1Y01A

Crystal structure of ahsp bound to fe(ii) alpha-hemoglobin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
89
structure length
89
Chain Sequence
LLKANKDLISAGLKEFSVLLNQQVFNDALVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxygen storage/transport
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Molecular mechanism of AHSP-mediated stabilization of alpha-hemoglobin.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09236 AHSP Alpha-haemoglobin stabilising protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1y01A00
4IDOA 4IDPA 3OVUA 3QNUA 1W0AA 1XZYA 4IDQA 1W0BA 3Q5DA 3IA3A 1Y01A 3QOFA 3X1DA 1Z8UA 1W09A 4IDNA 3Q5EA
chains in the Genus database with same CATH superfamily
3EABA 1HFAA 4IIJE 4O2BE 3RRWA 5HEUA 5AQUB 3FXDB 4U31A 2X9XA 3RQWA 1WYBA 2WB5A 4CN1A 5LG3A 4QH1A 4DO0A 2HN2A 1KNPA 3ZJ1A 2I6HA 2N9DA 4FI5A 4LFAT 3AEGA 3RGLA 5HEGA 2KNDA 1T72A 5FVKA 4PNIA 3SFDA 4DV6T 5FY7A 3SFEA 2D0TA 3E22E 3ZMTB 4IGUA 4ZEYA 4J2CA 3P4WA 4C91A 4QXHB 5LGNB 4UELA 4U72A 1MMNA 3AEDA 3KV6A 3PUGA 4IL4A 2MAWA 4DV5T 3CQXC 2BG9C 5L47A 1HNWT 4UV8B 4AQYT 1S94A 3HA4A 3ZN1B 4PK4A 3PUVF 4DR7T 3I9YA 1QLBA 2LEHA 5LHHB 2LSIA 4NXNT 3M65A 2XQ8A 4ZZCA 2BS3A 2HH7A 2L8KA 3RPUA 2V6YA 4EGWA 3ZSTA 3AVRA 1LRZA 2Z6EA 1US7B 2ZM2A 5AQJB 2CXFA 3I9WA 2LKHA 1HS7A 3PDYA 4UEMA 3AEEA 4HFEA 4Z91A 1WR0A 3GWHA 2IC9A 3AE3A 3RIFA 2WAUA 4QHOA 1B7TA 2X68A 4X66T 1XDOA 1WLXA 2DCFA 2LOPA 3KV9A 3SWHA 3RC3A 1V9DA 2X9YA 3F2EA 3FBLA 3JC6C 3AXJA 2LOSA 1M7KA 1YXRA 1ZOYA 1WYCA 1D1AA 3RLFF 4YT0A 1S35A 3ZMVB 3ETVA 2Y8DA 2X9HA 4PK5A 1N36T 3JCFA 3U78A 3GN5B 1BR2A 4U7YA 2MBGA 3AE4A 5LNKA 2Q9QD 3PUAA 3LDQB 5ABFA 3CQGB 5LJNA 2E2AA 4CXXA 3HKBE 4AKIA 2H88A 3R6NA 1VCTA 4EEDA 4E7SA 3FBZA 2E9XA 3RYCE 2L3LA 1WCRA 5F3JA 1LVFA 5FP3A 3EI0A 2H7VC 4JYAT 3AA6B 5JDNA 3LK3B 1HF8A 1UGOA 2LHRA 2AXDS 5AQHB 2LRLA 2IAKA 3C4ZA 5L4EA 3F57A 3B57A 3H3AA 3AAIA 3UUMA 2JJ9A 4YXDA 3PTRB 3A7MA 2YN6A 2W66A 5FYMA 5IUXA 5AQOB 2X67A 1BR4A 3QOFA 5LHGB 5AFUL 5F8PA 2NOXA 4QH5A 2XY8B 3NBXX 1HNZT 3O1JA 1D0YA 4EEBA 4LMLA 4DBQA 4HWHA 1WRDA 4KUMB 5F5WA 4QXCB 2J62A 3ZYKA 3PUZF 3IBPA 2DWGA 3AE7A 2B76A 3ZCIA 1FMVA 2A72A 2NTXA 2BKPA 5AQTB 2NWBA 2WY2A 4EZHA 2UUBT 4OYJA 2MPKA 4HE8A 4B3RT 4U33A 2FBWA 2IDOB 3PV0F 3PU8A 2C5JA 2CCQA 4TN7B 5JDLA 1CUNA 4GOUA 3UU6A 3PU3A 1N34T 1E2AA 2VKOA 2XSAA 4CI2B 2XTLA 4G63A 2KWHA 2RA1A 4E7ZA 2YEVC 3HKEE 4I43B 3ZMZB 5CA0E 2JMHA 4V1Av 4FJOA 4IE4A 4KBMB 3OBVE 5C3JA 2K3WA 4OK0A 2W62A 1MNEA 4CN6A 4H63V 4JEHB 3MJXA 2WZHA 3NRXA 5LBMA 2W67A 4JI2T 2WMOA 5AQSB 4OYKA 3K3QC 4ISSA 4MLKA 4EB6E 2X0LB 2XQ4A 2YDRA 3IA3A 4I4TE 4AQGA 2E5VA 4I0UA 2KT9A 5HYAA 3UU8A 2YDSA 4JBWF 2BVMA 2V6YB 4YHHT 4A56A 4DR2T 4CXYA 2HN1A 1X79A 3I0OA 4PFOA 2RPAA 3UU4A 2CE7A 4H9RC 2X9WA 