1FEWA

Crystal structure of smac/diablo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
SLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELKQKTQEEGEERAESEQEAYLRED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and biochemical basis of apoptotic activation by Smac/DIABLO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
total genus 90
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1fewA00
1FIOA 2XHEB 3LG7A 4TX5A 1S94A 1G73A 1FEWA 4JEUB 5M4YA 1HS7A 1BR0A 5LG4A 3C98B 2DNXA 4JEHB 1EZ3A
chains in the Genus database with same CATH superfamily
3ZSSA 5LYJE 4AISA 3VKHA 1LVFA 2VURA 1KFYA 4DNDA 2K3WA 3LDQB 2CEAA 5AQNB 1N33T 5JRCA 4HWDA 3EHZA 3JADA 2XUEA 2W4XA 3NBXX 2BZBA 2CWYA 2WS3A 2JIWA 1YKEB 2D0UA 4ZI3C 1MIYA 2ES0A 3KFWX 2VQET 1MIWA 3AXJA 3ONJA 1OEDB 2A72A 4HGAA 1ZP0A 3QUJA 5DABA 4CZZB 2IC6A 3AEAA 1VCSA 2DCFA 2K48A 3ZN1B 3UQ4A 3C98B 4B3MT 2VL0A 3AE6A 5F5WA 5AQUB 3TLVA 4UXNB 3ZLIA 4O4HE 3UUNA 4ISTA 2NW7A 1NWMX 3ABVA 3VR8A 2I6HA 4JI8T 1J5ET 1FIOA 1IBKT 1SA0E 1US7B 5HXRA 3DJBA 3MA9A 3ONLC 3OYZA 5L3BB 4CXXA 2ZM0A 3FXDB 4YHJA 4AXPA 4B3ST 2W67A 1HNXT 1IZNB 3ESLA 5H6QB 2XZEA 2YN6A 1SUMB 3RC8A 2D5UA 4EZ4A 3FZFB 4LF6T 2DWKA 2E2AA 4EIWA 3FZKB 4CN4A 4CI1B 1I94T 4GKJT 2DWGA 2XQ7A 1E7PA 3FHNA 2LSYA 3PUGA 1YQ3A 3CKDA 1W0BA 2AE9A 5FY1A 2NOXA 3KV6A 5KX5E 1KNRA 4IE5A 3LSVA 1WLXA 2V26A 2YOEA 4QXCB 4EYUA 2LT3A 1T8BA 4JV5T 3QB5K 1UX4A 2BKNA 5BR8T 3UULA 1HG5A 3K8PC 1KNPA 4DV3T 3C4XA 3I0QA 4HFVA 4O2BE 4O8SA 2VASA 4U31A 4EEBA 3I9YA 2WDRA 2WP9A 3PUAA 2CBJA 3E0ZA 4GOUA 4IDPA 4WZXA 1ZOYA 3P50A 5IHYA 4ZI7E 3E22E 4U2YA 4JYAT 3R84B 1S35A 2RA1A 5M4YA 4DR6T 2WWVA 3ZCIA 5ABFA 4Z8XA 1LKXA 2EHOC 3IHRA 3RHWA 3N9OA 4HWHA 2L9QA 2B1EA 2ZLYA 2UXXB 1QUUA 2BKOA 2XTLA 3AE5A 4U3CA 2JQ9A 2VWAA 2M6BA 1UCUA 2BS4A 2LJLA 3AAIA 3N5LA 4PJMA 4JI5T 3A8YC 3F2EA 2LM9A 3Q9DA 3CPZA 5FL1A 4YTPA 1MMNA 2LRLA 3PDYA 1YKHB 1BR0A 4Z90A 4YSXA 1KNZA 5AQVB 2KXPB 5JTGA 1MNDA 2XASB 5HEHA 2WQYA 4JLEA 3AA0B 4AKIA 4ZS3A 4UV8B 3MACA 3MZKB 3EI0A 1GQEA 2AXDS 2V8SV 2VVNA 2XQ5A 4IDZA 5DJQC 3KVAA 4ZS2A 3L8RA 2PTFA 3RX6A 1W9RA 4QWNB 2XJ7A 4DVDA 3HKCE 3PUWF 4XBFB 2WMNA 1OXZA 2YDSA 3ZN0B 1D0ZA 2KZ7B 4JI2T 4X66T 5CB4E 4N78D 5HXCA 2KNDA 5LG4A 1HNWT 1HR0T 2YU1A 3PE0A 2WZIA 2XSBA 2V7IA 3KBTA 3MXZA 4H9OC 3AE9A 2W62A 4LFAT 5CJ5A 4AQYT 2E8IA 2KSRA 4JI0T 5LG3A 2UXCT 2ODVA 4DR7T 2ZM6T 2W2UA 2XM2A 1MIVA 4M1PA 3AEEA 5L3DB 4KUMB 3Q2MA 2E9XB 5FP3A 1G73A 3LFMA 1XDOA 2D0TA 5LOVE 2J62A 3EAMA 4ANJA 4ISSA 1YQ4A 4X1IE 3RIFA 3LK3B 4DR4T 2J4GA 4HEAA 3N9QA 3FZMB 5AQKB 4DO0A 5JR9B 5EK2A 4H9PC 4UR9A 1O3XA 2WY2A 3N2OA 3HKEE 2D2SA 3NRXA 3UUXB 4HWIB 3RF1A 5J2UE 5LJMA 4QXBB 1HX8A 3PUYF 4YFSA 2W63A 4XAXB 5ABEA 2XM1A 1UK5A 2Q9QC 1S94A 2UUCT 4JUYA 2K9AA 2LKHA 4UIGA 3QB5A 2LHNA 4HFEA 2M67A 4YSYA 2WU5A 3SFEA 2L8KA 4JI6T 3RGLA 2MYSA 1YD8G 2JQQA 2LSGA 2VKDA 3BK9A 3I9WA 2RPAA 1X79A 4MBQA 4O4LE 3LJCA 3UFGA 3UFEA 3ZJ1A 5L3GB 4CXYA 3ZC0A 4YHHT 2UXNB 4A5XA 2V7MA 3KV9A 2X9XA 2H88A 3UU6A 5LNKA 4A56A 4CXWA 5LXTE 1XMOT 4IE6A 3ZEFB 5J1GA 3UTKA 1Y01A 2PFVA 2LSJA 3CX8B 4U74A 3HA4A 3VKGA 1D1CA 3KVBA 2X66A 2I59A 4I50E 3P4PA 3EABA 4LMJA 5FXXA 4P1NA 5AQTB 3WI3A 4QXHB 4I4TE 3L09A 4PJJA 3RC3A 3W15B 5JR9C 2X51A 5FXVA 5L3FB 3OPCA 2G0UA 4ZI2C 2PJQA 4IDQA 3WAKA 5HXEA 3ZMZB 3AEFA 2V6YB 5AQOB 4LF9T 4DR3T 4QH4A 3PTRB 4MLKA 2A3DA 3B5MA 4H9RC 2Q9QD 5LHGB 2KLQA 3UU8A 3FXEB 2DL1A 1MMDA 3AA7B 4JI3T 3JCFA 4JI7T 4OHFA 3KDSE 4U2ZA 3K3NA 5LGNB 2CRBA 2P9BA 3CK6A 5L47A 3IBPA 1T98A 2LRKA 2XQ9A 3RIUC 5GONE 3JC6D 4HWFA 5C2TA 1FMVA 1FMWA 4H9NC 4LMLA 4DR5T 5LMNT 1FEWA 2H7VC 3N9NA 2XQYA 3N9LA 1BR2A 2N2NA 4O2AE 5J2TE 3O1JA 4P0AA 4IIJE 2WDVA 3D0TA 1N32T 5ETWA 2QYWA 2V7LA 3FB2A 1WR0A 3M65A 3TLUA 5J0ZA 4DMWA 2LEHA 2NR4A 3ETVA 4IDNA 1WYCA 4KBMB 4TV9E 5E0OA 3RRWA 3ZYMA 4YXDA 5HWXA 3LBXA 4WNKA 4E7ZA 4NXNT 2ACXA 3CQCB 5DQVA 4X65T 4V1Av 2FUPA 3BQKA 2LSIA 3B13A 3C64A 2WDQA 3PUVF 2YDQA 3ZYLA 2JJ9A 4U72A 4DIDB 4DBQA 1NENA 4YSZA 4Z91A 5CFBA 3ZT6A 2EHOA 4UF0A 3EUHA 4X1KE 1HG2A 3J9X1 3RQWA 1J5WA 5LGTB 4AKRB 3AEBA 1U4QA 2N1GA 3T1YT 3RKGA 1T72A 2W61A 2VKOA 2XQ4A 3I0OA 2LHRA 4PW8A 3RKOA 2V5CA 3KBUA 1HNZT 4HFHA 5HEUA 1H7CA 2K24A 5DQWA 5LCYA 3ZPOA 4K0UA 2BS3A 2EHOB 1LRZA 3AE3A 4HFIA 4UF0B 5FYMA 5HWYA 1D1AA 3T1HT 1AJ3A 2YDRA 3VRBA 3ETUA 