1FEWA

Crystal structure of smac/diablo
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
173
structure length
173
Chain Sequence
SLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGKMNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQVEEVHQLSRKAETKLAEAQIEELKQKTQEEGEERAESEQEAYLRED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords SECOND MITOCHONDRIA-DERIVED ACTIVATOR OF CASPASES
publication title Structural and biochemical basis of apoptotic activation by Smac/DIABLO.
pubmed doi rcsb
source organism Homo sapiens
total genus 90
structure length 173
sequence length 173
ec nomenclature
pdb deposition date 2000-07-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1fewA00
3C98B 1FEWA 1S94A 2DNXA 4JEUB 4TX5A 1EZ3A 1BR0A 5M4YA 4JEHB 5LG4A 1G73A 2XHEB 3LG7A 1HS7A 1FIOA
chains in the Genus database with same CATH superfamily
2XQ7A 1FJGT 2PJQA 2XAQB 1O3XA 1R8IA 3L3PA 4Z91A 2RP4A 2K3WA 5E0OA 1HF8A 4TNWA 2JIWA 2BG9A 3QOFA 2ES0A 2X9HA 3W15B 4O4IE 4LF5T 3C64A 1VCTA 2CA5A 5LMNT 3I9YA 4WW0A 5LP6E 4L9IA 5JRCA 1Z0PA 4LFAT 1D0XA 2C5KT 2WS3A 1WR6A 2GK9A 2WZHA 4GK5E 1ZEEA 4HFHA 5FXZA 1N33T 3PURA 2VASA 1WCRA 4MLKA 4U72A 3R6NA 4WYVA 2W0GA 4TX5A 3IF8B 2KZ7B 5LG3A 4MALA 4YY3T 3P4WA 3RC3A 4JI0T 2ACXA 4IE0A 2BS2A 2DWKA 2DLRA 4QKNA 3QB5A 4MBQA 3HKDE 3NZQA 3IEEA 2H3RA 2YDRA 3CK6A 3ZJ1A 3A5XA 4BJMA 4OX9T 2BG9E 4F8HA 4JI1T 2X9YA 1MMAA 2JQQA 1HX8A 3UUXB 4YJ2E 2V5DA 4UR9A 2W63A 4H63H 1WYCA 5AQLB 3AE6A 4P09A 3ZMSB 2ZM6T 3RGLA 1L0VA 4PJMA 2LJLA 4V1Av 2DI4A 3AA7B 4ZZBA 2QYWA 4UELA 4YTPA 4CN4A 2ZMAA 3ZC0A 5JH7E 2A2FX 2JJ9A 2IC6A 4ASKA 2XAJB 4TUYE 2L9QA 4Q25A 4ZI3C 4ILCA 4TWDA 4QXCB 2VWAA 4JI5T 2V6XA 3N2KE 3ZT5A 2KINB 2E8IA 4ZI3D 3M65A 3PDYA 4U74A 1BR1A 2CXLA 4ISSA 3RHWA 5IWAT 2X67A 5L4EA 5FXVA 5IYZE 4JYAT 2ZM8A 1D1CA 1YD8G 2XASB 2SPCA 2CLYB 3UT5E 2WDVA 1UX5A 2CWOA 3UUNA 4X1KE 1H7CA 3SFDA 4CXWA 2X51A 4AISA 4EEDA 5JDHA 2VURA 2W67A 3PUAA 1WFDA 4GIWA 4KBMB 3KBUA 2RA1A 4I50E 2WCAA 2LM2A 4TWFA 4DMVA 5L2LA 4JLEA 1YXRA 5ABGA 5AQSB 2XQAA 2V1DB 2WU5A 2HHHT 5L3FB 3CIRA 5AQRB 5HXHA 4LMKA 1ZKEA 1I94T 5CA1E 2Z6EA 4U7YA 3J9X1 2V5CA 2J47A 5AQHB 3CQXC 3QUJA 2JQHA 3DJBA 4ZXLA 3KV4A 1VRBA 3I0QA 2E9XB 4LMJA 3RRWA 3ZMZB 2Q9QB 4AKLA 3HL6A 2YKSA 3O1IA 2LT3A 3AEBA 3SFEA 5HEGA 2E5LT 1OEDC 4TV8E 4HFCA 1JNRA 4CI3B 1E1HB 2VL0A 2YN6A 2YU1A 3FHNA 1W9RA 2I6HA 3P4SA 4TNVA 2NOXA 2VVSA 5J1GA 3OKQA 4QH5A 3SOLA 3WAJA 1MIVA 3LBXB 5BR8T 4N78D 4UIGA 2UUAT 3CQCB 4YXDA 4DR7T 4KP3C 1D0ZA 3CKDA 2XAHB 4AXPA 5IHYA 2EHOC 2FBWA 4HFIA 4DV2T 3CMLA 2A72A 4PAGA 1MMNA 4HEAA 2E9XA 4IE4A 3RYCE 4PJLA 2Q9QA 1XWMA 4ZS3A 1DU2A 1EZ3A 2LSKA 3N9NA 5FVLA 4UF0B 3RQWA 2J4GA 4WZXA 5ETWA 3FXEB 4AI6A 3AECA 2VL8A 4IGUA 5LGNB 2IMLA 1MMDA 4ZOLE 2WZIA 3I9WA 3ZT7A 2VQFT 3TLUA 4BJNA 4L0RA 3KFWX 3AA1B 3LBXA 4IHJE 3UU5A 3VRBA 5FL0A 4A56A 3ETVA 5HEUA 2UXXB 5JR9C 3PTRB 5LBQB 3ONJA 3C4WA 1IJ5A 3PE0A 3VU7H 3IBPA 3KVBA 2ACZA 2CHOA 4HWHA 5ADXL 2LOSA 3U78A 1SA0E 1LVFA 2H88A 3SS1A 3K3QC 2DWGA 2BBJA 4EV6A 4CN6A 1YW0A 2YU2A 4YTMA 1GQEA 5L3GB 4EGWA 1HR0T 1HX1B 2PG8A 3PU3A 4UF0A 4B3MT 3GWHA 4DUYT 3EABA 2V7LA 2JQ9A 3TLTA 2AE9A 3A7MA 5EZYE 5JQGE 1X79A 3RLFF 2X0LB 4KUMB 4YFSA 1US7B 5LNKA 3NRXA 5KXJA 2M6IA 5LGUB 5LCYA 4PFOA 4OHFA 4H9OC 4PK6A 4A98A 4M1PA 4CXXA 2J62A 4IDQA 5CGMA 2FJAA 2MBGA 5AQJB 4U2YA 4QX7B 2HPJA 2MPKA 5JVDE 1IAPA 4ZI7E 2K5BB 3RF1A 3LK3B 3CPZA 3RKGA 4EZHA 3ZJ2A 4WBNE 3UU3A 4GKJT 1HTJF 3N9QA 1XZYA 5TAOA 4JI4T 3RI5A 5JREA 1IJ6A 3ETUA 5HEJA 2XJ7A 4EZ4A 3OVUA 2LRLA 2M6BA 5GONE 3H3AA 2X0YA 1UK5A 3FZLB 5HXRA 4UEMA 2J1DG 4I55E 2LM9A 2VKOA 1J1JA 1CHUA 5AQMB 5AQIB 4PJNA 3RYHE 3MACA 1MMGA 2CXDA 1WR0A 4QWNB 5HEHA 5JDLA 2ZLYA 5LOVE 3AVSA 2W4XA 2LEHA 4EB6E 4CI1B 4ILBA 4ZEYA 4JV5T 3AE1A 1UUSA 3ZPOA 2IC9A 4LFBT 4HWIB 2NR4A 2A9UA 4AKHA 4NUUA 4YHHT 4HGAA 3LDQB 1D0YA 1OEDB 4CXYA 1J5ET 3BK9A 1NEKA 3AB3B 2XM2A 2M67A 4HFDA 2LHNA 4LF6T 4HFEA 5DQVA 4DR2T 2L3LA 4AIUA 3PUSA 4U31A 2BS3A 1S35A 3N9OA 2W62A 2EHOB 4ZS2A 4ZHQE 3HKEE 2KLQA 2BKPA 4JI2T 2XAGB 2LSJA 3MA9A 1SUMB 2DHRA 4PNIA 1SHZC 5AFUL 4DR3T 3PUXF 1XNQT 4CN1A 1OEDA 4ADZA 2V7JA 3JAFA 3P8CD 4HN9A 2VQET 5DQWA 2VKHA 3JAEA 4LF4T 5FXXA 2L8KA 3AE5A 2XPKA 4KHPT 5FYMA 3QNUA 3ZMVB 4HWCA 3ZN0B 5FY1A 3E08A 3C51A 5CB4E 5ABHA 5FL1A 5HYAA 2C0SA 1J5WA 2BZBA 1KNZA 5JR9B 2EHOA 1HNWT 3ZMTB 