4EYYR

Crystal structure of the icmr-icmq complex from legionella pneumophila
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
DVTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title IcmQ in the Type 4b secretion system contains an NAD+ binding domain.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein binding
molecule keywords IcmR
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4eyyR00
3N5LA 4FI5A 2CA5A 3CVRA 3FXDB 2C5IT 1H7CA 4L0RA 2C5KT 2IC6A 3P7IA 2KWIB 4J2CA 4B6XA 4EYYR 2X9YA 3QK6A 3FXEB 3QUJA 2G0UA 2K48A 3CKDA 2XTLA 1QSDA 2MBGA 1IJ6A 2C5JA 2X9XA 3MXZA 1LRZA 3L3PA 3S4UA 4DNDA 1IJ5A 1Z0PA 2KWHA 1ZKEA 2X9WA 1LVFA 3TKLB 4CQIA 2IC9A
chains in the Genus database with same CATH superfamily
5AQPB 2XSBA 4H9QC 4X1KE 1WR0A 1ZOYA 2WB5A 1E1HB 5LHHB 3N9NA 5DJQC 3HKCE 3LSVA 2X0HA 1XDPA 2E2AA 2MAWA 2QA7A 5AQLB 4UV8B 4A56A 2CWYA 4F6RC 4ZI2D 2HPLA 3ETVA 4LF9T 1N33T 3RC8A 5AQIB 2JPFA 2RA1A 4IT4A 2UXNB 1HG2A 3K8PC 4EYYR 5L47A 3KBUA 4ZOLE 2D2SA 3CKDA 3GN5A 2BG9C 4UEMA 5L4EA 2UU9T 4CXWA 1NWMX 4QXCB 2P9BA 3PUZF 3WAKA 3KV5A 3B57A 4L9IA 2VB6A 5HCMA 3KBTA 3ZMSB 2JJ9A 2WDRA 2CXFA 5GONE 3BK9A 3UU8A 3TKLB 1YKHB 3N5LA 4IHJE 4I4TE 2LSYA 4TN7B 2E9XD 1SE7A 2XY8B 3EHZA 4NUUA 1S94A 4JI3T 4JI6T 2XQAA 2X68A 4L0RA 3UT5E 3UQ4A 3JC6D 1NAFA 3AECA 3GMIA 3JAFA 4ZS2A 4X64T 2UUCT 3AVSA 2XASB 3O1JA 4DBQA 5L3BB 2KZ7B 3N9OA 3RIUA 4AQFC 3Q9DA 5LXTE 2NOXA 3AA0B 1D1CA 3ZT5A 4F8HA 2N9DA 3P4QA 5LCYA 2VKOA 2ZLYA 3AAEB 4EIWA 4B3TT 3N9PA 3PUQA 2QGSA 4JBWF 3ZCJA 4B3MT 3O9XA 2C5JA 1KNZA 1FEWA 3CK6A 5LBQB 2XJ7A 4X5TA 2L3LA 3L3PA 2H3RA 3Q2MA 2BS2A 5FYMA 2CBJA 3ZLIA 5ETWA 4EB6E 5LG4A 3J7Yq 3ANWA 3T8OA 3P4SA 1D0ZA 3I9WA 4P1NA 4QWNB 4XZCA 3RIUC 2V5CA 4AQFA 2JIWA 1HNXT 4NPPA 5FL1A 3KVBA 4QH4A 4QH5A 2VKHA 2X0YA 5HXHA 4HFDA 4ILBA 3A5XA 4TNVA 2A9UA 3HKEE 1HX1B 1I94T 3J9X1 4LF5T 5FXWA 2UXBT 2NTYA 3GWHA 2KWIB 1W0BA 1W9RA 4CN1A 5BR8T 1WYBA 5F8PA 4PJJA 4J2CA 2LM9A 4EYUA 4IDZA 3PUAA 2NR4A 2V6XA 3QUJA 2K48A 2Q9QD 1MMGA 4KBMB 4QHOA 3RH3A 4ANJA 3JC6C 2WU5A 3QB5A 2BVMA 4X65T 1IJ5A 1X79A 3CQXC 2IHR1 2W67A 1SA0E 3OYZA 1CHUA 4PFPA 2J4GA 3K3QC 2FBWA 3CWZB 5CA1E 3ONLC 1Y64B 3P50A 4TWHA 1UX5A 1KK7A 5DQWA 2SPCA 2LSIA 4YSXA 2W62A 3CVRA 4WW0A 1WFDA 5EK2A 4XBFB 4OHFA 4LMLA 1QUUA 4H63H 1YXRA 3VKGA 4CI1B 2ACXA 2UUBT 1HNWT 3UFGA 1MIVA 3ZMUB 3FZLB 3I9YA 2D0TA 2XM1A 5HEJA 4OYKA 4LFBT 4GK5E 1D1BA 2E9XA 4K0UA 4JI0T 4COFA 2J47A 1FJGT 2PFVA 4BA9A 5LHIB 4YTMA 4GOUA 4IGUA 1FMVA 4JI8T 1W0AA 3MXZA 2GK9A 5LGNB 5HAXA 3UUNA 2WAUA 4UR9A 3AE3A 4DNDA 3AEEA 4WYVA 3FZHB 4BJMA 5AQOB 3DP7A 2NW9A 1IBMT 4KHPT 2XPKA 2X9WA 2AE9A 4QX7B 5HCJA 3ZCIA 1NEKA 3SRZA 2IC9A 3C4WA 3EAMA 4CQIA 4CN6A 4DR1T 5FY0A 4HGAA 3RQUA 1E2AA 2DNXA 2YEVC 3QOFA 5L3DB 4H9RC 5FP3A 4DMVA 2Q9QC 4UVBB 1XZYA 3H3MA 4LMJA 1FMWA 4ZI3C 4JI5T 3PE0A 2K9AA 4C90A 5LMNT 3AA1B 5J2UE 2D9DA 4CXYA 1O3XA 1GQEA 1J5WA 2XHEB 3AEGA 5HEOA 4YSZA 3HKDE 4ERRA 5AQTB 4AI6A 4WZXA 2A72A 3T1YT 5JVDE 5LYJE 4MFRA 2DI4A 2HPJA 5DQVA 4ASKA 1N32T 2MTQA 2EHOC 2W63A 1U5PA 1UURA 2BS3A 1MMNA 5JDFA 1IJ6A 1CUNA 3AEAA 3G06A 2VQFT 2BKOA 2LHNA 3PURA 3I0QA 3EUHA 3PUSA 4X1YE 4EEBA 3MK7C 3IA3A 4LF4T 4TNWA 3AE2A 2KNDA 1X9BA 2WM9A 4O2AE 3RLFF 2Q9QA 2X9HA 3IHRA 2XQ6A 2E5LT 4DR5T 1YKEB 3RX6A 3RIAA 2LSGA 3EI0A 1MMAA 4AKIA 3K3OA 4YTNA 3T1HT 3RI5A 4DV4T 2J62A 1I6ZA 2QVAA 1HFAA 3WAJA 1HR0T 3N9MA 5JDNA 3P7IA 4EZ4A 4E7ZA 2RP4A 1NENA 2JQQA 4UVAB 3C4XA 4EV6A 3TLVA 4DUYT 1XDOA 3PJAA 5J2TE 4KP3C 2XQ9A 5HEGA 2XQYA 5LP6E 2G0UA 5AQSB 2E9XC 1OXZA 5ABEA 3ZYMA 4ZI3D 2WU2A 5CA0E 1LRZA 4Z8XA 3AA7B 1JNZA 1FIOA 3PUWF 2JQ9A 1SHZC 2WSSV 1D0YA 4H9PC 5AQGB 5AQVB 4ILAA 3RKGA 5ABFB 2EHOB 2WDQA 3ETUA 2IAKA 3ONJA 4U7YA 3H37A 1KNRA 4FJOA 2N2NA 2YDSA 4U31A 5L3CB 2ZM6T 3L39A 4BAYB 4ZEYA 1AJ3A 2W00A 2VL8A 3FXDB 2IW5B 5LJMA 2V1DB 3MKDA 3TLUA 2XAQB 1JNRA 5J1GA 4DV6T 2YDRA 4GK0E 5ADXL 2WWUA 4IE0A 4AKRB 1T7SA 4WBNE 1T8BA 2LM2A 2MOZA 2YN6A 4QX8B 3F31A 4OFZA 3EABA 4PJMA 2VL0A 5JRCA 2CEAA 3ZT6A 4OX9T 1KEYA 2H88A 4UV9B 5H6RB 1KFYA 5AQNB 3PUXF 1ZP0A 1XMQT 2H7OA 3P8CD 3KV6A 4JUYA 2VASA 2W4XA 4ZZCA 2V6YB 1IZNB 3NRYA 2CLYB 3KVAA 2UXCT 2WP9A 5EZYE 3EDUA 4CN4A 3LBXA 3S4UA 4PK5A 2EHOA 3RYFE 3FZKB 3ZJ1A 2CWOA 4TUYE 1M62A 2KINB 1M7KA 4I50E 4WBOA 4U2YA 5KMGP 1Y01A 4TV8E 2WBLA 4UXNB 3R84B 2XUEA 2ZM2A 3QB5K 3PU8A 5HEHA 3KV9A 4TV9E 1E7PA 4MALA 