1FEWA

Crystal structure of smac/diablo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
b'SLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELKQKTQEEGEERAESEQEAYLRED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
publication title Structural and biochemical basis of apoptotic activation by Smac/DIABLO.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 90
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1fewA00
3C98B 1HS7A 4TX5A 1S94A 1EZ3A 4JEUB 2XHEB 5LG4A 4JEHB 5M4YA 2DNXA 1G73A 1FIOA 3LG7A 1BR0A 1FEWA
chains in the Genus database with same CATH superfamily
3ZJ1A 4E7ZA 3UT5E 5HYAA 2W2UA 2WU2A 2VL0A 4XAXB 5JDLA 3AE2A 2XQ4A 2OA5A 2WDRA 4DV4T 2H7VC 3RKGA 5FNVE 3AE7A 3KBUA 4YTNA 2MOZA 3RYIE 1WR0A 2H88A 2RP4A 3ZJ2A 3AAEB 2OV9A 4ASKA 2XM2A 1J5ET 3B57A 4AI6A 3C4XA 2HN2A 2MAWA 3DJBA 5JREA 4O4HE 3PUGA 1BR0A 3P4QA 5C2TA 4B3MT 1W09A 2XQ3A 1NENA 4X1IE 1X79A 1OEDC 3HKDE 5LGNB 4CN1A 3RIAA 2WMOA 2YKSA 2VB6A 2Q9QC 3I1AA 2XM1A 3GA8A 5L3FB 4OHFA 4DR3T 2UUBT 3JADA 2UU9T 4OX9T 3N9OA 3SRZA 1MMGA 4NUUA 4EGWA 2LHNA 1IJ6A 2V7MA 4GYSA 2MBGA 4G63A 2X66A 4YXDA 4DR1T 1NAFA 3HKBE 4U2YA 5J0ZA 4ZOLE 4LFBT 2V8SV 4LMJA 3P7IA 2XSAA 4LFCT 4ZI3C 5TAOA 1HG2A 2D0UA 4H63V 5FMNA 1J5WA 1XWMA 4IDOA 1G73A 3C4WA 2X51A 3E22E 3N9LA 2IDOB 4ERRA 2W00A 3CK6A 3P50A 1HCIA 4P0BA 3ZC1A 4E7SA 1OWAA 2PTFA 2FJBA 3IHRA 4X1KE 3RC3A 3JC6C 5FY7A 3F31A 4OYKA 4JEHB 1HNZT 3UU4A 5FVKA 3LBXB 3KVBA 2KWHA 3CQCB 3R84B 2X9XA 3VHLA 4MBQA 2BVLA 4DBRA 3K1SA 5HXCA 5JDNA 3LK42 2YK0A 3KV5A 2XQ8A 2NW9A 2XZEA 5JR9B 2UUAT 3ONXA 4PK6A 3Q5DA 2LOPA 2A3DA 2JQHA 4KI0F 1LVFA 2JIWA 3P4PA 1T72A 2V7KA 3AE1A 1IJ5A 2VKDA 5HCMA 2V26A 2M6IA 2V7IA 3CVRA 4HTEA 2YDQA 3T8OA 4KX6A 2HHHT 2G0UA 3QB5A 2NW8A 2ES0A 1ZV4X 3TLSA 3C4ZA 2BZBA 3JAEA 2QGSA 4H9QC 4KP3C 3SFDA 3FZFB 2V6XA 1YQ4A 2D2SA 2LM2A 3N9QA 3EI0A 1B7TA 4YSYA 2DCFA 2WSSV 5A1LA 2NWBA 2DNXA 1ZEEA 2E5LT 4YTMA 2IC9A 3VR9A 3FZMB 3NKZA 1X9BA 3NBXX 4DV5T 1UUSA 5LJNA 5AFUL 4JLEA 5HXHA 5JDHA 4P09A 5AQTB 2IMLA 3D0TA 5BR8T 3OTOT 1OEDE 5IHYA 2BDEA 1FMWA 2EHOA 3IF8B 4X20E 3AE5A 4GK0E 5HXEA 4Z8XA 1E1HB 2DLRA 5JDGA 2X0YA 5JTGA 3CQGB 5IWAT 3F57A 3ZMZB 4I0UA 3PTRB 2WZIA 3ZEFB 4U2ZA 4IL9A 4UVAB 3FZLB 3OYXA 3JAFA 2NTXA 3P4RA 1FJGT 2YINA 4H9RC 1HR0T 2XQ6A 3AB3B 4CN6A 1KNZA 3GN5B 5IUXA 1D0ZA 3RH3A 5HWXA 4IDPA 5LG4A 1SHZC 2LT3A 1XDPA 1L0VA 3ZMSB 3ZLIA 2LLYA 3O4XE 4LMLA 5F8PA 5BMVE 1D1BA 2V6YA 2VQFT 4ZZBA 1UCUA 4X65T 4IGUA 4ZI3D 1YQ3A 2XUEA 4DR7T 4I50E 4HWHA 3RLFF 4CQIA 3PDYA 5AQKB 4YHHT 4A98A 2WQYA 5JRCA 5C3JA 3G06A 3LSVA 4Z91A 1HX1B 2M67A 2YEVC 2BKOA 2E9XB 4LF6T 1ZHCA 4ADZA 1V9DA 4DR6T 5AQJB 3VRBA 4A97A 3C64A 3K8PC 1HFAA 3LDQB 5AQUB 4UR9A 5HXSA 2JMHA 4TWHA 4JI8T 4G2AA 2LE8A 4A5XA 2BG9B 2H89A 2VVSA 4Z90A 4O4JE 5LJMA 3ZC0A 1FMVA 2VKHA 2C5KT 3RQUA 5DABA 2QA7A 1AJ3A 2XQ5A 3VKHA 2H7OA 3I9WA 4FJOA 4HE8A 3ANWB 4M1PA 4AQFC 1GQEA 3UULA 4KMCA 1E2AA 3DTOA 3RIUA 2XY8B 2UXBT 2LSJA 1N36T 2VURA 1WRDA 3P4SA 3L8RA 3MJXA 3UUMA 5FXWA 4TWDA 4AQYT 1FEWA 5DJQC 3FBLA 4CZZB 2EHOD 5FP3A 3CWZB 2CA5A 1Z8UA 3ETVA 3EDVA 4OFZA 2WY2A 5FY1A 3QUJA 4AISA 1BR1A 1KNPA 3Q5WA 4LMKA 4P0AA 3HKEE 4QX8B 1J1JA 3PUYF 5EK2A 2LOSA 4HEAA 5JH7E 3A5XA 4QH1A 5L3DB 3UQ7A 2X0LB 4GK5E 3KVAA 5LBQB 2WP9A 4O4LE 1WYCA 5ABFB 4IDNA 4DIDB 4DV2T 1HTJF 2SPCA 2Y6XA 5FXZA 5L4HA 3VU7H 1JNRA 5KMGP 5JQGE 4GKKT 1VCTA 4I4TE 2WB5A 2ZM0A 3UUNA 4IHJE 2K9AA 4ZI2D 3ZPOA 4QXBB 1SUMB 2MYSA 4P1NA 3EDUA 1W0AA 5EZYE 3IBPA 4ILUA 2XASB 4QH4A 5HEHA 3ZN0B 2N9DA 1UX4A 3B5MA 4O2AE 2BBHA 1ZOYA 3UU8A 3Q5XA 1KF6A 2IAKA 4EOZB 3K3NA 5GONE 2BG9E 3AEDA 1UURA 4B3TT 4GIWA 3AECA 3M65A 5HEGA 2LKHA 4DVDA 1QUUA 1VRBA 4HWIB 4AKIA 3Q2MA 2YN6A 3EVYA 4AXPA 4KBMB 2XPKA 3J7Yq 1I6ZA 2YOEA 2HPJA 2CEAA 2VASA 5HWYA 2JMKA 3H3MA 3O1IA 2XQAA 3HKCE 1ZKEA 4U7IA 2CXLA 4C90A 4ZI7E 2UUCT 2OLTA 2E2AA 4IREA 1OEDB 2XQ7A 3QK6A 2HH7A 4TZ4C 3EAMA 5LNKA 3PJAA 4XZCA 1FIOA 4F8HA 3PUZF 5KXJA 3T1YT 2Q9QB 4H63H 3AAIA 1Y01A 3ZT7A 3H37A 3OVUA 5LP6E 1BR4A 4U3CA 5L3BB 2KINB 3RGLA 4DO0A 3I0OA 3PE0A 2ZMAA 1Y64B 3UFEA 1WFDA 2AXDS 1IBMT 2YU2A 4CI2B 4HWDA 4NXMT 2ODVA 2XTLA 5FXXA 4EIWA 4ANJA 4DR2T 2YDSA 4HFCA 4IT4A 4DBQA 2BS4A 4JUYA 3LFMA 4N78D 2H3RA 1YD8G 2WU5A 5ABHA 1MIVA 2XAHB 3HR0A 4PJLA 2CRBA 3ZMUB 3RC8A 1HF8A 3O1JA 3OYZA 3LK3B 4CI1B 4AKHA 4HN9A 