4NIQA

Crystal structure of vps4 mit-vfa1 mim2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
82
structure length
82
Chain Sequence
MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein 4
publication title Vfa1 Binds to the N-terminal Microtubule-interacting and Trafficking (MIT) Domain of Vps4 and Stimulates Its ATPase Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 38
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4niqA00
1WFDA 3ZSTA 2CRBA 2CPTA 2LRLA 2W2UA 4NIQA 2A9UA 5FVKA 2RPAA 3ZT5A 5CGMA 4ZEYA 4U3CA 2JQKA 4IT4A 2K3WA 4CN4A 4U7IA 4U7YA 2V6YA 5LB7B 4A5XA 2LRKA 2V6YB 2DL1A 4U2YA 4U31A 2WY2A 3EABA 2WWVA 2JQ9A 2MPKA 1YXRA 2V6XA 2JQHA 2XZEA 3K1SA 4U2ZA 4WZXA 3ZT6A 5CJ5A 4P1NA 3ZT7A 4CN1A 1WR0A 1WCRA 3ZSSA 4U33A 5FVLA 4CN6A
chains in the Genus database with same CATH superfamily
3I9WA 4LMKA 2KWHA 4GKJT 2X9HA 4YTPA 4C91A 2K9AA 4KI0F 4XZCA 2X9YA 4F8HA 3UU3A 3BQIA 5JQGE 3CX6B 4P1NA 3CVRA 3HKDE 1HG2A 1S94A 3MA9A 2ES0A 4ZS2A 3ZT5A 4Z8XA 5DJQC 4HE8A 3ZMUB 3ETVA 4TWHA 3ZCIA 4LF7T 3BQLA 2XJ7A 5AQTB 4JI0T 2NTYA 2WS3A 4CI1B 4O4JE 4UIGA 4BJNA 4JI6T 5LHHB 2J47A 5IYZE 1M7KA 3FZKB 3IHRA 4HWIB 4HFBA 1JNZA 2FJBA 3AE1A 3IEEA 3ZPOA 1ZOYA 2LKGA 2XPKA 3IA3A 3CKDA 2Y8DA 3UUNA 3JAEA 4M1PA 5EZYE 4IE0A 3ANWA 2I0MA 1N33T 4LFBT 4LF5T 3ZYLA 4JV5T 3U3IA 3E22E 2V6YB 2IC9A 2Y48B 2JQHA 2YDSA 4MALA 3P4WA 4LF6T 3E0ZA 2NR4A 2VVSA 2WZIA 3V5UA 4ZI3C 4UELA 5JDLA 5HXEA 4IT4A 2AXDS 5LB7B 4IDNA 4AKGA 5AQHB 3E08A 5DQVA 2CHNA 2LM9A 3TLSA 2C5IT 1YQ3A 1US7B 2YEVC 3HKEE 3O9XA 4UV8B 2IUBA 2DI4A 4I4TE 3UFEA 5LGNB 4TZ4C 4KP3C 1XNRT 2UXNB 1M62A 4AQGA 1KNRA 5AQVB 3AB3B 3Q2MA 1D0ZA 4YTNA 2YDRA 1WR0A 4U33A 3ESLA 3I0OA 5H6QB 2XTLA 3HKCE 4H63H 3ANWB 4DV4T 4CN4A 3K3OA 2PFVA 1J1JA 4J2CA 3OJAA 4IDZA 3P4SA 1T98A 3ZMSB 4AKIA 1J5ET 4YHHT 3KBTA 3LSVA 2K3WA 3T1HT 2NTXA 3W15B 2C0SA 4IE6A 2V7LA 3NRYA 4PK6A 2VKJA 2GK9A 2LHNA 2D0TA 4JI8T 3ZSSA 4ILBA 2OLTA 4CXYA 1N32T 3ZMTB 2JMHA 1X9BA 4PW8A 2NWBA 3O1HA 2WWVA 2XQ9A 3PU3A 2UUAT 4ILCA 4JI1T 2WDRA 3P4RA 4CI2B 4WYVA 5FL1A 1IBMT 2XQ6A 1HX1B 2LSKA 2ZLYA 2JIWA 2B1EA 2QA7A 4G63A 3FZMB 4P0BA 3LFMA 2EHOD 2CBIA 2C5JA 2WU2A 4A98A 5HXRA 4DR5T 2IW5B 4LMJA 3PUSA 3BK9A 2QYWA 1E1HB 1LVKA 3N2OA 2JQ9A 3U78A 5DABA 2H7OA 3SFEA 4DR1T 4HFCA 4JEHB 5CB4E 1HX8A 3UQ4A 3RLFF 2SPCA 2A9UA 5LGTB 2W00A 3V5SA 3MK7C 3P4QA 3UUXB 5L2LA 3RH3A 4EGWA 5HCMA 4ZHQE 3GA8A 3TLUA 3N9NA 5FNVE 4PNIA 3ZN1B 5CA0E 4YXDA 