3RGLA 1MNEA 5L3EB 5JRCB 5AQQB 4UVCB 4AKGA 3AA6B 2ZMAA 1WRDA 1HX8A 3V5UA 2KT9A 4EGWA 2VK9A 4B6XA 2FJDA 4YT0A 4NUVA 2LT3A 2PBIA 4GYSA 1YQ4A 3ZN1B 1MIWA 2LJLA 4QXHB 2HN2A 4ADZA 4IL4A 2UXDT 3PJAJ 4H9SE 2Y8DA 3ZN0B 2V7LA 3HA4A 1HCIA 1UGOA 2DHRA 3VR8A 2VQET 5IUXA 4DV2T 4MBQA 4MLKA 4CI2B 4OYJA 3ZPOA 2CMRA 3MZKB 4P09A 4AQYT 3AE7A 3AE4A 4YHJA 3UU5A 3CQGB 2FUPA 2N1GA 3RF1A 4IDQA 4DVDA 2K3WA 2CHOA 3K1SA 4IDNA 4DO0A 2A2FX 2LSJA 2ODUA 2B1EA 1MIYA 4H9OC 2IIUA 2FJBA 4KX6A 5AQKB 5F3JA 3X1DA 4P0AA 4H63V 3RIFA 5JH7E 5JR9B 3PU3A 2VURA 4B3ST 2X0LB 4KMCA 4LFCT 3AXJB 5AQFB 5AQUB 4G2AA 5KDMC 2OA5A 5JDHA 3LBXB 5LJNA 1IAPA 5FVLA 4C91A 2HHHT 5CB4E 5ABHA 3M65A 5ABFA 3FXEB 4IREA 2DLRA 2I0MA 4IE4A 4PW8A 4PJNA 3W15B 3C51A 2PTFA 3PUYF 3U78A 1W09A 2Y6XA 4LF8T 1MMDA 3AEFA 3C50A 4LMKA 3I1AA 5L2LA 2IMLA 2FJAA 4YTPA 4NIQA 4EEDA 1B7TA 3C4ZA 3PTRB 3NZQA 4HEAA 4XAXB 3UULA 2VKJA 3AVRA 1Z0PA 3UU4A 3FBZA 4YJ2E 2X66A 5KX5E 4JI2T 4YHHT 1J5ET 2NW7A 3B5MA 3O1IA 4HFEA 2CCQA 5FXZA 4YXDA 3A7MA 3KV4A 2C5IT 4DBRA 4HWHA 4U33A 2V8SV 2CPTA 2BZBA 3NKZA 3OBVE 4PNIA 5FY1A 4ZI2C 2KMFA 3O4XE 1UUSA 3AAIA 5L3FB 3P4RA 4IDOA 1UCUA 2V26A 4YLHA 4M1PA 5ABGA 5J0ZA 3V5SA 4X66T 2XSAA 4ILCA 3LK42 5HXRA 2X9YA 3BQKA 1VCSA 4CI3B 1V9DA 1HF8A 3TLTA 1VOMA 2VVSA 2V7IA 2WCAA 4LFAT 3CX6B 1WR6A 1BR0A 4BJNA 1U4QA 2OV9A 2BG9A 4WNKA 3UU6A 4AKHA 2L9QA 2KLQA 4O8SA 5HXCA 2CXLA 2UXXB 2WZHA 4HWCA 2NTXA 3B13A 2CM0A 2E8IA 4EOZB 5JDGA 2CE7A 4B3RT 3D0TA 4X62T 3ZSTA 3UUMA 2WMOA 3AB3B 3L8RA 3LG7A 4X20E 4AISA 2K5BB 5JREA 4I0UA 5C3JA 2KSRA 4L5GA 3SFDA 4U3CA 3F57A 4N78D 3FZFB 4TWFA 5HWYA 2W0GA 3UTKA 2XQ3A 2UUAT 1H7CA 2BG9E 2D0UA 2ZM8A 2E5VA 2PJQA 2WQYA 3BQIA 2DWGA 3NZPA 2DL1A 4GYRA 4DV3T 2YOEA 1IBKT 3RYHE 4GIWA 3QNUA 5FY7A 5AQMB 4JI4T 3GA8A 3O1HA 4ZZBA 2H7VC 4TX5A 3AAAB 3TLWA 4V1Av 4UF0B 2XAGB 4Q25A 3CQCB 3BQLA 4ZI7E 3RHWA 5AFUL 3LJCA 2DCFA 3N9LA 2MBGA 4Z91A 3RC3A 5A1LA 4LF7T 4DR7T 4YSYA 3C64A 3M3ZB 1BR1A 3RRWA 4HE8A 3ANWB 5FL0A 2RPAA 3Q5XA 4OK0A 2LOPA 1D1AA 1WCRA 3HKBE 4HTEA 1DU2A 3P4PA 5JTGA 3F2EA 5JDQA 2BKPA 3SWHA 3ZEFB 2WY2A 4FI5A 3AEBA 2MPKA 1HG5A 1EZ3A 2X51A 3AE8A 3NVOA 2YDQA 2JMKA 3JADA 1OEDA 5BMVE 4DR4T 4JYAT 4KUMB 5LGUB 4NXMT 4A98A 5CJ5A 2I59A 2YINA 2XAFB 3NWIA 1XNRT 2XQ8A 2NW8A 3CX7B 4JEHB 5FXVA 5LA6E 3U3IA 2WWVA 3HR0A 5L3GB 4ZS3A 2ZM0A 3VR9A 5JDMA 5IWAT 2LLYA 1J1JA 1XWMA 2V7JA 4CZZB 1VRBA 2W2UA 1YQ3A 1QSDA 1UK5A 2X67A 4UIGA 2X9XA 5AQRB 4A5XA 1HTJF 4U72A 5JDLA 1ZEEA 3MA9A 4TZ4C 3UUBA 4A97A 4EXTA 4O4IE 4ISTA 3SFEA 3P4WA 4DIDB 4DV0T 2LRLA 2JRKA 4HFHA 1HNZT 3CPZA 3Q5EA 3OYXA 1G73A 3ZYKA 1R8IA 2R6GF 1WLXA 3H3AA 3LFMA 4JEUB 3K3NA 1L0VA 4GKJT 3GN5B 2DWKA 4IIJE 1YW0A 1YD8G 3Q5DA 4HFCA 5FKYA 4O4LE 4EZHA 1UX4A 2A3DA 4HFIA 4UF0A 3L09A 2K24A 2XQ5A 4DR2T 4DR3T 1MNDA 4PK4A 3IEEA 4X1IE 2FJEA 3KINB 3NBXX 2E9XB 5H6QB 3KDSE 4DV5T 3N2GE 4YJ3E 1QLBA 4YY3T 3QK6A 2VVNA 2V5DA 4Z90A 2V7MA 3ABVA 2CRBA 3HI2A 3MACA 4PK6A 3TLSA 4PFOA 3RPUA 2JQHA 3RQWA 2IUBA 2WS3A 3ZYLA 3N2OA 4IE6A 3CMLA 4EAHA 5LHGB 2W66A 2CXDA 2L8KA 5HXSA 4MHCA 2YKSA 3UQ7A 1KF6A 2B76A 2KWHA 2LHRA 1LVKA 2IDOB 3AXJA 2CLYC 5EK3A 5IYZE 2KXPB 2CHNA 4ISSA 1ZV4X 2LE8A 3DTOA 2XAJB 3OPCA 1Z8UA 2XQ7A 5HEUA 2M6IA 2YU1A 2D5UA 4JI1T 2JQKA 4QKNA 2EHOD 4JI7T 2CBIA 4O4JE 3ZMTB 3E22E 2XQ4A 1KNPA 2LSKA 1N36T 3JCFA 2BVLA 2J1DG 2M67A 4TWDA 5TAOA 1SUMB 2JMHA 3AE9A 4IL9A 5F5WA 3R6NA 4ZXLA 1D0XA 3AEDA 2OLTA 5EK4A 3ZT7A 2BKNA 1BR2A 3SS1A 3ZKRA 3RRCA 5LMUT 2XAHB 4JV5T 5HYAA 3ZMZB 5HXEA 1OEDE 3OKQA 3E0ZA 5JR9C 2NWBA 4U2ZA 3WI3A 1ZHCA 3VKHA 3VU7H 1LKXA 3NRXA 3QC9A 4U7IA 3EVYA 2Q9QB 2WMNA 2BDEA 4P0BA 4QXBB 2LOSA 3LDQB 3FBLA 4PJLA 3E08A 4HWFA 2I6HA 2LRKA 3C98B 2ODVA 1T72A 5LG3A 3CX8B 5FVKA 3A8YC 3DJBA 5LB7B 1G8XA 4DMWA 4HFBA 3ZC0A 4IE7A 3RYIE 2XM2A 3KFWX 5CFBA 3Q5WA 5HWXA 2C5KT 4DR6T 5AQHB 1OWAA 2IC6A 3AE1A 3LK3B 4AQGA 4LF6T 3EDVA 4GKKT 2BBJA 3IBPA 1XMOT 3OJAA 4K0KT 3UUXB 4I55E 3UU3A 2HN1A 2PG8A 3AE5A 1OEDB 4O4HE 5DABA 4YFSA 4HKAA 2QRXA 3ZC1A 3RKOA 4KI0F 3ZMVB 4CXXA 4DV1T 2BBHA 2ES0A 2V7KA 5JQGE 2NP9A 3ESLA 3PDYA 4HFVA 3ZJ2A 3PUVF 1S35A 5C2TA 4I43B 2M6BA 3MJXA 3N2KE 5LBMA 1ZKEA 3VHLA 1LVFA 5E0OA 5KXJA 2BG9B 2F4VT 3FZMB 4HN9A 3PUGA 3AE6A 2XZEA 2YK0A 1T98A 3OVUA 3HL6A 3I0OA 2CA5A 4UELA 4AKLA 2LKGA 1BR4A 5AQJB 3LK2B 4O2BE 4NXNT 5LOVE 1XNQT 5IHYA 3PV0F 3ZSSA 2W61A 5M4YA 5FXXA 4QH1A 3N9QA 4H9NC 1VCTA 2C0SA 5C8YE 2LEHA 5CGMA 5LNKA 2WDVA 2Y48B 2Z6EA 3ONXA 2YU2A 2QYWA 4G63A 3VRAA 5JR9A 2LKHA 4DUZT 1WYCA 5FMNA 3IF8B 2VWAA 4HWDA 4HWIB 2V6YA 4KHZF 4DV7T 1N34T 2HH7A 3FB2A 2XTLA 4AIUA 3OTOT 4U74A 1IBLT 3CIRA 4JLEA 2VKDA 3FHNA 2ACZA 4IE5A 4IDPA 4PAGA 4AXPA 1HS7A 5FNVE 2BS4A 4ZHQE 5LGTB 2WZIA 3SOLA 1US7B 2H89A 4ILUA 3RYCE 4E7SA 1OEDC 2MYSA 3JAEA 3UFEA 2AXDS 3VRBA 5L4HA