3C4XA 5L3BB 4CI2B 3L39A 3KINB 4GYSA 4PK5A 2FJDA 2WY2A 5FY7A 1D1BA 1U5PA 2BVLA 4B3ST 4DNDA 3TLSA 2NW9A 2K9AA 4IE6A 3TLWA 3C98B 3QB5K 2LE8A 4A5XA 2ZM0A 2JQKA 1WLXA 5AQGB 2YDQA 4JI8T 3EI0A 3MK7C 3DP7A 2NTXA 1OEDE 2YK0A 2CPTA 3KV5A 2V8SV 4YLHA 4B3RT 3EAMA 5JDGA 4ILUA 2I0MA 2IUBA 4DBQA 2KMFA 2XQ4A 2B76A 2BKOA 1D1AA 3NVOA 3K8PC 3ZSTA 1XDOA 2K48A 3JADA 2LSYA 5JR9A 3UULA 4KI0F 1Y01A 3EHZA 5JDMA 2JMKA 3P4QA 3L8RA 5A1LA 2QGSA 3TKLB 1KK7A 4TN7B 1HG2A 3UFEA 2WSSV 2XM1A 2KNDA 2IHR1 4AKIA 3LG7A 1W0AA 4DR4T 2NP9A 2Y48B 3EDUA 4DR6T 3KV9A 5AQPB 4E7SA 2HN1A 1YKEB 3AE2A 1XMOT 4XAXB 4AKGA 1X9BA 4AQFC 2YOEA 3Q5XA 4AQYT 2MYSA 4O4LE 2JPFA 3OBVE 4BAYB 3U3IA 4UXNB 4XZCA 2KXPB 1YQ3A 4NPPA 4HKAA 2WP9A 5EK3A 3C4ZA 2CBJA 4WBOA 3I0OA 4TV9E 3AA0B 4UV8B 1G8XA 4QHOA 2KWIB 3HA4A 3P4RA 4KX6A 2JRKA 5HCJA 4LF8T 4KHZF 3RIAA 3M3ZB 3OYZA 4NUVA 4U7IA 1HNXT 1ZHCA 2HPLA 3CX8B 2XSAA 2ZM2A 5AQVB 4YT0A 5HEOA 2W61A 3RH3A 2ODVA 2MOZA 1UX4A 5HWXA 5HXEA 4ERRA 4IT4A 3ZCIA 2BDEA 4B6XA 2C5IT 5LYJE 2XUEA 3PUVF 3DTOA 3MKDA 4YSZA 1IZNB 1KF6A 4X62T 5M4YA 2CWYA 3ZLIA 5JTGA 5J2TE 4DIDB 4JEUB 4LF7T 3K3OA 2XQ5A 4IE5A 3AEEA 3OTOT 3AEDA 3VHLA 3F31A 5KMGP 4DV4T 5LXTE 1NAFA 4CZZB 4H9RC 5F8PA 3EVYA 1OXZA 3ZC1A 2XQ8A 3H37A 3GN5B 2BS4A 1VCSA 3PU8A 1ZOYA 5C2TA 4OK0A 4UVCB 2W2UA 1BR0A 1FMVA 3S4UA 4IDPA 1S94A 5FMNA 2B1EA 3Q5DA 5J2UE 4X5TA 3ZCJA 4O2AE 1KEYA 3AAEB 4IDZA 4EOZB 2H7OA 4HE8A 4DR1T 1FEWA 3RIFA 2XQ3A 2UXBT 3SRZA 3UUBA 2XY8B 2XZEA 3FZMB 3FB2A 3AEFA 3L09A 1QSDA 4YTNA 2WU2A 4UVBB 3RIUC 3JCFA 3ZKRA 3FZFB 2D0TA 3GN5A 3GMIA 2DCFA 2NW7A 4MFRA 5AQTB 4P0BA 4LF9T 4X1IE 1LKXA 4DV6T 5F5WA 4ILAA 4BA9A 5ABEA 2WDRA 4YHJA 3ZYMA 1G73A 2NWBA 5L4HA 3RX6A 2X9XA 3V5SA 1OWAA 1SE7A 5CA0E 2ODUA 4G63A 1M7KA 1LVKA 3HR0A 5LGTB 4JUYA 4COFA 2HH7A 1HFAA 3BQLA 4PJJA 5LBMA 2LLYA 4I4TE 5EK4A 3FXDB 5LMUT 2DNXA 2CMRA 3T1YT 3NRYA 3EUHA 5J0ZA 2YINA 3RQUA 3MJXA 5LHHB 2G0UA 3KBTA 4XBFB 3IA3A 4NXNT 5DJQC 2OV9A 4GOUA 3RKOA 4X64T 2VVNA 2WB5A 2WWVA 2IAKA 3HI2A 3VR8A 2X66A 2C5JA 3MZKB 5JDQA 4QH4A 2CHNA 3UUMA 3QC9A 5F3JA 3Q9DA 3AE8A 2FJEA 4MHCA 2R6GF 3T1HT 4JEHB 1Z8UA 3UU8A 2RPAA 1N36T 2XHEB 3OPCA 2FUPA 2V6YB 4EEBA 4U33A 3HKBE 5AQFB 1W09A 5HWYA 4EIWA 3KV6A 1WYBA 2XSBA 3PUWF 4IE7A 3AE9A 5HXSA 5FNVE 5L3DB 3O1HA 4G2AA 4I0UA 4B3TT 5CFBA 2QVAA 4LFCT 2UXDT 4OFZA 3AAAB 1HCIA 2N1GA 4J2CA 1BR2A 2CRBA 2QA7A 4IDNA 2I59A 4YSXA 3O9XA 3G06A 4L5GA 3H3MA 3AA6B 4ANJA 2IW5B 3PUYF 4AQFA 3QK6A 3NWIA 3N2OA 4DVDA 4EYUA 1LRZA 4YSYA 2BVMA 2V6YA 4IREA 3N9MA 2VKDA 3F57A 3P4PA 5IUXA 2AXDS 2X68A 3E0ZA 2XAFB 5C8YE 3VKHA 4HTEA 5AQNB 5LHGB 2PBIA 3V5UA 2MTQA 2WDQA 2YEVC 2XTLA 1IBKT 3AE7A 3RYFE 5DABA 3ABVA 3PV0F 2N9DA 4P1NA 2LOPA 3UQ7A 1T7SA 1T72A 1MIWA 3E22E 4O4HE 1MIYA 4DV0T 3K3NA 3N9PA 4DMWA 5AQKB 3AEAA 5EK2A 2BKNA 2UU9T 1HS7A 3CX7B 1YKHB 3AE3A 2A3DA 4I43B 2PTFA 4HWFA 5LG4A 2H7VC 4HFVA 3ZT6A 1QUUA 2WMNA 1Y64B 4ZZCA 2VB6A 3RRCA 4ZI2C 3ZEFB 1ZP0A 3VR9A 2CCQA 2UUCT 1KNRA 1NWMX 5AQOB 2BG9C 4ZI2D 4ISTA 3PJAA 5LJMA 3OJAA 3LK2B 2CEAA 2X9WA 4JI6T 1MNDA 3PUGA 1QLBA 1UURA 3AXJB 2FJBA 2V26A 4A97A 4DV3T 2D5UA 5L3EB 3UQ4A 4IL9A 5KDMC 4NXMT 3FZHB 5LA6E 5FKYA 1JNZA 3ONLC 4H63V 4KMCA 1I6ZA 4CQIA 1ZV4X 4U2ZA 2QRXA 3B5MA 5AQUB 3NZPA 2UUBT 2NW8A 5KX5E 3GA8A 4FI5A 4HWDA 3NBXX 4HFBA 4NIQA 4LMLA 2XQYA 4PFPA 3WI3A 2BBHA 4UVAB 3B13A 4AQGA 3UFGA 2IDOB 4GK0E 5L47A 3VKGA 1IBLT 4U3CA 3ESLA 3UTKA 2WMOA 5L3CB 3AEGA 3R84B 3O4XE 3T8OA 2CE7A 4X66T 4IL4A 3B57A 4UV9B 4EXTA 3AXJA 3HKCE 2LSGA 3RIUA 1E7PA 5HAXA 1T8BA 3Q2MA 1V9DA 3CVRA 5LHIB 1XNRT 3RC8A 2NTYA 2IIUA 4O2BE 2D0UA 2D2SA 2LRKA 4TZ4C 3AVRA 3PUQA 3P50A 2WQYA 2V7IA 5C3JA 2KT9A 4YJ3E 4PW8A 2OLTA 2H89A 1MNEA 3BQKA 4FJOA 1WRDA 1HNZT 3FBLA 4E7ZA 3N9LA 2E2AA 2LKHA 2MAWA 2EHOD 4TWHA 1B7TA 2CM0A 3JC6C 4DR5T 3ONXA 4X20E 1HG5A 3JC6D 4QXBB 3N5LA 4DBRA 4P0AA 2VKJA 4Z90A 3LSVA 4DV5T 4EAHA 4WNKA 3P7IA 1N32T 3ZYLA 2HN2A 3AAIA 3LJCA 3IHRA 5JDFA 3ZYKA 2WAUA 4H9QC 3SWHA 3ZSSA 4OYJA 3EDVA 1AJ3A 3N2GE 2Y8DA 1CUNA 5JDNA 2KSRA 2WM9A 3MXZA 4X1YE 3O1JA 4IDOA 3TLVA 4O4JE 3UU4A 3WAKA 4X65T 4DUZT 1XDPA 3ZN1B 4GKKT 4DV7T 3AE4A 4GYRA 2XQ9A 3ZMUB 2VK9A 5BMVE 1W0BA 2K24A 2CXFA 4PK4A 3Q5WA 2XQ6A 4H9PC 3D0TA 3CQGB 4JBWF 2P9BA 3PJAJ 2W00A 1UCUA 2CLYC 2PFVA 1YQ4A 2UXNB 1KFYA 1XMQT 1M62A 4DO0A 3J7Yq 3ANWB 5LJNA 4C90A 2E5VA 3NKZA 2Y6XA 3RPUA 2F4VT 2LHRA 4Z8XA 2X0HA 2W66A 3CX6B 3OYXA 5FY0A 3BQIA 1FIOA 5FVKA 4C91A 5ABFB 4K0KT 1NENA 1UGOA 3FBZA 2YDSA 3C50A 1VOMA 3RYIE 5H6QB 3Q5EA 3PUZF 2WWUA 4QXHB 3A8YC 1KNPA 3UU6A 3KVAA 1BR4A 2DL1A 3CWZB 4QH1A 2JMHA 2V7MA 4QX8B 3F2EA 4JI3T 5CJ5A 4K0UA 3K1SA 5LB7B 5FXWA 1E2AA 3ANWA 2BG9B 3LK42 4H9NC 2LSIA 2E9XC 4EYYR 1IBMT 3FZKB 1N34T 2CBIA 4JI7T 2Q9QC 5FP3A 5H6RB 4F6RC 2E9XD 4H9SE 2LKGA 1FMWA 2UXCT 5HXCA 2Q9QD 3LFMA 1T98A 3VRAA 5JRCB 2D9DA 2N2NA 5ABFA 2OA5A 2WBLA 4OYKA 5HCMA 3KDSE 4DV1T 4IIJE 3X1DA 5AQQB 4AKRB 4O8SA 2V7KA 1U4QA 2KWHA 3I1AA
