4EYYR

Crystal structure of the icmr-icmq complex from legionella pneumophila
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
DVTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords IcmR
publication title IcmQ in the Type 4b secretion system contains an NAD+ binding domain.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4eyyR00
1IJ5A 4EYYR 1ZKEA 2C5IT 2X9XA 4DNDA 4B6XA 3CKDA 3CVRA 3MXZA 3L3PA 4J2CA 1H7CA 3S4UA 1QSDA 2XTLA 4FI5A 2C5KT 3FXEB 3P7IA 1LVFA 3TKLB 2KWHA 2KWIB 3FXDB 2K48A 2IC6A 3QK6A 2IC9A 4L0RA 1Z0PA 3QUJA 2CA5A 3N5LA 1LRZA 4CQIA 1IJ6A 2C5JA 2G0UA 2X9YA 2X9WA 2MBGA
chains in the Genus database with same CATH superfamily
4ILUA 4HE8A 3C98B 3CQGB 4G2AA 4YHHT 4GK0E 4KI0F 4AQFA 2JQQA 4U2YA 2XQ3A 2E9XC 5JR9A 4A98A 2ZM0A 3CPZA 3C64A 4DV6T 1MIVA 5LGTB 4UEMA 3PUGA 4FI5A 2HH7A 2WMNA 1VCSA 3A8YC 2KWIB 5AQSB 2KXPB 3CQCB 3AEAA 2YU2A 2CRBA 2RA1A 4DR7T 2XTLA 1XDOA 4JBWF 4IE5A 1B7TA 1UGOA 5LA6E 3BQLA 3LBXB 3RC8A 3N2KE 2RPAA 1ZP0A 2WU2A 4H63H 5AQLB 4HFVA 3MXZA 2V6YA 2LLYA 4TUYE 2ODVA 2WM9A 4U33A 5ABGA 3PUAA 5KX5E 3AVSA 2E5LT 2CXDA 4DR6T 3PJAA 4ISSA 3N2OA 3HKDE 1IJ5A 4U74A 4DMWA 2YK0A 2E9XD 2X0YA 2Q9QC 5LMNT 4HFEA 5AQVB 4LMLA 1YW0A 3ZC1A 2EHOA 3KFWX 3ONLC 2D5UA 2LSGA 5FVKA 3TLWA 3N5LA 4TWDA 3K3OA 3G06A 1HS7A 4DO0A 2VB6A 3RHWA 4UV8B 2CBIA 4AI6A 3QB5K 2X9XA 1SUMB 1KEYA 1VCTA 2XQAA 3K8PC 5ABFA 4DR3T 1HNWT 5FYMA 2H7OA 5AQIB 3P4PA 2W61A 4DR4T 2PBIA 4ERRA 2H88A 5LB7B 4PFOA 4GK5E 1W9RA 1HCIA 4TNVA 2YOEA 4KMCA 2UUAT 1ZEEA 5F3JA 2YDRA 5AQMB 2VKHA 4IDQA 2P9BA 1IBLT 4BA9A 3O1JA 1FMVA 2Q9QD 2CM0A 5LBMA 1E1HB 5TAOA 3PUSA 4COFA 4PW8A 1D1BA 2DHRA 3DP7A 3M3ZB 1YD8G 5HWXA 1D0ZA 3N9OA 1MMAA 4UVBB 4U31A 2LOPA 4HKAA 4PK6A 2WSSV 2LRKA 2CBJA 4IIJE 2E5VA 4DNDA 3LBXA 4ZOLE 2WY2A 3PU8A 1M7KA 4DV3T 2R6GF 4WBNE 1M62A 4A5XA 2HHHT 2WMOA 4PK5A 3B5MA 4JI7T 3FXDB 2IC6A 1BR2A 5BMVE 1KNZA 2BS3A 2YINA 4CQIA 4TWHA 2FBWA 3UFGA 2LHNA 3P8CD 1YQ4A 4XBFB 4JLEA 2FJBA 5IYZE 2CCQA 2IAKA 2W0GA 3LSVA 2JJ9A 2DWGA 4MBQA 4PJNA 3L39A 3ZYKA 4YXDA 4EYUA 4NIQA 2XHEB 4EZ4A 5J2TE 2XAFB 5FY0A 2XQYA 1UK5A 3AE3A 2X66A 3HKBE 3AVRA 3IA3A 4L9IA 1WYBA 2LHRA 4DV4T 1Y01A 4UVCB 5LOVE 3FZLB 4WBOA 4KX6A 2W4XA 2OLTA 4H9QC 5HEHA 2LE8A 3ABVA 5HXHA 3FZHB 1N34T 4IE7A 2PTFA 1HG2A 2LSKA 3FZKB 3EUHA 3FZFB 2UXCT 2LRLA 2A72A 3C4ZA 2W62A 5DJQC 2DL1A 2N1GA 5EK3A 5JDQA 3OTOT 3GWHA 5LG3A 4DR2T 2MOZA 3ZJ1A 1XZYA 3FBZA 2UXDT 3HKCE 2XQ4A 4HWHA 5FVLA 1IBKT 3UUNA 3JAFA 4NUVA 3DTOA 3ZEFB 1WFDA 4H9OC 4GYSA 3FXEB 4B3MT 4NPPA 4Z90A 1LKXA 4ZHQE 3AAAB 4KP3C 3RYHE 3U78A 2V5DA 5AQKB 4WYVA 5LJNA 3N9NA 4HFHA 2WCAA 4O4LE 5AQUB 4DVDA 2W63A 4H9PC 3Q9DA 4L0RA 2Y6XA 5F5WA 4DUYT 1QUUA 2NTXA 1OWAA 3VKHA 2J62A 5JTGA 3ZYMA 3F31A 2DNXA 3VHLA 4LF7T 1SA0E 5L3GB 1KNRA 5AQOB 3ETVA 3TLSA 2CA5A 4HTEA 3GN5A 1S35A 2UUBT 4YTPA 3FBLA 2HN1A 4M1PA 4X62T 4LF9T 4E7ZA 1XNQT 3AEDA 2JRKA 4AQYT 2KZ7B 3N9LA 2VKJA 2WBLA 5L47A 3LG7A 4I55E 2LSJA 2V26A 4NXNT 3NBXX 3LJCA 3P4WA 3NRXA 1HFAA 2H89A 3OJAA 2C5IT 3EAMA 4GOUA 5JDGA 2E9XB 5HAXA 3PU3A 2WZHA 1HX1B 1U5PA 5HEUA 4IDPA 4O4JE 1D0YA 4TNWA 1OEDA 2XQ6A 1EZ3A 5JVDE 2XQ7A 3PUVF 4J2CA 2XY8B 4UELA 4DV7T 1HNXT 2IDOB 3L8RA 3RIUA 4O4HE 2CE7A 3GA8A 5KXJA 1NWMX 2KMFA 2DI4A 1WLXA 5L4EA 1AJ3A 5CB4E 3N9PA 3LK2B 5LG4A 3SS1A 3MZKB 4QX8B 5J1GA 5JDLA 5ADXL 3TLVA 2CMRA 4LFCT 4NUUA 4EEDA 2X9WA 3KV9A 5CFBA 1ZKEA 1J5ET 3UUBA 1US7B 2HPJA 4ZEYA 3RYCE 4HWIB 2CXLA 4CN1A 5JDMA 3J9X1 3RRCA 1UURA 5CA0E 4EZHA 2NOXA 2LEHA 3ZPOA 4HWDA 4QXCB 3A5XA 1L0VA 2B1EA 4ILCA 4ZXLA 1YKEB 4TN7B 2Q9QB 3EHZA 3CVRA 2YDQA 1VRBA 4UR9A 3OVUA 3ZYLA 1N33T 4Q25A 2M6IA 4X20E 3AE4A 3N2GE 1IZNB 4EIWA 3PTRB 3NKZA 4C91A 4JI3T 2LKHA 4DIDB 4AISA 2WB5A 3QOFA 4X64T 2Y48B 5LXTE 4IE0A 3FHNA 4QH1A 1HR0T 3HL6A 2BG9A 4AKIA 2BKOA 2DLRA 3ZCJA 3DJBA 1ZHCA 5L2LA 4F6RC 3ZT6A 4B3ST 1T7SA 4OHFA 3SRZA 2WS3A 1ZOYA 3EDUA 2KWHA 3W15B 1LVKA 3AEGA 3ZMTB 2E9XA 3OYXA 2ZM6T 5BR8T 4H9NC 4U72A 5JREA 3ZN1B 5FXWA 1FMWA 2WWUA 3JCFA 3ESLA 5LJMA 3TLTA 4GKKT 3AXJB 4MLKA 3RF1A 2KSRA 1YKHB 3ZC0A 5AFUL 2JPFA 5AQNB 3T8OA 3RQWA 4CXYA 1T72A 3CK6A 4TZ4C 3AE8A 5ABEA 3V5SA 3TKLB 3AE1A 3RQUA 4P0AA 1KNPA 2E8IA 1MNEA 5M4YA 3N9MA 3Q2MA 2NR4A 5DABA 3UU5A 2L8KA 3D0TA 5C3JA 3Q5DA 2EHOD 2LJLA 2K9AA 2V7JA 2I59A 4P1NA 2J4GA 3MK7C 5FL0A 3V5UA 3PV0F 1D0XA 1H7CA 3AB3B 4AKHA 5HWYA 5FY1A 3UULA 4O8SA 5HYAA 