2IDOB 2L3LA 3AE1A 4KX6A 3AAEB 4L0RA 1IJ6A 5FNVE 5L2LA 4AQGA 2UUBT 2XQ3A 4TUYE 4GKKT 4KP3C 1J1JA 5LBMA 1CHUA 4IDOA 3C50A 2PBIA 5LHIB 4JI4T 4CI2B 1DU2A 4IREA 3UUBA 1CUNA 1M7KA 3NZPA 2CXDA 3P4SA 1WFDA 4ILAA 1ZKEA 2ZM2A 1IBMT 1ZHCA 4ILUA 2UU9T 3O1IA 1XNRT 5CA1E 4QH1A 3AE7A 2LSKA 2MTQA 3O4XE 4DV0T 2JMKA 4KMCA 3A7MA 3AB3B 4PK4A 4DV4T 2BG9B 2PG8A 3EVYA 3RLFF 3FBLA 1OEDC 4H63H 4H9SE 4C91A 2WU2A 3ZJ2A 3GN5A 4P0BA 4ZEYA 3UU4A 3AE4A 1MMGA 4TZ4C 1KK7A 4BJNA 2ACZA 2X68A 2WSSV 3GN5B 5A1LA 3P4QA 4FI5A 4AI6A 2BG9A 4EXTA 1WRDA 2E9XD 1N36T 2NTYA 3N9PA 1BR4A 3LK42 2X0YA 2X67A 3AE8A 1NEKA 2Z6EA 3PU3A 3RYFE 4EGWA 2BBJA 4NPPA 3SS1A 2CHNA 2LKGA 1ZV4X 3NVOA 4IE0A 4AIUA 5L3CB 3UQ7A 5L4EA 5IWAT 2DLRA 4OK0A 5AQHB 3ONXA 3JAFA 5JREA 2C5JA 2HPLA 4LF7T 4AKLA 3CX6B 4PK5A 4HFCA 5KDMC 3WAJA 4COFA 2MPKA 4IL9A 4WBNE 5HXSA 1L0VA 3UUMA 5KMGP 1I6ZA 2JQHA 1HCIA 3VR9A 1XZYA 4PJLA 1IBLT 1WYBA 4KHPT 4E7SA 3SWHA 3BQLA 4ZZCA 5HYAA 3NWIA 2Q9QB 3JAEA 4UEMA 5F3JA 4YT0A 2XQAA 4KHZF 4WW0A 1U5PA 2JQKA 5FY7A 2RP4A 5AQSB 2QRXA 5LP6E 3NRYA 4PNIA 3G06A 4ZZBA 4DV7T 4PFOA 3PURA 2YU2A 4AQFC 2KWHA 4PK6A 3UU5A 5JDHA 4YTMA 4H63V 4AQFA 1OEDE 5JDNA 3H3MA 2JPFA 3E08A 1FJGT 3HKBE 3QK6A 2B76A 2M6IA 3RH3A 2A9UA 4UELA 4DR2T 3EDUA 5LBQB 3J7Yq 2ZMAA 3LBXB 2MOZA 4A97A 3ZMSB 2KWIB 3CX7B 5EK3A 4EAHA 4ILCA 5LGUB 3PUXF 4WYVA 4YY3T 4LF4T 2F4VT 4DUYT 4HFBA 5TAOA 4B6XA 4AKHA 5AQGB 2BKPA 2H3RA 4L9IA 4O4JE 4U33A 3C4ZA 3RYIE 5JDMA 4DV1T 2XHEB 2XY8B 4UVCB 5AQLB 3AA1B 5EK4A 4DR1T 2LOSA 3OVUA 4IE7A 4LFCT 2V6XA 2WBLA 3H3AA 5AFUL 2LLYA 1UX5A 2CE7A 2XQ8A 2J47A 3A5XA 1HX1B 3AEDA 1MNEA 3GMIA 4IGUA 2OV9A 4QX8B 5AQPB 3ZMTB 5HEOA 2BDEA 1JNZA 4GK0E 4HKAA 3ZMVB 2BG9C 2HN1A 2R6GF 2Y6XA 4TWHA 3VRAA 1IJ5A 3QNUA 3ANWB 4IT4A 4DUZT 1SE7A 2FJEA 3HI2A 3MJXA 5JDLA 3CVRA 3U78A 2V6YA 3HL6A 4MHCA 4TWFA 2UXBT 1R8IA 2YKSA 3OYXA 3RYCE 1EZ3A 3ZKRA 4ZOLE 3MK7C 3ZSTA 5JDFA 3QC9A 5IYZE 4UVAB 4X64T 2CA5A 5AQIB 2UXDT 2KT9A 2SPCA 1HS7A 4ASKA 4CQIA 1WR6A 1UURA 1UGOA 5FKYA 4OX9T 3SOLA 4JBWF 2JMHA 2VVSA 3KINB 4IE4A 3RI5A 2CXLA 2W00A 3RIUA 4DMVA 2V7JA 4TN7B 2V1DB 3ZC1A 3ZT7A 2WMOA 4C90A 3PV0F 5LHHB 4LFBT 2E5VA 4X20E 5EZYE 4U7IA 5FVLA 4A98A 1D1BA 2VQFT 5AQRB 1BR1A 2QA7A 5ABFB 3FZLB 3VU7H 2EHOD 2H89A 2IHR1 5JDGA 2K5BB 4JI1T 2DNXA 2LOPA 4ZXLA 3TLWA 5AQFB 2HN2A 1E2AA 3LG7A 2UUAT 4CN1A 3OKQA 2HH7A 3L3PA 4EZHA 2WB5A 2HPJA 2BG9E 5LA6E 2OLTA 3OTOT 3N2GE 2IC9A 1SHZC 2VKHA 3AA6B 3P8CD 4HTEA 4HWCA 5JH7E 4UVBB 3RYHE 1D0YA 4ZI2D 1QSDA 5ABHA 2X9HA 2LM2A 2XAHB 2E5LT 2X0LB 3EDVA 5JR9A 2D9DA 2BVLA 3IF8B 3M3ZB 1E1HB 2CCQA 4G63A 3ZMUB 1MMAA 3F57A 4FJOA 1YXRA 4GIWA 2VK9A 5HCJA 2E9XA 3DP7A 3R6NA 1WCRA 2NWBA 4B3TT 2DHRA 3AE2A 4HFDA 3ZYKA 3JC6C 3UT5E 2FJBA 2XPKA 3T8OA 5HAXA 2Q9QA 3AVRA 3PJAJ 2KMFA 4K0KT 3B57A 3PJAA 5HEGA 4O4IE 3RPUA 2E9XC 4ZHQE 3HKDE 2JRKA 2GK9A 2MBGA 3Q5XA 4ILBA 4ZI3D 5F8PA 2WWUA 4NUUA 1JNRA 2Y8DA 4JEHB 2CLYC 2QGSA 2XAGB 3L39A 2XSAA 5FY0A 1VRBA 3LK2B 3K3OA 3N2KE 3ZT5A 2YEVC 4PJNA 4EB6E 4F8HA 2CPTA 2CHOA 1HF8A 4YJ2E 4EV6A 2WCAA 5FXWA 1OWAA 3P4WA 1XWMA 2ZM8A 5CGMA 4AKGA 3GWHA 5LMUT 1LVKA 4Q25A 3I1AA 3CQXC 4TX5A 1VOMA 1VCTA 4GYRA 4CN6A 4B3RT 5JRCB 2W0GA 1T7SA 1B7TA 3IA3A 2HHHT 5JQGE 3S4UA 4OFZA 2DI4A 3ANWA 2XQ6A 3P7IA 3VHLA 4EYYR 3AEGA 3CWZB 3NKZA 2NW9A 3O9XA 2X0HA 3Q5DA 4IHJE 3SFDA 3V5UA 5FMNA 1V9DA 1KEYA 2CMRA 4TWDA 3BQIA 3AECA 5C8YE 1YW0A 4G2AA 4KI0F 4UV9B 2I0MA 3CMLA 4XZCA 3C4WA 3FZHB 5AQJB 4BJMA 1M62A 4MALA 2V7KA 4NUVA 2YINA 2CM0A 3MKDA 1D0XA 2X9WA 5LB7B 2CBIA 5ABGA 2NP9A 3DTOA 4EEDA 4YTNA 2LE8A 1X9BA 4LF8T 2YK0A 5FXZA 1G8XA 2XAFB 3K3QC 2VL8A 4I55E 4ERRA 3PU8A 5JDQA 4HN9A 2WZHA 3KV4A 1KF6A 2QVAA 3CIRA 3H37A 3PUSA 4EOZB 4L5GA 4X62T 4F6RC 2X9YA 4DV6T 3RIAA 2CWOA 4TV8E 4X5TA 2WAUA 2OA5A 2IUBA 3CQGB 2NW8A 2KINB 4ADZA 1HFAA 1Z8UA 1Z0PA 3AAAB 4MFRA 4WBOA 5AQQB 3RRCA 3FBZA 2V5DA 3QOFA 2BS2A 4GK5E 3GA8A 3KV5A 3SRZA 5C3JA 3IEEA 1NAFA 3NZQA 2W66A 4LMKA 4QHOA 3Q5EA 1ZEEA 5JVDE 4NXMT 4BA9A 2CXFA 2C0SA 3TLSA 3P4RA 2A2FX 3N9MA 4P09A 1W09A 4HE8A 4QX7B 4YLHA 4JEUB 1Y64B 2IW5B 3K1SA 5ADXL 4GYSA 3TKLB 4BAYB 2N9DA 3TLTA 1QLBA 5BMVE 5KXJA 2ODUA 2WM9A 5HXHA 3V5SA 2BVMA 4LF5T 2FJAA 4NIQA 4DV2T 1W0AA 2VB6A 5L4HA 2XAJB 2MAWA 1XNQT 4OYJA 3O1HA 3PUQA 4IL4A 4YJ3E 4J2CA 3OJAA 5FVKA 3HR0A 5CA0E 5HCMA 2BBHA 4TNVA 2Y48B 4QH5A 2CLYB 5FL0A 2H7OA 5L3EB 3F31A 1OEDA 4I43B 3AXJB 1UUSA 3PUZF 4DBRA 2FBWA 2IMLA 3U3IA 3UU3A 1XDPA 2IIUA 2C5IT 1IAPA 4I0UA 4PAGA 2NTXA 2J1DG 4QKNA 4PFPA 3AVSA 3C51A 4TNWA 4X1YE 3X1DA 3ZCJA 5LJNA 3OBVE 5HEJA 5IUXA 3Q5WA 1N34T 1HTJF 4DV5T 5AQMB 2IAKA 2VKJA 5H6RB 2XAQB 1XMQT 4OYKA 4CI3B 2FJDA 2C5KT 3RQUA 4U7YA 4H9QC
