 A;  4ZI3 D;  4JBW F;  2OA5 A;  4GYR A;  5TAO A;  2CXF A;  2WDV A;  4ILC A;  2X66 A;  1Z8U A;  3AE9 A;  3QK6 A;  5AQR B;  5L47 A;  3UT5 E;  2XSA A;  1U4Q A;  3FZK B;  5ABH A;  2YN6 A;  3E08 A;  3C4X A;  3VKG A;  3ESL A;  2X0H A;  2VKJ A;  3GN5 A;  1HX8 A;  4X1K E;  2CA5 A;  4L9I A;  3R6N A;  1UCU A;  4DUZ T;  2DL1 A;  2V5D A;  2C0S A;  3PU8 A;  5H6Q B;  3RF1 A;  4DV6 T;  3PE0 A;  5HCJ A;  2IIU A;  4MHC A;  2XAQ B;  1B7T A;  2CE7 A;  4CXW A;  3F2E A;  2YDR A;  4PJN A;  3PUW F;  1U5P A;  4YXD A;  4ZI2 C;  4TWD A;  4BA9 A;  5C3J A;  2ZM0 A;  4ILA A;  4QXH B;  3AA1 B;  3LBX B;  1VCS A;  4DV2 T;  2XQ3 A;  2UXD T;  2W0G A;  2GK9 A;  2LSG A;  2OLT A;  1HG5 A;  3R84 B;  2WZH A;  4H63 V;  1IBM T;  4UVC B;  1WYC A;  2D9D A;  2YEV C;  1XMO T;  3P4R A;  4IIJ E;  2NWB A;  4WYV A;  2NP9 A;  3O4X E;  2LKG A;  2N1G A;  3IF8 B;  1JNZ A;  3EDV A;  2JIW A;  4B6X A;  3L39 A;  1YQ4 A;  2PG8 A;  5HEU A;  2D5U A;  2KZ7 B;  3FHN A;  4AQF A;  3UUL A;  3FBZ A;  2HHH T;  4P0A A;  2L8K A;  3RYH E;  2WY2 A;  2E8I A;  3UUN A;  2LSJ A;  3ZMT B;  4YSX A;  3ZYK A;  5FL1 A;  3RQU A;  2J47 A;  2LM9 A;  3N5L A;  2ES0 A;  2KIN B;  3RHW A;  1UX5 A;  2Y6X A;  3AED A;  2KMF A;  3AE1 A;  5EK2 A;  2KWI B;  4OK0 A;  4PFO A;  4JI5 T;  5DJQ C;  3UU4 A;  4Z8X A;  3AE8 A;  2FJA A;  1WFD A;  4QXB B;  3AXJ A;  1KEY A;  4G2A A;  3FXE B;  3UU5 A;  2LSI A;  4JI8 T;  4IE4 A;  3ZST A;  2CBI A;  1E7P A;  3N9L A;  4AIS A;  1CHU A;  3PTR B;  3P8C D;  4HN9 A;  1R8I A;  2K48 A;  4AXP A;  5HEG A;  5L4H A;  2X9X A;  2FJD A;  2M6I A;  5FVL A;  5HEJ A;  4QWN B;  5EK3 A;  4U7Y A;  3ZC0 A;  2IML A;  5LMN T;  2WS3 A;  2XHE B;  1W09 A;  3K1S A;  1SE7 A;  3JC6 D;  2NOX A;  1N32 T;  4YFS A;  3C4Z A;  1G8X A;  3ETU A;  4PW8 A;  2VVS A;  4OX9 T;  5LB7 B;  3ZT7 A;  5L3B B;  2LEH A;  2N2N A;  4PAG A;  4LF9 T;  3C64 A;  2XTL A;  4IE7 A;  4YY3 T;  1SHZ C;  5AQU B;  4H9O C;  5DQW A;  5FXZ A;  4K0K T;  2E2A A;  2YU1 A;  3AVS A;  1US7 B;  2DWG A;  3ZYM A;  4X65 T;  3RPU A;  4GIW A;  2VK9 A;  3OBV E;  3CWZ B;  1YXR A;  4TWF A;  2A3D A;  2L3L A;  3O1I A;  4TUY E;  3X1D A;  1AJ3 A;  4OYJ A;  3CK6 A;  3AE7 A;  3WI3 A;  1WRD A;  4YSY A;  4IL9 A;  2JMK A;  3KV6 A;  4DV0 T;  3K3O A;  2D2S A;  