4HGAA 5CJ5A 2V5CA 5HEOA 2WDVA 3AEEA 3P4SA 5J0ZA 4C90A 2Q9QA 3U3IA 4OK0A 3I0QA 5L3CB 5EZYE 3KVBA 2WQYA 4NXMT 2C5JA 2NWBA 5HCJA 2JQ9A 4B6XA 4P09A 1W0AA 1HTJF 4UF0B 4TV8E 3ZT5A 2DWKA 3PUZF 1G8XA 3KV4A 3ONXA 4EOZB 3P7IA 1Z8UA 4QHOA 1QLBA 3P4QA 2XSAA 2X51A 4E7SA 3NVOA 5FKYA 4JI2T 4MFRA 2IHR1 1HG5A 2V7IA 4YHJA 3ANWB 3RYFE 1I6ZA 4YLHA 3KV5A 2ZM8A 3IEEA 3MJXA 4CN4A 2XJ7A 3BQIA 3OYZA 1D1AA 3MA9A 3ZMVB 4LF6T 4X1IE 4Z8XA 3WAKA 2MPKA 4ZS3A 4QX7B 3UQ7A 2MTQA 4HWFA 2V1DB 4LF5T 3L09A 3RIFA 4JEUB 1MMNA 3M65A 3OKQA 2VURA 3AXJA 3UQ4A 3MKDA 4ZI7E 2K5BB 1BR1A 3WAJA 1WYCA 1CUNA 3PUQA 4CXWA 5ABHA 5JRCB 1CHUA 5HXRA 2FJDA 2QVAA 2ACZA 2L9QA 5CA1E 4EAHA 3R84B 3ZLIA 3MACA 3OBVE 2N9DA 2HPLA 2DCFA 4QH5A 5AQHB 4HFBA 3KVAA 3SOLA 1Z0PA 3Q5XA 5L4HA 3AA7B 5HEGA 4DV0T 2YKSA 2XSBA 1BR0A 1VOMA 1X9BA 4EV6A 5JH7E 1XWMA 2OA5A 5KDMC 4IDZA 1MIWA 2QYWA 5LGNB 4O2AE 3O1HA 3I9YA 1UX5A 2GK9A 4ADZA 2H3RA 4UXNB 1J5WA 2WP9A 1WR0A 2BVLA 1SHZC 2CEAA 3K3NA 4IE4A 5LYJE 4UF0A 3SFDA 3QUJA 2C0SA 3TLUA 2A2FX 4IDNA 2I6HA 5H6QB 3RRWA 3RKOA 3AEFA 5IUXA 2ZLYA 3C4XA 3CMLA 2YDSA 4LF8T 5JDNA 3HA4A 2MAWA 1KK7A 2YU1A 4JYAT 2JQKA 2JMHA 2PFVA 4YY3T 3ZMZB 2CHOA 1NAFA 4ZZBA 3ANWA 2XZEA 5JDFA 3BQKA 2XQ8A 3S4UA 5LHGB 3C50A 2C5KT 4BJNA 5JR9B 3RGLA 2XAJB 1DU2A 4IE6A 3EVYA 3OPCA 5FY7A 2XAGB 2UXBT 3T1HT 4AKLA 2V7LA 2ZM2A 3CIRA 3R6NA 2V7MA 2QRXA 2K24A 3CX6B 1XNRT 3VKGA 3UU8A 3PUWF 1UX4A 5LBQB 5KMGP 2ODUA 5AQJB 2BBHA 3KBTA 4EXTA 2X9HA 3H37A 2CLYB 3JAEA 1KF6A 2XAQB 3EDVA 1OXZA 4YJ2E 4YSZA 1I94T 2IW5B 4AKRB 2LOSA 4PJJA 3AAIA 4QXHB 5LNKA 4JI1T 4CXXA 4HWCA 3VRAA 4ILBA 4B3RT 2V6YB 2XASB 3VR8A 4U3CA 3C51A 3UUMA 4LFAT 3P4RA 4ZZCA 3Q5WA 4AQFC 4AKGA 1HF8A 2D9DA 4IGUA 4AXPA 5JR9C 3ZMUB 1HX8A 1T8BA 5IHYA 3X1DA 2X67A 3RPUA 2EHOB 4ASKA 4DBRA 3AE6A 2VVSA 2D2SA 3IHRA 3PDYA 2NW8A 3IF8B 3RKGA 1W0BA 4QXBB 2A9UA 2SPCA 4L5GA 4X1KE 4K0KT 4PJLA 1R8IA 2CLYC 2XM2A 4KUMB 1JNZA 2MYSA 3I0OA 4WW0A 3B13A 1WRDA 2VL8A 5JDHA 3QK6A 4XAXB 2PG8A 5ABFB 2ACXA 4DV2T 5ETWA 2VKDA 1E2AA 1WR6A 2VKOA 4KHPT 5FP3A 5J2UE 3ZT7A 2J1DG 4CI1B 5FNVE 5AQFB 4X66T 5CGMA 2PJQA 4QWNB 1Y64B 4I4TE 1IAPA 1GQEA 4ILAA 4UV9B 1XMQT 3ZMSB 2EHOC 3HI2A 3LDQB 2XQ9A 1LVFA 3C4WA 1FJGT 4ISTA 2BKNA 4OX9T 1NEKA 2BBJA 4LMJA 4EEBA 4JV5T 3K3QC 4IL4A 1HNZT 4K0UA 1NENA 2B76A 1U4QA 4UIGA 4CN6A 2XPKA 4DV5T 4A56A 3I9WA 4AQGA 2UUCT 3PURA 4V1Av 2YN6A 4YSYA 4PJMA 2VASA 4I50E 5A1LA 5F8PA 2NW9A 1S94A 3AEBA 4IL9A 3FZMB 1ZV4X 2CPTA 5LMUT 2IC9A 2RP4A 2KNDA 5AQPB 4PAGA 1JNRA 4LFBT 2UXXB 2JIWA 4KBMB 4X5TA 1D1CA 2KINB 3UU6A 3ZKRA 2VL0A 3AA0B 4EB6E 4EGWA 2H7VC 2WU5A 4F8HA 4LF4T 3CWZB 2QGSA 1YQ3A 4O4IE 3BK9A 3IBPA 3AE9A 4H9SE 4YSXA 2L3LA 3CX7B 2LM2A 3NZPA 4IDOA 2CWYA 1MMDA 5LGUB 2NW7A 4U2ZA 2F4VT 5EK2A 1W09A 3F57A 3QNUA 4B3TT 2MBGA 5L3FB 4LMKA 5DQVA 2W2UA 5HCMA 4U7YA 2VWAA 2NP9A 5AQTB 3JADA 4ZI3C 5C8YE 1YXRA 2LKGA 3ZCIA 1XDPA 2LM9A 4XZCA 3UU4A 1MIYA 2WZIA 3UTKA 3K1SA 4WZXA 1E7PA 3KINB 1QSDA 3AECA 5L3DB 3KV6A 4O2BE 3AA6B 3I1AA 4JUYA 4DBQA 2KT9A 4X65T 3UUXB 2AXDS 2X0HA 4KHZF 3SFEA 2VK9A 4H63V 2W66A 2M6BA 3O4XE 4GYRA 4TV9E 3H3MA 1BR4A 3LK42 1N32T 3RH3A 2V8SV 4YFSA 1OEDE 5IWAT 3H3AA 2VQET 2OV9A 4YJ3E 3CX8B 3B57A 3ZSTA 5E0OA 1FIOA 3AAEB 3VR9A 2XAHB 1T98A 4DV1T 1IJ6A 2NTYA 2X9YA 4HFIA 4PK4A 4JI5T 5AQQB 4ZI3D 3JC6C 3LK3B 3CKDA 5FL1A 5L3EB 4JI4T 3QC9A 1IBMT 3A7MA 5H6RB 4DMVA 5HEJA 4DR1T 3GN5B 3N9QA 4PFPA 3NZQA 4WNKA 3ZN0B 2XUEA 3O1IA 3RX6A 3J7Yq 4GKJT 4BAYB 2XQ5A 4YTNA 3KBUA 3AE2A 3RIAA 1J1JA 4IT4A 2BDEA 4CZZB 4N78D 3ZJ2A 2LSYA 5C2TA 2A3DA 2UXNB 2VVNA 3E08A 2XM1A 3NRYA 3CQXC 2W00A 4QKNA 4P0BA 1OEDB 2CWOA 2W67A 4I43B 5HXSA 4UVAB 2FJAA 2VQFT 5GONE 2BZBA 4H9RC 2KLQA 4MALA 4CI3B 2BS4A 2Z6EA 4CI2B 3RI5A 4TX5A 3SWHA 3RLFF 3JC6D 2BG9E 4U7IA 4TWFA 4ZS2A 2ZMAA 4JI6T 2IIUA 3KDSE 4ZI2C 2ES0A 3PJAJ 1UUSA 3EI0A 3PUYF 2LT3A 5DQWA 3HKEE 1WCRA 1UCUA 2FUPA 2K48A 3ONJA 4A97A 4DR5T 1X79A 2BKPA 5LHHB 5FXVA 2K3WA 2WWVA 1MNDA 3Q5EA 2AE9A 2WAUA 3L3PA 4I0UA 1SE7A 4OFZA 2BS2A 3RC3A 4PNIA 2X0LB 1OEDC 3QB5A 2CXFA 5LCYA 3EABA 2BVMA 4YT0A 5AQGB 1V9DA 4FJOA 2M67A 3UT5E 4HFDA 2CHNA 3LFMA 3T1YT 4YTMA 4X1YE 4GIWA 2J47A 3RIUC 2Y8DA 4QH4A 5JRCA 4HN9A 4AIUA 3P50A 2JMKA 4JI8T 5HXEA 4ANJA 2X68A 2BG9B 3E22E 5EK4A 2E2AA 2WDQA 5LHIB 4DUZT 1KFYA 2IUBA 2JQHA 2IMLA 3HR0A 3UU3A 4ZI2D 2LSIA 3ZSSA 2V7KA 3VU7H 3WI3A 4MHCA 1LRZA 2G0UA 5L3BB 4EYYR 2V6XA 4HEAA 3AE7A 3RYIE 4IHJE 1G73A 2YEVC 4OYJA 5FXXA 2I0MA 4HFCA 5JQGE 4Z91A 5FXZA 2D0UA 5HXCA 3E0ZA 2FJEA 3ETUA 3O9XA 4JI0T 3PE0A 2UU9T 3NWIA 1FEWA 1XMOT 2D0TA 2WDRA 3PUXF 4BJMA 3UFEA 5LP6E 1MMGA 5AQRB 3VRBA 2QA7A 4JEHB 1O3XA 4OYKA 3GMIA 3F2EA 4G63A 2BG9C 1N36T 2N2NA 2HN2A 5FMNA 3AE5A 3AA1B 4IREA 3FB2A
