1Y01A

Crystal structure of ahsp bound to fe(ii) alpha-hemoglobin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
LLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Molecular mechanism of AHSP-mediated stabilization of alpha-hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxygen storage/transport
total genus 35
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1y01A00
3Q5DA 1XZYA 3IA3A 3Q5EA 1W0BA 3QOFA 3QNUA 3OVUA 4IDPA 3X1DA 4IDQA 4IDNA 4IDOA 1W09A 1Z8UA 1W0AA 1Y01A
chains in the Genus database with same CATH superfamily
3AE7A 4LFCT 1B7TA 2Q9QD 4M1PA 3WAKA 2W63A 3VRAA 5FYMA 2W4XA 3RYCE 4EZ4A 4PNIA 2X51A 3AEFA 2H88A 4UELA 4Z8XA 4N78D 4DV6T 3HI2A 3J9X1 1KNZA 2X0HA 4DMWA 4HFCA 1D0ZA 2UXDT 3N9NA 2V6YB 5H6RB 1HX8A 1VRBA 1W09A 5LP6E 4H9PC 5AFUL 2X68A 3HKEE 4K0UA 3R84B 1T8BA 2HPJA 2XQYA 4MBQA 3E0ZA 4EOZB 4EYUA 2Z6EA 2J4GA 5CA0E 3N9OA 2BDEA 2ACZA 4IE7A 4CN4A 2E5LT 3UTKA 3JC6C 3NBXX 2WB5A 2OV9A 2W61A 4IDQA 3U3IA 2PG8A 5L3FB 3H3MA 2BVLA 4EZHA 2V26A 4CQIA 3UFGA 1ZKEA 4YY3T 3RKOA 4JV5T 4U2YA 4H9NC 2FJAA 5JDQA 5JREA 1XNRT 3ONLC 3PJAA 3ZC0A 4UEMA 5HEOA 4H9RC 5AQLB 5FL1A 5L3DB 4IE0A 1O3XA 4NXNT 4B6XA 2J1DG 3ZMSB 4IGUA 2DNXA 1IJ6A 2WU5A 4MLKA 2A9UA 4HKAA 1KNPA 3Q9DA 5AQFB 2EHOB 2WMOA 4O8SA 4ADZA 4KI0F 2VQFT 2LT3A 3KBTA 1JNZA 4TWHA 2JRKA 2JPFA 2BVMA 3FZLB 1NENA 2R6GF 1BR0A 4X1YE 1CHUA 4EXTA 3W15B 4MALA 4ZI2D 5LMUT 5HWYA 3ANWA 2V7KA 4F6RC 1W9RA 3E08A 2HHHT 4IDZA 3UQ7A 5C2TA 1FJGT 4TUYE 4GKJT 3UUXB 2CPTA 2UXNB 3Q5WA 1UX5A 3O1IA 3ONXA 4IIJE 2CXFA 3F31A 4AQYT 2JMHA 1OEDA 2WP9A 2W67A 2WDRA 1H7CA 2CM0A 4IREA 1V9DA 3SRZA 2LJLA 2NW8A 4TNWA 2K5BB 3L39A 3HL6A 2XM2A 2XQ9A 1MNDA 2YKSA 4X1IE 5M4YA 3ZLIA 3LDQB 3AEAA 3PTRB 1G8XA 2VB6A 5AQIB 4TZ4C 3C98B 4DV7T 3AXJB 4DV3T 3UU5A 3LG7A 4ISSA 2LSJA 3AA6B 4P1NA 4TX5A 2LKGA 3DJBA 3CVRA 4B3TT 4X1KE 4HWIB 3UQ4A 3PU3A 3ZEFB 1IBKT 2XPKA 2D9DA 2DCFA 3B57A 2LE8A 2PTFA 2XQ7A 3ZYKA 5L2LA 3D0TA 2E9XD 2I6HA 5FXZA 4HN9A 3FZMB 3UFEA 3ZMZB 3B13A 2EHOD 3VU7H 4DVDA 3AECA 3MKDA 2K24A 1T72A 4ZZCA 4AI6A 3UULA 4L0RA 5FL0A 4BA9A 3DTOA 2LSYA 3C4ZA 2I0MA 3L3PA 5LG4A 2WWVA 2X9XA 5HCMA 2G0UA 3T8OA 4A97A 3DP7A 3RQUA 4WW0A 4E7ZA 3ZT5A 2CRBA 5JDFA 3VKHA 3ZPOA 2K3WA 2ZLYA 1XMOT 2JQKA 3Q2MA 1KF6A 1UUSA 4V1Av 1NAFA 1WCRA 1HTJF 5FY7A 2KWIB 5CJ5A 3TLUA 1I94T 4MFRA 4PJMA 5J2UE 2LOSA 2MOZA 4WBOA 3F2EA 2L8KA 2X9WA 2LSGA 3RGLA 1UK5A 3EUHA 4YSXA 5L3EB 4LF4T 1Z8UA 2CA5A 2PFVA 2IDOB 3PDYA 3KV6A 3M3ZB 3UUNA 4WZXA 3OVUA 1YKHB 4CI3B 1OEDC 4HEAA 3ZYLA 1UX4A 4YTNA 4JI5T 2XHEB 5A1LA 2YU2A 2Q9QB 3CIRA 4C91A 2WU2A 4O2BE 4QXHB 2LSKA 1QUUA 2B1EA 2JQQA 3SWHA 2P9BA 2WAUA 5JVDE 3AEDA 5JDMA 2KINB 3I0OA 4L5GA 4DMVA 1U5PA 4C90A 2HPLA 5AQRB 4CZZB 5LMNT 3JAEA 4KHPT 4IT4A 4U2ZA 4QH5A 