3LBXA 4L5GA 3ZCJA 2XQYA 2X67A 2VWAA 4YT0A 2B1EA 3P8CD 4YHJA 5J2TE 3V5UA 2CPTA 4PK5A 2W63A 3A8YC 2WBLA 5JR9A 3FBZA 3RIFA 2J4GA 1U4QA 2CWYA 4K0KT 2DHRA 2CBIA 1QLBA 4Q25A 3BQIA 2CWOA 3L39A 3F2EA 2W67A 4HFDA 4IE7A 4LF8T 2LSYA 3PV0F 2MPKA 5CJ5A 4DNDA 2XAJB 3AEGA 3R6NA 4GKJT 3UU6A 4YTPA 5LGUB 5HEJA 4UELA 2XJ7A 1WLXA 5HXRA 3ZMVB 3N9NA 5LYJE 3AXJB 4OYJA 2EHOC 3HI2A 3T1HT 3AE4A 3AVRA 5L4EA 1BR2A 4OK0A 3O9XA 3ZMTB 2PBIA 1D1AA 5ABEA 2WZHA 5L47A 5EK4A 4B3RT 2R6GF 3HL6A 4AKRB 5AQHB 2L3LA 4LF7T 4U72A 4MHCA 2PFVA 3PJAJ 4XBFB 3J9X1 2UXDT 2WMNA 1Z0PA 5DQVA 2V7JA 4H9PC 2LSGA 5AQPB 4KHPT 2X9HA 2E5VA 2V5DA 5L3GB 1KNRA 3MXZA 4DV1T 2JQ9A 2DWGA 4WBNE 1N32T 5ABGA 4ZI2C 4U31A 2XAFB 1HX8A 4DV0T 3UU5A 2KT9A 5AQVB 1IAPA 3NZQA 2XAQB 2NW7A 3TLTA 3BQLA 3CMLA 3PU8A 2W4XA 5HCJA 3GN5A 2HPLA 3RRCA 3AEFA 1MIWA 1IBLT 2ZLYA 3E08A 4BJMA 3VR8A 2WAUA 4PJJA 4TX5A 2UXCT 5J1GA 4IE0A 3ZCIA 2F4VT 2L9QA 3VKGA 2X68A 2CCQA 5L2LA 3W15B 3AA6B 2LHRA 3UQ4A 3N2GE 4YJ3E 4YSXA 4DR5T 3FZKB 3ZYLA 2XAGB 4YLHA 1HG5A 1O3XA 1VOMA 5AQQB 1DU2A 2E9XA 2M6BA 4I55E 2FJEA 3ZN1B 2K5BB 4HWFA 3FB2A 1UK5A 2CXFA 5LOVE 3AAAB 2J62A 3RPUA 5AQSB 3N2OA 2QVAA 3KINB 3WI3A 3H3AA 3FZHB 1MMDA 2CMRA 3RIUC 1MNDA 3OKQA 4KHZF 2N2NA 4UIGA 5DQWA 1H7CA 3C98B 3KBTA 2HN1A 3ZSTA 3VRAA 4JI7T 1YKEB 4TN7B 1HNWT 2LEHA 2X9YA 2BG9A 3NRXA 3PUQA 2AE9A 2FBWA 2LSIA 2DI4A 5FKYA 4IL4A 2Z6EA 4YFSA 3NZPA 3AVSA 4CI3B 4ZHQE 2RPAA 1HNXT 2W66A 3AA0B 5M4YA 3ANWA 2D9DA 3SFEA 4UVBB 3NVOA 1N34T 4EXTA 2ZM2A 5HEUA 4O2BE 4PK4A 4GYRA 3I9YA 4QH5A 4O8SA 5AQLB 4ILAA 2KMFA 4PAGA 2K3WA 2NR4A 4NPPA 1EZ3A 5EK3A 3FXDB 3OBVE 2LSKA 4MFRA 2LRLA 3N5LA 3CX8B 2CLYB 4HFVA 1XMQT 3UTKA 4U74A 3S4UA 3ZYKA 3AE8A 2VVNA 4ZS3A 3EHZA 1LVKA 1MIYA 4PJMA 3ZT6A 3I0QA 3AE6A 2Y8DA 1CUNA 4MLKA 2BVMA 4YJ2E 3ESLA 3MA9A 2BS3A 2V5CA 5LXTE 4UXNB 2KLQA 4BAYB 1KEYA 2IIUA 2A9UA 5LBMA 5LMNT 4X1YE 1MMNA 3ONJA 2GK9A 4QKNA 5ABFA 3RYHE 2CM0A 3PUWF 2W62A 1UX5A 2A2FX 5ADXL 2VQET 3ZKRA 2I6HA 4I43B 1MMAA 5F3JA 3QNUA 2VK9A 2BKNA 1XNQT 5KDMC 5HEOA 4QHOA 2WWUA 3LK2B 3RRWA 1S35A 2XQ9A 2WWVA 4F6RC 3AA1B 4X64T 1UGOA 1M62A 2E9XD 2VKOA 4IE6A 2K24A 2UXXB 5C8YE 4DUYT 3A7MA 2NP9A 3TLVA 2CHOA 3RQWA 4U7YA 2CBJA 3EUHA 3CKDA 3K3OA 4LF5T 2K48A 1R8IA 3RKOA 2DWKA 4DUZT 1XMOT 3AEEA 3CX6B 4DMWA 3Q5EA 1U5PA 3UFGA 2LJLA 1SE7A 3FHNA 5KX5E 4UVCB 1T7SA 3EABA 3MZKB 4JYAT 3RI5A 2QYWA 1VCSA 5AQMB 3ZSSA 1E7PA 1US7B 5LHHB 2C5JA 5AQOB 2LKGA 4AQGA 1D0YA 1ZP0A 2FJDA 4PFPA 3BK9A 3SS1A 1OEDA 2KXPB 1XDOA 5H6QB 4X5TA 3C51A 3GMIA 3JCFA 5LGTB 2X9WA 2Q9QA 4DV3T 3KV6A 4AIUA 3RHWA 1XZYA 3MACA 5JVDE 2LRKA 2WCAA 2WS3A 2ACZA 2IC6A 3IEEA 5FY0A 3KV9A 4BA9A 2FJAA 3KFWX 3KDSE 3AEBA 3KV4A 3CQXC 4NIQA 5JR9C 2KSRA 1T98A 1OXZA 4IE4A 5LHIB 2NTYA 5J2UE 3TKLB 2WDQA 3MK7C 2RA1A 4ISTA 2L8KA 1W0BA 4DR4T 5CA0E 5L3EB 5FL1A 4FI5A 4L0RA 2D0TA 4TV9E 2X0HA 5AQFB 3QC9A 4DMVA 2ZM6T 3QOFA 2JRKA 3ZYMA 1CHUA 2BS2A 4B3ST 4HFIA 4YSZA 3FXEB 2CE7A 3IA3A 5CA1E 4BJNA 5LB7B 4IDZA 1YXRA 3E0ZA 4JI2T 4QXHB 2ODUA 2IHR1 2D5UA 2BBJA 1JNZA 2IW5B 2ZM8A 3V5SA 2KNDA 2PJQA 2JQQA 4H9OC 4UV8B 3PUAA 2J47A 3N9PA 1IZNB 4K0UA 5IYZE 4X62T 1M7KA 3ONLC 3N9MA 3AXJA 3UUXB 4JI1T 4HFBA 3LG7A 1LKXA 2WM9A 5FVLA 2E8IA 1IBKT 1QSDA 4WNKA 3AE9A 4JEUB 3C50A 3ETUA 3CX7B 4KUMB 1NWMX 3U78A 2P9BA 1SA0E 2BKPA 4CXXA 3PUVF 1NEKA 4O4IE 4QWNB 2EHOB 3M3ZB 4NUVA 5CB4E 3K3QC 4EZHA 4JI4T 4TWFA 2N1GA 4JV5T 4ZEYA 1KFYA 4LFAT 4WYVA 1WCRA 3DP7A 1XNRT 3UUBA 4COFA 3L09A 2XHEB 3ABVA 3NRYA 4AKLA 4EB6E 2Q9QD 5FL0A 3TLWA 2VKJA 4TV8E 3MKDA 3GWHA 2C0SA 5H6RB 4CN4A 2FUPA 5AQNB 1LRZA 3P4WA 5FYMA 4HFHA 2V6YB 2E9XC 4C91A 2WDVA 3RX6A 2J1DG 3OJAA 4ILBA 4J2CA 3SWHA 3WAKA 2KZ7B 1D0XA 3QB5K 5L3CB 4LF9T 3LJCA 5JRCB 5E0OA 3AEAA 3N2KE 4H9SE 4X66T 4DV7T 2YDRA 4JI0T 3O1HA 4EYYR 1D1CA 3WAJA 4IDQA 2ACXA 4TNWA 2CXDA 1MNEA 3TLUA 4MALA 2LM9A 4PFOA 1YKHB 5JDQA 1HS7A 3RF1A 2V1DB 2BG9C 2DL1A 3CPZA 3PU3A 3PUXF 3UU3A 2W0GA 1G8XA 4WW0A 3JC6D 4JBWF 2I0MA 2W61A 3Q9DA 4B6XA 3HA4A 4AKGA 5AQRB 4PNIA 4WZXA 2IUBA 4QXCB 1YW0A 1N33T 4HFEA 5CFBA 3PUSA 5LG3A 4UF0B 2UXNB 2JPFA 2MTQA 3CIRA 4LF4T 3L3PA 1S94A 2XSBA 4ILCA 5LMUT 4UF0A 5ETWA 4U33A 4ISSA 2QRXA 2CLYC 3ZT5A 4ZS2A 5F5WA 4CXYA 2V7LA 4A56A 3B13A 5JDFA 4PJNA 4JI3T 4DV6T 4EV6A 1KK7A 1W9RA 2PG8A 1WYBA 4AQFA 4NXNT 4HKAA 5CGMA 4V1Av 5FXVA 5LHGB 4IIJE 2NOXA 2YU1A 3PURA 1WR6A 4ZZCA 4EEDA 4HGAA 5AQIB 2B76A 2I59A 3OPCA 5AQGB 3SOLA 3U3IA 4TNVA 4UEMA 4EAHA 2A72A 4TUYE 3X1DA 2KWIB 4WBOA 4YY3T 2CHNA 3RYCE 4EYUA 3NWIA 3AA7B 4JI5T 1I94T 3AE3A 2JQKA 4GOUA 4EZ4A 4EEBA 4UV9B 4CXWA 4H9NC 3BQKA 4L9IA 5LCYA 2JJ9A 2Y48B 4HWCA 5LA6E 2C5IT 2VL8A 4QX7B 5HAXA 5JDMA 3RYFE 4IE5A 4ZXLA 4JI6T 4PW8A 1T8BA