chains in the Genus database with same CATH topology
4O4IE 4ILUA 4ZI7E 3BK9A 3IBPA 2K5BB 1BR1A 4HE8A 3WAJA 1OWAA 1WYCA 4H9SE 3VKHA 1CUNA 3PUQA 4CXWA 2L3LA 3C98B 3CQGB 4G2AA 3CX7B 3ZYMA 5JRCB 3NZPA 4GK0E 3F31A 4AQFA 2DNXA 3VHLA 5HXRA 2JQQA 2E9XC 2CWYA 1SA0E 5L3GB 1MMDA 5LGUB 2L9QA 2NW7A 3ETVA 5CA1E 2CA5A 5EK2A 3F57A 4EAHA 4HTEA 5JR9A 2MBGA 5L3FB 3GN5A 2ZM0A 1S35A 3CPZA 3C64A 3FBLA 5DQVA 3R84B 1MIVA 4M1PA 3ZLIA 3MACA 4E7ZA 3OBVE 2N9DA 5LGTB 4UEMA 2HPLA 2JRKA 2DCFA 2KZ7B 2VWAA 3N9LA 2NP9A 3PUGA 2VKJA 2WBLA 4FI5A 2HH7A 2WMNA 3LG7A 3KVAA 4I55E 2LSJA 4ZI3C 3SOLA 2KWIB 5C8YE 2V26A 1Z0PA 2KXPB 3NBXX 3ZCIA 3Q5XA 3CQCB 2LM9A 3LJCA 4XZCA 3NRXA 1HFAA 1MIYA 3UTKA 3OJAA 2C5IT 2YU2A 4GOUA 3AA7B 3KINB 5JDGA 2RA1A 1BR0A 1VOMA 1QSDA 2XTLA 2E9XB 5HAXA 3PU3A 5JH7E 4IE5A 5L3DB 3KV6A 4O2BE 3AA6B 1U5PA 1B7TA 5LA6E 3BQLA 4O4JE 2OA5A 5KDMC 3I1AA 3LBXB 3N2KE 3RC8A 4IDZA 4JUYA 1D0YA 4DBQA 1MIWA 5LGNB 4O2AE 2KT9A 3O1HA 1EZ3A 4H63H 3I9YA 3UUXB 1UX5A 4HFVA 2GK9A 4ADZA 2H3RA 4UXNB 5JVDE 2VK9A 3MXZA 4H63V 2BVLA 1SHZC 2CEAA 3K3NA 3O4XE 4GYRA 4J2CA 4TUYE 2ODVA 2WM9A 4TV9E 4IE4A 5LYJE 3PUAA 4UELA 1BR4A 3LK42 4UF0A 5KX5E 3RH3A 3AVSA 2CXDA 3QUJA 4YFSA 2C0SA 4ISSA 2A2FX 3N2OA 3HKDE 5H6QB 3RRWA 4O4HE 1IJ5A 2CE7A 3GA8A 4U74A 3RKOA 4DMWA 3H3AA 1NWMX 2YK0A 2E9XD 2Q9QC 2KMFA 2ZLYA 2DI4A 3C4XA 1WLXA 3CMLA 5JDNA 3HA4A 1YW0A 3ZC1A 4YJ3E 1KK7A 1AJ3A 3CX8B 3B57A 5CB4E 5E0OA 3N9PA 2EHOA 2YU1A 1FIOA 3AAEB 3KFWX 3LK2B 2XAHB 2JMHA 2PFVA 2D5UA 3SS1A 3ZMZB 5LG4A 3MZKB 2LSGA 1T98A 4QX8B 1NAFA 5J1GA 5ADXL 5JDLA 2CMRA 3N5LA 3ANWA 4NUUA 1IJ6A 2NTYA 2X9YA 3K3OA 2X9WA 3KV9A 1ZKEA 4PK4A 5JDFA 3JC6C 1US7B 2HPJA 3LK3B 3CKDA 3RYCE 2VB6A 4DO0A 4ZI3D 1HS7A 5L3EB 2CXLA 3BQKA 3QC9A 3S4UA 5LHGB 5JDMA 3C50A 2C5KT 5H6RB 3J9X1 4BJNA 4DMVA 5JR9B 3RRCA 3GN5B 3N9QA 4UV8B 2XAJB 5CA0E 4EZHA 4PFPA 3NZQA 4WNKA 4AI6A 4IE6A 3ZN0B 2NOXA 2LEHA 3EVYA 2XUEA 5FY7A 3O1IA 3RX6A 4QXCB 3ZPOA 3A5XA 4BAYB 3J7Yq 2B1EA 2XAGB 1YKEB 4TN7B 2Q9QB 2X9XA 3KBUA 4AKLA 3CVRA 1VRBA 3K8PC 2V7LA 2ZM2A 2BDEA 3R6NA 4N78D 4CZZB 2V7MA 3ZJ2A 2LSYA 2A3DA 3ZYLA 3CX6B 2K24A 5FYMA 3VKGA 2UXNB 4X20E 2H7OA 3N2GE 1IZNB 2W61A 4EIWA 1UX4A 3E08A 5LBQB 5KMGP 2PBIA 3PTRB 4ERRA 2ODUA 4C91A 3KBTA 4EXTA 2X9HA 3H37A 3NRYA 3CQXC 2CLYB 4PFOA 4GK5E 2W00A 2XAQB 3EDVA 1OXZA 4YJ2E 2IW5B 1HCIA 4AKRB 4QKNA 4P0BA 2Y48B 2LOSA 4KMCA 4PJJA 5LXTE 4IE0A 3FHNA 1ZEEA 3AAIA 2CWOA 4QXHB 5F3JA 5LNKA 2VKHA 2P9BA 4CXXA 3HL6A 4BA9A 3O1JA 4AKIA 4I43B 2DLRA 3ZCJA 5HXSA 1FMVA 2Q9QD 2CM0A 4UVAB 5LBMA 1E1HB 3DJBA 5TAOA 1ZHCA 5L2LA 2XASB 3PUSA 4F6RC 5GONE 4PW8A 2BZBA 4H9RC 2KLQA 3C51A 3UUMA 4MALA 4CI3B 1D1BA 2DHRA 3Q5WA 4AQFC 3DP7A 2Z6EA 4CI2B 4OHFA 3SRZA 1YD8G 5HWXA 4AKGA 4TX5A 1D0ZA 3N9OA 1MMAA 3EDUA 3SWHA 1HF8A 2KWHA 4UVBB 3W15B 1LVKA 3JC6D 4IGUA 2LOPA 4HKAA 4AXPA 3ZMTB 5JR9C 4PK6A 2WSSV 4ZS2A 3ZMUB 2E9XA 2ZMAA 1HX8A 3OYXA 4H9NC 5IHYA 2X67A 3KDSE 4IIJE 3RPUA 4U72A 5JREA 4ZI2C 3ZN1B 2ES0A 2EHOB 4DNDA 5FXWA 4ASKA 3LBXA 1FMWA 2WWUA 4ZOLE 3PU8A 4DBRA 3ESLA 5LJMA 2LT3A 5DQWA 3HKEE 2D2SA 3IHRA 4WBNE 2WMOA 1UCUA 4MLKA 4PK5A 1YKHB 3ZC0A 5AFUL 3FXDB 3PDYA 2K48A 2IC6A 2JPFA 1BR2A 5BMVE 1KNZA 3T8OA 4CXYA 1X79A 2NW8A 2YINA 4TZ4C 4CQIA 3IF8B 5LHHB 5FXVA 3V5SA 3TKLB 4QXBB 1MNDA 2SPCA 4L5GA 4X1KE 2LHNA 3P8CD 4PJLA 4P0AA 2WAUA 4XBFB 2CLYC 4KUMB 4JLEA 2E8IA 1MNEA 3L3PA 5M4YA 3N9MA 3Q2MA 5IYZE 4OFZA 2CCQA 2IAKA 2MYSA 2W0GA 5DABA 3RC3A 4PNIA 3I0OA 2JJ9A 4WW0A 3B13A 2X0LB 2DWGA 4MBQA 2L8KA 3D0TA 1WRDA 2VL8A 2CXFA 5LCYA 5JDHA 3QK6A 4PJNA 4XAXB 2PG8A 2BVMA 2EHOD 2LJLA 3ZYKA 2K9AA 2ACXA 1V9DA 2V7JA 2I59A 5ETWA 4FJOA 2VKDA 2M67A 4EYUA 1WR6A 3MK7C 3UT5E 3V5UA 2VKOA 2XHEB 1D0XA 4EZ4A 5FP3A 1H7CA 3AB3B 5J2UE 5J2TE 4AKHA 3LFMA 5HWYA 2J1DG 4CI1B 2XAFB 5FNVE 5FY0A 2XQYA 4X1YE 2X66A 3HKBE 5FY1A 3AVRA 4GIWA 4L9IA 3UULA 2PJQA 1WYBA 2Y8DA 2LHRA 5JRCA 4QWNB 1Y64B 4HN9A 4O8SA 4UVCB 5HYAA 2JMKA 4I4TE 5HXEA 1IAPA 5LOVE 4ANJA 2X68A 4HGAA 3E22E 4UV9B 5EK4A 3ZMSB 4WBOA 2EHOC 3HI2A 5LHIB 4C90A 2Q9QA 4H9QC 3U3IA 