chains in the Genus database with same CATH topology
4X1KE 4H9QC 5LHHB 1E1HB 3N9NA 5DJQC 3HKCE 2QA7A 4A56A 4UV8B 2CWYA 4F6RC 2HPLA 3ETVA 3RC8A 2JPFA 2RA1A 2UXNB 1HG2A 3K8PC 4EYYR 3KBUA 4ZOLE 2D2SA 3CKDA 3GN5A 4UEMA 4CXWA 1NWMX 4QXCB 2P9BA 3WAKA 3KV5A 3B57A 4L9IA 2VB6A 3ZMSB 3KBTA 2JJ9A 2CXFA 5GONE 3BK9A 3TKLB 1YKHB 3N5LA 4IHJE 4I4TE 2LSYA 4TN7B 2E9XD 4NUUA 1S94A 3UT5E 2X68A 4L0RA 3JC6D 1NAFA 4ZS2A 3GMIA 3AVSA 2XASB 3O1JA 4DBQA 5L3BB 2KZ7B 3N9OA 4AQFC 5LXTE 3Q9DA 2NOXA 3AA0B 1D1CA 2N9DA 5LCYA 2VKOA 2ZLYA 3AAEB 4EIWA 3N9PA 3PUQA 2QGSA 3ZCJA 3O9XA 2C5JA 1KNZA 1FEWA 5LBQB 2L3LA 3L3PA 2H3RA 3Q2MA 5FYMA 3ZLIA 4EB6E 4ZI2D 5ETWA 5LG4A 3J7Yq 3ANWA 3T8OA 1D0ZA 3I9WA 4QWNB 4XZCA 4AQFA 3KVBA 2VKHA 5HXHA 3A5XA 3HKEE 3J9X1 5FXWA 2NTYA 3GWHA 2KWIB 1WYBA 5F8PA 4PJJA 4J2CA 2LM9A 4EYUA 4IDZA 3PUAA 3QUJA 2K48A 2Q9QD 1MMGA 4KBMB 4QHOA 3RH3A 4ANJA 3JC6C 2BVMA 1IJ5A 1X79A 3CQXC 3OYZA 1SA0E 4PFPA 3K3QC 5CA1E 3CWZB 1Y64B 1UX5A 1KK7A 5DQWA 2SPCA 2LSIA 5EK2A 2W62A 3CVRA 4WW0A 4OHFA 1QUUA 4H63H 3VKGA 4CI1B 2ACXA 1MIVA 3ZMUB 3I9YA 2D0TA 4OYKA 4GK5E 1D1BA 2E9XA 4K0UA 2PFVA 4BA9A 5LHIB 4GOUA 4IGUA 1FMVA 3MXZA 2GK9A 5LGNB 5HAXA 3UUNA 2WAUA 4DNDA 4BJMA 3DP7A 2NW9A 2X9WA 4QX7B 3ZCIA 3SRZA 3C4WA 2IC9A 4CQIA 3ZC0A 5FY0A 4HGAA 2YEVC 2DNXA 5L3DB 4H9RC 5FP3A 4DMVA 2Q9QC 4UVBB 4ZI3C 4C90A 1FMWA 3PE0A 2K9AA 3AA1B 5J2UE 4CXYA 1O3XA 2XHEB 3HKDE 4ERRA 4AI6A 2A72A 5JVDE 5LYJE 4MFRA 2DI4A 2HPJA 5DQVA 4ASKA 2MTQA 2EHOC 2W63A 1U5PA 5JDFA 1MMNA 1IJ6A 1CUNA 3PURA 2LHNA 3I0QA 3EUHA 3PUSA 4X1YE 3MK7C 2KNDA 2WM9A 4O2AE 2Q9QA 2X9HA 3IHRA 1YKEB 3RX6A 2LSGA 1MMAA 4AKIA 3K3OA 1HFAA 3WAJA 3N9MA 5JDNA 3P7IA 4EZ4A 4E7ZA 2RP4A 2JQQA 4UVAB 3C4XA 5J2TE 4KP3C 2XQYA 5LP6E 2G0UA 2E9XC 1OXZA 3ZYMA 4ZI3D 5CA0E 1LRZA 4Z8XA 3AA7B 1FIOA 4H9PC 1SHZC 2WSSV 1D0YA 2EHOB 3ETUA 4AXPA 2IAKA 3H37A 4FJOA 2N2NA 5L3CB 4BAYB 1AJ3A 2W00A 2VL8A 3FXDB 2IW5B 5LJMA 2V1DB 3MKDA 2XAQB 5J1GA 4GK0E 5ADXL 2WWUA 4IE0A 4AKRB 4WBNE 2MOZA 4QX8B 3F31A 4OFZA 4PJMA 5JRCA 2CEAA 4UV9B 5H6RB 2H7OA 3P8CD 3KV6A 4JUYA 2VASA 1IZNB 3NRYA 2CLYB 3KVAA 5EZYE 3EDUA 3LBXA 3S4UA 4PK5A 2EHOA 3RYFE 3ZJ1A 2CWOA 4TUYE 2KINB 4I50E 4WBOA 5KMGP 4TV8E 2WBLA 4UXNB 3R84B 2XUEA 2ZM2A 3PU8A 3KV9A 4TV9E 4MALA 1MNEA 5L3EB 5JRCB 4UVCB 4AKGA 3AA6B 2ZMAA 1WRDA 1HX8A 3V5UA 2KT9A 2VK9A 4B6XA 4NUVA 2LT3A 2PBIA 4GYSA 3ZN1B 1MIWA 2LJLA 4QXHB 4ADZA 4H9SE 2Y8DA 3ZN0B 2V7LA 3HA4A 1HCIA 2DHRA 4MBQA 4MLKA 4CI2B 4OYJA 3ZPOA 2CMRA 3MZKB 4P09A 4YHJA 3CQGB 2N1GA 4DVDA 4DO0A 2A2FX 2LSJA 2ODUA 2B1EA 1MIYA 4H9OC 5F3JA 4P0AA 4H63V 5JR9B 3PU3A 2X0LB 4KMCA 4G2AA 5KDMC 2OA5A 5JDHA 3LBXB 5LJNA 1IAPA 4C91A 5CB4E 3M65A 3FXEB 2DLRA 4PW8A 4IE4A 4PJNA 3W15B 3C51A 3U78A 5L2LA 2Y6XA 1MMDA 3C50A 3I1AA 1B7TA 3C4ZA 3PTRB 3NZQA 4HEAA 4XAXB 3UULA 2VKJA 3AVRA 1Z0PA 4YJ2E 3FBZA 2X66A 5KX5E 2NW7A 3O1IA 2CCQA 5FXZA 3KV4A 2C5IT 4DBRA 3OBVE 2BZBA 5FY1A 4PNIA 4ZI2C 2KMFA 3O4XE 3AAIA 5L3FB 1UCUA 2V26A 4YLHA 4M1PA 3V5SA 3LK42 5HXRA 2X9YA 3BQKA 4CI3B 1V9DA 1HF8A 1VOMA 2V7IA 3CX6B 1WR6A 1BR0A 4BJNA 1U4QA 4WNKA 4AKHA 2L9QA 2KLQA 4O8SA 5HXCA 2CXLA 2UXXB 2NTXA 3B13A 2CM0A 2E8IA 4EOZB 5JDGA 2CE7A 3D0TA 3UUMA 2WMOA 3AB3B 3LG7A 4X20E 5JREA 2K5BB 4L5GA 3F57A 4N78D 5HWYA 2W0GA 3UTKA 1H7CA 2D0UA 2ZM8A 2PJQA 3BQIA 3NZPA 2DWGA 4GYRA 3RYHE 4GIWA 5FY7A 3GA8A 3O1HA 2H7VC 4TX5A 3AAAB 4V1Av 4UF0B 2XAGB 3CQCB 3BQLA 4ZI7E 5AFUL 3LJCA 2DCFA 3N9LA 2MBGA 3RC3A 5A1LA 3C64A 3RRWA 1BR1A 4HE8A 3ANWB 3Q5XA 4OK0A 2LOPA 1D1AA 3HKBE 4HTEA 3F2EA 5JDQA 3SWHA 3ZEFB 4FI5A 1HG5A 1EZ3A 2X51A 5BMVE 2JMKA 4KUMB 5LGUB 2I59A 2YINA 2XAFB 2NW8A 3CX7B 4JEHB 5FXVA 5LA6E 3U3IA 5L3GB 3HR0A 4ZS3A 2ZM0A 5JDMA 2V7JA 4CZZB 1VRBA 1QSDA 2X67A 4UIGA 2X9XA 1HTJF 4U72A 5JDLA 1ZEEA 3MA9A 4TZ4C 4EXTA 4O4IE 4ISTA 2JRKA 3CPZA 3OYXA 1G73A 3ZYKA 3H3AA 3LFMA 1WLXA 4JEUB 3K3NA 3GN5B 2DWKA 4IIJE 1YW0A 1YD8G 4O4LE 4EZHA 1UX4A 2A3DA 4UF0A 3L09A 2K24A 1MNDA 4PK4A 3IEEA 4X1IE 3KINB 3NBXX 2E9XB 5H6QB 3KDSE 3N2GE 4YJ3E 