3VKGA 5J2TE 3N2KE 3J9X1 4YSYA 1H7CA 4JI1T 4NIQA 4UF0B 5FY0A 5AQNB 5HXRA 2WWUA 2XQ6A 2XHEB 4IREA 4DMVA 5LGUB 4EV6A 2WBLA 4EYUA 1UK5A 4IL9A 2CM0A 2ODVA 3H37A 1D1CA 3AE2A 4YFSA 1I94T 2YU1A 4X65T 1QSDA 5GONE 4ZXLA 3AE6A 1MIWA 4L0RA 2JQQA 1YD8G 4IE5A 2KWIB 4NUVA 4PW8A 5JREA 4TWDA 3K8PC 2FJEA 1NENA 3SS1A 5HXSA 3QUJA 4IDPA 4U74A 1W0BA 3ESLA 2V6XA 2PJQA 4MBQA 2MYSA 3CK6A 2BG9E 2IC6A 1HNXT 3L3PA 1G8XA 1HCIA 1HG2A 3FXEB 3KINB 3TLSA 2M67A 3ZMSB 5CA1E 1Z8UA 4OHFA 4HWIB 2JMKA 2FJBA 5HEHA 2Q9QC 4TWFA 2IIUA 2ODUA 2XPKA 4IT4A 1YQ4A 4CQIA 5DQWA 3QK6A 3NRYA 4I50E 3UQ7A 4NPPA 1X9BA 2X0YA 5JRCA 2XQ5A 4DMWA 1JNZA 5IHYA 5JR9A 1N33T 4IDQA 5ABGA 3UFGA 2V7MA 3QB5K 3CX8B 3MACA 3ZSSA 3AAAB 2YU2A 3P8CD 4CI3B 4X5TA 5AQGB 4AKHA 5LP6E 3ZEFB 4H9SE 1UX5A 3CMLA 3MXZA 5HEOA 4ZHQE 1BR0A 4ADZA 4IDNA 3OYZA 3TLVA 2G0UA 3AEFA 4JI7T 4KHZF 3UU3A 1UURA 3FZKB 4AKGA 2OV9A 5FXXA 3RIUA 3K3NA 3BQLA 5ABHA 5DQVA 1R8IA 2LKGA 1OEDB 4BJNA 4YY3T 4N78D 2XM1A 1T98A 2LM9A 3AA1B 3SOLA 4XBFB 2CHOA 2XQYA 4M1PA 5FL1A 2KZ7B 2IHR1 3FB2A 3L09A 1EZ3A 5FNVE 5IWAT 5FXWA 3H3MA 2DLRA 1OXZA 3HL6A 3IEEA 3JAFA 4X1KE 4JV5T 3NWIA 3HKCE 2NW8A 1AJ3A 5AQKB 3E0ZA 3ZLIA 3KBUA 4F8HA 3AA0B 4TNVA 2EHOA 3B13A 2V7KA 2HHHT 1GQEA 4HFIA 5LMNT 3HKDE 2V5CA 1KEYA 2ZLYA 3TLWA 3WAJA 1KFYA 4TV9E 2ACXA 4QH4A 2KSRA 4LF7T 4DIDB 2MOZA 2B1EA 1CHUA 4H9QC 1G73A 3PUXF 2XQ7A 2PBIA 4EOZB 4P0AA 1FJGT 2QA7A 1UX4A 2NP9A 2FJAA 3ANWA 2D5UA 4H63H 1DU2A 5L3BB 4B6XA 4DV0T 4HFVA 2JIWA 4CXWA 4CN4A 4ZS3A 5EK4A 4JUYA 2ES0A 3VR9A 5L3CB 2UXDT 5L3FB 1W0AA 1J1JA 1U5PA 2LM2A 3C50A 3C4XA 5JDGA 2BDEA 3FZLB 3ZC0A 1UCUA 1OEDC 3ABVA 4LMJA 4HTEA 2QYWA 3GA8A 5JDMA 2XAHB 5HAXA 4IDZA 4PJJA 2D9DA 1ZHCA 2QRXA 2XM2A 2WQYA 4DUYT 3LBXA 4UVCB 5FKYA 3UUBA 2JRKA 1NEKA 3AEAA 2CHNA 3ONJA 2W4XA 2Y48B 4DVDA 3F31A 2KMFA 3ZYMA 5JRCB 2CEAA 2IMLA 4K0UA 3O4XE 2BG9A 3RI5A 4AKLA 5JR9B 4OX9T 4O8SA 4LF8T 3OKQA 2NR4A 4GIWA 5C2TA 2JQ9A 1YKHB 3UQ4A 3LK2B 4YHJA 3PJAA 4P1NA 4IE0A 3P4PA 3JAEA 1MNDA 1MIYA 4ZI3C 2C5IT 3AE8A 3RYHE 3CX6B 2ZMAA 3MK7C 1MMDA 2XQAA 5FXZA 2NW9A 5JQGE 3O1IA 5HXHA 1J5ET 4ISTA 1HX1B 2RP4A 3N9OA 3ONLC 4CI1B 4HWCA 3P7IA 5AQPB 4B3MT 5JTGA 2N2NA 3LK42 5L2LA 1BR1A 1FMWA 2ZM0A 2OA5A 4GK5E 2IUBA 2NW7A 5LJMA 4DV2T 3ZT6A 4MALA 3JADA 4AQFC 2VURA 3EAMA 3PURA 1QUUA 2E9XD 2PTFA 2BKNA 5KMGP 4IE6A 5BR8T 4ANJA 4ILAA 2DNXA 2A2FX 2NTYA 4XAXB 5JH7E 5J0ZA 1FIOA 4YTPA 3C4WA 4Z8XA 2EHOB 5FL0A 2VKHA 2VVNA 4ILUA 3OPCA 3TLTA 2CWYA 2AE9A 2J1DG 4TNWA 2WU5A 3A8YC 2UXXB 4U2YA 4DR1T 4HWDA 3RX6A 4DV1T 2BBJA 3LJCA 4A5XA 4X20E 4O4HE 3RYIE 2BKOA 3CVRA 3J7Yq 4X64T 2BS4A 3N9PA 2VVSA 2VK9A 2XAQB 4F6RC 5FMNA 1IAPA 4NUUA 1J5WA 5KXJA 5IYZE 4JEUB 2K5BB 5HCJA 4BAYB 4IE7A 4LF5T 2LHNA 2XQ3A 3KV4A 3K3OA 2JQKA 1IBLT 4EXTA 5DJQC 3IHRA 4COFA 3OYXA 2CMRA 