1Y01A

Crystal structure of ahsp bound to fe(ii) alpha-hemoglobin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
LLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Molecular mechanism of AHSP-mediated stabilization of alpha-hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxygen storage/transport
total genus 35
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1y01A00
3X1DA 1Y01A 4IDNA 4IDOA 1W09A 4IDPA 3IA3A 3Q5EA 3QNUA 3QOFA 3OVUA 1W0AA 3Q5DA 1Z8UA 4IDQA 1XZYA 1W0BA
chains in the Genus database with same CATH superfamily
1WR0A 3FZLB 5H6QB 4DV1T 1N33T 5FXVA 2VWAA 2ZLYA 2W4XA 3C50A 1IZNB 2JMHA 3MA9A 4DNDA 2CBIA 3FZKB 5M4YA 4PK5A 3NBXX 2XZEA 2E9XC 3RIUC 1D1AA 4JI3T 2IAKA 4GYSA 1M7KA 3WAJA 1BR1A 2WM9A 3C4XA 3NWIA 5LBQB 4EEBA 3CKDA 2XTLA 3TKLB 4OYKA 4DO0A 5AQUB 4GIWA 3A7MA 5JDHA 4QKNA 3OYZA 1KNRA 4UELA 3UU8A 4NXNT 1CHUA 3NRYA 5ABGA 3UU3A 5HCMA 3K3NA 1HCIA 3HKCE 3JAFA 3AB3B 5LMNT 4K0KT 5JR9A 5HAXA 3PUVF 2MOZA 4WNKA 3UFGA 4PNIA 2EHOD 4EOZB 3PUYF 2BKOA 2DI4A 2YKSA 2H3RA 1O3XA 2X9HA 3UUBA 5JR9B 4HTEA 3RRCA 4X66T 2LRKA 2QYWA 5AQIB 3FZFB 3O4XE 2E9XD 3IBPA 2VL8A 5LGNB 3PJAA 4TWHA 4OFZA 2X66A 3RX6A 2VQET 2M67A 1YKEB 2IHR1 5HEUA 3ZJ1A 2XQ8A 3UUXB 3I9YA 4B3RT 4KBMB 4FI5A 5AQGB 3P4WA 4XZCA 3RKGA 3F31A 1ZOYA 2CHOA 4TV8E 2J4GA 5HEOA 3P50A 4X1IE 1WRDA 3AE3A 3E08A 2J62A 4QXHB 4DV3T 1MIYA 2ZM0A 4UF0A 2QRXA 1LKXA 4KI0F 5AQSB 5JREA 4IDNA 1MMNA 2FBWA 1J5WA 4WYVA 4U74A 4UF0B 2XSBA 4UR9A 4EYUA 3IEEA 3L39A 1MMDA 5HYAA 3QB5A 5AQPB 2OV9A 1FEWA 3LFMA 2H7OA 3J9X1 4DR7T 5HEGA 3ZYLA 2A2FX 3C98B 1FMWA 5J1GA 5JDQA 4NXMT 5EK4A 3PJAJ 3PU3A 3N9PA 3VHLA 3B5MA 3A5XA 5AQNB 4KHZF 1J5ET 3OVUA 3IF8B 1MMGA 3M65A 3JC6C 4NUUA 4YTMA 2FJEA 3BQIA 4ZEYA 2N2NA 5DABA 3CX8B 2LT3A 4X1YE 4YLHA 2W66A 5LGUB 4PW8A 4JI4T 5HXCA 3LJCA 2IDOB 2MAWA 3PDYA 1HG5A 3OBVE 4A56A 2YK0A 4GYRA 1IJ5A 2FJAA 3K3OA 4LF6T 4IE7A 2NTXA 3QOFA 1XDPA 4IL4A 4X20E 5JR9C 1G8XA 3I0OA 4ILAA 3ZMUB 1MNEA 5KMGP 1W9RA 3CQXC 4CZZB 3ZMSB 3CIRA 2XQ5A 3MACA 3ZLIA 4WW0A 4DMWA 1W09A 5DQWA 4PJNA 4U7YA 3PUAA 1YD8G 2WWUA 3BQKA 1X79A 3NZPA 4H9PC 2JMKA 1XWMA 3GMIA 3PUZF 4F8HA 4JI8T 1MNDA 5L3FB 2CXFA 5L3GB 5KDMC 3QB5K 2CXDA 3JC6D 2W61A 3V5UA 2WWVA 3H37A 3B13A 5FXXA 5BR8T 2XM2A 4U31A 3CWZB 4YJ2E 2XPKA 1S35A 2R6GF 1HX1B 3CQCB 3Q9DA 4HWHA 4TNWA 4DV6T 2LLYA 3L09A 2WB5A 2IC9A 2KWHA 4O4LE 3AE8A 4CXWA 2FJBA 4IE5A 2JQHA 2HN2A 3EI0A 3ZMTB 2LSKA 4QH1A 3VRBA 4ZI3C 4JI7T 3P8CD 3AA6B 4H9RC 1D0YA 3FXDB 1KNZA 4V1Av 2DCFA 1N32T 1US7B 2VURA 2VKDA 5FVKA 2KINB 2E9XB 2PBIA 4U2ZA 4U2YA 4JI0T 3N2OA 2LSGA 2WCAA 3CQGB 4P1NA 3I1AA 2K3WA 1OEDB 3R84B 5AQFB 3KV9A 3HA4A 1EZ3A 3C51A 2VKOA 3O1HA 2X67A 4QH4A 4COFA 4AKHA 4AI6A 3NZQA 4C90A 5AQOB 5CB4E 1XNQT 5CFBA 3KVBA 1YXRA 