1FEWA

Crystal structure of smac/diablo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
b'SLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELKQKTQEEGEERAESEQEAYLRED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
molecule tags Apoptosis
source organism Homo sapiens
publication title Structural and biochemical basis of apoptotic activation by Smac/DIABLO.
pubmed doi rcsb
total genus 90
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1fewA00
1FEWA 5M4YA 1EZ3A 5LG4A 1HS7A 2DNXA 2XHEB 4TX5A 1FIOA 1BR0A 1S94A 4JEUB 1G73A 4JEHB 3C98B 3LG7A
chains in the Genus database with same CATH superfamily
1IJ5A 3CPZA 2VQFT 2GK9A 3UT5E 4HFBA 5LG3A 5FXXA 4COFA 3MJXA 2KWHA 1MMNA 2LEHA 3AE3A 5FY0A 3UULA 4ANJA 5HXHA 3F2EA 4K0KT 2OLTA 3IEEA 2DCFA 1HR0T 1J5ET 2YDRA 4BJMA 3AE6A 2D9DA 3P7IA 1D0YA 1M62A 4GK5E 4TN7B 3OTOT 4CXXA 5KX5E 4DR3T 4DR6T 2I6HA 2X0HA 3QNUA 3ZMSB 2L3LA 3SRZA 1Y64B 2JMKA 3AE4A 4O8SA 5LBMA 3RYHE 4A97A 3PU8A 3ONXA 5LHIB 4B6XA 1Z8UA 4PK5A 4EOZB 1JNRA 2NTYA 3AA1B 3CX8B 3KV4A 5JR9A 4CI3B 4B3MT 3SS1A 4WYVA 1QSDA 4EXTA 5L2LA 3PUGA 5J2TE 4YXDA 3PUQA 3K3QC 3PURA 3RKGA 2BS4A 2CM0A 2FJDA 3JC6C 3N9QA 5LNKA 3LK42 2A3DA 2PTFA 2XZEA 4X1KE 4X62T 4JI1T 2BVLA 2D0TA 2YDQA 2V7LA 3LG7A 2Q9QC 4MFRA 4YJ3E 4EGWA 4H9NC 1MIYA 2VQET 2XSBA 3HL6A 4ILAA 4UV8B 5AQQB 4DR1T 1WLXA 2ZMAA 2VURA 1FMWA 3PUAA 5HEGA 1MMGA 3NZPA 4HKAA 4KP3C 3T1YT 5AQJB 2H89A 4YSYA 2IHR1 4ADZA 2B76A 3FZKB 4O4HE 4O2BE 5AQHB 4GOUA 2ZLYA 4UELA 5L4HA 3UUNA 2LM2A 3FHNA 5AQNB 2Q9QA 2YU2A 3RIFA 4X65T 2JIWA 5L3CB 3E08A 4DR4T 4A56A 4CXYA 4I4TE 4L9IA 5JRCA 2JQKA 5IWAT 2UXCT 2WU5A 1WCRA 2I59A 2RP4A 3ABVA 4PFPA 3AAEB 1W0AA 5F8PA 5LBQB 3RYCE 2JQHA 3ZSTA 2VVSA 2X0YA 4G2AA 4WBOA 3ZMVB 1SE7A 4Q25A 1OEDE 1X9BA 2ZM2A 3LDQB 4OX9T 3N9OA 3NRYA 4IE0A 2KMFA 2C5IT 3HKBE 3PUWF 3VR8A 4LF4T 1X79A 2CRBA 3VKHA 3I9YA 1UUSA 4IDNA 2IC9A 3AEGA 3UUBA 2E5LT 2WB5A 3UU6A 1VCTA 3AA0B 2KNDA 4LF7T 3GWHA 1XWMA 3N2KE 5F5WA 3AE1A 4F6RC 3D0TA 2MTQA 3NVOA 5HEUA 2L9QA 2ZM6T 2CA5A 4U7YA 4U74A 1KK7A 2G0UA 3RIUA 4ASKA 2VL0A 1SA0E 3RYFE 2CMRA 3ESLA 5CGMA 2K9AA 3CQGB 1FMVA 2K48A 3E22E 3H3AA 4YJ2E 3EVYA 4O2AE 5JH7E 3VKGA 1NEKA 2PG8A 3RLFF 4HEAA 3SFEA 2YINA 3CVRA 3KBTA 3C4ZA 2JMHA 1HG2A 3KVAA 4IGUA 4JEHB 4PK4A 4P0BA 1I6ZA 1UCUA 5ETWA 3B13A 3UTKA 4DV1T 3F31A 2DWGA 3LBXA 3ZYLA 2VKHA 3CQXC 3KDSE 3HR0A 5DABA 4GYRA 3VHLA 2WZHA 4NUUA 4UV9B 3C51A 4HFHA 4B3TT 1MIWA 1VOMA 2E9XD 2RPAA 5FY7A 4HFIA 2F4VT 2WQYA 2CE7A 2KINB 2K24A 1J1JA 2VKJA 2WMNA 1ZKEA 3AAIA 3ZKRA 3ZCIA 3AA6B 1D0XA 3PJAJ 3O1JA 2NR4A 5HXEA 3AE5A 4JI0T 4LFCT 2OV9A 5IHYA 5HYAA 4AI6A 3PE0A 2KLQA 3C4XA 2Y48B 4LMJA 3ZMUB 2XQ5A 2I0MA 4PNIA 4TX5A 4CI1B 2V1DB 2HHHT 4GYSA 1KEYA 3KBUA 2UU9T 1BR4A 4ZS2A 4LFAT 3O1IA 4UIGA 5AQUB 3IHRA 3EI0A 3OKQA 4Z90A 1HFAA 2EHOD 5JR9C 5LHGB 2YK0A 1HX1B 3HI2A 3KV9A 3ZC1A 4EYUA 2IDOB 2WWUA 5EK2A 1YD8G 4QH5A 4ZI2D 5FYMA 3VR9A 5FXZA 2JQQA 3UFEA 5HEJA 1XDOA 3UU8A 5FL1A 3ONJA 2EHOA 2H7OA 2XY8B 1G73A 3N2GE 5AQFB 1OEDC 3FZLB 3O4XE 3FZFB 5L3DB 2CHNA 5L3EB 1D1AA 1LVFA 5ABEA 5AQOB 1YQ4A 2CPTA 5JDFA 2CWOA 4ZZCA 5AQKB 5LMUT 2WZIA 2H3RA 3CK6A 1T7SA 4PJLA 2PJQA 4TWFA 4BAYB 3OBVE 2VK9A 2IIUA 3RKOA 3UUMA 4AKHA 4H63V 1H7CA 1U4QA 2NTXA 4JI8T 1KNPA 3ZYMA 4DV7T 3PUSA 3NZQA 3VU7H 1MMDA 3AAAB 4HN9A 1BR2A 2A9UA 4QXCB 2BKNA 3K3NA 4QXBB 2XM2A 3CIRA 4V1Av 4XZCA 4UF0A 4KHPT 1YQ3A 2XQ7A 4NIQA 4X1YE 3EDUA 3W15B 2K3WA 2MYSA 2UUBT 4H9PC 5FKYA 2WY2A 2D5UA 2HH7A 2BG9C 1UX4A 2DL1A 1OWAA 1L0VA 4BJNA 5CA0E 1WRDA 4IL4A 4A5XA 4WBNE 5EK4A 4BA9A 5LHHB 4KMCA 3DTOA 2WM9A 3LK2B 5HAXA 2MBGA 2MOZA 3AEDA 1T98A 1W0BA 1YKEB 2QGSA 2ODVA 4C91A 1YW0A 4UVCB 1XNQT 2CCQA 2J62A 3A7MA 3AVSA 4P09A 2YU1A 2LOPA 3Q9DA 4GIWA 3IA3A 4M1PA 2QYWA 2YN6A 3P4SA 4AISA 3J7Yq 3Q2MA 4PW8A 1XMQT 2X66A 2ODUA 2LHRA 5DQVA 3AXJA 3PDYA 3PUXF 4NUVA 4KHZF 3RIUC 3GN5B 4JI4T 3L39A 4HFDA 4DV6T 3ZPOA 3UU3A 5LJNA 1ZP0A 4F8HA 4UXNB 2W63A 2XQ4A 3L09A 3LJCA 4IL9A 4QHOA 2FJAA 2CEAA 2L8KA 2XAQB 3UQ7A 3ZT7A 5A1LA 4P0AA 4ZOLE 4YLHA 4ILCA 1ZEEA 4WZXA 2XUEA 4N78D 2M67A 2NP9A 4TWHA 3J9X1 5BR8T 3B57A 4JEUB 4X1IE 5ABGA 1O3XA 3FZMB 3RI5A 3I0QA 4OHFA 4HE8A 2LE8A 4AKRB 1XDPA 3B5MA 1SHZC 2X0LB 4GK0E 2BG9B 3NWIA 4AQFA 4UVAB 3QOFA 5LGTB 2RA1A 3O9XA 3AXJB 1ZV4X 2N2NA 1SUMB 1D1CA 2XTLA 5DQWA 1OEDB 3MA9A 4L5GA 