chains in the Genus database with same CATH topology
3ZJ1A 1FMVA 4E7ZA 2VKHA 2C5KT 3UT5E 5HYAA 4H9PC 5JR9C 5DABA 1T98A 2LSGA 2QA7A 1OXZA 4XAXB 2X9HA 5JDLA 4IE4A 5LHIB 1AJ3A 5L3GB 2NTYA 2OA5A 3MXZA 5J2UE 3VKHA 2H7OA 3TKLB 2H7VC 2DWGA 4WBNE 5FNVE 3I9WA 4FJOA 4HE8A 3MK7C 3KBUA 2RA1A 3ANWB 4ISTA 4ZI2C 4M1PA 4AQFC 2XAFB 2MOZA 3RYIE 1HX8A 3UULA 2L8KA 4KMCA 2KT9A 1IAPA 5CA0E 2RP4A 3NZQA 5L3EB 3ZJ2A 2XAQB 3AAEB 2NW7A 3DTOA 4ASKA 3BQLA 3CMLA 4FI5A 3PU8A 3B57A 4L0RA 4AI6A 2D0TA 3C4XA 4TV9E 2LSJA 3GN5A 2HPLA 3RRCA 1MIWA 1WRDA 3DJBA 3UUMA 3MJXA 3QC9A 4DMVA 4O4HE 5FXWA 5JREA 3PUGA 2JRKA 1BR0A 1FEWA 2ZLYA 3E08A 5DJQC 3ZYMA 4PW8A 4X1IE 3FBLA 1X79A 4BJMA 4CZZB 2WAUA 4PJJA 3FXEB 3HKDE 4TX5A 2CE7A 2EHOD 5J1GA 5LGNB 4IE0A 3ZCIA 5FP3A 5CA1E 4BJNA 2WMOA 4IDZA 2VB6A 3CWZB 2CA5A 3ETVA 2Q9QC 2L9QA 3E0ZA 3I1AA 3VKGA 3EDVA 2X68A 3GA8A 4OFZA 4QXHB 5L3FB 4OHFA 5FY1A 3QUJA 1BR1A 2CCQA 2ODUA 5L2LA 3W15B 3AA6B 2D5UA 2LHRA 2IW5B 3Q5WA 2ZM8A 3N9OA 3V5SA 3N2GE 2KNDA 1MMGA 4NUUA 4YJ3E 3SRZA 2LHNA 4P0AA 2PJQA 1IJ6A 3HKEE 4QX8B 2JQQA 4H9OC 5EK2A 2LOSA 2V7MA 4GYSA 4HEAA 2MBGA 4UV8B 4G63A 5JH7E 2X66A 3PUAA 2XAGB 4YLHA 3ZYLA 3N9PA 1IZNB 4K0UA 3A5XA 1HG5A 1O3XA 1VOMA 5IYZE 5L3DB 3N9MA 2X0LB 3UUXB 1NAFA 3HKBE 2E9XA 3LG7A 4I55E 4GK5E 1LKXA 2WM9A 4ZOLE 3KVAA 2E8IA 1QSDA 3P7IA 4WNKA 3ZN1B 5LBQB 2K5BB 1WYCA 4O4LE 4ZI3C 5TAOA 4JEUB 3FB2A 1HG2A 3C50A 1HTJF 2SPCA 2Y6XA 3ETUA 2D0UA 2CXFA 5FXZA 3VU7H 3CX7B 5KMGP 4H63V 4KUMB 1NWMX 3U78A 5LOVE 5FMNA 3AAAB 2P9BA 5JQGE 1SA0E 4I4TE 3RPUA 3N2OA 3KINB 1G73A 3WI3A 3H3AA 3C4WA 2ZM0A 1MMDA 2X51A 2CMRA 3UUNA 4CXXA 4IHJE 4O4IE 4QWNB 2EHOB 2K9AA 4ZI2D 1MNDA 3OKQA 4UIGA 2N2NA 4NUVA 3E22E 5DQWA 1H7CA 3ZPOA 3N9LA 4QXBB 3C98B 3KBTA 5CB4E 2MYSA 3K3QC 4EZHA 3EDUA 1YKEB 4TN7B 5EZYE 2N1GA 3IBPA 4ERRA 4ILUA 2LEHA 2XASB 2W00A 2X9YA 1HCIA 3NRXA 4P0BA 3PUQA 3ZC1A 3ZN0B 4E7SA 2N9DA 2LSIA 1UX4A 2DI4A 1OWAA 3IHRA 4O2AE 4X1KE 3RC3A 3JC6C 3DP7A 2Z6EA 5FY7A 4YFSA 3F31A 4OYKA 4JEHB 3NZPA 3L09A 3AVSA 3LBXB 4CI3B 2XHEB 4ZHQE 3Q5XA 3KVBA 2KWHA 3CQCB 3NRYA 4AKLA 3AA0B 2IAKA 3R84B 4EOZB 4EB6E 2Q9QD 3ANWA 2X9XA 3K3NA 5M4YA 3VHLA 2VKJA 4UVBB 4MBQA 2BVLA 4TV8E 4DBRA 5GONE 3MKDA 5HXCA 3GWHA 4EXTA 5JDNA 2C0SA 3LK42 2YK0A 2ZM2A 5H6RB 3KV5A 2NW9A 4O2BE 4PK4A 4GYRA 3I9YA 5JR9B 4GIWA 4O8SA 3ONXA 3M65A 4PK6A 1LRZA 2KMFA 5FYMA 4DVDA 1QUUA 2LOPA 1VRBA 2E9XC 2A3DA 4PAGA 4C91A 1LVFA 4AKIA 3Q2MA 2V7KA 3EVYA 3RX6A 4AXPA 2J1DG 1IJ5A 3OJAA 1EZ3A 2VKDA 4J2CA 5EK3A 4KBMB 3FXDB 2V26A 3J7Yq 3OBVE 3SWHA 2LSKA 3WAKA 4MFRA 2V7IA 2KZ7B 2HPJA 2CEAA 3CVRA 2VASA 5HWYA 3N5LA 4HTEA 1D0XA 5L3CB 2JMKA 3O1IA 3LJCA 3CX8B 5JRCB 2CLYB 4HFVA 3HKCE 5E0OA 1ZKEA 3UTKA 2CXLA 4H9SE 3N2KE 4U74A 3T8OA 3S4UA 4C90A 3ZYKA 4ZI7E 3O1HA 4EYYR 2G0UA 4ZS3A 1D1CA 3WAJA 2NW8A 1LVKA 2ACXA 2ES0A 1ZV4X 1MIYA 2CXDA 3C4ZA 4PJMA 3I0QA 1MNEA 2Y8DA 2BZBA 4MALA 1CUNA 2QGSA 4H9QC 2LM9A 3QK6A 2HH7A 1YKHB 4KP3C 4PFOA 4TZ4C 4MLKA 2BVMA 5JDQA 5LNKA 4YJ2E 2D2SA 3ESLA 4XZCA 3MA9A 1FIOA 1HS7A 2V1DB 3N9QA 4UXNB 2Q9QB 5LXTE 1B7TA 2KLQA 2DCFA 4H63H 4BAYB 2WSSV 3AAIA 3CPZA 3PU3A 5A1LA 2NWBA 5LBMA 2DNXA 4X1YE 1MMNA 1ZEEA 2W0GA 2GK9A 2IC9A 3H37A 5LP6E 4QKNA 1BR4A 1G8XA 5L3BB 3RYHE 2KINB 2CM0A 4WW0A 3JC6D 2W62A 1UX5A 2A2FX 5ADXL 3NBXX 4DO0A 3I0OA 2W61A 3PE0A 3Q9DA 2ZMAA 4B6XA 3HA4A 1Y64B 3UFEA 5LJNA 5AFUL 4JLEA 5HXHA 4I43B 5F3JA 1MMAA 5JDHA 4P09A 2YU2A 4AKGA 4CI2B 3D0TA 4PNIA 5IHYA 2BDEA 1FMWA 2EHOA 3IF8B 4X20E 2ODVA 2VK9A 2XTLA 4GK0E 5FXXA 5HXEA 4EIWA 4Z8XA 4ANJA 4QXCB 1E1HB 2DLRA 5KDMC 1YW0A 5JDGA 4QHOA 2WWUA 3LK2B 3CQGB 3RRWA 3PUSA 1S35A 4DBQA 3F57A 3ZMZB 4JUYA 4N78D 3LFMA 4F6RC 2H3RA 1YD8G 3AA1B 1MIVA 3PTRB 3ZEFB 4UVAB 2XAHB 3HR0A 4UF0B 3OYXA 2UXNB 2E9XD 4PJLA 2VKOA 2NTXA 4IE6A 3ZMUB 2JPFA 1HF8A 2K24A 3O1JA 3OYZA 3LK3B 2UXXB 3RC8A 4CI1B 2MTQA 4AKHA 2YINA 4H9RC 3L3PA 4HN9A 3LBXA 1S94A 4L5GA 5C8YE 3AB3B 2NP9A 3ZCJA 2XQYA 4UF0A 1KNZA 2X67A 3GN5B 2VWAA 1D0ZA 5ETWA 3RH3A 2B1EA 3P8CD 4YHJA 