3HR0A 4OK0A 1LVFA 2LE8A 3C4WA 4ZI2D 2LSIA 3I0QA 2V7KA 4ISTA 3VU7H 5HXHA 5L3CB 5EZYE 3WI3A 4MHCA 3KVBA 1LRZA 2C5JA 2G0UA 5L3BB 2NWBA 4IE7A 4EYYR 3K3QC 4B6XA 1HG2A 4P09A 2LSKA 1HTJF 3EUHA 4K0UA 4UF0B 4TV8E 1U4QA 2DWKA 4UIGA 4HEAA 1G8XA 2A72A 3KV4A 3ONXA 3C4ZA 4EOZB 2W62A 5DJQC 3P7IA 2N1GA 5EK3A 4QHOA 3RYIE 5JDQA 4A56A 4IHJE 3I9WA 3GWHA 1G73A 4AQGA 2YEVC 4OYJA 3PURA 5FXXA 2MOZA 3ZJ1A 2X51A 4V1Av 4E7SA 5JQGE 3FBZA 3HKCE 5HXCA 5FXZA 2D0UA 4MFRA 3UUNA 3E0ZA 4PJMA 2VASA 4I50E 5A1LA 3ETUA 4NUVA 3DTOA 5F8PA 3O9XA 3PE0A 1HG5A 1S94A 2NW9A 2V7IA 4YHJA 3ANWB 3ZEFB 4H9OC 1FEWA 4GYSA 3FXEB 3RYFE 2D0TA 1ZV4X 4YLHA 3KV5A 2IC9A 2ZM8A 2RP4A 2KNDA 3IEEA 3MJXA 4PAGA 1LKXA 3BQIA 4BJMA 4ZHQE 3OYZA 3AAAB 4KP3C 3UFEA 3RYHE 1D1AA 2UXXB 3U78A 5LP6E 3MA9A 3ZMVB 4KBMB 1MMGA 4X1IE 1D1CA 4Z8XA 3WAKA 2QA7A 4JEHB 1O3XA 2KINB 4OYKA 4ZS3A 3GMIA 3F2EA 3N9NA 4G63A 4QX7B 5LJNA 3AA0B 2MTQA 4EB6E 2N2NA 2H7VC 4O4LE 2V1DB 5FMNA 4DVDA 2W63A 3AA1B 4H9PC 3Q9DA 3L09A 4JEUB 1MMNA 3M65A 2Y6XA 4L0RA 3CWZB 3OKQA 3MKDA 1QUUA 2NTXA 3FB2A 2QGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IJ5 A;  4EYY R;  1ZKE A;  2C5I T;  2X9X A;  4DND A;  4B6X A;  3CKD A;  3CVR A;  3MXZ A;  3L3P A;  4J2C A;  1H7C A;  3S4U A;  1QSD A;  2XTL A;  4FI5 A;  2C5K T;  3FXE B;  3P7I A;  1LVF A;  3TKL B;  2KWH A;  2KWI B;  3FXD B;  2K48 A;  2IC6 A;  3QK6 A;  2IC9 A;  4L0R A;  1Z0P A;  3QUJ A;  2CA5 A;  3N5L A;  1LRZ A;  4CQI A;  1IJ6 A;  2C5J A;  2G0U A;  2X9Y A;  2X9W A;  2MBG A; 
#chains in the Genus database with same CATH topology
 4ILU A;  4HE8 A;  3C98 B;  3CQG B;  4G2A A;  4YHH T;  4GK0 E;  4KI0 F;  4AQF A;  2JQQ A;  4U2Y A;  2XQ3 A;  2E9X C;  5JR9 A;  4A98 A;  2ZM0 A;  3CPZ A;  3C64 A;  4DV6 T;  1MIV A;  5LGT B;  4UEM A;  3PUG A;  4FI5 A;  2HH7 A;  2WMN A;  1VCS A;  3A8Y C;  2KWI B;  5AQS B;  2KXP B;  3CQC B;  3AEA A;  2YU2 A;  2CRB A;  2RA1 A;  4DR7 T;  2XTL A;  1XDO A;  4JBW F;  4IE5 A;  1B7T A;  1UGO A;  5LA6 E;  3BQL A;  3LBX B;  3RC8 A;  3N2K E;  2RPA A;  1ZP0 A;  2WU2 A;  4H63 H;  5AQL B;  4HFV A;  3MXZ A;  2V6Y A;  2LLY A;  4TUY E;  2ODV A;  2WM9 A;  4U33 A;  5ABG A;  3PUA A;  5KX5 E;  3AVS A;  2E5L T;  2CXD A;  4DR6 T;  3PJA A;  4ISS A;  3N2O A;  3HKD E;  1IJ5 A;  4U74 A;  4DMW A;  2YK0 A;  2E9X D;  2X0Y A;  2Q9Q C;  5LMN T;  4HFE A;  5AQV B;  4LML A;  1YW0 A;  3ZC1 A;  2EHO A;  3KFW X;  3ONL C;  2D5U A;  2LSG A;  5FVK A;  3TLW A;  3N5L A;  4TWD A;  3K3O A;  3G06 A;  1HS7 A;  4DO0 A;  2VB6 A;  3RHW A;  4UV8 B;  2CBI A;  4AI6 A;  3QB5 K;  2X9X A;  1SUM B;  1KEY A;  1VCT A;  2XQA A;  3K8P C;  5ABF A;  4DR3 T;  1HNW T;  5FYM A;  2H7O A;  5AQI B;  3P4P A;  2W61 A;  4DR4 T;  2PBI A;  4ERR A;  2H88 A;  5LB7 B;  4PFO A;  4GK5 E;  1W9R A;  1HCI A;  4TNV A;  2YOE A;  4KMC A;  2UUA T;  1ZEE A;  5F3J A;  2YDR A;  5AQM B;  2VKH A;  4IDQ A;  2P9B A;  1IBL T;  4BA9 A;  3O1J A;  1FMV A;  2Q9Q D;  2CM0 A;  5LBM A;  1E1H B;  5TAO A;  3PUS A;  4COF A;  4PW8 A;  1D1B A;  2DHR A;  3DP7 A;  3M3Z B;  1YD8 G;  5HWX A;  1D0Z A;  3N9O A;  1MMA A;  4UVB B;  4U31 A;  2LOP A;  4HKA A;  4PK6 A;  2WSS V;  2LRK A;  2CBJ A;  4IIJ E;  2E5V A;  4DND A;  3LBX A;  4ZOL E;  2WY2 A;  3PU8 A;  1M7K A;  4DV3 T;  2R6G F;  4WBN E;  1M62 A;  4A5X A;  2HHH T;  2WMO A;  4PK5 A;  3B5M A;  4JI7 T;  3FXD B;  2IC6 A;  1BR2 A;  5BMV E;  1KNZ A;  2BS3 A;  2YIN A;  4CQI A;  4TWH A;  2FBW A;  3UFG A;  2LHN A;  3P8C D;  1YQ4 A;  4XBF B;  4JLE A;  2FJB A;  5IYZ E;  2CCQ A;  2IAK A;  2W0G A;  3LSV A;  2JJ9 A;  2DWG A;  4MBQ A;  4PJN A;  3L39 A;  3ZYK A;  4YXD A;  4EYU A;  4NIQ A;  2XHE B;  4EZ4 A;  5J2T E;  2XAF B;  5FY0 A;  2XQY A;  1UK5 A;  3AE3 A;  2X66 A;  3HKB E;  3AVR A;  3IA3 A;  4L9I A;  1WYB A;  2LHR A;  4DV4 T;  1Y01 A;  4UVC B;  5LOV E;  3FZL B;  4WBO A;  4KX6 A;  2W4X A;  2OLT A;  4H9Q C;  5HEH A;  2LE8 A;  3ABV A;  5HXH A;  3FZH B;  1N34 T;  4IE7 A;  2PTF A;  1HG2 A;  2LSK A;  3FZK B;  3EUH A;  3FZF B;  2UXC T;  2LRL A;  2A72 A;  3C4Z A;  2W62 A;  5DJQ C;  2DL1 A;  2N1G A;  5EK3 A;  5JDQ A;  3OTO T;  3GWH A;  5LG3 A;  4DR2 T;  2MOZ A;  3ZJ1 A;  1XZY A;  3FBZ A;  2UXD T;  3HKC E;  2XQ4 A;  4HWH A;  5FVL A;  1IBK T;  3UUN A;  3JAF A;  4NUV A;  3DTO A;  3ZEF B;  1WFD A;  4H9O C;  4GYS A;  3FXE B;  4B3M T;  4NPP A;  4Z90 