1D1AA 3TKLB 5LGUB 4TWDA 3LK2B 4ZS2A 1HNXT 1OWAA 3RX6A 2FJDA 4NUVA 1SUMB 2XAHB 3AA7B 4LF5T 3J7Yq 3QNUA 5ABFA 5FP3A 2DHRA 5HEUA 5LGNB 3V5UA 2J47A 3FZHB 4UVCB 4U31A 2C5JA 1D0XA 2XQ3A 2LOPA 2E8IA 2WY2A 2WQYA 4Z90A 2N9DA 2CCQA 5JTGA 3NRXA 3RQWA 2ZM2A 3ZCJA 4COFA 4CXXA 4EV6A 3UU4A 3KV9A 2WZIA 5ABGA 4UF0B 1HF8A 2W2UA 2UU9T 3HKBE 5HXHA 1WR0A 4IDPA 5AQKB 4ASKA 2V5CA 2KMFA 3AE1A 2JQ9A 5HXRA 4HFHA 4O2AE 2YDRA 4GK0E 3QOFA 2BG9B 1R8IA 5FXXA 3P4SA 1MMNA 2YDSA 3FXDB 4UV9B 3PU8A 2X9YA 4U3CA 3RRCA 2C0SA 1N33T 3A7MA 2WDQA 4HFIA 4JBWF 2XTLA 2J62A 2BKNA 2XM1A 2ODVA 2CEAA 1LKXA 5JR9A 4DR5T 4HWCA 3TLWA 3IF8B 3OPCA 3AEBA 4YHHT 4H63H 3AE5A 1E2AA 1N34T 3FZKB 3EAMA 4QX7B 4ILAA 2LM2A 2CXLA 3HKCE 3QUJA 1S35A 5HAXA 5IYZE 2XAGB 4JI8T 5LHGB 2VKOA 4DV4T 1ZHCA 4TNVA 2E5VA 1Y01A 4FI5A 1L0VA 2LLYA 1E1HB 4MHCA 3AEGA 2C5IT 1ZP0A 2DWGA 2N1GA 4LMKA 1N32T 5EK2A 3FXEB 4EGWA 5HEHA 2D0UA 4DV2T 2M67A 3ETUA 2UXCT 2JMKA 2YINA 2I59A 5BR8T 5CFBA 3UU8A 2CHNA 3N9LA 2KZ7B 4QWNB 5CA1E 3QB5A 2JJ9A 3VR8A 2QRXA 3CX6B 3HA4A 1X9BA 3KV5A 2H3RA 4PK4A 3EDVA 4IE4A 2LRLA 4I43B 3M65A 2WBLA 2CE7A 4NIQA 3K3QC 2E9XB 4EEDA 3AVRA 2UUCT 5DQVA 3SFDA 3GWHA 1IAPA 1OEDE 2UXBT 4XBFB 5AQMB 2KSRA 3K3OA 1YQ3A 3C64A 4OK0A 5F5WA 1W0AA 4G2AA 4H63V 5ABHA 4AIUA 3C4WA 2DLRA 4DR6T 4KX6A 3JCFA 3K8PC 3EDUA 4ILCA 2VASA 4B3MT 3PURA 2V1DB 4DBQA 5JR9C 4KP3C 1KEYA 4LF6T 1YQ4A 1HFAA 4HFVA 1MIVA 2A3DA 3N2KE 4CI2B 2QA7A 2HN2A 4XZCA 4UV8B 2NTXA 4H9OC 3PUAA 5IUXA 2XAFB 1QLBA 5AQOB 3L09A 4P09A 3NZQA 5KXJA 2V6YA 1LVFA 1MMAA 2WWUA 2CBJA 2L9QA 3KBUA 1HNWT 3PUWF 4LMJA 2VKDA 1HR0T 4OX9T 3FB2A 4CN6A 3C4XA 3GN5B 5LJMA 1JNRA 1NWMX 2FJEA 4JEHB 5EK4A 3S4UA 4YSZA 2XSAA 3ZN1B 2KT9A 3NRYA 5ABEA 2BKOA 4ZXLA 3ZMUB 3NWIA 2A72A 4JI7T 2NR4A 2CXDA 1M7KA 5J0ZA 4HFDA 4JLEA 4X65T 4PJNA 1MIWA 3ZMTB 1M62A 5EK3A 4BAYB 4J2CA 1D1BA 3MJXA 2PBIA 2YOEA 5BMVE 5AQQB 2BBJA 4I4TE 2H7OA 2A2FX 3CMLA 4UVAB 3N2OA 1MNEA 1ZOYA 3L8RA 2YU1A 4ZI7E 1CUNA 4DUYT 4DV5T 3I0QA 3V5SA 4AKRB 4CI1B 1NEKA 2KNDA 5E0OA 2VKHA 4NUUA 4X62T 3LSVA 1IBLT 2EHOA 1WRDA 3KDSE 1XDPA 3OBVE 3LBXB 3RYHE 4L9IA 5JRCB 4DIDB 3BK9A 5AQNB 3RHWA 3Q5DA 2LHRA 3FBZA 3MK7C 2BG9C 3RRWA 1KK7A 5ADXL 4IDOA 1HG2A 3O1JA 2CLYC 2DL1A 4FJOA 4U7IA 4X64T 4YSYA 1G73A 5L3GB 4DR1T 3AA1B 2L3LA 2IC6A 3N2GE 2M6BA 4AQFC 5AQUB 4EYYR 4ZI2C 2V6XA 2AE9A 5DABA 2RP4A 3BQLA 4ERRA 3LJCA 5LG3A 5FXVA 2D0TA 1HX1B 4CN1A 5HYAA 4LF7T 4YFSA 4HWDA 1BR1A 4YXDA 4A5XA 3CQCB 1YXRA 1XNQT 4HGAA 2LRKA 2YEVC 2VL0A 3R6NA 4YTPA 5HXEA 3RH3A 4KMCA 3AE4A 3PE0A 3JAFA 3P4RA 2W00A 4TV8E 3AXJA 2IAKA 5J1GA 2LHNA 4WNKA 2BS3A 2D2SA 1N36T 4U74A 3E22E 1MMGA 5IHYA 3O9XA 5L3CB 3P4WA 4UR9A 5LGTB 2AXDS 2BBHA 3QC9A 1OXZA 1WYCA 1MIYA 2V8SV 5AQHB 4PJJA 4QH4A 5LBMA 3JC6D 4ZOLE 3K1SA 4JI6T 1XWMA 