chains in the Genus database with same CATH topology
4BAYB 3U3IA 2PG8A 3PU3A 4UF0A 4UXNB 2LOPA 3GWHA 4XZCA 2KXPB 2PJQA 2V7LA 4HKAA 1MIWA 2XAQB 3E22E 4O4HE 1MIYA 1O3XA 5EK3A 3C4ZA 5EZYE 3K3NA 5JQGE 3N9PA 3L3PA 4DMWA 1X79A 2RP4A 4WBOA 2X0LB 3I0OA 4TV9E 5E0OA 1HF8A 3AA0B 4KUMB 5EK2A 4UV8B 1G8XA 4YFSA 1US7B 2ES0A 2KWIB 3HA4A 4QHOA 5LNKA 3NRXA 2X9HA 1HS7A 3CX7B 1YKHB 5LGUB 3W15B 4O4IE 5LCYA 2JRKA 4PFOA 4OHFA 3C64A 4H9OC 2A3DA 4PK6A 2CA5A 3OYZA 4NUVA 3I9YA 4WW0A 5LP6E 4L9IA 1ZHCA 2HPLA 4M1PA 4I43B 4CXXA 3CX8B 5LG4A 5JRCA 1Z0PA 2ZM2A 2MBGA 1D0XA 2H7VC 4HFVA 2C5KT 1QUUA 1WR6A 2WMNA 2GK9A 1Y64B 4GK5E 1ZEEA 2VB6A 3RRCA 4ZI2C 2W61A 4QX7B 3ZEFB 5FXZA 2HPJA 2CCQA 3RH3A 3PURA 2ODVA 1NWMX 2MOZA 5JVDE 2VASA 1IAPA 4MLKA 4ZI2D 1UX4A 4U72A 5HWXA 4ZI7E 2K5BB 3R6NA 4ISTA 5HXEA 5LJMA 4ERRA 3LK3B 2W0GA 4TX5A 3IF8B 3OJAA 2KZ7B 3ZCIA 3LK2B 2BDEA 3CPZA 4B6XA 4EZHA 4MALA 2CEAA 3ZJ2A 4O4LE 2C5IT 3RC3A 2X9WA 2ACXA 4WBNE 4IE0A 1MNDA 5LYJE 3PUGA 2DWKA 2DLRA 2XUEA 3DTOA 3MKDA 4QKNA 2V26A 1HTJF 4MBQA 1IZNB 3HKDE 3N9QA 3NZQA 2D5UA 3IEEA 5TAOA 2H3RA 5M4YA 3ZJ1A 2CWYA 5L3EB 3A5XA 3ZLIA 4BJMA 5KDMC 5J2TE 2X9YA 5JREA 1MMAA 4JEUB 1IJ6A 3ETUA 3K3OA 2JQQA 4IE5A 5LA6E 1HX8A 3UUXB 4H63V 4YJ2E 4KMCA 3VHLA 4CQIA 1ZV4X 3F31A 4EZ4A 3RC8A 5KMGP 2W63A 3NZPA 2NW8A 5LXTE 1NAFA 4CZZB 4H63H 5KX5E 4H9RC 3GA8A 1WYCA 5F8PA 4FI5A 3EVYA 1OXZA 3ZC1A 4P09A 5GONE 3H3AA 3NBXX 3ZMSB 3H37A 2XQYA 5HXRA 4PFPA 3WI3A 4PJMA 4UVAB 4UEMA 2J1DG 2LJLA 4I55E 3B13A 4V1Av 2DI4A 2LM9A 4AQGA 2VKOA 3GN5B 3AA7B 4GK0E 3VKGA 4UELA 3PU8A 2ZMAA 3ZC0A 5JH7E 3ESLA 3UTKA 2WMOA 5L3CB 2A2FX 2JJ9A 4PJNA 4OK0A 3RYHE 2IC6A 3MACA 1MMGA 2CXDA 4UVCB 4ASKA 3R84B 3O4XE 4QWNB 2CE7A 3T8OA 1BR0A 2XAJB 1FMVA 5JDLA 2ZLYA 3S4UA 5LOVE 4TUYE 3B57A 2L9QA 3AVSA 1S94A 4UV9B 4EXTA 5FMNA 3HKCE 4ZI3C 2LSGA 4QXCB 2B1EA 2VWAA 5HAXA 5J2UE 2LEHA 3Q2MA 1V9DA 3ZCJA 3CVRA 4EB6E 3N2KE 4CI1B 2KINB 2E8IA 2NTYA 4O2BE 3M65A 4O2AE 3PDYA 4ZI3D 2D0UA 4U74A 1BR1A 3ZPOA 2D2SA 2CXLA 2IC9A 4TZ4C 4ISSA 3AVRA 3AAEB 4IDZA 4EOZB 2H7OA 3PUQA 4AKHA 2X67A 4NUUA 4HGAA 4HE8A 1FEWA 2V7IA 5FXVA 5IYZE 2ZM8A 3SRZA 1D1CA 1D0YA 1YD8G 2XASB 2KT9A 4YJ3E 4PW8A 4CXYA 2SPCA 2CLYB 3BK9A 3UT5E 1MNEA 3FB2A 3BQKA 1UX5A 4FJOA 3L09A 2CWOA 3AB3B 1QSDA 2M67A 2LHNA 5DQVA 4UVBB 1WRDA 3UUNA 3FBLA 4X1KE 1H7CA 4E7ZA 4CXWA 3N9LA 2X51A 2L3LA 2D0TA 3GN5A 2EHOD 5JDHA 1B7TA 2CM0A 3GMIA 2DCFA 2NW7A 3PUSA 4MFRA 3JC6C 4P0BA 3ONXA 1S35A 4X1IE 3N9OA 3PUAA 1LKXA 4X20E 4GIWA 1HG5A 3JC6D 2W62A 4KBMB 4QXBB 3KBUA 2RA1A 4I50E 3N5LA 4BA9A 4DBRA 4P0AA 2VKJA 4YHJA 2EHOB 3ZYMA 4ZS2A 4ZHQE 1G73A 2NWBA 3HKEE 4EAHA 4DMVA 4WNKA 3P7IA 3RX6A 2X9XA 3V5SA 2KLQA 2XAGB 3ZYLA 5L2LA 1OWAA 4JLEA 3AAIA 3LJCA 5CA0E 2LSJA 3IHRA 3MA9A 2ODUA 5JDFA 2DHRA 3ZYKA 2V1DB 2WAUA 4G63A 1LVKA 4H9QC 3SWHA 3HR0A 4PNIA 4OYJA 3EDVA 1SHZC 5AFUL 1AJ3A 3N2GE 5LGTB 5L3FB 2Y8DA 4JUYA 2HH7A 1CUNA 1HFAA 3BQLA 4PJJA 5JDNA 5LBMA 2WM9A 3MXZA 4X1YE 4I4TE 5EK4A 5HXHA 3FXDB 3O1JA 4ADZA 2DNXA 2V7JA 2CMRA 1ZKEA 4O4JE 3P8CD 5CA1E 2Z6EA 3J9X1 4HN9A 3WAKA 3NRYA 3EUHA 5DQWA 3ZN1B 2VKHA 3CQXC 3QUJA 2YINA 3DJBA 5FXXA 2L8KA 3MJXA 4GYRA 3ZMUB 2VK9A 3KV4A 5FYMA 5LHHB 1VRBA 2G0UA 5BMVE 3KBTA 3I0QA 4XBFB 2E9XB 3ZMVB 3ZN0B 5FY1A 3RRWA 2K24A 3ZMZB 2Q9QB 2CXFA 4PK4A 5DJQC 4AKLA 3E08A 3HL6A 3Q5WA 3C51A 3O1IA 4GOUA 5CB4E 4H9PC 2LT3A 3RKOA 5HYAA 2C0SA 3D0TA 3CQGB 2BZBA 2P9BA 2W00A 1KNZA 1UCUA 5JR9B 4TV8E 2EHOA 3ZMTB 4CI3B 2IAKA 2CLYC 3HI2A 3C4XA 5L3BB 4CI2B 2PFVA 2X66A 1E1HB 2C5JA 2YU1A 3KINB 3MZKB 2UXNB 3FHNA 4GYSA 4PK5A 5JDQA 5FY7A 4DO0A 3J7Yq 1D1BA 2NOXA 1U5PA 2BVLA 3ANWB 3UUMA 5LJNA 4DNDA 3QC9A 4C90A 2NW9A 2K9AA 5J1GA 5F3JA 3Q9DA 3OKQA 4IE6A 3SOLA 3WAJA 3C98B 1MIVA 2Y6XA 3LBXB 2LE8A 3RPUA 4MHCA 4N78D 4UIGA 4JEHB 2LHRA 2XHEB 3CQCB 4Z8XA 3OYXA 3CX6B 2ZM0A 