4U3CA 1NENA 3AA7B 1HF8A 3ETVA 4IDQA 4X5TA 5LOVE 2W4XA 1OXZA 2VWAA 3JC6D 4LF8T 2NW9A 4K0UA 4DVDA 4EYYR 3UQ4A 3AEEA 3RGLA 4HWFA 3QUJA 4MBQA 3ZLIA 1WFDA 5IUXA 5JDMA 1XNRT 1IJ6A 4KI0F 1HX8A 5AQTB 3AEBA 3IF8B 2LOSA 4PK6A 5AFUL 1WYBA 5JDQA 4DR7T 1WR0A 4ILBA 3P4WA 2BKPA 3MACA 4EZHA 4EZ4A 2BS2A 4IE7A 5HXRA 2A72A 2B1EA 4YTMA 5L4EA 4LF6T 2X68A 2CLYB 5DJQC 4IDPA 2DNXA 3OVUA 4EEDA 5L3BB 4DV3T 3SFDA 2ZM8A 2V6YB 3T1HT 2W67A 2HN2A 3Q5EA 4CI2B 4JUYA 2HPLA 3U78A 4DMWA 3EHZA 1YXRA 2ZM0A 4CN4A 3F57A 5JDLA 3C4WA 1BR0A 2EHOC 4E7SA 2KZ7B 2KXPB 3N9MA 1OEDA 3LSVA 3BK9A 2X9HA 3Q5WA 4QXHB 2NW8A 3BQIA 3ZN1B 2N1GA 3CX7B 2LRLA 2V6XA 3L8RA 4ISTA 2K5BB 1GQEA 1MIVA 3MKDA 3NBXX 3VRBA 4QX8B 4CN1A 5J2UE 2UUCT 2W2UA 4DUZT 1NAFA 4DR2T 2V7KA 4L0RA 5ABFA 2HPJA 5AQMB 2H88A 4LF5T 4O4JE 4AKGA 2X51A 3RRCA 4JI7T 3R6NA 3ZN0B 4CXWA 2A2FX 3AEFA 4ILUA 5JQGE 2J1DG 2W62A 3MZKB 3PU3A 4FI5A 4IE4A 4ZI7E 1FEWA 3L3PA 5C8YE 4B3ST 2NOXA 2BBHA 2KWIB 3O1HA 4UF0B 3SWHA 3KINB 1XZYA 4YSZA 2FJBA 2M6BA 3KV6A 3ZJ2A 4DUYT 2R6GF 2V5CA 2YKSA 1YKHB 2E9XC 4QX7B 5HCMA 4H63H 4QKNA 4DV0T 2XHEB 2LSIA 4ZHQE 5CJ5A 3P8CD 1LKXA 5JDGA 1CUNA 4OFZA 2BG9A 4YTPA 3AE7A 3M3ZB 4QH4A 5JVDE 2DHRA 1HCIA 4DBQA 5KXJA 4AQYT 2WWVA 4YY3T 2MAWA 3RC3A 4YFSA 4AIUA 4ZEYA 2JQ9A 3G06A 4X64T 4J2CA 1UGOA 4IHJE 3K3OA 5FY1A 3ONLC 3P4QA 3TLUA 4CQIA 2IAKA 4I50E 4YHJA 4JI3T 3A8YC 2XQ9A 3EUHA 4PFOA 2LSGA 3H37A 3ZEFB 4IT4A 3AECA 4ZI3D 1J5WA 2VKDA 4I0UA 4MALA 2LSYA 4DMVA 2D0UA 4LFBT 4TV9E 1QLBA 5FXVA 1D0ZA 2W00A 2LSKA 4DNDA 5J0ZA 2XJ7A 3MK7C 2C0SA 3I9WA 5E0OA 1E2AA 5CA1E 2LKHA 1FIOA 2ACZA 2CLYC 2CWYA 3RQUA 2XASB 1FJGT 5LB7B 2IMLA 3U3IA 4U2YA 3T8OA 3TLWA 5L47A 4ISSA 1Y01A 4DBRA 3X1DA 1UX5A 2Y6XA 2E5VA 3M65A 3JAEA 2JJ9A 2BBJA 5LCYA 3OJAA 3PUVF 4FJOA 2EHOB 3C98B 2LSJA 2V7MA 3PJAA 3TLTA 2E2AA 1HTJF 1MNEA 3FZHB 4AQFC 4C90A 1IBMT 2V5DA 2YEVC 4OYKA 2Q9QD 2QRXA 1D1BA 3HKDE 3I1AA 5LA6E 1T8BA 4OYJA 4H9RC 1R8IA 4KX6A 4UVBB 5LGUB 1XMOT 1N32T 4DV4T 2DLRA 2PFVA 3AE8A 2OA5A 2ACXA 3CWZB 1S35A 3P4PA 4HGAA 4IREA 5HCJA 4NXNT 2D2SA 3C50A 5M4YA 4U33A 2Z6EA 2XQYA 4KUMB 5HWXA 1N33T 4OK0A 2C5KT 2WMOA 3RHWA 3WAKA 3N9NA 1HG5A 3ANWA 5HWYA 1M7KA 2IW5B 3JCFA 4IIJE 3FXEB 2XQ6A 2WSSV 3SOLA 3WI3A 1BR1A 2ES0A 2W61A 2UXBT 5HEHA 3LK3B 2QVAA 1MNDA 2PBIA 1CHUA 3RF1A 2IUBA 3AVRA 3S4UA 5BMVE 4U31A 5FVKA 4JI2T 5FP3A 3ZC0A 5JR9B 2XQAA 2LHNA 3ANWB 4H9QC 4TZ4C 3ZMZB 3WAJA 5H6RB 2LLYA 2V7IA 5LGNB 3V5SA 1N36T 2YDSA 3MXZA 5JDHA 3ZSSA 2BG9E 3QB5A 5H6QB 5ABFB 3QB5K 3BQKA 5J1GA 4HWDA 2WDRA 3N9LA 3Q5XA 2X67A 2WAUA 1UURA 2WS3A 3HKEE 3LFMA 3QC9A 2UUAT 3RC8A 1IAPA 1W09A 4G63A 3UU4A 5KDMC 3V5UA 1HNXT 2NWBA 2WDVA 3DJBA 3JAFA 4DO0A 4EIWA 1DU2A 2VB6A 4JI5T 4XAXB 5JDNA 4QH1A 2VL8A 4H9SE 3RQWA 4YHHT 4CN6A 3CKDA 3KV5A 4E7ZA 3ZYKA 3CMLA 2BDEA 4HTEA 2Q9QB 3AE2A 4NPPA 5AQVB 2CBJA 2E9XA 2KSRA 4ZXLA 3CX6B 2BKOA 2M6IA 2AXDS 2WCAA 3KFWX 4HWHA 5LP6E 4H9OC 4TNVA 5F3JA 5GONE 1S94A 1IBLT 4WW0A 3AEAA 5L3FB 2C5JA 4KBMB 2CXLA 3AB3B 4YSXA 2XQ8A 3ZT5A 2VKOA 2W0GA 4Z91A 1ZOYA 2FUPA 1UK5A 4IE5A 4ZS3A 2XAHB 2JPFA 4MLKA 4PJJA 4PJNA 3JADA 4I55E 4TNWA 4X20E 3TKLB 1T72A 2J47A 5C2TA 2WBLA 5LYJE 2VVNA 4IDZA 1HNWT 1EZ3A 2CXFA 3PUYF 4DR5T 1IZNB 3HA4A 5FVLA 1E1HB 4YTNA 3PUZF 2FJEA 2V26A 3FBZA 5ABHA 5AQPB 1WR6A 1WYCA 3UU5A 4HFEA 5HXCA 2CBIA 2CHOA 3H3MA 3K8PC 2NW7A 3FXDB 2W66A 3IBPA 3OYZA 1E7PA 3I0OA 3E0ZA 5ADXL 1IBKT 2UXNB 4LF9T 2LJLA 1KNZA 4AKLA 1N34T 4EB6E 2JRKA 1MMAA 2IC6A 2YOEA 4P1NA 4QWNB 2WU2A 4HFVA 5AQIB 5FMNA 5FNVE 5L3GB 3N9PA 4HFCA 5LG4A 3RRWA 4AQGA 2XAGB 1AJ3A 2LRKA 3BQLA 3N5LA 4IE6A 5AQLB 4JYAT 2V7JA 3FBLA 2WDQA 4JLEA 1HNZT 2LT3A 5HXSA 3N2OA 1JNZA 2AE9A 2VASA 2X9WA 3EAMA 3OYXA 3GMIA 3K1SA 4WNKA 3TLSA 1LVKA 1G8XA 1KFYA 1US7B 4AXPA 2XAFB 5JREA 2X9XA 5LJMA 2WP9A 4Z8XA 4XBFB 1KF6A 3LBXB 5LXTE 3ZCJA 4ERRA 2BVMA 1KNRA 2N9DA 2V8SV 3OPCA 5EZYE 4ZI2C 2KT9A 4EV6A 3AE9A 4U7IA 2XM1A 3EDVA 3RX6A 4B3RT 3KVBA 3ETUA 4GKJT 3CQCB 4YT0A 4O4LE 2BZBA 4TV8E 2FBWA 4O4IE 1VCSA 4AKIA 3NRXA 2XPKA 5JRCB 2CXDA 4TUYE 2QA7A 3PV0F 4DIDB 4I43B 1U5PA 5JTGA 2UXDT 3GN5A 4UEMA 4JI6T 2Y8DA 1I94T 5IYZE 2BS3A 2P9BA 4MHCA 3EABA 4PAGA 1Z0PA 4NXMT 3FB2A 4ZI3C 5TAOA 5FL0A 5HEOA 3UUXB 3QK6A 3DP7A 5CB4E 4U2ZA 4HWIB 3TLVA 2HN1A 4DV2T 2UXXB 3R84B 4X66T 4GKKT 1B7TA 1V9DA 3HKCE 4JBWF 5C3JA 3VRAA 2XQ3A 2DI4A 2XAJB 2DWKA 3P50A 5KMGP 3RPUA 2MPKA 4HWCA 1QUUA 4UR9A 5AQGB 3RYIE 2E8IA 1NWMX 4JV5T 4ZZBA 2E9XB 1W9RA 1VRBA 5LMNT 1ZHCA 3GA8A 1LRZA 2J4GA 3RH3A 3NKZA 5AQRB 4DV5T 4IDOA 3UFGA 5EK3A 2V6YA 3RIAA 3ZJ1A 3P4RA 2X9YA 4LMLA 4EEBA 4PJMA 4EAHA 2H7VC 4TWDA 4A98A 2XSAA 3C64A 3PTRB 4U72A 5AQSB 3ZT6A 2SPCA 1HS7A 5FXWA 3ZMTB 4LMKA 4CZZB 3Q5DA 3A5XA 2LKGA 5CFBA 2LM9A