4DV0T 2YN6A 3ZKRA 2HPJA 3ZYMA 3AE5A 4DR6T 3UQ7A 2BKPA 3CX6B 1BR4A 4IT4A 4NIQA 2V7JA 4BJMA 5FVLA 1B7TA 2CBJA 3KVAA 2KSRA 1KNPA 4ZI3D 2I6HA 2B76A 1T8BA 5LMUT 4B6XA 2C0SA 3UFEA 5H6RB 3SWHA 2CCQA 2WZIA 2RP4A 2LM2A 5EK2A 3LSVA 3ZMZB 1LRZA 3N5LA 4PK6A 3AE7A 4JI5T 4QHOA 1Z0PA 1NWMX 2AXDS 5LXTE 1UURA 1NENA 1WFDA 4I0UA 4ZOLE 4ZI7E 3DTOA 4DV5T 4G2AA 1OWAA 3RLFF 4YHJA 3ONLC 2KT9A 3J7Yq 2QGSA 4Z90A 2XUEA 4ZHQE 2X9XA 2DLRA 3H3MA 4YJ3E 4CXXA 2MBGA 5LNKA 3JADA 3EDVA 1S94A 4H9NC 2H88A 3RQWA 4IE0A 4LFAT 4Q25A 3Q2MA 2HH7A 2WY2A 3AAIA 2BZBA 2XSAA 4LMKA 2VB6A 4KUMB 3N9MA 4AKLA 2A9UA 2NTYA 2H7VC 3OJAA 4DBRA 1Y64B 2Y6XA 4HN9A 2NP9A 5C2TA 2AE9A 2E8IA 4BJNA 4O4HE 3K3QC 2PTFA 4I4TE 5JRCB 2ACXA 2VQFT 3OPCA 2BG9A 4YTPA 3M3ZB 1UCUA 3N9OA 4GK5E 4ERRA 1QUUA 2WDVA 1NEKA 4LF7T 4DV7T 5E0OA 1OEDC 2V7LA 2BG9B 4QWNB 2DWGA 3FBZA 4BA9A 4MBQA 4JLEA 5JVDE 3UT5E 1E2AA 5FY1A 1HS7A 3E22E 5JDNA 3AE1A 3AEAA 3ZCJA 3O1IA 3WAKA 3FXEB 4O2AE 2D2SA 2K24A 3C4WA 5ABHA 5L47A 5LHGB 2VL0A 3F2EA 1G73A 5FYMA 2ODVA 4EXTA 4ZI2C 3ONXA 1W0AA 4AQGA 4CXYA 4DUYT 1CUNA 5DQVA 1MIVA 4KMCA 4IDQA 4TN7B 2X0HA 5C3JA 4ADZA 5LP6E 5C8YE 3PURA 1XMQT 2CHNA 3KFWX 1D0XA 1KEYA 4IDOA 2LSYA 4EEDA 4H9QC 4L9IA 3R6NA 3ZSSA 2LEHA 3FB2A 1KFYA 2CPTA 4HEAA 3HI2A 3K8PC 3LK42 4E7ZA 2RPAA 2CA5A 3KBTA 2V26A 5L3CB 4AKIA 4DR1T 4TWDA 1VCTA 4CQIA 4JYAT 4P0BA 2IMLA 1W0BA 3EUHA 4WBNE 5L3EB 2WDQA 2NWBA 3OKQA 2KZ7B 4TUYE 4C91A 4X5TA 4YT0A 2Q9QA 2BBJA 4HFCA 4HE8A 1J1JA 2X0LB 3WI3A 4AQFA 3PE0A 1BR2A 2P9BA 4HWDA 2XAGB 4GK0E 2BBHA 3P7IA 5LG4A 3CX7B 4ZI2D 3OTOT 2XASB 1UK5A 1XDOA 2JQ9A 4UVCB 2RA1A 2D0UA 5AQLB 3AEEA 3SOLA 2W63A 4O2BE 2CM0A 4FJOA 3Q5WA 4IE4A 1LVFA 4NPPA 1D0ZA 3ZC0A 5FL0A 4ISTA 2LM9A 5AQVB 2VK9A 1HNXT 5AQTB 2LSJA 3DP7A 1HTJF 2BG9C 2NW7A 5EK3A 1OEDE 4IDZA 3QUJA 4HKAA 1IBKT 4M1PA 2BVMA 3AAAB 3AEBA 1WLXA 2C5KT 2HHHT 3RHWA 2ACZA 5FY7A 4IGUA 3RRWA 3UULA 4UVBB 2WBLA 2JIWA 3W15B 4MALA 3AVSA 3FZHB 2CWOA 4I55E 4YY3T 2V1DB 3LK3B 2L8KA 2W2UA 3RGLA 4LMJA 3RQUA 5L2LA 4YFSA 2SPCA 2LE8A 4TZ4C 1ZP0A 5CA0E 3CPZA 4EAHA 1UGOA 3Q5DA 3PUWF 1ZEEA 5FKYA 2XAHB 4YTNA 3PV0F 1VRBA 2BKNA 5ABEA 3HKBE 5HCJA 4CI2B 4EYYR 3ZT7A 5HEJA 1SA0E 5TAOA 4EV6A 3B57A 4DR2T 4PJMA 3HR0A 4A98A 4L5GA 4N78D 1FIOA 2FUPA 3P4QA 1U5PA 2XM1A 4DIDB 3ZYKA 4EZ4A 3SRZA 2LRLA 3AVRA 5LBMA 4ASKA 3UQ4A 5L4EA 5LHIB 2V6YA 3N9QA 4YHHT 2UUCT 5HWYA 4DR3T 3TLSA 5L3BB 2JQQA 4AQFC 2V7MA 4CN1A 4EIWA 2XAFB 2L9QA 5FY0A 3T1HT 4LFCT 2EHOA 4YXDA 5AQQB 5KX5E 4X1KE 5F5WA 4YSZA 2WQYA 3FBLA 3HL6A 3T1YT 3RIUA 2HPLA 1VOMA 5LB7B 3RYCE 3KV5A 3AXJA 2CE7A 2XQ3A 3CMLA 2WU5A 2BG9E 1N36T 2X9WA 4JI1T 3MKDA 4DV2T 5JTGA 3VR8A 3RIFA 3QK6A 4O8SA 3RKOA 3FHNA 3BK9A 2KNDA 5LHHB 4HFVA 2BDEA 1T7SA 2WS3A 4IREA 3VU7H 3GN5A 3ABVA 2ES0A 4GKJT 5HXEA 