3QK6A 2V7MA 3HI2A 4PK6A 3MACA 4PFOA 3RPUA 3ZYLA 3N2OA 4IE6A 3CMLA 4EAHA 5LHGB 2CXDA 2L8KA 4MHCA 2KWHA 2LHRA 5EK3A 1LVKA 2CLYC 5IYZE 2KXPB 4ISSA 5HXSA 1ZV4X 2LE8A 3DTOA 2XAJB 5JH7E 2YU1A 2D5UA 4QKNA 2EHOD 4O4JE 3ZMTB 3E22E 2LSKA 2BVLA 2J1DG 2M67A 5TAOA 2JMHA 3R6NA 1D0XA 5EK4A 1BR2A 3SS1A 3RRCA 2XAHB 5HYAA 3ZMZB 5HXEA 3OKQA 5JR9C 3E0ZA 2NWBA 3WI3A 1ZHCA 3VKHA 3VU7H 1LKXA 3NRXA 3QC9A 3EVYA 2Q9QB 2WMNA 2BDEA 4P0BA 4QXBB 2LOSA 3FBLA 4PJLA 3E08A 3C98B 2ODVA 3CX8B 4DMWA 3DJBA 1G8XA 4IE7A 3RYIE 3KFWX 3Q5WA 5HWXA 2C5KT 1OWAA 2IC6A 3LK3B 4AQGA 3EDVA 3IBPA 3OJAA 3UUXB 4I55E 2PG8A 4O4HE 5DABA 3ZC1A 4YFSA 4HKAA 3RKOA 3ZMVB 4CXXA 2V7KA 2ES0A 5JQGE 2NP9A 3ESLA 3PDYA 4HFVA 3ZJ2A 1S35A 4I43B 3MJXA 5LBMA 3N2KE 1ZKEA 3VHLA 1LVFA 5E0OA 4HN9A 3PUGA 2YK0A 1T98A 3HL6A 3I0OA 2CA5A 4UELA 4AKLA 1BR4A 3LK2B 4O2BE 5LOVE 5IHYA 2W61A 5M4YA 5FXXA 4XBFB 3N9QA 4H9NC 2C0SA 5C8YE 5LNKA 2LEHA 2Y48B 2Z6EA 3ONXA 2YU2A 4G63A 5JR9A 1WYCA 5FMNA 3IF8B 2VWAA 2HH7A 3FB2A 2XTLA 4U74A 4JLEA 4PAGA 2VKDA 3FHNA 4IE5A 1HS7A 5FNVE 4ZHQE 5LGTB 3SOLA 1US7B 4ILUA 3RYCE 4E7SA 2MYSA 3UFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N5L A;  4FI5 A;  2CA5 A;  3CVR A;  3FXD B;  2C5I T;  1H7C A;  4L0R A;  2C5K T;  2IC6 A;  3P7I A;  2KWI B;  4J2C A;  4B6X A;  4EYY R;  2X9Y A;  3QK6 A;  3FXE B;  3QUJ A;  2G0U A;  2K48 A;  3CKD A;  2XTL A;  1QSD A;  2MBG A;  1IJ6 A;  2C5J A;  2X9X A;  3MXZ A;  1LRZ A;  3L3P A;  3S4U A;  4DND A;  1IJ5 A;  1Z0P A;  2KWH A;  1ZKE A;  2X9W A;  1LVF A;  3TKL B;  4CQI A;  2IC9 A; 
#chains in the Genus database with same CATH topology
 5AQP B;  2XSB A;  4H9Q C;  4X1K E;  1WR0 A;  1ZOY A;  2WB5 A;  1E1H B;  5LHH B;  3N9N A;  5DJQ C;  3HKC E;  3LSV A;  2X0H A;  1XDP A;  2E2A A;  2MAW A;  2QA7 A;  5AQL B;  4UV8 B;  4A56 A;  2CWY A;  4F6R C;  4ZI2 D;  2HPL A;  3ETV A;  4LF9 T;  1N33 T;  3RC8 A;  5AQI B;  2JPF A;  2RA1 A;  4IT4 A;  2UXN B;  1HG2 A;  3K8P C;  4EYY R;  5L47 A;  3KBU A;  4ZOL E;  2D2S A;  3CKD A;  3GN5 A;  2BG9 C;  4UEM A;  5L4E A;  2UU9 T;  4CXW A;  1NWM X;  4QXC B;  2P9B A;  3PUZ F;  3WAK A;  3KV5 A;  3B57 A;  4L9I A;  2VB6 A;  5HCM A;  3KBT A;  3ZMS B;  2JJ9 A;  2WDR A;  2CXF A;  5GON E;  3BK9 A;  3UU8 A;  3TKL B;  1YKH B;  3N5L A;  4IHJ E;  4I4T E;  2LSY A;  4TN7 B;  2E9X D;  1SE7 A;  2XY8 B;  3EHZ A;  4NUU A;  1S94 A;  4JI3 T;  4JI6 T;  2XQA A;  2X68 A;  4L0R A;  3UT5 E;  3UQ4 A;  3JC6 D;  1NAF A;  3AEC A;  3GMI A;  3JAF A;  4ZS2 A;  4X64 T;  2UUC T;  3AVS A;  2XAS B;  3O1J A;  4DBQ A;  5L3B B;  2KZ7 B;  3N9O A;  3RIU A;  4AQF C;  3Q9D A;  5LXT E;  2NOX A;  3AA0 B;  1D1C A;  3ZT5 A;  4F8H A;  2N9D A;  3P4Q A;  5LCY A;  2VKO A;  2ZLY A;  3AAE B;  4EIW A;  4B3T T;  3N9P A;  3PUQ A;  2QGS A;  4JBW F;  3ZCJ A;  4B3M T;  3O9X A;  2C5J A;  1KNZ A;  1FEW A;  3CK6 A;  5LBQ B;  2XJ7 A;  4X5T A;  2L3L A;  3L3P A;  2H3R A;  3Q2M A;  2BS2 A;  5FYM A;  2CBJ A;  3ZLI A;  5ETW A;  4EB6 E;  5LG4 A;  3J7Y q;  3ANW A;  3T8O A;  3P4S A;  1D0Z A;  3I9W A;  4P1N A;  4QWN B;  4XZC A;  3RIU C;  2V5C A;  4AQF A;  2JIW A;  1HNX T;  4NPP A;  5FL1 A;  3KVB A;  4QH4 A;  4QH5 A;  2VKH A;  2X0Y A;  5HXH A;  4HFD A;  4ILB A;  3A5X A;  4TNV A;  2A9U A;  3HKE E;  1HX1 B;  1I94 T;  3J9X 1;  4LF5 T;  5FXW A;  2UXB T;  2NTY A;  3GWH A;  2KWI B;  1W0B A;  1W9R A;  4CN1 A;  5BR8 T;  1WYB A;  5F8P A;  4PJJ A;  4J2C A;  2LM9 A;  4EYU A;  4IDZ A;  3PUA A;  2NR4 A;  2V6X A;  3QUJ A;  2K48 A;  2Q9Q D;  1MMG A;  4KBM B;  4QHO A;  3RH3 A;  4ANJ A;  3JC6 C;  2WU5 A;  3QB5 A;  2BVM A;  4X65 T;  1IJ5 A;  1X79 A;  3CQX C;  2IHR 1;  2W67 A;  1SA0 E;  3OYZ A;  1CHU A;  4PFP A;  2J4G A;  3K3Q C;  2FBW A;  3CWZ B;  5CA1 E;  3ONL C;  1Y64 B;  3P50 A;  4TWH A;  1UX5 A;  1KK7 A;  5DQW A;  2SPC A;  2LSI A;  4YSX A;  2W62 A;  3CVR A;  4WW0 A;  1WFD A;  5EK2 A;  4XBF B;  4OHF A;  4LML A;  1QUU A;  4H63 H;  1YXR A;  3VKG A;  4CI1 B;  2ACX A;  2UUB T;  1HNW T;  3UFG A;  1MIV A;  3ZMU B;  3FZL B;  3I9Y A;  2D0T A;  2XM1 A;  5HEJ A;  4OYK A;  4LFB T;  4GK5 E;  1D1B A;  2E9X A;  4K0U A;  4JI0 T;  4COF A;  2J47 A;  1FJG T;  2PFV A;  4BA9 A;  5LHI B;  4YTM A;  4GOU A;  4IGU A;  1FMV A;  4JI8 T;  1W0A A;  3MXZ A;  2GK9 A;  5LGN B;  5HAX A;  3UUN A;  2WAU A;  4UR9 A;  3AE3 A;  4DND A;  3AEE A;  4WYV A;  3FZH B;  