5LBQB 2W63A 4QXBB 2V26A 3AXJB 2WSSV 4JI4T 2CBIA 5M4YA 4LFBT 3AVSA 3AECA 2WDRA 4H9NC 3FZHB 2N1GA 1YKEB 1YW0A 3T1YT 4HFHA 3KVBA 2F4VT 4DR6T 2LSKA 2C0SA 2V7LA 4GYSA 4KP3C 5J1GA 1NWMX 1VRBA 2WM9A 1D0XA 2Y6XA 4KX6A 4L9IA 5CGMA 4HEAA 5ABFB 4O4LE 2VWAA 4HFCA 4A98A 4ZI7E 1U4QA 2VKDA 1SHZC 4P0BA 4ZOLE 4HGAA 2E9XB 1XZYA 4UIGA 3P50A 4ZI3D 3GN5A 5KDMC 4I55E 4PJLA 5FY1A 4YLHA 2E8IA 4P09A 5L3EB 4H9OC 4LFCT 2LRKA 2MTQA 2HPJA 4JLEA 3RYFE 4TV8E 3DTOA 5EK2A 3Q5WA 4XZCA 3ZPOA 4QX8B 3ONXA 3RQUA 3M3ZB 3X1DA 1VOMA 1XMQT 1Y01A 3PJAJ 3BQIA 4JI0T 2M6BA 3ZT5A 4WW0A 4WYVA 2K9AA 4YTNA 2E5LT 2V1DB 3AAEB 2FJDA 1KK7A 2YK0A 4U2ZA 3Q5EA 2A3DA 2GK9A 4O4JE 3NVOA 2KXPB 2YKSA 3LFMA 2CXDA 1MIVA 2C5KT 2DWKA 4WBNE 2VASA 3C64A 4NXMT 4AIUA 2DHRA 4EIWA 5HCMA 2LT3A 1M62A 3VRAA 2ZM8A 5AQQB 3CKDA 1OEDE 3RH3A 2LSGA 1KNRA 3AE5A 4HFBA 3Q2MA 1L0VA 5LG4A 3PE0A 3VU7H 3RRCA 4B3TT 4JI3T 1ZKEA 2UXCT 4GKKT 4YTMA 1Y64B 4ASKA 4HKAA 5E0OA 3ZN0B 5LCYA 3IF8B 4UVAB 1HX8A 4AISA 5AQVB 4UVBB 2X51A 4PK6A 1I6ZA 2W0GA 3RKOA 4YJ3E 3AE1A 1MMAA 4BJMA 2E9XC 5AQIB 1W09A 4AI6A 2FUPA 5LOVE 2QVAA 3MKDA 4ILBA 1ZEEA 1FEWA 4DR4T 4HWFA 2CWOA 2XAGB 2OLTA 2Q9QA 4GKJT 1E7PA 2XASB 5FVLA 3GMIA 2ZM6T 1IZNB 3ZMUB 3ZYLA 4ZZBA 5L3GB 4ZI2D 5EK3A 2XZEA 3P4QA 4YSXA 3FHNA 3T8OA 4EZ4A 5C8YE 2H3RA 4LF9T 4OFZA 3L8RA 4KMCA 3WAKA 5ETWA 2DL1A 3T1HT 2UUCT 3W15B 3V5UA 2H89A 3MZKB 1IBKT 4UF0A 3TLUA 3VHLA 4DUZT 2ACZA 4PJMA 4AXPA 2EHOD 2X66A 4LMKA 4DV4T 1VCSA 2D2SA 4WZXA 2J47A 4X1YE 2WCAA 4QWNB 5J2UE 2VL0A 4A97A 3N9LA 3BK9A 2A9UA 1JNRA 2KINB 3RF1A 1XWMA 3Q9DA 5AQRB 1SE7A 1ZP0A 4U7IA 3SRZA 3VR8A 4JI5T 3HI2A 3O9XA 3N2OA 5A1LA 3R84B 2W00A 4ILCA 4LF6T 1D1BA 4ERRA 3OVUA 3PUSA 3P4SA 1D0ZA 3PUWF 3AB3B 4X1IE 5EZYE 3FZMB 2DI4A 2K24A 4KHPT 2LSJA 5L3DB 1SA0E 2LE8A 3U3IA 5FXVA 3FZFB 3N9QA 2UUAT 4PAGA 4BA9A 2WP9A 3EVYA 4HFDA 2SPCA 5AQMB 2WS3A 4WBOA 2WDQA 5CFBA 2CLYB 2WDVA 4KI0F 5HWXA 5CB4E 2W2UA 3E08A 5HEJA 2BBHA 4QKNA 4IDOA 3VKHA 5LB7B 4WNKA 4YJ2E 1W9RA 3KVAA 2VB6A 3PUYF 3C51A 2YINA 2UU9T 4UR9A 1N32T 2M6IA 2XSBA 1IJ6A 3ZC1A 5ABEA 5HXEA 4JI6T 1Z0PA 5ADXL 2BZBA 2YOEA 2PG8A 5AQLB 2PFVA 3CX7B 1NAFA 4ZS2A 5HWYA 3KDSE 4K0KT 3UUNA 1SUMB 4DBRA 1OEDA 4LF4T 3UTKA 5TAOA 3RC8A 4TZ4C 1ZV4X 2VQFT 3EUHA 3UT5E 5DABA 3ZKRA 2WU2A 3EDVA 4AKRB 5JDQA 2Q9QB 4YSZA 1T8BA 1UUSA 3VRBA 3AA7B 2WWVA 3KV5A 3N2GE 2LLYA 1KF6A 3ZT7A 5LYJE 1IBMT 3RKGA 3K1SA 3EDUA 3B5MA 1WR6A 3RIAA 3ETUA 4HN9A 5L4HA 4CZZB 4B3ST 3PUQA 5JDFA 3ZJ2A 3P4RA 5JR9C 2XUEA 2UXNB 3ANWB 4U3CA 1KNZA 2VKJA 3CPZA 4DV3T 3A5XA 2X0HA 3JC6D 2L9QA 5KX5E 2WMNA 2YDQA 3D0TA 1O3XA 5LXTE 4JI8T 2J4GA 4EAHA 2VQET 2I59A 4TX5A 2XJ7A 3OJAA 3N9NA 5AQFB 4O2AE 2CRBA 3I1AA 1HG5A 3LG7A 2JQHA 1IJ5A 3RIUC 2CLYC 3QC9A 2CPTA 4DR3T 4UV9B 4ZI2C 3KFWX 3S4UA 3EHZA 4Q25A 2CA5A 4G2AA 2CXLA 