3ZSSA 5H6QB 2Y8DA 4ZZBA 2DWKA 3C51A 1IZNB 3KINB 3X1DA 1WLXA 5L4EA 4HFBA 5DJQC 5HCJA 2E9XC 3P4PA 3MXZA 3ONJA 2UUBT 4K0KT 2NWBA 5JDGA 4E7SA 2EHOC 3C50A 2YN6A 3TLSA 3RKGA 5C3JA 4GKKT 1S94A 2WSSV 4AKIA 3HKDE 4X5TA 4G63A 2LSIA 5KX5E 3NKZA 4ZS3A 4QKNA 3VHLA 2K48A 4O4HE 5JDHA 4EIWA 4YHJA 3KV4A 2IC9A 5KDMC 3PUQA 4HWFA 2NW7A 1D1CA 2RPAA 1QSDA 2ZM8A 2V7LA 1I6ZA 5IWAT 5KMGP 3CWZB 4OHFA 5JDLA 3PJAJ 5FVLA 1YD8G 5LA6E 3N9MA 3FHNA 3TLVA 4DUZT 2W62A 3Q5XA 4DR2T 4OYKA 3ZC1A 4ILBA 4ZEYA 4A98A 4JI0T 3PUXF 4Z91A 5AQTB 1GQEA 1FEWA 3ETVA 1KNRA 5AQJB 3PUYF 4AKHA 5FY1A 3AB3B 5C8YE 3HR0A 1ZEEA 2Q9QA 2VQET 3T1HT 2QGSA 5HXSA 2N2NA 5HXCA 4O4IE 5EZYE 4GIWA 5AQSB 3I9WA 2NP9A 1OEDB 2VWAA 4X20E 4AQGA 5HEJA 5HWXA 1XDOA 3BQKA 3O4XE 4ZHQE 3O1HA 5FXWA 2PJQA 4ISTA 4IHJE 3AE8A 4NPPA 4ZI3C 2BZBA 3PUZF 1UCUA 3P8CD 3VRBA 3PV0F 3MA9A 2KLQA 3IHRA 3SFEA 4YJ2E 2MTQA 2FJBA 4DBRA 3FBLA 3ZT7A 4QXCB 2C5KT 4PFPA 4PK6A 3VR9A 2X67A 3P50A 2X0LB 2IUBA 4PW8A 2ZMAA 4B3ST 3MACA 2BG9E 3KVAA 2XAJB 2RA1A 4IE6A 3AAIA 3CQGB 3RIFA 2CWYA 2X0YA 2XASB 4BJMA 3NZPA 3H37A 1LRZA 2VL8A 2BS2A 5LOVE 1KFYA 3LK42 5LCYA 2D5UA 4HWHA 2DI4A 3CX8B 2ODUA 2XAQB 4IL9A 1ZV4X 4UF0A 2GK9A 4DO0A 2WCAA 3CPZA 2XQ8A 3RC8A 2ZM6T 1HG5A 2XJ7A 3VKGA 3A8YC 2VVNA 3RC3A 2HN1A 5LXTE 3ZJ1A 2JIWA 3G06A 3P7IA 3UUBA 2VURA 4PJLA 2BG9A 1LVKA 1FMWA 4DV0T 5F3JA 5CB4E 3AE9A 4I55E 3N5LA 3EVYA 1J5WA 4AISA 4ILUA 3ZT6A 1X79A 3WAJA 3LK3B 2K9AA 2NTYA 3P4QA 4KUMB 1XMQT 1W0BA 3WI3A 2KXPB 2W0GA 2CWOA 2ZM0A 1T98A 4HE8A 4AQFA 4ANJA 2VVSA 4AKLA 3K3NA 1UGOA 2SPCA 2Q9QC 1DU2A 1BR4A 3N9QA 5L47A 1YW0A 2XQ4A 5L3BB 3PUGA 4JI2T 2UUAT 4TN7B 1E7PA 2WZHA 2FBWA 5FKYA 1HCIA 2XQ5A 2VKJA 2OA5A 3QB5K 5JQGE 1T7SA 5HEGA 5ETWA 2LM9A 3OYXA 4U7YA 2V7MA 5CGMA 4P0AA 3I1AA 2WMNA 2MBGA 3ESLA 2HH7A 4U72A 2CHOA 2X66A 5J2TE 3RPUA 1SA0E 4OYJA 2XQAA 2LEHA 3GA8A 3RIAA 5LJNA 2IIUA 5LHIB 1Y64B 4TV9E 2M6IA 3CX7B 2MAWA 4X66T 4QXBB 3SOLA 4DR7T 3IEEA 3OJAA 3ZN0B 2WM9A 4UVBB 4AXPA 2JQHA 3T1YT 4QX8B 4P0BA 4KHZF 5L4HA 2Y48B 5ABFB 1HS7A 4YJ3E 2E9XA 3I9YA 2BKPA 3TLTA 2QVAA 3IA3A 4JYAT 3UT5E 3RI5A 5AQPB 4JI3T 2ACXA 4GK5E 1IBMT 3RF1A 2LKHA 3A5XA 2VK9A 3BQIA 5AQVB 2NOXA 3Q5EA 4PFOA 4PK5A 2ES0A 3RIUA 1VCTA 5LYJE 4JI1T 4IDNA 3B5MA 3ABVA 5DQWA 3EI0A 4LFAT 2QYWA 4KBMB 1US7B 4AKGA 3FZFB 3PUSA 1SE7A 5FMNA 1WYBA 4YLHA 2XSBA 5FNVE 4DNDA 2X9HA 4B3RT 3PUVF 4HFEA 4LFBT 1WR6A 3AA0B 4IE5A 2F4VT 4OFZA 4PAGA 3GMIA 2MYSA 4LF9T 4O4JE 1SHZC 5AQGB 3AE2A 2IMLA 4YTMA 4EAHA 5JR9B 3AEEA 2CMRA 3EABA 3ZMVB 4YT0A 3RLFF 4JEUB 1D0YA 4LF8T 3QK6A 5LBQB 2V7IA 1Z0PA 4WBNE 4TWFA 3JADA 2YK0A 4EEBA 3N9PA 4UIGA 5LB7B 2YDQA 3ZCIA 2XUEA 3GN5A 4GYSA 3CK6A 4IL4A 4DR3T 3AE6A 2NW9A 3ZKRA 3RYFE 1FIOA 3KFWX 2XY8B 4CXWA 4GOUA 4ZI3D 5JH7E 2KWHA 4GYRA 5GONE 2H89A 