chains in the Genus database with same CATH topology
1IJ5A 3CPZA 2GK9A 3UT5E 5FXXA 3MJXA 2KWHA 1MMNA 2LEHA 5FY0A 3UULA 4ANJA 5HXHA 3F2EA 3IEEA 2DCFA 4BJMA 3P7IA 1D0YA 4GK5E 4TN7B 4CXXA 5KX5E 2L3LA 3SRZA 1Y64B 2JMKA 4O8SA 5LBMA 3RYHE 3PU8A 3ONXA 5LHIB 4B6XA 4PK5A 4EOZB 3CX8B 2NTYA 3AA1B 3KV4A 5JR9A 4CI3B 3SS1A 1QSDA 4EXTA 5L2LA 3PUGA 5J2TE 3PUQA 3K3QC 3PURA 2CM0A 3N9QA 3JC6C 5LNKA 3LK42 2A3DA 4X1KE 2BVLA 2D0TA 3LG7A 2V7LA 4MFRA 2Q9QC 4YJ3E 4H9NC 1MIYA 3HL6A 4UV8B 1WLXA 2ZMAA 1FMWA 3PUAA 1MMGA 3NZPA 4HKAA 4KP3C 4ADZA 4O2BE 4O4HE 4GOUA 2ZLYA 4UELA 3UUNA 3FHNA 2Q9QA 2YU2A 5L3CB 3E08A 4A56A 4CXYA 4I4TE 4L9IA 5JRCA 2I59A 2RP4A 4PFPA 5F8PA 3AAEB 5LBQB 3RYCE 4G2AA 4WBOA 3ZMVB 2ZM2A 3N9OA 3NRYA 4IE0A 2KMFA 2C5IT 1X79A 3VKHA 3I9YA 2IC9A 3AA0B 2KNDA 3GWHA 3N2KE 4F6RC 3D0TA 2MTQA 2L9QA 2CA5A 4U74A 5JH7E 1KK7A 2G0UA 4ASKA 3RYFE 1SA0E 3ESLA 2CMRA 2K9AA 3CQGB 1FMVA 2K48A 3E22E 3H3AA 4YJ2E 3EVYA 4O2AE 3VKGA 2PG8A 4HEAA 2YINA 3CVRA 3KBTA 3C4ZA 2JMHA 1HG2A 3KVAA 4IGUA 4JEHB 4PK4A 4P0BA 1UCUA 5ETWA 3B13A 3UTKA 3F31A 2DWGA 3LBXA 3ZYLA 2VKHA 3CQXC 3KDSE 3HR0A 5DABA 4GYRA 3VHLA 4NUUA 4UV9B 3C51A 1MIWA 1VOMA 2E9XD 5FY7A 2CE7A 2KINB 2K24A 2VKJA 2WMNA 3AAIA 1ZKEA 3ZCIA 3AA6B 1D0XA 5HXEA 3O1JA 5IHYA 4AI6A 5HYAA 3PE0A 2KLQA 3C4XA 2Y48B 3ZMUB 4PNIA 4CI1B 4TX5A 2V1DB 4GYSA 3KBUA 1BR4A 4ZS2A 3O1IA 4UIGA 3IHRA 3OKQA 1HFAA 2EHOD 5JR9C 5LHGB 2YK0A 3HI2A 3KV9A 3ZC1A 4EYUA 5EK2A 2WWUA 1YD8G 4ZI2D 5FYMA 5FXZA 2JQQA 3UFEA 2EHOA 2H7OA 1G73A 3N2GE 3O4XE 5L3DB 5L3EB 1D1AA 1LVFA 5JDFA 2CWOA 2H3RA 4PJLA 2PJQA 4BAYB 3OBVE 2VK9A 3RKOA 3UUMA 4AKHA 4H63V 1H7CA 1U4QA 2NTXA 3ZYMA 3PUSA 3NZQA 3VU7H 1MMDA 3AAAB 4HN9A 1BR2A 4QXBB 4QXCB 4XZCA 3K3NA 4V1Av 4UF0A 4X1YE 3EDUA 3W15B 2MYSA 4H9PC 5CA0E 2D5UA 2HH7A 1UX4A 1OWAA 4BJNA 1WRDA 4WBNE 5EK4A 4BA9A 5LHHB 4KMCA 3DTOA 2WM9A 3LK2B 5HAXA 2MBGA 2MOZA 1T98A 1YKEB 4C91A 2QGSA 2ODVA 1YW0A 4UVCB 2CCQA 3AVSA 4P09A 2YU1A 2LOPA 3Q9DA 4GIWA 4M1PA 3J7Yq 3Q2MA 4PW8A 2X66A 2ODUA 2LHRA 5DQVA 3PDYA 4NUVA 3GN5B 3ZPOA 5LJNA 4UXNB 2W63A 3L09A 4QHOA 3LJCA 2CEAA 2L8KA 2XAQB 5A1LA 4P0AA 4ZOLE 4YLHA 1ZEEA 2XUEA 4N78D 2M67A 2NP9A 3J9X1 3B57A 4JEUB 4X1IE 1O3XA 3I0QA 4OHFA 4HE8A 2LE8A 4AKRB 1SHZC 2X0LB 4GK0E 4AQFA 4UVAB 5LGTB 2RA1A 3O9XA 1ZV4X 2N2NA 2XTLA 1D1CA 4AQGA 5DQWA 3MA9A 4L5GA 3AA7B 1HF8A 3ETVA 5LOVE 3JC6D 1OXZA 2VWAA 2NW9A 4DVDA 4EYYR 4K0UA 3ZC0A 5JDMA 3QUJA 4MBQA 3ZLIA 1IJ6A 1HX8A 3IF8B 2LOSA 4PK6A 5AFUL 1WYBA 5JDQA 4EZHA 3MACA 4EZ4A 4IE7A 5HXRA 2A72A 2B1EA 2X68A 2CLYB 5DJQC 2DNXA 5L3BB 2ZM8A 4CI2B 4JUYA 2HPLA 3U78A 4DMWA 2ZM0A 5JDLA 3F57A 1BR0A 3C4WA 2EHOC 4E7SA 2KZ7B 2KXPB 3N9MA 3Q5WA 3BK9A 2X9HA 4QXHB 2NW8A 3BQIA 3ZN1B 2N1GA 3CX7B 4ISTA 2K5BB 1MIVA 3MKDA 3NBXX 4QX8B 5J2UE 1NAFA 2V7KA 4L0RA 2HPJA 4O4JE 2X51A 3RRCA 3R6NA 3ZN0B 4CXWA 2A2FX 4ILUA 5JQGE 2J1DG 2W62A 3MZKB 3PU3A 4FI5A 4IE4A 4ZI7E 1FEWA 3L3PA 5C8YE 2KWIB 2NOXA 4UF0B 3O1HA 3SWHA 3KINB 3KV6A 3ZJ2A 4QX7B 1YKHB 2E9XC 4H63H 4QKNA 2XHEB 2LSIA 4ZHQE 5JDGA 3P8CD 1LKXA 1CUNA 4OFZA 5JVDE 2DHRA 1HCIA 4DBQA 3RC3A 4YFSA 4J2CA 4IHJE 3K3OA 5FY1A 4CQIA 2IAKA 4I50E 4YHJA 3EUHA 4PFOA 2LSGA 3H37A 3ZEFB 4ZI3D 4MALA 2VKDA 2LSYA 4DMVA 2D0UA 4TV9E 5FXVA 1D0ZA 2W00A 2LSKA 4DNDA 3MK7C 2C0SA 3I9WA 5E0OA 5CA1E 1FIOA 2CLYC 2CWYA 2XASB 3U3IA 3T8OA 4ISSA 4DBRA 1UX5A 2Y6XA 3M65A 2JJ9A 5LCYA 3OJAA 4FJOA 2EHOB 3C98B 2LSJA 2V7MA 1HTJF 1MNEA 4AQFC 4C90A 2YEVC 4OYKA 2Q9QD 3I1AA 1D1BA 3HKDE 5LA6E 4OYJA 4H9RC 4UVBB 5LGUB 2DLRA 2PFVA 2OA5A 2ACXA 3CWZB 1S35A 4HGAA 2D2SA 3C50A 5M4YA 2Z6EA 2XQYA 4KUMB 5HWXA 4OK0A 2C5KT 2WMOA 3WAKA 3N9NA 1HG5A 3ANWA 5HWYA 2IW5B 4IIJE 3FXEB 3WI3A 2WSSV 3SOLA 1BR1A 2ES0A 2W61A 3LK3B 1MNDA 2PBIA 3AVRA 3S4UA 5BMVE 5FP3A 5JR9B 3ANWB 2LHNA 4H9QC 4TZ4C 3ZMZB 3WAJA 5H6RB 2V7IA 5LGNB 3V5SA 3MXZA 5JDHA 5H6QB 3BQKA 5J1GA 3N9LA 3Q5XA 2X67A 2WAUA 3HKEE 3LFMA 3QC9A 3RC8A 1IAPA 4G63A 5KDMC 3V5UA 2NWBA 4DO0A 3DJBA 4EIWA 2VB6A 5JDNA 4XAXB 