A;  1LKX A;  4ZHQ E;  3AAA B;  4KP3 C;  3RYH E;  3U78 A;  2V5D A;  5AQK B;  4WYV A;  5LJN A;  3N9N A;  4HFH A;  2WCA A;  4O4L E;  5AQU B;  4DVD A;  2W63 A;  4H9P C;  3Q9D A;  4L0R A;  2Y6X A;  5F5W A;  4DUY T;  1QUU A;  2NTX A;  1OWA A;  3VKH A;  2J62 A;  5JTG A;  3ZYM A;  3F31 A;  2DNX A;  3VHL A;  4LF7 T;  1SA0 E;  5L3G B;  1KNR A;  5AQO B;  3ETV A;  3TLS A;  2CA5 A;  4HTE A;  3GN5 A;  1S35 A;  2UUB T;  4YTP A;  3FBL A;  2HN1 A;  4M1P A;  4X62 T;  4LF9 T;  4E7Z A;  1XNQ T;  3AED A;  2JRK A;  4AQY T;  2KZ7 B;  3N9L A;  2VKJ A;  2WBL A;  5L47 A;  3LG7 A;  4I55 E;  2LSJ A;  2V26 A;  4NXN T;  3NBX X;  3LJC A;  3P4W A;  3NRX A;  1HFA A;  2H89 A;  3OJA A;  2C5I T;  3EAM A;  4GOU A;  5JDG A;  2E9X B;  5HAX A;  3PU3 A;  2WZH A;  1HX1 B;  1U5P A;  5HEU A;  4IDP A;  4O4J E;  1D0Y A;  4TNW A;  1OED A;  2XQ6 A;  1EZ3 A;  5JVD E;  2XQ7 A;  3PUV F;  4J2C A;  2XY8 B;  4UEL A;  4DV7 T;  1HNX T;  2IDO B;  3L8R A;  3RIU A;  4O4H E;  2CE7 A;  3GA8 A;  5KXJ A;  1NWM X;  2KMF A;  2DI4 A;  1WLX A;  5L4E A;  1AJ3 A;  5CB4 E;  3N9P A;  3LK2 B;  5LG4 A;  3SS1 A;  3MZK B;  4QX8 B;  5J1G A;  5JDL A;  5ADX L;  3TLV A;  2CMR A;  4LFC T;  4NUU A;  4EED A;  2X9W A;  3KV9 A;  5CFB A;  1ZKE A;  1J5E T;  3UUB A;  1US7 B;  2HPJ A;  4ZEY A;  3RYC E;  4HWI B;  2CXL A;  4CN1 A;  5JDM A;  3J9X 1;  3RRC A;  1UUR A;  5CA0 E;  4EZH A;  2NOX A;  2LEH A;  3ZPO A;  4HWD A;  4QXC B;  3A5X A;  1L0V A;  2B1E A;  4ILC A;  4ZXL A;  1YKE B;  4TN7 B;  2Q9Q B;  3EHZ A;  3CVR A;  2YDQ A;  1VRB A;  4UR9 A;  3OVU A;  3ZYL A;  1N33 T;  4Q25 A;  2M6I A;  4X20 E;  3AE4 A;  3N2G E;  1IZN B;  4EIW A;  3PTR B;  3NKZ A;  4C91 A;  4JI3 T;  2LKH A;  4DID B;  4AIS A;  2WB5 A;  3QOF A;  4X64 T;  2Y48 B;  5LXT E;  4IE0 A;  3FHN A;  4QH1 A;  1HR0 T;  3HL6 A;  2BG9 A;  4AKI A;  2BKO A;  2DLR A;  3ZCJ A;  3DJB A;  1ZHC A;  5L2L A;  4F6R C;  3ZT6 A;  4B3S T;  1T7S A;  4OHF A;  3SRZ A;  2WS3 A;  1ZOY A;  3EDU A;  2KWH A;  3W15 B;  1LVK A;  3AEG A;  3ZMT B;  2E9X A;  3OYX A;  2ZM6 T;  5BR8 T;  4H9N C;  4U72 A;  5JRE A;  3ZN1 B;  5FXW A;  1FMW A;  2WWU A;  3JCF A;  3ESL A;  5LJM A;  3TLT A;  4GKK T;  3AXJ B;  4MLK A;  3RF1 A;  2KSR A;  1YKH B;  3ZC0 A;  5AFU L;  2JPF A;  5AQN B;  3T8O A;  3RQW A;  4CXY A;  1T72 A;  3CK6 A;  4TZ4 C;  3AE8 A;  5ABE A;  3V5S A;  3TKL B;  3AE1 A;  3RQU A;  4P0A A;  1KNP A;  2E8I A;  1MNE A;  5M4Y A;  3N9M A;  3Q2M A;  2NR4 A;  5DAB A;  3UU5 A;  2L8K A;  3D0T A;  5C3J A;  3Q5D A;  2EHO D;  2LJL A;  2K9A A;  2V7J A;  2I59 A;  4P1N A;  2J4G A;  3MK7 C;  5FL0 A;  3V5U A;  3PV0 F;  1D0X A;  1H7C A;  3AB3 B;  4AKH A;  5HWY A;  5FY1 A;  3UUL A;  4O8S A;  5HYA A;  4HGA A;  5CJ5 A;  2V5C A;  5HEO A;  2WDV A;  3AEE A;  3P4S A;  5J0Z A;  4C90 A;  2Q9Q A;  3U3I A;  4OK0 A;  3I0Q A;  5L3C B;  5EZY E;  3KVB A;  2WQY A;  4NXM T;  2C5J A;  2NWB A;  5HCJ A;  2JQ9 A;  4B6X A;  4P09 A;  1W0A A;  1HTJ F;  4UF0 B;  4TV8 E;  3ZT5 A;  2DWK A;  3PUZ F;  1G8X A;  3KV4 A;  3ONX A;  4EOZ B;  3P7I A;  1Z8U A;  4QHO A;  1QLB A;  3P4Q A;  2XSA A;  2X51 A;  4E7S A;  3NVO A;  5FKY A;  4JI2 T;  4MFR A;  2IHR 1;  1HG5 A;  2V7I A;  4YHJ A;  3ANW B;  3RYF E;  1I6Z A;  4YLH A;  3KV5 A;  2ZM8 A;  3IEE A;  3MJX A;  4CN4 A;  2XJ7 A;  3BQI A;  3OYZ A;  1D1A A;  3MA9 A;  3ZMV B;  4LF6 T;  4X1I E;  4Z8X A;  3WAK A;  2MPK A;  4ZS3 A;  4QX7 B;  3UQ7 A;  2MTQ A;  4HWF A;  2V1D B;  4LF5 T;  3L09 A;  3RIF A;  4JEU B;  1MMN A;  3M65 A;  3OKQ A;  2VUR A;  3AXJ A;  3UQ4 A;  3MKD A;  4ZI7 E;  2K5B B;  1BR1 A;  3WAJ A;  1WYC A;  1CUN A;  3PUQ A;  4CXW A;  5ABH A;  5JRC B;  1CHU A;  5HXR A;  2FJD A;  2QVA A;  2ACZ A;  2L9Q A;  5CA1 E;  4EAH A;  3R84 B;  3ZLI A;  3MAC A;  3OBV E;  2N9D A;  2HPL A;  2DCF A;  4QH5 A;  5AQH B;  4HFB A;  3KVA A;  3SOL A;  1Z0P A;  3Q5X A;  5L4H A;  3AA7 B;  5HEG A;  4DV0 T;  2YKS A;  2XSB A;  1BR0 A;  1VOM A;  1X9B A;  4EV6 A;  5JH7 E;  1XWM A;  2OA5 A;  5KDM C;  4IDZ A;  1MIW A;  2QYW A;  5LGN B;  4O2A E;  3O1H A;  3I9Y A;  1UX5 A;  2GK9 A;  4ADZ A;  2H3R A;  4UXN B;  1J5W A;  2WP9 A;  1WR0 A;  2BVL A;  1SHZ C;  2CEA A;  3K3N A;  4IE4 A;  5LYJ E;  4UF0 A;  3SFD A;  3QUJ A;  2C0S A;  3TLU A;  2A2F X;  4IDN A;  2I6H A;  5H6Q B;  3RRW A;  3RKO A;  3AEF A;  5IUX A;  2ZLY A;  3C4X A;  3CML A;  