4YJ3 E;  1I94 T;  4MBQ A;  5JDN A;  4DR5 T;  2VAS A;  2J62 A;  3BQK A;  3PDY A;  4WZX A;  3HR0 A;  2WCA A;  2YK0 A;  3K3Q C;  4I50 E;  2WB5 A;  1VRB A;  4DMW A;  2W63 A;  2W66 A;  3VR9 A;  2LRK A;  3RX6 A;  4K0U A;  1MMD A;  2J4G A;  2LE8 A;  4GKK T;  3JAD A;  1OED E;  4IHJ E;  2LOP A;  4YHH T;  4GK5 E;  4HFD A;  4EYU A;  4ZI3 C;  3JAE A;  3ZT5 A;  1M62 A;  2XAS B;  3OTO T;  1QUU A;  1XNR T;  2YKS A;  4H9Q C;  5AQQ B;  2L9Q A;  2CHN A;  5HWX A;  2WMO A;  5FMN A;  2KSR A;  2IW5 B;  5J2T E;  4DR7 T;  1FMV A;  4B3R T;  2CXD A;  5CFB A;  3KFW X;  5LHH B;  5ADX L;  3ZCI A;  5JR9 A;  1L0V A;  5FVK A;  4JLE A;  3E22 E;  2LM2 A;  3AA0 B;  4HKA A;  2KND A;  3C98 B;  5JDQ A;  4YJ2 E;  2LSY A;  3ZN0 B;  3QB5 A;  2MAW A;  4A56 A;  4QHO A;  1O3X A;  5ABF B;  4DV1 T;  3TLT A;  1UUR A;  5HYA A;  3GA8 A;  4O4H E;  1J5W A;  2DHR A;  3ANW B;  3ZC1 A;  4EIW A;  1M7K A;  1S94 A;  4IST A;  4E7S A;  2RA1 A;  5KMG P;  1D0Y A;  5CB4 E;  4G63 A;  1BR1 A;  4ILU A;  1HNW T;  2IDO B;  2Q9Q A;  4HWF A;  3VRB A;  5J1G A;  2E9X D;  2XM2 A;  2H89 A;  1WYB A;  5KDM C;  4PK5 A;  4LF7 T;  4TN7 B;  5AQL B;  5JDL A;  3VRA A;  4MLK A;  3ZSS A;  3C51 A;  2H3R A;  5CA0 E;  2B76 A;  2A9U A;  2W4X A;  2OV9 A;  3MKD A;  2KLQ A;  1MND A;  3SFD A;  3AAA B;  2WMN A;  4I4T E;  3TLU A;  5LG3 A;  5M4Y A;  5EZY E;  4ZZC A;  3O1J A;  5BR8 T;  3EVY A;  3RLF F;  2B1E A;  2EHO D;  2G0U A;  3Q5X A;  3U3I A;  3FZH B;  2NW7 A;  4YLH A;  4ISS A;  1XWM A;  2KWH A;  3LBX A;  4O4J E;  2LT3 A;  4IDZ A;  4I43 B;  2W61 A;  2Z6E A;  3B57 A;  5KX5 E;  2WWU A;  2QVA A;  3EAM A;  1YD8 G;  3ZJ1 A;  5DAB A;  5LHG B;  2PBI A;  5J2U E;  3F31 A;  3MZK B;  3CQG B;  3UQ7 A;  4OHF A;  2BG9 A;  5AQF B;  3ZPO A;  1MIW A;  4DV3 T;  2CBJ A;  2QGS A;  4NXN T;  2VWA A;  4A5X A;  2CMR A;  3UTK A;  3CX8 B;  4O4L E;  4Z91 A;  4U2Y A;  1LKX A;  5H6R B;  2HH7 A;  2V7K A;  3I1A A;  4EGW A;  2V7I A;  4IRE A;  2VKO A;  2XQ7 A;  2M6B A;  3PUG A;  2X9H A;  5JDH A;  3M65 A;  3ZT6 A;  3JC6 C;  4IE6 A;  3NWI A;  1OED C;  2V6Y B;  5JQG E;  5JH7 E;  4ZS3 A;  2BZB A;  3L09 A;  3AVR A;  3P4W A;  2C5J A;  4CXY A;  2MOZ A;  4ZHQ E;  3QC9 A;  2XAG B;  4HFH A;  3EUH A;  2VQE T;  2HN2 A;  3LFM A;  1E1H B;  5AQV B;  