4EYYR

Crystal structure of the icmr-icmq complex from legionella pneumophila
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
59
structure length
59
Chain Sequence
DVTDATLGSVYSEIISPVKDCILTVAKAVSFNPGGKDNTDAVEVLTELNTKVERAALNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IcmR
publication title IcmQ in the Type 4b secretion system contains an NAD+ binding domain.
pubmed doi rcsb
source organism Legionella pneumophila subsp. pneumophila
molecule tags Protein binding
total genus 22
structure length 59
sequence length 59
ec nomenclature
pdb deposition date 2012-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4eyyR00
1LVFA 2X9WA 3FXEB 2XTLA 3L3PA 1ZKEA 2C5JA 2C5KT 4J2CA 2X9YA 3QUJA 2CA5A 3P7IA 2IC6A 4FI5A 2K48A 3S4UA 2KWIB 3TKLB 1IJ5A 3CVRA 2MBGA 2IC9A 1LRZA 3MXZA 4DNDA 2C5IT 4EYYR 2G0UA 1QSDA 3N5LA 3FXDB 3CKDA 2X9XA 2KWHA 4L0RA 1H7CA 1IJ6A 3QK6A 4CQIA 4B6XA 1Z0PA
chains in the Genus database with same CATH superfamily
1KFYA 4XZCA 2PG8A 3Q5DA 4JUYA 2FBWA 1R8IA 1BR0A 3C51A 2WU5A 3FXDB 3PUQA 2ACZA 3U3IA 3PUVF 2V6XA 5LMUT 3CK6A 3ANWA 4H9SE 2BS4A 3UUNA 3A8YC 2BS3A 4X66T 3ZT7A 2CWYA 3O1JA 4CI2B 4HWHA 1LVFA 3L3PA 2LJLA 3PURA 3ZMVB 3I0OA 4DR6T 3SS1A 5LGNB 5CFBA 1CUNA 3P4SA 5HEGA 1OEDB 2ZMAA 2JQ9A 4ZI3D 3RC3A 2V8SV 3F57A 1Y01A 3AXJA 4YSXA 2LSKA 4X1YE 4AKIA 4IIJE 3JC6D 3AEGA 3TKLB 4XBFB 2LRLA 1M62A 1MMNA 3MXZA 4JEHB 2KNDA 3Q5WA 2NR4A 3NVOA 4LMLA 4CN4A 2WY2A 1FEWA 1UK5A 1HX8A 1WCRA 4MFRA 3AXJB 2J1DG 4AKLA 2IAKA 4FI5A 2KWIB 3EDUA 3AEEA 2IC9A 5LJMA 1UURA 3EI0A 2VWAA 4QH4A 1N36T 5AQFB 1ZEEA 3L39A 5ADXL 3QB5K 2CXDA 3EDVA 2JRKA 4IE6A 3UU6A 3UFGA 4J2CA 2BBHA 3O9XA 5LJNA 5EK2A 2XUEA 3P4QA 5AQOB 5KX5E 4QX8B 4ADZA 3FZMB 4QXBB 1J5ET 3RKGA 5J2UE 2CXFA 4BA9A 2WB5A 5AQIB 2H88A 2M67A 2YKSA 2WZIA 3ZKRA 2JJ9A 3NRXA 4IGUA 5BMVE 1GQEA 3UTKA 4YY3T 2CHNA 2LSGA 2IW5B 4HWFA 3ETUA 3TLWA 4HN9A 3ZJ2A 2HPLA 2Z6EA 2YU1A 2X9HA 2JPFA 5AQPB 5L47A 4MBQA 1WRDA 3KV9A 3ZCIA 5EK3A 4PAGA 5JRCB 3PUYF 2VL0A 2D2SA 4O4LE 3FXEB 3UT5E 4U72A 3IF8B 4U33A 3CQCB 3IBPA 1G8XA 3AEDA 2N1GA 1YKHB 4B3RT 1I6ZA 4TWDA 2XASB 3EHZA 4HTEA 4U3CA 2K3WA 4NUVA 3AEFA 1D0ZA 5AQRB 2D0TA 4H9RC 2XSAA 2XTLA 3IHRA 5JVDE 2NP9A 4HFVA 2VL8A 1LKXA 3HI2A 2IC6A 3LK2B 3OBVE 3ZMZB 4UR9A 3SFEA 5FL0A 4IL9A 5J1GA 3C50A 2XJ7A 3ZN0B 2N2NA 3ZC0A 1MNDA 5JR9C 2CLYB 5LCYA 3RX6A 2X66A 2VKOA 2PJQA 2H7VC 1N34T 4ASKA 5DQVA 2N9DA 3HKCE 1KNPA 5LMNT 2HPJA 1MMGA 2UUBT 4BJMA 3N9NA 5LBMA 2WP9A 3RIUC 4ZEYA 5FY0A 1WR0A 3FB2A 1Z0PA 4GK5E 5IUXA 4LFAT 3UUMA 2J4GA 5JDFA 3PDYA 1XWMA 3ESLA 4LFBT 1WR6A 4ANJA 4AQYT 3HR0A 2CEAA 1MNEA 2JMKA 3UFEA 1WLXA 4UV8B 2FJEA 4DMVA 3ZSTA 3CX8B 2M6IA 4CXXA 5L3BB 2VB6A 4TWHA 1XZYA 2L9QA 4P09A 2IDOB 5CJ5A 3A7MA 2V5CA 4CXYA 2K5BB 4O2AE 3VR9A 2F4VT 3I1AA 5LYJE 3PUGA 4C91A 1UGOA 4YJ2E 5H6RB 4DR2T 1EZ3A 2YOEA 4KHPT 1J1JA 4OYJA 5JDMA 3CPZA 4B3MT 5FY7A 4IREA 2FUPA 4TV9E 3AA6B 3BQLA 2B76A 2MOZA 5L3GB 3QK6A 2IMLA 3LFMA 2E8IA 4G63A 2K24A 2GK9A 5LG4A 2KT9A 1U4QA 4O4JE 1OEDC 5C2TA 3UQ4A 2IUBA 4COFA 2DLRA 3RPUA 2RPAA 2YINA 5JDLA 2CE7A 3WAJA 5HCMA 2WSSV 3V5SA 3KV6A 3LDQB 2W4XA 2NTXA 1KEYA 1XDPA 3K3NA 2LT3A 1M7KA 1KF6A 3B57A 3SFDA 4I0UA 4Z90A 5HXHA 4AKRB 4ZI2D 3VKHA 2LSJA 2DL1A 1E2AA 1D1CA 1IJ5A 2BDEA 2W67A 3AE2A 5FXWA 3ZYMA 3TLUA 1XNQT 2W00A 1VRBA 3N9QA 3I9YA 1YD8G 4NPPA 4IDPA 3MJXA 2D0UA 3UULA 3C98B 4WBOA 4EOZB 2J62A 2NW9A 3TLSA 2EHOB 4L9IA 3I9WA 1SA0E 5CA0E 3RH3A 3QC9A 2LOSA 2LM2A 2KMFA 4KP3C 5HYAA 4JI3T 3LG7A 2X9YA 2BBJA 2XAJB 4DV4T 2YDSA 4EGWA 2BG9E 1Y64B 5JR9A 2YU2A 2RP4A 1T72A 2WQYA 2UXNB 5ABGA 5CGMA 2VK9A 2WMNA 3ZN1B 3FBLA 5FXXA 4HWIB 2X0LB 3RIUA 3S4UA 2AXDS 1MIYA 2XAGB 3GN5B 2XM2A 4DUZT 2V7IA 3MZKB 4U7IA 5L3FB 5IHYA 1HNZT 1X79A 2YN6A 4JYAT 5GONE 4TN7B 5E0OA 3LSVA 4KMCA 4AKHA 4OX9T 2HH7A 4DO0A 3QNUA 4IE7A 4A97A 2BKNA 2XY8B 1HF8A 2C5JA 2LE8A 3QB5A 2JMHA 2CBJA 3CMLA 2CLYC 3OKQA 3AE4A 5KMGP 4KX6A 2LSYA 4HFCA 5FVKA 3Q2MA 2CBIA 3AECA 4QHOA 5F5WA 3LK3B 3ZCJA 1OEDA 3FZFB 4JI6T 3UU3A 1D1BA 4MALA 2YDQA 2E9XB 5LBQB 4O2BE 3B5MA 4YHJA 3TLVA 4LF9T 4E7SA 3AA0B 4P1NA 4GIWA 4PFPA 5FVLA 2MPKA 4DV0T 4OYKA 1O3XA 3VRBA 3J7Yq 5AQHB 2X9XA 3L8RA 1IJ6A 1HCIA 2JIWA 4QKNA 2BZBA 1T7SA 2R6GF 3KBTA 1MIVA 5AQQB 3VRAA 5LXTE 3BQKA 1OWAA 3UU5A 1D0XA 4DVDA 4K0UA 1XDOA 2ODVA 2WWVA 4CXWA 4LF4T 2C0SA 2LEHA 4ZOLE 1VCSA 3FBZA 2MAWA 4X5TA 3RYHE 3N9PA 3R6NA 5JH7E 4EXTA 1J5WA 