2BKNA 2HPLA 4TNWA 3M3ZB 4EXTA 4ASKA 4EB6E 4TV8E 3SFDA 4BJMA 4DV5T 3CQXC 4O4HE 4NXMT 3O4XE 2K5BB 4DR6T 3PUGA 3EAMA 3F57A 2XQ3A 4QXHB 2X67A 3KDSE 3QK6A 4CQIA 3AE8A 3OVUA 1XNQT 4UVBB 3PDYA 3B5MA 2FUPA 4GKKT 5AFUL 2N2NA 4HWFA 4KHPT 2NOXA 2WDQA 3QB5K 3ZKRA 3A7MA 4ZEYA 2VURA 3B57A 2BS4A 1HG5A 1FJGT 1ZEEA 2UXBT 1EZ3A 3N9PA 4YSXA 2ZM2A 5LG3A 3QUJA 3Q5XA 5LHGB 3PURA 2N9DA 4PJMA 5JDHA 4IDOA 1SHZC 4EYUA 3JC6D 1I94T 3AECA 2WAUA 4LMLA 4DV2T 1G73A 2X68A 2UU9T 5ABFA 3PJAJ 2PJQA 5CJ5A 5AQPB 4JEUB 4EZHA 3UFGA 2V7KA 3PUWF 2V8SV 2PG8A 5LBMA 1HF8A 4EIWA 3EI0A 4MLKA 4FJOA 3LBXA 1HCIA 3HI2A 3EDUA 4NPPA 1UCUA 5HYAA 4AKHA 2V5DA 3H37A 1VOMA 4PK5A 4DMVA 1XZYA 4FI5A 3VR9A 2VK9A 1QLBA 3VU7H 3L3PA 2CM0A 2KINB 2XQAA 2XAGB 2LLYA 4TNVA 1NAFA 3FBLA 1YW0A 2NW9A 2UXCT 4OYKA 2VWAA 5AQIB 4PJNA 3I9YA 5FVLA 5HXSA 3CIRA 4B3RT 2XSBA 4U7YA 5ABHA 2KZ7B 3ZYKA 3WAJA 1J5WA 2V6XA 4K0UA 5ABFB 3PUXF 2X0HA 5L3CB 4MFRA 3S4UA 3CK6A 5FY0A 3RYIE 4H9SE 4BA9A 2ODVA 4ZOLE 1YKHB 2L8KA 4QX8B 3LBXB 3KV5A 3CQCB 1IAPA 3ZT7A 1FIOA 4O2BE 5E0OA 4PFOA 2V7MA 2Q9QC 1T72A 1IZNB 2MOZA 1QSDA 3JCFA 4HFIA 3T8OA 1KF6A 2WY2A 4HWDA 4X20E 5FXWA 5IWAT 2XM1A 3HR0A 4WZXA 2Q9QA 3AA1B 5LCYA 4QH4A 3TLWA 4ZZBA 4LF9T 2E5VA 1UURA 2D9DA 1WLXA 3WAKA 4DV1T 4U2ZA 2VL0A 2WU5A 3AVRA 1MIWA 3N9MA 3IBPA 2QVAA 1KEYA 4O4IE 4DR4T 4AKLA 5L4EA 4OHFA 3KV6A 5ABGA 3AA7B 1S35A 3UU8A 5EK4A 5JDMA 2KWIB 1H7CA 2WZHA 3ZN0B 3TLTA 4AISA 5LMNT 1IJ6A 3CPZA 2V5CA 5F5WA 2LJLA 5HEHA 1IBLT 4E7SA 4CN1A 3VR8A 2Q9QB 2BBJA 3FXEB 4DR3T 1X79A 5L4HA 3PV0F 5AQNB 2CXDA 3CX8B 3C51A 2BBHA 3AE2A 2HN1A 3SRZA 3A8YC 1YXRA 3N2GE 1B7TA 4O2AE 2BZBA 3C98B 5LA6E 4AIUA 4X64T 3I1AA 4JYAT 3ZMVB 4JUYA 4BAYB 5JR9A 4IDQA 1WYBA 1R8IA 3RC8A 4L0RA 5FYMA 4IL4A 5H6RB 4QXCB 1LRZA 1FMWA 2CCQA 4HTEA 2JQQA 3K8PC 2W61A 2CRBA 2YN6A 2CXLA 5ABEA 5HAXA 4QH1A 2K24A 2ODUA 2ACXA 4U2YA 4ILUA 4ERRA 3Q5EA 3RRWA 4DMWA 3R84B 3C4XA 3MJXA 5FY1A 3RKGA 5L3FB 4LFCT 4X1IE 4UVCB 2LRLA 4MBQA 2A2FX 3AE4A 3QOFA 3RHWA 4B3TT 4EV6A 1WR6A 4WW0A 3VRBA 4UVAB 3RYHE 5AQKB 4ISSA 4TX5A 3MACA 3Q5WA 2XQ7A 3NRXA 3UU4A 4DR2T 2XQ5A 2WMOA 2E2AA 2PTFA 4JI5T 1U5PA 5BMVE 1ZV4X 1QUUA 2RP4A 3KVAA 4PK4A 2UXXB 2H89A 3LDQB 3TKLB 5LYJE 2ZMAA 4JI2T 4IL9A 4EZ4A 4QH5A 4NUVA 3DP7A 4TV9E 3D0TA 2XY8B 4HGAA 1CHUA 3ZLIA 4DO0A 3RRCA 4YY3T 4WNKA 1OEDE 3M65A 5DQWA 3OYXA 1XDPA 4P09A 3RIAA 3PUQA 3FB2A 4XAXB 4ILAA 4N78D 3KVBA 5IHYA 2X9WA 2CPTA 3RX6A 2W0GA 3AEEA 2JPFA 4EEBA 5LJMA 4DV0T 