1D1BA 3G06A 1MIWA 2YU2A 3AEGA 4HWCA 3TLVA 3C64A 3RI5A 3ZN1B 5JDGA 2UXBT 4YSXA 1XZYA 5GONE 4CN6A 2D9DA 1HF8A 4QXCB 5LYJE 2K5BB 2YU1A 1U4QA 5ABFA 2G0UA 4UXNB 4GOUA 5FMNA 3P4SA 3GWHA 3C4ZA 4J2CA 2VVNA 3VRAA 3PU8A 2KXPB 2CMRA 2WDRA 5FXZA 4TWFA 2JQKA 1XMOT 3RC8A 4P0AA 1D1CA 2FJDA 4AKGA 3RH3A 2BS4A 4XAXB 4WZXA 4PAGA 2M6IA 3RF1A 3PUSA 3AA7B 3K1SA 4PJLA 3CVRA 5ETWA 1Y01A 5HEHA 1I6ZA 5FL1A 4UVAB 1NAFA 2VKJA 3JAEA 3I9WA 1YQ3A 4MFRA 4UEMA 4CI1B 1ZV4X 4DV4T 2ODUA 2W0GA 2OA5A 4CI3B 1YQ4A 2IUBA 4O4JE 4U7IA 1IJ6A 2JJ9A 2C5IT 2QVAA 4L0RA 4DBQA 2YDQA 2LJLA 3ZT5A 4KP3C 3SFEA 2E5LT 3MK7C 4DMVA 3EDUA 3I0QA 4ZZCA 2K9AA 4QX8B 3LK2B 1DU2A 2M6BA 1QSDA 5FP3A 3VKHA 5IWAT 3MXZA 1H7CA 3ZT6A 1KF6A 4JI2T 2V5DA 2NR4A 2PFVA 3AE9A 5AQMB 2X68A 1WYCA 1HNZT 2CLYB 5HXRA 4EGWA 2UXCT 4JEUB 5F8PA 4JBWF 2CRBA 3ZEFB 4LF5T 5AQRB 5IHYA 4H9SE 2VVSA 2HN1A 4QX7B 2CXLA 3CK6A 2DHRA 1UUSA 4F6RC 2MTQA 3TLUA 4PFPA 4TX5A 1GQEA 2F4VT 3RIAA 4AKRB 4B3MT 3UU5A 4JV5T 3FZMB 2A3DA 1R8IA 3RYFE 4OYJA 3AE4A 4HFHA 4U3CA 4EZHA 4ANJA 2PJQA 3L3PA 1MMAA 2N9DA 3D0TA 2YDSA 2XQ9A 3NVOA 2WAUA 1BR0A 4X65T 2V5CA 2UUBT 3DJBA 3UU6A 1YW0A 2V6XA 2LOPA 2UXXB 1E7PA 5KXJA 4Z8XA 4LF4T 5AFUL 1LVKA 4IDPA 2A72A 3ZMVB 2ZMAA 3NRXA 3ANWA 4EB6E 5LJMA 1IBMT 2IW5B 2XAJB 1WCRA 4HWFA 5LJNA 2PG8A 5AQKB 3P4RA 1WYBA 2Q9QB 3F57A 2XAQB 2XJ7A 3TLWA 3ANWB 2GK9A 4DR5T 3QC9A 3HKEE 4AQYT 3MZKB 3NKZA 4U72A 2BS3A 4LFBT 3GA8A 2D0TA 3N9NA 2LKGA 5JQGE 2XY8B 1SE7A 2UXNB 3LDQB 4PFOA 2Y48B 3ZN0B 4KHPT 1HX8A 4WBOA 4G63A 4NUVA 2NOXA 4X64T 2XQ4A 1HR0T 4P09A 2C5JA 2H89A 1UX4A 3UU4A 1UX5A 1XNRT 3UTKA 3EVYA 1KK7A 3N2GE 2CLYC 3N9LA 2W00A 3X1DA 5L4HA 3OYXA 4ZZBA 3ONJA 4XBFB 3SS1A 1SUMB 2LKHA 4DVDA 2Z6EA 4GKKT 4BAYB 5AQHB 4E7SA 4H9OC 3ZC1A 3U3IA 3KDSE 2VASA 2WU2A 3RPUA 3UUNA 4TNVA 2K48A 3PUXF 3U78A 2YOEA 2ZM8A 4B3TT 5JDLA 3A8YC 3O1JA 2QA7A 5LG3A 4LF8T 4AISA 1N34T 2Y8DA 2WZHA 1I94T 4OX9T 2E5VA 2L3LA 5LCYA 2WMOA 4JEHB 1HG2A 3QNUA 2V8SV 2X9YA 2W62A 2LHRA 3AE2A 1JNZA 2LOSA 1FMVA 3VKGA 2MYSA 5A1LA 4Z91A 4K0UA 2YDRA 1OXZA 5JDMA 4HGAA 3EAMA 3VR9A 4B3ST 1V9DA 2I59A 1T72A 4O4IE 4ILBA 5HWXA 3E0ZA 2DNXA 4IHJE 2WSSV 3H3AA 4H63H 2WMNA 4ZS2A 1AJ3A 4I50E 2I0MA 2Q9QC 4HWIB 3RC3A 5CA1E 2V6YB 5AQJB 3ZCIA 3T8OA 3Q5EA 4IE6A 4CN4A 3Q5XA 2J47A 4MLKA 5IYZE 4LMLA 4IL9A 5HXHA 5ADXL 1Z8UA 1ZHCA 3RYIE 2JPFA 1HNWT 5LA6E 4PK4A 4ILUA 4U33A 2JRKA 4IIJE 2ZM2A 2E2AA 2WP9A 4HFBA 4AXPA 4A97A 5J2TE 2DL1A 1IAPA 3TLTA 4ISSA 2LSIA 2EHOB 4HFDA 1M62A 3LBXA 5LGTB 5IUXA 4DUZT 5J0ZA 2E9XA 4ZS3A 3KINB 5L3DB 4HFIA 3SFDA 2IC6A 3AEDA 1YKHB 3KV6A 4UV9B 2V7KA 1OEDA 3LBXB 5EZYE 2W67A 2XQ7A 4PJJA 4YSYA 3AXJB 4TV9E 4A5XA 1X9BA 4HFEA 4H63V 4UV8B 4I43B 3ZJ2A 3KV4A 3BQLA 5CGMA 2V7IA 2Q9QD 2NW9A 3ESLA 3UUMA 2VKHA 2LHNA 1L0VA 4KX6A 