2YDS A;  4LF8 T;  5JDN A;  3HA4 A;  2MAW A;  1KK7 A;  2YU1 A;  4JYA T;  2JQK A;  2JMH A;  2PFV A;  4YY3 T;  3ZMZ B;  2CHO A;  1NAF A;  4ZZB A;  3ANW A;  2XZE A;  5JDF A;  3BQK A;  2XQ8 A;  3S4U A;  5LHG B;  3C50 A;  2C5K T;  4BJN A;  5JR9 B;  3RGL A;  2XAJ B;  1DU2 A;  4IE6 A;  3EVY A;  3OPC A;  5FY7 A;  2XAG B;  2UXB T;  3T1H T;  4AKL A;  2V7L A;  2ZM2 A;  3CIR A;  3R6N A;  2V7M A;  2QRX A;  2K24 A;  3CX6 B;  1XNR T;  3VKG A;  3UU8 A;  3PUW F;  1UX4 A;  5LBQ B;  5KMG P;  2ODU A;  5AQJ B;  2BBH A;  3KBT A;  4EXT A;  2X9H A;  3H37 A;  2CLY B;  3JAE A;  1KF6 A;  2XAQ B;  3EDV A;  1OXZ A;  4YJ2 E;  4YSZ A;  1I94 T;  2IW5 B;  4AKR B;  2LOS A;  4PJJ A;  3AAI A;  4QXH B;  5LNK A;  4JI1 T;  4CXX A;  4HWC A;  3VRA A;  4ILB A;  4B3R T;  2V6Y B;  2XAS B;  3VR8 A;  4U3C A;  3C51 A;  3UUM A;  4LFA T;  3P4R A;  4ZZC A;  3Q5W A;  4AQF C;  4AKG A;  1HF8 A;  2D9D A;  4IGU A;  4AXP A;  5JR9 C;  3ZMU B;  1HX8 A;  1T8B A;  5IHY A;  3X1D A;  2X67 A;  3RPU A;  2EHO B;  4ASK A;  4DBR A;  3AE6 A;  2VVS A;  2D2S A;  3IHR A;  3PDY A;  2NW8 A;  3IF8 B;  3RKG A;  1W0B A;  4QXB B;  2A9U A;  2SPC A;  4L5G A;  4X1K E;  4K0K T;  4PJL A;  1R8I A;  2CLY C;  2XM2 A;  4KUM B;  1JNZ A;  2MYS A;  3I0O A;  4WW0 A;  3B13 A;  1WRD A;  2VL8 A;  5JDH A;  3QK6 A;  4XAX B;  2PG8 A;  5ABF B;  2ACX A;  4DV2 T;  5ETW A;  2VKD A;  1E2A A;  1WR6 A;  2VKO A;  4KHP T;  5FP3 A;  5J2U E;  3ZT7 A;  2J1D G;  4CI1 B;  5FNV E;  5AQF B;  4X66 T;  5CGM A;  2PJQ A;  4QWN B;  1Y64 B;  4I4T E;  1IAP A;  1GQE A;  4ILA A;  4UV9 B;  1XMQ T;  3ZMS B;  2EHO C;  3HI2 A;  3LDQ B;  2XQ9 A;  1LVF A;  3C4W A;  1FJG T;  4IST A;  2BKN A;  4OX9 T;  1NEK A;  2BBJ A;  4LMJ A;  4EEB A;  4JV5 T;  3K3Q C;  4IL4 A;  1HNZ T;  4K0U A;  1NEN A;  2B76 A;  1U4Q A;  4UIG A;  4CN6 A;  2XPK A;  4DV5 T;  4A56 A;  3I9W A;  4AQG A;  2UUC T;  3PUR A;  4V1A v;  2YN6 A;  4YSY A;  4PJM A;  2VAS A;  4I50 E;  5A1L A;  5F8P A;  2NW9 A;  1S94 A;  3AEB A;  4IL9 A;  3FZM B;  1ZV4 X;  2CPT A;  5LMU T;  2IC9 A;  2RP4 A;  2KND A;  5AQP B;  4PAG A;  1JNR A;  4LFB T;  2UXX B;  2JIW A;  4KBM B;  4X5T A;  1D1C A;  2KIN B;  3UU6 A;  3ZKR A;  2VL0 A;  3AA0 B;  4EB6 E;  4EGW A;  2H7V C;  2WU5 A;  4F8H A;  4LF4 T;  3CWZ B;  2QGS A;  1YQ3 A;  4O4I E;  3BK9 A;  3IBP A;  3AE9 A;  4H9S E;  4YSX A;  2L3L A;  3CX7 B;  2LM2 A;  3NZP A;  4IDO A;  2CWY A;  1MMD A;  5LGU B;  2NW7 A;  4U2Z A;  2F4V T;  5EK2 A;  1W09 A;  3F57 A;  3QNU A;  4B3T T;  2MBG A;  5L3F B;  4LMK A;  5DQV A;  2W2U A;  5HCM A;  4U7Y A;  2VWA A;  2NP9 A;  5AQT B;  3JAD A;  4ZI3 C;  5C8Y E;  1YXR A;  2LKG A;  3ZCI A;  1XDP A;  2LM9 A;  4XZC A;  3UU4 A;  1MIY A;  2WZI A;  3UTK A;  3K1S A;  4WZX A;  1E7P A;  3KIN B;  1QSD A;  3AEC A;  5L3D B;  3KV6 A;  4O2B E;  3AA6 B;  3I1A A;  4JUY A;  4DBQ A;  2KT9 A;  4X65 T;  3UUX B;  2AXD S;  2X0H A;  4KHZ F;  3SFE A;  2VK9 A;  4H63 V;  2W66 A;  2M6B A;  3O4X E;  4GYR A;  4TV9 E;  3H3M A;  1BR4 A;  3LK4 2;  1N32 T;  3RH3 A;  2V8S V;  4YFS A;  1OED E;  5IWA T;  3H3A A;  2VQE T;  2OV9 A;  4YJ3 E;  3CX8 B;  3B57 A;  3ZST A;  5E0O A;  1FIO A;  3AAE B;  3VR9 A;  2XAH B;  1T98 A;  4DV1 T;  1IJ6 A;  2NTY A;  2X9Y A;  4HFI A;  4PK4 A;  4JI5 T;  5AQQ B;  4ZI3 D;  3JC6 C;  3LK3 B;  3CKD A;  5FL1 A;  5L3E B;  4JI4 T;  3QC9 A;  1IBM T;  3A7M A;  5H6R B;  4DMV A;  5HEJ A;  4DR1 T;  3GN5 B;  3N9Q A;  4PFP A;  3NZQ A;  4WNK A;  3ZN0 B;  2XUE A;  3O1I A;  3RX6 A;  3J7Y q;  4GKJ T;  4BAY B;  2XQ5 A;  4YTN A;  3KBU A;  3AE2 A;  3RIA A;  1J1J A;  4IT4 A;  2BDE A;  4CZZ B;  4N78 D;  3ZJ2 A;  2LSY A;  5C2T A;  2A3D A;  2UXN B;  2VVN A;  3E08 A;  2XM1 A;  3NRY A;  3CQX C;  2W00 A;  4QKN A;  4P0B A;  1OED B;  2CWO A;  2W67 A;  4I43 B;  5HXS A;  4UVA B;  2FJA A;  2VQF T;  5GON E;  2BZB A;  4H9R C;  2KLQ A;  4MAL A;  4CI3 B;  2BS4 A;  2Z6E A;  4CI2 B;  3RI5 A;  4TX5 A;  3SWH A;  3RLF F;  3JC6 D;  2BG9 E;  4U7I A;  4TWF A;  4ZS2 A;  2ZMA A;  4JI6 T;  2IIU A;  3KDS E;  4ZI2 C;  2ES0 A;  3PJA J;  1UUS A;  3EI0 A;  3PUY F;  2LT3 A;  5DQW A;  3HKE E;  1WCR A;  1UCU A;  2FUP A;  2K48 A;  3ONJ A;  4A97 A;  4DR5 T;  1X79 A;  2BKP A;  5LHH B;  5FXV A;  2K3W A;  2WWV A;  1MND A;  3Q5E A;  2AE9 A;  2WAU A;  3L3P A;  4I0U A;  1SE7 A;  4OFZ A;  2BS2 A;  3RC3 A;  4PNI A;  