2VL8A 4TUYE 4IHJE 3Q5DA 4C90A 3NZPA 2XAJB 4AQFA 2IW5B 4Z90A 4PFPA 2QGSA 2P9BA 1XMOT 4DNDA 3LBXB 2H7OA 3UUXB 3N5LA 5H6QB 2V5DA 5HXCA 4PJNA 5LGTB 3KBTA 3G06A 3UU5A 5LA6E 4UXNB 3OTOT 2R6GF 3V5SA 5CJ5A 5LMUT 1MMGA 2XAFB 2BG9B 4DV7T 2V7JA 2BVLA 3LSVA 2EHOC 3CWZB 1E1HB 2XQ9A 1HTJF 3UULA 1WFDA 2BS2A 2LJLA 3L39A 4MHCA 2W61A 2D0UA 2KLQA 4GYRA 3QB5A 3N9MA 4L5GA 5LHIB 3UFEA 1HR0T 1T7SA 3MA9A 3BQKA 3NKZA 3Q5XA 3ZCJA 1XDPA 5JDHA 3TKLB 5JVDE 3O1HA 2I0MA 3AE9A 4TWHA 1XNQT 2V8SV 4H9PC 3QNUA 2V7IA 5H6RB 3DP7A 2WZIA 4O4IE 2JPFA 3RHWA 2K48A 3WI3A 1YQ3A 3DJBA 1OWAA 4GK0E 3NZQA 5BMVE 2UXBT 3I0QA 4DR5T 4MFRA 2HPLA 3C98B 1XNRT 2CBJA 4QX7B 1LVKA 3HR0A 1LKXA 4X62T 3CIRA 4EYYR 3AEBA 3CQCB 2LSYA
chains in the Genus database with same CATH topology
4IDOA 4IDPA 3OVUA 3QNUA 1W0AA 1XZYA 4IDQA 1W0BA 3Q5DA 3IA3A 1Y01A 3QOFA 3X1DA 1Z8UA 1W09A 4IDNA 3Q5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IDO A;  4IDP A;  3OVU A;  3QNU A;  1W0A A;  1XZY A;  4IDQ A;  1W0B A;  3Q5D A;  3IA3 A;  1Y01 A;  3QOF A;  3X1D A;  1Z8U A;  1W09 A;  4IDN A;  3Q5E A; 
#chains in the Genus database with same CATH topology
 3EAB A;  1HFA A;  4IIJ E;  4O2B E;  3RRW A;  5HEU A;  5AQU B;  3FXD B;  4U31 A;  2X9X A;  3RQW A;  1WYB A;  2WB5 A;  4CN1 A;  5LG3 A;  4QH1 A;  4DO0 A;  2HN2 A;  1KNP A;  3ZJ1 A;  2I6H A;  2N9D A;  4FI5 A;  4LFA T;  3AEG A;  3RGL A;  5HEG A;  2KND A;  1T72 A;  5FVK A;  4PNI A;  3SFD A;  4DV6 T;  5FY7 A;  3SFE A;  2D0T A;  3E22 E;  3ZMT B;  4IGU A;  4ZEY A;  4J2C A;  3P4W A;  4C91 A;  4QXH B;  5LGN B;  4UEL A;  4U72 A;  1MMN A;  3AED A;  3KV6 A;  3PUG A;  4IL4 A;  2MAW A;  4DV5 T;  3CQX C;  2BG9 C;  5L47 A;  1HNW T;  4UV8 B;  4AQY T;  1S94 A;  3HA4 A;  3ZN1 B;  4PK4 A;  3PUV F;  4DR7 T;  3I9Y A;  1QLB A;  2LEH A;  5LHH B;  2LSI A;  4NXN T;  3M65 A;  2XQ8 A;  4ZZC A;  2BS3 A;  2HH7 A;  2L8K A;  3RPU A;  2V6Y A;  4EGW A;  3ZST A;  3AVR A;  1LRZ A;  2Z6E A;  1US7 B;  2ZM2 A;  5AQJ B;  2CXF A;  3I9W A;  2LKH A;  1HS7 A;  3PDY A;  4UEM A;  3AEE A;  4HFE A;  4Z91 A;  1WR0 A;  3GWH A;  2IC9 A;  3AE3 A;  3RIF A;  2WAU A;  4QHO A;  1B7T A;  2X68 A;  4X66 T;  1XDO A;  1WLX A;  2DCF A;  2LOP A;  3KV9 A;  3SWH A;  3RC3 A;  1V9D A;  2X9Y A;  3F2E A;  3FBL A;  3JC6 C;  3AXJ A;  2LOS A;  1M7K A;  1YXR A;  1ZOY A;  1WYC A;  1D1A A;  3RLF F;  4YT0 A;  1S35 A;  3ZMV B;  3ETV A;  2Y8D A;  2X9H A;  4PK5 A;  1N36 T;  3JCF A;  3U78 A;  3GN5 B;  1BR2 A;  4U7Y A;  2MBG A;  3AE4 A;  5LNK A;  2Q9Q D;  3PUA A;  3LDQ B;  5ABF A;  3CQG B;  5LJN A;  2E2A A;  4CXX A;  3HKB E;  4AKI A;  2H88 A;  3R6N A;  1VCT A;  4EED A;  4E7S A;  3FBZ A;  2E9X A;  3RYC E;  2L3L A;  1WCR A;  5F3J A;  1LVF A;  5FP3 A;  3EI0 A;  2H7V C;  4JYA T;  3AA6 B;  