4QXBB 5FNVE 2XQAA 3GN5B 4JI6T 2IIUA 4MHCA 2BS2A 3AA1B 5JH7E 4OK0A 3KBUA 2XQ6A 4UIGA 4JUYA 3AA0B 3AE6A 2UXDT 3JCFA 1FJGT 3PUGA 1SHZC 2MPKA 5BMVE 5HXSA 5ABFB 2B1EA 2DWKA 3IHRA 5FXWA 2J1DG 2CEAA 3MJXA 5JDFA 1ZKEA 4LF9T 2CWYA 2XHEB 3PTRB 3EHZA 1WR6A 2KWIB 2KLQA 2BVLA 3HKDE 3ETUA 5J2UE 4AIUA 3IA3A 2YINA 3L8RA 3RYHE 2YEVC 3LG7A 3V5SA 1T98A 3AAEB 3PUQA 2OLTA 5F3JA 1VCSA 2D5UA 2KMFA 3S4UA 3ETVA 2UU9T 3P4PA 2N1GA 2ZM6T 3AECA 2XQYA 2X0YA 1JNRA 3AEFA 1IBLT 1HFAA 4ILCA 5LOVE 2UUAT 5CJ5A 5DJQC 4DR4T 3EABA 4QH5A 2X51A 3N2KE 4X62T 2EHOC 3O9XA 1QLBA 4OHFA 1E1HB 5JRCA 2NW8A 4ZXLA 3ZSTA 3ZPOA
chains in the Genus database with same CATH topology
3X1DA 1Y01A 4IDNA 4IDOA 1W09A 4IDPA 3IA3A 3Q5EA 3QNUA 3QOFA 3OVUA 1W0AA 3Q5DA 1Z8UA 4IDQA 1XZYA 1W0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3X1D A;  1Y01 A;  4IDN A;  4IDO A;  1W09 A;  4IDP A;  3IA3 A;  3Q5E A;  3QNU A;  3QOF A;  3OVU A;  1W0A A;  3Q5D A;  1Z8U A;  4IDQ A;  1XZY A;  1W0B A; 
#chains in the Genus database with same CATH topology
 1WR0 A;  3FZL B;  5H6Q B;  4DV1 T;  1N33 T;  5FXV A;  2VWA A;  2ZLY A;  2W4X A;  3C50 A;  1IZN B;  2JMH A;  3MA9 A;  4DND A;  2CBI A;  3FZK B;  5M4Y A;  4PK5 A;  3NBX X;  2XZE A;  2E9X C;  3RIU C;  1D1A A;  4JI3 T;  2IAK A;  4GYS A;  1M7K A;  3WAJ A;  1BR1 A;  2WM9 A;  3C4X A;  3NWI A;  5LBQ B;  4EEB A;  3CKD A;  2XTL A;  3TKL B;  4OYK A;  4DO0 A;  5AQU B;  4GIW A;  3A7M A;  5JDH A;  4QKN A;  3OYZ A;  1KNR A;  4UEL A;  3UU8 A;  4NXN T;  1CHU A;  3NRY A;  5ABG A;  3UU3 A;  5HCM A;  3K3N A;  1HCI A;  3HKC E;  3JAF A;  3AB3 B;  5LMN T;  4K0K T;  5JR9 A;  5HAX A;  3PUV F;  2MOZ A;  4WNK A;  3UFG A;  4PNI A;  2EHO D;  4EOZ B;  3PUY F;  2BKO A;  2DI4 A;  2YKS A;  2H3R A;  1O3X A;  2X9H A;  3UUB A;  5JR9 B;  4HTE A;  3RRC A;  4X66 T;  2LRK A;  2QYW A;  5AQI B;  3FZF B;  3O4X E;  2E9X D;  3IBP A;  2VL8 A;  5LGN B;  3PJA A;  4TWH A;  4OFZ A;  2X66 A;  3RX6 A;  2VQE T;  2M67 A;  1YKE B;  2IHR 1;  5HEU A;  3ZJ1 A;  2XQ8 A;  3UUX B;  3I9Y A;  4B3R T;  4KBM B;  4FI5 A;  5AQG B;  3P4W A;  4XZC A;  3RKG A;  3F31 A;  1ZOY A;  2CHO A;  4TV8 E;  2J4G A;  5HEO A;  3P50 A;  4X1I E;  1WRD A;  3AE3 A;  3E08 A;  2J62 A;  4QXH B;  4DV3 T;  1MIY A;  2ZM0 A;  4UF0 A;  2QRX A;  1LKX A;  4KI0 F;  5AQS B;  5JRE A;  4IDN A;  1MMN A;  2FBW A;  1J5W A;  4WYV A;  4U74 A;  4UF0 B;  2XSB A;  4UR9 A;  4EYU A;  3IEE A;  3L39 A;  1MMD A;  5HYA A;  3QB5 A;  5AQP B;  2OV9 A;  1FEW A;  3LFM A;  2H7O A;  3J9X 1;  4DR7 T;  5HEG A;  3ZYL A;  2A2F X;  3C98 B;  1FMW A;  5J1G A;  5JDQ A;  4NXM T;  5EK4 A;  3PJA J;  3PU3 A;  3N9P A;  3VHL A;  3B5M A;  3A5X A;  5AQN B;  4KHZ F;  1J5E T;  3OVU A;  3IF8 B;  1MMG A;  3M65 A;  3JC6 C;  