2FJBA 1I94T 1YW0A 1HFAA 2I0MA 3PUZF 5DQWA 2Y6XA 2V5DA 4BJNA 3MK7C 5JDHA 4WYVA 3RI5A 2MBGA 2Y48B 1HX1B 2G0UA 1OXZA 1HG5A 3NZQA 2XPKA 4B3TT 3UQ7A 2X9WA 4YJ3E 4GK0E 4KI0F 2QRXA 2KZ7B 2LHNA 4OHFA 2XQ9A 4EYYR 1QSDA 1X9BA 2VASA 5IYZE 2CWOA 3CWZB 1XMOT 5JRCA 3ZC1A 5LG3A 1IAPA 3HKBE 5AFUL 1US7B 4DIDB 5FY1A 3K3OA 3AVRA 4OK0A 5J2TE 3CKDA 3RRCA 1H7CA 2HN2A 3UU8A 3UU4A 4HWCA 1XMQT 1CHUA 4YHHT 2EHOC 2X0HA 2E5LT 3RGLA 2V7KA 4DR3T 2LRKA 3HA4A 3J9X1 1IZNB 3NKZA 5FXVA 3VR8A 2XZEA 2ODUA 3ABVA 3KBUA 3MACA 4YTNA 3OYXA 4PW8A 3C4WA 1QLBA 2E2AA 2IIUA 2XQ8A 3Q5XA 1S94A 4QX7B 3EABA 2MYSA 2DWKA 4XAXB 5JDQA 4I4TE 4WBNE 4PJJA 3JCFA 4TV8E 3GMIA 4EYUA 4TNVA 3RLFF 4C90A 2UUAT 3NWIA 3L09A 4N78D 2WBLA 3P4RA 4ILAA 2KINB 3F31A 4GKKT 3ETVA 4Q25A 1IBKT 1D0YA 4DBQA 3LJCA 2NW7A 4YSZA 4CI1B 4AI6A 4G2AA 3ONXA 4DV2T 4U2ZA 5HEOA 5AQGB 4DV3T 1D1AA 2DWGA 2XQ7A 4KUMB 1MMDA 4U74A 1FIOA 2K9AA 3C64A 4L5GA 4HWDA 2XAHB 5C3JA 4JI7T 3PJAA 2I6HA 5TAOA 4DR5T 4JI8T 3DP7A 5AQMB 3UUBA 4Z91A 2Q9QB 3AVSA 2A9UA 4UVBB 4IE4A 2ES0A 2V7LA 4LF8T 5FYMA 3AAAB 4OFZA 4ISSA 2PBIA 3LBXB 4O4HE 1YQ4A 4L0RA 3RQWA 5LP6E 4X65T 3AE5A 2LM9A 3AE6A 2BVMA 4NXMT 2WDVA 2LLYA 4LF5T 2WZHA 4JV5T 2E9XC 2WDQA 2H7OA 1V9DA 3ZEFB 2SPCA 2EHOD 4B6XA 4YFSA 2LHRA 5ABFB 1FMVA 5JDNA 2W63A 2J47A 4JEUB 4DBRA 1U5PA 5IWAT 4EEDA 5L3CB 3PU3A 3H3MA 4UIGA 2UUCT 4H63H 1BR2A 3ZMUB 4HFBA 2DHRA 2VKDA 4QXHB 1N32T 3JAFA 2BKOA 2XAQB 3WI3A 3CIRA 3RRWA 2C5IT 4I43B 2I59A 2W0GA 4F6RC 3X1DA 4CQIA 3AE3A 3P4PA 2X0YA 2V1DB 3P8CD 4EZHA 2EHOA 4CN1A 2BG9B 3M3ZB 4E7ZA 2HN1A 4X1KE 1HR0T 3KVBA 3OPCA 4IDZA 2MTQA 3VKGA 2QVAA 3Q9DA 3SOLA 3R84B 5HXSA 3BK9A 5HWXA 3A5XA 2P9BA 5LHIB 3FZLB 4H9OC 2OV9A 4EV6A 5J0ZA 3FHNA 5AQTB 5LB7B 3KINB 5ABEA 4PK4A 2LKGA 2K48A 3PE0A 3CVRA 3GN5A 1BR4A 2XHEB 3EAMA 3UUXB 4YSYA 3I0QA 2YDRA 2BVLA 3ZJ1A 4YT0A 3RYCE 5L4HA 2E9XD 3AE7A 3GA8A 3AE8A 3EVYA 4HKAA 1ZOYA 4LMKA 3RYIE 1DU2A 5M4YA 4UF0B 3JC6C 4JLEA 3AA7B 2NWBA 1HG2A 5FL1A 2UXBT 2AE9A 1HTJF 3CQXC 1SUMB 5FKYA 5HEJA 2XQYA 2QA7A 2ZM8A 3PUSA 3VU7H 3T1YT 4NIQA 1W0AA 3PU8A 3N5LA 4UVAB 3N2OA 1VCTA 2KLQA 3AE1A 3P50A 2CPTA 4P0AA 4H9QC 4MHCA 4HFEA 4F8HA 2QGSA 5L4EA 3E0ZA 4IE0A 4ZXLA 3HKDE 2VVSA 5AQKB 4CZZB 2A3DA 2E9XA 2QYWA 3NBXX 2X67A 5LOVE 4Z8XA 4PJLA 3FZHB 1QUUA 3AEAA 3OJAA 2LOPA 4X20E 3N9OA 2XQ3A 2V6YB 3B13A 4JI4T 4QH5A 2DNXA 3CX7B 1LVKA 4X1IE 3HKEE 4A5XA 4DR4T 4DMWA 4BAYB 3CQGB 5FNVE 1IBLT 2UXDT 5KDMC 2HHHT 1JNZA 4IHJE 2Q9QC 3AEBA 3Q5EA 1YQ3A 4HGAA 5JREA 3AA1B 2VURA 2X68A 1NWMX 4H9NC 5F8PA 1SE7A 3ZMSB 3ANWB 3RF1A 5JQGE 4YTMA 4P0BA 3ZLIA 4AQFC 5L3DB 4AIUA 1UUSA 3QOFA 2CRBA 5HEUA 4ZHQE 1HS7A 2W66A 5DJQC 1FMWA 3KFWX 1ZKEA 2OA5A 5HXEA 4PFOA 1MIWA 3O1IA 3ZSSA 4DV1T 2D5UA 5CA1E 3O4XE 1XNRT 3K3QC 2W61A 4EB6E 4ZI7E 3T8OA 2PTFA 3RIAA 4JI0T 5C8YE 5HCJA 4ZZCA 1HNWT 1UX5A 2UXXB 4KBMB 1OEDE 1VOMA 1T8BA 4WZXA 2H3RA 4LF7T 5LGUB 3KVAA 3JADA 3SRZA 5DABA 4CI3B 4JBWF 4AQGA 4CN6A 4A56A 3ZMTB 4ISTA 4PK5A 2PFVA 5HWYA 2UU9T 1N33T 2V7MA 3P4WA 3ZT6A 1KNZA 2W2UA 2ZLYA 4EEBA 4LFCT 3K8PC 1IBMT 2D9DA 2E5VA 2BG9C 3QUJA 2VVNA 2Y8DA 5EZYE 3TLTA 1L0VA 2JQQA 2CHOA 4IDNA 1KK7A 3FZKB 4QXCB 3KV4A 2YK0A 1W09A 5AQJB 3K1SA 3C4XA 1WFDA 1MMAA 2X51A 2YEVC 4UELA 2Q9QD 5AQNB 4PJMA 1S35A 3ZYKA 4YXDA 4DV5T 3LK42 5A1LA 4YLHA 1HNXT 5FMNA 2DCFA 2ZM0A 3CX6B 4GOUA 4PNIA 4UEMA 5JTGA 4ZS2A 1ZV4X 2WM9A 4U2YA 3WAKA 3ONLC 2C5KT 3OTOT 4AISA 4I50E 3N2GE 2JQHA 4QWNB 4DNDA 2A2FX 4QH1A 2KXPB 1W0BA 2WU2A 2XQ5A 1ZP0A 3RC8A 2V26A 1JNRA 4UVCB 3VHLA 1B7TA 1Z8UA 2WCAA 2XSBA 4IDQA 3DTOA 3P7IA 4ILUA 2ZM6T 4GYRA 1E1HB 2CCQA 3AAEB 5HAXA 3IEEA 2Q9QA 4JI1T 5AQSB 2WAUA 3W15B 2V7JA 4ZI2C 5H6QB 3NRYA 3N9MA 3E08A 3LBXA 3G06A 4KHZF 2WMOA 5HEHA 1BR1A 4WNKA 2XQ4A 4AQFA 2ZM2A 2ACXA 5L2LA 3RHWA 2UXCT 4ZZBA 4DV6T 2CA5A 4YTPA 3M65A 4H63V 2NTYA 2WS3A 5ABFA 4DUYT 3JAEA 4A98A 2CMRA 4NUUA 3BQIA 2BKPA 3AAIA 5FXZA 1KNRA 4NXNT 1WYCA 4ILCA 4JI5T 4IT4A 4TUYE 4UV9B 3RYFE 3PV0F 5HXCA 2LSIA 3ZT5A 4FJOA 4ERRA 2RA1A 4IL4A 5ETWA 5HXRA 5LGTB 3AB3B 3OVUA 1T98A 2XM1A 5FP3A 4V1Av 3RQUA 3KV5A 5AQLB 4HFDA 4PK6A 4TWFA 3E22E 3PJAJ 3N2KE 3H3AA 5JDGA 3ONJA 4MLKA 2BG9A 4O8SA 1W9RA 1ZHCA 3PTRB 4EAHA 5LHGB 1WYBA 4GYSA 2XQAA 4U7YA 5LA6E 3SWHA 3ZPOA 2KSRA 4DR7T 4DR1T 4X62T 3H37A 1YKEB 4X64T 3MKDA 4O4IE 5LHHB 1YXRA 4TNWA 4I55E 4TZ4C 5KXJA 4PJNA 3IA3A 5AQUB 4AKGA 2H89A 3T1HT 4HEAA 3PUWF 3EUHA 4HFIA 1UCUA 4M1PA 3RKOA 1NAFA 2JQKA 2W62A 3OYZA 3HL6A 4U31A 5LNKA 4EZ4A 4LF6T 2NW8A 2BS2A 1UX4A 2WDRA 5AQVB 4UXNB 2FJAA 1NEKA 3KDSE 2CM0A 2FJDA 3O1HA 4ILBA 4UF0A 4AXPA 2KWHA 2XAFB 5F3JA 4H9PC 3PUAA 3D0TA 3DJBA 1NENA 4EIWA 4ZI3C 2L3LA 2L8KA 2XQ6A 3NZPA 4IE5A 3RIFA 2LKHA 3AE9A 4ZS3A 5ABHA 4K0KT 4TX5A 3MA9A 1SHZC 3ZYLA 1AJ3A 2NOXA 3U78A 3F2EA 2WWUA 2IHR1 1G73A 4DV7T 2OLTA 5CB4E 5JR9B 1LRZA 1E7PA 4B3ST 3N9LA 5EK4A 2CXLA 4JI2T 2M6BA 2VQFT 2VKJA 4LMJA 3GWHA 2B1EA 4WW0A 3C4ZA 3V5UA 5BR8T 5L3EB 2VKHA 1FJGT 4HE8A 2V6YA 2VQET 4GKJT 4IDOA 3PUXF 2A72A 4HFHA 2DI4A