1EZ3A 2H7VC 5LNKA 4CXYA 3MZKB 3UUMA 4DV1T 1YKEB 5FY0A 5F8PA 3UU3A 2Y6XA 3ZYMA 2V5DA 1HNZT 3AAAB 2IHR1 5JDNA 1UURA 3SS1A 2OLTA 5FVKA 4JI4T 3KVBA 1AJ3A 3F57A 4WYVA 4QHOA 3EHZA 2FUPA 2E2AA 3AE3A 4H9SE 4XAXB 4JUYA 4QH1A 3OTOT 4NXMT 1J1JA 4I50E 4H9QC 4LMLA 3UU6A 4O4LE 3H3AA 2XQ6A 3OKQA 1BR2A 3LBXA 3ZJ2A 1WFDA 2UXXB 2WS3A 1IJ5A 3RYIE 2V7JA 3U78A 5JRCA 1VOMA 3ZSTA 3AAEB 3RIUC 1MMDA 4DR4T 1FMVA 4A56A 3OYZA 3AVSA 2B76A 4I0UA 4HTEA 2WDVA 5TAOA 1XZYA 5LHHB 1J5ET 4UXNB 3CKDA 2W66A 2IW5B 2XZEA 3IBPA 4F8HA 4EB6E 1VCSA 3ANWB 4U33A 3CQXC 4BJNA 2MPKA 2CLYB 3LFMA 2BS4A 4Q25A 2CBIA 3NVOA 1U4QA
chains in the Genus database with same CATH topology
3Q5DA 1XZYA 3IA3A 3Q5EA 1W0BA 3QOFA 3QNUA 3OVUA 4IDPA 3X1DA 4IDQA 4IDNA 4IDOA 1W09A 1Z8UA 1W0AA 1Y01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q5D A;  1XZY A;  3IA3 A;  3Q5E A;  1W0B A;  3QOF A;  3QNU A;  3OVU A;  4IDP A;  3X1D A;  4IDQ A;  4IDN A;  4IDO A;  1W09 A;  1Z8U A;  1W0A A;  1Y01 A; 
#chains in the Genus database with same CATH topology
 3AE7 A;  4LFC T;  1B7T A;  2Q9Q D;  4M1P A;  3WAK A;  2W63 A;  3VRA A;  5FYM A;  2W4X A;  3RYC E;  4EZ4 A;  4PNI A;  2X51 A;  3AEF A;  2H88 A;  4UEL A;  4Z8X A;  4N78 D;  4DV6 T;  3HI2 A;  3J9X 1;  1KNZ A;  2X0H A;  4DMW A;  4HFC A;  1D0Z A;  2UXD T;  3N9N A;  2V6Y B;  5H6R B;  1HX8 A;  1VRB A;  1W09 A;  5LP6 E;  4H9P C;  5AFU L;  2X68 A;  3HKE E;  4K0U A;  3R84 B;  1T8B A;  2HPJ A;  2XQY A;  4MBQ A;  3E0Z A;  4EOZ B;  4EYU A;  2Z6E A;  2J4G A;  5CA0 E;  3N9O A;  2BDE A;  2ACZ A;  4IE7 A;  4CN4 A;  2E5L T;  3UTK A;  3JC6 C;  3NBX X;  2WB5 A;  2OV9 A;  2W61 A;  4IDQ A;  3U3I A;  2PG8 A;  5L3F B;  3H3M A;  2BVL A;  4EZH A;  2V26 A;  4CQI A;  3UFG A;  1ZKE A;  4YY3 T;  3RKO A;  4JV5 T;  4U2Y A;  4H9N C;  2FJA A;  5JDQ A;  5JRE A;  1XNR T;  3ONL C;  3PJA A;  3ZC0 A;  4UEM A;  5HEO A;  4H9R C;  5AQL B;  5FL1 A;  5L3D B;  4IE0 A;  1O3X A;  4NXN T;  4B6X A;  2J1D G;  3ZMS B;  4IGU A;  2DNX A;  1IJ6 A;  2WU5 A;  4MLK A;  2A9U A;  4HKA A;  1KNP A;  3Q9D A;  5AQF B;  2EHO B;  2WMO A;  4O8S A;  4ADZ A;  4KI0 F;  2VQF T;  2LT3 A;  3KBT A;  1JNZ A;  4TWH A;  2JRK A;  2JPF A;  2BVM A;  3FZL B;  1NEN A;  2R6G F;  1BR0 A;  4X1Y E;  1CHU A;  4EXT A;  3W15 B;  4MAL A;  4ZI2 D;  5LMU T;  5HWY A;  3ANW A;  2V7K A;  4F6R C;  1W9R A;  3E08 A;  2HHH T;  4IDZ A;  3UQ7 A;  5C2T A;  1FJG T;  4TUY E;  4GKJ T;  3UUX B;  2CPT A;  2UXN B;  3Q5W A;  1UX5 A;  3O1I A;  3ONX A;  4IIJ E;  2CXF A;  3F31 A;  4AQY T;  2JMH A;  1OED A;  2WP9 A;  2W67 A;  2WDR A;  1H7C A;  2CM0 A;  4IRE A;  1V9D A;  3SRZ A;  2LJL A;  2NW8 A;  4TNW A;  2K5B B;  3L39 A;  3HL6 A;  2XM2 A;  2XQ9 A;  1MND A;  2YKS A;  4X1I E;  5M4Y A;  3ZLI A;  