chains in the Genus database with same CATH topology
3VKHA 5LYJE 1LVFA 4DNDA 5JRCA 2CEAA 2XUEA 3NBXX 4ZI3C 2BZBA 2CWYA 1YKEB 2D0UA 1MIYA 2ES0A 3KFWX 1MIWA 4HGAA 2A72A 4CZZB 3QUJA 5DABA 2IC6A 2DCFA 2K48A 3ZN1B 3C98B 4UXNB 3ZLIA 4O4HE 3UUNA 4ISTA 2NW7A 1NWMX 1FIOA 1SA0E 1US7B 5HXRA 3DJBA 3MA9A 3OYZA 5L3BB 4CXXA 2ZM0A 3FXDB 4YHJA 4AXPA 1IZNB 3ESLA 5H6QB 3RC8A 2D5UA 2DWKA 4EIWA 4CI1B 2DWGA 3FHNA 3PUGA 2LSYA 3CKDA 5FY1A 5KX5E 2NOXA 3KV6A 4IE5A 1WLXA 2V26A 4QXCB 4EYUA 2LT3A 1UX4A 3UULA 1HG5A 3K8PC 3C4XA 3I0QA 4HFVA 4O2BE 4O8SA 2VASA 3I9YA 3PUAA 3E0ZA 4GOUA 4ZI7E 5IHYA 3E22E 3R84B 1S35A 2RA1A 5M4YA 3ZCIA 4Z8XA 1LKXA 2EHOC 3IHRA 3N9OA 2L9QA 2B1EA 2ZLYA 2UXXB 1QUUA 2XTLA 2VWAA 3N5LA 1UCUA 2LJLA 3AAIA 4PJMA 3F2EA 2LM9A 3Q9DA 3CPZA 1MMNA 3PDYA 1YKHB 1BR0A 1KNZA 2KXPB 1MNDA 2XASB 4JLEA 3AA0B 4AKIA 4ZS3A 4UV8B 3MACA 3MZKB 4IDZA 5DJQC 3KVAA 4ZS2A 3RX6A 4QWNB 4DVDA 3HKCE 4XBFB 2WMNA 1OXZA 3ZN0B 1D0ZA 2KZ7B 5CB4E 4N78D 5HXCA 2KNDA 5LG4A 2YU1A 3PE0A 2V7IA 3KBTA 3MXZA 4H9OC 2W62A 2E8IA 2ODVA 4M1PA 1MIVA 5L3DB 4KUMB 3Q2MA 2E9XB 5FP3A 1G73A 3LFMA 2D0TA 5LOVE 4ANJA 4ISSA 4X1IE 3LK3B 4HEAA 4DO0A 3N9QA 5JR9B 5EK2A 4H9PC 1O3XA 3N2OA 5LJMA 3HKEE 2D2SA 3NRXA 3UUXB 5J2UE 4QXBB 1HX8A 4YFSA 2W63A 4XAXB 2Q9QC 1S94A 4JUYA 2K9AA 4UIGA 2LHNA 2M67A 2L8KA 2MYSA 1YD8G 2JQQA 2LSGA 2VKDA 3BK9A 3I9WA 4MBQA 1X79A 4O4LE 3ZJ1A 3LJCA 5L3GB 3UFEA 4CXYA 3ZC0A 2UXNB 2V7MA 3KV9A 2X9XA 5LXTE 5LNKA 4A56A 4CXWA 4IE6A 3ZEFB 5J1GA 3UTKA 2PFVA 2LSJA 3CX8B 4U74A 3HA4A 3VKGA 1D1CA 3KVBA 2X66A 2I59A 4I50E 5FXXA 3WI3A 4QXHB 4I4TE 3L09A 4PJJA 3RC3A 3W15B 5JR9C 2X51A 5FXVA 5L3FB 2G0UA 4ZI2C 2PJQA 5HXEA 3WAKA 3ZMZB 3PTRB 4MLKA 2A3DA 4H9RC 2Q9QD 5LHGB 2KLQA 3FXEB 3AA7B 1MMDA 4OHFA 3KDSE 5LGNB 3K3NA 2P9BA 3IBPA 1T98A 5GONE 3JC6D 1FMVA 1FMWA 4H9NC 1FEWA 2H7VC 3N9NA 2XQYA 3N9LA 1BR2A 2N2NA 4O2AE 5J2TE 3O1JA 4P0AA 4IIJE 3D0TA 5ETWA 2V7LA 3FB2A 3M65A 4AI6A 4DMWA 2LEHA 4TV9E 3ETVA 4KBMB 1WYCA 5E0OA 3ZYMA 5HWXA 3LBXA 4WNKA 4E7ZA 2ACXA 3CQCB 5DQVA 4V1Av 3BQKA 2LSIA 3B13A 3C64A 3ZYLA 2JJ9A 4U72A 4DBQA 2EHOA 4UF0A 3EUHA 4X1KE 1HG2A 3J9X1 5LGTB 4AKRB 1U4QA 2N1GA 3SWHA 2W61A 2VKOA 3I0OA 4PW8A 2LHRA 3RKOA 3KBUA 1H7CA 2K24A 5DQWA 5LCYA 3ZPOA 4K0UA 5HWYA 2EHOB 1LRZA 4UF0B 5FYMA 4EZ4A 1AJ3A 1D1AA 3ETUA 2L3LA 5L2LA 3AAEB 4L0RA 1IJ6A 5FNVE 4AQGA 4TUYE 4KP3C 5LBMA 3C50A 2PBIA 5LHIB 4CI2B 1CUNA 3NZPA 2CXDA 1ZKEA 2ZM2A 1ZHCA 4ILUA 3O1IA 5CA1E 2LSKA 2MTQA 3O4XE 2JMKA 4KMCA 3AB3B 4PK4A 2PG8A 3EVYA 3FBLA 4H63H 4H9SE 4C91A 3ZJ2A 3GN5A 4P0BA 1MMGA 4TZ4C 1KK7A 4BJNA 2X68A 3GN5B 2WSSV 5A1LA 4FI5A 4EXTA 1WRDA 2E9XD 2NTYA 3N9PA 1BR4A 3LK42 2X67A 2Z6EA 3PU3A 3RYFE 3SS1A 5L3CB 1ZV4X 4IE0A 2DLRA 4OK0A 3ONXA 5JREA 2C5JA 2HPLA 4AKLA 3CX6B 4PK5A 5KDMC 3WAJA 4WBNE 5HXSA 3UUMA 5KMGP 1HCIA 4PJLA 1WYBA 4E7SA 3BQLA 5HYAA 2Q9QB 4UEMA 4WW0A 1U5PA 5FY7A 2RP4A 5LP6E 3NRYA 4PNIA 4PFOA 3PURA 2YU2A 4AQFC 2KWHA 4PK6A 5JDHA 4H63V 4AQFA 5JDNA 2JPFA 3E08A 3HKBE 3QK6A 3RH3A 4UELA 3EDUA 5LBQB 3J7Yq 2ZMAA 3LBXB 2MOZA 3ZMSB 2KWIB 3CX7B 5EK3A 4EAHA 5LGUB 4AKHA 5TAOA 4B6XA 2H3RA 4L9IA 4O4JE 3C4ZA 3RYIE 5JDMA 2XHEB 4UVCB 3AA1B 5EK4A 2LOSA 4IE7A 2WBLA 3H3AA 5AFUL 3RRWA 1UX5A 2CE7A 3A5XA 1MNEA 3GMIA 4IGUA 3ZMTB 4QX8B 2BDEA 4HKAA 4GK0E 3ZMVB 2Y6XA 1IJ5A 3ANWB 3HI2A 3MJXA 5JDLA 3CVRA 3U78A 4MHCA 3OYXA 3RYCE 1EZ3A 4ZOLE 3MK7C 5JDFA 3QC9A 5IYZE 4UVAB 2CA5A 2KT9A 2SPCA 1HS7A 4ASKA 4CQIA 1WR6A 3SOLA 2JMHA 3KINB 4IE4A 2CXLA 2W00A 4DMVA 2V7JA 4TN7B 2V1DB 3ZC1A 4C90A 2WMOA 5LHHB 4X20E 5EZYE 1D1BA 1BR1A 2QA7A 3VU7H 2EHOD 5JDGA 2K5BB 2DNXA 2LOPA 3LG7A 3OKQA 2HH7A 3L3PA 4EZHA 2HPJA 5LA6E 3N2GE 2IC9A 1SHZC 2VKHA 3AA6B 3P8CD 4HTEA 5JH7E 4UVBB 3RYHE 1D0YA 4ZI2D 1QSDA 2X9HA 2XAHB 2X0LB 3EDVA 5JR9A 2BVLA 3IF8B 1E1HB 2CCQA 4G63A 3ZMUB 1MMAA 3F57A 4FJOA 4GIWA 2VK9A 2E9XA 3DP7A 3R6NA 2NWBA 2DHRA 3ZYKA 3JC6C 3UT5E 3T8OA 5HAXA 2Q9QA 3AVRA 2KMFA 3B57A 4O4IE 3RPUA 2E9XC 4ZHQE 3HKDE 2JRKA 2GK9A 2MBGA 3Q5XA 4ZI3D 5F8PA 2WWUA 4NUUA 