5FY0A 1WLXA 5LHIB 3BQIA 1FIOA 3MK7C 3DP7A 3HKBE 4KP3C 1D0ZA 2NTXA 3CKDA 2XAHB 2YK0A 4AXPA 4C91A 5HWYA 5IHYA 2EHOC 3KV6A 4EIWA 3KV5A 1WYBA 4YLHA 3FBZA 4IE7A 3CMLA 5JDGA 5HXSA 5FNVE 2A72A 5L3DB 3C50A 4PAGA 3O1HA 1VOMA 3RYIE 5H6QB 4ILUA 1MMNA 4HEAA 4G2AA 2E9XA 4IE4A 2WWUA 4QXHB 3RYCE 4DBQA 2KMFA 4PJLA 2Q9QA 1D1AA 3KVAA 1BR4A 3K8PC 4ZS3A 4OFZA 3AAAB 1HCIA 2N1GA 1EZ3A 2LSKA 4J2CA 3N9NA 3CWZB 1BR2A 4UF0B 2K48A 2QA7A 2JMHA 2LSYA 5JR9A 5ETWA 3FXEB 2V7MA 3UULA 4AI6A 4QX8B 2VL8A 3F2EA 2I59A 4IGUA 4K0UA 5LGNB 5JDMA 3O9XA 1MMDA 4L5GA 4ZOLE 2JMKA 5FXWA 3AA6B 3I9WA 4ANJA 3ANWA 4BJNA 2IW5B 3LK42 4L0RA 5A1LA 2QGSA 3TKLB 4AQFA 3KFWX 3QK6A 4H9NC 1KK7A 2LSIA 2E9XC 4TN7B 4EYYR 3AA1B 3LBXA 1HG2A 3N2OA 4IHJE 4DVDA 4EYUA 1LRZA 3UFEA 2Q9QC 5FP3A 5H6RB 2BVMA 2WSSV 4F6RC 2E9XD 4H9SE 2KNDA 1FMWA 3N9MA 5HXCA 2VKDA 4A56A 2Q9QD 3F57A 3LFMA 4AKIA 1T98A 3ETVA 2X68A 3E0ZA 3LG7A 2UXXB 2XAFB 5C8YE 5JRCB 5JR9C 2N2NA 3PTRB 3VKHA 4HTEA 2NP9A 2Y48B 5LBQB 2OA5A 3EDUA 3C4WA 5LHGB 2WBLA 2PBIA 3V5UA 4OYKA 1IJ5A 2MTQA 3KDSE 2YEVC 3PE0A 3VU7H 3IBPA 3KVBA 3KV9A 2XTLA 5ADXL 2LOSA 4E7SA 4IIJE 3U78A 1SA0E 1LVFA 3SS1A 1YKEB 4O8SA 3K3QC 2DWGA 2V7KA 4AKRB 4XAXB 3RYFE 4AKGA 5DABA 1YW0A 1U4QA 2KWHA 4AQFC 2YU2A 3Q5XA 2MYSA 5L3GB 2N9DA 3I1AA 2JPFA 3OBVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C98 B;  1FEW A;  1S94 A;  2DNX A;  4JEU B;  4TX5 A;  1EZ3 A;  1BR0 A;  5M4Y A;  4JEH B;  5LG4 A;  1G73 A;  2XHE B;  3LG7 A;  1HS7 A;  1FIO A; 
#chains in the Genus database with same CATH topology
 2XQ7 A;  1FJG T;  2PJQ A;  2XAQ B;  1O3X A;  1R8I A;  3L3P A;  4Z91 A;  2RP4 A;  2K3W A;  5E0O A;  1HF8 A;  4TNW A;  2JIW A;  2BG9 A;  3QOF A;  2ES0 A;  2X9H A;  3W15 B;  4O4I E;  4LF5 T;  3C64 A;  1VCT A;  2CA5 A;  5LMN T;  3I9Y A;  4WW0 A;  5LP6 E;  4L9I A;  5JRC A;  1Z0P A;  4LFA T;  1D0X A;  2C5K T;  2WS3 A;  1WR6 A;  2GK9 A;  2WZH A;  4GK5 E;  1ZEE A;  4HFH A;  5FXZ A;  1N33 T;  3PUR A;  2VAS A;  1WCR A;  4MLK A;  4U72 A;  3R6N A;  4WYV A;  2W0G A;  4TX5 A;  3IF8 B;  2KZ7 B;  5LG3 A;  4MAL A;  4YY3 T;  3P4W A;  3RC3 A;  4JI0 T;  2ACX A;  4IE0 A;  2BS2 A;  2DWK A;  2DLR A;  4QKN A;  3QB5 A;  4MBQ A;  3HKD E;  3NZQ A;  3IEE A;  2H3R A;  2YDR A;  3CK6 A;  3ZJ1 A;  3A5X A;  4BJM A;  4OX9 T;  2BG9 E;  4F8H A;  4JI1 T;  2X9Y A;  1MMA A;  2JQQ A;  1HX8 A;  3UUX B;  4YJ2 E;  2V5D A;  4UR9 A;  2W63 A;  4H63 H;  1WYC A;  5AQL B;  3AE6 A;  4P09 A;  3ZMS B;  2ZM6 T;  3RGL A;  1L0V A;  4PJM A;  2LJL A;  4V1A v;  2DI4 A;  3AA7 B;  4ZZB A;  2QYW A;  4UEL A;  4YTP A;  4CN4 A;  2ZMA A;  3ZC0 A;  5JH7 E;  2A2F X;  2JJ9 A;  2IC6 A;  4ASK A;  2XAJ B;  4TUY E;  2L9Q A;  4Q25 A;  4ZI3 C;  4ILC A;  4TWD A;  4QXC B;  2VWA A;  4JI5 T;  2V6X A;  3N2K E;  3ZT5 A;  2KIN B;  2E8I A;  4ZI3 D;  3M65 A;  3PDY A;  4U74 A;  1BR1 A;  2CXL A;  4ISS A;  3RHW A;  5IWA T;  2X67 A;  5L4E A;  5FXV A;  5IYZ E;  4JYA T;  2ZM8 A;  1D1C A;  1YD8 G;  2XAS B;  2SPC A;  2CLY B;  3UT5 E;  2WDV A;  1UX5 A;  2CWO A;  3UUN A;  4X1K E;  1H7C A;  3SFD A;  4CXW A;  2X51 A;  4AIS A;  4EED A;  5JDH A;  2VUR A;  2W67 A;  3PUA A;  1WFD A;  4GIW A;  4KBM B;  3KBU A;  2RA1 A;  4I50 E;  2WCA A;  2LM2 A;  4TWF A;  4DMV A;  5L2L A;  4JLE A;  1YXR A;  5ABG A;  5AQS B;  2XQA A;  2V1D B;  2WU5 A;  2HHH T;  5L3F B;  3CIR A;  5AQR B;  5HXH A;  4LMK A;  1ZKE A;  1I94 T;  5CA1 E;  2Z6E A;  4U7Y A;  3J9X 1;  2V5C A;  2J47 A;  5AQH B;  3CQX C;  3QUJ A;  2JQH A;  3DJB A;  4ZXL A;  3KV4 A;  1VRB A;  3I0Q A;  2E9X B;  4LMJ A;  3RRW A;  3ZMZ B;  2Q9Q B;  4AKL A;  3HL6 A;  2YKS A;  3O1I A;  2LT3 A;  3AEB A;  3SFE A;  5HEG A;  2E5L T;  1OED C;  4TV8 E;  4HFC A;  1JNR A;  4CI3 B;  1E1H B;  2VL0 A;  2YN6 A;  2YU1 A;  3FHN A;  1W9R A;  2I6H A;  3P4S A;  4TNV A;  2NOX A;  2VVS A;  5J1G A;  3OKQ A;  4QH5 A;  3SOL A;  3WAJ A;  1MIV A;  3LBX B;  5BR8 T;  4N78 D;  4UIG A;  2UUA T;  3CQC B;  4YXD A;  4DR7 T;  4KP3 C;  1D0Z A;  3CKD A;  2XAH B;  4AXP A;  5IHY A;  2EHO C;  2FBW A;  4HFI A;  4DV2 T;  3CML A;  2A72 A;  4PAG A;  1MMN A;  4HEA A;  2E9X A;  4IE4 A;  3RYC E;  4PJL A;  2Q9Q A;  1XWM A;  4ZS3 A;  1DU2 A;  1EZ3 A;  2LSK A;  3N9N A;  5FVL A;  4UF0 B;  3RQW A;  2J4G A;  4WZX A;  5ETW A;  3FXE B;  4AI6 A;  3AEC A;  2VL8 A;  4IGU A;  5LGN B;  2IML A;  1MMD