chains in the Genus database with same CATH topology
5HXHA 4G2AA 3ONXA 4AKRB 4ZI2D 4CI3B 3VKHA 4XZCA 1D1AA 4AQGA 2PG8A 2LSJA 2DWGA 4KUMB 1MMDA 4JUYA 4A56A 4U74A 1D1CA 3ZMTB 1IJ5A 4ISTA 2BDEA 4PK5A 1BR0A 5FXWA 1FIOA 2K9AA 3C64A 2PFVA 4L5GA 5HWYA 3ZYMA 3C51A 3FXDB 2XAHB 2V7MA 3PUQA 2W00A 3U3IA 1KNZA 5TAOA 2ZLYA 3K8PC 1VRBA 3N9QA 3DP7A 1YD8G 3I9YA 3MJXA 2Q9QB 3AVSA 3ANWA 4H9SE 4UVBB 4IE4A 2D0UA 3QUJA 2Y8DA 3UULA 3C98B 5EZYE 4WBOA 4EOZB 2ES0A 2V7LA 2JQQA 3UUNA 5FYMA 1KK7A 4QXCB 2NW9A 2EHOB 3AAAB 4OFZA 4ISSA 3KV4A 2YK0A 4L9IA 2PBIA 3I9WA 3LBXB 4O4HE 1SA0E 4L0RA 5CA0E 2CWYA 3RH3A 5LP6E 3QC9A 2LOSA 2KMFA 3O1JA 4CI2B 3C4XA 1LVFA 2LM9A 2BVMA 3L3PA 4KP3C 1MMAA 2LJLA 3PURA 5HYAA 2X51A 2YEVC 3ZMVB 3I0OA 3LG7A 2X9YA 4UELA 2Q9QD 2XAJB 3SS1A 5LGNB 4PJMA 1CUNA 1S35A 1Y64B 2E9XC 3ZYKA 5JR9A 2YU2A 3LK42 5A1LA 4YLHA 2H7OA 1V9DA 2ZMAA 2DCFA 2RP4A 2SPCA 2EHOD 5FMNA 3ZEFB 4ZI3D 2ZM0A 3RC3A 3F57A 3CX6B 2UXNB 4B6XA 4GOUA 4YFSA 2LHRA 4PNIA 4UEMA 4ZS2A 2VK9A 1FMVA 2WMNA 1ZV4X 2WM9A 5JDNA 2W63A 3ZN1B 2LSKA 4X1YE 3WAKA 3FBLA 2C5KT 5FXXA 4AKIA 2X0LB 4JEUB 4DBRA 1U5PA 4IIJE 3JC6D 3S4UA 5L3CB 1MIYA 3PU3A 3TKLB 4XBFB 4I50E 3N2GE 2XAGB 1MMNA 4QWNB 4UIGA 3MXZA 3GN5B 2A2FX 4DNDA 4JEHB 2KNDA 4H63H 2KXPB 1BR2A 3ZMUB 2V7IA 2DHRA 2VKDA 3Q5WA 3MZKB 4QXHB 3RC8A 5L3FB 2V26A 1FEWA 4UVCB 1HX8A 3VHLA 4MFRA 1B7TA 5IHYA 2J1DG 4AKLA 1X79A 2XAQB 2IAKA 3DTOA 3WI3A 3P7IA 4ILUA 4FI5A 4GYRA 2KWIB 5GONE 3EDUA 4TN7B 1E1HB 2CCQA 2IC9A 5E0OA 3RRWA 5LJMA 2C5IT 3AAEB 4I43B 4KMCA 2VWAA 2I59A 5HAXA 1ZEEA 3IEEA 4AKHA 2W0GA 4F6RC 4CQIA 2HH7A 5ADXL 4DO0A 2CXDA 3EDVA 2JRKA 2Q9QA 4IE6A 4IE7A 1HF8A 2C5JA 2V1DB 3P8CD 4J2CA 4EZHA 2WAUA 3O9XA 3W15B 5LJNA 2LE8A 2V7JA 5EK2A 2XUEA 4ZI2C 5H6QB 2JMHA 3NRYA 5KX5E 4QX8B 2EHOA 3N9MA 4ADZA 3E08A 3CMLA 3LBXA 4QXBB 2CLYC 3OKQA 4E7ZA 5KMGP 2WMOA 4X1KE 1BR1A 3KVBA 4WNKA 2LSYA 4AQFA 5J2UE 2ZM2A 2CXFA 4IDZA 4BA9A 3Q2MA 2ACXA 2MTQA 5L2LA 3VKGA 4QHOA 3Q9DA 3SOLA 3R84B 2M67A 2CA5A 2JJ9A 5HXSA 3NRXA 4IGUA 3LK3B 3M65A 5BMVE 3BK9A 3ZCJA 3UTKA 5HWXA 4H63V 2NTYA 1D1BA 2LSGA 4MALA 2IW5B 3A5XA 2P9BA 5LHIB 2E9XB 3ETUA 5LBQB 4HN9A 3ZJ2A 4H9OC 2HPLA 4O2BE 2CMRA 4NUUA 2Z6EA 3BQIA 3FHNA 4YHJA 2YU1A 3AAIA 5FXZA 3KINB 4E7SA 2X9HA 3AA0B 4GIWA 2JPFA 4PFPA 4PK4A 2K48A 4MBQA 3PE0A 1WYCA 3CVRA 4OYKA 1O3XA 1WRDA 3GN5A 1BR4A 2XHEB 3J7Yq 3KV9A 3ZCIA 3UUXB 5EK3A 2X9XA 3I0QA 4TUYE 4UV9B 4PAGA 1IJ6A 2BVLA 3ZJ1A 5JRCB 3RYFE 1HCIA 4QKNA 2BZBA 5HXCA 3KBTA 3RYCE 1MIVA 2E9XD 2LSIA 2D2SA 3GA8A 4O4LE 3FXEB 3UT5E 4U72A 3IF8B 3EVYA 4HKAA 4FJOA 3CQCB 3IBPA 4ERRA 1G8XA 2RA1A 2N1GA 5LXTE 3BQKA 5ETWA 5HXRA 1OWAA 1YKHB 3RYIE 5LGTB 1D0XA 3AB3B 4DVDA 5M4YA 4K0UA 4UF0B 1T98A 2ODVA 2XASB 3JC6C 4HTEA 4JLEA 5FP3A 3AA7B 2NWBA 1HG2A 4V1Av 4NUVA 1HTJF 1D0ZA 4CXWA 3CQXC 2D0TA 2C0SA 3KV5A 2LEHA 4PK6A 4ZOLE 4H9RC 3FBZA 3E22E 2XTLA 3IHRA 5JVDE 2XQYA 2NP9A 4HFVA 3RYHE 2VL8A 3N9PA 3N2KE 1LKXA 2QA7A 2IC6A 3HI2A 2ZM8A 3R6NA 5JH7E 3PUSA 3VU7H 3LK2B 3H3AA 3OBVE 4EXTA 3ZMZB 5JDGA 4MLKA 4O8SA 3PU8A 3N5LA 1ZHCA 3PTRB 4EAHA 5LHGB 4UVAB 1WYBA 4GYSA 5J1GA 1YW0A 3C50A 5LA6E 3N2OA 3SWHA 2KLQA 3ZN0B 2N2NA 3ZC0A 1MNDA 3ZPOA 1HFAA 5JR9C 2CLYB 5LCYA 4P0AA 4H9QC 4MHCA 3RX6A 2X66A 5DQWA 2VKOA 2Y6XA 2PJQA 3H37A 2QGSA 1YKEB 2H7VC 4ASKA 4BJNA 3MK7C 5JDHA 5DQVA 3E0ZA 2N9DA 3MKDA 4O4IE 3HKCE 2MBGA 5LHHB 2Y48B 2HPJA 4I55E 4IE0A 1MMGA 2G0UA 4BJMA 1OXZA 3N9NA 1HG5A 3NZQA 3HKDE 4TZ4C 4CZZB 5LBMA 2A3DA 4PJNA 2E9XA 5FY0A 3FB2A 1Z0PA 4AKGA 4GK5E 3NBXX 4HEAA 2X67A 5LOVE 4Z8XA 2X9WA 5JDFA 3UUMA 3EUHA 4GK0E 3PDYA 4PJLA 4YJ3E 1UCUA 4M1PA 3ESLA 1QUUA 1WR6A 3RKOA 4ANJA 2KZ7B 3OJAA 2LHNA 1NAFA 3HR0A 2CEAA 1MNEA 2LOPA 2JMKA 2W62A 4X20E 3UFEA 1WLXA 3OYZA 4OHFA 3HL6A 4UV8B 4DMVA 5LNKA 4EYYR 4EZ4A 3CX8B 3N9OA 1QSDA 4CXXA 5L3BB 2VB6A 2VASA 5IYZE 2CWOA 2L9QA 4P09A 3CWZB 3B13A 