5JDN A;  3LK3 B;  1HF8 A;  1UGO A;  2LHR A;  2AXD S;  5AQH B;  2LRL A;  2IAK A;  3C4Z A;  5L4E A;  3F57 A;  3B57 A;  3H3A A;  3AAI A;  3UUM A;  2JJ9 A;  4YXD A;  3PTR B;  3A7M A;  2YN6 A;  2W66 A;  5FYM A;  5IUX A;  5AQO B;  2X67 A;  1BR4 A;  3QOF A;  5LHG B;  5AFU L;  5F8P A;  2NOX A;  4QH5 A;  2XY8 B;  3NBX X;  1HNZ T;  3O1J A;  1D0Y A;  4EEB A;  4LML A;  4DBQ A;  4HWH A;  1WRD A;  4KUM B;  5F5W A;  4QXC B;  2J62 A;  3ZYK A;  3PUZ F;  3IBP A;  2DWG A;  3AE7 A;  2B76 A;  3ZCI A;  1FMV A;  2A72 A;  2NTX A;  2BKP A;  5AQT B;  2NWB A;  2WY2 A;  4EZH A;  2UUB T;  4OYJ A;  2MPK A;  4HE8 A;  4B3R T;  4U33 A;  2FBW A;  2IDO B;  3PV0 F;  3PU8 A;  2C5J A;  2CCQ A;  4TN7 B;  5JDL A;  1CUN A;  4GOU A;  3UU6 A;  3PU3 A;  1N34 T;  1E2A A;  2VKO A;  2XSA A;  4CI2 B;  2XTL A;  4G63 A;  2KWH A;  2RA1 A;  4E7Z A;  2YEV C;  3HKE E;  4I43 B;  3ZMZ B;  5CA0 E;  2JMH A;  4V1A v;  4FJO A;  4IE4 A;  4KBM B;  3OBV E;  5C3J A;  2K3W A;  4OK0 A;  2W62 A;  1MNE A;  4CN6 A;  4H63 V;  4JEH B;  3MJX A;  2WZH A;  3NRX A;  5LBM A;  2W67 A;  4JI2 T;  2WMO A;  5AQS B;  4OYK A;  3K3Q C;  4ISS A;  4MLK A;  4EB6 E;  2X0L B;  2XQ4 A;  2YDR A;  3IA3 A;  4I4T E;  4AQG A;  2E5V A;  4I0U A;  2KT9 A;  5HYA A;  3UU8 A;  2YDS A;  4JBW F;  2BVM A;  2V6Y B;  4YHH T;  4A56 A;  4DR2 T;  4CXY A;  2HN1 A;  1X79 A;  3I0O A;  4PFO A;  2RPA A;  3UU4 A;  2CE7 A;  4H9R C;  2X9W A;  3VKG A;  5J2T E;  3N2K E;  3J9X 1;  4YSY A;  1H7C A;  4JI1 T;  4NIQ A;  4UF0 B;  5FY0 A;  5AQN B;  5HXR A;  2WWU A;  2XQ6 A;  2XHE B;  4IRE A;  4DMV A;  5LGU B;  4EV6 A;  2WBL A;  4EYU A;  1UK5 A;  4IL9 A;  2CM0 A;  2ODV A;  3H37 A;  1D1C A;  3AE2 A;  4YFS A;  1I94 T;  2YU1 A;  4X65 T;  1QSD A;  5GON E;  4ZXL A;  3AE6 A;  1MIW A;  4L0R A;  2JQQ A;  1YD8 G;  4IE5 A;  2KWI B;  4NUV A;  4PW8 A;  5JRE A;  4TWD A;  3K8P C;  2FJE A;  1NEN A;  3SS1 A;  5HXS A;  3QUJ A;  4IDP A;  4U74 A;  1W0B A;  3ESL A;  2V6X A;  2PJQ A;  4MBQ A;  2MYS A;  3CK6 A;  2BG9 E;  2IC6 A;  1HNX T;  3L3P A;  1G8X A;  1HCI A;  1HG2 A;  3FXE B;  3KIN B;  3TLS A;  2M67 A;  3ZMS B;  5CA1 E;  1Z8U A;  4OHF A;  4HWI B;  2JMK A;  2FJB A;  5HEH A;  2Q9Q C;  4TWF A;  2IIU A;  2ODU A;  2XPK A;  4IT4 A;  1YQ4 A;  4CQI A;  5DQW A;  3QK6 A;  3NRY A;  4I50 E;  3UQ7 A;  4NPP A;  1X9B A;  2X0Y A;  5JRC A;  2XQ5 A;  4DMW A;  1JNZ A;  5IHY A;  5JR9 A;  1N33 T;  4IDQ A;  5ABG A;  3UFG A;  2V7M A;  3QB5 K;  3CX8 B;  3MAC A;  3ZSS A;  3AAA B;  2YU2 A;  3P8C D;  4CI3 B;  4X5T A;  5AQG B;  4AKH A;  5LP6 E;  3ZEF B;  4H9S E;  1UX5 A;  3CML A;  3MXZ A;  5HEO A;  4ZHQ E;  1BR0 A;  4ADZ A;  4IDN A;  3OYZ A;  3TLV A;  2G0U A;  3AEF A;  4JI7 T;  4KHZ F;  3UU3 A;  1UUR A;  3FZK B;  4AKG A;  2OV9 A;  5FXX A;  3RIU A;  