3FHNA 4YT0A 4DV7T 5JVDE 4HEAA 3PUZF 5C2TA 3F31A 1IBKT 3AXJA 3TLVA 1MIYA 5HEJA 4UV9B 1YQ4A 4IIJE 5AQLB 3RQWA 5FVKA 2QRXA 2CHOA 2BS3A 4HFHA 4DIDB 2EHOC 4X1YE 5FXVA 2XQ4A 2WMNA 4EAHA 2VQFT 4HKAA 2L9QA 1UGOA 2X0YA 3CWZB 3RQUA 3RKOA 3L39A 2DCFA 1E2AA 2BDEA 3AEFA 4YTMA 2JQKA 4K0KT 4AQFC 2EHOA 4F6RC 3UT5E 4HFDA 1NEKA 3SOLA 2CXFA 3ZSTA 4AQFA 3RIUC 2YDQA 3R6NA 2BVLA 4A5XA 3LG7A 3WI3A 2FJDA 4B6XA 1O3XA 3L09A 5HWXA 3AXJB 3RIUA 3N9LA 3AE6A 3N2KE 5FXXA 4GK0E 4NXNT 5KX5E 2PBIA 3OTOT 4CXWA 2DNXA 1SUMB 3QNUA 2ZM0A 2XQYA 2JMKA 2EHOB 4O8SA 3O1IA 2E9XD 5JDGA 4AQYT 4HWCA 5LXTE 5HCJA 4GK5E 4HFVA 5AQJB 4LF4T 4TUYE 3P50A 2KLQA 2VVNA 1XMQT 2YU2A 3ONXA 3FZLB 4UEMA 2X0LB 2UUBT 1MMAA 3JC6C 3NKZA 4ZXLA 4JLEA 2CWYA 1WRDA 4GYSA 3P4PA 1CUNA 1HNXT 4IGUA 3NVOA 2KNDA 2LSIA 1U4QA 3UTKA 3C50A 4KHZF 5C3JA 3ZC0A 1N34T 3HL6A 4ZI2D 2BVMA 3AAEB 2M6IA 3RYFE 1G8XA 1XDOA 2D2SA 2RA1A 3G06A 3IF8B 4YSZA 1MNEA 1BR0A 1WCRA 4UXNB 4QXBB 4E7ZA 2G0UA 3AEGA 1AJ3A 4COFA 4XBFB 3J9X1 3PE0A 2MYSA 3ONJA 1D0YA 1OEDC 5JTGA 2LKHA 1GQEA 5FP3A 5EK3A 2HPJA 1HTJF 3AEAA 3VKHA 3ABVA 3N9QA 1MMDA 2Z6EA 5AQOB 1OEDA 5ADXL 1HR0T 2DWGA 1XWMA 3GN5A 1OWAA 1L0VA 2VASA 5FY7A 3DTOA 5IUXA 4CN6A 4AI6A 2F4VT 5LP6E 5F3JA 1HS7A 1NENA 3N5LA 2IMLA 4HFEA 5GONE 3MXZA 2E5LT 2N1GA 3SWHA 1KK7A 3RF1A 2W66A 2WM9A 3AE3A 5LOVE 2OA5A 4YHJA 4KMCA 5KXJA 3C4ZA 2IC6A 5JDFA 4ISTA 1UX5A 2IDOB 2YU1A 2IHR1 5FMNA 5JDQA 2NW8A 4GOUA 3K3NA 2NW7A 3LK2B 1DU2A 4CZZB 2XAHB 4NIQA 4IE4A 3QB5A 3RC3A 4TN7B 3C4WA 4ZS3A 2V6YA 1W0BA 2A72A 5LJNA 3GMIA 2YKSA 1OEDB 3ZEFB 3LK3B 3GN5B 4QX7B 3P8CD 4YJ3E 2X51A 4IREA 3PUVF 1MIVA 3AE5A 1HNZT 3J7Yq 1W0AA 3NWIA 3ONLC 4HN9A 3LK42 5CGMA 4NUUA 2VKHA 3C64A 2V26A 2WQYA 5JRCA 2UXDT 4DR7T 4I50E 5JH7E 2H3RA 2KSRA 4U31A 3UQ7A 4LF8T 4JI4T 3NBXX 5C8YE 3HKBE 4GYRA 1VCTA 1SA0E 2XHEB 1N36T 4DNDA 5JR9C 2K48A 4DVDA 5AQGB 4OFZA 4JI7T 2J62A 4L9IA 4CI3B 5KDMC 5LMUT 2LE8A 2M67A 3ETUA 3UU5A 2XUEA 3F2EA 4GIWA 3EHZA 2I6HA 2XAFB 4ZI3D 3ZJ2A 2YINA 2FJEA 4KX6A 4AXPA 4KBMB 5HXHA 2MPKA 3KFWX 4ZZCA 4H9QC 3H3AA 5CFBA 5AQSB 2W63A 2BG9E 4OYJA 4EOZB 2E8IA 3AAIA 3PU8A 4PFPA 5JRCB 2LSYA 4LFAT 3CX7B 4JBWF 3Q9DA 3SS1A 2ZM6T 1IJ5A 3VRAA 2YK0A 3O1JA 2J4GA 5CA1E 4TWFA 3ZC1A 1YKEB 3FBZA 3FZFB 3NZPA 2LOPA 3KINB 2WSSV 2XZEA 2NP9A 2ZM8A 4I43B 4WBOA 5L3GB 3L8RA 1VCSA 2ACZA 2XSAA 5EK2A 5J2UE 5JR9B 1D1AA 5LHIB 4H9OC 4X65T 3AEBA 3AAAB 5FXZA 5LG4A 3UU6A 4OX9T 1WFDA 3RYCE 5HEOA 2BKOA 3FXDB 3Q5DA 4ZI7E 