A;  4ZOL E;  2WZI A;  3I9W A;  3ZT7 A;  2VQF T;  3TLU A;  4BJN A;  4L0R A;  3KFW X;  3AA1 B;  3LBX A;  4IHJ E;  3UU5 A;  3VRB A;  5FL0 A;  4A56 A;  3ETV A;  5HEU A;  2UXX B;  5JR9 C;  3PTR B;  5LBQ B;  3ONJ A;  3C4W A;  1IJ5 A;  3PE0 A;  3VU7 H;  3IBP A;  3KVB A;  2ACZ A;  2CHO A;  4HWH A;  5ADX L;  2LOS A;  3U78 A;  1SA0 E;  1LVF A;  2H88 A;  3SS1 A;  3K3Q C;  2DWG A;  2BBJ A;  4EV6 A;  4CN6 A;  1YW0 A;  2YU2 A;  4YTM A;  1GQE A;  5L3G B;  4EGW A;  1HR0 T;  1HX1 B;  2PG8 A;  3PU3 A;  4UF0 A;  4B3M T;  3GWH A;  4DUY T;  3EAB A;  2V7L A;  2JQ9 A;  3TLT A;  2AE9 A;  3A7M A;  5EZY E;  5JQG E;  1X79 A;  3RLF F;  2X0L B;  4KUM B;  4YFS A;  1US7 B;  5LNK A;  3NRX A;  5KXJ A;  2M6I A;  5LGU B;  5LCY A;  4PFO A;  4OHF A;  4H9O C;  4PK6 A;  4A98 A;  4M1P A;  4CXX A;  2J62 A;  4IDQ A;  5CGM A;  2FJA A;  2MBG A;  5AQJ B;  4U2Y A;  4QX7 B;  2HPJ A;  2MPK A;  5JVD E;  1IAP A;  4ZI7 E;  2K5B B;  3RF1 A;  3LK3 B;  3CPZ A;  3RKG A;  4EZH A;  3ZJ2 A;  4WBN E;  3UU3 A;  4GKJ T;  1HTJ F;  3N9Q A;  1XZY A;  5TAO A;  4JI4 T;  3RI5 A;  5JRE A;  1IJ6 A;  3ETU A;  5HEJ A;  2XJ7 A;  4EZ4 A;  3OVU A;  2LRL A;  2M6B A;  5GON E;  3H3A A;  2X0Y A;  1UK5 A;  3FZL B;  5HXR A;  4UEM A;  2J1D G;  4I55 E;  2LM9 A;  2VKO A;  1J1J A;  1CHU A;  5AQM B;  5AQI B;  4PJN A;  3RYH E;  3MAC A;  1MMG A;  2CXD A;  1WR0 A;  4QWN B;  5HEH A;  5JDL A;  2ZLY A;  5LOV E;  3AVS A;  2W4X A;  2LEH A;  4EB6 E;  4CI1 B;  4ILB A;  4ZEY A;  4JV5 T;  3AE1 A;  1UUS A;  3ZPO A;  2IC9 A;  4LFB T;  4HWI B;  2NR4 A;  2A9U A;  4AKH A;  4NUU A;  4YHH T;  4HGA A;  3LDQ B;  1D0Y A;  1OED B;  4CXY A;  1J5E T;  3BK9 A;  1NEK A;  3AB3 B;  2XM2 A;  2M67 A;  4HFD A;  2LHN A;  4LF6 T;  4HFE A;  5DQV A;  4DR2 T;  2L3L A;  4AIU A;  3PUS A;  4U31 A;  2BS3 A;  1S35 A;  3N9O A;  2W62 A;  2EHO B;  4ZS2 A;  4ZHQ E;  3HKE E;  2KLQ A;  2BKP A;  4JI2 T;  2XAG B;  2LSJ A;  3MA9 A;  1SUM B;  2DHR A;  4PNI A;  1SHZ C;  5AFU L;  4DR3 T;  3PUX F;  1XNQ T;  4CN1 A;  1OED A;  4ADZ A;  2V7J A;  3JAF A;  3P8C D;  4HN9 A;  2VQE T;  5DQW A;  2VKH A;  3JAE A;  4LF4 T;  5FXX A;  2L8K A;  3AE5 A;  2XPK A;  4KHP T;  5FYM A;  3QNU A;  3ZMV B;  4HWC A;  3ZN0 B;  5FY1 A;  3E08 A;  3C51 A;  5CB4 E;  5ABH A;  5FL1 A;  5HYA A;  2C0S A;  1J5W A;  2BZB A;  1KNZ A;  5JR9 B;  2EHO A;  1HNW T;  3ZMT B;  3C4X A;  5L3B B;  4CI2 B;  3L39 A;  3KIN B;  4GYS A;  4PK5 A;  2FJD A;  2WY2 A;  5FY7 A;  1D1B A;  1U5P A;  2BVL A;  4B3S T;  4DND A;  3TLS A;  2NW9 A;  2K9A A;  4IE6 A;  3TLW A;  3C98 B;  3QB5 K;  2LE8 A;  4A5X A;  2ZM0 A;  2JQK A;  1WLX A;  5AQG B;  2YDQ A;  4JI8 T;  3EI0 A;  3MK7 C;  3DP7 A;  2NTX A;  1OED E;  2YK0 A;  2CPT A;  3KV5 A;  2V8S V;  4YLH A;  4B3R T;  3EAM A;  5JDG A;  4ILU A;  2I0M A;  2IUB A;  4DBQ A;  2KMF A;  2XQ4 A;  2B76 A;  2BKO A;  1D1A A;  3NVO A;  3K8P C;  3ZST A;  1XDO A;  2K48 A;  3JAD A;  2LSY A;  5JR9 A;  3UUL A;  4KI0 F;  1Y01 A;  3EHZ A;  5JDM A;  2JMK A;  3P4Q A;  3L8R A;  5A1L A;  2QGS A;  3TKL B;  1KK7 A;  4TN7 B;  1HG2 A;  3UFE A;  2WSS V;  2XM1 A;  2KND A;  2IHR 1;  4AKI A;  3LG7 A;  1W0A A;  4DR4 T;  2NP9 A;  2Y48 B;  3EDU A;  4DR6 T;  3KV9 A;  5AQP B;  4E7S A;  2HN1 A;  1YKE B;  3AE2 A;  1XMO T;  4XAX B;  4AKG A;  1X9B A;  4AQF C;  2YOE A;  3Q5X A;  4AQY T;  2MYS A;  4O4L E;  2JPF A;  3OBV E;  4BAY B;  3U3I A;  4UXN B;  4XZC A;  2KXP B;  1YQ3 A;  4NPP A;  4HKA A;  2WP9 A;  5EK3 A;  3C4Z A;  2CBJ A;  4WBO A;  3I0O A;  4TV9 E;  3AA0 B;  4UV8 B;  1G8X A;  4QHO A;  2KWI B;  3HA4 A;  3P4R A;  4KX6 A;  2JRK A;  5HCJ A;  4LF8 T;  4KHZ F;  3RIA A;  3M3Z B;  3OYZ A;  4NUV A;  4U7I A;  1HNX T;  1ZHC A;  2HPL A;  3CX8 B;  2XSA A;  2ZM2 A;  5AQV B;  4YT0 A;  5HEO A;  2W61 A;  3RH3 A;  2ODV A;  2MOZ A;  1UX4 A;  5HWX A;  5HXE A;  4ERR A;  4IT4 A;  3ZCI A;  2BDE A;  4B6X A;  2C5I T;  5LYJ E;  2XUE A;  3PUV F;  3DTO A;  3MKD A;  4YSZ A;  1IZN B;  1KF6 A;  4X62 T;  5M4Y A;  2CWY A;  3ZLI A;  5JTG A;  5J2T E;  4DID B;  4JEU B;  4LF7 T;  3K3O A;  2XQ5 A;  4IE5 A;  3AEE A;  3OTO T;  3AED A;  3VHL A;  3F31 A;  5KMG P;  4DV4 T;  5LXT E;  1NAF A;  4CZZ B;  4H9R C;  5F8P A;  3EVY A;  1OXZ A;  3ZC1 A;  2XQ8 A;  3H37 A;  3GN5 B;  2BS4 A;  1VCS A;  3PU8 A;  1ZOY A;  5C2T A;  4OK0 A;  4UVC B;  2W2U A;  1BR0 A;  1FMV