3K3N A;  3BQL A;  5ABH A;  5DQV A;  1R8I A;  2LKG A;  1OED B;  4BJN A;  4YY3 T;  4N78 D;  2XM1 A;  1T98 A;  2LM9 A;  3AA1 B;  3SOL A;  4XBF B;  2CHO A;  2XQY A;  4M1P A;  5FL1 A;  2KZ7 B;  2IHR 1;  3FB2 A;  3L09 A;  1EZ3 A;  5FNV E;  5IWA T;  5FXW A;  3H3M A;  2DLR A;  1OXZ A;  3HL6 A;  3IEE A;  3JAF A;  4X1K E;  4JV5 T;  3NWI A;  3HKC E;  2NW8 A;  1AJ3 A;  5AQK B;  3E0Z A;  3ZLI A;  3KBU A;  4F8H A;  3AA0 B;  4TNV A;  2EHO A;  3B13 A;  2V7K A;  2HHH T;  1GQE A;  4HFI A;  5LMN T;  3HKD E;  2V5C A;  1KEY A;  2ZLY A;  3TLW A;  3WAJ A;  1KFY A;  4TV9 E;  2ACX A;  4QH4 A;  2KSR A;  4LF7 T;  4DID B;  2MOZ A;  2B1E A;  1CHU A;  4H9Q C;  1G73 A;  3PUX F;  2XQ7 A;  2PBI A;  4EOZ B;  4P0A A;  1FJG T;  2QA7 A;  1UX4 A;  2NP9 A;  2FJA A;  3ANW A;  2D5U A;  4H63 H;  1DU2 A;  5L3B B;  4B6X A;  4DV0 T;  4HFV A;  2JIW A;  4CXW A;  4CN4 A;  4ZS3 A;  5EK4 A;  4JUY A;  2ES0 A;  3VR9 A;  5L3C B;  2UXD T;  5L3F B;  1W0A A;  1J1J A;  1U5P A;  2LM2 A;  3C50 A;  3C4X A;  5JDG A;  2BDE A;  3FZL B;  3ZC0 A;  1UCU A;  1OED C;  3ABV A;  4LMJ A;  4HTE A;  2QYW A;  3GA8 A;  5JDM A;  2XAH B;  5HAX A;  4IDZ A;  4PJJ A;  2D9D A;  1ZHC A;  2QRX A;  2XM2 A;  2WQY A;  4DUY T;  3LBX A;  4UVC B;  5FKY A;  3UUB A;  2JRK A;  1NEK A;  3AEA A;  2CHN A;  3ONJ A;  2W4X A;  2Y48 B;  4DVD A;  3F31 A;  2KMF A;  3ZYM A;  5JRC B;  2CEA A;  2IML A;  4K0U A;  3O4X E;  2BG9 A;  3RI5 A;  4AKL A;  5JR9 B;  4OX9 T;  4O8S A;  4LF8 T;  3OKQ A;  2NR4 A;  4GIW A;  5C2T A;  2JQ9 A;  1YKH B;  3UQ4 A;  3LK2 B;  4YHJ A;  3PJA A;  4P1N A;  4IE0 A;  3P4P A;  3JAE A;  1MND A;  1MIY A;  4ZI3 C;  2C5I T;  3AE8 A;  3RYH E;  3CX6 B;  2ZMA A;  3MK7 C;  1MMD A;  2XQA A;  5FXZ A;  2NW9 A;  5JQG E;  3O1I A;  5HXH A;  1J5E T;  4IST A;  1HX1 B;  2RP4 A;  3N9O A;  3ONL C;  4CI1 B;  4HWC A;  3P7I A;  5AQP B;  4B3M T;  5JTG A;  2N2N A;  3LK4 2;  5L2L A;  1BR1 A;  1FMW A;  2ZM0 A;  2OA5 A;  4GK5 E;  2IUB A;  2NW7 A;  5LJM A;  4DV2 T;  3ZT6 A;  4MAL A;  3JAD A;  4AQF C;  2VUR A;  3EAM A;  3PUR A;  1QUU A;  2E9X D;  2PTF A;  2BKN A;  5KMG P;  4IE6 A;  5BR8 T;  4ANJ A;  4ILA A;  2DNX A;  2A2F X;  2NTY A;  4XAX B;  5JH7 E;  5J0Z A;  1FIO A;  4YTP A;  3C4W A;  4Z8X A;  2EHO B;  5FL0 A;  2VKH A;  2VVN A;  4ILU A;  3OPC A;  3TLT A;  2CWY A;  2AE9 A;  2J1D G;  4TNW A;  2WU5 A;  3A8Y C;  2UXX B;  4U2Y A;  4DR1 T;  4HWD A;  3RX6 A;  4DV1 T;  2BBJ A;  3LJC A;  4A5X A;  4X20 E;  4O4H E;  3RYI E;  2BKO A;  3CVR A;  3J7Y q;  4X64 T;  2BS4 A;  3N9P A;  2VVS A;  2VK9 A;  2XAQ B;  4F6R C;  5FMN A;  1IAP A;  4NUU A;  1J5W A;  5KXJ A;  5IYZ E;  4JEU B;  2K5B B;  5HCJ A;  4BAY B;  4IE7 A;  4LF5 T;  2LHN A;  2XQ3 A;  3KV4 A;  3K3O A;  2JQK A;  1IBL T;  4EXT A;  5DJQ C;  3IHR