4A56A 3BQKA 2YOEA 5M4YA 3OKQA 2J1DG 2MBGA 4ANJA 2CMRA 2WBLA 4X66T 2FBWA 1BR4A 4U7IA 3EDVA 1JNRA 2LRKA 1V9DA 5KMGP 3UUMA 5HXCA 5L3DB 1LVFA 4ADZA 3K1SA 2X9XA 1T8BA 4PAGA 3AE9A 3AEDA 5FKYA 2LEHA 4IE5A 3KV9A 3JAFA 2R6GF 3ZYMA 4U3CA 1BR2A 3VHLA 3VKGA 4PJLA 5AQFB 3ZMZB 1W9RA 5TAOA 3CMLA 5BR8T 4B3ST 1XMOT 2LOSA 3OBVE 2IIUA 4X5TA 2CLYC 3DJBA 5L47A 1WYCA 2RPAA 2VB6A 3KV4A 5AQQB 2WB5A 2DL1A 2VQET 5L3EB 5A1LA 2L3LA 2V1DB 3PJAA 4X1KE 1UUSA 1T7SA 5HEUA 2MTQA 4C90A 2D5UA 2XM2A 1Y64B 2IAKA 2CEAA 1D1CA 2BS2A 1KFYA 2CWOA 2MAWA 4B3MT 3KBUA 2BKPA 1VRBA 3RPUA 3JADA 4JI3T 3RIFA 4DUYT 4QWNB 1Z0PA 4YJ2E 3PTRB 2C5KT 4G2AA 4UR9A 2W4XA 5AQMB 3NZQA 4X62T 2VKOA 4YFSA 1LKXA 5ETWA 4IDPA 2HH7A 2DHRA 3RI5A 2XASB 4Z90A 2LSGA 4DV6T 4TWDA 2QGSA 3B13A 3PUYF 2I59A 4EEDA 3AE7A 1OXZA 2HHHT 1MNDA 2KT9A 3ZT6A 4UF0A 2BG9C 2XAJB 5F8PA 2CLYB 4H9PC 1E7PA 2VL8A 2E9XC 1HFAA 4CXXA 4I0UA 3PUAA 2M6BA 1MMNA 3GWHA 4YSYA 2BG9A 4KUMB 2VKDA 3ZJ1A 3RGLA 5J1GA 2E9XA 1KNZA 2XAQB 4U72A 4A97A 5L3BB 4DV3T 2UUCT 2DLRA 1YD8G 4QKNA 2LSJA 4YLHA 2X66A 3HA4A 3I0QA 4I55E 2LT3A 2KMFA 2FJAA 2W67A 3OYZA 5J0ZA 2W2UA 3MKDA 3X1DA 1W09A 2V7JA 2OV9A 4PJJA 5FL0A 1NWMX 3N9OA 2CE7A 2KXPB 2LHRA 1ZP0A 2WDVA 1ZKEA 2JJ9A 4Z91A 4UF0B 2HN2A 4ZI2C 4QHOA 4IHJE 4P0AA 3P7IA 4H9RC 4HWHA 3AA0B 2H7VC 2B76A 4MHCA 3EABA 1KNPA 3EVYA 4H9NC 4OK0A 2H88A 2BG9B 2A3DA 3A5XA 2P9BA 5HWYA 3ZCJA 2LM2A 2V7IA 3FZHB 2DWKA 1Y01A 2E9XB 4U74A 3LJCA 2JRKA 2WWUA 1BR1A 2Y6XA 5JREA 4AKRB 2WP9A 4DUZT 2CBJA 2AE9A 2W62A 3MZKB 5LGUB 3H3MA 3EUHA 3UUBA 3UULA 5J2TE 1UX4A 1ZHCA 3CQGB 4Q25A 4DBRA 1D0XA 2Q9QD 3AA6B 4DBQA 2CA5A 3T1YT 1MMGA 1FMVA 2D0UA 4EYYR 5AQUB 4L5GA 1HNWT 4O4LE 4IE7A 5LNKA 5HEGA 1I6ZA 4H63V 1Z8UA 5AQRB 4V1Av 4WBNE 2WCAA 1SE7A 3QC9A 3OPCA 5LBQB 3AVSA 3K3QC 1D1BA 5JDNA 1UK5A 1FEWA 2XQ8A
chains in the Genus database with same CATH topology
1WFDA 3ZSTA 2CRBA 2CPTA 2LRLA 2W2UA 4NIQA 2A9UA 5FVKA 2RPAA 3ZT5A 5CGMA 4ZEYA 4U3CA 2JQKA 4IT4A 2K3WA 4CN4A 4U7IA 4U7YA 2V6YA 5LB7B 4A5XA 2LRKA 2V6YB 2DL1A 4U2YA 4U31A 2WY2A 3EABA 2WWVA 2JQ9A 2MPKA 1YXRA 2V6XA 2JQHA 2XZEA 3K1SA 4U2ZA 4WZXA 3ZT6A 5CJ5A 4P1NA 3ZT7A 4CN1A 1WR0A 1WCRA 3ZSSA 4U33A 5FVLA 4CN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFD A;  3ZST A;  2CRB A;  2CPT A;  2LRL A;  2W2U A;  4NIQ A;  2A9U A;  5FVK A;  2RPA A;  3ZT5 A;  5CGM A;  4ZEY A;  4U3C A;  2JQK A;  4IT4 A;  2K3W A;  4CN4 A;  4U7I A;  4U7Y A;  2V6Y A;  5LB7 B;  4A5X A;  2LRK A;  2V6Y B;  2DL1 A;  4U2Y A;  4U31 A;  2WY2 A;  3EAB A;  2WWV A;  2JQ9 A;  2MPK A;  1YXR A;  2V6X A;  2JQH A;  2XZE A;  3K1S A;  4U2Z A;  4WZX A;  3ZT6 A;  5CJ5 A;  4P1N A;  3ZT7 A;  4CN1 A;  1WR0 A;  1WCR A;  3ZSS A;  4U33 A;  5FVL A;  4CN6 A; 