5HWXA 5J2TE 4ISSA 3V5UA 5LG4A 1SHZC 2LT3A 2CLYC 4ZS2A 4PK5A 3EUHA 3CKDA 3K3OA 2W63A 3ZMSB 2WBLA 5JR9A 4CXYA 2V7LA 4A56A 3ZLIA 3B13A 3FBZA 2K48A 3O4XE 3RKOA 5JDFA 4PJNA 5DQVA 1U4QA 5F8PA 2DWKA 5BMVE 1D1BA 3CX6B 2CWYA 1KK7A 4DMWA 1U5PA 2PG8A 1WYBA 1UCUA 4IGUA 2LJLA 4ZI3D 2DHRA 3FHNA 3BQIA 4AQFA 2CWOA 5KX5E 2XUEA 3F2EA 4UVCB 4HKAA 4IE7A 2LSYA 4I50E 4V1Av 3MZKB 5FXVA 4CQIA 4DNDA 5LHGB 2XAJB 3PDYA 3R6NA 4IIJE 2NOXA 2YU1A 3PURA 5JRCA 1US7B 5LGUB 5LHHB 2C5JA 4UELA 1WR6A 1WLXA 5HXRA 4HGAA 4AQGA 1D0YA 3ZMVB 3N9NA 2M67A 2YEVC 5LYJE 2I59A 4OYJA 4PFPA 2EHOC 3HI2A 2E9XB 3BK9A 3SS1A 3SOLA 3U3IA 3AVRA 2KXPB 5H6QB 1BR2A 4UEMA 4EAHA 3C51A 2A72A 4OK0A 4TUYE 3O9XA 2KWIB 4WBOA 1ZHCA 3GMIA 3ZMTB 2PBIA 1D1AA 5LGTB 4ADZA 3RYCE 2X9WA 1V9DA 2Q9QA 4EYUA 3KV6A 5EK4A 3AA7B 3C64A 3HL6A 3K8PC 3MACA 4GOUA 5JVDE 1HFAA 4AKRB 4EZ4A 4UV9B 4CXWA 2L3LA 2IC6A 4H9NC 3IEEA 5FY0A 3KV9A 4BA9A 4U72A 3BQKA 4L9IA 5LCYA 4MHCA 2PFVA 2JJ9A 2Y48B 5LA6E 2C5IT 2VL8A 4XBFB 3J9X1 5HXSA 4QX7B 3KFWX 5HAXA 3KDSE 2JMHA 2WMNA 5JDMA 4G2AA 1Z0PA 2LE8A 3RYFE 4IE5A 3CQXC 4O4JE 5LJMA 2V7JA 3KV4A 3ZC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C98 B;  1HS7 A;  4TX5 A;  1S94 A;  1EZ3 A;  4JEU B;  2XHE B;  5LG4 A;  4JEH B;  5M4Y A;  2DNX A;  1G73 A;  1FIO A;  3LG7 A;  1BR0 A;  1FEW A; 
#chains in the Genus database with same CATH topology
 3ZJ1 A;  4E7Z A;  3UT5 E;  5HYA A;  2W2U A;  2WU2 A;  2VL0 A;  4XAX B;  5JDL A;  3AE2 A;  2XQ4 A;  2OA5 A;  2WDR A;  4DV4 T;  2H7V C;  3RKG A;  5FNV E;  3AE7 A;  3KBU A;  4YTN A;  2MOZ A;  3RYI E;  1WR0 A;  2H88 A;  2RP4 A;  3ZJ2 A;  3AAE B;  2OV9 A;  4ASK A;  2XM2 A;  1J5E T;  3B57 A;  4AI6 A;  3C4X A;  2HN2 A;  2MAW A;  3DJB A;  5JRE A;  4O4H E;  3PUG A;  1BR0 A;  3P4Q A;  5C2T A;  4B3M T;  1W09 A;  2XQ3 A;  1NEN A;  4X1I E;  1X79 A;  1OED C;  3HKD E;  5LGN B;  4CN1 A;  3RIA A;  2WMO A;  2YKS A;  2VB6 A;  2Q9Q C;  3I1A A;  2XM1 A;  3GA8 A;  5L3F B;  4OHF A;  4DR3 T;  2UUB T;  3JAD A;  2UU9 T;  4OX9 T;  3N9O A;  3SRZ A;  1MMG A;  4NUU A;  4EGW A;  2LHN A;  1IJ6 A;  2V7M A;  4GYS A;  2MBG A;  4G63 A;  2X66 A;  4YXD A;  4DR1 T;  1NAF A;  3HKB E;  4U2Y A;  5J0Z A;  4ZOL E;  4LFB T;  2V8S V;  4LMJ A;  3P7I A;  2XSA A;  4LFC T;  4ZI3 C;  5TAO A;  1HG2 A;  2D0U A;  4H63 V;  5FMN A;  1J5W A;  1XWM A;  4IDO A;  1G73 A;  3C4W A;  2X51 A;  3E22 E;  3N9L A;  2IDO B;  4ERR A;  2W00 A;  3CK6 A;  3P50 A;  1HCI A;  4P0B A;  3ZC1 A;  4E7S A;  1OWA A;  2PTF A;  2FJB A;  3IHR A;  4X1K E;  3RC3 A;  3JC6 C;  5FY7 A;  3F31 A;  4OYK A;  4JEH B;  1HNZ T;  3UU4 A;  5FVK A;  3LBX B;  3KVB A;  2KWH A;  3CQC B;  3R84 B;  2X9X A;  3VHL A;  4MBQ A;  2BVL A;  4DBR A;  3K1S A;  5HXC A;  5JDN A;  3LK4 2;  2YK0 A;  3KV5 A;  2XQ8 A;  2NW9 A;  2XZE A;  5JR9 B;  2UUA T;  3ONX A;  4PK6 A;  3Q5D A;  2LOP A;  2A3D A;  2JQH A;  4KI0 F;  1LVF A;  2JIW A;  3P4P A;  1T72 A;  2V7K A;  3AE1 A;  1IJ5 A;  2VKD A;  5HCM A;  2V26 A;  2M6I A;  2V7I A;  3CVR A;  4HTE A;  2YDQ A;  3T8O A;  4KX6 A;  2HHH T;  2G0U A;  3QB5 A;  2NW8 A;  2ES0 A;  1ZV4 X;  3TLS A;  3C4Z A;  2BZB A;  3JAE A;  2QGS A;  4H9Q C;  4KP3 C;  3SFD A;  3FZF B;  2V6X A;  1YQ4 A;  2D2S A;  2LM2 A;  3N9Q A;  3EI0 A;  1B7T A;  4YSY A;  2DCF A;  2WSS V;  5A1L A;  2NWB A;  2DNX A;  1ZEE A;  2E5L T;  4YTM A;  2IC9 A;  3VR9 A;  3FZM B;  3NKZ A;  1X9B A;  3NBX X;  4DV5 T;  1UUS A;  5LJN A;  5AFU L;  4JLE A;  5HXH A;  5JDH A;  4P09 A;  5AQT B;  2IML A;  3D0T A;  5BR8 T;  3OTO T;  1OED E;  5IHY A;  2BDE A;  1FMW A;  2EHO A;  3IF8 B;  4X20 E;  3AE5 A;  4GK0 E;  5HXE A;  4Z8X A;  1E1H B;  2DLR A;  5JDG A;  2X0Y A;  5JTG A;  3CQG B;  5IWA T;  3F57 A;  3ZMZ B;  4I0U A;  3PTR B;  2WZI A;  3ZEF B;  4U2Z A;  4IL9 A;  4UVA B;  3FZL B;  3OYX A;  3JAF A;  2NTX A;  3P4R A;  1FJG T;  2YIN A;  4H9R C;  1HR0 T;  2XQ6 A;  3AB3 B;  4CN6 A;  1KNZ A;  3GN5 B;  5IUX A;  1D0Z A;  3RH3 A;  5HWX A;  4IDP A;  5LG4 A;  1SHZ C;  2LT3 A;  1XDP A;  1L0V A;  3ZMS B;  3ZLI A;  2LLY A;  3O4X E;  4LML A;  5F8P A;  5BMV E;  1D1B A;  2V6Y A;  2VQF T;  4ZZB A;  1UCU A;  4X65 T;  4IGU A;  4ZI3 D;  1YQ3 A;  2XUE A;  4DR7 T;  4I50 E;  4HWH A;  3RLF F;  4CQI A;  3PDY A;  5AQK B;  4YHH T;  4A98 A;  2WQY A;  5JRC A;  5C3J A;  3G06 A;  