4JEHB 2Y8DA 2CLYC 2QGSA 2XAGB 5FY0A 1VRBA 3LK2B 3K3OA 3N2KE 4YJ2E 2YEVC 4PJNA 4EB6E 1HF8A 5FXWA 1OWAA 2ZM8A 4AKGA 3GWHA 1LVKA 3I1AA 3CQXC 4TX5A 1VOMA 4GYRA 5JRCB 2W0GA 1B7TA 5JQGE 3S4UA 4OFZA 2DI4A 3ANWA 3VHLA 3P7IA 4EYYR 3CWZB 2NW9A 3O9XA 4IHJE 3V5UA 5C8YE 5FMNA 1V9DA 2CMRA 3BQIA 1YW0A 4G2AA 4UV9B 3CMLA 4XZCA 3C4WA 4BJMA 4MALA 2V7KA 4NUVA 2YINA 2CM0A 3MKDA 1D0XA 2X9WA 2NP9A 3DTOA 2LE8A 2YK0A 5FXZA 1G8XA 2XAFB 3K3QC 2VL8A 4I55E 4ERRA 3PU8A 5JDQA 4HN9A 4EOZB 3KV4A 3H37A 3PUSA 4L5GA 4F6RC 2X9YA 2CWOA 4TV8E 2WAUA 2OA5A 3CQGB 2NW8A 2KINB 4ADZA 1HFAA 4MFRA 1Z0PA 3AAAB 4WBOA 3RRCA 5F3JA 3FBZA 3SRZA 4GK5E 3GA8A 3KV5A 3IEEA 1NAFA 3NZQA 5JVDE 4QHOA 1ZEEA 4BA9A 2CXFA 2C0SA 2A2FX 3N9MA 4P09A 4HE8A 4QX7B 4YLHA 4JEUB 1Y64B 2IW5B 5ADXL 4GYSA 3TKLB 4BAYB 2N9DA 5BMVE 2ODUA 2WM9A 5HXHA 3V5SA 2BVMA 2VB6A 2XAJB 4OYJA 3O1HA 3PUQA 4YJ3E 4J2CA 3OJAA 3HR0A 5CA0E 2Y48B 2CLYB 2H7OA 5L3EB 3F31A 4I43B 4DBRA 3U3IA 4PAGA 2C5IT 1IAPA 4QKNA 2NTXA 2J1DG 4PFPA 5LJNA 3AVSA 3C51A 4X1YE 3ZCJA 3OBVE 3Q5WA 1HTJF 2IAKA 2VKJA 5H6RB 2XAQB 4OYKA 4CI3B 3HL6A 2C5KT 4H9QC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FIO A;  2XHE B;  3LG7 A;  4TX5 A;  1S94 A;  1G73 A;  1FEW A;  4JEU B;  5M4Y A;  1HS7 A;  1BR0 A;  5LG4 A;  3C98 B;  2DNX A;  4JEH B;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 3ZSS A;  5LYJ E;  4AIS A;  3VKH A;  1LVF A;  2VUR A;  1KFY A;  4DND A;  2K3W A;  3LDQ B;  2CEA A;  5AQN B;  1N33 T;  5JRC A;  4HWD A;  3EHZ A;  3JAD A;  2XUE A;  2W4X A;  3NBX X;  2BZB A;  2CWY A;  2WS3 A;  2JIW A;  1YKE B;  2D0U A;  4ZI3 C;  1MIY A;  2ES0 A;  3KFW X;  2VQE T;  1MIW A;  3AXJ A;  3ONJ A;  1OED B;  2A72 A;  4HGA A;  1ZP0 A;  3QUJ A;  5DAB A;  4CZZ B;  2IC6 A;  3AEA A;  1VCS A;  2DCF A;  2K48 A;  3ZN1 B;  3UQ4 A;  3C98 B;  4B3M T;  2VL0 A;  3AE6 A;  5F5W A;  5AQU B;  3TLV A;  4UXN B;  3ZLI A;  4O4H E;  3UUN A;  4IST A;  2NW7 A;  1NWM X;  3ABV A;  3VR8 A;  2I6H A;  4JI8 T;  1J5E T;  1FIO A;  1IBK T;  1SA0 E;  1US7 B;  5HXR A;  3DJB A;  3MA9 A;  3ONL C;  3OYZ A;  5L3B B;  4CXX A;  2ZM0 A;  3FXD B;  4YHJ A;  4AXP A;  4B3S T;  2W67 A;  1HNX T;  1IZN B;  3ESL A;  5H6Q B;  2XZE A;  2YN6 A;  1SUM B;  3RC8 A;  2D5U A;  4EZ4 A;  3FZF B;  4LF6 T;  2DWK A;  2E2A A;  4EIW A;  3FZK B;  4CN4 A;  4CI1 B;  1I94 T;  4GKJ T;  2DWG A;  2XQ7 A;  1E7P A;  3FHN A;  2LSY A;  3PUG A;  1YQ3 A;  3CKD A;  1W0B A;  2AE9 A;  5FY1 A;  2NOX A;  3KV6 A;  5KX5 E;  1KNR A;  4IE5 A;  3LSV A;  1WLX A;  2V26 A;  2YOE A;  4QXC B;  4EYU A;  2LT3 A;  1T8B A;  4JV5 T;  3QB5 K;  1UX4 A;  2BKN A;  5BR8 T;  3UUL A;  1HG5 A;  3K8P C;  1KNP A;  4DV3 T;  3C4X A;  3I0Q A;  4HFV A;  4O2B E;  4O8S A;  2VAS A;  4U31 A;  4EEB A;  3I9Y A;  2WDR A;  2WP9 A;  3PUA A;  2CBJ A;  3E0Z A;  4GOU A;  4IDP A;  4WZX A;  1ZOY A;  3P50 A;  5IHY A;  4ZI7 E;  3E22 E;  4U2Y A;  4JYA T;  3R84 B;  1S35 A;  2RA1 A;  5M4Y A;  4DR6 T;  2WWV A;  3ZCI A;  5ABF A;  4Z8X A;  1LKX A;  2EHO C;  3IHR A;  3RHW A;  3N9O A;  4HWH A;  2L9Q A;  2B1E A;  2ZLY A;  2UXX B;  1QUU A;  2BKO A;  2XTL A;  3AE5 A;  4U3C A;  2JQ9 A;  2VWA A;  2M6B A;  1UCU A;  2BS4 A;  2LJL A;  3AAI A;  3N5L A;  4PJM A;  4JI5 T;  3A8Y C;  3F2E A;  2LM9 A;  3Q9D A;  3CPZ A;  5FL1 A;  4YTP A;  1MMN A;  2LRL A;  3PDY A;  1YKH B;  1BR0 A;  4Z90 A;  4YSX A;  1KNZ A;  5AQV B;  2KXP B;  5JTG A;  1MND A;  2XAS B;  5HEH A;  2WQY A;  4JLE A;  3AA0 B;  4AKI A;  4ZS3 A;  4UV8 B;  3MAC A;  3MZK B;  3EI0 A;  1GQE A;  2AXD S;  2V8S V;  2VVN A;  2XQ5 A;  4IDZ A;  5DJQ C;  3KVA A;  4ZS2 A;  3L8R A;  2PTF A;  3RX6 A;  1W9R A;  4QWN B;  2XJ7 A;  4DVD A;  3HKC E;  3PUW F;  4XBF B;  2WMN A;  1OXZ A;  2YDS A;  3ZN0 B;  1D0Z A;  2KZ7 B;  4JI2 T;  4X66 T;  5CB4 E;  4N78 D;  5HXC A;  2KND A;  5LG4 A;  1HNW T;  1HR0 T;  2YU1 A;  3PE0 A;  2WZI A;  2XSB A;  2V7I A;  3KBT A;  3MXZ A;  4H9O C;  3AE9 A;  2W62 A;  4LFA T;  5CJ5 A;  4AQY T;  2E8I A;  2KSR A;  4JI0 T;  5LG3 A;  2UXC T;  2ODV A;  4DR7 T;  2ZM6 T;  2W2U A;  2XM2 A;  1MIV A;  4M1P A;  3AEE A;  5L3D B;  4KUM B;  3Q2M A;  2E9X B;  5FP3 A;  1G73 A;  3LFM A;  1XDO A;  2D0T A;  5LOV E;  2J62 A;  3EAM A;  4ANJ A;  4ISS A;  1YQ4 A;  4X1I E;  3RIF A;  3LK3 B;  4DR4 T;  2J4G A;  4HEA A;  3N9Q A;  