#chains in the Genus database with same CATH topology
 3I9W A;  4LMK A;  2KWH A;  4GKJ T;  2X9H A;  4YTP A;  4C91 A;  2K9A A;  4KI0 F;  4XZC A;  2X9Y A;  4F8H A;  3UU3 A;  3BQI A;  5JQG E;  3CX6 B;  4P1N A;  3CVR A;  3HKD E;  1HG2 A;  1S94 A;  3MA9 A;  2ES0 A;  4ZS2 A;  3ZT5 A;  4Z8X A;  5DJQ C;  4HE8 A;  3ZMU B;  3ETV A;  4TWH A;  3ZCI A;  4LF7 T;  3BQL A;  2XJ7 A;  5AQT B;  4JI0 T;  2NTY A;  2WS3 A;  4CI1 B;  4O4J E;  4UIG A;  4BJN A;  4JI6 T;  5LHH B;  2J47 A;  5IYZ E;  1M7K A;  3FZK B;  3IHR A;  4HWI B;  4HFB A;  1JNZ A;  2FJB A;  3AE1 A;  3IEE A;  3ZPO A;  1ZOY A;  2LKG A;  2XPK A;  3IA3 A;  3CKD A;  2Y8D A;  3UUN A;  3JAE A;  4M1P A;  5EZY E;  4IE0 A;  3ANW A;  2I0M A;  1N33 T;  4LFB T;  4LF5 T;  3ZYL A;  4JV5 T;  3U3I A;  3E22 E;  2V6Y B;  2IC9 A;  2Y48 B;  2JQH A;  2YDS A;  4MAL A;  3P4W A;  4LF6 T;  3E0Z A;  2NR4 A;  2VVS A;  2WZI A;  3V5U A;  4ZI3 C;  4UEL A;  5JDL A;  5HXE A;  4IT4 A;  2AXD S;  5LB7 B;  4IDN A;  4AKG A;  5AQH B;  3E08 A;  5DQV A;  2CHN A;  2LM9 A;  3TLS A;  2C5I T;  1YQ3 A;  1US7 B;  2YEV C;  3HKE E;  3O9X A;  4UV8 B;  2IUB A;  2DI4 A;  4I4T E;  3UFE A;  5LGN B;  4TZ4 C;  4KP3 C;  1XNR T;  2UXN B;  1M62 A;  4AQG A;  1KNR A;  5AQV B;  3AB3 B;  3Q2M A;  1D0Z A;  4YTN A;  2YDR A;  1WR0 A;  4U33 A;  3ESL A;  3I0O A;  5H6Q B;  2XTL A;  3HKC E;  4H63 H;  3ANW B;  4DV4 T;  4CN4 A;  3K3O A;  2PFV A;  1J1J A;  4J2C A;  3OJA A;  4IDZ A;  3P4S A;  1T98 A;  3ZMS B;  4AKI A;  1J5E T;  4YHH T;  3KBT A;  3LSV A;  2K3W A;  3T1H T;  2NTX A;  3W15 B;  2C0S A;  4IE6 A;  2V7L A;  3NRY A;  4PK6 A;  2VKJ A;  2GK9 A;  2LHN A;  2D0T A;  4JI8 T;  3ZSS A;  4ILB A;  2OLT A;  4CXY A;  1N32 T;  3ZMT B;  2JMH A;  1X9B A;  4PW8 A;  2NWB A;  3O1H A;  2WWV A;  2XQ9 A;  3PU3 A;  2UUA T;  4ILC A;  4JI1 T;  2WDR A;  3P4R A;  4CI2 B;  4WYV A;  5FL1 A;  1IBM T;  2XQ6 A;  1HX1 B;  2LSK A;  2ZLY A;  2JIW A;  2B1E A;  2QA7 A;  4G63 A;  3FZM B;  4P0B A;  3LFM A;  2EHO D;  2CBI A;  2C5J A;  2WU2 A;  4A98 A;  5HXR A;  4DR5 T;  2IW5 B;  4LMJ A;  3PUS A;  3BK9 A;  2QYW A;  1E1H B;  1LVK A;  3N2O A;  2JQ9 A;  3U78 A;  5DAB A;  2H7O A;  