A;  4COF A;  3OYX A;  2CMR A;  5LBQ B;  2W63 A;  4QXB B;  2V26 A;  3AXJ B;  2WSS V;  4JI4 T;  2CBI A;  5M4Y A;  4LFB T;  3AVS A;  3AEC A;  2WDR A;  4H9N C;  3FZH B;  2N1G A;  1YKE B;  1YW0 A;  3T1Y T;  4HFH A;  3KVB A;  2F4V T;  4DR6 T;  2LSK A;  2C0S A;  2V7L A;  4GYS A;  4KP3 C;  5J1G A;  1NWM X;  1VRB A;  2WM9 A;  1D0X A;  2Y6X A;  4KX6 A;  4L9I A;  5CGM A;  4HEA A;  5ABF B;  4O4L E;  2VWA A;  4HFC A;  4A98 A;  4ZI7 E;  1U4Q A;  2VKD A;  1SHZ C;  4P0B A;  4ZOL E;  4HGA A;  2E9X B;  1XZY A;  4UIG A;  3P50 A;  4ZI3 D;  3GN5 A;  5KDM C;  4I55 E;  4PJL A;  5FY1 A;  4YLH A;  2E8I A;  4P09 A;  5L3E B;  4H9O C;  4LFC T;  2LRK A;  2MTQ A;  2HPJ A;  4JLE A;  3RYF E;  4TV8 E;  3DTO A;  5EK2 A;  3Q5W A;  4XZC A;  3ZPO A;  4QX8 B;  3ONX A;  3RQU A;  3M3Z B;  3X1D A;  1VOM A;  1XMQ T;  1Y01 A;  3PJA J;  3BQI A;  4JI0 T;  2M6B A;  3ZT5 A;  4WW0 A;  4WYV A;  2K9A A;  4YTN A;  2E5L T;  2V1D B;  3AAE B;  2FJD A;  1KK7 A;  2YK0 A;  4U2Z A;  3Q5E A;  2A3D A;  2GK9 A;  4O4J E;  3NVO A;  2KXP B;  2YKS A;  3LFM A;  2CXD A;  1MIV A;  2C5K T;  2DWK A;  4WBN E;  2VAS A;  3C64 A;  4NXM T;  4AIU A;  2DHR A;  4EIW A;  5HCM A;  2LT3 A;  1M62 A;  3VRA A;  2ZM8 A;  5AQQ B;  3CKD A;  1OED E;  3RH3 A;  2LSG A;  1KNR A;  3AE5 A;  4HFB A;  3Q2M A;  1L0V A;  5LG4 A;  3PE0 A;  3VU7 H;  3RRC A;  4B3T T;  4JI3 T;  1ZKE A;  2UXC T;  4GKK T;  4YTM A;  1Y64 B;  4ASK A;  4HKA A;  5E0O A;  3ZN0 B;  5LCY A;  3IF8 B;  4UVA B;  1HX8 A;  4AIS A;  5AQV B;  4UVB B;  2X51 A;  4PK6 A;  1I6Z A;  2W0G A;  3RKO A;  4YJ3 E;  3AE1 A;  1MMA A;  4BJM A;  2E9X C;  5AQI B;  1W09 A;  4AI6 A;  2FUP A;  5LOV E;  2QVA A;  3MKD A;  4ILB A;  1ZEE A;  1FEW A;  4DR4 T;  4HWF A;  2CWO A;  2XAG B;  2OLT A;  2Q9Q A;  4GKJ T;  1E7P A;  2XAS B;  5FVL A;  3GMI A;  2ZM6 T;  1IZN B;  3ZMU B;  3ZYL A;  4ZZB A;  5L3G B;  4ZI2 D;  5EK3 A;  2XZE A;  3P4Q A;  4YSX A;  3FHN A;  3T8O A;  4EZ4 A;  5C8Y E;  2H3R A;  4LF9 T;  4OFZ A;  3L8R A;  4KMC A;  3WAK A;  5ETW A;  2DL1 A;  3T1H T;  2UUC T;  3W15 B;  3V5U A;  2H89 A;  3MZK B;  1IBK T;  4UF0 A;  3TLU A;  3VHL A;  4DUZ T;  2ACZ A;  4PJM A;  4AXP A;  2EHO D;  2X66 A;  4LMK A;  4DV4 T;  1VCS A;  2D2S A;  4WZX A;  2J47 A;  4X1Y E;  2WCA A;  4QWN B;  5J2U E;  2VL0 A;  4A97 A;  3N9L A;  3BK9 A;  2A9U A;  1JNR A;  2KIN B;  3RF1 A;  1XWM A;  3Q9D A;  5AQR B;  1SE7 A;  1ZP0 A;  4U7I A;  3SRZ A;  3VR8 A;  4JI5 T;  3HI2 A;  3O9X A;  3N2O A;  5A1L A;  3R84 B;  2W00 A;  4ILC A;  4LF6 T;  1D1B A;  4ERR A;  3OVU A;  3PUS A;  3P4S A;  1D0Z A;  3PUW F;  3AB3 B;  4X1I E;  5EZY E;  3FZM B;  2DI4 A;  2K24 A;  4KHP T;  2LSJ A;  5L3D B;  1SA0 E;  2LE8 A;  3U3I A;  5FXV A;  3FZF B;  3N9Q A;  2UUA T;  4PAG A;  4BA9 A;  2WP9 A;  