3LSV A;  4Z91 A;  1HX1 B;  2M67 A;  2YEV C;  2BKO A;  2E9X B;  4LF6 T;  1ZHC A;  4ADZ A;  1V9D A;  4DR6 T;  5AQJ B;  3VRB A;  4A97 A;  3C64 A;  3K8P C;  1HFA A;  3LDQ B;  5AQU B;  4UR9 A;  5HXS A;  2JMH A;  4TWH A;  4JI8 T;  4G2A A;  2LE8 A;  4A5X A;  2BG9 B;  2H89 A;  2VVS A;  4Z90 A;  4O4J E;  5LJM A;  3ZC0 A;  1FMV A;  2VKH A;  2C5K T;  3RQU A;  5DAB A;  2QA7 A;  1AJ3 A;  2XQ5 A;  3VKH A;  2H7O A;  3I9W A;  4FJO A;  4HE8 A;  3ANW B;  4M1P A;  4AQF C;  1GQE A;  3UUL A;  4KMC A;  1E2A A;  3DTO A;  3RIU A;  2XY8 B;  2UXB T;  2LSJ A;  1N36 T;  2VUR A;  1WRD A;  3P4S A;  3L8R A;  3MJX A;  3UUM A;  5FXW A;  4TWD A;  4AQY T;  1FEW A;  5DJQ C;  3FBL A;  4CZZ B;  2EHO D;  5FP3 A;  3CWZ B;  2CA5 A;  1Z8U A;  3ETV A;  3EDV A;  4OFZ A;  2WY2 A;  5FY1 A;  3QUJ A;  4AIS A;  1BR1 A;  1KNP A;  3Q5W A;  4LMK A;  4P0A A;  3HKE E;  4QX8 B;  1J1J A;  3PUY F;  5EK2 A;  2LOS A;  4HEA A;  5JH7 E;  3A5X A;  4QH1 A;  5L3D B;  3UQ7 A;  2X0L B;  4GK5 E;  3KVA A;  5LBQ B;  2WP9 A;  4O4L E;  1WYC A;  5ABF B;  4IDN A;  4DID B;  4DV2 T;  1HTJ F;  2SPC A;  2Y6X A;  5FXZ A;  5L4H A;  3VU7 H;  1JNR A;  5KMG P;  5JQG E;  4GKK T;  1VCT A;  4I4T E;  2WB5 A;  2ZM0 A;  3UUN A;  4IHJ E;  2K9A A;  4ZI2 D;  3ZPO A;  4QXB B;  1SUM B;  2MYS A;  4P1N A;  3EDU A;  1W0A A;  5EZY E;  3IBP A;  4ILU A;  2XAS B;  4QH4 A;  5HEH A;  3ZN0 B;  2N9D A;  1UX4 A;  3B5M A;  4O2A E;  2BBH A;  1ZOY A;  3UU8 A;  3Q5X A;  1KF6 A;  2IAK A;  4EOZ B;  3K3N A;  5GON E;  2BG9 E;  3AED A;  1UUR A;  4B3T T;  4GIW A;  3AEC A;  3M65 A;  5HEG A;  2LKH A;  4DVD A;  1QUU A;  1VRB A;  4HWI B;  4AKI A;  3Q2M A;  2YN6 A;  3EVY A;  4AXP A;  4KBM B;  2XPK A;  3J7Y q;  1I6Z A;  2YOE A;  2HPJ A;  2CEA A;  2VAS A;  5HWY A;  2JMK A;  3H3M A;  3O1I A;  2XQA A;  3HKC E;  1ZKE A;  4U7I A;  2CXL A;  4C90 A;  4ZI7 E;  2UUC T;  2OLT A;  2E2A A;  4IRE A;  1OED B;  2XQ7 A;  3QK6 A;  2HH7 A;  4TZ4 C;  3EAM A;  5LNK A;  3PJA A;  4XZC A;  1FIO A;  4F8H A;  3PUZ F;  5KXJ A;  3T1Y T;  2Q9Q B;  4H63 H;  3AAI A;  1Y01 A;  3ZT7 A;  3H37 A;  3OVU A;  5LP6 E;  1BR4 A;  4U3C A;  5L3B B;  2KIN B;  3RGL A;  4DO0 A;  3I0O A;  3PE0 A;  2ZMA A;  1Y64 B;  3UFE A;  1WFD A;  2AXD S;  1IBM T;  2YU2 A;  4CI2 B;  4HWD A;  4NXM T;  2ODV A;  2XTL A;  5FXX A;  4EIW A;  4ANJ A;  4DR2 T;  2YDS A;  4HFC A;  4IT4 A;  4DBQ A;  2BS4 A;  4JUY A;  3LFM A;  4N78 D;  2H3R A;  1YD8 G;  2WU5 A;  5ABH A;  1MIV A;  2XAH B;  3HR0 A;  4PJL A;  2CRB A;  3ZMU B;  3RC8 A;  1HF8 A;  3O1J A;  3OYZ A;  3LK3 B;  4CI1 B;  4AKH A;  4HN9 A;  3LBX A;  4L5G A;  3ZCJ A;  2XQY A;  2X67 A;  2VWA A;  4YT0 A;  2B1E A;  3P8C D;  4YHJ A;  5J2T E;  3V5U A;  2CPT A;  4PK5 A;  2W63 A;  3A8Y C;  2WBL A;  5JR9 A;  3FBZ A;  3RIF A;  2J4G A;  1U4Q A;  2CWY A;  4K0K T;  2DHR A;  2CBI A;  1QLB A;  4Q25 A;  3BQI A;  2CWO A;  3L39 A;  3F2E A;  2W67 A;  4HFD A;  4IE7 A;  4LF8 T;  2LSY A;  3PV0 F;  2MPK A;  5CJ5 A;  4DND A;  2XAJ B;  3AEG A;  3R6N A;  4GKJ T;  3UU6 A;  4YTP A;  5LGU B;  5HEJ A;  4UEL A;  2XJ7 A;  1WLX A;  5HXR A;  3ZMV B;  3N9N A;  5LYJ E;  3AXJ B;  4OYJ A;  2EHO C;  3HI2 A;  3T1H T;  3AE4 A;  3AVR A;  5L4E A;  1BR2 A;  4OK0 A;  3O9X A;  3ZMT B;  2PBI A;  1D1A A;  5ABE A;  2WZH A;  5L47 A;  5EK4 A;  4B3R T;  2R6G F;  3HL6 A;  4AKR B;  5AQH B;  2L3L A;  4LF7 T;  4U72 A;  4MHC A;  2PFV A;  3PJA J;  4XBF B;  3J9X 1;  2UXD T;  2WMN A;  1Z0P A;  5DQV A;  2V7J A;  4H9P C;  2LSG A;  5AQP B;  4KHP T;  2X9H A;  2E5V A;  2V5D A;  5L3G B;  1KNR A;  3MXZ A;  4DV1 T;  2JQ9 A;  2DWG A;  4WBN E;  1N32 T;  5ABG A;  4ZI2 C;  4U31 A;  2XAF B;  1HX8 A;  4DV0 T;  3UU5 A;  2KT9 A;  5AQV B;  1IAP A;  3NZQ A;  2XAQ B;  2NW7 A;  3TLT A;  3BQL A;  3CML A;  3PU8 A;  2W4X A;  5HCJ A;  3GN5 A;  2HPL A;  3RRC A;  3AEF A;  1MIW A;  1IBL T;  2ZLY A;  3E08 A;  4BJM A;  3VR8 A;  2WAU A;  4PJJ A;  4TX5 A;  2UXC T;  5J1G A;  4IE0 A;  3ZCI A;  2F4V T;  2L9Q A;  3VKG A;  2X68 A;  2CCQ A;  5L2L A;  3W15 B;  3AA6 B;  2LHR A;  3UQ4 A;  3N2G E;  4YJ3 E;  4YSX A;  4DR5 T;  3FZK B;  3ZYL A;  2XAG B;  4YLH A;  1HG5 A;  1O3X A;  1VOM A;  5AQQ B;  1DU2 A;  2E9X A;  2M6B A;  4I55 E;  2FJE A;  3ZN1 B;  2K5B B;  4HWF A;  3FB2 A;  1UK5 A;  2CXF A;  5LOV E;  3AAA B;  2J62 A;  3RPU