3SFE A;  4DR1 T;  4HFC A;  4JEH B;  5CB4 E;  1HX8 A;  3UQ4 A;  3RLF F;  2SPC A;  2A9U A;  5LGT B;  2W00 A;  3V5S A;  3MK7 C;  3P4Q A;  3UUX B;  5L2L A;  3RH3 A;  4EGW A;  5HCM A;  4ZHQ E;  3GA8 A;  3TLU A;  3N9N A;  5FNV E;  4PNI A;  3ZN1 B;  5CA0 E;  4YXD A;  2BKN A;  2HPL A;  4TNW A;  3M3Z B;  4EXT A;  4ASK A;  4EB6 E;  4TV8 E;  3SFD A;  4BJM A;  4DV5 T;  3CQX C;  4O4H E;  4NXM T;  3O4X E;  2K5B B;  4DR6 T;  3PUG A;  3EAM A;  3F57 A;  2XQ3 A;  4QXH B;  2X67 A;  3KDS E;  3QK6 A;  4CQI A;  3AE8 A;  3OVU A;  1XNQ T;  4UVB B;  3PDY A;  3B5M A;  2FUP A;  4GKK T;  5AFU L;  2N2N A;  4HWF A;  4KHP T;  2NOX A;  2WDQ A;  3QB5 K;  3ZKR A;  3A7M A;  4ZEY A;  2VUR A;  3B57 A;  2BS4 A;  1HG5 A;  1FJG T;  1ZEE A;  2UXB T;  1EZ3 A;  3N9P A;  4YSX A;  2ZM2 A;  5LG3 A;  3QUJ A;  3Q5X A;  5LHG B;  3PUR A;  2N9D A;  4PJM A;  5JDH A;  4IDO A;  1SHZ C;  4EYU A;  3JC6 D;  1I94 T;  3AEC A;  2WAU A;  4LML A;  4DV2 T;  1G73 A;  2X68 A;  2UU9 T;  5ABF A;  3PJA J;  2PJQ A;  5CJ5 A;  5AQP B;  4JEU B;  4EZH A;  3UFG A;  2V7K A;  3PUW F;  2V8S V;  2PG8 A;  5LBM A;  1HF8 A;  4EIW A;  3EI0 A;  4MLK A;  4FJO A;  3LBX A;  1HCI A;  3HI2 A;  3EDU A;  4NPP A;  1UCU A;  5HYA A;  4AKH A;  2V5D A;  3H37 A;  1VOM A;  4PK5 A;  4DMV A;  1XZY A;  4FI5 A;  3VR9 A;  2VK9 A;  1QLB A;  3VU7 H;  3L3P A;  2CM0 A;  2KIN B;  2XQA A;  2XAG B;  2LLY A;  4TNV A;  1NAF A;  3FBL A;  1YW0 A;  2NW9 A;  2UXC T;  4OYK A;  2VWA A;  5AQI B;  4PJN A;  3I9Y A;  5FVL A;  5HXS A;  3CIR A;  4B3R T;  2XSB A;  4U7Y A;  5ABH A;  2KZ7 B;  3ZYK A;  3WAJ A;  1J5W A;  2V6X A;  4K0U A;  5ABF B;  3PUX F;  2X0H A;  5L3C B;  4MFR A;  3S4U A;  3CK6 A;  5FY0 A;  3RYI E;  4H9S E;  4BA9 A;  2ODV A;  4ZOL E;  1YKH B;  2L8K A;  4QX8 B;  3LBX B;  3KV5 A;  3CQC B;  1IAP A;  3ZT7 A;  1FIO A;  4O2B E;  5E0O A;  4PFO A;  2V7M A;  2Q9Q C;  1T72 A;  1IZN B;  2MOZ A;  1QSD A;  3JCF A;  4HFI A;  3T8O A;  1KF6 A;  2WY2 A;  4HWD A;  4X20 E;  5FXW A;  5IWA T;  2XM1 A;  3HR0 A;  4WZX A;  2Q9Q A;  3AA1 B;  5LCY A;  4QH4 A;  3TLW A;  4ZZB A;  4LF9 T;  2E5V A;  1UUR A;  2D9D A;  1WLX A;  3WAK A;  4DV1 T;  4U2Z A;  2VL0 A;  2WU5 A;  3AVR A;  1MIW A;  3N9M A;  3IBP A;  2QVA A;  1KEY A;  4O4I E;  4DR4 T;  4AKL A;  5L4E A;  4OHF A;  3KV6 A;  5ABG A;  3AA7 B;  1S35 A;  3UU8 A;  5EK4 A;  5JDM A;  2KWI B;  1H7C A;  2WZH A;  3ZN0 B;  3TLT A;  4AIS A;  5LMN T;  1IJ6 A;  3CPZ A;  