4NUU A;  4YTM A;  2FJE A;  3BQI A;  4ZEY A;  2N2N A;  5DAB A;  3CX8 B;  2LT3 A;  4X1Y E;  4YLH A;  2W66 A;  5LGU B;  4PW8 A;  4JI4 T;  5HXC A;  3LJC A;  2IDO B;  2MAW A;  3PDY A;  1HG5 A;  3OBV E;  4A56 A;  2YK0 A;  4GYR A;  1IJ5 A;  2FJA A;  3K3O A;  4LF6 T;  4IE7 A;  2NTX A;  3QOF A;  1XDP A;  4IL4 A;  4X20 E;  5JR9 C;  1G8X A;  3I0O A;  4ILA A;  3ZMU B;  1MNE A;  5KMG P;  1W9R A;  3CQX C;  4CZZ B;  3ZMS B;  3CIR A;  2XQ5 A;  3MAC A;  3ZLI A;  4WW0 A;  4DMW A;  1W09 A;  5DQW A;  4PJN A;  4U7Y A;  3PUA A;  1YD8 G;  2WWU A;  3BQK A;  1X79 A;  3NZP A;  4H9P C;  2JMK A;  1XWM A;  3GMI A;  3PUZ F;  4F8H A;  4JI8 T;  1MND A;  5L3F B;  2CXF A;  5L3G B;  5KDM C;  3QB5 K;  2CXD A;  3JC6 D;  2W61 A;  3V5U A;  2WWV A;  3H37 A;  3B13 A;  5FXX A;  5BR8 T;  2XM2 A;  4U31 A;  3CWZ B;  4YJ2 E;  2XPK A;  1S35 A;  2R6G F;  1HX1 B;  3CQC B;  3Q9D A;  4HWH A;  4TNW A;  4DV6 T;  2LLY A;  3L09 A;  2WB5 A;  2IC9 A;  2KWH A;  4O4L E;  3AE8 A;  4CXW A;  2FJB A;  4IE5 A;  2JQH A;  2HN2 A;  3EI0 A;  3ZMT B;  2LSK A;  4QH1 A;  3VRB A;  4ZI3 C;  4JI7 T;  3P8C D;  3AA6 B;  4H9R C;  1D0Y A;  3FXD B;  1KNZ A;  4V1A v;  2DCF A;  1N32 T;  1US7 B;  2VUR A;  2VKD A;  5FVK A;  2KIN B;  2E9X B;  2PBI A;  4U2Z A;  4U2Y A;  4JI0 T;  3N2O A;  2LSG A;  2WCA A;  3CQG B;  4P1N A;  3I1A A;  2K3W A;  1OED B;  3R84 B;  5AQF B;  3KV9 A;  3HA4 A;  1EZ3 A;  3C51 A;  2VKO A;  3O1H A;  2X67 A;  4QH4 A;  4COF A;  4AKH A;  4AI6 A;  3NZQ A;  4C90 A;  5AQO B;  5CB4 E;  1XNQ T;  5CFB A;  3KVB A;  1YXR A;  4DV0 T;  2YN6 A;  3ZKR A;  2HPJ A;  3ZYM A;  3AE5 A;  4DR6 T;  3UQ7 A;  2BKP A;  3CX6 B;  1BR4 A;  4IT4 A;  4NIQ A;  2V7J A;  4BJM A;  5FVL A;  1B7T A;  2CBJ A;  3KVA A;  2KSR A;  1KNP A;  4ZI3 D;  2I6H A;  2B76 A;  1T8B A;  5LMU T;  4B6X A;  2C0S A;  3UFE A;  5H6R B;  3SWH A;  2CCQ A;  2WZI A;  2RP4 A;  2LM2 A;  5EK2 A;  3LSV A;  3ZMZ B;  1LRZ A;  3N5L A;  4PK6 A;  3AE7 A;  4JI5 T;  4QHO A;  1Z0P A;  1NWM X;  2AXD S;  5LXT E;  1UUR A;  1NEN A;  1WFD A;  4I0U A;  4ZOL E;  4ZI7 E;  3DTO A;  4DV5 T;  4G2A A;  1OWA A;  3RLF F;  4YHJ A;  3ONL C;  2KT9 A;  3J7Y q;  2QGS A;  4Z90 A;  2XUE A;  4ZHQ E;  2X9X A;  2DLR A;  3H3M A;  4YJ3 E;  4CXX A;  2MBG A;  5LNK A;  3JAD A;  3EDV A;  1S94 A;  4H9N C;  2H88 A;  3RQW A;  4IE0 A;  4LFA T;  4Q25 A;  3Q2M A;  2HH7 A;  2WY2 A;  3AAI A;  2BZB A;  2XSA A;  4LMK A;  2VB6 A;  4KUM B;  3N9M A;  4AKL A;  2A9U A;  2NTY A;  2H7V C;  3OJA A;  4DBR A;  1Y64 B;  2Y6X A;  4HN9 A;  2NP9 A;  5C2T A;  2AE9 A;  2E8I A;  4BJN A;  4O4H E;  3K3Q C;  2PTF A;  4I4T E;  5JRC B;  2ACX A;  2VQF T;  3OPC A;  2BG9 A;  4YTP A;  3M3Z B;  1UCU A;  3N9O A;  4GK5 E;  4ERR A;  1QUU A;  2WDV A;  1NEK A;  4LF7 