3LDQ B;  3AEA A;  3PTR B;  1G8X A;  2VB6 A;  5AQI B;  4TZ4 C;  3C98 B;  4DV7 T;  3AXJ B;  4DV3 T;  3UU5 A;  3LG7 A;  4ISS A;  2LSJ A;  3AA6 B;  4P1N A;  4TX5 A;  2LKG A;  3DJB A;  3CVR A;  4B3T T;  4X1K E;  4HWI B;  3UQ4 A;  3PU3 A;  3ZEF B;  1IBK T;  2XPK A;  2D9D A;  2DCF A;  3B57 A;  2LE8 A;  2PTF A;  2XQ7 A;  3ZYK A;  5L2L A;  3D0T A;  2E9X D;  2I6H A;  5FXZ A;  4HN9 A;  3FZM B;  3UFE A;  3ZMZ B;  3B13 A;  2EHO D;  3VU7 H;  4DVD A;  3AEC A;  3MKD A;  2K24 A;  1T72 A;  4ZZC A;  4AI6 A;  3UUL A;  4L0R A;  5FL0 A;  4BA9 A;  3DTO A;  2LSY A;  3C4Z A;  2I0M A;  3L3P A;  5LG4 A;  2WWV A;  2X9X A;  5HCM A;  2G0U A;  3T8O A;  4A97 A;  3DP7 A;  3RQU A;  4WW0 A;  4E7Z A;  3ZT5 A;  2CRB A;  5JDF A;  3VKH A;  3ZPO A;  2K3W A;  2ZLY A;  1XMO T;  2JQK A;  3Q2M A;  1KF6 A;  1UUS A;  4V1A v;  1NAF A;  1WCR A;  1HTJ F;  5FY7 A;  2KWI B;  5CJ5 A;  3TLU A;  1I94 T;  4MFR A;  4PJM A;  5J2U E;  2LOS A;  2MOZ A;  4WBO A;  3F2E A;  2L8K A;  2X9W A;  2LSG A;  3RGL A;  1UK5 A;  3EUH A;  4YSX A;  5L3E B;  4LF4 T;  1Z8U A;  2CA5 A;  2PFV A;  2IDO B;  3PDY A;  3KV6 A;  3M3Z B;  3UUN A;  4WZX A;  3OVU A;  1YKH B;  4CI3 B;  1OED C;  4HEA A;  3ZYL A;  1UX4 A;  4YTN A;  4JI5 T;  2XHE B;  5A1L A;  2YU2 A;  2Q9Q B;  3CIR A;  4C91 A;  2WU2 A;  4O2B E;  4QXH B;  2LSK A;  1QUU A;  2B1E A;  2JQQ A;  3SWH A;  2P9B A;  2WAU A;  5JVD E;  3AED A;  5JDM A;  2KIN B;  3I0O A;  4L5G A;  4DMV A;  1U5P A;  4C90 A;  2HPL A;  5AQR B;  4CZZ B;  5LMN T;  3JAE A;  4KHP T;  4IT4 A;  4U2Z A;  4QH5 A;  1D1A A;  3TKL B;  5LGU B;  4TWD A;  3LK2 B;  4ZS2 A;  1HNX T;  1OWA A;  3RX6 A;  2FJD A;  4NUV A;  1SUM B;  2XAH B;  3AA7 B;  4LF5 T;  3J7Y q;  3QNU A;  5ABF A;  5FP3 A;  2DHR A;  5HEU A;  5LGN B;  3V5U A;  2J47 A;  3FZH B;  4UVC B;  4U31 A;  2C5J A;  1D0X A;  2XQ3 A;  2LOP A;  2E8I A;  2WY2 A;  2WQY A;  4Z90 A;  2N9D A;  2CCQ A;  5JTG A;  3NRX A;  3RQW A;  2ZM2 A;  3ZCJ A;  4COF A;  4CXX A;  4EV6 A;  3UU4 A;  3KV9 A;  2WZI A;  5ABG A;  4UF0 B;  1HF8 A;  2W2U A;  2UU9 T;  3HKB E;  5HXH A;  1WR0 A;  4IDP A;  5AQK B;  4ASK A;  2V5C A;  2KMF A;  3AE1 A;  2JQ9 A;  5HXR A;  4HFH A;  4O2A E;  2YDR A;  4GK0 E;  3QOF A;  2BG9 B;  1R8I A;  5FXX A;  3P4S A;  1MMN A;  2YDS A;  3FXD B;  4UV9 B;  3PU8 A;  2X9Y A;  4U3C A;  3RRC A;  2C0S A;  1N33 T;  3A7M A;  2WDQ A;  4HFI A;  4JBW F;  2XTL A;  2J62 A;  2BKN A;  2XM1 A;  2ODV A;  2CEA A;  1LKX A;  5JR9 A;  4DR5 T;  4HWC A;  3TLW A;  3IF8 B;  3OPC A;  3AEB A;  4YHH T;  4H63 H;  3AE5 A;  1E2A A;  1N34 T;  3FZK B;  3EAM A;  4QX7 B;  4ILA A;  2LM2 A;  2CXL A;  3HKC E;  3QUJ A;  1S35 A;  5HAX A;  5IYZ E;  2XAG B;  4JI8 T;  5LHG B;  2VKO A;  4DV4 T;  1ZHC A;  4TNV A;  2E5V A;  1Y01 