2V5C A;  5F5W A;  2LJL A;  5HEH A;  1IBL T;  4E7S A;  4CN1 A;  3VR8 A;  2Q9Q B;  2BBJ A;  3FXE B;  4DR3 T;  1X79 A;  5L4H A;  3PV0 F;  5AQN B;  2CXD A;  3CX8 B;  3C51 A;  2BBH A;  3AE2 A;  2HN1 A;  3SRZ A;  3A8Y C;  1YXR A;  3N2G E;  1B7T A;  4O2A E;  2BZB A;  3C98 B;  5LA6 E;  4AIU A;  4X64 T;  3I1A A;  4JYA T;  3ZMV B;  4JUY A;  4BAY B;  5JR9 A;  4IDQ A;  1WYB A;  1R8I A;  3RC8 A;  4L0R A;  5FYM A;  4IL4 A;  5H6R B;  4QXC B;  1LRZ A;  1FMW A;  2CCQ A;  4HTE A;  2JQQ A;  3K8P C;  2W61 A;  2CRB A;  2YN6 A;  2CXL A;  5ABE A;  5HAX A;  4QH1 A;  2K24 A;  2ODU A;  2ACX A;  4U2Y A;  4ILU A;  4ERR A;  3Q5E A;  3RRW A;  4DMW A;  3R84 B;  3C4X A;  3MJX A;  5FY1 A;  3RKG A;  5L3F B;  4LFC T;  4X1I E;  4UVC B;  2LRL A;  4MBQ A;  2A2F X;  3AE4 A;  3QOF A;  3RHW A;  4B3T T;  4EV6 A;  1WR6 A;  4WW0 A;  3VRB A;  4UVA B;  3RYH E;  5AQK B;  4ISS A;  4TX5 A;  3MAC A;  3Q5W A;  2XQ7 A;  3NRX A;  3UU4 A;  4DR2 T;  2XQ5 A;  2WMO A;  2E2A A;  2PTF A;  4JI5 T;  1U5P A;  5BMV E;  1ZV4 X;  1QUU A;  2RP4 A;  3KVA A;  4PK4 A;  2UXX B;  2H89 A;  3LDQ B;  3TKL B;  5LYJ E;  2ZMA A;  4JI2 T;  4IL9 A;  4EZ4 A;  4QH5 A;  4NUV A;  3DP7 A;  4TV9 E;  3D0T A;  2XY8 B;  4HGA A;  1CHU A;  3ZLI A;  4DO0 A;  3RRC A;  4YY3 T;  4WNK A;  1OED E;  3M65 A;  5DQW A;  3OYX A;  1XDP A;  4P09 A;  3RIA A;  3PUQ A;  3FB2 A;  4XAX B;  4ILA A;  4N78 D;  3KVB A;  5IHY A;  2X9W A;  2CPT A;  3RX6 A;  2W0G A;  3AEE A;  2JPF A;  4EEB A;  5LJM A;  4DV0 T;  3FHN A;  4YT0 A;  4DV7 T;  5JVD E;  4HEA A;  3PUZ F;  5C2T A;  3F31 A;  1IBK T;  3AXJ A;  3TLV A;  1MIY A;  5HEJ A;  4UV9 B;  1YQ4 A;  4IIJ E;  5AQL B;  3RQW A;  5FVK A;  2QRX A;  2CHO A;  2BS3 A;  4HFH A;  4DID B;  2EHO C;  4X1Y E;  5FXV A;  2XQ4 A;  2WMN A;  4EAH A;  2VQF T;  4HKA A;  2L9Q A;  1UGO A;  2X0Y A;  3CWZ B;  3RQU A;  3RKO A;  3L39 A;  2DCF A;  1E2A A;  2BDE A;  3AEF A;  4YTM A;  2JQK A;  4K0K T;  4AQF C;  2EHO A;  4F6R C;  3UT5 E;  4HFD A;  1NEK A;  3SOL A;  2CXF A;  3ZST A;  4AQF A;  3RIU C;  2YDQ A;  3R6N A;  2BVL A;  4A5X A;  3LG7 A;  3WI3 A;  2FJD A;  4B6X A;  1O3X A;  3L09 A;  5HWX A;  3AXJ B;  3RIU A;  3N9L A;  3AE6 A;  3N2K E;  5FXX A;  4GK0 E;  4NXN T;  5KX5 E;  2PBI A;  3OTO T;  4CXW A;  2DNX A;  1SUM B;  3QNU A;  2ZM0 A;  2XQY A;  2JMK A;  2EHO B;  4O8S A;  3O1I A;  2E9X D;  5JDG A;  4AQY T;  4HWC A;  5LXT E;  5HCJ A;  4GK5 E;  4HFV A;  5AQJ B;  4LF4 T;  4TUY