2VL8A 4H9SE 3CKDA 3KV5A 4E7ZA 3ZYKA 3CMLA 2BDEA 4HTEA 2Q9QB 2E9XA 3CX6B 3KFWX 5LP6E 4H9OC 5F3JA 5GONE 1S94A 4WW0A 5L3FB 2C5JA 4KBMB 2CXLA 3AB3B 2VKOA 2W0GA 4ZS3A 4IE5A 2XAHB 2JPFA 4MLKA 4PJJA 4PJNA 5LYJE 4I55E 4X20E 3TKLB 2WBLA 4IDZA 1EZ3A 2CXFA 1IZNB 3HA4A 1E1HB 2V26A 3FBZA 1WR6A 1WYCA 5HXCA 3K8PC 2NW7A 3FXDB 3IBPA 3OYZA 5ADXL 3I0OA 3E0ZA 2UXNB 2LJLA 1KNZA 4AKLA 4EB6E 2JRKA 1MMAA 2IC6A 4QWNB 5FNVE 4HFVA 5LG4A 5L3GB 5FMNA 4AKGA 3N9PA 3RRWA 2XAGB 1AJ3A 3BQLA 3N5LA 4IE6A 2V7JA 3FBLA 4JLEA 2LT3A 5HXSA 3N2OA 2VASA 2X9WA 3OYXA 3ZMSB 3GMIA 4WNKA 1LVKA 1US7B 1G8XA 4AXPA 5JREA 2XAFB 2X9XA 5LJMA 4Z8XA 4XBFB 3LBXB 5LXTE 3ZCJA 4ERRA 2BVMA 2N9DA 5EZYE 4ZI2C 2KT9A 3EDVA 3RX6A 3KVBA 3ETUA 3CQCB 4O4LE 2BZBA 4TV8E 4O4IE 4AKIA 3NRXA 5JRCB 2CXDA 4TUYE 2QA7A 4I43B 1U5PA 3GN5A 4UEMA 2Y8DA 5IYZE 2P9BA 4MHCA 4PAGA 1Z0PA 3FB2A 4ZI3C 5TAOA 3UUXB 3QK6A 3DP7A 5CB4E 2UXXB 3R84B 1B7TA 1V9DA 3HKCE 2DI4A 2XAJB 2DWKA 5KMGP 3RPUA 1QUUA 3RYIE 2E8IA 1NWMX 2E9XB 1VRBA 1ZHCA 3GA8A 1LRZA 3RH3A 5EK3A 3ZJ1A 2X9YA 4PJMA 4EAHA 2H7VC 3C64A 4U72A 3PTRB 1HS7A 2SPCA 5FXWA 3ZMTB 4CZZB 3A5XA 3HKBE 2LM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FEW A;  5M4Y A;  1EZ3 A;  5LG4 A;  1HS7 A;  2DNX A;  2XHE B;  4TX5 A;  1FIO A;  1BR0 A;  1S94 A;  4JEU B;  1G73 A;  4JEH B;  3C98 B;  3LG7 A; 
#chains in the Genus database with same CATH topology
 1IJ5 A;  3CPZ A;  2VQF T;  2GK9 A;  3UT5 E;  4HFB A;  5LG3 A;  5FXX A;  4COF A;  3MJX A;  2KWH A;  1MMN A;  2LEH A;  3AE3 A;  5FY0 A;  3UUL A;  4ANJ A;  5HXH A;  3F2E A;  4K0K T;  2OLT A;  3IEE A;  2DCF A;  1HR0 T;  1J5E T;  2YDR A;  4BJM A;  3AE6 A;  2D9D A;  3P7I A;  1D0Y A;  1M62 A;  4GK5 E;  4TN7 B;  3OTO T;  4CXX A;  5KX5 E;  4DR3 T;  4DR6 T;  2I6H A;  2X0H A;  3QNU A;  3ZMS B;  2L3L A;  3SRZ A;  1Y64 B;  2JMK A;  3AE4 A;  4O8S A;  5LBM A;  3RYH E;  4A97 A;  3PU8 A;  3ONX A;  5LHI B;  4B6X A;  1Z8U A;  4PK5 A;  4EOZ B;  1JNR A;  2NTY A;  3AA1 B;  3CX8 B;  3KV4 A;  5JR9 A;  4CI3 B;  4B3M T;  3SS1 A;  4WYV A;  1QSD A;  4EXT A;  5L2L A;  3PUG A;  5J2T E;  4YXD A;  3PUQ A;  3K3Q C;  3PUR A;  3RKG A;  2BS4 A;  2CM0 A;  2FJD A;  3JC6 C;  3N9Q A;  5LNK A;  3LK4 2;  2A3D A;  2PTF A;  2XZE A;  4X1K E;  4X62 T;  4JI1 T;  2BVL A;  2D0T A;  2YDQ A;  2V7L A;  3LG7 A;  2Q9Q C;  4MFR A;  4YJ3 E;  4EGW A;  4H9N C;  1MIY A;  2VQE T;  2XSB A;  3HL6 A;  4ILA A;  4UV8 B;  5AQQ B;  4DR1 T;  1WLX A;  2ZMA A;  2VUR A;  1FMW A;  3PUA A;  5HEG A;  1MMG A;  3NZP A;  4HKA A;  4KP3 C;  3T1Y T;  5AQJ B;  2H89 A;  4YSY A;  2IHR 1;  4ADZ A;  2B76 A;  3FZK B;  4O4H E;  4O2B E;  5AQH B;  4GOU A;  2ZLY A;  4UEL A;  5L4H A;  3UUN A;  2LM2 A;  3FHN A;  5AQN B;  2Q9Q A;  2YU2 A;  3RIF A;  4X65 T;  2JIW A;  5L3C B;  3E08 A;  4DR4 T;  4A56 A;  4CXY A;  4I4T E;  4L9I A;  5JRC A;  2JQK A;  5IWA T;  2UXC T;  2WU5 A;  1WCR A;  2I59 A;  2RP4 A;  3ABV A;  4PFP A;  3AAE B;  1W0A A;  5F8P A;  5LBQ B;  3RYC E;  2JQH A;  3ZST A;  2VVS A;  2X0Y A;  4G2A A;  4WBO A;  3ZMV B;  1SE7 A;  4Q25 A;  1OED E;  1X9B A;  2ZM2 A;  3LDQ B;  4OX9 T;  3N9O A;  3NRY A;  4IE0 A;  2KMF A;  2C5I T;  3HKB E;  3PUW F;  3VR8 A;  4LF4 T;  1X79 A;  2CRB A;  3VKH A;  3I9Y A;  1UUS A;  4IDN A;  2IC9 A;  3AEG A;  3UUB A;  2E5L T;  2WB5 A;  3UU6 A;  1VCT A;  3AA0 B;  2KND A;  4LF7 T;  3GWH A;  1XWM A;  3N2K E;  5F5W A;  3AE1 A;  4F6R C;  3D0T A;  2MTQ A;  3NVO A;  5HEU A;  2L9Q A;  2ZM6 T;  2CA5 A;  4U7Y A;  4U74 A;  1KK7 A;  2G0U A;  3RIU A;  4ASK A;  2VL0 A;  1SA0 E;  3RYF E;  2CMR A;  3ESL A;  5CGM A;  2K9A A;  3CQG B;  1FMV A;  2K48 A;  3E22 E;  3H3A A;  4YJ2 E;  3EVY A;  4O2A E;  5JH7 E;  3VKG A;  1NEK A;  2PG8 A;  3RLF F;  4HEA A;  3SFE A;  2YIN A;  3CVR A;  3KBT A;  3C4Z A;  2JMH A;  1HG2 A;  3KVA A;  4IGU A;  4JEH B;  4PK4 A;  4P0B A;  1I6Z A;  1UCU A;  5ETW A;  3B13 A;  3UTK A;  4DV1 T;  3F31 A;  2DWG A;  3LBX A;  3ZYL A;  2VKH A;  3CQX C;  3KDS E;  3HR0 A;  5DAB A;  4GYR A;  3VHL A;  2WZH A;  4NUU A;  4UV9 B;  3C51 A;  4HFH A;  4B3T T;  1MIW A;  1VOM A;  2E9X D;  2RPA A;  5FY7 A;  4HFI A;  2F4V T;  2WQY A;  2CE7 A;  2KIN B;  2K24 A;  1J1J A;  2VKJ A;  2WMN A;  1ZKE A;  3AAI A;  3ZKR A;  3ZCI A;  3AA6 B;  1D0X A;  3PJA J;  3O1J A;  2NR4 A;  5HXE A;  3AE5 