2I59 A;  2CCQ A;  5C8Y E;  2LOS A;  1D1C A;  2NTX A;  3EAB A;  5JDM A;  4M1P A;  1HF8 A;  3RC3 A;  3CKD A;  1N34 T;  4EYY R;  4P09 A;  1N33 T;  5HXH A;  2CPT A;  4H9P C;  1HTJ F;  4B3T T;  2JQQ A;  1ZOY A;  4GYS A;  4A98 A;  1FMW A;  3OKQ A;  3EHZ A;  3TLS A;  1EZ3 A;  4F6R C;  1YKE B;  3MAC A;  3N2O A;  2I0M A;  4H9N C;  2V7J A;  4B3S T;  2UXC T;  2WSS V;  4C91 A;  3UFE A;  1NEK A;  4X5T A;  4U33 A;  4CZZ B;  2CLY C;  2WDQ A;  3HKC E;  2RP4 A;  4ASK A;  4LFC T;  3LG7 A;  3H37 A;  3NKZ A;  3AEB A;  2BVL A;  4LF6 T;  3OVU A;  5LG4 A;  1MIV A;  4X20 E;  4PJL A;  3AE2 A;  4UV9 B;  5L3E B;  1D1B A;  2A72 A;  4PJM A;  2SPC A;  1E2A A;  2V8S V;  3UUB A;  2WWV A;  4IDN A;  4YSZ A;  2CRB A;  2KXP B;  3PUZ F;  2LSK A;  4DR4 T;  3H3A A;  3ZLI A;  2FUP A;  2BDE A;  3KVA A;  2NW8 A;  2UXB T;  3PUQ A;  2C5K T;  3Q2M A;  5JTG A;  2BKO A;  2UXX B;  3AAE B;  5HXR A;  1W0A A;  5L4E A;  4IDQ A;  2ZM6 T;  2M67 A;  4TNW A;  2JRK A;  4EV6 A;  1IBL T;  1MMG A;  3NRX A;  1JNR A;  2DLR A;  3AE3 A;  2WZI A;  3BQI A;  4GKJ T;  3JAF A;  2RPA A;  4JUY A;  2XAF B;  4TX5 A;  2Y8D A;  3O9X A;  2IHR 1;  3CX6 B;  1UK5 A;  3B13 A;  4JI2 T;  4HFV A;  1GQE A;  4UV8 B;  3ONX A;  4ANJ A;  3WAJ A;  3V5U A;  4IT4 A;  1HG2 A;  2AXD S;  2YDQ A;  2VL0 A;  3AA6 B;  3ONJ A;  5LGU B;  5AQJ B;  5JRC A;  2E9X C;  4NUV A;  2IC9 A;  4O2A E;  5AQK B;  3W15 B;  3P4S A;  2FJB A;  4LMJ A;  3NZP A; 
#chains in the Genus database with same CATH homology
 2KND A;  4OYK A;  3C98 B;  3J9X 1;  5JDQ A;  5JRE A;  4DVD A;  3SRZ A;  4DO0 A;  1D0Z A;  2IAK A;  5FYM A;  3KV5 A;  3TKL B;  4YJ2 E;  5LXT E;  2WAU A;  2LSY A;  3ZN0 B;  4A56 A;  4QHO A;  1MIY A;  1O3X A;  2IC6 A;  2ZM8 A;  3I9W A;  4U74 A;  4ZI3 D;  4KBM B;  1G73 A;  3OYX A;  2OA5 A;  2ODV A;  2ZMA A;  1UX4 A;  2CLY B;  4GYR A;  5TAO A;  2HPL A;  2CXF A;  5HYA A;  3BQL A;  3GA8 A;  2E9X B;  4O4H E;  4QXC B;  2DHR A;  3KBT A;  4I55 E;  3ANW B;  3ZC1 A;  4EIW A;  2X66 A;  3CVR A;  1S94 A;  2W00 A;  2EHO C;  3GN5 B;  4IST A;  4WW0 A;  4E7S A;  5HXE A;  5E0O A;  3QK6 A;  3AAI A;  2RA1 A;  3Q5W A;  3KIN B;  5KMG P;  3UT5 E;  1D0Y A;  4UIG A;  1U4Q A;  4CXX A;  5DQV A;  3CQX C;  5CB4 E;  4G63 A;  4PK4 A;  1BR1 A;  1ZHC