3FZM B;  5AQK B;  4DO0 A;  5JR9 B;  5EK2 A;  4H9P C;  4UR9 A;  1O3X A;  2WY2 A;  3N2O A;  3HKE E;  2D2S A;  3NRX A;  3UUX B;  4HWI B;  3RF1 A;  5J2U E;  5LJM A;  4QXB B;  1HX8 A;  3PUY F;  4YFS A;  2W63 A;  4XAX B;  5ABE A;  2XM1 A;  1UK5 A;  2Q9Q C;  1S94 A;  2UUC T;  4JUY A;  2K9A A;  2LKH A;  4UIG A;  3QB5 A;  2LHN A;  4HFE A;  2M67 A;  4YSY A;  2WU5 A;  3SFE A;  2L8K A;  4JI6 T;  3RGL A;  2MYS A;  1YD8 G;  2JQQ A;  2LSG A;  2VKD A;  3BK9 A;  3I9W A;  2RPA A;  1X79 A;  4MBQ A;  4O4L E;  3LJC A;  3UFG A;  3UFE A;  3ZJ1 A;  5L3G B;  4CXY A;  3ZC0 A;  4YHH T;  2UXN B;  4A5X A;  2V7M A;  3KV9 A;  2X9X A;  2H88 A;  3UU6 A;  5LNK A;  4A56 A;  4CXW A;  5LXT E;  1XMO T;  4IE6 A;  3ZEF B;  5J1G A;  3UTK A;  1Y01 A;  2PFV A;  2LSJ A;  3CX8 B;  4U74 A;  3HA4 A;  3VKG A;  1D1C A;  3KVB A;  2X66 A;  2I59 A;  4I50 E;  3P4P A;  3EAB A;  4LMJ A;  5FXX A;  4P1N A;  5AQT B;  3WI3 A;  4QXH B;  4I4T E;  3L09 A;  4PJJ A;  3RC3 A;  3W15 B;  5JR9 C;  2X51 A;  5FXV A;  5L3F B;  3OPC A;  2G0U A;  4ZI2 C;  2PJQ A;  4IDQ A;  3WAK A;  5HXE A;  3ZMZ B;  3AEF A;  2V6Y B;  5AQO B;  4LF9 T;  4DR3 T;  4QH4 A;  3PTR B;  4MLK A;  2A3D A;  3B5M A;  4H9R C;  2Q9Q D;  5LHG B;  2KLQ A;  3UU8 A;  3FXE B;  2DL1 A;  1MMD A;  3AA7 B;  4JI3 T;  3JCF A;  4JI7 T;  4OHF A;  3KDS E;  4U2Z A;  3K3N A;  5LGN B;  2CRB A;  2P9B A;  3CK6 A;  5L47 A;  3IBP A;  1T98 A;  2LRK A;  2XQ9 A;  3RIU C;  5GON E;  3JC6 D;  4HWF A;  5C2T A;  1FMV A;  1FMW A;  4H9N C;  4LML A;  4DR5 T;  5LMN T;  1FEW A;  2H7V C;  3N9N A;  2XQY A;  3N9L A;  1BR2 A;  2N2N A;  4O2A E;  5J2T E;  3O1J A;  4P0A A;  4IIJ E;  2WDV A;  3D0T A;  1N32 T;  5ETW A;  2QYW A;  2V7L A;  3FB2 A;  1WR0 A;  3M65 A;  3TLU A;  5J0Z A;  4DMW A;  2LEH A;  2NR4 A;  3ETV A;  4IDN A;  1WYC A;  4KBM B;  4TV9 E;  5E0O A;  3RRW A;  3ZYM A;  4YXD A;  5HWX A;  3LBX A;  4WNK A;  4E7Z A;  4NXN T;  2ACX A;  3CQC B;  5DQV A;  4X65 T;  4V1A v;  2FUP A;  3BQK A;  2LSI A;  3B13 A;  3C64 A;  2WDQ A;  3PUV F;  2YDQ A;  3ZYL A;  2JJ9 A;  4U72 A;  4DID B;  4DBQ A;  1NEN A;  4YSZ A;  4Z91 A;  5CFB A;  3ZT6 A;  2EHO A;  4UF0 A;  3EUH A;  4X1K E;  1HG2 A;  3J9X 1;  3RQW A;  1J5W A;  5LGT B;  4AKR B;  3AEB A;  1U4Q A;  2N1G A;  3T1Y T;  3RKG A;  1T72 A;  2W61 A;  2VKO A;  2XQ4 A;  3I0O A;  2LHR A;  4PW8 A;  3RKO A;  2V5C A;  3KBU A;  1HNZ T;  4HFH A;  5HEU A;  1H7C A;  2K24 A;  5DQW A;  5LCY A;  3ZPO A;  4K0U A;  2BS3 A;  2EHO B;  1LRZ A;  3AE3 A;  4HFI A;  4UF0 B;  5FYM A;  5HWY A;  1D1A A;  3T1H T;  1AJ3 A;  2YDR A;  3VRB A;  3ETU A;  2IDO B;  2L3L A;  3AE1 A;  4KX6 A;  3AAE B;  4L0R A;  1IJ6 A;  5FNV E;  5L2L A;  4AQG A;  2UUB T;  2XQ3 A;  4TUY E;  4GKK T;  4KP3 C;  1J1J A;  5LBM A;  1CHU A;  4IDO A;  3C50 A;  2PBI A;  5LHI B;  4JI4 T;  4CI2 B;  1DU2 A;  4IRE A;  3UUB A;  1CUN A;  1M7K A;  3NZP A;  2CXD A;  3P4S A;  1WFD A;  4ILA A;  1ZKE A;  2ZM2 A;  1IBM T;  1ZHC A;  4ILU A;  2UU9 T;  3O1I A;  1XNR T;  5CA1 E;  4QH1 A;  3AE7 A;  2LSK A;  2MTQ A;  3O4X E;  4DV0 T;  2JMK A;  4KMC A;  3A7M A;  3AB3 B;  4PK4 A;  4DV4 T;  2BG9 B;  2PG8 A;  3EVY A;  3RLF F;  3FBL A;  1OED C;  4H63 H;  4H9S E;  4C91 A;  2WU2 A;  3ZJ2 A;  3GN5 A;  4P0B A;  4ZEY A;  3UU4 A;  3AE4 A;  1MMG A;  4TZ4 C;  1KK7 A;  4BJN A;  2ACZ A;  2X68 A;  2WSS V;  3GN5 B;  5A1L A;  3P4Q A;  4FI5 A;  4AI6 A;  2BG9 A;  4EXT A;  1WRD A;  2E9X D;  1N36 T;  2NTY A;  3N9P A;  1BR4 A;  3LK4 2;  2X0Y A;  2X67 A;  3AE8 A;  1NEK A;  2Z6E A;  3PU3 A;  3RYF E;  4EGW A;  2BBJ A;  4NPP A;  3SS1 A;  2CHN A;  2LKG A;  1ZV4 X;  3NVO A;  4IE0 A;  4AIU A;  5L3C B;  3UQ7 A;  5L4E A;  5IWA T;  2DLR A;  4OK0 A;  5AQH B;  3ONX A;  3JAF A;  5JRE A;  2C5J A;  2HPL A;  4LF7 T;  4AKL A;  3CX6 B;  4PK5 A;  4HFC A;  5KDM C;  3WAJ A;  4COF A;  2MPK A;  4IL9 A;  4WBN E;  5HXS A;  1L0V A;  3UUM A;  5KMG P;  1I6Z A;  2JQH A;  1HCI A;  3VR9 A;  1XZY A;  4PJL A;  1IBL T;  1WYB A;  4KHP T;  4E7S A;  3SWH A;  3BQL A;  4ZZC A;  5HYA A;  3NWI A;  2Q9Q B;  3JAE A;  4UEM A;  5F3J A;  4YT0 A;  2XQA A;  4KHZ F;  4WW0 A;  1U5P A;  2JQK A;  5FY7 A;  2RP4 A;  5AQS B;  2QRX A;  5LP6 E;  3NRY A;  4PNI A;  3G06 A;  4ZZB A;  4DV7 T;  4PFO A;  3PUR A;  2YU2 A;  4AQF C;  2KWH A;  4PK6 A;  3UU5 A;  