A;  3S4U A;  4IDP A;  1S94 A;  5FMN A;  2B1E A;  3Q5D A;  5J2U E;  4X5T A;  3ZCJ A;  4O2A E;  1KEY A;  3AAE B;  4IDZ A;  4EOZ B;  2H7O A;  4HE8 A;  4DR1 T;  1FEW A;  3RIF A;  2XQ3 A;  2UXB T;  3SRZ A;  3UUB A;  2XY8 B;  2XZE A;  3FZM B;  3FB2 A;  3AEF A;  3L09 A;  1QSD A;  4YTN A;  2WU2 A;  4UVB B;  3RIU C;  3JCF A;  3ZKR A;  3FZF B;  2D0T A;  3GN5 A;  3GMI A;  2DCF A;  2NW7 A;  4MFR A;  5AQT B;  4P0B A;  4LF9 T;  4X1I E;  1LKX A;  4DV6 T;  5F5W A;  4ILA A;  4BA9 A;  5ABE A;  2WDR A;  4YHJ A;  3ZYM A;  1G73 A;  2NWB A;  5L4H A;  3RX6 A;  2X9X A;  3V5S A;  1OWA A;  1SE7 A;  5CA0 E;  2ODU A;  4G63 A;  1M7K A;  1LVK A;  3HR0 A;  5LGT B;  4JUY A;  4COF A;  2HH7 A;  1HFA A;  3BQL A;  4PJJ A;  5LBM A;  2LLY A;  4I4T E;  5EK4 A;  3FXD B;  5LMU T;  2DNX A;  2CMR A;  3T1Y T;  3NRY A;  3EUH A;  5J0Z A;  2YIN A;  3RQU A;  3MJX A;  5LHH B;  2G0U A;  3KBT A;  4XBF B;  3IA3 A;  4NXN T;  5DJQ C;  2OV9 A;  4GOU A;  3RKO A;  4X64 T;  2VVN A;  2WB5 A;  2WWV A;  2IAK A;  3HI2 A;  3VR8 A;  2X66 A;  2C5J A;  3MZK B;  5JDQ A;  4QH4 A;  2CHN A;  3UUM A;  3QC9 A;  5F3J A;  3Q9D A;  3AE8 A;  2FJE A;  4MHC A;  2R6G F;  3T1H T;  4JEH B;  1Z8U A;  3UU8 A;  2RPA A;  1N36 T;  2XHE B;  3OPC A;  2FUP A;  2V6Y B;  4EEB A;  4U33 A;  3HKB E;  5AQF B;  1W09 A;  5HWY A;  4EIW A;  3KV6 A;  1WYB A;  2XSB A;  3PUW F;  4IE7 A;  3AE9 A;  5HXS A;  5FNV E;  5L3D B;  3O1H A;  4G2A A;  4I0U A;  4B3T T;  5CFB A;  2QVA A;  4LFC T;  2UXD T;  4OFZ A;  3AAA B;  1HCI A;  2N1G A;  4J2C A;  1BR2 A;  2CRB A;  2QA7 A;  4IDN A;  2I59 A;  4YSX A;  3O9X A;  3G06 A;  4L5G A;  3H3M A;  3AA6 B;  4ANJ A;  2IW5 B;  3PUY F;  4AQF A;  3QK6 A;  3NWI A;  3N2O A;  4DVD A;  4EYU A;  1LRZ A;  4YSY A;  2BVM A;  2V6Y A;  4IRE A;  3N9M A;  2VKD A;  3F57 A;  3P4P A;  5IUX A;  2AXD S;  2X68 A;  3E0Z A;  2XAF B;  5C8Y E;  3VKH A;  4HTE A;  5AQN B;  5LHG B;  2PBI A;  3V5U A;  2MTQ A;  2WDQ A;  2YEV C;  2XTL A;  1IBK T;  3AE7 A;  3RYF E;  5DAB A;  3ABV A;  3PV0 F;  2N9D A;  4P1N A;  2LOP A;  3UQ7 A;  1T7S A;  1T72 A;  1MIW A;  3E22 E;  4O4H E;  1MIY A;  4DV0 T;  3K3N A;  3N9P A;  4DMW A;  5AQK B;  3AEA A;  5EK2 A;  2BKN A;  2UU9 T;  1HS7 A;  3CX7 B;  1YKH B;  3AE3 A;  2A3D A;  4I43 B;  2PTF A;  4HWF A;  5LG4 A;  2H7V C;  4HFV A;  3ZT6 A;  1QUU A;  2WMN A;  1Y64 B;  4ZZC A;  2VB6 A;  3RRC A;  4ZI2 C;  3ZEF B;  1ZP0 A;  3VR9 A;  2CCQ A;  2UUC T;  1KNR A;  1NWM X;  5AQO B;  2BG9 C;  4ZI2 D;  4IST A;  3PJA A;  5LJM A;  3OJA A;  3LK2 B;  2CEA A;  2X9W A;  4JI6 T;  1MND A;  3PUG A;  1QLB A;  1UUR A;  3AXJ B;  2FJB A;  2V26 A;  4A97 A;  4DV3 T;  2D5U A;  5L3E B;  3UQ4 A;  4IL9 A;  5KDM C;  4NXM T;  3FZH B;  5LA6 E;  5FKY A;  1JNZ A;  3ONL C;  4H63 V;  4KMC A;  1I6Z A;  4CQI A;  1ZV4 X;  4U2Z A;  2QRX A;  3B5M A;  5AQU B;  3NZP A;  2UUB T;  2NW8 A;  5KX5 E;  3GA8 A;  4FI5 A;  4HWD A;  3NBX X;  4HFB A;  4NIQ A;  4LML A;  2XQY A;  4PFP A;  3WI3 A;  2BBH A;  4UVA B;  3B13 A;  4AQG A;  3UFG A;  2IDO B;  4GK0 E;  5L47 A;  3VKG A;  1IBL T;  4U3C A;  3ESL A;  3UTK A;  2WMO A;  5L3C B;  3AEG A;  3R84 B;  3O4X E;  3T8O A;  2CE7 A;  4X66 T;  4IL4 A;  3B57 A;  4UV9 B;  4EXT A;  3AXJ A;  3HKC E;  2LSG A;  3RIU A;  1E7P A;  5HAX A;  1T8B A;  3Q2M A;  1V9D A;  3CVR A;  5LHI B;  1XNR T;  3RC8 A;  2NTY A;  2IIU A;  4O2B E;  2D0U A;  2D2S A;  2LRK A;  4TZ4 C;  3AVR A;  3PUQ A;  3P50 A;  2WQY A;  2V7I A;  5C3J A;  2KT9 A;  4YJ3 E;  4PW8 A;  2OLT A;  2H89 A;  1MNE A;  3BQK A;  4FJO A;  1WRD A;  1HNZ T;  3FBL A;  4E7Z A;  3N9L A;  2E2A A;  2LKH A;  2MAW A;  2EHO D;  4TWH A;  1B7T A;  2CM0 A;  3JC6 C;  4DR5 T;  3ONX A;  4X20 E;  1HG5 A;  3JC6 D;  4QXB B;  3N5L A;  4DBR A;  4P0A A;  2VKJ A;  4Z90 A;  3LSV A;  4DV5 T;  4EAH A;  4WNK A;  3P7I A;  1N32 T;  3ZYL A;  2HN2 A;  3AAI A;  3LJC A;  3IHR A;  5JDF A;  3ZYK A;  2WAU A;  4H9Q C;  3SWH A;  3ZSS A;  4OYJ A;  3EDV A;  1AJ3 A;  3N2G E;  2Y8D A;  1CUN A;  5JDN A;  2KSR A;  2WM9 A;  3MXZ A;  4X1Y E;  3O1J A;  4IDO A;  3TLV A;  4O4J E;  3UU4 A;  3WAK A;  4X65 T;  4DUZ T;  1XDP A;  3ZN1 B;  4GKK T;  4DV7 T;  3AE4 A;  4GYR A;  2XQ9 A;  3ZMU B;  2VK9 A;  5BMV E;  1W0B A;  2K24 A;  2CXF A;  4PK4 A;  3Q5W A;  2XQ6 A;  4H9P C;  3D0T A;  3CQG B;  4JBW F;  2P9B A;  3PJA J;  2W00 A;  