A;  4JI0 T;  4LFC T;  2OV9 A;  5IHY A;  5HYA A;  4AI6 A;  3PE0 A;  2KLQ A;  3C4X A;  2Y48 B;  4LMJ A;  3ZMU B;  2XQ5 A;  2I0M A;  4PNI A;  4TX5 A;  4CI1 B;  2V1D B;  2HHH T;  4GYS A;  1KEY A;  3KBU A;  2UU9 T;  1BR4 A;  4ZS2 A;  4LFA T;  3O1I A;  4UIG A;  5AQU B;  3IHR A;  3EI0 A;  3OKQ A;  4Z90 A;  1HFA A;  2EHO D;  5JR9 C;  5LHG B;  2YK0 A;  1HX1 B;  3HI2 A;  3KV9 A;  3ZC1 A;  4EYU A;  2IDO B;  2WWU A;  5EK2 A;  1YD8 G;  4QH5 A;  4ZI2 D;  5FYM A;  3VR9 A;  5FXZ A;  2JQQ A;  3UFE A;  5HEJ A;  1XDO A;  3UU8 A;  5FL1 A;  3ONJ A;  2EHO A;  2H7O A;  2XY8 B;  1G73 A;  3N2G E;  5AQF B;  1OED C;  3FZL B;  3O4X E;  3FZF B;  5L3D B;  2CHN A;  5L3E B;  1D1A A;  1LVF A;  5ABE A;  5AQO B;  1YQ4 A;  2CPT A;  5JDF A;  2CWO A;  4ZZC A;  5AQK B;  5LMU T;  2WZI A;  2H3R A;  3CK6 A;  1T7S A;  4PJL A;  2PJQ A;  4TWF A;  4BAY B;  3OBV E;  2VK9 A;  2IIU A;  3RKO A;  3UUM A;  4AKH A;  4H63 V;  1H7C A;  1U4Q A;  2NTX A;  4JI8 T;  1KNP A;  3ZYM A;  4DV7 T;  3PUS A;  3NZQ A;  3VU7 H;  1MMD A;  3AAA B;  4HN9 A;  1BR2 A;  2A9U A;  4QXC B;  2BKN A;  3K3N A;  4QXB B;  2XM2 A;  3CIR A;  4V1A v;  4XZC A;  4UF0 A;  4KHP T;  1YQ3 A;  2XQ7 A;  4NIQ A;  4X1Y E;  3EDU A;  3W15 B;  2K3W A;  2MYS A;  2UUB T;  4H9P C;  5FKY A;  2WY2 A;  2D5U A;  2HH7 A;  2BG9 C;  1UX4 A;  2DL1 A;  1OWA A;  1L0V A;  4BJN A;  5CA0 E;  1WRD A;  4IL4 A;  4A5X A;  4WBN E;  5EK4 A;  4BA9 A;  5LHH B;  4KMC A;  3DTO A;  2WM9 A;  3LK2 B;  5HAX A;  2MBG A;  2MOZ A;  3AED A;  1T98 A;  1W0B A;  1YKE B;  2QGS A;  2ODV A;  4C91 A;  1YW0 A;  4UVC B;  1XNQ T;  2CCQ A;  2J62 A;  3A7M A;  3AVS A;  4P09 A;  2YU1 A;  2LOP A;  3Q9D A;  4GIW A;  3IA3 A;  4M1P A;  2QYW A;  2YN6 A;  3P4S A;  4AIS A;  3J7Y q;  3Q2M A;  4PW8 A;  1XMQ T;  2X66 A;  2ODU A;  2LHR A;  5DQV A;  3AXJ A;  3PDY A;  3PUX F;  4NUV A;  4KHZ F;  3RIU C;  3GN5 B;  4JI4 T;  3L39 A;  4HFD A;  4DV6 T;  3ZPO A;  3UU3 A;  5LJN A;  1ZP0 A;  4F8H A;  4UXN B;  2W63 A;  2XQ4 A;  3L09 A;  3LJC A;  4IL9 A;  4QHO A;  2FJA A;  2CEA A;  2L8K A;  2XAQ B;  3UQ7 A;  3ZT7 A;  5A1L A;  4P0A A;  4ZOL E;  4YLH A;  4ILC A;  1ZEE A;  4WZX A;  2XUE A;  4N78 D;  2M67 A;  2NP9 A;  4TWH A;  3J9X 1;  5BR8 T;  3B57 A;  4JEU B;  4X1I E;  5ABG A;  1O3X A;  3FZM B;  3RI5 A;  3I0Q A;  4OHF A;  4HE8 A;  2LE8 A;  4AKR B;  1XDP A;  3B5M A;  1SHZ C;  2X0L B;  4GK0 E;  2BG9 B;  3NWI A;  4AQF A;  4UVA B;  3QOF A;  5LGT B;  2RA1 A;  3O9X A;  3AXJ B;  1ZV4 X;  2N2N A;  1SUM B;  1D1C A;  2XTL A;  5DQW A;  1OED B;  3MA9 A;  4L5G A;  4U3C A;  1NEN A;  3AA7 B;  1HF8 A;  3ETV A;  4IDQ A;  4X5T A;  5LOV E;  2W4X A;  1OXZ A;  2VWA A;  3JC6 D;  4LF8 T;  2NW9 A;  4K0U A;  4DVD A;  4EYY R;  3UQ4 A;  3AEE A;  3RGL A;  4HWF A;  3QUJ A;  4MBQ A;  3ZLI A;  1WFD A;  5IUX A;  5JDM A;  1XNR T;  1IJ6 A;  4KI0 F;  1HX8 A;  5AQT B;  3AEB A;  3IF8 B;  2LOS A;  4PK6 A;  5AFU L;  1WYB A;  5JDQ A;  4DR7 T;  1WR0 A;  4ILB A;  3P4W A;  2BKP A;  3MAC A;  4EZH A;  4EZ4 A;  2BS2 A;  4IE7 A;  5HXR A;  2A72 A;  2B1E A;  4YTM A;  5L4E A;  4LF6 T;  2X68 A;  2CLY B;  5DJQ C;  4IDP A;  2DNX A;  3OVU A;  4EED A;  5L3B B;  4DV3 T;  3SFD A;  2ZM8 A;  2V6Y B;  3T1H T;  2W67 A;  2HN2 A;  3Q5E A;  4CI2 B;  4JUY A;  2HPL A;  3U78 A;  4DMW A;  3EHZ A;  1YXR A;  2ZM0 A;  4CN4 A;  3F57 A;  5JDL A;  3C4W A;  1BR0 A;  2EHO C;  4E7S A;  2KZ7 B;  2KXP B;  3N9M A;  1OED A;  3LSV A;  3BK9 A;  2X9H A;  3Q5W A;  4QXH B;  2NW8 A;  3BQI A;  3ZN1 B;  2N1G A;  3CX7 B;  2LRL A;  2V6X A;  3L8R A;  4IST A;  2K5B B;  1GQE A;  1MIV A;  3MKD A;  3NBX X;  3VRB A;  4QX8 B;  4CN1 A;  5J2U E;  2UUC T;  2W2U A;  4DUZ T;  1NAF A;  4DR2 T;  2V7K A;  4L0R A;  5ABF A;  2HPJ A;  5AQM B;  2H88 A;  4LF5 T;  4O4J E;  4AKG A;  2X51 A;  3RRC A;  4JI7 T;  3R6N A;  3ZN0 B;  4CXW A;  2A2F X;  3AEF A;  4ILU A;  5JQG E;  2J1D G;  2W62 A;  3MZK B;  3PU3 A;  4FI5 A;  4IE4 A;  4ZI7 E;  1FEW A;  3L3P A;  5C8Y E;  4B3S T;  2NOX A;  2BBH A;  2KWI B;  3O1H A;  4UF0 B;  3SWH A;  3KIN B;  1XZY A;  4YSZ A;  2FJB A;  2M6B A;  3KV6 A;  3ZJ2 A;  4DUY T;  2R6G F;  2V5C A;  2YKS A;  1YKH B;  2E9X C;  4QX7 B;  5HCM A;  4H63 H;  4QKN A;  4DV0 T;  2XHE B;  2LSI A;  4ZHQ E;  5CJ5 A;  3P8C D;  1LKX A;  5JDG A;  1CUN A;  4OFZ A;  2BG9 A;  4YTP A;  3AE7 A;  3M3Z B;  4QH4 A;  5JVD E;  2DHR A;  1HCI A;  4DBQ A;  5KXJ A;  4AQY T;  2WWV A;  4YY3 T;  2MAW A;  3RC3 A;  4YFS A;  4AIU A;  4ZEY A;  2JQ9 A;  3G06 A;  4X64 T;  4J2C A;  1UGO A;  4IHJ E;  3K3O A;  5FY1 A;  3ONL C;  3P4Q A;  3TLU A;  4CQI A;  2IAK A;  4I50 E;  4YHJ A;  4JI3 T;  3A8Y C;  2XQ9 A;  3EUH A;  4PFO A;  2LSG A;  3H37 A;  3ZEF B;  4IT4 A;  3AEC A;  4ZI3 D;  1J5W A;  2VKD A;  4I0U A;  4MAL A;  2LSY A;  4DMV A;  2D0U A;  4LFB T;  4TV9 E;  1QLB A;  5FXV A;  1D0Z A;  2W00 A;  2LSK A;  4DND A;  5J0Z A;  2XJ7 A;  3MK7 C;  2C0S A;  3I9W A;  5E0O A;  1E2A A;  5CA1 E;  2LKH A;  1FIO A;  2ACZ A;  2CLY C;  2CWY A;  3RQU A;  2XAS B;  1FJG T;  5LB7 B;  2IML A;  3U3I A;  4U2Y A;  3T8O A;  3TLW A;  5L47 A;  4ISS A;  1Y01 A;  4DBR A;  3X1D A;  1UX5 A;  2Y6X A;  2E5V A;  3M65 A;  3JAE A;  2JJ9 A;  2BBJ A;  5LCY A;  3OJA A;  3PUV F;  4FJO A;  2EHO B;  3C98 B;  2LSJ A;  2V7M A;  3PJA A;  3TLT A;  2E2A A;  1HTJ F;  1MNE A;  3FZH B;  4AQF C;  4C90 A;  1IBM T;  2V5D A;  2YEV C;  4OYK A;  2Q9Q D;  2QRX A;  1D1B A;  3HKD E;  3I1A A;  5LA6 E;  1T8B A;  4OYJ A;  4H9R C;  1R8I A;  4KX6 A;  4UVB B;  5LGU B;  1XMO T;  1N32 T;  4DV4 T;  2DLR A;  2PFV A;  3AE8 A;  2OA5 A;  2ACX A;  3CWZ B;  1S35 A;  3P4P A;  4HGA A;  4IRE A;  5HCJ A;  4NXN T;  2D2S A;  3C50 A;  5M4Y A;  4U33 A;  2Z6E A;  2XQY A;  4KUM B;  5HWX A;  1N33 T;  4OK0 A;  2C5K T;  2WMO A;  3RHW A;  3WAK A;  3N9N A;  1HG5 A;  3ANW A;  5HWY A;  1M7K A;  2IW5 B;  3JCF A;  4IIJ E;  3FXE B;  2XQ6 A;  2WSS V;  3SOL A;  3WI3 A;  1BR1 A;  2ES0 A;  2W61 A;  2UXB T;  5HEH A;  3LK3 B;  2QVA A;  1MND A;  2PBI A;  1CHU A;  3RF1 A;  2IUB A;  3AVR A;  3S4U A;  5BMV E;  4U31 A;  5FVK A;  4JI2 T;  5FP3 A;  3ZC0 A;  5JR9 B;  2XQA A;  2LHN A;  3ANW B;  4H9Q C;  4TZ4 C;  3ZMZ B;  3WAJ A;  5H6R B;  2LLY A;  2V7I A;  5LGN B;  3V5S A;  1N36 T;  2YDS A;  3MXZ A;  5JDH A;  3ZSS A;  2BG9 E;  3QB5 A;  5H6Q B;  5ABF B;  3QB5 K;  3BQK A;  5J1G A;  4HWD A;  2WDR A;  3N9L A;  3Q5X A;  2X67 A;  2WAU A;  1UUR A;  2WS3 A;  3HKE E;  3LFM A;  3QC9 A;  2UUA T;  3RC8 A;  1IAP A;  1W09 A;  4G63 A;  3UU4 A;  5KDM C;  3V5U A;  1HNX T;  2NWB A;  2WDV A;  3DJB A;  3JAF A;  4DO0 A;  4EIW A;  1DU2 A;  2VB6 A;  4JI5 T;  4XAX B;  5JDN A;  4QH1 A;  2VL8 A;  4H9S E;  3RQW A;  4YHH T;  4CN6 A;  3CKD A;  3KV5 A;  4E7Z A;  3ZYK A;  3CML A;  2BDE A;  4HTE A;  2Q9Q B;  3AE2 A;  4NPP A;  5AQV B;  2CBJ A;  2E9X A;  2KSR A;  4ZXL A;  3CX6 B;  2BKO A;  2M6I A;  2AXD S;  2WCA A;  3KFW X;  4HWH A;  5LP6 E;  4H9O C;  4TNV A;  5F3J A;  5GON E;  1S94 A;  1IBL T;  4WW0 A;  3AEA A;  5L3F B;  2C5J A;  4KBM B;  2CXL A;  3AB3 B;  4YSX A;  2XQ8 A;  3ZT5 A;  2VKO A;  2W0G A;  4Z91 A;  1ZOY A;  2FUP A;  1UK5 A;  4IE5 A;  4ZS3 A;  2XAH B;  2JPF A;  4MLK A;  4PJJ A;  4PJN A;  3JAD A;  4I55 E;  4TNW A;  4X20 E;  3TKL B;  1T72 A;  2J47 A;  5C2T A;  2WBL A;  5LYJ E;  2VVN A;  4IDZ A;  1HNW T;  1EZ3 A;  2CXF A;  3PUY F;  4DR5 T;  1IZN B;  3HA4 A;  5FVL A;  1E1H B;  4YTN A;  3PUZ F;  2FJE A;  2V26 A;  3FBZ A;  5ABH A;  5AQP B;  1WR6 A;  1WYC A;  3UU5 A;  4HFE A;  5HXC A;  2CBI A;  2CHO A;  3H3M A;  3K8P C;  2NW7 A;  3FXD B;  2W66 A;  3IBP A;  3OYZ A;  1E7P A;  3I0O A;  3E0Z A;  5ADX L;  1IBK T;  2UXN B;  4LF9 T;  2LJL A;  1KNZ A;  4AKL A;  1N34 T;  4EB6 E;  2JRK A;  1MMA A;  2IC6 A;  2YOE A;  4P1N A;  4QWN B;  2WU2 A;  4HFV A;  5AQI B;  5FMN A;  5FNV E;  5L3G B;  3N9P A;  4HFC A;  5LG4 A;  3RRW A;  4AQG A;  2XAG B;  1AJ3 A;  2LRK A;  3BQL A;  3N5L A;  4IE6 A;  5AQL B;  4JYA T;  2V7J A;  3FBL A;  2WDQ A;  4JLE A;  1HNZ T;  2LT3 A;  5HXS A;  3N2O A;  1JNZ A;  2AE9 A;  2VAS A;  2X9W A;  3EAM A;  3OYX A;  3GMI A;  3K1S A;  4WNK A;  3TLS A;  1LVK A;  1G8X A;  1KFY A;  1US7 B;  4AXP A;  2XAF B;  5JRE A;  2X9X A;  5LJM A;  2WP9 A;  4Z8X A;  4XBF B;  1KF6 A;  3LBX B;  5LXT E;  3ZCJ A;  4ERR A;  2BVM A;  1KNR A;  2N9D A;  2V8S V;  3OPC A;  5EZY E;  4ZI2 C;  2KT9 A;  4EV6 A;  3AE9 A;  4U7I A;  2XM1 A;  3EDV A;  3RX6 A;  4B3R T;  3KVB A;  3ETU A;  4GKJ T;  3CQC B;  4YT0 A;  4O4L E;  2BZB A;  4TV8 E;  2FBW A;  4O4I E;  1VCS A;  4AKI A;  3NRX A;  2XPK A;  5JRC B;  2CXD A;  4TUY E;  2QA7 A;  3PV0 F;  4DID B;  4I43 B;  1U5P