5JRCA 3ZC1A 2NW8A 1UX4A 2DNXA 1IAPA 4CXYA 2K5BB 3CX7B 1LVKA 4X1IE 3HKEE 3HKBE 4O2AE 4DMWA 5AFUL 1US7B 4UXNB 3KDSE 4BAYB 5FY1A 2CM0A 3CQGB 3I1AA 3K3OA 5FNVE 3AVRA 3O1HA 5LYJE 5KDMC 3PUGA 4OK0A 4IHJE 4UF0A 4AXPA 5J2TE 2Q9QC 3CKDA 3RRCA 4HGAA 4C91A 2KWHA 4YJ2E 5JREA 1H7CA 2XAFB 5F3JA 4H9PC 5H6RB 3PUAA 3D0TA 3DJBA 3AA1B 1EZ3A 2X68A 1NWMX 4EIWA 4H9NC 5F8PA 2EHOC 4ZI3C 2L3LA 2L8KA 2V7KA 4OYJA 3ZMSB 3ANWB 5JDMA 3CPZA 3NZPA 5FY7A 5JQGE 3HA4A 3J9X1 4P0BA 3ZLIA 4IE5A 1IZNB 4AQFC 5FXVA 5L3DB 4TV9E 3AA6B 3BQLA 2ODUA 4ZS3A 2MOZA 5L3GB 3QK6A 3KBUA 3MACA 4TX5A 4ZHQE 3LFMA 1HS7A 2E8IA 3MA9A 2K24A 4G63A 3OYXA 4PW8A 1SHZC 2GK9A 3C4WA 5LG4A 3ZYLA 2KT9A 1AJ3A 3KFWX 1FMWA 2NOXA 3Q5XA 5DJQC 3U78A 1S94A 1U4QA 1ZKEA 4O4JE 4QX7B 3F2EA 2WWUA 2MYSA 2OA5A 5HXEA 4PFOA 1MIWA 3O1IA 1G73A 2DWKA 2D5UA 4XAXB 5CA1E 3O4XE 5CB4E 5JDQA 4I4TE 5JR9B 1LRZA 4WBNE 4PJJA 2DLRA 3K3QC 3RPUA 2W61A 3N9LA 5EK4A 2CXLA 2YINA 4EB6E 5JDLA 4TV8E 4ZI7E 3T8OA 3GMIA 4EYUA 2CE7A 3WAJA 4C90A 5C8YE 2WSSV 3L09A 2VKJA 3V5SA 1UX5A 3GWHA 2UXXB 4KBMB 4N78D 2B1EA 4WW0A 2WBLA 3C4ZA 3KV6A 2KINB 3V5UA 2NTXA 1VOMA 3F31A 3K3NA 2LT3A 2H3RA 5L3EB 2VKHA 3ETVA 5LGUB 4HE8A 3KVAA 1D0YA 3B57A 4DBQA 3LJCA 2A72A 2NW7A 3SRZA 5DABA 2DI4A 4CI1B 4AI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LVF A;  2X9W A;  3FXE B;  2XTL A;  3L3P A;  1ZKE A;  2C5J A;  2C5K T;  4J2C A;  2X9Y A;  3QUJ A;  2CA5 A;  3P7I A;  2IC6 A;  4FI5 A;  2K48 A;  3S4U A;  2KWI B;  3TKL B;  1IJ5 A;  3CVR A;  2MBG A;  2IC9 A;  1LRZ A;  3MXZ A;  4DND A;  2C5I T;  4EYY R;  2G0U A;  1QSD A;  3N5L A;  3FXD B;  3CKD A;  2X9X A;  2KWH A;  4L0R A;  1H7C A;  1IJ6 A;  3QK6 A;  4CQI A;  4B6X A;  1Z0P A; 
#chains in the Genus database with same CATH topology
 1KFY A;  4XZC A;  2PG8 A;  3Q5D A;  4JUY A;  2FBW A;  1R8I A;  1BR0 A;  3C51 A;  2WU5 A;  3FXD B;  3PUQ A;  2ACZ A;  3U3I A;  3PUV F;  2V6X A;  5LMU T;  3CK6 A;  3ANW A;  4H9S E;  2BS4 A;  3UUN A;  3A8Y C;  2BS3 A;  4X66 T;  3ZT7 A;  2CWY A;  3O1J A;  4CI2 B;  4HWH A;  1LVF A;  3L3P A;  2LJL A;  3PUR A;  3ZMV B;  3I0O A;  4DR6 T;  3SS1 A;  5LGN B;  5CFB A;  1CUN A;  3P4S A;  5HEG A;  1OED B;  2ZMA A;  2JQ9 A;  4ZI3 D;  3RC3 A;  2V8S V;  3F57 A;  1Y01 A;  3AXJ A;  4YSX A;  2LSK A;  4X1Y E;  4AKI A;  4IIJ E;  3JC6 D;  3AEG A;  3TKL B;  4XBF B;  2LRL A;  1M62 A;  1MMN A;  3MXZ A;  4JEH B;  2KND A;  3Q5W A;  2NR4 A;  3NVO A;  4LML A;  4CN4 A;  2WY2 A;  1FEW A;  1UK5 A;  1HX8 A;  1WCR A;  4MFR A;  3AXJ B;  2J1D G;  4AKL A;  2IAK A;  4FI5 A;  2KWI B;  3EDU A;  3AEE A;  2IC9 A;  5LJM A;  1UUR A;  3EI0 A;  2VWA A;  4QH4 A;  1N36 T;  5AQF B;  1ZEE A;  3L39 A;  5ADX L;  3QB5 K;  2CXD A;  3EDV A;  2JRK A;  4IE6 A;  3UU6 A;  3UFG A;  4J2C A;  2BBH A;  3O9X A;  5LJN A;  5EK2 A;  2XUE A;  3P4Q A;  5AQO B;  5KX5 E;  4QX8 B;  4ADZ A;  3FZM B;  4QXB B;  1J5E T;  3RKG A;  5J2U E;  2CXF A;  4BA9 A;  2WB5 A;  5AQI B;  2H88 A;  2M67 A;  2YKS A;  2WZI A;  3ZKR A;  2JJ9 A;  3NRX A;  4IGU A;  5BMV E;  1GQE A;  3UTK A;  4YY3 T;  2CHN A;  2LSG A;  2IW5 B;  4HWF A;  3ETU A;  3TLW A;  4HN9 A;  3ZJ2 A;  2HPL A;  2Z6E A;  2YU1 A;  2X9H A;  2JPF A;  5AQP B;  5L47 A;  4MBQ A;  1WRD A;  3KV9 A;  3ZCI A;  5EK3 A;  4PAG A;  5JRC B;  3PUY F;  2VL0 A;  2D2S A;  4O4L E;  3FXE B;  3UT5 E;  4U72 A;  3IF8 B;  4U33 A;  3CQC B;  3IBP A;  1G8X A;  3AED A;  2N1G A;  1YKH B;  4B3R T;  1I6Z A;  4TWD A;  2XAS B;  3EHZ A;  4HTE A;  4U3C A;  2K3W A;  4NUV A;  3AEF A;  1D0Z A;  5AQR B;  2D0T A;  4H9R C;  2XSA A;  2XTL A;  3IHR A;  5JVD E;  2NP9 A;  4HFV A;  2VL8 A;  1LKX A;  3HI2 A;  2IC6 A;  3LK2 B;  3OBV E;  3ZMZ B;  4UR9 A;  3SFE A;  5FL0 A;  4IL9 A;  5J1G A;  3C50 A;  2XJ7 A;  3ZN0 B;  2N2N A;  3ZC0 A;  1MND A;  5JR9 C;  2CLY B;  5LCY A;  3RX6 A;  2X66 A;  2VKO A;  2PJQ A;  2H7V C;  1N34 T;  4ASK A;  5DQV A;  2N9D A;  3HKC E;  1KNP A;  5LMN T;  2HPJ A;  1MMG A;  2UUB T;  4BJM A;  3N9N A;  5LBM A;  2WP9 A;  3RIU C;  4ZEY A;  5FY0 A;  1WR0 A;  3FB2 A;  1Z0P A;  4GK5 E;  5IUX A;  4LFA T;  3UUM A;  2J4G A;  5JDF A;  3PDY A;  1XWM A;  3ESL A;  4LFB T;  1WR6 A;  4ANJ A;  4AQY T;  3HR0 A;  2CEA A;  1MNE A;  2JMK A;  3UFE A;  1WLX A;  4UV8 B;  2FJE A;  4DMV A;  3ZST A;  3CX8 B;  2M6I A;  4CXX A;  5L3B B;  2VB6 A;  4TWH A;  1XZY A;  2L9Q A;  4P09 A;  2IDO B;  5CJ5 A;  3A7M