T;  4DV7 T;  5E0O A;  1OED C;  2V7L A;  2BG9 B;  4QWN B;  2DWG A;  3FBZ A;  4BA9 A;  4MBQ A;  4JLE A;  5JVD E;  3UT5 E;  1E2A A;  5FY1 A;  1HS7 A;  3E22 E;  5JDN A;  3AE1 A;  3AEA A;  3ZCJ A;  3O1I A;  3WAK A;  3FXE B;  4O2A E;  2D2S A;  2K24 A;  3C4W A;  5ABH A;  5L47 A;  5LHG B;  2VL0 A;  3F2E A;  1G73 A;  5FYM A;  2ODV A;  4EXT A;  4ZI2 C;  3ONX A;  1W0A A;  4AQG A;  4CXY A;  4DUY T;  1CUN A;  5DQV A;  1MIV A;  4KMC A;  4IDQ A;  4TN7 B;  2X0H A;  5C3J A;  4ADZ A;  5LP6 E;  5C8Y E;  3PUR A;  1XMQ T;  2CHN A;  3KFW X;  1D0X A;  1KEY A;  4IDO A;  2LSY A;  4EED A;  4H9Q C;  4L9I A;  3R6N A;  3ZSS A;  2LEH A;  3FB2 A;  1KFY A;  2CPT A;  4HEA A;  3HI2 A;  3K8P C;  3LK4 2;  4E7Z A;  2RPA A;  2CA5 A;  3KBT A;  2V26 A;  5L3C B;  4AKI A;  4DR1 T;  4TWD A;  1VCT A;  4CQI A;  4JYA T;  4P0B A;  2IML A;  1W0B A;  3EUH A;  4WBN E;  5L3E B;  2WDQ A;  2NWB A;  3OKQ A;  2KZ7 B;  4TUY E;  4C91 A;  4X5T A;  4YT0 A;  2Q9Q A;  2BBJ A;  4HFC A;  4HE8 A;  1J1J A;  2X0L B;  3WI3 A;  4AQF A;  3PE0 A;  1BR2 A;  2P9B A;  4HWD A;  2XAG B;  4GK0 E;  2BBH A;  3P7I A;  5LG4 A;  3CX7 B;  4ZI2 D;  3OTO T;  2XAS B;  1UK5 A;  1XDO A;  2JQ9 A;  4UVC B;  2RA1 A;  2D0U A;  5AQL B;  3AEE A;  3SOL A;  2W63 A;  4O2B E;  2CM0 A;  4FJO A;  3Q5W A;  4IE4 A;  1LVF A;  4NPP A;  1D0Z A;  3ZC0 A;  5FL0 A;  4IST A;  2LM9 A;  5AQV B;  2VK9 A;  1HNX T;  5AQT B;  2LSJ A;  3DP7 A;  1HTJ F;  2BG9 C;  2NW7 A;  5EK3 A;  1OED E;  4IDZ A;  3QUJ A;  4HKA A;  1IBK T;  4M1P A;  2BVM A;  3AAA B;  3AEB A;  1WLX A;  2C5K T;  2HHH T;  3RHW A;  2ACZ A;  5FY7 A;  4IGU A;  3RRW A;  3UUL A;  4UVB B;  2WBL A;  2JIW A;  3W15 B;  4MAL A;  3AVS A;  3FZH B;  2CWO A;  4I55 E;  4YY3 T;  2V1D B;  3LK3 B;  2L8K A;  2W2U A;  3RGL A;  4LMJ A;  3RQU A;  5L2L A;  4YFS A;  2SPC A;  2LE8 A;  4TZ4 C;  1ZP0 A;  5CA0 E;  3CPZ A;  4EAH A;  1UGO A;  3Q5D A;  3PUW F;  1ZEE A;  5FKY A;  2XAH B;  4YTN A;  3PV0 F;  1VRB A;  2BKN A;  5ABE A;  3HKB E;  5HCJ A;  4CI2 B;  4EYY R;  3ZT7 A;  5HEJ A;  1SA0 E;  5TAO A;  4EV6 A;  3B57 A;  4DR2 T;  4PJM A;  3HR0 A;  4A98 A;  4L5G A;  4N78 D;  1FIO A;  2FUP A;  3P4Q A;  1U5P A;  2XM1 A;  4DID B;  3ZYK A;  4EZ4 A;  3SRZ A;  2LRL A;  3AVR A;  5LBM A;  4ASK A;  3UQ4 A;  5L4E A;  5LHI B;  2V6Y A;  3N9Q A;  4YHH T;  2UUC T;  5HWY A;  4DR3 T;  3TLS A;  5L3B B;  2JQQ A;  4AQF C;  2V7M A;  4CN1 A;  4EIW A;  2XAF B;  2L9Q A;  5FY0 A;  3T1H T;  4LFC T;  2EHO A;  4YXD A;  5AQQ B;  5KX5 E;  4X1K E;  5F5W A;  4YSZ A;  2WQY A;  3FBL A;  3HL6 A;  3T1Y T;  3RIU A;  2HPL A;  1VOM A;  5LB7 B;  3RYC E;  3KV5 A;  3AXJ A;  2CE7 A;  2XQ3 A;  3CML A;  2WU5 A;  2BG9 E;  1N36 T;  2X9W A;  4JI1 T;  3MKD A;  4DV2 T;  5JTG A;  3VR8 A;  