2X0L B;  1OED C;  3QB5 A;  2CXF A;  5LCY A;  3EAB A;  2BVM A;  4YT0 A;  5AQG B;  1V9D A;  4FJO A;  2M67 A;  3UT5 E;  4HFD A;  2CHN A;  3LFM A;  3T1Y T;  4YTM A;  4X1Y E;  4GIW A;  2J47 A;  3RIU C;  2Y8D A;  4QH4 A;  5JRC A;  4HN9 A;  4AIU A;  3P50 A;  2JMK A;  4JI8 T;  5HXE A;  4ANJ A;  2X68 A;  2BG9 B;  3E22 E;  5EK4 A;  2E2A A;  2WDQ A;  5LHI B;  4DUZ T;  1KFY A;  2IUB A;  2JQH A;  2IML A;  3HR0 A;  3UU3 A;  4ZI2 D;  2LSI A;  3ZSS A;  2V7K A;  3VU7 H;  3WI3 A;  4MHC A;  1LRZ A;  2G0U A;  5L3B B;  4EYY R;  2V6X A;  4HEA A;  3AE7 A;  3RYI E;  4IHJ E;  1G73 A;  2YEV C;  4OYJ A;  5FXX A;  2I0M A;  4HFC A;  5JQG E;  4Z91 A;  5FXZ A;  2D0U A;  5HXC A;  3E0Z A;  2FJE A;  3ETU A;  3O9X A;  4JI0 T;  3PE0 A;  2UU9 T;  3NWI A;  1FEW A;  1XMO T;  2D0T A;  2WDR A;  3PUX F;  4BJM A;  3UFE A;  5LP6 E;  1MMG A;  5AQR B;  3VRB A;  2QA7 A;  4JEH B;  1O3X A;  4OYK A;  3GMI A;  3F2E A;  4G63 A;  2BG9 C;  1N36 T;  2N2N A;  2HN2 A;  5FMN A;  3AE5 A;  3AA1 B;  4IRE A;  3FB2 A; 
#chains in the Genus database with same CATH homology
 4O4I E;  4ILU A;  4ZI7 E;  3BK9 A;  3IBP A;  2K5B B;  1BR1 A;  4HE8 A;  3WAJ A;  1OWA A;  1WYC A;  4H9S E;  3VKH A;  1CUN A;  3PUQ A;  4CXW A;  2L3L A;  3C98 B;  3CQG B;  4G2A A;  3CX7 B;  3ZYM A;  5JRC B;  3NZP A;  4GK0 E;  3F31 A;  4AQF A;  2DNX A;  3VHL A;  5HXR A;  2JQQ A;  2E9X C;  2CWY A;  1SA0 E;  5L3G B;  1MMD A;  5LGU B;  2L9Q A;  2NW7 A;  3ETV A;  5CA1 E;  2CA5 A;  5EK2 A;  3F57 A;  4EAH A;  4HTE A;  5JR9 A;  2MBG A;  5L3F B;  3GN5 A;  2ZM0 A;  1S35 A;  3CPZ A;  3C64 A;  3FBL A;  5DQV A;  3R84 B;  1MIV A;  4M1P A;  3ZLI A;  3MAC A;  4E7Z A;  3OBV E;  2N9D A;  5LGT B;  4UEM A;  2HPL A;  2JRK A;  2DCF A;  2KZ7 B;  2VWA A;  3N9L A;  2NP9 A;  3PUG A;  2VKJ A;  2WBL A;  4FI5 A;  2HH7 A;  2WMN A;  3LG7 A;  3KVA A;  4I55 E;  2LSJ A;  4ZI3 C;  3SOL A;  2KWI B;  5C8Y E;  2V26 A;  1Z0P A;  2KXP B;  3NBX X;  3ZCI A;  3Q5X A;  3CQC B;  2LM9 A;  3LJC A;  4XZC A;  3NRX A;  1HFA A;  1MIY A;  3UTK A;  3OJA A;  2C5I T;  2YU2 A;  4GOU A;  3AA7 B;  3KIN B;  5JDG A;  2RA1 A;  1BR0 A;  1VOM A;  1QSD A;  2XTL A;  2E9X B;  5HAX A;  3PU3 A;  5JH7 E;  4IE5 A;  5L3D B;  3KV6 A;  4O2B E;  3AA6 B;  1U5P A;  1B7T A;  5LA6 E;  3BQL A;  4O4J E;  2OA5 A;  5KDM C;  3I1A A;  3LBX B;  3N2K E;  3RC8 A;  4IDZ A;  4JUY A;  1D0Y A;  4DBQ A;  1MIW A;  5LGN B;  4O2A E;  2KT9 A;  3O1H A;  1EZ3 A;  4H63 H;  3I9Y A;  3UUX B;  1UX5 A;  4HFV A;  2GK9 A;  4ADZ A;  2H3R A;  4UXN B;  5JVD E;  2VK9 A;  3MXZ A;  4H63 V;  2BVL A;  1SHZ C;  2CEA A;  3K3N A;  3O4X E;  4GYR A;  4J2C A;  4TUY E;  2ODV A;  2WM9 A;  4TV9 E;  4IE4 A;  5LYJ E;  3PUA A;  4UEL A;  1BR4 A;  3LK4 2;  4UF0 A;  5KX5 E;  3RH3 A;  3AVS A;  2CXD A;  3QUJ A;  4YFS A;  2C0S A;  4ISS A;  2A2F X;  3N2O A;  3HKD E;  5H6Q B;  3RRW A;  4O4H E;  1IJ5 A;  2CE7 A;  3GA8 A;  4U74 A;  3RKO A;  4DMW A;  3H3A A;  1NWM X;  2YK0 A;  2E9X D;  2Q9Q C;  2KMF A;  2ZLY A;  2DI4 A;  3C4X A;  1WLX A;  3CML A;  5JDN A;  3HA4 A;  1YW0 A;  3ZC1 A;  4YJ3 E;  1KK7 A;  1AJ3 A;  3CX8 B;  3B57 A;  5CB4 E;  5E0O A;  3N9P A;  2EHO A;  2YU1 A;  1FIO A;  3AAE B;  3KFW X;  3LK2 B;  2XAH B;  2JMH A;  2PFV A;  2D5U A;  3SS1 A;  3ZMZ B;  5LG4 A;  3MZK B;  2LSG A;  1T98 A;  4QX8 B;  1NAF A;  5J1G A;  5ADX L;  5JDL A;  2CMR A;  3N5L A;  3ANW A;  4NUU A;  1IJ6 A;  2NTY A;  2X9Y A;  3K3O A;  2X9W A;  3KV9 A;  1ZKE A;  4PK4 A;  5JDF A;  3JC6 C;  1US7 B;  2HPJ A;  3LK3 B;  3CKD A;  3RYC E;  2VB6 A;  4DO0 A;  4ZI3 D;  1HS7 A;  5L3E B;  2CXL A;  3BQK A;  3QC9 A;  3S4U A;  5LHG B;  5JDM A;  3C50 A;  2C5K T;  5H6R B;  3J9X 1;  4BJN A;  4DMV A;  5JR9 B;  3RRC A;  3GN5 B;  3N9Q A;  4UV8 B;  2XAJ B;  5CA0 E;  4EZH A;  4PFP A;  3NZQ A;  4WNK A;  4AI6 A;  4IE6 A;  3ZN0 B;  2NOX A;  2LEH A;  3EVY A;  2XUE A;  5FY7 A;  3O1I A;  3RX6 A;  4QXC B;  3ZPO A;  3A5X A;  4BAY B;  3J7Y q;  2B1E A;  2XAG B;  1YKE B;  4TN7 B;  2Q9Q B;  2X9X A;  3KBU A;  4AKL A;  3CVR A;  1VRB A;  3K8P C;  2V7L A;  2ZM2 A;  2BDE A;  3R6N A;  4N78 D;  4CZZ B;  2V7M A;  3ZJ2 A;  2LSY A;  2A3D A;  3ZYL A;  3CX6 B;  2K24 A;  5FYM A;  3VKG A;  2UXN B;  4X20 E;  2H7O A;  3N2G E;  1IZN B;  2W61 A;  4EIW A;  1UX4 A;  3E08 A;  5LBQ B;  5KMG P;  2PBI A;  3PTR B;  4ERR A;  2ODU A;  4C91 