A;  2V5C A;  4CXY A;  2K5B B;  4O2A E;  3VR9 A;  2F4V T;  3I1A A;  5LYJ E;  3PUG A;  4C91 A;  1UGO A;  4YJ2 E;  5H6R B;  4DR2 T;  1EZ3 A;  2YOE A;  4KHP T;  1J1J A;  4OYJ A;  5JDM A;  3CPZ A;  4B3M T;  5FY7 A;  4IRE A;  2FUP A;  4TV9 E;  3AA6 B;  3BQL A;  2B76 A;  2MOZ A;  5L3G B;  3QK6 A;  2IML A;  3LFM A;  2E8I A;  4G63 A;  2K24 A;  2GK9 A;  5LG4 A;  2KT9 A;  1U4Q A;  4O4J E;  1OED C;  5C2T A;  3UQ4 A;  2IUB A;  4COF A;  2DLR A;  3RPU A;  2RPA A;  2YIN A;  5JDL A;  2CE7 A;  3WAJ A;  5HCM A;  2WSS V;  3V5S A;  3KV6 A;  3LDQ B;  2W4X A;  2NTX A;  1KEY A;  1XDP A;  3K3N A;  2LT3 A;  1M7K A;  1KF6 A;  3B57 A;  3SFD A;  4I0U A;  4Z90 A;  5HXH A;  4AKR B;  4ZI2 D;  3VKH A;  2LSJ A;  2DL1 A;  1E2A A;  1D1C A;  1IJ5 A;  2BDE A;  2W67 A;  3AE2 A;  5FXW A;  3ZYM A;  3TLU A;  1XNQ T;  2W00 A;  1VRB A;  3N9Q A;  3I9Y A;  1YD8 G;  4NPP A;  4IDP A;  3MJX A;  2D0U A;  3UUL A;  3C98 B;  4WBO A;  4EOZ B;  2J62 A;  2NW9 A;  3TLS A;  2EHO B;  4L9I A;  3I9W A;  1SA0 E;  5CA0 E;  3RH3 A;  3QC9 A;  2LOS A;  2LM2 A;  2KMF A;  4KP3 C;  5HYA A;  4JI3 T;  3LG7 A;  2X9Y A;  2BBJ A;  2XAJ B;  4DV4 T;  2YDS A;  4EGW A;  2BG9 E;  1Y64 B;  5JR9 A;  2YU2 A;  2RP4 A;  1T72 A;  2WQY A;  2UXN B;  5ABG A;  5CGM A;  2VK9 A;  2WMN A;  3ZN1 B;  3FBL A;  5FXX A;  4HWI B;  2X0L B;  3RIU A;  3S4U A;  2AXD S;  1MIY A;  2XAG B;  3GN5 B;  2XM2 A;  4DUZ T;  2V7I A;  3MZK B;  4U7I A;  5L3F B;  5IHY A;  1HNZ T;  1X79 A;  2YN6 A;  4JYA T;  5GON E;  4TN7 B;  5E0O A;  3LSV A;  4KMC A;  4AKH A;  4OX9 T;  2HH7 A;  4DO0 A;  3QNU A;  4IE7 A;  4A97 A;  2BKN A;  2XY8 B;  1HF8 A;  2C5J A;  2LE8 A;  3QB5 A;  2JMH A;  2CBJ A;  3CML A;  2CLY C;  3OKQ A;  3AE4 A;  5KMG P;  4KX6 A;  2LSY A;  4HFC A;  5FVK A;  3Q2M A;  2CBI A;  3AEC A;  4QHO A;  5F5W A;  3LK3 B;  3ZCJ A;  1OED A;  3FZF B;  4JI6 T;  3UU3 A;  1D1B A;  4MAL A;  2YDQ A;  2E9X B;  5LBQ B;  4O2B E;  3B5M A;  4YHJ A;  3TLV A;  4LF9 T;  4E7S A;  3AA0 B;  4P1N A;  4GIW A;  4PFP A;  5FVL A;  2MPK A;  4DV0 T;  4OYK A;  1O3X A;  3VRB A;  3J7Y q;  5AQH B;  2X9X A;  3L8R A;  1IJ6 A;  1HCI A;  2JIW A;  4QKN A;  2BZB A;  1T7S A;  2R6G F;  3KBT A;  1MIV A;  5AQQ B;  3VRA A;  5LXT E;  3BQK A;  1OWA A;  3UU5 A;  1D0X A;  4DVD A;  4K0U A;  1XDO A;  2ODV A;  2WWV A;  4CXW A;  4LF4 T;  2C0S A;  2LEH A;  4ZOL E;  1VCS A;  3FBZ A;  2MAW A;  4X5T A;  3RYH E;  3N9P A;  3R6N A;  5JH7 E;  4EXT A;  1J5W A;  2FJB A;  1I94 T;  1YW0 A;  1HFA A;  2I0M A;  3PUZ F;  5DQW A;  2Y6X A;  2V5D A;  4BJN A;  3MK7 C;  5JDH A;  4WYV A;  3RI5 A;  2MBG A;  2Y48 B;  1HX1 B;  2G0U A;  1OXZ A;  1HG5 A;  3NZQ A;  2XPK A;  4B3T T;  3UQ7 A;  2X9W A;  4YJ3 E;  4GK0 E;  4KI0 F;  2QRX A;  2KZ7 B;  2LHN A;  4OHF A;  2XQ9 A;  4EYY R;  1QSD A;  1X9B A;  2VAS A;  5IYZ E;  2CWO A;  3CWZ B;  1XMO T;  5JRC A;  3ZC1 A;  5LG3 A;  1IAP A;  3HKB E;  5AFU L;  1US7 B;  4DID B;  5FY1 A;  3K3O A;  3AVR A;  4OK0 A;  5J2T E;  3CKD A;  3RRC A;  1H7C A;  2HN2 A;  3UU8 A;  3UU4 A;  4HWC A;  1XMQ T;  1CHU A;  4YHH T;  2EHO C;  2X0H A;  2E5L T;  3RGL A;  2V7K A;  4DR3 T;  2LRK A;  3HA4 A;  3J9X 1;  1IZN B;  3NKZ A;  5FXV A;  3VR8 A;  2XZE A;  2ODU A;  3ABV A;  3KBU A;  3MAC A;  4YTN A;  3OYX A;  4PW8 A;  3C4W A;  1QLB A;  2E2A A;  2IIU A;  2XQ8 A;  3Q5X A;  1S94 A;  4QX7 B;  3EAB A;  2MYS A;  2DWK A;  4XAX B;  5JDQ A;  4I4T E;  4WBN E;  4PJJ A;  3JCF A;  4TV8 E;  3GMI A;  4EYU A;  4TNV A;  3RLF F;  4C90 A;  2UUA T;  3NWI A;  3L09 A;  4N78 D;  2WBL A;  3P4R A;  4ILA A;  2KIN B;  3F31 A;  4GKK T;  3ETV A;  4Q25 A;  1IBK T;  1D0Y A;  4DBQ A;  3LJC A;  2NW7 A;  4YSZ A;  4CI1 B;  4AI6 A;  4G2A A;  3ONX A;  4DV2 T;  4U2Z A;  5HEO A;  5AQG B;  4DV3 T;  1D1A A;  2DWG A;  2XQ7 A;  4KUM B;  1MMD A;  4U74 A;  1FIO A;  2K9A A;  3C64 A;  4L5G A;  4HWD A;  2XAH B;  5C3J A;  4JI7 T;  3PJA A;  2I6H A;  5TAO A;  4DR5 T;  4JI8 T;  3DP7 A;  5AQM B;  3UUB A;  4Z91 A;  2Q9Q B;  3AVS A;  2A9U A;  4UVB B;  4IE4 A;  2ES0 A;  2V7L A;  4LF8 T;  5FYM A;  3AAA B;  4OFZ A;  4ISS A;  2PBI A;  3LBX B;  4O4H E;  1YQ4 A;  4L0R A;  3RQW A;  5LP6 E;  4X65 T;  3AE5 A;  2LM9 A;  3AE6 A;  2BVM A;  4NXM T;  2WDV A;  2LLY A;  4LF5 T;  2WZH A;  4JV5 T;  2E9X C;  2WDQ A;  2H7O A;  1V9D A;  3ZEF B;  2SPC A;  2EHO D;  4B6X A;  4YFS A;  2LHR A;  5ABF B;  1FMV A;  5JDN A;  