4BJM A;  5AQO B;  3DP7 A;  2NW9 A;  1IBM T;  4KHP T;  2XPK A;  2X9W A;  2AE9 A;  4QX7 B;  5HCJ A;  3ZCI A;  1NEK A;  3SRZ A;  2IC9 A;  3C4W A;  3EAM A;  4CQI A;  4CN6 A;  4DR1 T;  5FY0 A;  4HGA A;  3RQU A;  1E2A A;  2DNX A;  2YEV C;  3QOF A;  5L3D B;  4H9R C;  5FP3 A;  4DMV A;  2Q9Q C;  4UVB B;  1XZY A;  3H3M A;  4LMJ A;  1FMW A;  4ZI3 C;  4JI5 T;  3PE0 A;  2K9A A;  4C90 A;  5LMN T;  3AA1 B;  5J2U E;  2D9D A;  4CXY A;  1O3X A;  1GQE A;  1J5W A;  2XHE B;  3AEG A;  5HEO A;  4YSZ A;  3HKD E;  4ERR A;  5AQT B;  4AI6 A;  4WZX A;  2A72 A;  3T1Y T;  5JVD E;  5LYJ E;  4MFR A;  2DI4 A;  2HPJ A;  5DQV A;  4ASK A;  1N32 T;  2MTQ A;  2EHO C;  2W63 A;  1U5P A;  1UUR A;  2BS3 A;  1MMN A;  5JDF A;  1IJ6 A;  1CUN A;  3AEA A;  3G06 A;  2VQF T;  2BKO A;  2LHN A;  3PUR A;  3I0Q A;  3EUH A;  3PUS A;  4X1Y E;  4EEB A;  3MK7 C;  3IA3 A;  4LF4 T;  4TNW A;  3AE2 A;  2KND A;  1X9B A;  2WM9 A;  4O2A E;  3RLF F;  2Q9Q A;  2X9H A;  3IHR A;  2XQ6 A;  2E5L T;  4DR5 T;  1YKE B;  3RX6 A;  3RIA A;  2LSG A;  3EI0 A;  1MMA A;  4AKI A;  3K3O A;  4YTN A;  3T1H T;  3RI5 A;  4DV4 T;  2J62 A;  1I6Z A;  2QVA A;  1HFA A;  3WAJ A;  1HR0 T;  3N9M A;  5JDN A;  3P7I A;  4EZ4 A;  4E7Z A;  2RP4 A;  1NEN A;  2JQQ A;  4UVA B;  3C4X A;  4EV6 A;  3TLV A;  4DUY T;  1XDO A;  3PJA A;  5J2T E;  4KP3 C;  2XQ9 A;  5HEG A;  2XQY A;  5LP6 E;  2G0U A;  5AQS B;  2E9X C;  1OXZ A;  5ABE A;  3ZYM A;  4ZI3 D;  2WU2 A;  5CA0 E;  1LRZ A;  4Z8X A;  3AA7 B;  1JNZ A;  1FIO A;  3PUW F;  2JQ9 A;  1SHZ C;  2WSS V;  1D0Y A;  4H9P C;  5AQG B;  5AQV B;  4ILA A;  3RKG A;  5ABF B;  2EHO B;  2WDQ A;  3ETU A;  2IAK A;  3ONJ A;  4U7Y A;  3H37 A;  1KNR A;  4FJO A;  2N2N A;  2YDS A;  4U31 A;  5L3C B;  2ZM6 T;  3L39 A;  4BAY B;  4ZEY A;  1AJ3 A;  2W00 A;  2VL8 A;  3FXD B;  2IW5 B;  5LJM A;  2V1D B;  3MKD A;  3TLU A;  2XAQ B;  1JNR A;  5J1G A;  4DV6 T;  2YDR A;  4GK0 E;  5ADX L;  2WWU A;  4IE0 A;  4AKR B;  1T7S A;  4WBN E;  1T8B A;  2LM2 A;  2MOZ A;  2YN6 A;  4QX8 B;  3F31 A;  4OFZ A;  3EAB A;  4PJM A;  2VL0 A;  5JRC A;  2CEA A;  3ZT6 A;  4OX9 T;  1KEY A;  2H88 A;  4UV9 B;  5H6R B;  1KFY A;  5AQN B;  3PUX F;  1ZP0 A;  1XMQ T;  2H7O A;  3P8C D;  3KV6 A;  4JUY A;  2VAS A;  2W4X A;  4ZZC A;  2V6Y B;  1IZN B;  3NRY A;  2CLY B;  3KVA A;  2UXC T;  2WP9 A;  5EZY E;  3EDU A;  4CN4 A;  3LBX A;  3S4U A;  4PK5 A;  2EHO A;  3RYF E;  3FZK B;  3ZJ1 A;  2CWO A;  4TUY E;  1M62 A;  2KIN B;  1M7K A;  4I50 E;  4WBO A;  4U2Y A;  5KMG P;  1Y01 A;  4TV8 E;  2WBL A;  4UXN B;  3R84 B;  2XUE A;  2ZM2 A;  3QB5 K;  3PU8 A;  5HEH A;  3KV9 A;  4TV9 E;  1E7P A;  4MAL A;  3RGL A;  1MNE A;  5L3E B;  5JRC B;  5AQQ B;  4UVC B;  4AKG A;  3AA6 B;  2ZMA A;  1WRD A;  1HX8 A;  3V5U A;  2KT9 A;  4EGW A;  2VK9 A;  4B6X A;  2FJD A;  4YT0 A;  4NUV A;  2LT3 A;  2PBI A;  4GYS A;  1YQ4 A;  3ZN1 B;  1MIW A;  2LJL A;  4QXH B;  2HN2 A;  4ADZ A;  4IL4 A;  2UXD T;  3PJA J;  4H9S E;  2Y8D A;  3ZN0 B;  2V7L A;  3HA4 A;  1HCI A;  1UGO A;  2DHR A;  3VR8 A;  2VQE T;  5IUX A;  4DV2 T;  4MBQ A;  4MLK A;  4CI2 B;  4OYJ A;  3ZPO A;  2CMR A;  3MZK B;  4P09 A;  4AQY T;  3AE7 A;  3AE4 A;  4YHJ A;  3UU5 A;  3CQG B;  2FUP A;  2N1G A;  3RF1 A;  4IDQ A;  4DVD A;  2K3W A;  2CHO A;  3K1S A;  4IDN A;  4DO0 A;  2A2F X;  2LSJ A;  2ODU A;  2B1E A;  1MIY A;  4H9O C;  2IIU A;  2FJB A;  4KX6 A;  5AQK B;  5F3J A;  3X1D A;  4P0A A;  4H63 V;  3RIF A;  5JH7 E;  5JR9 B;  3PU3 A;  2VUR A;  4B3S T;  2X0L B;  4KMC A;  4LFC T;  3AXJ B;  5AQF B;  5AQU B;  4G2A A;  5KDM C;  2OA5 A;  5JDH A;  3LBX B;  5LJN A;  1IAP A;  5FVL A;  4C91 A;  2HHH T;  5CB4 E;  5ABH A;  3M65 A;  5ABF A;  3FXE B;  4IRE A;  2DLR A;  2I0M A;  4IE4 A;  4PW8 A;  4PJN A;  3W15 B;  3C51 A;  2PTF A;  3PUY F;  3U78 A;  1W09 A;  2Y6X A;  4LF8 T;  1MMD A;  3AEF A;  3C50 A;  4LMK A;  3I1A A;  5L2L A;  2IML A;  2FJA A;  4YTP A;  4NIQ A;  4EED A;  1B7T A;  3C4Z A;  3PTR B;  3NZQ A;  4HEA A;  4XAX B;  3UUL A;  2VKJ A;  3AVR A;  1Z0P A;  3UU4 A;  3FBZ A;  4YJ2 E;  2X66 A;  5KX5 E;  4JI2 T;  4YHH T;  1J5E T;  2NW7 A;  3B5M A;  3O1I A;  4HFE A;  2CCQ A;  5FXZ A;  4YXD A;  3A7M A;  3KV4 A;  2C5I T;  4DBR A;  4HWH A;  4U33 A;  2V8S V;  2CPT A;  2BZB A;  3NKZ A;  3OBV E;  4PNI A;  5FY1 A;  4ZI2 C;  2KMF A;  3O4X E;  1UUS A;  3AAI A;  5L3F B;  