A;  5AQS B;  3N2O A;  2QVA A;  3KIN B;  3WI3 A;  3H3A A;  3FZH B;  1MMD A;  2CMR A;  3RIU C;  1MND A;  3OKQ A;  4KHZ F;  2N2N A;  4UIG A;  5DQW A;  1H7C A;  3C98 B;  3KBT A;  2HN1 A;  3ZST A;  3VRA A;  4JI7 T;  1YKE B;  4TN7 B;  1HNW T;  2LEH A;  2X9Y A;  2BG9 A;  3NRX A;  3PUQ A;  2AE9 A;  2FBW A;  2LSI A;  2DI4 A;  5FKY A;  4IL4 A;  2Z6E A;  4YFS A;  3NZP A;  3AVS A;  4CI3 B;  4ZHQ E;  2RPA A;  1HNX T;  2W66 A;  3AA0 B;  5M4Y A;  3ANW A;  2D9D A;  3SFE A;  4UVB B;  3NVO A;  1N34 T;  4EXT A;  2ZM2 A;  5HEU A;  4O2B E;  4PK4 A;  4GYR A;  3I9Y A;  4QH5 A;  4O8S A;  5AQL B;  4ILA A;  2KMF A;  4PAG A;  2K3W A;  2NR4 A;  4NPP A;  1EZ3 A;  5EK3 A;  3FXD B;  3OBV E;  2LSK A;  4MFR A;  2LRL A;  3N5L A;  3CX8 B;  2CLY B;  4HFV A;  1XMQ T;  3UTK A;  4U74 A;  3S4U A;  3ZYK A;  3AE8 A;  2VVN A;  4ZS3 A;  3EHZ A;  1LVK A;  1MIY A;  4PJM A;  3ZT6 A;  3I0Q A;  3AE6 A;  2Y8D A;  1CUN A;  4MLK A;  2BVM A;  4YJ2 E;  3ESL A;  3MA9 A;  2BS3 A;  2V5C A;  5LXT E;  4UXN B;  2KLQ A;  4BAY B;  1KEY A;  2IIU A;  2A9U A;  5LBM A;  5LMN T;  4X1Y E;  1MMN A;  3ONJ A;  2GK9 A;  4QKN A;  5ABF A;  3RYH E;  2CM0 A;  3PUW F;  2W62 A;  1UX5 A;  2A2F X;  5ADX L;  2VQE T;  3ZKR A;  2I6H A;  4I43 B;  1MMA A;  5F3J A;  3QNU A;  2VK9 A;  2BKN A;  1XNQ T;  5KDM C;  5HEO A;  4QHO A;  2WWU A;  3LK2 B;  3RRW A;  1S35 A;  2XQ9 A;  2WWV A;  4F6R C;  3AA1 B;  4X64 T;  1UGO A;  1M62 A;  2E9X D;  2VKO A;  4IE6 A;  2K24 A;  2UXX B;  5C8Y E;  4DUY T;  3A7M A;  2NP9 A;  3TLV A;  2CHO A;  3RQW A;  4U7Y A;  2CBJ A;  3EUH A;  3CKD A;  3K3O A;  4LF5 T;  2K48 A;  1R8I A;  3RKO A;  2DWK A;  4DUZ T;  1XMO T;  3AEE A;  3CX6 B;  4DMW A;  3Q5E A;  1U5P A;  3UFG A;  2LJL A;  1SE7 A;  3FHN A;  5KX5 E;  4UVC B;  1T7S A;  3EAB A;  3MZK B;  4JYA T;  3RI5 A;  2QYW A;  1VCS A;  5AQM B;  3ZSS A;  1E7P A;  1US7 B;  5LHH B;  2C5J A;  5AQO B;  2LKG A;  4AQG A;  1D0Y A;  1ZP0 A;  2FJD A;  4PFP A;  3BK9 A;  3SS1 A;  1OED A;  2KXP B;  1XDO A;  5H6Q B;  4X5T A;  3C51 A;  3GMI A;  3JCF A;  5LGT B;  2X9W A;  2Q9Q A;  4DV3 T;  3KV6 A;  4AIU A;  3RHW A;  1XZY A;  3MAC A;  5JVD E;  2LRK A;  2WCA A;  2WS3 A;  2ACZ A;  2IC6 A;  3IEE A;  5FY0 A;  3KV9 A;  4BA9 A;  2FJA A;  3KFW X;  3KDS E;  3AEB A;  3KV4 A;  3CQX C;  4NIQ A;  5JR9 C;  2KSR A;  1T98 A;  1OXZ A;  4IE4 A;  5LHI B;  2NTY A;  5J2U E;  3TKL B;  2WDQ A;  3MK7 C;  2RA1 A;  4IST A;  2L8K A;  1W0B A;  4DR4 T;  5CA0 E;  5L3E B;  5FL1 A;  4FI5 A;  4L0R A;  2D0T A;  4TV9 E;  2X0H A;  5AQF B;  3QC9 A;  4DMV A;  2ZM6 T;  3QOF A;  2JRK A;  3ZYM A;  1CHU A;  2BS2 A;  4B3S T;  4HFI A;  4YSZ A;  3FXE B;  2CE7 A;  3IA3 A;  5CA1 E;  4BJN A;  5LB7 B;  4IDZ A;  1YXR A;  3E0Z A;  4JI2 T;  4QXH B;  2ODU A;  2IHR 1;  2D5U A;  2BBJ A;  1JNZ A;  2IW5 B;  2ZM8 A;  3V5S A;  2KND A;  2PJQ A;  2JQQ A;  4H9O C;  4UV8 B;  3PUA A;  2J47 A;  3N9P A;  1IZN B;  4K0U A;  5IYZ E;  4X62 T;  1M7K A;  3ONL C;  3N9M A;  3AXJ A;  3UUX B;  4JI1 T;  4HFB A;  3LG7 A;  1LKX A;  2WM9 A;  5FVL A;  2E8I A;  1IBK T;  1QSD A;  4WNK A;  3AE9 A;  4JEU B;  3C50 A;  3ETU A;  3CX7 B;  4KUM B;  1NWM X;  3U78 A;  2P9B A;  1SA0 E;  2BKP A;  4CXX A;  3PUV F;  1NEK A;  4O4I E;  4QWN B;  2EHO B;  3M3Z B;  4NUV A;  5CB4 E;  3K3Q C;  4EZH A;  4JI4 T;  4TWF A;  2N1G A;  4JV5 T;  4ZEY A;  1KFY A;  4LFA T;  4WYV A;  1WCR A;  3DP7 A;  1XNR T;  3UUB A;  4COF A;  3L09 A;  2XHE B;  3ABV A;  3NRY A;  4AKL A;  4EB6 E;  2Q9Q D;  5FL0 A;  3TLW A;  2VKJ A;  4TV8 E;  3MKD A;  3GWH A;  2C0S A;  5H6R B;  4CN4 A;  2FUP A;  5AQN B;  1LRZ A;  3P4W A;  5FYM A;  4HFH A;  2V6Y B;  2E9X C;  4C91 A;  2WDV A;  3RX6 A;  2J1D G;  3OJA A;  4ILB A;  4J2C A;  3SWH A;  3WAK A;  2KZ7 B;  1D0X A;  3QB5 K;  5L3C B;  4LF9 T;  3LJC A;  5JRC B;  5E0O A;  3AEA A;  3N2K E;  4H9S E;  4X66 T;  4DV7 T;  2YDR A;  4JI0 T;  3O1H A;  4EYY R;  1D1C A;  3WAJ A;  4IDQ A;  2ACX A;  4TNW A;  2CXD A;  1MNE A;  3TLU A;  4MAL A;  2LM9 A;  4PFO A;  1YKH B;  5JDQ A;  1HS7 A;  3RF1 A;  2V1D B;  2BG9 C;  2DL1 A;  3CPZ A;  3PU3 A;  3PUX F;  3UU3 A;  2W0G A;  1G8X A;  4WW0 A;  3JC6 D;  4JBW F;  2I0M A;  2W61 A;  3Q9D A;  4B6X A;  3HA4 A;  4AKG A;  5AQR B;  4PNI A;  4WZX A;  2IUB A;  4QXC B;  1YW0 A;  1N33 T;  4HFE A;  5CFB