2W63 A;  2J47 A;  4JEU B;  4DBR A;  1U5P A;  5IWA T;  4EED A;  5L3C B;  3PU3 A;  3H3M A;  4UIG A;  2UUC T;  4H63 H;  1BR2 A;  3ZMU B;  4HFB A;  2DHR A;  2VKD A;  4QXH B;  1N32 T;  3JAF A;  2BKO A;  2XAQ B;  3WI3 A;  3CIR A;  3RRW A;  2C5I T;  4I43 B;  2I59 A;  2W0G A;  4F6R C;  3X1D A;  4CQI A;  3AE3 A;  3P4P A;  2X0Y A;  2V1D B;  3P8C D;  4EZH A;  2EHO A;  4CN1 A;  2BG9 B;  3M3Z B;  4E7Z A;  2HN1 A;  4X1K E;  1HR0 T;  3KVB A;  3OPC A;  4IDZ A;  2MTQ A;  3VKG A;  2QVA A;  3Q9D A;  3SOL A;  3R84 B;  5HXS A;  3BK9 A;  5HWX A;  3A5X A;  2P9B A;  5LHI B;  3FZL B;  4H9O C;  2OV9 A;  4EV6 A;  5J0Z A;  3FHN A;  5AQT B;  5LB7 B;  3KIN B;  5ABE A;  4PK4 A;  2LKG A;  2K48 A;  3PE0 A;  3CVR A;  3GN5 A;  1BR4 A;  2XHE B;  3EAM A;  3UUX B;  4YSY A;  3I0Q A;  2YDR A;  2BVL A;  3ZJ1 A;  4YT0 A;  3RYC E;  5L4H A;  2E9X D;  3AE7 A;  3GA8 A;  3AE8 A;  3EVY A;  4HKA A;  1ZOY A;  4LMK A;  3RYI E;  1DU2 A;  5M4Y A;  4UF0 B;  3JC6 C;  4JLE A;  3AA7 B;  2NWB A;  1HG2 A;  5FL1 A;  2UXB T;  2AE9 A;  1HTJ F;  3CQX C;  1SUM B;  5FKY A;  5HEJ A;  2XQY A;  2QA7 A;  2ZM8 A;  3PUS A;  3VU7 H;  3T1Y T;  4NIQ A;  1W0A A;  3PU8 A;  3N5L A;  4UVA B;  3N2O A;  1VCT A;  2KLQ A;  3AE1 A;  3P50 A;  2CPT A;  4P0A A;  4H9Q C;  4MHC A;  4HFE A;  4F8H A;  2QGS A;  5L4E A;  3E0Z A;  4IE0 A;  4ZXL A;  3HKD E;  2VVS A;  5AQK B;  4CZZ B;  2A3D A;  2E9X A;  2QYW A;  3NBX X;  2X67 A;  5LOV E;  4Z8X A;  4PJL A;  3FZH B;  1QUU A;  3AEA A;  3OJA A;  2LOP A;  4X20 E;  3N9O A;  2XQ3 A;  2V6Y B;  3B13 A;  4JI4 T;  4QH5 A;  2DNX A;  3CX7 B;  1LVK A;  4X1I E;  3HKE E;  4A5X A;  4DR4 T;  4DMW A;  4BAY B;  3CQG B;  5FNV E;  1IBL T;  2UXD T;  5KDM C;  2HHH T;  1JNZ A;  4IHJ E;  2Q9Q C;  3AEB A;  3Q5E A;  1YQ3 A;  4HGA A;  5JRE A;  3AA1 B;  2VUR A;  2X68 A;  1NWM X;  4H9N C;  5F8P A;  1SE7 A;  3ZMS B;  3ANW B;  3RF1 A;  5JQG E;  4YTM A;  4P0B A;  3ZLI A;  4AQF C;  5L3D B;  4AIU A;  1UUS A;  3QOF A;  2CRB A;  5HEU A;  4ZHQ E;  1HS7 A;  2W66 A;  5DJQ C;  1FMW A;  3KFW X;  1ZKE A;  2OA5 A;  5HXE A;  4PFO A;  1MIW A;  3O1I A;  3ZSS A;  4DV1 T;  2D5U A;  5CA1 E;  3O4X E;  1XNR T;  3K3Q C;  2W61 A;  4EB6 E;  4ZI7 E;  3T8O A;  2PTF A;  3RIA A;  4JI0 T;  5C8Y E;  5HCJ A;  4ZZC A;  1HNW T;  1UX5 A;  2UXX B;  4KBM B;  1OED E;  1VOM A;  1T8B A;  4WZX A;  2H3R A;  4LF7 T;  5LGU B;  3KVA A;  3JAD A;  3SRZ A;  5DAB A;  4CI3 B;  4JBW F;  4AQG A;  4CN6 A;  4A56 A;  3ZMT B;  4IST A;  4PK5 A;  2PFV A;  5HWY A;  2UU9 T;  1N33 T;  2V7M A;  3P4W A;  3ZT6 A;  1KNZ A;  2W2U A;  2ZLY A;  4EEB A;  4LFC T;  3K8P C;  1IBM T;  2D9D A;  2E5V A;  2BG9 C;  3QUJ A;  2VVN A;  2Y8D A;  5EZY E;  3TLT A;  1L0V A;  2JQQ A;  2CHO A;  4IDN A;  1KK7 A;  3FZK B;  4QXC B;  3KV4 A;  2YK0 A;  1W09 A;  5AQJ B;  3K1S A;  3C4X A;  1WFD A;  1MMA A;  2X51 A;  2YEV C;  4UEL A;  2Q9Q D;  5AQN B;  4PJM A;  1S35 A;  3ZYK A;  4YXD A;  4DV5 T;  3LK4 2;  5A1L A;  4YLH A;  1HNX T;  5FMN A;  2DCF A;  2ZM0 A;  3CX6 B;  4GOU A;  4PNI A;  4UEM A;  5JTG A;  4ZS2 A;  1ZV4 X;  2WM9 A;  4U2Y A;  3WAK A;  3ONL C;  2C5K T;  3OTO T;  4AIS A;  4I50 E;  3N2G E;  2JQH A;  4QWN B;  4DND A;  2A2F X;  4QH1 A;  2KXP B;  1W0B A;  2WU2 A;  2XQ5 A;  1ZP0 A;  3RC8 A;  2V26 A;  1JNR A;  4UVC B;  3VHL A;  1B7T A;  1Z8U A;  2WCA A;  2XSB A;  4IDQ A;  3DTO A;  3P7I A;  4ILU A;  2ZM6 T;  4GYR A;  1E1H B;  2CCQ A;  3AAE B;  5HAX A;  3IEE A;  2Q9Q A;  4JI1 T;  5AQS B;  2WAU A;  3W15 B;  2V7J A;  4ZI2 C;  5H6Q B;  3NRY A;  3N9M A;  3E08 A;  3LBX A;  3G06 A;  4KHZ F;  2WMO A;  5HEH A;  1BR1 A;  4WNK A;  2XQ4 A;  4AQF A;  2ZM2 A;  2ACX A;  5L2L A;  3RHW A;  2UXC T;  4ZZB A;  4DV6 T;  2CA5 A;  4YTP A;  3M65 A;  4H63 V;  2NTY A;  2WS3 A;  5ABF A;  4DUY T;  3JAE A;  4A98 A;  2CMR A;  4NUU A;  3BQI A;  2BKP A;  3AAI A;  5FXZ A;  1KNR A;  4NXN T;  1WYC A;  4ILC A;  4JI5 T;  4IT4 A;  4TUY E;  4UV9 B;  3RYF E;  3PV0 F;  5HXC A;  2LSI A;  3ZT5 A;  4FJO A;  4ERR A;  2RA1 A;  4IL4 A;  5ETW A;  5HXR A;  5LGT B;  3AB3 B;  3OVU A;  1T98 A;  2XM1 A;  5FP3 A;  4V1A v;  3RQU A;  3KV5 A;  5AQL B;  4HFD A;  4PK6 A;  4TWF A;  3E22 E;  3PJA J;  3N2K E;  3H3A A;  5JDG A;  3ONJ A;  4MLK A;  2BG9 A;  4O8S A;  1W9R A;  1ZHC A;  3PTR B;  4EAH A;  5LHG B;  1WYB A;  4GYS A;  2XQA A;  4U7Y A;  5LA6 E;  3SWH A;  3ZPO A;  2KSR A;  