3EVY A;  4HFD A;  2SPC A;  5AQM B;  2WS3 A;  4WBO A;  2WDQ A;  5CFB A;  2CLY B;  2WDV A;  4KI0 F;  5HWX A;  5CB4 E;  2W2U A;  3E08 A;  5HEJ A;  2BBH A;  4QKN A;  4IDO A;  3VKH A;  5LB7 B;  4WNK A;  4YJ2 E;  1W9R A;  3KVA A;  2VB6 A;  3PUY F;  3C51 A;  2YIN A;  2UU9 T;  4UR9 A;  1N32 T;  2M6I A;  2XSB A;  1IJ6 A;  3ZC1 A;  5ABE A;  5HXE A;  4JI6 T;  1Z0P A;  5ADX L;  2BZB A;  2YOE A;  2PG8 A;  5AQL B;  2PFV A;  3CX7 B;  1NAF A;  4ZS2 A;  5HWY A;  3KDS E;  4K0K T;  3UUN A;  1SUM B;  4DBR A;  1OED A;  4LF4 T;  3UTK A;  5TAO A;  3RC8 A;  4TZ4 C;  1ZV4 X;  2VQF T;  3EUH A;  3UT5 E;  5DAB A;  3ZKR A;  2WU2 A;  3EDV A;  4AKR B;  5JDQ A;  2Q9Q B;  4YSZ A;  1T8B A;  1UUS A;  3VRB A;  3AA7 B;  2WWV A;  3KV5 A;  3N2G E;  2LLY A;  1KF6 A;  3ZT7 A;  5LYJ E;  1IBM T;  3RKG A;  3K1S A;  3EDU A;  3B5M A;  1WR6 A;  3RIA A;  3ETU A;  4HN9 A;  5L4H A;  4CZZ B;  4B3S T;  3PUQ A;  5JDF A;  3ZJ2 A;  3P4R A;  5JR9 C;  2XUE A;  2UXN B;  3ANW B;  4U3C A;  1KNZ A;  2VKJ A;  3CPZ A;  4DV3 T;  3A5X A;  2X0H A;  3JC6 D;  2L9Q A;  5KX5 E;  2WMN A;  2YDQ A;  3D0T A;  1O3X A;  5LXT E;  4JI8 T;  2J4G A;  4EAH A;  2VQE T;  2I59 A;  4TX5 A;  2XJ7 A;  3OJA A;  3N9N A;  5AQF B;  4O2A E;  2CRB A;  3I1A A;  1HG5 A;  3LG7 A;  2JQH A;  1IJ5 A;  3RIU C;  2CLY C;  3QC9 A;  2CPT A;  4DR3 T;  4UV9 B;  4ZI2 C;  3KFW X;  3S4U A;  3EHZ A;  4Q25 A;  2CA5 A;  4G2A A;  2CXL A;  2VL8 A;  4TUY E;  4IHJ E;  3Q5D A;  4C90 A;  3NZP A;  2XAJ B;  4AQF A;  2IW5 B;  4Z90 A;  4PFP A;  2QGS A;  2P9B A;  1XMO T;  4DND A;  3LBX B;  2H7O A;  3UUX B;  3N5L A;  5H6Q B;  2V5D A;  5HXC A;  4PJN A;  5LGT B;  3KBT A;  3G06 A;  3UU5 A;  5LA6 E;  4UXN B;  3OTO T;  2R6G F;  3V5S A;  5CJ5 A;  5LMU T;  1MMG A;  2XAF B;  2BG9 B;  4DV7 T;  2V7J A;  2BVL A;  3LSV A;  2EHO C;  3CWZ B;  1E1H B;  2XQ9 A;  1HTJ F;  3UUL A;  1WFD A;  2BS2 A;  2LJL A;  3L39 A;  4MHC A;  2W61 A;  2D0U A;  2KLQ A;  4GYR A;  3QB5 A;  3N9M A;  4L5G A;  5LHI B;  3UFE A;  1HR0 T;  1T7S A;  3MA9 A;  3BQK A;  3NKZ A;  3Q5X A;  3ZCJ A;  1XDP A;  5JDH A;  3TKL B;  5JVD E;  3O1H A;  2I0M A;  3AE9 A;  4TWH A;  1XNQ T;  2V8S V;  4H9P C;  3QNU A;  2V7I A;  5H6R B;  3DP7 A;  2WZI A;  4O4I E;  2JPF A;  3RHW A;  2K48 A;  3WI3 A;  1YQ3 A;  3DJB A;  1OWA A;  4GK0 E;  3NZQ A;  5BMV E;  2UXB T;  3I0Q A;  4DR5 T;  4MFR A;  2HPL A;  3C98 B;  1XNR T;  2CBJ A;  4QX7 B;  1LVK A;  3HR0 A;  1LKX A;  4X62 T;  3CIR A;  4EYY R;  3AEB A;  3CQC B;  2LSY A; 
#chains in the Genus database with same CATH homology
 4IDO A;  4IDP A;  3OVU A;  3QNU A;  1W0A A;  1XZY A;  4IDQ A;  1W0B A;  3Q5D A;  3IA3 A;  1Y01 A;  3QOF A;  3X1D A;  1Z8U A;  1W09 A;  4IDN A;  3Q5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...