1UCU A;  2CLY C;  2PFV A;  1YQ4 A;  2UXN B;  1KFY A;  1XMQ T;  1M62 A;  4DO0 A;  3J7Y q;  3ANW B;  5LJN A;  4C90 A;  2E5V A;  3NKZ A;  2Y6X A;  3RPU A;  2F4V T;  2LHR A;  4Z8X A;  2X0H A;  2W66 A;  3CX6 B;  3OYX A;  5FY0 A;  3BQI A;  1FIO A;  5FVK A;  4C91 A;  5ABF B;  4K0K T;  1NEN A;  1UGO A;  3FBZ A;  2YDS A;  3C50 A;  1VOM A;  3RYI E;  5H6Q B;  3Q5E A;  3PUZ F;  2WWU A;  4QXH B;  3A8Y C;  1KNP A;  3UU6 A;  3KVA A;  1BR4 A;  2DL1 A;  3CWZ B;  4QH1 A;  2JMH A;  2V7M A;  4QX8 B;  3F2E A;  4JI3 T;  5CJ5 A;  4K0U A;  3K1S A;  5LB7 B;  5FXW A;  1E2A A;  3ANW A;  2BG9 B;  3LK4 2;  4H9N C;  2LSI A;  2E9X C;  4EYY R;  1IBM T;  3FZK B;  1N34 T;  2CBI A;  4JI7 T;  2Q9Q C;  5FP3 A;  5H6R B;  4F6R C;  2E9X D;  4H9S E;  2LKG A;  1FMW A;  2UXC T;  5HXC A;  2Q9Q D;  3LFM A;  1T98 A;  3VRA A;  5JRC B;  2D9D A;  2N2N A;  5ABF A;  2OA5 A;  2WBL A;  4OYK A;  5HCM A;  3KDS E;  4DV1 T;  4IIJ E;  3X1D A;  5AQQ B;  4AKR B;  4O8S A;  2V7K A;  1U4Q A;  2KWH A;  3I1A A; 
#chains in the Genus database with same CATH homology
 4BAY B;  3U3I A;  2PG8 A;  3PU3 A;  4UF0 A;  4UXN B;  2LOP A;  3GWH A;  4XZC A;  2KXP B;  2PJQ A;  2V7L A;  4HKA A;  1MIW A;  2XAQ B;  3E22 E;  4O4H E;  1MIY A;  1O3X A;  5EK3 A;  3C4Z A;  5EZY E;  3K3N A;  5JQG E;  3N9P A;  3L3P A;  4DMW A;  1X79 A;  2RP4 A;  4WBO A;  2X0L B;  3I0O A;  4TV9 E;  5E0O A;  1HF8 A;  3AA0 B;  4KUM B;  5EK2 A;  4UV8 B;  1G8X A;  4YFS A;  1US7 B;  2ES0 A;  2KWI B;  3HA4 A;  4QHO A;  5LNK A;  3NRX A;  2X9H A;  1HS7 A;  3CX7 B;  1YKH B;  5LGU B;  3W15 B;  4O4I E;  5LCY A;  2JRK A;  4PFO A;  4OHF A;  3C64 A;  4H9O C;  2A3D A;  4PK6 A;  2CA5 A;  3OYZ A;  4NUV A;  3I9Y A;  4WW0 A;  5LP6 E;  4L9I A;  1ZHC A;  2HPL A;  4M1P A;  4I43 B;  4CXX A;  3CX8 B;  5LG4 A;  5JRC A;  1Z0P A;  2ZM2 A;  2MBG A;  1D0X A;  2H7V C;  4HFV A;  2C5K T;  1QUU A;  1WR6 A;  2WMN A;  2GK9 A;  1Y64 B;  4GK5 E;  1ZEE A;  2VB6 A;  3RRC A;  4ZI2 C;  2W61 A;  4QX7 B;  3ZEF B;  5FXZ A;  2HPJ A;  2CCQ A;  3RH3 A;  3PUR A;  2ODV A;  1NWM X;  2MOZ A;  5JVD E;  2VAS A;  1IAP A;  4MLK A;  4ZI2 D;  1UX4 A;  4U72 A;  5HWX A;  4ZI7 E;  2K5B B;  3R6N A;  4IST A;  5HXE A;  5LJM A;  4ERR A;  3LK3 B;  2W0G A;  4TX5 A;  3IF8 B;  3OJA A;  2KZ7 B;  3ZCI A;  3LK2 B;  2BDE A;  3CPZ A;  4B6X A;  4EZH A;  4MAL A;  2CEA A;  3ZJ2 A;  4O4L E;  2C5I T;  3RC3 A;  2X9W A;  2ACX A;  4WBN E;  4IE0 A;  1MND A;  5LYJ E;  3PUG A;  2DWK A;  2DLR A;  2XUE A;  3DTO A;  3MKD A;  4QKN A;  2V26 A;  1HTJ F;  4MBQ A;  1IZN B;  3HKD E;  3N9Q A;  3NZQ A;  2D5U A;  3IEE A;  5TAO A;  2H3R A;  5M4Y A;  3ZJ1 A;  2CWY A;  5L3E B;  3A5X A;  3ZLI A;  4BJM A;  5KDM C;  5J2T E;  2X9Y A;  5JRE A;  1MMA A;  4JEU B;  1IJ6 A;  3ETU A;  3K3O A;  2JQQ A;  4IE5 A;  5LA6 E;  1HX8 A;  3UUX B;  4H63 V;  4YJ2 E;  4KMC A;  3VHL A;  4CQI A;  1ZV4 X;  3F31 A;  4EZ4 A;  3RC8 A;  5KMG P;  2W63 A;  3NZP A;  2NW8 A;  5LXT E;  1NAF A;  4CZZ B;  4H63 H;  5KX5 E;  4H9R C;  3GA8 A;  1WYC A;  5F8P A;  4FI5 A;  3EVY A;  1OXZ A;  3ZC1 A;  4P09 A;  5GON E;  3H3A A;  3NBX X;  3ZMS B;  3H37 A;  2XQY A;  5HXR A;  4PFP A;  3WI3 A;  4PJM A;  4UVA B;  4UEM A;  2J1D G;  2LJL A;  4I55 E;  3B13 A;  4V1A v;  2DI4 A;  2LM9 A;  4AQG A;  2VKO A;  3GN5 B;  3AA7 B;  4GK0 E;  3VKG A;  4UEL A;  3PU8 A;  2ZMA A;  3ZC0 A;  5JH7 E;  3ESL A;  3UTK A;  2WMO A;  5L3C B;  2A2F X;  2JJ9 A;  4PJN A;  4OK0 A;  3RYH E;  2IC6 A;  3MAC A;  1MMG A;  2CXD A;  4UVC B;  4ASK A;  3R84 B;  3O4X E;  4QWN B;  2CE7 A;  3T8O A;  1BR0 A;  2XAJ B;  1FMV A;  5JDL A;  2ZLY A;  3S4U A;  5LOV E;  4TUY E;  3B57 A;  2L9Q A;  3AVS A;  1S94 A;  4UV9 B;  4EXT A;  5FMN A;  3HKC E;  4ZI3 C;  2LSG A;  4QXC B;  2B1E A;  2VWA A;  5HAX A;  5J2U E;  2LEH A;  3Q2M A;  1V9D A;  3ZCJ A;  3CVR A;  4EB6 E;  3N2K E;  4CI1 B;  2KIN B;  2E8I A;  2NTY A;  4O2B E;  3M65 A;  4O2A E;  3PDY A;  4ZI3 D;  2D0U A;  4U74 A;  1BR1 A;  3ZPO A;  2D2S A;  2CXL A;  2IC9 A;  4TZ4 C;  4ISS A;  3AVR A;  3AAE B;  4IDZ A;  4EOZ B;  2H7O A;  3PUQ A;  4AKH A;  2X67 A;  4NUU A;  4HGA A;  4HE8 A;  1FEW A;  2V7I A;  5FXV A;  5IYZ E;  2ZM8 A;  3SRZ A;  1D1C A;  1D0Y A;  1YD8 G;  2XAS B;  2KT9 A;  4YJ3 E;  4PW8 A;  4CXY A;  2SPC A;  2CLY B;  3BK9 A;  3UT5 E;  1MNE A;  3FB2 A;  3BQK A;  1UX5 A;  