A;  4ILU A;  5HWY A;  5LBQ B;  3O1H A;  4EAH A;  3E08 A;  2Q9Q A;  3C4X A;  3VKG A;  2E9X A;  3VU7 H;  2X9W A;  2W62 A;  2Q9Q D;  3ANW A;  3ESL A;  4GOU A;  2E9X D;  5J1G A;  1NWM X;  2QA7 A;  1YW0 A;  2VKH A;  5A1L A;  1SA0 E;  2VKJ A;  1WYB A;  3E0Z A;  3GN5 A;  2V26 A;  4PK5 A;  1HX8 A;  4H9S E;  4X1K E;  2CA5 A;  5LBM A;  5KDM C;  3UUX B;  4L9I A;  4EB6 E;  5GON E;  5L3F B;  3R6N A;  4TN7 B;  3ZJ2 A;  1UCU A;  5JDL A;  2X0L B;  4L0R A;  3ZEF B;  4MFR A;  2EHO B;  2C0S A;  3PU8 A;  5H6Q B;  3RRW A;  4MLK A;  3C51 A;  3PE0 A;  2H3R A;  5CA0 E;  4UEL A;  4MHC A;  5FY1 A;  1IAP A;  5HAX A;  5LCY A;  2XAQ B;  3MKD A;  1B7T A;  2KLQ A;  1QSD A;  3IEE A;  2CE7 A;  1MND A;  4CXW A;  3F2E A;  4PJN A;  3BK9 A;  3AAA B;  3V5S A;  2WMN A;  1U5P A;  4I4T E;  4ZI2 C;  4BA9 A;  5M4Y A;  3ZMV B;  2Y48 B;  2ZM0 A;  5EZY E;  3O1J A;  3ZMZ B;  2EHO A;  3EVY A;  2ACX A;  3AA1 B;  3LBX B;  4QXH B;  3SOL A;  2B1E A;  4AQF C;  3UUM A;  3C50 A;  4H63 H;  2EHO D;  1BR4 A;  3MJX A;  3N2G E;  2G0U A;  4EXT A;  2ZM2 A;  2ZLY A;  3SS1 A;  3Q5X A;  2W0G A;  3ETV A;  2GK9 A;  3MK7 C;  2LSG A;  3U3I A;  1HG5 A;  5FY0 A;  3R84 B;  4H63 V;  1Y64 B;  5EK4 A;  4OFZ A;  2NW7 A;  4TV9 E;  4YLH A;  4UVC B;  1IJ6 A;  4ISS A;  1WYC A;  5FY7 A;  2YEV C;  2KWH A;  3LBX A;  4O4J E;  3J7Y q;  5FNV E;  2LT3 A;  4IDZ A;  3PUS A;  4I43 B;  2W61 A;  4IIJ E;  2NWB A;  2A2F X;  3NBX X;  2NP9 A;  3O4X E;  2N1G A;  3CQC B;  2Z6E A;  3B57 A;  5KX5 E;  4FJO A;  3IF8 B;  2WWU A;  2JPF A;  3VKH A;  2K5B B;  1YD8 G;  3ZJ1 A;  5DAB A;  5LYJ E;  3EDV A;  5LHG B;  2XAH B;  2PBI A;  3KV4 A;  4B6X A;  5F8P A;  5J2U E;  2VKD A;  3RYI E;  3F31 A;  3MZK B;  4PNI A;  3CQG B;  2PG8 A;  4UVB B;  3I9Y A;  4DBQ A;  1D1A A;  4OHF A;  2D5U A;  2KZ7 B;  5HXC A;  1FEW A;  3ZPO A;  1MIW A;  4ZI2 D;  3FHN A;  2X51 A;  5ETW A;  2QGS A;  2LHR A;  3AB3 B;  2DNX A;  4AQF A;  3UUL A;  3FBZ A;  4DBR A;  4J2C A;  4P0A A;  2L8K A;  3QUJ A;  4AKL A;  3RYH E;  2VWA A;  1D0X A;  2CXL A;  2CMR A;  5IHY A;  4DMV A;  5BMV E;  3UTK A;  3CX8 B;  4O4L E;  2E8I A;  3UUN A;  2XAJ B;  2LSJ A;  5JVD E;  1LKX A;  1IZN B;  3ZMT B;  3ZYK A;  1BR2 A;  2CWY A;  2LM9 A;  5H6R B;  3N5L A;  2ES0 A;  2KIN B;  