A;  3PUS A;  5LG3 A;  4UF0 B;  2UXN B;  2JPF A;  2MTQ A;  3CIR A;  4LF4 T;  3L3P A;  1S94 A;  2XSB A;  4ILC A;  5LMU T;  4UF0 A;  5ETW A;  4U33 A;  4ISS A;  2QRX A;  2CLY C;  3ZT5 A;  4ZS2 A;  5F5W A;  4CXY A;  2V7L A;  4A56 A;  3B13 A;  5JDF A;  4PJN A;  4JI3 T;  4DV6 T;  4EV6 A;  1KK7 A;  1W9R A;  2PG8 A;  1WYB A;  4AQF A;  4NXN T;  4HKA A;  5CGM A;  4V1A v;  5FXV A;  5LHG B;  4IIJ E;  2NOX A;  2YU1 A;  3PUR A;  1WR6 A;  4ZZC A;  4EED A;  4HGA A;  5AQI B;  2B76 A;  2I59 A;  3OPC A;  5AQG B;  3SOL A;  3U3I A;  4TNV A;  4UEM A;  4EAH A;  2A72 A;  4TUY E;  3X1D A;  2KWI B;  4WBO A;  4YY3 T;  2CHN A;  3RYC E;  4EYU A;  3NWI A;  3AA7 B;  4JI5 T;  1I94 T;  3AE3 A;  2JQK A;  4GOU A;  4EZ4 A;  4EEB A;  4UV9 B;  4CXW A;  4H9N C;  3BQK A;  4L9I A;  5LCY A;  2JJ9 A;  2Y48 B;  4HWC A;  5LA6 E;  2C5I T;  2VL8 A;  4QX7 B;  5HAX A;  5JDM A;  3RYF E;  4IE5 A;  4ZXL A;  4JI6 T;  4PW8 A;  1T8B A; 
#chains in the Genus database with same CATH homology
 3ZJ1 A;  1FMV A;  4E7Z A;  2VKH A;  2C5K T;  3UT5 E;  5HYA A;  4H9P C;  5JR9 C;  5DAB A;  1T98 A;  2LSG A;  2QA7 A;  1OXZ A;  4XAX B;  2X9H A;  5JDL A;  4IE4 A;  5LHI B;  1AJ3 A;  5L3G B;  2NTY A;  2OA5 A;  3MXZ A;  5J2U E;  3VKH A;  2H7O A;  3TKL B;  2H7V C;  2DWG A;  4WBN E;  5FNV E;  3I9W A;  4FJO A;  4HE8 A;  3MK7 C;  3KBU A;  2RA1 A;  3ANW B;  4IST A;  4ZI2 C;  4M1P A;  4AQF C;  2XAF B;  2MOZ A;  3RYI E;  1HX8 A;  3UUL A;  2L8K A;  4KMC A;  2KT9 A;  1IAP A;  5CA0 E;  2RP4 A;  3NZQ A;  5L3E B;  3ZJ2 A;  2XAQ B;  3AAE B;  2NW7 A;  3DTO A;  4ASK A;  3BQL A;  3CML A;  4FI5 A;  3PU8 A;  3B57 A;  4L0R A;  4AI6 A;  2D0T A;  3C4X A;  4TV9 E;  2LSJ A;  3GN5 A;  2HPL A;  3RRC A;  1MIW A;  1WRD A;  3DJB A;  3UUM A;  3MJX A;  3QC9 A;  4DMV A;  4O4H E;  5FXW A;  5JRE A;  3PUG A;  2JRK A;  1BR0 A;  1FEW A;  2ZLY A;  3E08 A;  5DJQ C;  3ZYM A;  4PW8 A;  4X1I E;  3FBL A;  1X79 A;  4BJM A;  4CZZ B;  2WAU A;  4PJJ A;  3FXE B;  3HKD E;  4TX5 A;  2CE7 A;  2EHO D;  5J1G A;  5LGN B;  4IE0 A;  3ZCI A;  5FP3 A;  5CA1 E;  4BJN A;  2WMO A;  4IDZ A;  2VB6 A;  3CWZ B;  2CA5 A;  3ETV A;  2Q9Q C;  2L9Q A;  3E0Z A;  3I1A A;  3VKG A;  3EDV A;  2X68 A;  3GA8 A;  4OFZ A;  4QXH B;  5L3F B;  4OHF A;  5FY1 A;  3QUJ A;  1BR1 A;  2CCQ A;  2ODU A;  5L2L A;  3W15 B;  3AA6 B;  2D5U A;  2LHR A;  2IW5 B;  3Q5W A;  2ZM8 A;  3N9O A;  3V5S A;  3N2G E;  2KND A;  1MMG A;  4NUU A;  4YJ3 E;  3SRZ A;  2LHN A;  4P0A A;  2PJQ A;  1IJ6 A;  3HKE E;  4QX8 B;  2JQQ A;  4H9O C;  5EK2 A;  2LOS A;  2V7M A;  4GYS A;  4HEA A;  2MBG A;  4UV8 B;  4G63 A;  5JH7 E;  2X66 A;  3PUA A;  2XAG B;  4YLH A;  3ZYL A;  3N9P A;  1IZN B;  4K0U A;  3A5X A;  1HG5 A;  1O3X A;  1VOM A;  5IYZ E;  5L3D B;  3N9M A;  2X0L B;  3UUX B;  1NAF A;  3HKB E;  2E9X A;  3LG7 A;  4I55 E;  4GK5 E;  1LKX A;  2WM9 A;  4ZOL E;  3KVA A;  2E8I A;  1QSD A;  3P7I A;  4WNK A;  3ZN1 B;  5LBQ B;  2K5B B;  1WYC A;  4O4L E;  4ZI3 C;  5TAO A;  4JEU B;  3FB2 A;  1HG2 A;  3C50 A;  1HTJ F;  2SPC A;  2Y6X A;  3ETU A;  2D0U A;  2CXF A;  5FXZ A;  3VU7 H;  3CX7 B;  5KMG P;  4H63 V;  4KUM B;  1NWM X;  3U78 A;  5LOV E;  5FMN A;  3AAA B;  2P9B A;  5JQG E;  1SA0 E;  4I4T E;  3RPU A;  3N2O A;  3KIN B;  1G73 A;  3WI3 A;  3H3A A;  3C4W A;  2ZM0 A;  1MMD A;  2X51 A;  2CMR A;  3UUN A;  4CXX A;  4IHJ E;  4O4I E;  4QWN B;  2EHO B;  2K9A A;  4ZI2 D;  1MND A;  3OKQ A;  4UIG A;  2N2N A;  4NUV A;  3E22 E;  5DQW A;  1H7C A;  3ZPO A;  3N9L A;  4QXB B;  3C98 B;  3KBT A;  5CB4 E;  2MYS A;  3K3Q C;  4EZH A;  3EDU A;  1YKE B;  4TN7 B;  5EZY E;  2N1G A;  3IBP A;  4ERR A;  4ILU A;  2LEH A;  2XAS B;  2W00 A;  2X9Y A;  1HCI A;  3NRX A;  4P0B A;  3PUQ A;  3ZC1 A;  3ZN0 B;  4E7S A;  2N9D A;  2LSI A;  1UX4 A;  2DI4 A;  1OWA A;  3IHR A;  4O2A E;  4X1K E;  3RC3 A;  3JC6 C;  3DP7 A;  2Z6E A;  5FY7 A;  4YFS A;  3F31 A;  4OYK A;  4JEH B;  3NZP A;  3L09 A;  3AVS A;  3LBX B;  4CI3 B;  2XHE B;  4ZHQ E;  3Q5X A;  3KVB A;  2KWH A;  3CQC B;  3NRY A;  4AKL A;  3AA0 B;  2IAK A;  3R84 B;  4EOZ B;  4EB6 E;  2Q9Q D;  3ANW A;  2X9X A;  3K3N A;  5M4Y A;  3VHL A;  2VKJ A;  4UVB B;  4MBQ A;  2BVL A;  4TV8 E;  4DBR A;  5GON E;  3MKD A;  5HXC A;  3GWH A;  4EXT A;  5JDN A;  2C0S A;  3LK4 2;  2YK0 A;  2ZM2 A;  5H6R