5JDH A;  4YTM A;  4H63 V;  4AQF A;  1OED E;  5JDN A;  3H3M A;  2JPF A;  3E08 A;  1FJG T;  3HKB E;  3QK6 A;  2B76 A;  2M6I A;  3RH3 A;  2A9U A;  4UEL A;  4DR2 T;  3EDU A;  5LBQ B;  3J7Y q;  2ZMA A;  3LBX B;  2MOZ A;  4A97 A;  3ZMS B;  2KWI B;  3CX7 B;  5EK3 A;  4EAH A;  4ILC A;  5LGU B;  3PUX F;  4WYV A;  4YY3 T;  4LF4 T;  2F4V T;  4DUY T;  4HFB A;  5TAO A;  4B6X A;  4AKH A;  5AQG B;  2BKP A;  2H3R A;  4L9I A;  4O4J E;  4U33 A;  3C4Z A;  3RYI E;  5JDM A;  4DV1 T;  2XHE B;  2XY8 B;  4UVC B;  5AQL B;  3AA1 B;  5EK4 A;  4DR1 T;  2LOS A;  3OVU A;  4IE7 A;  4LFC T;  2V6X A;  2WBL A;  3H3A A;  5AFU L;  2LLY A;  1UX5 A;  2CE7 A;  2XQ8 A;  2J47 A;  3A5X A;  1HX1 B;  3AED A;  1MNE A;  3GMI A;  4IGU A;  2OV9 A;  4QX8 B;  5AQP B;  3ZMT B;  5HEO A;  2BDE A;  1JNZ A;  4GK0 E;  4HKA A;  3ZMV B;  2BG9 C;  2HN1 A;  2R6G F;  2Y6X A;  4TWH A;  3VRA A;  1IJ5 A;  3QNU A;  3ANW B;  4IT4 A;  4DUZ T;  1SE7 A;  2FJE A;  3HI2 A;  3MJX A;  5JDL A;  3CVR A;  3U78 A;  2V6Y A;  3HL6 A;  4MHC A;  4TWF A;  2UXB T;  1R8I A;  2YKS A;  3OYX A;  3RYC E;  1EZ3 A;  3ZKR A;  4ZOL E;  3MK7 C;  3ZST A;  5JDF A;  3QC9 A;  5IYZ E;  4UVA B;  4X64 T;  2CA5 A;  5AQI B;  2UXD T;  2KT9 A;  2SPC A;  1HS7 A;  4ASK A;  4CQI A;  1WR6 A;  1UUR A;  1UGO A;  5FKY A;  4OX9 T;  3SOL A;  4JBW F;  2JMH A;  2VVS A;  3KIN B;  4IE4 A;  3RI5 A;  2CXL A;  2W00 A;  3RIU A;  4DMV A;  2V7J A;  4TN7 B;  2V1D B;  3ZC1 A;  3ZT7 A;  2WMO A;  4C90 A;  3PV0 F;  5LHH B;  4LFB T;  2E5V A;  4X20 E;  5EZY E;  4U7I A;  5FVL A;  4A98 A;  1D1B A;  2VQF T;  5AQR B;  1BR1 A;  2QA7 A;  5ABF B;  3FZL B;  3VU7 H;  2EHO D;  2H89 A;  2IHR 1;  5JDG A;  2K5B B;  4JI1 T;  2DNX A;  2LOP A;  4ZXL A;  3TLW A;  5AQF B;  2HN2 A;  1E2A A;  3LG7 A;  2UUA T;  4CN1 A;  3OKQ A;  2HH7 A;  3L3P A;  4EZH A;  2WB5 A;  2HPJ A;  2BG9 E;  5LA6 E;  2OLT A;  3OTO T;  3N2G E;  2IC9 A;  1SHZ C;  2VKH A;  3AA6 B;  3P8C D;  4HTE A;  4HWC A;  5JH7 E;  4UVB B;  3RYH E;  1D0Y A;  4ZI2 D;  1QSD A;  5ABH A;  2X9H A;  2LM2 A;  2XAH B;  2E5L T;  2X0L B;  3EDV A;  5JR9 A;  2D9D A;  2BVL A;  3IF8 B;  3M3Z B;  1E1H B;  2CCQ A;  4G63 A;  3ZMU B;  1MMA A;  3F57 A;  4FJO A;  1YXR A;  4GIW A;  2VK9 A;  5HCJ A;  2E9X A;  3DP7 A;  3R6N A;  1WCR A;  2NWB A;  4B3T T;  2DHR A;  3AE2 A;  4HFD A;  3ZYK A;  3JC6 C;  3UT5 E;  2FJB A;  2XPK A;  3T8O A;  5HAX A;  2Q9Q A;  3AVR A;  3PJA J;  2KMF A;  4K0K T;  3B57 A;  3PJA A;  5HEG A;  4O4I E;  3RPU A;  2E9X C;  4ZHQ E;  3HKD E;  2JRK A;  2GK9 A;  2MBG A;  3Q5X A;  4ILB A;  4ZI3 D;  5F8P A;  2WWU A;  4NUU A;  1JNR A;  2Y8D A;  4JEH B;  2CLY C;  2QGS A;  2XAG B;  3L39 A;  2XSA A;  5FY0 A;  1VRB A;  3LK2 B;  3K3O A;  3N2K E;  3ZT5 A;  2YEV C;  4PJN A;  4EB6 E;  4F8H A;  2CPT A;  2CHO A;  1HF8 A;  4YJ2 E;  4EV6 A;  2WCA A;  5FXW A;  1OWA A;  3P4W A;  1XWM A;  2ZM8 A;  5CGM A;  4AKG A;  3GWH A;  5LMU T;  1LVK A;  4Q25 A;  3I1A A;  3CQX C;  4TX5 A;  1VOM A;  1VCT A;  4GYR A;  4CN6 A;  4B3R T;  5JRC B;  2W0G A;  1T7S A;  1B7T A;  3IA3 A;  2HHH T;  5JQG E;  3S4U A;  4OFZ A;  2DI4 A;  3ANW A;  2XQ6 A;  3P7I A;  3VHL A;  4EYY R;  3AEG A;  3CWZ B;  3NKZ A;  2NW9 A;  3O9X A;  2X0H A;  3Q5D A;  4IHJ E;  3SFD A;  3V5U A;  5FMN A;  1V9D A;  1KEY A;  2CMR A;  4TWD A;  3BQI A;  3AEC A;  5C8Y E;  1YW0 A;  4G2A A;  4KI0 F;  4UV9 B;  2I0M A;  3CML A;  4XZC A;  3C4W A;  3FZH B;  5AQJ B;  4BJM A;  1M62 A;  4MAL A;  2V7K A;  4NUV A;  2YIN A;  2CM0 A;  3MKD A;  1D0X A;  2X9W A;  5LB7 B;  2CBI A;  5ABG A;  2NP9 A;  3DTO A;  4EED A;  4YTN A;  2LE8 A;  1X9B A;  4LF8 T;  2YK0 A;  5FXZ A;  1G8X A;  2XAF B;  3K3Q C;  2VL8 A;  4I55 E;  4ERR A;  3PU8 A;  5JDQ A;  4HN9 A;  2WZH A;  3KV4 A;  1KF6 A;  2QVA A;  3CIR A;  3H37 A;  3PUS A;  4EOZ B;  4L5G A;  4X62 T;  4F6R C;  2X9Y A;  4DV6 T;  3RIA A;  2CWO A;  4TV8 E;  4X5T A;  2WAU A;  2OA5 A;  2IUB A;  3CQG B;  2NW8 A;  2KIN B;  4ADZ A;  1HFA A;  1Z8U A;  1Z0P A;  3AAA B;  4MFR A;  4WBO A;  5AQQ B;  3RRC A;  3FBZ A;  2V5D A;  3QOF A;  2BS2 A;  4GK5 E;  3GA8 A;  3KV5 A;  3SRZ A;  5C3J A;  3IEE A;  1NAF A;  3NZQ A;  2W66 A;  4LMK A;  4QHO A;  3Q5E A;  1ZEE A;  5JVD E;  4NXM T;  4BA9 A;  2CXF A;  2C0S A;  3TLS A;  3P4R A;  2A2F X;  3N9M A;  4P09 A;  1W09 