3I0Q A;  1UX5 A;  4AKI A;  1ZEE A;  2Y6X A;  3A5X A;  3U78 A;  2KMF A;  2HH7 A;  5EK2 A;  2V7K A;  2KWI B;  4OK0 A;  4P0B A;  3I1A A;  3K3N A;  4PFO A;  4ERR A;  2D0U A;  5DJQ C;  4O8S A;  3NRY A;  3LJC A;  2V7I A;  3ZYL A;  3N9M A;  5L3D B;  4Z8X A;  2CWO A;  2VKO A;  5HXS A;  3EDU A;  3PUG A;  2X9H A;  5JDH A;  3M65 A;  3RYF E;  3JC6 C;  4IE6 A;  3VHL A;  4QXB B;  4G2A A;  4QKN A;  3L3P A;  3FXE B;  5JQG E;  3HKD E;  5JH7 E;  4ZS3 A;  2LSI A;  4BJN A;  2BZB A;  2LHN A;  3HKE E;  3L09 A;  3LK2 B;  3AVR A;  2P9B A;  2C5J A;  4KP3 C;  4FI5 A;  3HL6 A;  5FXV A;  4CXY A;  2JMH A;  2MOZ A;  4IE4 A;  2YIN A;  4ZHQ E;  2X67 A;  3N9L A;  1H7C A;  1VOM A;  3QC9 A;  2XAG B;  1MMN A;  2KT9 A;  4ZOL E;  4CQI A;  3PTR B;  3EUH A;  2DI4 A;  3P8C D;  2WM9 A;  3LFM A;  4BJM A;  4HN9 A;  1E1H B;  4MAL A;  3FBL A;  2K24 A;  4XAX B;  2DCF A;  2I59 A;  2CCQ A;  2NTY A;  2K48 A;  5C8Y E;  4AXP A;  2LOS A;  4UF0 B;  1D1C A;  2NTX A;  4WBO A;  4U72 A;  5JR9 C;  5JDM A;  2X9X A;  4M1P A;  3Q9D A;  1LRZ A;  4PJJ A;  4HGA A;  4EOZ B;  2V1D B;  4QWN B;  5EK3 A;  1HF8 A;  2D0T A;  1CUN A;  4WBN E;  1WLX A;  3RC3 A;  3ZC0 A;  2UXN B;  3CKD A;  4EYY R;  2XHE B;  2NW9 A;  1LVK A;  4P09 A;  3AA7 B;  1S35 A;  2XUE A;  5HXH A;  3CX7 B;  4H9P C;  1HTJ F;  4UF0 A;  2HPJ A;  4PFP A;  3JC6 D;  2NOX A;  3FXD B;  2JJ9 A;  1KK7 A;  2MBG A;  2JQQ A;  1HS7 A;  4GYS A;  1FMW A;  3C4Z A;  3HI2 A;  1G8X A;  3OKQ A;  3OYZ A;  4TV8 E;  2H7O A;  4YFS A;  3RYC E;  4DND A;  3ETU A;  3I0O A;  5FP3 A;  2J1D G;  1KNZ A;  1EZ3 A;  4PW8 A;  4F6R C;  1YKE B;  3MAC A;  3N9P A;  3N2O A;  5JR9 B;  5L3B B;  3CPZ A;  4H9N C;  4X1Y E;  4AKH A;  2V7J A;  5LGN B;  5LJN A;  5CA1 E;  5LA6 E;  2WSS V;  2LEH A;  2N2N A;  3N9N A;  3F57 A;  4PAG A;  4C91 A;  3UFE A;  3C64 A;  4CZZ B;  3GMI A;  2XTL A;  1MMA A;  2CLY C;  4YHJ A;  4IE7 A;  4E7Z A;  4UXN B;  3HA4 A;  5LOV E;  1SHZ C;  2Q9Q C;  2RP4 A;  3HKC E;  4ASK A;  3PUR A;  3LG7 A;  4H9O C;  3H37 A;  1IJ5 A;  5DQW A;  5FXZ A;  3C4W A;  2BVL A;  2CEA A;  5LG4 A;  1MIV A;  2YU1 A;  1OWA A;  4TZ4 C;  3AVS A;  1US7 B;  5FXX A;  2DWG A;  3ZYM A;  4X20 E;  4KUM B;  4PJL A;  4EZH A;  5JDG A;  1T98 A;  3RPU A;  4GIW A;  2VK9 A;  3MA9 A;  