3P4R A;  4IDO A;  1UCU A;  2V26 A;  4YLH A;  4M1P A;  5ABG A;  5J0Z A;  3V5S A;  4X66 T;  2XSA A;  4ILC A;  3LK4 2;  5HXR A;  2X9Y A;  3BQK A;  1VCS A;  4CI3 B;  1V9D A;  1HF8 A;  3TLT A;  1VOM A;  2VVS A;  2V7I A;  2WCA A;  4LFA T;  3CX6 B;  1WR6 A;  1BR0 A;  4BJN A;  1U4Q A;  2OV9 A;  2BG9 A;  4WNK A;  3UU6 A;  4AKH A;  2L9Q A;  2KLQ A;  4O8S A;  5HXC A;  2CXL A;  2UXX B;  2WZH A;  4HWC A;  2NTX A;  3B13 A;  2CM0 A;  2E8I A;  4EOZ B;  5JDG A;  2CE7 A;  4B3R T;  3D0T A;  4X62 T;  3ZST A;  3UUM A;  2WMO A;  3AB3 B;  3L8R A;  3LG7 A;  4X20 E;  4AIS A;  2K5B B;  5JRE A;  4I0U A;  5C3J A;  2KSR A;  4L5G A;  3SFD A;  4U3C A;  3F57 A;  4N78 D;  3FZF B;  4TWF A;  5HWY A;  2W0G A;  3UTK A;  2XQ3 A;  2UUA T;  1H7C A;  2BG9 E;  2D0U A;  2ZM8 A;  2E5V A;  2PJQ A;  2WQY A;  3BQI A;  2DWG A;  3NZP A;  2DL1 A;  4GYR A;  4DV3 T;  2YOE A;  1IBK T;  3RYH E;  4GIW A;  3QNU A;  5FY7 A;  5AQM B;  4JI4 T;  3GA8 A;  3O1H A;  4ZZB A;  2H7V C;  4TX5 A;  3AAA B;  3TLW A;  4V1A v;  4UF0 B;  2XAG B;  4Q25 A;  3CQC B;  3BQL A;  4ZI7 E;  3RHW A;  5AFU L;  3LJC A;  2DCF A;  3N9L A;  2MBG A;  4Z91 A;  3RC3 A;  5A1L A;  4LF7 T;  4DR7 T;  4YSY A;  3C64 A;  3M3Z B;  1BR1 A;  3RRW A;  4HE8 A;  3ANW B;  5FL0 A;  2RPA A;  3Q5X A;  4OK0 A;  2LOP A;  1D1A A;  1WCR A;  3HKB E;  4HTE A;  1DU2 A;  3P4P A;  5JTG A;  3F2E A;  5JDQ A;  2BKP A;  3SWH A;  3ZEF B;  2WY2 A;  4FI5 A;  3AEB A;  2MPK A;  1HG5 A;  1EZ3 A;  2X51 A;  3AE8 A;  3NVO A;  2YDQ A;  2JMK A;  3JAD A;  1OED A;  5BMV E;  4DR4 T;  4JYA T;  4KUM B;  5LGU B;  4NXM T;  4A98 A;  5CJ5 A;  2I59 A;  2YIN A;  2XAF B;  3NWI A;  1XNR T;  2XQ8 A;  2NW8 A;  3CX7 B;  4JEH B;  5FXV A;  5LA6 E;  3U3I A;  2WWV A;  3HR0 A;  5L3G B;  4ZS3 A;  2ZM0 A;  3VR9 A;  5JDM A;  5IWA T;  2LLY A;  1J1J A;  1XWM A;  2V7J A;  4CZZ B;  1VRB A;  2W2U A;  1YQ3 A;  1QSD A;  1UK5 A;  2X67 A;  4UIG A;  2X9X A;  5AQR B;  4A5X A;  1HTJ F;  4U72 A;  5JDL A;  1ZEE A;  3MA9 A;  4TZ4 C;  3UUB A;  4A97 A;  4EXT A;  4O4I E;  4IST A;  3SFE A;  3P4W A;  4DID B;  4DV0 T;  2LRL A;  2JRK A;  4HFH A;  1HNZ T;  3CPZ A;  3Q5E A;  3OYX A;  1G73 A;  3ZYK A;  1R8I A;  2R6G F;  1WLX A;  3H3A A;  3LFM A;  4JEU B;  3K3N A;  1L0V A;  4GKJ T;  3GN5 B;  2DWK A;  4IIJ E;  1YW0 A;  1YD8 G;  3Q5D A;  4HFC A;  5FKY A;  4O4L E;  4EZH A;  1UX4 A;  2A3D A;  4HFI A;  4UF0 A;  3L09 A;  2K24 A;  2XQ5 A;  4DR2 T;  4DR3 T;  1MND A;  4PK4 A;  3IEE A;  4X1I E;  2FJE A;  3KIN B;  3NBX X;  2E9X B;  5H6Q B;  3KDS E;  4DV5 T;  3N2G E;  4YJ3 E;  1QLB A;  4YY3 T;  3QK6 A;  2VVN A;  2V5D A;  4Z90 A;  2V7M A;  3ABV A;  2CRB A;  3HI2 A;  3MAC A;  4PK6 A;  3TLS A;  4PFO A;  3RPU A;  2JQH A;  3RQW A;  2IUB A;  2WS3 A;  3ZYL A;  3N2O A;  4IE6 A;  3CML A;  4EAH A;  5LHG B;  2W66 A;  2CXD A;  2L8K A;  5HXS A;  4MHC A;  2YKS A;  3UQ7 A;  1KF6 A;  2B76 A;  2KWH A;  2LHR A;  1LVK A;  2IDO B;  3AXJ A;  2CLY C;  5EK3 A;  5IYZ E;  2KXP B;  2CHN A;  4ISS A;  1ZV4 X;  2LE8 A;  3DTO A;  2XAJ B;  3OPC A;  1Z8U A;  2XQ7 A;  5HEU A;  2M6I A;  2YU1 A;  2D5U A;  4JI1 T;  2JQK A;  4QKN A;  2EHO D;  4JI7 T;  2CBI A;  4O4J E;  3ZMT B;  3E22 E;  2XQ4 A;  1KNP A;  2LSK A;  1N36 T;  3JCF A;  2BVL A;  2J1D G;  2M67 A;  4TWD A;  5TAO A;  1SUM B;  2JMH A;  3AE9 A;  4IL9 A;  5F5W A;  3R6N A;  4ZXL A;  1D0X A;  3AED A;  2OLT A;  5EK4 A;  3ZT7 A;  2BKN A;  1BR2 A;  3SS1 A;  3ZKR A;  3RRC A;  5LMU T;  2XAH B;  4JV5 T;  5HYA A;  3ZMZ B;  5HXE A;  1OED E;  3OKQ A;  3E0Z A;  5JR9 C;  2NWB A;  4U2Z A;  3WI3 A;  1ZHC A;  3VKH A;  3VU7 H;  1LKX A;  3NRX A;  3QC9 A;  4U7I A;  3EVY A;  2Q9Q B;  2WMN A;  2BDE A;  4P0B A;  4QXB B;  2LOS A;  3LDQ B;  3FBL A;  4PJL A;  3E08 A;  4HWF A;  2I6H A;  2LRK A;  3C98 B;  2ODV A;  1T72 A;  5LG3 A;  3CX8 B;  5FVK A;  3A8Y C;  3DJB A;  5LB7 B;  1G8X A;  4DMW A;  4HFB A;  3ZC0 A;  4IE7 A;  3RYI E;  2XM2 A;  3KFW X;  5CFB A;  3Q5W A;  5HWX A;  2C5K T;  4DR6 T;  5AQH B;  1OWA A;  2IC6 A;  3AE1 A;  3LK3 B;  4AQG A;  4LF6 T;  3EDV A;  4GKK T;  2BBJ A;  3IBP A;  1XMO T;  3OJA A;  4K0K T;  3UUX B;  4I55 E;  3UU3 A;  2HN1 A;  2PG8 A;  3AE5 A;  1OED B;  4O4H E;  5DAB A;  4YFS A;  4HKA A;  2QRX A;  3ZC1 A;  3RKO A;  4KI0 F;  3ZMV B;  4CXX A;  4DV1 T;  2BBH A;  2ES0 A;  2V7K A;  5JQG E;  2NP9 A;  3ESL A;  3PDY