A;  4HE8 A;  4QX7 B;  4YLH A;  4JEU B;  1Y64 B;  2IW5 B;  3K1S A;  5ADX L;  4GYS A;  3TKL B;  4BAY B;  2N9D A;  3TLT A;  1QLB A;  5BMV E;  5KXJ A;  2ODU A;  2WM9 A;  5HXH A;  3V5S A;  2BVM A;  4LF5 T;  2FJA A;  4NIQ A;  4DV2 T;  1W0A A;  2VB6 A;  5L4H A;  2XAJ B;  2MAW A;  1XNQ T;  4OYJ A;  3O1H A;  3PUQ A;  4IL4 A;  4YJ3 E;  4J2C A;  3OJA A;  5FVK A;  3HR0 A;  5CA0 E;  5HCM A;  2BBH A;  4TNV A;  2Y48 B;  4QH5 A;  2CLY B;  5FL0 A;  2H7O A;  5L3E B;  3F31 A;  1OED A;  4I43 B;  3AXJ B;  1UUS A;  3PUZ F;  4DBR A;  2FBW A;  2IML A;  3U3I A;  3UU3 A;  1XDP A;  2IIU A;  2C5I T;  1IAP A;  4I0U A;  4PAG A;  2NTX A;  2J1D G;  4QKN A;  4PFP A;  3AVS A;  3C51 A;  4TNW A;  4X1Y E;  3X1D A;  3ZCJ A;  5LJN A;  3OBV E;  5HEJ A;  5IUX A;  3Q5W A;  1N34 T;  1HTJ F;  4DV5 T;  5AQM B;  2IAK A;  2VKJ A;  5H6R B;  2XAQ B;  1XMQ T;  4OYK A;  4CI3 B;  2FJD A;  2C5K T;  3RQU A;  4U7Y A;  4H9Q C; 
#chains in the Genus database with same CATH homology
 3VKH A;  5LYJ E;  1LVF A;  4DND A;  5JRC A;  2CEA A;  2XUE A;  3NBX X;  4ZI3 C;  2BZB A;  2CWY A;  1YKE B;  2D0U A;  1MIY A;  2ES0 A;  3KFW X;  1MIW A;  4HGA A;  2A72 A;  4CZZ B;  3QUJ A;  5DAB A;  2IC6 A;  2DCF A;  2K48 A;  3ZN1 B;  3C98 B;  4UXN B;  3ZLI A;  4O4H E;  3UUN A;  4IST A;  2NW7 A;  1NWM X;  1FIO A;  1SA0 E;  1US7 B;  5HXR A;  3DJB A;  3MA9 A;  3OYZ A;  5L3B B;  4CXX A;  2ZM0 A;  3FXD B;  4YHJ A;  4AXP A;  1IZN B;  3ESL A;  5H6Q B;  3RC8 A;  2D5U A;  2DWK A;  4EIW A;  4CI1 B;  2DWG A;  3FHN A;  3PUG A;  2LSY A;  3CKD A;  5FY1 A;  5KX5 E;  2NOX A;  3KV6 A;  4IE5 A;  1WLX A;  2V26 A;  4QXC B;  4EYU A;  2LT3 A;  1UX4 A;  3UUL A;  1HG5 A;  3K8P C;  3C4X A;  3I0Q A;  4HFV A;  4O2B E;  4O8S A;  2VAS A;  3I9Y A;  3PUA A;  3E0Z A;  4GOU A;  4ZI7 E;  5IHY A;  3E22 E;  3R84 B;  1S35 A;  2RA1 A;  5M4Y A;  3ZCI A;  4Z8X A;  1LKX A;  2EHO C;  3IHR A;  3N9O A;  2L9Q A;  2B1E A;  2ZLY A;  2UXX B;  1QUU A;  2XTL A;  2VWA A;  3N5L A;  1UCU A;  2LJL A;  3AAI A;  4PJM A;  3F2E A;  2LM9 A;  3Q9D A;  3CPZ A;  1MMN A;  3PDY A;  1YKH B;  1BR0 A;  1KNZ A;  2KXP B;  1MND A;  2XAS B;  4JLE A;  3AA0 B;  4AKI A;  4ZS3 A;  4UV8 B;  3MAC A;  3MZK B;  4IDZ A;  5DJQ C;  3KVA A;  4ZS2 A;  3RX6 A;  4QWN B;  4DVD A;  3HKC E;  4XBF B;  2WMN A;  1OXZ A;  3ZN0 B;  1D0Z A;  2KZ7 B;  5CB4 E;  4N78 D;  5HXC A;  2KND A;  5LG4 A;  2YU1 A;  3PE0 A;  2V7I A;  3KBT A;  3MXZ A;  4H9O C;  2W62 A;  2E8I A;  2ODV A;  4M1P A;  1MIV A;  5L3D B;  4KUM B;  3Q2M A;  2E9X B;  5FP3 A;  1G73 A;  3LFM A;  2D0T A;  5LOV E;  4ANJ A;  4ISS A;  4X1I E;  3LK3 B;  4HEA A;  4DO0 A;  3N9Q A;  5JR9 B;  5EK2 A;  4H9P C;  1O3X A;  3N2O A;  5LJM A;  3HKE E;  2D2S A;  3NRX A;  3UUX B;  5J2U E;  4QXB B;  1HX8 A;  4YFS A;  2W63 A;  4XAX B;  2Q9Q C;  1S94 A;  4JUY A;  2K9A A;  4UIG A;  2LHN A;  2M67 A;  2L8K A;  2MYS A;  1YD8 G;  2JQQ A;  2LSG A;  2VKD A;  3BK9 A;  3I9W A;  4MBQ A;  1X79 A;  4O4L E;  3ZJ1 A;  3LJC A;  5L3G B;  3UFE A;  4CXY A;  3ZC0 A;  2UXN B;  2V7M A;  3KV9 A;  2X9X A;  5LXT E;  5LNK A;  4A56 A;  4CXW A;  4IE6 A;  3ZEF B;  5J1G A;  3UTK A;  2PFV A;  2LSJ A;  3CX8 B;  4U74 A;  3HA4 A;  3VKG A;  1D1C A;  3KVB A;  2X66 A;  2I59 A;  4I50 E;  5FXX A;  3WI3 A;  4QXH B;  4I4T E;  3L09 A;  4PJJ A;  3RC3 A;  3W15 B;  5JR9 C;  2X51 A;  5FXV A;  5L3F B;  2G0U A;  4ZI2 C;  2PJQ A;  5HXE A;  3WAK A;  3ZMZ B;  3PTR B;  4MLK A;  2A3D A;  4H9R C;  2Q9Q D;  5LHG B;  2KLQ A;  3FXE B;  3AA7 B;  1MMD A;  4OHF A;  3KDS E;  5LGN B;  3K3N A;  2P9B A;  3IBP A;  1T98 A;  5GON E;  3JC6 D;  1FMV A;  1FMW A;  4H9N C;  1FEW A;  2H7V C;  3N9N A;  2XQY A;  3N9L A;  1BR2 A;  2N2N A;  4O2A E;  5J2T E;  3O1J A;  4P0A A;  4IIJ E;  3D0T A;  5ETW A;  2V7L A;  3FB2 A;  3M65 A;  4AI6 A;  4DMW A;  2LEH A;  4TV9 E;  3ETV A;  4KBM B;  1WYC A;  5E0O A;  3ZYM A;  5HWX A;  3LBX A;  4WNK A;  4E7Z A;  2ACX A;  3CQC B;  5DQV A;  4V1A v;  3BQK A;  2LSI A;  3B13 A;  3C64 A;  3ZYL A;  2JJ9 A;  4U72 A;  4DBQ A;  2EHO A;  4UF0 A;  3EUH A;  4X1K E;  1HG2 A;  3J9X 1;  5LGT B;  4AKR B;  1U4Q A;  2N1G A;  3SWH A;  2W61 A;  2VKO A;  3I0O A;  4PW8 A;  2LHR A;  3RKO A;  3KBU A;  1H7C A;  2K24 A;  5DQW A;  5LCY A;  3ZPO A;  4K0U A;  5HWY A;  2EHO B;  1LRZ A;  