A;  4FI5 A;  1L0V A;  2LLY A;  1E1H B;  4MHC A;  3AEG A;  2C5I T;  1ZP0 A;  2DWG A;  2N1G A;  4LMK A;  1N32 T;  5EK2 A;  3FXE B;  4EGW A;  5HEH A;  2D0U A;  4DV2 T;  2M67 A;  3ETU A;  2UXC T;  2JMK A;  2YIN A;  2I59 A;  5BR8 T;  5CFB A;  3UU8 A;  2CHN A;  3N9L A;  2KZ7 B;  4QWN B;  5CA1 E;  3QB5 A;  2JJ9 A;  3VR8 A;  2QRX A;  3CX6 B;  3HA4 A;  1X9B A;  3KV5 A;  2H3R A;  4PK4 A;  3EDV A;  4IE4 A;  2LRL A;  4I43 B;  3M65 A;  2WBL A;  2CE7 A;  4NIQ A;  3K3Q C;  2E9X B;  4EED A;  3AVR A;  2UUC T;  5DQV A;  3SFD A;  3GWH A;  1IAP A;  1OED E;  2UXB T;  4XBF B;  5AQM B;  2KSR A;  3K3O A;  1YQ3 A;  3C64 A;  4OK0 A;  5F5W A;  1W0A A;  4G2A A;  4H63 V;  5ABH A;  4AIU A;  3C4W A;  2DLR A;  4DR6 T;  4KX6 A;  3JCF A;  3K8P C;  3EDU A;  4ILC A;  2VAS A;  4B3M T;  3PUR A;  2V1D B;  4DBQ A;  5JR9 C;  4KP3 C;  1KEY A;  4LF6 T;  1YQ4 A;  1HFA A;  4HFV A;  1MIV A;  2A3D A;  3N2K E;  4CI2 B;  2QA7 A;  2HN2 A;  4XZC A;  4UV8 B;  2NTX A;  4H9O C;  3PUA A;  5IUX A;  2XAF B;  1QLB A;  5AQO B;  3L09 A;  4P09 A;  3NZQ A;  5KXJ A;  2V6Y A;  1LVF A;  1MMA A;  2WWU A;  2CBJ A;  2L9Q A;  3KBU A;  1HNW T;  3PUW F;  4LMJ A;  2VKD A;  1HR0 T;  4OX9 T;  3FB2 A;  4CN6 A;  3C4X A;  3GN5 B;  5LJM A;  1JNR A;  1NWM X;  2FJE A;  4JEH B;  5EK4 A;  3S4U A;  4YSZ A;  2XSA A;  3ZN1 B;  2KT9 A;  3NRY A;  5ABE A;  2BKO A;  4ZXL A;  3ZMU B;  3NWI A;  2A72 A;  4JI7 T;  2NR4 A;  2CXD A;  1M7K A;  5J0Z A;  4HFD A;  4JLE A;  4X65 T;  4PJN A;  1MIW A;  3ZMT B;  1M62 A;  5EK3 A;  4BAY B;  4J2C A;  1D1B A;  3MJX A;  2PBI A;  2YOE A;  5BMV E;  5AQQ B;  2BBJ A;  4I4T E;  2H7O A;  2A2F X;  3CML A;  4UVA B;  3N2O A;  1MNE A;  1ZOY A;  3L8R A;  2YU1 A;  4ZI7 E;  1CUN A;  4DUY T;  4DV5 T;  3I0Q A;  3V5S A;  4AKR B;  4CI1 B;  1NEK A;  2KND A;  5E0O A;  2VKH A;  4NUU A;  4X62 T;  3LSV A;  1IBL T;  2EHO A;  1WRD A;  3KDS E;  1XDP A;  3OBV E;  3LBX B;  3RYH E;  4L9I A;  5JRC B;  4DID B;  3BK9 A;  5AQN B;  3RHW A;  3Q5D A;  2LHR A;  3FBZ A;  3MK7 C;  2BG9 C;  3RRW A;  1KK7 A;  5ADX L;  4IDO A;  1HG2 A;  3O1J A;  2CLY C;  2DL1 A;  4FJO A;  4U7I A;  4X64 T;  4YSY A;  1G73 A;  5L3G B;  4DR1 T;  3AA1 B;  2L3L A;  2IC6 A;  3N2G E;  2M6B A;  4AQF C;  5AQU B;  4EYY R;  4ZI2 C;  2V6X A;  2AE9 A;  5DAB A;  2RP4 A;  3BQL A;  4ERR A;  3LJC A;  5LG3 A;  5FXV A;  2D0T A;  1HX1 B;  4CN1 A;  5HYA A;  4LF7 T;  4YFS A;  4HWD A;  1BR1 A;  4YXD A;  4A5X A;  3CQC B;  1YXR A;  1XNQ T;  4HGA A;  2LRK A;  2YEV C;  2VL0 A;  3R6N A;  4YTP A;  5HXE A;  3RH3 A;  4KMC A;  3AE4 A;  3PE0 A;  3JAF A;  3P4R A;  2W00 A;  4TV8 E;  3AXJ A;  2IAK A;  5J1G A;  2LHN A;  4WNK A;  2BS3 A;  2D2S A;  1N36 T;  4U74 A;  3E22 E;  1MMG A;  5IHY A;  3O9X A;  5L3C B;  