4FJO A;  3L09 A;  2CWO A;  3AB3 B;  1QSD A;  2M67 A;  2LHN A;  5DQV A;  4UVB B;  1WRD A;  3UUN A;  3FBL A;  4X1K E;  1H7C A;  4E7Z A;  4CXW A;  3N9L A;  2X51 A;  2L3L A;  2D0T A;  3GN5 A;  2EHO D;  5JDH A;  1B7T A;  2CM0 A;  3GMI A;  2DCF A;  2NW7 A;  3PUS A;  4MFR A;  3JC6 C;  4P0B A;  3ONX A;  1S35 A;  4X1I E;  3N9O A;  3PUA A;  1LKX A;  4X20 E;  4GIW A;  1HG5 A;  3JC6 D;  2W62 A;  4KBM B;  4QXB B;  3KBU A;  2RA1 A;  4I50 E;  3N5L A;  4BA9 A;  4DBR A;  4P0A A;  2VKJ A;  4YHJ A;  2EHO B;  3ZYM A;  4ZS2 A;  4ZHQ E;  1G73 A;  2NWB A;  3HKE E;  4EAH A;  4DMV A;  4WNK A;  3P7I A;  3RX6 A;  2X9X A;  3V5S A;  2KLQ A;  2XAG B;  3ZYL A;  5L2L A;  1OWA A;  4JLE A;  3AAI A;  3LJC A;  5CA0 E;  2LSJ A;  3IHR A;  3MA9 A;  2ODU A;  5JDF A;  2DHR A;  3ZYK A;  2V1D B;  2WAU A;  4G63 A;  1LVK A;  4H9Q C;  3SWH A;  3HR0 A;  4PNI A;  4OYJ A;  3EDV A;  1SHZ C;  5AFU L;  1AJ3 A;  3N2G E;  5LGT B;  5L3F B;  2Y8D A;  4JUY A;  2HH7 A;  1CUN A;  1HFA A;  3BQL A;  4PJJ A;  5JDN A;  5LBM A;  2WM9 A;  3MXZ A;  4X1Y E;  4I4T E;  5EK4 A;  5HXH A;  3FXD B;  3O1J A;  4ADZ A;  2DNX A;  2V7J A;  2CMR A;  1ZKE A;  4O4J E;  3P8C D;  5CA1 E;  2Z6E A;  3J9X 1;  4HN9 A;  3WAK A;  3NRY A;  3EUH A;  5DQW A;  3ZN1 B;  2VKH A;  3CQX C;  3QUJ A;  2YIN A;  3DJB A;  5FXX A;  2L8K A;  3MJX A;  4GYR A;  3ZMU B;  2VK9 A;  3KV4 A;  5FYM A;  5LHH B;  1VRB A;  2G0U A;  5BMV E;  3KBT A;  3I0Q A;  4XBF B;  2E9X B;  3ZMV B;  3ZN0 B;  5FY1 A;  3RRW A;  2K24 A;  3ZMZ B;  2Q9Q B;  2CXF A;  4PK4 A;  5DJQ C;  4AKL A;  3E08 A;  3HL6 A;  3Q5W A;  3C51 A;  3O1I A;  4GOU A;  5CB4 E;  4H9P C;  2LT3 A;  3RKO A;  5HYA A;  2C0S A;  3D0T A;  3CQG B;  2BZB A;  2P9B A;  2W00 A;  1KNZ A;  1UCU A;  5JR9 B;  4TV8 E;  2EHO A;  3ZMT B;  4CI3 B;  2IAK A;  2CLY C;  3HI2 A;  3C4X A;  5L3B B;  4CI2 B;  2PFV A;  2X66 A;  1E1H B;  2C5J A;  2YU1 A;  3KIN B;  3MZK B;  2UXN B;  3FHN A;  4GYS A;  4PK5 A;  5JDQ A;  5FY7 A;  4DO0 A;  3J7Y q;  1D1B A;  2NOX A;  1U5P A;  2BVL A;  3ANW B;  3UUM A;  5LJN A;  4DND A;  3QC9 A;  4C90 A;  2NW9 A;  2K9A A;  5J1G A;  5F3J A;  3Q9D A;  3OKQ A;  4IE6 A;  3SOL A;  3WAJ A;  3C98 B;  1MIV A;  2Y6X A;  3LBX B;  2LE8 A;  3RPU A;  4MHC A;  4N78 D;  4UIG A;  4JEH B;  2LHR A;  2XHE B;  3CQC B;  4Z8X A;  3OYX A;  3CX6 B;  2ZM0 A;  5FY0 A;  1WLX A;  5LHI B;  3BQI A;  1FIO A;  3MK7 C;  3DP7 A;  3HKB E;  4KP3 C;  1D0Z A;  2NTX A;  3CKD A;  2XAH B;  2YK0 A;  4AXP A;  4C91 A;  5HWY A;  5IHY A;  2EHO C;  3KV6 A;  4EIW A;  3KV5 A;  1WYB A;  4YLH A;  3FBZ A;  4IE7 A;  3CML A;  5JDG A;  5HXS A;  5FNV E;  2A72 A;  5L3D B;  3C50 A;  4PAG A;  3O1H A;  1VOM A;  3RYI E;  5H6Q B;  4ILU A;  1MMN A;  4HEA A;  4G2A A;  2E9X A;  4IE4 A;  2WWU A;  4QXH B;  3RYC E;  4DBQ A;  2KMF A;  4PJL A;  2Q9Q A;  1D1A A;  3KVA A;  1BR4 A;  3K8P C;  4ZS3 A;  4OFZ A;  3AAA B;  1HCI A;  2N1G A;  1EZ3 A;  2LSK A;  4J2C A;  3N9N A;  3CWZ B;  1BR2 A;  4UF0 B;  2K48 A;  2QA7 A;  2JMH A;  2LSY A;  5JR9 A;  5ETW A;  3FXE B;  2V7M A;  3UUL A;  4AI6 A;  4QX8 B;  2VL8 A;  3F2E A;  2I59 A;  4IGU A;  4K0U A;  5LGN B;  5JDM A;  3O9X A;  1MMD A;  4L5G A;  4ZOL E;  2JMK A;  5FXW A;  3AA6 B;  3I9W A;  4ANJ A;  3ANW A;  4BJN A;  2IW5 B;  3LK4 2;  4L0R A;  5A1L A;  2QGS A;  3TKL B;  4AQF A;  3KFW X;  3QK6 A;  4H9N C;  1KK7 A;  2LSI A;  2E9X C;  4TN7 B;  4EYY R;  3AA1 B;  3LBX A;  1HG2 A;  3N2O A;  4IHJ E;  4DVD A;  4EYU A;  1LRZ A;  3UFE A;  2Q9Q C;  5FP3 A;  5H6R B;  2BVM A;  2WSS V;  4F6R C;  2E9X D;  4H9S E;  2KND A;  1FMW A;  3N9M A;  5HXC A;  2VKD A;  4A56 A;  2Q9Q D;  3F57 A;  3LFM A;  4AKI A;  1T98 A;  3ETV A;  2X68 A;  3E0Z A;  3LG7 A;  2UXX B;  2XAF B;  5C8Y E;  5JRC B;  5JR9 C;  2N2N A;  3PTR B;  3VKH A;  4HTE A;  2NP9 A;  2Y48 B;  5LBQ B;  2OA5 A;  3EDU A;  3C4W A;  5LHG B;  2WBL A;  2PBI A;  3V5U A;  4OYK A;  1IJ5 A;  2MTQ A;  3KDS E;  2YEV C;  3PE0 A;  3VU7 H;  3IBP A;  3KVB A;  3KV9 A;  2XTL A;  5ADX L;  2LOS A;  4E7S A;  4IIJ E;  3U78 A;  1SA0 E;  1LVF A;  3SS1 A;  1YKE B;  4O8S A;  3K3Q C;  2DWG A;  2V7K A;  4AKR B;  4XAX B;  3RYF E;  4AKG A;  5DAB A;  1YW0 A;  1U4Q A;  2KWH A;  4AQF C;  2YU2 A;  3Q5X A;  2MYS A;  5L3G B;  2N9D A;  3I1A A;  2JPF A;  3OBV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...