4UF0 B;  5FYM A;  4EZ4 A;  1AJ3 A;  1D1A A;  3ETU A;  2L3L A;  5L2L A;  3AAE B;  4L0R A;  1IJ6 A;  5FNV E;  4AQG A;  4TUY E;  4KP3 C;  5LBM A;  3C50 A;  2PBI A;  5LHI B;  4CI2 B;  1CUN A;  3NZP A;  2CXD A;  1ZKE A;  2ZM2 A;  1ZHC A;  4ILU A;  3O1I A;  5CA1 E;  2LSK A;  2MTQ A;  3O4X E;  2JMK A;  4KMC A;  3AB3 B;  4PK4 A;  2PG8 A;  3EVY A;  3FBL A;  4H63 H;  4H9S E;  4C91 A;  3ZJ2 A;  3GN5 A;  4P0B A;  1MMG A;  4TZ4 C;  1KK7 A;  4BJN A;  2X68 A;  3GN5 B;  2WSS V;  5A1L A;  4FI5 A;  4EXT A;  1WRD A;  2E9X D;  2NTY A;  3N9P A;  1BR4 A;  3LK4 2;  2X67 A;  2Z6E A;  3PU3 A;  3RYF E;  3SS1 A;  5L3C B;  1ZV4 X;  4IE0 A;  2DLR A;  4OK0 A;  3ONX A;  5JRE A;  2C5J A;  2HPL A;  4AKL A;  3CX6 B;  4PK5 A;  5KDM C;  3WAJ A;  4WBN E;  5HXS A;  3UUM A;  5KMG P;  1HCI A;  4PJL A;  1WYB A;  4E7S A;  3BQL A;  5HYA A;  2Q9Q B;  4UEM A;  4WW0 A;  1U5P A;  5FY7 A;  2RP4 A;  5LP6 E;  3NRY A;  4PNI A;  4PFO A;  3PUR A;  2YU2 A;  4AQF C;  2KWH A;  4PK6 A;  5JDH A;  4H63 V;  4AQF A;  5JDN A;  2JPF A;  3E08 A;  3HKB E;  3QK6 A;  3RH3 A;  4UEL A;  3EDU A;  5LBQ B;  3J7Y q;  2ZMA A;  3LBX B;  2MOZ A;  3ZMS B;  2KWI B;  3CX7 B;  5EK3 A;  4EAH A;  5LGU B;  4AKH A;  5TAO A;  4B6X A;  2H3R A;  4L9I A;  4O4J E;  3C4Z A;  3RYI E;  5JDM A;  2XHE B;  4UVC B;  3AA1 B;  5EK4 A;  2LOS A;  4IE7 A;  2WBL A;  3H3A A;  5AFU L;  3RRW A;  1UX5 A;  2CE7 A;  3A5X A;  1MNE A;  3GMI A;  4IGU A;  3ZMT B;  4QX8 B;  2BDE A;  4HKA A;  4GK0 E;  3ZMV B;  2Y6X A;  1IJ5 A;  3ANW B;  3HI2 A;  3MJX A;  5JDL A;  3CVR A;  3U78 A;  4MHC A;  3OYX A;  3RYC E;  1EZ3 A;  4ZOL E;  3MK7 C;  5JDF A;  3QC9 A;  5IYZ E;  4UVA B;  2CA5 A;  2KT9 A;  2SPC A;  1HS7 A;  4ASK A;  4CQI A;  1WR6 A;  3SOL A;  2JMH A;  3KIN B;  4IE4 A;  2CXL A;  2W00 A;  4DMV A;  2V7J A;  4TN7 B;  2V1D B;  3ZC1 A;  4C90 A;  2WMO A;  5LHH B;  4X20 E;  5EZY E;  1D1B A;  1BR1 A;  2QA7 A;  3VU7 H;  2EHO D;  5JDG A;  2K5B B;  2DNX A;  2LOP A;  3LG7 A;  3OKQ A;  2HH7 A;  3L3P A;  4EZH A;  2HPJ A;  5LA6 E;  3N2G E;  2IC9 A;  1SHZ C;  2VKH A;  3AA6 B;  3P8C D;  4HTE A;  5JH7 E;  4UVB B;  3RYH E;  1D0Y A;  4ZI2 D;  1QSD A;  2X9H A;  2XAH B;  2X0L B;  3EDV A;  5JR9 A;  2BVL A;  3IF8 B;  1E1H B;  2CCQ A;  4G63 A;  3ZMU B;  1MMA A;  3F57 A;  4FJO A;  4GIW A;  2VK9 A;  2E9X A;  3DP7 A;  3R6N A;  2NWB A;  2DHR A;  3ZYK A;  3JC6 C;  3UT5 E;  3T8O A;  5HAX A;  2Q9Q A;  3AVR A;  2KMF A;  3B57 A;  4O4I E;  3RPU A;  2E9X C;  4ZHQ E;  3HKD E;  2JRK A;  2GK9 A;  2MBG A;  3Q5X A;  4ZI3 D;  5F8P A;  2WWU A;  4NUU A;  4JEH B;  2Y8D A;  2CLY C;  2QGS A;  2XAG B;  5FY0 A;  1VRB A;  3LK2 B;  3K3O A;  3N2K E;  4YJ2 E;  2YEV C;  4PJN A;  4EB6 E;  1HF8 A;  5FXW A;  1OWA A;  2ZM8 A;  4AKG A;  3GWH A;  1LVK A;  3I1A A;  3CQX C;  4TX5 A;  1VOM A;  4GYR A;  5JRC B;  2W0G A;  1B7T A;  5JQG E;  3S4U A;  4OFZ A;  2DI4 A;  3ANW A;  3VHL A;  3P7I A;  4EYY R;  3CWZ B;  2NW9 A;  3O9X A;  4IHJ E;  3V5U A;  5C8Y E;  5FMN A;  1V9D A;  2CMR A;  3BQI A;  1YW0 A;  4G2A A;  4UV9 B;  3CML A;  4XZC A;  3C4W A;  4BJM A;  4MAL A;  2V7K A;  4NUV A;  2YIN A;  2CM0 A;  3MKD A;  1D0X A;  2X9W A;  2NP9 A;  3DTO A;  2LE8 A;  2YK0 A;  5FXZ A;  1G8X A;  2XAF B;  3K3Q C;  2VL8 A;  4I55 E;  4ERR A;  3PU8 A;  5JDQ A;  4HN9 A;  4EOZ B;  3KV4 A;  3H37 A;  3PUS A;  4L5G A;  4F6R C;  2X9Y A;  2CWO A;  4TV8 E;  2WAU A;  2OA5 A;  3CQG B;  2NW8 A;  2KIN B;  4ADZ A;  1HFA A;  4MFR A;  1Z0P A;  3AAA B;  4WBO A;  3RRC A;  5F3J A;  3FBZ A;  3SRZ A;  4GK5 E;  3GA8 A;  3KV5 A;  3IEE A;  1NAF A;  3NZQ A;  5JVD E;  4QHO A;  1ZEE A;  4BA9 A;  2CXF A;  2C0S A;  2A2F X;  3N9M A;  4P09 A;  4HE8 A;  4QX7 B;  4YLH A;  4JEU B;  1Y64 B;  2IW5 B;  5ADX L;  4GYS A;  3TKL B;  4BAY B;  2N9D A;  5BMV E;  2ODU A;  2WM9 A;  5HXH A;  3V5S A;  2BVM A;  2VB6 A;  2XAJ B;  4OYJ A;  3O1H A;  3PUQ A;  4YJ3 E;  4J2C A;  3OJA A;  3HR0 A;  5CA0 E;  2Y48 B;  2CLY B;  2H7O A;  5L3E B;  3F31 A;  4I43 B;  4DBR A;  3U3I A;  4PAG A;  2C5I T;  1IAP A;  4QKN A;  2NTX A;  2J1D G;  4PFP A;  5LJN A;  3AVS A;  3C51 A;  4X1Y E;  3ZCJ A;  3OBV E;  3Q5W A;  1HTJ F;  2IAK A;  2VKJ A;  5H6R B;  2XAQ B;  4OYK A;  4CI3 B;  3HL6 A;  2C5K T;  4H9Q C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...