A;  4HFV A;  3ZJ2 A;  3PUV F;  1S35 A;  5C2T A;  4I43 B;  2M6B A;  3MJX A;  3N2K E;  5LBM A;  1ZKE A;  3VHL A;  1LVF A;  5E0O A;  5KXJ A;  2BG9 B;  2F4V T;  3FZM B;  4HN9 A;  3PUG A;  3AE6 A;  2XZE A;  2YK0 A;  1T98 A;  3OVU A;  3HL6 A;  3I0O A;  2CA5 A;  4UEL A;  4AKL A;  2LKG A;  1BR4 A;  5AQJ B;  3LK2 B;  4O2B E;  4NXN T;  5LOV E;  1XNQ T;  5IHY A;  3PV0 F;  3ZSS A;  2W61 A;  5M4Y A;  5FXX A;  4QH1 A;  3N9Q A;  4H9N C;  1VCT A;  2C0S A;  5C8Y E;  2LEH A;  5CGM A;  5LNK A;  2WDV A;  2Y48 B;  2Z6E A;  3ONX A;  2YU2 A;  2QYW A;  4G63 A;  3VRA A;  5JR9 A;  2LKH A;  4DUZ T;  1WYC A;  5FMN A;  3IF8 B;  2VWA A;  4HWD A;  4HWI B;  2V6Y A;  4KHZ F;  4DV7 T;  1N34 T;  2HH7 A;  3FB2 A;  2XTL A;  4AIU A;  3OTO T;  4U74 A;  1IBL T;  3CIR A;  4JLE A;  2VKD A;  3FHN A;  2ACZ A;  4IE5 A;  4IDP A;  4PAG A;  4AXP A;  1HS7 A;  5FNV E;  2BS4 A;  4ZHQ E;  5LGT B;  2WZI A;  3SOL A;  1US7 B;  2H89 A;  4ILU A;  3RYC E;  4E7S A;  1OED C;  2MYS A;  3JAE A;  3UFE A;  2AXD S;  3VRB A;  5L4H A; 
#chains in the Genus database with same CATH homology
 4X1K E;  4H9Q C;  5LHH B;  1E1H B;  3N9N A;  5DJQ C;  3HKC E;  2QA7 A;  4A56 A;  4UV8 B;  2CWY A;  4F6R C;  2HPL A;  3ETV A;  3RC8 A;  2JPF A;  2RA1 A;  2UXN B;  1HG2 A;  3K8P C;  4EYY R;  3KBU A;  4ZOL E;  2D2S A;  3CKD A;  3GN5 A;  4UEM A;  4CXW A;  1NWM X;  4QXC B;  2P9B A;  3WAK A;  3KV5 A;  3B57 A;  4L9I A;  2VB6 A;  3ZMS B;  3KBT A;  2JJ9 A;  2CXF A;  5GON E;  3BK9 A;  3TKL B;  1YKH B;  3N5L A;  4IHJ E;  4I4T E;  2LSY A;  4TN7 B;  2E9X D;  4NUU A;  1S94 A;  3UT5 E;  2X68 A;  4L0R A;  3JC6 D;  1NAF A;  4ZS2 A;  3GMI A;  3AVS A;  2XAS B;  3O1J A;  4DBQ A;  5L3B B;  2KZ7 B;  3N9O A;  4AQF C;  5LXT E;  3Q9D A;  2NOX A;  3AA0 B;  1D1C A;  2N9D A;  5LCY A;  2VKO A;  2ZLY A;  3AAE B;  4EIW A;  3N9P A;  3PUQ A;  2QGS A;  3ZCJ A;  3O9X A;  2C5J A;  1KNZ A;  1FEW A;  5LBQ B;  2L3L A;  3L3P A;  2H3R A;  3Q2M A;  5FYM A;  3ZLI A;  4EB6 E;  4ZI2 D;  5ETW A;  5LG4 A;  3J7Y q;  3ANW A;  3T8O A;  1D0Z A;  3I9W A;  4QWN B;  4XZC A;  4AQF A;  3KVB A;  2VKH A;  5HXH A;  3A5X A;  3HKE E;  3J9X 1;  5FXW A;  2NTY A;  3GWH A;  2KWI B;  1WYB A;  5F8P A;  4PJJ A;  4J2C A;  2LM9 A;  4EYU A;  4IDZ A;  3PUA A;  3QUJ A;  2K48 A;  2Q9Q D;  1MMG A;  4KBM B;  4QHO A;  3RH3 A;  4ANJ A;  3JC6 C;  2BVM A;  1IJ5 A;  1X79 A;  3CQX C;  3OYZ A;  1SA0 E;  4PFP A;  3K3Q C;  5CA1 E;  3CWZ B;  1Y64 B;  1UX5 A;  1KK7 A;  5DQW A;  2SPC A;  2LSI A;  5EK2 A;  2W62 A;  3CVR A;  4WW0 A;  4OHF A;  1QUU A;  4H63 H;  3VKG A;  4CI1 B;  2ACX A;  1MIV A;  3ZMU B;  3I9Y A;  2D0T A;  4OYK A;  4GK5 E;  1D1B A;  2E9X A;  4K0U A;  2PFV A;  4BA9 A;  5LHI B;  4GOU A;  4IGU A;  1FMV A;  3MXZ A;  2GK9 A;  5LGN B;  5HAX A;  3UUN A;  2WAU A;  4DND A;  4BJM A;  3DP7 A;  2NW9 A;  2X9W A;  4QX7 B;  3ZCI A;  3SRZ A;  3C4W A;  2IC9 A;  4CQI A;  3ZC0 A;  5FY0 A;  4HGA A;  2YEV C;  2DNX A;  5L3D B;  4H9R C;  5FP3 A;  4DMV A;  2Q9Q C;  4UVB B;  4ZI3 C;  4C90 A;  1FMW A;  3PE0 A;  2K9A A;  3AA1 B;  5J2U E;  4CXY A;  1O3X A;  2XHE B;  3HKD E;  4ERR A;  4AI6 A;  2A72 A;  5JVD E;  5LYJ E;  4MFR A;  2DI4 A;  2HPJ A;  5DQV A;  4ASK A;  2MTQ A;  2EHO C;  2W63 A;  1U5P A;  5JDF A;  1MMN A;  1IJ6 A;  1CUN A;  3PUR A;  2LHN A;  3I0Q A;  3EUH A;  3PUS A;  4X1Y E;  3MK7 C;  2KND A;  2WM9 A;  4O2A E;  2Q9Q A;  2X9H A;  3IHR A;  1YKE B;  3RX6 A;  2LSG A;  1MMA A;  4AKI A;  3K3O A;  1HFA A;  3WAJ A;  3N9M A;  5JDN A;  3P7I A;  4EZ4 A;  4E7Z A;  2RP4 A;  2JQQ A;  4UVA B;  3C4X A;  5J2T E;  4KP3 C;  2XQY A;  5LP6 E;  2G0U A;  2E9X C;  1OXZ A;  3ZYM A;  4ZI3 D;  5CA0 E;  1LRZ A;  4Z8X A;  3AA7 B;  1FIO A;  4H9P C;  1SHZ C;  2WSS V;  1D0Y A;  2EHO B;  3ETU A;  4AXP A;  2IAK A;  3H37 A;  4FJO A;  2N2N A;  5L3C B;  4BAY B;  1AJ3 A;  2W00 A;  2VL8 A;  3FXD B;  2IW5 B;  5LJM A;  2V1D B;  3MKD A;  2XAQ B;  5J1G A;  4GK0 E;  5ADX L;  2WWU A;  4IE0 A;  4AKR B;  4WBN E;  2MOZ A;  4QX8 B;  3F31 A;  4OFZ A;  4PJM A;  5JRC A;  2CEA A;  4UV9 B;  5H6R B;  2H7O A;  3P8C D;  3KV6 A;  4JUY A;  2VAS A;  1IZN B;  3NRY A;  2CLY B;  3KVA A;  5EZY E;  3EDU A;  3LBX A;  3S4U A;  4PK5 A;  2EHO A;  3RYF E;  3ZJ1 A;  2CWO A;  4TUY E;  2KIN B;  4I50 E;  4WBO A;  5KMG P;  4TV8 E;  2WBL A;  4UXN B;  3R84 B;  2XUE A;  2ZM2 