3RIF A;  3QK6 A;  4O8S A;  3RKO A;  3FHN A;  3BK9 A;  2KND A;  5LHH B;  4HFV A;  2BDE A;  1T7S A;  2WS3 A;  4IRE A;  3VU7 H;  3GN5 A;  3ABV A;  2ES0 A;  4GKJ T;  5HXE A;  1D1B A;  3G06 A;  1MIW A;  2YU2 A;  3AEG A;  4HWC A;  3TLV A;  3C64 A;  3RI5 A;  3ZN1 B;  5JDG A;  2UXB T;  4YSX A;  1XZY A;  5GON E;  4CN6 A;  2D9D A;  1HF8 A;  4QXC B;  5LYJ E;  2K5B B;  2YU1 A;  1U4Q A;  5ABF A;  2G0U A;  4UXN B;  4GOU A;  5FMN A;  3P4S A;  3GWH A;  3C4Z A;  4J2C A;  2VVN A;  3VRA A;  3PU8 A;  2KXP B;  2CMR A;  2WDR A;  5FXZ A;  4TWF A;  2JQK A;  1XMO T;  3RC8 A;  4P0A A;  1D1C A;  2FJD A;  4AKG A;  3RH3 A;  2BS4 A;  4XAX B;  4WZX A;  4PAG A;  2M6I A;  3RF1 A;  3PUS A;  3AA7 B;  3K1S A;  4PJL A;  3CVR A;  5ETW A;  1Y01 A;  5HEH A;  1I6Z A;  5FL1 A;  4UVA B;  1NAF A;  2VKJ A;  3JAE A;  3I9W A;  1YQ3 A;  4MFR A;  4UEM A;  4CI1 B;  1ZV4 X;  4DV4 T;  2ODU A;  2W0G A;  2OA5 A;  4CI3 B;  1YQ4 A;  2IUB A;  4O4J E;  4U7I A;  1IJ6 A;  2JJ9 A;  2C5I T;  2QVA A;  4L0R A;  4DBQ A;  2YDQ A;  2LJL A;  3ZT5 A;  4KP3 C;  3SFE A;  2E5L T;  3MK7 C;  4DMV A;  3EDU A;  3I0Q A;  4ZZC A;  2K9A A;  4QX8 B;  3LK2 B;  1DU2 A;  2M6B A;  1QSD A;  5FP3 A;  3VKH A;  5IWA T;  3MXZ A;  1H7C A;  3ZT6 A;  1KF6 A;  4JI2 T;  2V5D A;  2NR4 A;  2PFV A;  3AE9 A;  5AQM B;  2X68 A;  1WYC A;  1HNZ T;  2CLY B;  5HXR A;  4EGW A;  2UXC T;  4JEU B;  5F8P A;  4JBW F;  2CRB A;  3ZEF B;  4LF5 T;  5AQR B;  5IHY A;  4H9S E;  2VVS A;  2HN1 A;  4QX7 B;  2CXL A;  3CK6 A;  2DHR A;  1UUS A;  4F6R C;  2MTQ A;  3TLU A;  4PFP A;  4TX5 A;  1GQE A;  2F4V T;  3RIA A;  4AKR B;  4B3M T;  3UU5 A;  4JV5 T;  3FZM B;  2A3D A;  1R8I A;  3RYF E;  4OYJ A;  3AE4 A;  4HFH A;  4U3C A;  4EZH A;  4ANJ A;  2PJQ A;  3L3P A;  1MMA A;  2N9D A;  3D0T A;  2YDS A;  2XQ9 A;  3NVO A;  2WAU A;  1BR0 A;  4X65 T;  2V5C A;  2UUB T;  3DJB A;  3UU6 A;  1YW0 A;  2V6X A;  2LOP A;  2UXX B;  1E7P A;  5KXJ A;  4Z8X A;  4LF4 T;  5AFU L;  1LVK A;  4IDP A;  2A72 A;  3ZMV B;  2ZMA A;  3NRX A;  3ANW A;  4EB6 E;  5LJM A;  1IBM T;  2IW5 B;  2XAJ B;  1WCR A;  4HWF A;  5LJN A;  2PG8 A;  5AQK B;  3P4R A;  1WYB A;  2Q9Q B;  3F57 A;  2XAQ B;  2XJ7 A;  3TLW A;  3ANW B;  2GK9 A;  4DR5 T;  3QC9 A;  3HKE E;  4AQY T;  3MZK B;  3NKZ A;  4U72 A;  2BS3 A;  4LFB T;  3GA8 A;  2D0T A;  3N9N A;  2LKG A;  5JQG E;  2XY8 B;  1SE7 A;  2UXN B;  3LDQ B;  4PFO A;  2Y48 B;  3ZN0 B;  4KHP T;  1HX8 A;  4WBO A;  4G63 A;  4NUV A;  2NOX A;  4X64 T;  2XQ4 A;  1HR0 T;  4P09 A;  2C5J A;  2H89 A;  1UX4 A;  3UU4 A;  1UX5 A;  1XNR T;  3UTK A;  3EVY A;  1KK7 A;  3N2G E;  2CLY C;  3N9L A;  2W00 A;  3X1D A;  5L4H A;  3OYX A;  4ZZB A;  3ONJ A;  4XBF B;  3SS1 A;  1SUM B;  2LKH A;  4DVD A;  2Z6E A;  4GKK T;  