A;  3KBT A;  4EXT A;  2X9H A;  3H37 A;  3NRY A;  3CQX C;  2CLY B;  4PFO A;  4GK5 E;  2W00 A;  2XAQ B;  3EDV A;  1OXZ A;  4YJ2 E;  2IW5 B;  1HCI A;  4AKR B;  4QKN A;  4P0B A;  2Y48 B;  2LOS A;  4KMC A;  4PJJ A;  5LXT E;  4IE0 A;  3FHN A;  1ZEE A;  3AAI A;  2CWO A;  4QXH B;  5F3J A;  5LNK A;  2VKH A;  2P9B A;  4CXX A;  3HL6 A;  4BA9 A;  3O1J A;  4AKI A;  4I43 B;  2DLR A;  3ZCJ A;  5HXS A;  1FMV A;  2Q9Q D;  2CM0 A;  4UVA B;  5LBM A;  1E1H B;  3DJB A;  5TAO A;  1ZHC A;  5L2L A;  2XAS B;  3PUS A;  4F6R C;  5GON E;  4PW8 A;  2BZB A;  4H9R C;  2KLQ A;  3C51 A;  3UUM A;  4MAL A;  4CI3 B;  1D1B A;  2DHR A;  3Q5W A;  4AQF C;  3DP7 A;  2Z6E A;  4CI2 B;  4OHF A;  3SRZ A;  1YD8 G;  5HWX A;  4AKG A;  4TX5 A;  1D0Z A;  3N9O A;  1MMA A;  3EDU A;  3SWH A;  1HF8 A;  2KWH A;  4UVB B;  3W15 B;  1LVK A;  3JC6 D;  4IGU A;  2LOP A;  4HKA A;  4AXP A;  3ZMT B;  5JR9 C;  4PK6 A;  2WSS V;  4ZS2 A;  3ZMU B;  2E9X A;  2ZMA A;  1HX8 A;  3OYX A;  4H9N C;  5IHY A;  2X67 A;  3KDS E;  4IIJ E;  3RPU A;  4U72 A;  5JRE A;  4ZI2 C;  3ZN1 B;  2ES0 A;  2EHO B;  4DND A;  5FXW A;  4ASK A;  3LBX A;  1FMW A;  2WWU A;  4ZOL E;  3PU8 A;  4DBR A;  3ESL A;  5LJM A;  2LT3 A;  5DQW A;  3HKE E;  2D2S A;  3IHR A;  4WBN E;  2WMO A;  1UCU A;  4MLK A;  4PK5 A;  1YKH B;  3ZC0 A;  5AFU L;  3FXD B;  3PDY A;  2K48 A;  2IC6 A;  2JPF A;  1BR2 A;  5BMV E;  1KNZ A;  3T8O A;  4CXY A;  1X79 A;  2NW8 A;  2YIN A;  4TZ4 C;  4CQI A;  3IF8 B;  5LHH B;  5FXV A;  3V5S A;  3TKL B;  4QXB B;  1MND A;  2SPC A;  4L5G A;  4X1K E;  2LHN A;  3P8C D;  4PJL A;  4P0A A;  2WAU A;  4XBF B;  2CLY C;  4KUM B;  4JLE A;  2E8I A;  1MNE A;  3L3P A;  5M4Y A;  3N9M A;  3Q2M A;  5IYZ E;  4OFZ A;  2CCQ A;  2IAK A;  2MYS A;  2W0G A;  5DAB A;  3RC3 A;  4PNI A;  3I0O A;  2JJ9 A;  4WW0 A;  3B13 A;  2X0L B;  2DWG A;  4MBQ A;  2L8K A;  3D0T A;  1WRD A;  2VL8 A;  2CXF A;  5LCY A;  5JDH A;  3QK6 A;  4PJN A;  4XAX B;  2PG8 A;  2BVM A;  2EHO D;  2LJL A;  3ZYK A;  2K9A A;  2ACX A;  1V9D A;  2V7J A;  2I59 A;  5ETW A;  4FJO A;  2VKD A;  2M67 A;  4EYU A;  1WR6 A;  3MK7 C;  3UT5 E;  3V5U A;  2VKO A;  2XHE B;  1D0X A;  4EZ4 A;  5FP3 A;  1H7C A;  3AB3 B;  5J2U E;  5J2T E;  4AKH A;  3LFM A;  5HWY A;  2J1D G;  4CI1 B;  2XAF B;  5FNV E;  5FY0 A;  2XQY A;  4X1Y E;  2X66 A;  3HKB E;  5FY1 A;  3AVR A;  4GIW A;  4L9I A;  3UUL A;  2PJQ A;  1WYB A;  2Y8D A;  2LHR A;  5JRC A;  4QWN B;  1Y64 B;  4HN9 A;  4O8S A;  4UVC B;  5HYA A;  2JMK A;  4I4T E;  5HXE A;  1IAP A;  5LOV E;  4ANJ A;  2X68 A;  4HGA A;  3E22 E;  4UV9 B;  5EK4 A;  3ZMS B;  4WBO A;  2EHO C;  3HI2 A;  5LHI B;  4C90 A;  2Q9Q A;  4H9Q C;  3U3I A;  3HR0 A;  4OK0 A;  1LVF A;  2LE8 A;  3C4W A;  4ZI2 D;  2LSI A;  3I0Q A;  2V7K A;  4IST A;  3VU7 H;  5HXH A;  5L3C B;  5EZY E;  3WI3 A;  4MHC A;  3KVB A;  1LRZ A;  2C5J A;  2G0U A;  5L3B B;  2NWB A;  4IE7 A;  4EYY R;  3K3Q C;  4B6X A;  1HG2 A;  4P09 A;  2LSK A;  1HTJ F;  3EUH A;  4K0U A;  4UF0 B;  4TV8 E;  1U4Q A;  2DWK A;  4UIG A;  4HEA A;  1G8X A;  2A72 A;  3KV4 A;  3ONX A;  3C4Z A;  4EOZ B;  2W62 A;  5DJQ C;  3P7I A;  2N1G A;  5EK3 A;  4QHO A;  3RYI E;  5JDQ A;  4A56 A;  4IHJ E;  3I9W A;  3GWH A;  1G73 A;  4AQG A;  2YEV C;  4OYJ A;  3PUR A;  5FXX A;  2MOZ A;  3ZJ1 A;  2X51 A;  4V1A v;  4E7S A;  5JQG E;  3FBZ A;  3HKC E;  5HXC A;  5FXZ A;  2D0U A;  4MFR A;  3UUN A;  3E0Z A;  4PJM A;  2VAS A;  4I50 E;  5A1L A;  3ETU A;  4NUV A;  3DTO A;  5F8P A;  3O9X A;  3PE0 A;  1HG5 A;  1S94 A;  2NW9 A;  2V7I A;  4YHJ A;  3ANW B;  3ZEF B;  4H9O C;  1FEW A;  4GYS A;  3FXE B;  3RYF E;  2D0T A;  1ZV4 X;  4YLH A;  3KV5 A;  2IC9 A;  2ZM8 A;  2RP4 A;  2KND A;  3IEE A;  3MJX A;  4PAG A;  1LKX A;  3BQI A;  4BJM A;  4ZHQ E;  3OYZ A;  3AAA B;  4KP3 C;  3UFE A;  3RYH E;  1D1A A;  2UXX B;  3U78 A;  5LP6 E;  3MA9 A;  3ZMV B;  4KBM B;  1MMG A;  4X1I E;  1D1C A;  4Z8X A;  3WAK A;  2QA7 A;  4JEH B;  1O3X A;  2KIN B;  4OYK A;  4ZS3 A;  3GMI A;  3F2E A;  3N9N A;  4G63 A;  4QX7 B;  5LJN A;  3AA0 B;  2MTQ A;  4EB6 E;  2N2N A;  2H7V C;  4O4L E;  2V1D B;  5FMN A;  4DVD A;  2W63 A;  3AA1 B;  4H9P C;  3Q9D A;  3L09 A;  4JEU B;  1MMN A;  3M65 A;  2Y6X A;  4L0R A;  3CWZ B;  3OKQ A;  3MKD A;  1QUU A;  2NTX A;  3FB2 A;  2QGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...