3P4W A;  4UR9 A;  5LGT B;  2AXD S;  2BBH A;  3QC9 A;  1OXZ A;  1WYC A;  1MIY A;  2V8S V;  5AQH B;  4PJJ A;  4QH4 A;  5LBM A;  3JC6 D;  4ZOL E;  3K1S A;  4JI6 T;  1XWM A;  3ZSS A;  5H6Q B;  2Y8D A;  4ZZB A;  2DWK A;  3C51 A;  1IZN B;  3KIN B;  3X1D A;  1WLX A;  5L4E A;  4HFB A;  5DJQ C;  5HCJ A;  2E9X C;  3P4P A;  3MXZ A;  3ONJ A;  2UUB T;  4K0K T;  2NWB A;  5JDG A;  4E7S A;  2EHO C;  3C50 A;  2YN6 A;  3TLS A;  3RKG A;  5C3J A;  4GKK T;  1S94 A;  2WSS V;  4AKI A;  3HKD E;  4X5T A;  4G63 A;  2LSI A;  5KX5 E;  3NKZ A;  4ZS3 A;  4QKN A;  3VHL A;  2K48 A;  4O4H E;  5JDH A;  4EIW A;  4YHJ A;  3KV4 A;  2IC9 A;  5KDM C;  3PUQ A;  4HWF A;  2NW7 A;  1D1C A;  2RPA A;  1QSD A;  2ZM8 A;  2V7L A;  1I6Z A;  5IWA T;  5KMG P;  3CWZ B;  4OHF A;  5JDL A;  3PJA J;  5FVL A;  1YD8 G;  5LA6 E;  3N9M A;  3FHN A;  3TLV A;  4DUZ T;  2W62 A;  3Q5X A;  4DR2 T;  4OYK A;  3ZC1 A;  4ILB A;  4ZEY A;  4A98 A;  4JI0 T;  3PUX F;  4Z91 A;  5AQT B;  1GQE A;  1FEW A;  3ETV A;  1KNR A;  5AQJ B;  3PUY F;  4AKH A;  5FY1 A;  3AB3 B;  5C8Y E;  3HR0 A;  1ZEE A;  2Q9Q A;  2VQE T;  3T1H T;  2QGS A;  5HXS A;  2N2N A;  5HXC A;  4O4I E;  5EZY E;  4GIW A;  5AQS B;  3I9W A;  2NP9 A;  1OED B;  2VWA A;  4X20 E;  4AQG A;  5HEJ A;  5HWX A;  1XDO A;  3BQK A;  3O4X E;  4ZHQ E;  3O1H A;  5FXW A;  2PJQ A;  4IST A;  4IHJ E;  3AE8 A;  4NPP A;  4ZI3 C;  2BZB A;  3PUZ F;  1UCU A;  3P8C D;  3VRB A;  3PV0 F;  3MA9 A;  2KLQ A;  3IHR A;  3SFE A;  4YJ2 E;  2MTQ A;  2FJB A;  4DBR A;  3FBL A;  3ZT7 A;  4QXC B;  2C5K T;  4PFP A;  4PK6 A;  3VR9 A;  2X67 A;  3P50 A;  2X0L B;  2IUB A;  4PW8 A;  2ZMA A;  4B3S T;  3MAC A;  2BG9 E;  3KVA A;  2XAJ B;  2RA1 A;  4IE6 A;  3AAI A;  3CQG B;  3RIF A;  2CWY A;  2X0Y A;  2XAS B;  4BJM A;  3NZP A;  3H37 A;  1LRZ A;  2VL8 A;  2BS2 A;  5LOV E;  1KFY A;  3LK4 2;  5LCY A;  2D5U A;  4HWH A;  2DI4 A;  3CX8 B;  2ODU A;  2XAQ B;  4IL9 A;  1ZV4 X;  4UF0 A;  2GK9 A;  4DO0 A;  2WCA A;  3CPZ A;  2XQ8 A;  3RC8 A;  2ZM6 T;  1HG5 A;  2XJ7 A;  3VKG A;  3A8Y C;  2VVN A;  3RC3 A;  2HN1 A;  5LXT E;  3ZJ1 A;  2JIW A;  3G06 A;  3P7I A;  3UUB A;  2VUR A;  4PJL A;  2BG9 A;  1LVK A;  1FMW A;  4DV0 T;  5F3J A;  5CB4 E;  3AE9 A;  4I55 E;  3N5L A;  3EVY A;  1J5W A;  4AIS A;  4ILU A;  3ZT6 A;  1X79 A;  3WAJ A;  3LK3 B;  2K9A A;  2NTY A;  3P4Q A;  4KUM B;  1XMQ T;  1W0B A;  3WI3 A;  2KXP B;  2W0G A;  2CWO A;  2ZM0 A;  1T98 A;  4HE8 A;  4AQF A;  4ANJ A;  2VVS A;  4AKL A;  3K3N A;  1UGO A;  2SPC A;  2Q9Q C;  1DU2 A;  1BR4 A;  3N9Q A;  5L47 A;  1YW0 A;  2XQ4 A;  5L3B B;  3PUG A;  4JI2 T;  2UUA T;  4TN7 B;  1E7P A;  2WZH A;  2FBW A;  5FKY A;  1HCI A;  2XQ5 A;  2VKJ A;  2OA5 A;  3QB5 K;  5JQG E;  1T7S A;  5HEG A;  5ETW A;  2LM9 