3OBV E;  3CWZ B;  4UV9 B;  4NUU A;  5L3E B;  3MXZ A;  1D1B A;  2WBL A;  2A3D A;  2A72 A;  5F3J A;  4XBF B;  2L3L A;  2CM0 A;  1FIO A;  3WAK A;  4PJM A;  3O1I A;  2SPC A;  4TUY E;  2Q9Q B;  1AJ3 A;  1V9D A;  2LJL A;  2KXP B;  4OYJ A;  2VB6 A;  3OJA A;  2LSK A;  2PFV A;  3H3A A;  3ZLI A;  5L3C B;  2V7L A;  2BDE A;  3KVA A;  3WI3 A;  1WRD A;  4GK0 E;  5AFU L;  5LHI B;  1NAF A;  3KBU A;  2NW8 A;  1X79 A;  3RC8 A;  5JDF A;  2PJQ A;  5LP6 E;  5JRC B;  2JMK A;  3KV6 A;  3PUQ A;  2C5K T;  4EZ4 A;  3K3O A;  3Q2M A;  2C5I T;  5L3G B;  1HFA A;  2UXX B;  2D2S A;  2H7V C;  3AAE B;  2ODU A;  1OXZ A;  3DP7 A;  4YJ3 E;  4MBQ A;  5HXR A;  5JDN A;  2VAS A;  3BQK A;  3PDY A;  4HTE A;  4L5G A;  3HR0 A;  3K3Q C;  2YK0 A;  4I50 E;  4JEH B;  3SWH A;  3N9O A;  2M67 A;  4UEM A;  5LJM A;  1VRB A;  4DMW A;  2W63 A;  2JRK A;  3P7I A;  4IE5 A;  4AQG A;  4AKG A;  3IBP A;  4ADZ A;  2YU2 A;  3RX6 A;  4V1A v;  3CML A;  4K0U A;  4PK6 A;  1MMD A;  2LE8 A;  1MMG A;  3NRX A;  2DLR A;  4ZS2 A;  2X68 A;  3RKO A;  3KDS E;  2DWK A;  2XQY A;  3ZN1 B;  3DTO A;  5LNK A;  4IHJ E;  2LOP A;  3DJB A;  3NZQ A;  5LGT B;  3BQI A;  4QX7 B;  3GWH A;  4GK5 E;  4EYU A;  3N9Q A;  4JUY A;  2K9A A;  2XAF B;  4TX5 A;  2MYS A;  4O4I E;  4ZI7 E;  2N9D A;  1LVF A;  3KVB A;  3T8O A;  1HCI A;  4ZI3 C;  1Z0P A;  3PU3 A;  4O2B E;  2Y8D A;  4BAY B;  4AI6 A;  3O9X A;  3LK3 B;  4H9R C;  2MTQ A;  2XAS B;  3CX6 B;  3HKB E;  3B13 A;  4C90 A;  4HFV A;  4KMC A;  3S4U A;  4HEA A;  4WNK A;  1QUU A;  2X9Y A;  3K8P C;  4UV8 B;  2VL8 A;  3ONX A;  2V7M A;  4ANJ A;  3WAJ A;  3V5U A;  4H9Q C;  4HE8 A;  1MNE A;  1HG2 A;  2L9Q A;  3ZCJ A;  3PUA A;  4QX8 B;  3ZMU B;  3IHR A;  5FXW A;  4CI1 B;  2WMO A;  5HWX A;  5IYZ E;  3N2K E;  4IGU A;  1BR0 A;  2BVM A;  5FMN A;  4CI2 B;  3ZMS B;  2IW5 B;  4N78 D;  5J2T E;  4JEU B;  3AA6 B;  5LGU B;  1FMV A;  4CI3 B;  1ZKE A;  4AKR B;  2CXD A;  5JRC A;  3LK4 2;  2E9X C;  3KFW X;  4X1I E;  3FB2 A;  3KV9 A;  5LHH B;  3RRC A;  1WR6 A;  5ADX L;  5L2L A;  1YKH B;  4XZC A;  4NUV A;  3RH3 A;  2IC9 A;  4O2A E;  1ZV4 X;  3ZCI A;  5JR9 A;  4IE0 A;  4UVA B;  4JLE A;  3E22 E;  3W15 B;  3NZP A;  3AA0 B;  4HKA A;  3D0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...