A;  3PU8 A;  3KV9 A;  4TV9 E;  4MAL A;  1MNE A;  5L3E B;  5JRC B;  4UVC B;  4AKG A;  3AA6 B;  2ZMA A;  1WRD A;  1HX8 A;  3V5U A;  2KT9 A;  2VK9 A;  4B6X A;  4NUV A;  2LT3 A;  2PBI A;  4GYS A;  3ZN1 B;  1MIW A;  2LJL A;  4QXH B;  4ADZ A;  4H9S E;  2Y8D A;  3ZN0 B;  2V7L A;  3HA4 A;  1HCI A;  2DHR A;  4MBQ A;  4MLK A;  4CI2 B;  4OYJ A;  3ZPO A;  2CMR A;  3MZK B;  4P09 A;  4YHJ A;  3CQG B;  2N1G A;  4DVD A;  4DO0 A;  2A2F X;  2LSJ A;  2ODU A;  2B1E A;  1MIY A;  4H9O C;  5F3J A;  4P0A A;  4H63 V;  5JR9 B;  3PU3 A;  2X0L B;  4KMC A;  4G2A A;  5KDM C;  2OA5 A;  5JDH A;  3LBX B;  5LJN A;  1IAP A;  4C91 A;  5CB4 E;  3M65 A;  3FXE B;  2DLR A;  4PW8 A;  4IE4 A;  4PJN A;  3W15 B;  3C51 A;  3U78 A;  5L2L A;  2Y6X A;  1MMD A;  3C50 A;  3I1A A;  1B7T A;  3C4Z A;  3PTR B;  3NZQ A;  4HEA A;  4XAX B;  3UUL A;  2VKJ A;  3AVR A;  1Z0P A;  4YJ2 E;  3FBZ A;  2X66 A;  5KX5 E;  2NW7 A;  3O1I A;  2CCQ A;  5FXZ A;  3KV4 A;  2C5I T;  4DBR A;  3OBV E;  2BZB A;  5FY1 A;  4PNI A;  4ZI2 C;  2KMF A;  3O4X E;  3AAI A;  5L3F B;  1UCU A;  2V26 A;  4YLH A;  4M1P A;  3V5S A;  3LK4 2;  5HXR A;  2X9Y A;  3BQK A;  4CI3 B;  1V9D A;  1HF8 A;  1VOM A;  2V7I A;  3CX6 B;  1WR6 A;  1BR0 A;  4BJN A;  1U4Q A;  4WNK A;  4AKH A;  2L9Q A;  2KLQ A;  4O8S A;  5HXC A;  2CXL A;  2UXX B;  2NTX A;  3B13 A;  2CM0 A;  2E8I A;  4EOZ B;  5JDG A;  2CE7 A;  3D0T A;  3UUM A;  2WMO A;  3AB3 B;  3LG7 A;  4X20 E;  5JRE A;  2K5B B;  4L5G A;  3F57 A;  4N78 D;  5HWY A;  2W0G A;  3UTK A;  1H7C A;  2D0U A;  2ZM8 A;  2PJQ A;  3BQI A;  3NZP A;  2DWG A;  4GYR A;  3RYH E;  4GIW A;  5FY7 A;  3GA8 A;  3O1H A;  2H7V C;  4TX5 A;  3AAA B;  4V1A v;  4UF0 B;  2XAG B;  3CQC B;  3BQL A;  4ZI7 E;  5AFU L;  3LJC A;  2DCF A;  3N9L A;  2MBG A;  3RC3 A;  5A1L A;  3C64 A;  3RRW A;  1BR1 A;  4HE8 A;  3ANW B;  3Q5X A;  4OK0 A;  2LOP A;  1D1A A;  3HKB E;  4HTE A;  3F2E A;  5JDQ A;  3SWH A;  3ZEF B;  4FI5 A;  1HG5 A;  1EZ3 A;  2X51 A;  5BMV E;  2JMK A;  4KUM B;  5LGU B;  2I59 A;  2YIN A;  2XAF B;  2NW8 A;  3CX7 B;  4JEH B;  5FXV A;  5LA6 E;  3U3I A;  5L3G B;  3HR0 A;  4ZS3 A;  2ZM0 A;  5JDM A;  2V7J A;  4CZZ B;  1VRB A;  1QSD A;  2X67 A;  4UIG A;  2X9X A;  1HTJ F;  4U72 A;  5JDL A;  1ZEE A;  3MA9 A;  4TZ4 C;  4EXT A;  4O4I E;  4IST A;  2JRK A;  3CPZ A;  3OYX A;  1G73 A;  3ZYK A;  3H3A A;  3LFM A;  1WLX A;  4JEU B;  3K3N A;  3GN5 B;  2DWK A;  4IIJ E;  1YW0 A;  1YD8 G;  4O4L E;  4EZH A;  1UX4 A;  2A3D A;  4UF0 A;  3L09 A;  2K24 A;  1MND A;  4PK4 A;  3IEE A;  4X1I E;  3KIN B;  3NBX X;  2E9X B;  5H6Q B;  3KDS E;  3N2G E;  4YJ3 E;  3QK6 A;  2V7M A;  3HI2 A;  4PK6 A;  3MAC A;  4PFO A;  3RPU A;  3ZYL A;  3N2O A;  4IE6 A;  3CML A;  4EAH A;  5LHG B;  2CXD A;  2L8K A;  4MHC A;  2KWH A;  2LHR A;  5EK3 A;  1LVK A;  2CLY C;  5IYZ E;  2KXP B;  4ISS A;  5HXS A;  1ZV4 X;  2LE8 A;  3DTO A;  2XAJ B;  5JH7 E;  2YU1 A;  2D5U A;  4QKN A;  2EHO D;  4O4J E;  3ZMT B;  3E22 E;  2LSK A;  2BVL A;  2J1D G;  2M67 A;  5TAO A;  2JMH A;  3R6N A;  1D0X A;  5EK4 A;  1BR2 A;  3SS1 A;  3RRC A;  2XAH B;  5HYA A;  3ZMZ B;  5HXE A;  3OKQ A;  5JR9 C;  3E0Z A;  2NWB A;  3WI3 A;  1ZHC A;  3VKH A;  3VU7 H;  1LKX A;  3NRX A;  3QC9 A;  3EVY A;  2Q9Q B;  2WMN A;  2BDE A;  4P0B A;  4QXB B;  2LOS A;  3FBL A;  4PJL A;  3E08 A;  3C98 B;  2ODV A;  3CX8 B;  4DMW A;  3DJB A;  1G8X A;  4IE7 A;  3RYI E;  3KFW X;  3Q5W A;  5HWX A;  2C5K T;  1OWA A;  2IC6 A;  3LK3 B;  4AQG A;  3EDV A;  3IBP A;  3OJA A;  3UUX B;  4I55 E;  2PG8 A;  4O4H E;  5DAB A;  3ZC1 A;  4YFS A;  4HKA A;  3RKO A;  3ZMV B;  4CXX A;  2V7K A;  2ES0 A;  5JQG E;  2NP9 A;  3ESL A;  3PDY A;  4HFV A;  3ZJ2 A;  1S35 A;  4I43 B;  3MJX A;  5LBM A;  3N2K E;  1ZKE A;  3VHL A;  1LVF A;  5E0O A;  4HN9 A;  3PUG A;  2YK0 A;  1T98 A;  3HL6 A;  3I0O A;  2CA5 A;  4UEL A;  4AKL A;  1BR4 A;  3LK2 B;  4O2B E;  5LOV E;  5IHY A;  2W61 A;  5M4Y A;  5FXX A;  4XBF B;  3N9Q A;  4H9N C;  2C0S A;  5C8Y E;  5LNK A;  2LEH A;  2Y48 B;  2Z6E A;  3ONX A;  2YU2 A;  4G63 A;  5JR9 A;  1WYC A;  5FMN A;  3IF8 B;  2VWA A;  2HH7 A;  3FB2 A;  2XTL A;  4U74 A;  4JLE A;  4PAG A;  2VKD A;  3FHN A;  4IE5 A;  1HS7 A;  5FNV E;  4ZHQ E;  5LGT B;  3SOL A;  1US7 B;  4ILU A;  3RYC E;  4E7S A;  2MYS A;  3UFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...