A;  3OYX A;  4U7Y A;  2V7M A;  5CGM A;  4P0A A;  3I1A A;  2WMN A;  2MBG A;  3ESL A;  2HH7 A;  4U72 A;  2CHO A;  2X66 A;  5J2T E;  3RPU A;  1SA0 E;  4OYJ A;  2XQA A;  2LEH A;  3GA8 A;  3RIA A;  5LJN A;  2IIU A;  5LHI B;  1Y64 B;  4TV9 E;  2M6I A;  3CX7 B;  2MAW A;  4X66 T;  4QXB B;  3SOL A;  4DR7 T;  3IEE A;  3OJA A;  3ZN0 B;  2WM9 A;  4UVB B;  4AXP A;  2JQH A;  3T1Y T;  4QX8 B;  4P0B A;  4KHZ F;  5L4H A;  2Y48 B;  5ABF B;  1HS7 A;  4YJ3 E;  2E9X A;  3I9Y A;  2BKP A;  3TLT A;  2QVA A;  3IA3 A;  4JYA T;  3UT5 E;  3RI5 A;  5AQP B;  4JI3 T;  2ACX A;  4GK5 E;  1IBM T;  3RF1 A;  2LKH A;  3A5X A;  2VK9 A;  3BQI A;  5AQV B;  2NOX A;  3Q5E A;  4PFO A;  4PK5 A;  2ES0 A;  3RIU A;  1VCT A;  5LYJ E;  4JI1 T;  4IDN A;  3B5M A;  3ABV A;  5DQW A;  3EI0 A;  4LFA T;  2QYW A;  4KBM B;  1US7 B;  4AKG A;  3FZF B;  3PUS A;  1SE7 A;  5FMN A;  1WYB A;  4YLH A;  2XSB A;  5FNV E;  4DND A;  2X9H A;  4B3R T;  3PUV F;  4HFE A;  4LFB T;  1WR6 A;  3AA0 B;  4IE5 A;  2F4V T;  4OFZ A;  4PAG A;  3GMI A;  2MYS A;  4LF9 T;  4O4J E;  1SHZ C;  5AQG B;  3AE2 A;  2IML A;  4YTM A;  4EAH A;  5JR9 B;  3AEE A;  2CMR A;  3EAB A;  3ZMV B;  4YT0 A;  3RLF F;  4JEU B;  1D0Y A;  4LF8 T;  3QK6 A;  5LBQ B;  2V7I A;  1Z0P A;  4WBN E;  4TWF A;  3JAD A;  2YK0 A;  4EEB A;  3N9P A;  4UIG A;  5LB7 B;  2YDQ A;  3ZCI A;  2XUE A;  3GN5 A;  4GYS A;  3CK6 A;  4IL4 A;  4DR3 T;  3AE6 A;  2NW9 A;  3ZKR A;  3RYF E;  1FIO A;  3KFW X;  2XY8 B;  4CXW A;  4GOU A;  4ZI3 D;  5JH7 E;  2KWH A;  4GYR A;  5GON E;  2H89 A;  1EZ3 A;  2H7V C;  5LNK A;  4CXY A;  3MZK B;  3UUM A;  4DV1 T;  1YKE B;  5FY0 A;  5F8P A;  3UU3 A;  2Y6X A;  3ZYM A;  2V5D A;  1HNZ T;  3AAA B;  2IHR 1;  5JDN A;  1UUR A;  3SS1 A;  2OLT A;  5FVK A;  4JI4 T;  3KVB A;  1AJ3 A;  3F57 A;  4WYV A;  4QHO A;  3EHZ A;  2FUP A;  2E2A A;  3AE3 A;  4H9S E;  4XAX B;  4JUY A;  4QH1 A;  3OTO T;  4NXM T;  1J1J A;  4I50 E;  4H9Q C;  4LML A;  3UU6 A;  4O4L E;  3H3A A;  2XQ6 A;  3OKQ A;  1BR2 A;  3LBX A;  3ZJ2 A;  1WFD A;  2UXX B;  2WS3 A;  1IJ5 A;  3RYI E;  2V7J A;  3U78 A;  5JRC A;  1VOM A;  3ZST A;  3AAE B;  3RIU C;  1MMD A;  4DR4 T;  1FMV A;  4A56 A;  3OYZ A;  3AVS A;  2B76 A;  4I0U A;  4HTE A;  2WDV A;  5TAO A;  1XZY A;  5LHH B;  1J5E T;  4UXN B;  3CKD A;  2W66 A;  2IW5 B;  2XZE A;  3IBP A;  4F8H A;  4EB6 E;  1VCS A;  3ANW B;  4U33 A;  3CQX C;  4BJN A;  2MPK A;  2CLY B;  3LFM A;  2BS4 A;  4Q25 A;  2CBI A;  3NVO A;  1U4Q A; 
#chains in the Genus database with same CATH homology
 3Q5D A;  1XZY A;  3IA3 A;  3Q5E A;  1W0B A;  3QOF A;  3QNU A;  3OVU A;  4IDP A;  3X1D A;  4IDQ A;  4IDN A;  4IDO A;  1W09 A;  1Z8U A;  1W0A A;  1Y01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...