A;  5JTG A;  2UXD T;  3GN5 A;  4UEM A;  4JI6 T;  2Y8D A;  1I94 T;  5IYZ E;  2BS3 A;  2P9B A;  4MHC A;  3EAB A;  4PAG A;  1Z0P A;  4NXM T;  3FB2 A;  4ZI3 C;  5TAO A;  5FL0 A;  5HEO A;  3UUX B;  3QK6 A;  3DP7 A;  5CB4 E;  4U2Z A;  4HWI B;  3TLV A;  2HN1 A;  4DV2 T;  2UXX B;  3R84 B;  4X66 T;  4GKK T;  1B7T A;  1V9D A;  3HKC E;  4JBW F;  5C3J A;  3VRA A;  2XQ3 A;  2DI4 A;  2XAJ B;  2DWK A;  3P50 A;  5KMG P;  3RPU A;  2MPK A;  4HWC A;  1QUU A;  4UR9 A;  5AQG B;  3RYI E;  2E8I A;  1NWM X;  4JV5 T;  4ZZB A;  2E9X B;  1W9R A;  1VRB A;  5LMN T;  1ZHC A;  3GA8 A;  1LRZ A;  2J4G A;  3RH3 A;  3NKZ A;  5AQR B;  4DV5 T;  4IDO A;  3UFG A;  5EK3 A;  2V6Y A;  3RIA A;  3ZJ1 A;  3P4R A;  2X9Y A;  4LML A;  4EEB A;  4PJM A;  4EAH A;  2H7V C;  4TWD A;  4A98 A;  2XSA A;  3C64 A;  3PTR B;  4U72 A;  5AQS B;  3ZT6 A;  2SPC A;  1HS7 A;  5FXW A;  3ZMT B;  4LMK A;  4CZZ B;  3Q5D A;  3A5X A;  2LKG A;  5CFB A;  2LM9 A; 
#chains in the Genus database with same CATH homology
 1IJ5 A;  3CPZ A;  2GK9 A;  3UT5 E;  5FXX A;  3MJX A;  2KWH A;  1MMN A;  2LEH A;  5FY0 A;  3UUL A;  4ANJ A;  5HXH A;  3F2E A;  3IEE A;  2DCF A;  4BJM A;  3P7I A;  1D0Y A;  4GK5 E;  4TN7 B;  4CXX A;  5KX5 E;  2L3L A;  3SRZ A;  1Y64 B;  2JMK A;  4O8S A;  5LBM A;  3RYH E;  3PU8 A;  3ONX A;  5LHI B;  4B6X A;  4PK5 A;  4EOZ B;  3CX8 B;  2NTY A;  3AA1 B;  3KV4 A;  5JR9 A;  4CI3 B;  3SS1 A;  1QSD A;  4EXT A;  5L2L A;  3PUG A;  5J2T E;  3PUQ A;  3K3Q C;  3PUR A;  2CM0 A;  3N9Q A;  3JC6 C;  5LNK A;  3LK4 2;  2A3D A;  4X1K E;  2BVL A;  2D0T A;  3LG7 A;  2V7L A;  4MFR A;  2Q9Q C;  4YJ3 E;  4H9N C;  1MIY A;  3HL6 A;  4UV8 B;  1WLX A;  2ZMA A;  1FMW A;  3PUA A;  1MMG A;  3NZP A;  4HKA A;  4KP3 C;  4ADZ A;  4O2B E;  4O4H E;  4GOU A;  2ZLY A;  4UEL A;  3UUN A;  3FHN A;  2Q9Q A;  2YU2 A;  5L3C B;  3E08 A;  4A56 A;  4CXY A;  4I4T E;  4L9I A;  5JRC A;  2I59 A;  2RP4 A;  4PFP A;  5F8P A;  3AAE B;  5LBQ B;  3RYC E;  4G2A A;  4WBO A;  3ZMV B;  2ZM2 A;  3N9O A;  3NRY A;  4IE0 A;  2KMF A;  2C5I T;  1X79 A;  3VKH A;  3I9Y A;  2IC9 A;  3AA0 B;  2KND A;  3GWH A;  3N2K E;  4F6R C;  3D0T A;  2MTQ A;  2L9Q A;  2CA5 A;  4U74 A;  5JH7 E;  1KK7 A;  2G0U A;  4ASK A;  3RYF E;  1SA0 E;  3ESL A;  2CMR A;  2K9A A;  3CQG B;  1FMV A;  2K48 A;  3E22 E;  3H3A A;  4YJ2 E;  3EVY A;  4O2A E;  3VKG A;  2PG8 A;  4HEA A;  2YIN A;  3CVR A;  3KBT A;  3C4Z A;  2JMH A;  1HG2 A;  3KVA A;  4IGU A;  4JEH B;  4PK4 A;  4P0B A;  1UCU A;  5ETW A;  3B13 A;  3UTK A;  3F31 A;  2DWG A;  3LBX A;  3ZYL A;  2VKH A;  3CQX C;  3KDS E;  3HR0 A;  5DAB A;  4GYR A;  3VHL A;  4NUU A;  4UV9 B;  3C51 A;  1MIW A;  1VOM A;  2E9X D;  5FY7 A;  2CE7 A;  2KIN B;  2K24 A;  2VKJ A;  2WMN A;  3AAI A;  1ZKE A;  3ZCI A;  3AA6 B;  1D0X A;  5HXE A;  3O1J A;  5IHY A;  4AI6 A;  5HYA A;  3PE0 A;  2KLQ A;  3C4X A;  2Y48 B;  3ZMU B;  4PNI A;  4CI1 B;  4TX5 A;  2V1D B;  4GYS A;  3KBU A;  1BR4 A;  4ZS2 A;  3O1I A;  4UIG A;  3IHR A;  3OKQ A;  1HFA A;  2EHO D;  5JR9 C;  5LHG B;  2YK0 A;  3HI2 A;  3KV9 A;  3ZC1 A;  4EYU A;  5EK2 A;  2WWU A;  1YD8 G;  4ZI2 D;  5FYM A;  5FXZ A;  2JQQ A;  3UFE A;  2EHO A;  2H7O A;  1G73 A;  3N2G E;  3O4X E;  5L3D B;  5L3E B;  1D1A A;  1LVF A;  5JDF A;  2CWO A;  2H3R A;  4PJL A;  2PJQ A;  4BAY B;  3OBV E;  2VK9 A;  3RKO A;  3UUM A;  4AKH A;  4H63 V;  1H7C A;  1U4Q A;  2NTX A;  3ZYM A;  3PUS A;  3NZQ A;  3VU7 H;  1MMD A;  3AAA B;  4HN9 A;  1BR2 A;  4QXB B;  4QXC B;  4XZC A;  3K3N A;  4V1A v;  4UF0 A;  4X1Y E;  3EDU A;  3W15 B;  2MYS A;  4H9P C;  5CA0 E;  2D5U A;  2HH7 A;  1UX4 A;  1OWA A;  4BJN A;  1WRD A;  4WBN E;  5EK4 A;  4BA9 A;  5LHH B;  4KMC A;  3DTO A;  2WM9 A;  3LK2 B;  5HAX A;  2MBG A;  2MOZ A;  1T98 A;  1YKE B;  4C91 A;  2QGS A;  2ODV A;  1YW0 A;  4UVC B;  2CCQ A;  3AVS A;  4P09 A;  2YU1 A;  2LOP A;  3Q9D A;  4GIW A;  4M1P A;  3J7Y q;  3Q2M A;  4PW8 A;  2X66 A;  2ODU A;  2LHR A;  5DQV A;  3PDY A;  4NUV A;  3GN5 B;  3ZPO A;  5LJN A;  4UXN B;  2W63 A;  3L09 A;  4QHO A;  3LJC A;  2CEA A;  2L8K A;  2XAQ B;  5A1L A;  4P0A A;  4ZOL E;  4YLH A;  1ZEE A;  2XUE A;  4N78 D;  2M67 A;  2NP9 A;  3J9X 1;  3B57 A;  4JEU B;  4X1I E;  1O3X A;  3I0Q A;  4OHF A;  4HE8 A;  2LE8 A;  4AKR B;  1SHZ C;  2X0L B;  4GK0 E;  4AQF A;  