4DR7 T;  4DR1 T;  4X62 T;  3H37 A;  1YKE B;  4X64 T;  3MKD A;  4O4I E;  5LHH B;  1YXR A;  4TNW A;  4I55 E;  4TZ4 C;  5KXJ A;  4PJN A;  3IA3 A;  5AQU B;  4AKG A;  2H89 A;  3T1H T;  4HEA A;  3PUW F;  3EUH A;  4HFI A;  1UCU A;  4M1P A;  3RKO A;  1NAF A;  2JQK A;  2W62 A;  3OYZ A;  3HL6 A;  4U31 A;  5LNK A;  4EZ4 A;  4LF6 T;  2NW8 A;  2BS2 A;  1UX4 A;  2WDR A;  5AQV B;  4UXN B;  2FJA A;  1NEK A;  3KDS E;  2CM0 A;  2FJD A;  3O1H A;  4ILB A;  4UF0 A;  4AXP A;  2KWH A;  2XAF B;  5F3J A;  4H9P C;  3PUA A;  3D0T A;  3DJB A;  1NEN A;  4EIW A;  4ZI3 C;  2L3L A;  2L8K A;  2XQ6 A;  3NZP A;  4IE5 A;  3RIF A;  2LKH A;  3AE9 A;  4ZS3 A;  5ABH A;  4K0K T;  4TX5 A;  3MA9 A;  1SHZ C;  3ZYL A;  1AJ3 A;  2NOX A;  3U78 A;  3F2E A;  2WWU A;  2IHR 1;  1G73 A;  4DV7 T;  2OLT A;  5CB4 E;  5JR9 B;  1LRZ A;  1E7P A;  4B3S T;  3N9L A;  5EK4 A;  2CXL A;  4JI2 T;  2M6B A;  2VQF T;  2VKJ A;  4LMJ A;  3GWH A;  2B1E A;  4WW0 A;  3C4Z A;  3V5U A;  5BR8 T;  5L3E B;  2VKH A;  1FJG T;  4HE8 A;  2V6Y A;  2VQE T;  4GKJ T;  4IDO A;  3PUX F;  2A72 A;  4HFH A;  2DI4 A; 
#chains in the Genus database with same CATH homology
 5HXH A;  4G2A A;  3ONX A;  4AKR B;  4ZI2 D;  4CI3 B;  3VKH A;  4XZC A;  1D1A A;  4AQG A;  2PG8 A;  2LSJ A;  2DWG A;  4KUM B;  1MMD A;  4JUY A;  4A56 A;  4U74 A;  1D1C A;  3ZMT B;  1IJ5 A;  4IST A;  2BDE A;  4PK5 A;  1BR0 A;  5FXW A;  1FIO A;  2K9A A;  3C64 A;  2PFV A;  4L5G A;  5HWY A;  3ZYM A;  3C51 A;  3FXD B;  2XAH B;  2V7M A;  3PUQ A;  2W00 A;  3U3I A;  1KNZ A;  5TAO A;  2ZLY A;  3K8P C;  1VRB A;  3N9Q A;  3DP7 A;  1YD8 G;  3I9Y A;  3MJX A;  2Q9Q B;  3AVS A;  3ANW A;  4H9S E;  4UVB B;  4IE4 A;  2D0U A;  3QUJ A;  2Y8D A;  3UUL A;  3C98 B;  5EZY E;  4WBO A;  4EOZ B;  2ES0 A;  2V7L A;  2JQQ A;  3UUN A;  5FYM A;  1KK7 A;  4QXC B;  2NW9 A;  2EHO B;  3AAA B;  4OFZ A;  4ISS A;  3KV4 A;  2YK0 A;  4L9I A;  2PBI A;  3I9W A;  3LBX B;  4O4H E;  1SA0 E;  4L0R A;  5CA0 E;  2CWY A;  3RH3 A;  5LP6 E;  3QC9 A;  2LOS A;  2KMF A;  3O1J A;  4CI2 B;  3C4X A;  1LVF A;  2LM9 A;  2BVM A;  3L3P A;  4KP3 C;  1MMA A;  2LJL A;  3PUR A;  5HYA A;  2X51 A;  2YEV C;  3ZMV B;  3I0O A;  3LG7 A;  2X9Y A;  4UEL A;  2Q9Q D;  2XAJ B;  3SS1 A;  5LGN B;  4PJM A;  1CUN A;  1S35 A;  1Y64 B;  2E9X C;  3ZYK A;  5JR9 A;  2YU2 A;  3LK4 2;  5A1L A;  4YLH A;  2H7O A;  1V9D A;  2ZMA A;  2DCF A;  2RP4 A;  2SPC A;  2EHO D;  5FMN A;  3ZEF B;  4ZI3 D;  2ZM0 A;  3RC3 A;  3F57 A;  3CX6 B;  2UXN B;  4B6X A;  4GOU A;  4YFS A;  2LHR A;  4PNI A;  4UEM A;  4ZS2 A;  2VK9 A;  1FMV A;  2WMN A;  1ZV4 X;  2WM9 A;  5JDN A;  2W63 A;  3ZN1 B;  2LSK A;  4X1Y E;  3WAK A;  3FBL A;  2C5K T;  5FXX A;  4AKI A;  2X0L B;  4JEU B;  4DBR A;  1U5P A;  4IIJ E;  3JC6 D;  3S4U A;  5L3C B;  1MIY A;  3PU3 A;  3TKL B;  4XBF B;  4I50 E;  3N2G E;  2XAG B;  1MMN A;  4QWN B;  4UIG A;  3MXZ A;  3GN5 B;  2A2F X;  4DND A;  4JEH B;  2KND A;  4H63 H;  2KXP B;  1BR2 A;  3ZMU B;  2V7I A;  2DHR A;  2VKD A;  3Q5W A;  3MZK B;  4QXH B;  3RC8 A;  5L3F B;  2V26 A;  1FEW A;  4UVC B;  1HX8 A;  3VHL A;  4MFR A;  1B7T A;  5IHY A;  2J1D G;  4AKL A;  1X79 A;  2XAQ B;  2IAK A;  3DTO A;  3WI3 A;  3P7I A;  4ILU A;  4FI5 A;  4GYR A;  2KWI B;  5GON E;  3EDU A;  4TN7 B;  1E1H B;  2CCQ A;  2IC9 A;  5E0O A;  3RRW A;  5LJM A;  2C5I T;  3AAE B;  4I43 B;  4KMC A;  2VWA A;  2I59 A;  5HAX A;  1ZEE A;  3IEE A;  4AKH A;  2W0G A;  4F6R C;  4CQI A;  2HH7 A;  5ADX L;  4DO0 A;  2CXD A;  3EDV A;  2JRK A;  2Q9Q A;  4IE6 A;  4IE7 A;  1HF8 A;  2C5J A;  2V1D B;  3P8C D;  4J2C A;  4EZH A;  2WAU A;  3O9X A;  3W15 B;  5LJN A;  2LE8 A;  2V7J A;  5EK2 A;  2XUE A;  4ZI2 C;  5H6Q B;  2JMH A;  3NRY A;  5KX5 E;  4QX8 B;  2EHO A;  3N9M A;  4ADZ A;  3E08 A;  3CML A;  3LBX A;  4QXB B;  2CLY C;  3OKQ A;  4E7Z A;  5KMG P;  2WMO A;  4X1K E;  1BR1 A;  3KVB A;  4WNK A;  2LSY A;  4AQF A;  5J2U E;  2ZM2 A;  2CXF A;  4IDZ A;  4BA9 A;  3Q2M A;  2ACX A;  2MTQ A;  5L2L A;  3VKG A;  4QHO A;  3Q9D A;  3SOL A;  3R84 B;  2M67 A;  2CA5 A;  2JJ9 A;  5HXS A;  3NRX A;  4IGU A;  3LK3 B;  3M65 A;  5BMV E;  3BK9 A;  3ZCJ A;  3UTK A;  5HWX A;  4H63 V;  2NTY A;  1D1B A;  2LSG A;  4MAL A;  2IW5 B;  3A5X A;  2P9B A;  5LHI B;  2E9X B;  3ETU A;  5LBQ B;  4HN9 A;  3ZJ2 A;  4H9O C;  2HPL A;  4O2B E;  2CMR A;  4NUU A;  2Z6E A;  3BQI A;  3FHN A;  4YHJ A;  2YU1 A;  3AAI A;  5FXZ A;  3KIN B;  4E7S A;  2X9H A;  3AA0 B;  4GIW A;  2JPF A;  4PFP A;  4PK4 A;  2K48 A;  4MBQ A;  3PE0 A;  1WYC A;  3CVR A;  4OYK A;  1O3X A;  1WRD A;  3GN5 A;  1BR4 A;  2XHE B;  3J7Y q;  3KV9 A;  3ZCI A;  3UUX B;  5EK3 A;  2X9X A;  3I0Q A;  4TUY E;  4UV9 B;  4PAG A;  1IJ6 A;  2BVL A;  3ZJ1 A;  5JRC B;  3RYF E;  1HCI A;  4QKN A;  2BZB A;  5HXC A;  3KBT A;  3RYC E;  1MIV A;  2E9X D;  2LSI A;  2D2S A;  3GA8 A;  4O4L E;  3FXE B;  3UT5 E;  4U72 A;  3IF8 B;  3EVY A;  4HKA A;  4FJO A;  3CQC B;  3IBP A;  4ERR A;  1G8X A;  2RA1 A;  2N1G A;  5LXT E;  3BQK A;  5ETW A;  5HXR A;  1OWA A;  1YKH B;  3RYI E;  5LGT B;  1D0X A;  3AB3 B;  4DVD A;  5M4Y A;  4K0U A;  4UF0 B;  1T98 A;  2ODV A;  2XAS B;  3JC6 C;  4HTE A;  4JLE A;  5FP3 A;  3AA7 B;  2NWB A;  1HG2 A;  4V1A v;  4NUV A;  1HTJ F;  1D0Z A;  4CXW A;  3CQX C;  2D0T A;  2C0S A;  3KV5 A;  2LEH A;  4PK6 A;  4ZOL E;  4H9R C;  3FBZ A;  3E22 E;  2XTL A;  3IHR A;  5JVD E;  2XQY A;  2NP9 A;  4HFV A;  3RYH E;  2VL8 A;  3N9P A;  3N2K E;  1LKX A;  2QA7 A;  2IC6 A;  3HI2 A;  2ZM8 A;  3R6N A;  5JH7 E;  3PUS A;  3VU7 H;  3LK2 B;  3H3A A;  3OBV E;  4EXT A;  3ZMZ B;  5JDG A;  4MLK A;  4O8S A;  3PU8 A;  3N5L A;  1ZHC A;  3PTR B;  4EAH A;  5LHG B;  4UVA B;  1WYB A;  4GYS A;  5J1G A;  1YW0 A;  3C50 A;  5LA6 E;  3N2O A;  3SWH A;  2KLQ A;  3ZN0 B;  2N2N A;  3ZC0 A;  1MND A;  3ZPO A;  1HFA A;  5JR9 C;  2CLY B;  5LCY A;  4P0A A;  4H9Q C;  4MHC A;  3RX6 A;  2X66 A;  5DQW A;  2VKO A;  2Y6X A;  2PJQ A;  3H37 A;  2QGS A;  1YKE B;  2H7V C;  4ASK A;  4BJN A;  3MK7 C;  5JDH A;  5DQV A;  3E0Z A;  2N9D A;  3MKD A;  4O4I E;  3HKC E;  2MBG A;  5LHH B;  2Y48 B;  2HPJ A;  4I55 E;  4IE0 A;  1MMG A;  2G0U A;  4BJM A;  1OXZ A;  3N9N A;  1HG5 A;  3NZQ A;  3HKD E;  4TZ4 C;  4CZZ B;  5LBM A;  2A3D A;  4PJN A;  2E9X A;  5FY0 A;  3FB2 A;  1Z0P A;  4AKG A;  4GK5 E;  3NBX X;  4HEA A;  2X67 A;  5LOV E;  4Z8X A;  2X9W A;  5JDF A;  3UUM A;  3EUH A;  4GK0 E;  3PDY A;  4PJL A;  4YJ3 E;  1UCU A;  4M1P A;  3ESL A;  1QUU A;  1WR6 A;  3RKO A;  4ANJ A;  2KZ7 B;  3OJA A;  2LHN A;  1NAF A;  3HR0 A;  2CEA A;  1MNE A;  2LOP A;  2JMK A;  2W62 A;  4X20 E;  3UFE A;  1WLX A;  3OYZ A;  4OHF A;  3HL6 A;  4UV8 B;  4DMV A;  5LNK A;  4EYY R;  4EZ4 A;  3CX8 B;  3N9O A;  1QSD A;  4CXX A;  5L3B B;  2VB6 A;  2VAS A;  5IYZ E;  2CWO A;  2L9Q A;  4P09 A;  3CWZ B;  3B13 A;  5JRC A;  3ZC1 A;  2NW8 A;  1UX4 A;  2DNX A;  1IAP A;  4CXY A;  2K5B B;  3CX7 B;  1LVK A;  4X1I E;  3HKE E;  3HKB E;  4O2A E;  4DMW A;  5AFU L;  1US7 B;  4UXN B;  3KDS E;  4BAY B;  5FY1 A;  2CM0 A;  3CQG B;  3I1A A;  3K3O A;  5FNV E;  3AVR A;  3O1H A;  5LYJ E;  5KDM C;  3PUG A;  4OK0 A;  4IHJ E;  4UF0 A;  4AXP A;  5J2T E;  2Q9Q C;  3CKD A;  3RRC A;  4HGA A;  4C91 A;  2KWH A;  4YJ2 E;  5JRE A;  1H7C A;  2XAF B;  5F3J A;  4H9P C;  5H6R B;  3PUA A;  3D0T A;  3DJB A;  3AA1 B;  1EZ3 A;  2X68 A;  1NWM X;  4EIW A;  4H9N C;  5F8P A;  2EHO C;  4ZI3 C;  2L3L A;  2L8K A;  2V7K A;  4OYJ A;  3ZMS B;  3ANW B;  5JDM A;  3CPZ A;  3NZP A;  5FY7 A;  5JQG E;  3HA4 A;  3J9X 1;  4P0B A;  3ZLI A;  4IE5 A;  1IZN B;  4AQF C;  5FXV A;  5L3D B;  4TV9 E;  3AA6 B;  3BQL A;  2ODU A;  4ZS3 A;  2MOZ A;  5L3G B;  3QK6 A;  3KBU A;  3MAC A;  4TX5 A;  4ZHQ E;  3LFM A;  1HS7 A;  2E8I A;  3MA9 A;  2K24 A;  4G63 A;  3OYX A;  4PW8 A;  1SHZ C;  2GK9 A;  3C4W A;  5LG4 A;  3ZYL A;  2KT9 A;  1AJ3 A;  3KFW X;  1FMW A;  2NOX A;  3Q5X A;  5DJQ C;  3U78 A;  1S94 A;  1U4Q A;  1ZKE A;  4O4J E;  4QX7 B;  3F2E A;  2WWU A;  2MYS A;  2OA5 A;  5HXE A;  4PFO A;  1MIW A;  3O1I A;  1G73 A;  2DWK A;  2D5U A;  4XAX B;  5CA1 E;  3O4X E;  5CB4 E;  5JDQ A;  4I4T E;  5JR9 B;  1LRZ A;  4WBN E;  4PJJ A;  2DLR A;  3K3Q C;  3RPU A;  2W61 A;  3N9L A;  5EK4 A;  2CXL A;  2YIN A;  4EB6 E;  5JDL A;  4TV8 E;  4ZI7 E;  3T8O A;  3GMI A;  4EYU A;  2CE7 A;  3WAJ A;  4C90 A;  5C8Y E;  2WSS V;  3L09 A;  2VKJ A;  3V5S A;  1UX5 A;  3GWH A;  2UXX B;  4KBM B;  4N78 D;  2B1E A;  4WW0 A;  2WBL A;  3C4Z A;  3KV6 A;  2KIN B;  3V5U A;  2NTX A;  1VOM A;  3F31 A;  3K3N A;  2LT3 A;  2H3R A;  5L3E B;  2VKH A;  3ETV A;  5LGU B;  4HE8 A;  3KVA A;  1D0Y A;  3B57 A;  4DBQ A;  3LJC A;  2A72 A;  2NW7 A;  3SRZ A;  5DAB A;  2DI4 A;  4CI1 B;  4AI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...