4BAY B;  5AQH B;  4E7S A;  4H9O C;  3ZC1 A;  3U3I A;  3KDS E;  2VAS A;  2WU2 A;  3RPU A;  3UUN A;  4TNV A;  2K48 A;  3PUX F;  3U78 A;  2YOE A;  2ZM8 A;  4B3T T;  5JDL A;  3A8Y C;  3O1J A;  2QA7 A;  5LG3 A;  4LF8 T;  4AIS A;  1N34 T;  2Y8D A;  2WZH A;  1I94 T;  4OX9 T;  2E5V A;  2L3L A;  5LCY A;  2WMO A;  4JEH B;  1HG2 A;  3QNU A;  2V8S V;  2X9Y A;  2W62 A;  2LHR A;  3AE2 A;  1JNZ A;  2LOS A;  1FMV A;  3VKG A;  2MYS A;  5A1L A;  4Z91 A;  4K0U A;  2YDR A;  1OXZ A;  5JDM A;  4HGA A;  3EAM A;  3VR9 A;  4B3S T;  1V9D A;  2I59 A;  1T72 A;  4O4I E;  4ILB A;  5HWX A;  3E0Z A;  2DNX A;  4IHJ E;  2WSS V;  3H3A A;  4H63 H;  2WMN A;  4ZS2 A;  1AJ3 A;  4I50 E;  2I0M A;  2Q9Q C;  4HWI B;  3RC3 A;  5CA1 E;  2V6Y B;  5AQJ B;  3ZCI A;  3T8O A;  3Q5E A;  4IE6 A;  4CN4 A;  3Q5X A;  2J47 A;  4MLK A;  5IYZ E;  4LML A;  4IL9 A;  5HXH A;  5ADX L;  1Z8U A;  1ZHC A;  3RYI E;  2JPF A;  1HNW T;  5LA6 E;  4PK4 A;  4ILU A;  4U33 A;  2JRK A;  4IIJ E;  2ZM2 A;  2E2A A;  2WP9 A;  4HFB A;  4AXP A;  4A97 A;  5J2T E;  2DL1 A;  1IAP A;  3TLT A;  4ISS A;  2LSI A;  2EHO B;  4HFD A;  1M62 A;  3LBX A;  5LGT B;  5IUX A;  4DUZ T;  5J0Z A;  2E9X A;  4ZS3 A;  3KIN B;  5L3D B;  4HFI A;  3SFD A;  2IC6 A;  3AED A;  1YKH B;  3KV6 A;  4UV9 B;  2V7K A;  1OED A;  3LBX B;  5EZY E;  2W67 A;  2XQ7 A;  4PJJ A;  4YSY A;  3AXJ B;  4TV9 E;  4A5X A;  1X9B A;  4HFE A;  4H63 V;  4UV8 B;  4I43 B;  3ZJ2 A;  3KV4 A;  3BQL A;  5CGM A;  2V7I A;  2Q9Q D;  2NW9 A;  3ESL A;  3UUM A;  2VKH A;  2LHN A;  1L0V A;  4KX6 A;  4QXB B;  5FNV E;  2XQA A;  3GN5 B;  4JI6 T;  2IIU A;  4MHC A;  2BS2 A;  3AA1 B;  5JH7 E;  4OK0 A;  3KBU A;  2XQ6 A;  4UIG A;  4JUY A;  3AA0 B;  3AE6 A;  2UXD T;  3JCF A;  1FJG T;  3PUG A;  1SHZ C;  2MPK A;  5BMV E;  5HXS A;  5ABF B;  2B1E A;  2DWK A;  3IHR A;  5FXW A;  2J1D G;  2CEA A;  3MJX A;  5JDF A;  1ZKE A;  4LF9 T;  2CWY A;  2XHE B;  3PTR B;  3EHZ A;  1WR6 A;  2KWI B;  2KLQ A;  2BVL A;  3HKD E;  3ETU A;  5J2U E;  4AIU A;  3IA3 A;  2YIN A;  3L8R A;  3RYH E;  2YEV C;  3LG7 A;  3V5S A;  1T98 A;  3AAE B;  3PUQ A;  2OLT A;  5F3J A;  1VCS A;  2D5U A;  2KMF A;  3S4U A;  3ETV A;  2UU9 T;  3P4P A;  2N1G A;  2ZM6 T;  3AEC A;  2XQY A;  2X0Y A;  1JNR A;  3AEF A;  1IBL T;  1HFA A;  4ILC A;  5LOV E;  2UUA T;  5CJ5 A;  5DJQ C;  4DR4 T;  3EAB A;  4QH5 A;  2X51 A;  3N2K E;  4X62 T;  2EHO C;  3O9X A;  1QLB A;  4OHF A;  1E1H B;  5JRC A;  2NW8 A;  4ZXL A;  3ZST A;  3ZPO A; 
#chains in the Genus database with same CATH homology
 3X1D A;  1Y01 A;  4IDN A;  4IDO A;  1W09 A;  4IDP A;  3IA3 A;  3Q5E A;  3QNU A;  3QOF A;  3OVU A;  1W0A A;  3Q5D A;  1Z8U A;  4IDQ A;  1XZY A;  1W0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...