B;  3KV5 A;  2NW9 A;  4O2B E;  4PK4 A;  4GYR A;  3I9Y A;  5JR9 B;  4GIW A;  4O8S A;  3ONX A;  3M65 A;  4PK6 A;  1LRZ A;  2KMF A;  5FYM A;  4DVD A;  1QUU A;  2LOP A;  1VRB A;  2E9X C;  2A3D A;  4PAG A;  4C91 A;  1LVF A;  4AKI A;  3Q2M A;  2V7K A;  3EVY A;  3RX6 A;  4AXP A;  2J1D G;  1IJ5 A;  3OJA A;  1EZ3 A;  2VKD A;  4J2C A;  5EK3 A;  4KBM B;  3FXD B;  2V26 A;  3J7Y q;  3OBV E;  3SWH A;  2LSK A;  3WAK A;  4MFR A;  2V7I A;  2KZ7 B;  2HPJ A;  2CEA A;  3CVR A;  2VAS A;  5HWY A;  3N5L A;  4HTE A;  1D0X A;  5L3C B;  2JMK A;  3O1I A;  3LJC A;  3CX8 B;  5JRC B;  2CLY B;  4HFV A;  3HKC E;  5E0O A;  1ZKE A;  3UTK A;  2CXL A;  4H9S E;  3N2K E;  4U74 A;  3T8O A;  3S4U A;  4C90 A;  3ZYK A;  4ZI7 E;  3O1H A;  4EYY R;  2G0U A;  4ZS3 A;  1D1C A;  3WAJ A;  2NW8 A;  1LVK A;  2ACX A;  2ES0 A;  1ZV4 X;  1MIY A;  2CXD A;  3C4Z A;  4PJM A;  3I0Q A;  1MNE A;  2Y8D A;  2BZB A;  4MAL A;  1CUN A;  2QGS A;  4H9Q C;  2LM9 A;  3QK6 A;  2HH7 A;  1YKH B;  4KP3 C;  4PFO A;  4TZ4 C;  4MLK A;  2BVM A;  5JDQ A;  5LNK A;  4YJ2 E;  2D2S A;  3ESL A;  4XZC A;  3MA9 A;  1FIO A;  1HS7 A;  2V1D B;  3N9Q A;  4UXN B;  2Q9Q B;  5LXT E;  1B7T A;  2KLQ A;  2DCF A;  4H63 H;  4BAY B;  2WSS V;  3AAI A;  3CPZ A;  3PU3 A;  5A1L A;  2NWB A;  5LBM A;  2DNX A;  4X1Y E;  1MMN A;  1ZEE A;  2W0G A;  2GK9 A;  2IC9 A;  3H37 A;  5LP6 E;  4QKN A;  1BR4 A;  1G8X A;  5L3B B;  3RYH E;  2KIN B;  2CM0 A;  4WW0 A;  3JC6 D;  2W62 A;  1UX5 A;  2A2F X;  5ADX L;  3NBX X;  4DO0 A;  3I0O A;  2W61 A;  3PE0 A;  3Q9D A;  2ZMA A;  4B6X A;  3HA4 A;  1Y64 B;  3UFE A;  5LJN A;  5AFU L;  4JLE A;  5HXH A;  4I43 B;  5F3J A;  1MMA A;  5JDH A;  4P09 A;  2YU2 A;  4AKG A;  4CI2 B;  3D0T A;  4PNI A;  5IHY A;  2BDE A;  1FMW A;  2EHO A;  3IF8 B;  4X20 E;  2ODV A;  2VK9 A;  2XTL A;  4GK0 E;  5FXX A;  5HXE A;  4EIW A;  4Z8X A;  4ANJ A;  4QXC B;  1E1H B;  2DLR A;  5KDM C;  1YW0 A;  5JDG A;  4QHO A;  2WWU A;  3LK2 B;  3CQG B;  3RRW A;  3PUS A;  1S35 A;  4DBQ A;  3F57 A;  3ZMZ B;  4JUY A;  4N78 D;  3LFM A;  4F6R C;  2H3R A;  1YD8 G;  3AA1 B;  1MIV A;  3PTR B;  3ZEF B;  4UVA B;  2XAH B;  3HR0 A;  4UF0 B;  3OYX A;  2UXN B;  2E9X D;  4PJL A;  2VKO A;  2NTX A;  4IE6 A;  3ZMU B;  2JPF A;  1HF8 A;  2K24 A;  3O1J A;  3OYZ A;  3LK3 B;  2UXX B;  3RC8 A;  4CI1 B;  2MTQ A;  4AKH A;  2YIN A;  4H9R C;  3L3P A;  4HN9 A;  3LBX A;  1S94 A;  4L5G A;  5C8Y E;  3AB3 B;  2NP9 A;  3ZCJ A;  2XQY A;  4UF0 A;  1KNZ A;  2X67 A;  3GN5 B;  2VWA A;  1D0Z A;  5ETW A;  3RH3 A;  2B1E A;  3P8C D;  4YHJ A;  5HWX A;  5J2T E;  4ISS A;  3V5U A;  5LG4 A;  1SHZ C;  2LT3 A;  2CLY C;  4ZS2 A;  4PK5 A;  3EUH A;  3CKD A;  3K3O A;  2W63 A;  3ZMS B;  2WBL A;  5JR9 A;  4CXY A;  2V7L A;  4A56 A;  3ZLI A;  3B13 A;  3FBZ A;  2K48 A;  3O4X E;  3RKO A;  5JDF A;  4PJN A;  5DQV A;  1U4Q A;  5F8P A;  2DWK A;  5BMV E;  1D1B A;  3CX6 B;  2CWY A;  1KK7 A;  4DMW A;  1U5P A;  2PG8 A;  1WYB A;  1UCU A;  4IGU A;  2LJL A;  4ZI3 D;  2DHR A;  3FHN A;  3BQI A;  4AQF A;  2CWO A;  5KX5 E;  2XUE A;  3F2E A;  4UVC B;  4HKA A;  4IE7 A;  2LSY A;  4I50 E;  4V1A v;  3MZK B;  5FXV A;  4CQI A;  4DND A;  5LHG B;  2XAJ B;  3PDY A;  3R6N A;  4IIJ E;  2NOX A;  2YU1 A;  3PUR A;  5JRC A;  1US7 B;  5LGU B;  5LHH B;  2C5J A;  4UEL A;  1WR6 A;  1WLX A;  5HXR A;  4HGA A;  4AQG A;  1D0Y A;  3ZMV B;  3N9N A;  2M67 A;  2YEV C;  5LYJ E;  2I59 A;  4OYJ A;  4PFP A;  2EHO C;  3HI2 A;  2E9X B;  3BK9 A;  3SS1 A;  3SOL A;  3U3I A;  3AVR A;  2KXP B;  5H6Q B;  1BR2 A;  4UEM A;  4EAH A;  3C51 A;  2A72 A;  4OK0 A;  4TUY E;  3O9X A;  2KWI B;  4WBO A;  1ZHC A;  3GMI A;  3ZMT B;  2PBI A;  1D1A A;  5LGT B;  4ADZ A;  3RYC E;  2X9W A;  1V9D A;  2Q9Q A;  4EYU A;  3KV6 A;  5EK4 A;  3AA7 B;  3C64 A;  3HL6 A;  3K8P C;  3MAC A;  4GOU A;  5JVD E;  1HFA A;  4AKR B;  4EZ4 A;  4UV9 B;  4CXW A;  2L3L A;  2IC6 A;  4H9N C;  3IEE A;  5FY0 A;  3KV9 A;  4BA9 A;  4U72 A;  3BQK A;  4L9I A;  5LCY A;  4MHC A;  2PFV A;  2JJ9 A;  2Y48 B;  5LA6 E;  2C5I T;  2VL8 A;  4XBF B;  3J9X 1;  5HXS A;  4QX7 B;  3KFW X;  5HAX A;  3KDS E;  2JMH A;  2WMN A;  5JDM A;  4G2A A;  1Z0P A;  2LE8 A;  3RYF E;  4IE5 A;  3CQX C;  4O4J E;  5LJM A;  2V7J A;  3KV4 A;  3ZC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...