4UVA B;  5LGT B;  2RA1 A;  3O9X A;  1ZV4 X;  2N2N A;  2XTL A;  1D1C A;  4AQG A;  5DQW A;  3MA9 A;  4L5G A;  3AA7 B;  1HF8 A;  3ETV A;  5LOV E;  3JC6 D;  1OXZ A;  2VWA A;  2NW9 A;  4DVD A;  4EYY R;  4K0U A;  3ZC0 A;  5JDM A;  3QUJ A;  4MBQ A;  3ZLI A;  1IJ6 A;  1HX8 A;  3IF8 B;  2LOS A;  4PK6 A;  5AFU L;  1WYB A;  5JDQ A;  4EZH A;  3MAC A;  4EZ4 A;  4IE7 A;  5HXR A;  2A72 A;  2B1E A;  2X68 A;  2CLY B;  5DJQ C;  2DNX A;  5L3B B;  2ZM8 A;  4CI2 B;  4JUY A;  2HPL A;  3U78 A;  4DMW A;  2ZM0 A;  5JDL A;  3F57 A;  1BR0 A;  3C4W A;  2EHO C;  4E7S A;  2KZ7 B;  2KXP B;  3N9M A;  3Q5W A;  3BK9 A;  2X9H A;  4QXH B;  2NW8 A;  3BQI A;  3ZN1 B;  2N1G A;  3CX7 B;  4IST A;  2K5B B;  1MIV A;  3MKD A;  3NBX X;  4QX8 B;  5J2U E;  1NAF A;  2V7K A;  4L0R A;  2HPJ A;  4O4J E;  2X51 A;  3RRC A;  3R6N A;  3ZN0 B;  4CXW A;  2A2F X;  4ILU A;  5JQG E;  2J1D G;  2W62 A;  3MZK B;  3PU3 A;  4FI5 A;  4IE4 A;  4ZI7 E;  1FEW A;  3L3P A;  5C8Y E;  2KWI B;  2NOX A;  4UF0 B;  3O1H A;  3SWH A;  3KIN B;  3KV6 A;  3ZJ2 A;  4QX7 B;  1YKH B;  2E9X C;  4H63 H;  4QKN A;  2XHE B;  2LSI A;  4ZHQ E;  5JDG A;  3P8C D;  1LKX A;  1CUN A;  4OFZ A;  5JVD E;  2DHR A;  1HCI A;  4DBQ A;  3RC3 A;  4YFS A;  4J2C A;  4IHJ E;  3K3O A;  5FY1 A;  4CQI A;  2IAK A;  4I50 E;  4YHJ A;  3EUH A;  4PFO A;  2LSG A;  3H37 A;  3ZEF B;  4ZI3 D;  4MAL A;  2VKD A;  2LSY A;  4DMV A;  2D0U A;  4TV9 E;  5FXV A;  1D0Z A;  2W00 A;  2LSK A;  4DND A;  3MK7 C;  2C0S A;  3I9W A;  5E0O A;  5CA1 E;  1FIO A;  2CLY C;  2CWY A;  2XAS B;  3U3I A;  3T8O A;  4ISS A;  4DBR A;  1UX5 A;  2Y6X A;  3M65 A;  2JJ9 A;  5LCY A;  3OJA A;  4FJO A;  2EHO B;  3C98 B;  2LSJ A;  2V7M A;  1HTJ F;  1MNE A;  4AQF C;  4C90 A;  2YEV C;  4OYK A;  2Q9Q D;  3I1A A;  1D1B A;  3HKD E;  5LA6 E;  4OYJ A;  4H9R C;  4UVB B;  5LGU B;  2DLR A;  2PFV A;  2OA5 A;  2ACX A;  3CWZ B;  1S35 A;  4HGA A;  2D2S A;  3C50 A;  5M4Y A;  2Z6E A;  2XQY A;  4KUM B;  5HWX A;  4OK0 A;  2C5K T;  2WMO A;  3WAK A;  3N9N A;  1HG5 A;  3ANW A;  5HWY A;  2IW5 B;  4IIJ E;  3FXE B;  3WI3 A;  2WSS V;  3SOL A;  1BR1 A;  2ES0 A;  2W61 A;  3LK3 B;  1MND A;  2PBI A;  3AVR A;  3S4U A;  5BMV E;  5FP3 A;  5JR9 B;  3ANW B;  2LHN A;  4H9Q C;  4TZ4 C;  3ZMZ B;  3WAJ A;  5H6R B;  2V7I A;  5LGN B;  3V5S A;  3MXZ A;  5JDH A;  5H6Q B;  3BQK A;  5J1G A;  3N9L A;  3Q5X A;  2X67 A;  2WAU A;  3HKE E;  3LFM A;  3QC9 A;  3RC8 A;  1IAP A;  4G63 A;  5KDM C;  3V5U A;  2NWB A;  4DO0 A;  3DJB A;  4EIW A;  2VB6 A;  5JDN A;  4XAX B;  2VL8 A;  4H9S E;  3CKD A;  3KV5 A;  4E7Z A;  3ZYK A;  3CML A;  2BDE A;  4HTE A;  2Q9Q B;  2E9X A;  3CX6 B;  3KFW X;  5LP6 E;  4H9O C;  5F3J A;  5GON E;  1S94 A;  4WW0 A;  5L3F B;  2C5J A;  4KBM B;  2CXL A;  3AB3 B;  2VKO A;  2W0G A;  4ZS3 A;  4IE5 A;  2XAH B;  2JPF A;  4MLK A;  4PJJ A;  4PJN A;  5LYJ E;  4I55 E;  4X20 E;  3TKL B;  2WBL A;  4IDZ A;  1EZ3 A;  2CXF A;  1IZN B;  3HA4 A;  1E1H B;  2V26 A;  3FBZ A;  1WR6 A;  1WYC A;  5HXC A;  3K8P C;  2NW7 A;  3FXD B;  3IBP A;  3OYZ A;  5ADX L;  3I0O A;  3E0Z A;  2UXN B;  2LJL A;  1KNZ A;  4AKL A;  4EB6 E;  2JRK A;  1MMA A;  2IC6 A;  4QWN B;  5FNV E;  4HFV A;  5LG4 A;  5L3G B;  5FMN A;  4AKG A;  3N9P A;  3RRW A;  2XAG B;  1AJ3 A;  3BQL A;  3N5L A;  4IE6 A;  2V7J A;  3FBL A;  4JLE A;  2LT3 A;  5HXS A;  3N2O A;  2VAS A;  2X9W A;  3OYX A;  3ZMS B;  3GMI A;  4WNK A;  1LVK A;  1US7 B;  1G8X A;  4AXP A;  5JRE A;  2XAF B;  2X9X A;  5LJM A;  4Z8X A;  4XBF B;  3LBX B;  5LXT E;  3ZCJ A;  4ERR A;  2BVM A;  2N9D A;  5EZY E;  4ZI2 C;  2KT9 A;  3EDV A;  3RX6 A;  3KVB A;  3ETU A;  3CQC B;  4O4L E;  2BZB A;  4TV8 E;  4O4I E;  4AKI A;  3NRX A;  5JRC B;  2CXD A;  4TUY E;  2QA7 A;  4I43 B;  1U5P A;  3GN5 A;  4UEM A;  2Y8D A;  5IYZ E;  2P9B A;  4MHC A;  4PAG A;  1Z0P A;  3FB2 A;  4ZI3 C;  5TAO A;  3UUX B;  3QK6 A;  3DP7 A;  5CB4 E;  2UXX B;  3R84 B;  1B7T A;  1V9D A;  3HKC E;  2DI4 A;  2XAJ B;  2DWK A;  5KMG P;  3RPU A;  1QUU A;  3RYI E;  2E8I A;  1NWM X;  2E9X B;  1VRB A;  1ZHC A;  3GA8 A;  1LRZ A;  3RH3 A;  5EK3 A;  3ZJ1 A;  2X9Y A;  4PJM A;  4EAH A;  2H7V C;  3C64 A;  4U72 A;  3PTR B;  1HS7 A;  2SPC A;  5FXW A;  3ZMT B;  4CZZ B;  3A5X A;  3HKB E;  2LM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...