E;  3P50 A;  2KLQ A;  2VVN A;  1XMQ T;  2YU2 A;  3ONX A;  3FZL B;  4UEM A;  2X0L B;  2UUB T;  1MMA A;  3JC6 C;  3NKZ A;  4ZXL A;  4JLE A;  2CWY A;  1WRD A;  4GYS A;  3P4P A;  1CUN A;  1HNX T;  4IGU A;  3NVO A;  2KND A;  2LSI A;  1U4Q A;  3UTK A;  3C50 A;  4KHZ F;  5C3J A;  3ZC0 A;  1N34 T;  3HL6 A;  4ZI2 D;  2BVM A;  3AAE B;  2M6I A;  3RYF E;  1G8X A;  1XDO A;  2D2S A;  2RA1 A;  3G06 A;  3IF8 B;  4YSZ A;  1MNE A;  1BR0 A;  1WCR A;  4UXN B;  4QXB B;  4E7Z A;  2G0U A;  3AEG A;  1AJ3 A;  4COF A;  4XBF B;  3J9X 1;  3PE0 A;  2MYS A;  3ONJ A;  1D0Y A;  1OED C;  5JTG A;  2LKH A;  1GQE A;  5FP3 A;  5EK3 A;  2HPJ A;  1HTJ F;  3AEA A;  3VKH A;  3ABV A;  3N9Q A;  1MMD A;  2Z6E A;  5AQO B;  1OED A;  5ADX L;  1HR0 T;  2DWG A;  1XWM A;  3GN5 A;  1OWA A;  1L0V A;  2VAS A;  5FY7 A;  3DTO A;  5IUX A;  4CN6 A;  4AI6 A;  2F4V T;  5LP6 E;  5F3J A;  1HS7 A;  1NEN A;  3N5L A;  2IML A;  4HFE A;  5GON E;  3MXZ A;  2E5L T;  2N1G A;  3SWH A;  1KK7 A;  3RF1 A;  2W66 A;  2WM9 A;  3AE3 A;  5LOV E;  2OA5 A;  4YHJ A;  4KMC A;  5KXJ A;  3C4Z A;  2IC6 A;  5JDF A;  4IST A;  1UX5 A;  2IDO B;  2YU1 A;  2IHR 1;  5FMN A;  5JDQ A;  2NW8 A;  4GOU A;  3K3N A;  2NW7 A;  3LK2 B;  1DU2 A;  4CZZ B;  2XAH B;  4NIQ A;  4IE4 A;  3QB5 A;  3RC3 A;  4TN7 B;  3C4W A;  4ZS3 A;  2V6Y A;  1W0B A;  2A72 A;  5LJN A;  3GMI A;  2YKS A;  1OED B;  3ZEF B;  3LK3 B;  3GN5 B;  4QX7 B;  3P8C D;  4YJ3 E;  2X51 A;  4IRE A;  3PUV F;  1MIV A;  3AE5 A;  1HNZ T;  3J7Y q;  1W0A A;  3NWI A;  3ONL C;  4HN9 A;  3LK4 2;  5CGM A;  4NUU A;  2VKH A;  3C64 A;  2V26 A;  2WQY A;  5JRC A;  2UXD T;  4DR7 T;  4I50 E;  5JH7 E;  2H3R A;  2KSR A;  4U31 A;  3UQ7 A;  4LF8 T;  4JI4 T;  3NBX X;  5C8Y E;  3HKB E;  4GYR A;  1VCT A;  1SA0 E;  2XHE B;  1N36 T;  4DND A;  5JR9 C;  2K48 A;  4DVD A;  5AQG B;  4OFZ A;  4JI7 T;  2J62 A;  4L9I A;  4CI3 B;  5KDM C;  5LMU T;  2LE8 A;  2M67 A;  3ETU A;  3UU5 A;  2XUE A;  3F2E A;  4GIW A;  3EHZ A;  2I6H A;  2XAF B;  4ZI3 D;  3ZJ2 A;  2YIN A;  2FJE A;  4KX6 A;  4AXP A;  4KBM B;  5HXH A;  2MPK A;  3KFW X;  4ZZC A;  4H9Q C;  3H3A A;  5CFB A;  5AQS B;  2W63 A;  2BG9 E;  4OYJ A;  4EOZ B;  2E8I A;  3AAI A;  3PU8 A;  4PFP A;  5JRC B;  2LSY A;  4LFA T;  3CX7 B;  4JBW F;  3Q9D A;  3SS1 A;  2ZM6 T;  1IJ5 A;  3VRA A;  2YK0 A;  3O1J A;  2J4G A;  5CA1 E;  4TWF A;  3ZC1 A;  1YKE B;  3FBZ A;  3FZF B;  3NZP A;  2LOP A;  3KIN B;  2WSS V;  2XZE A;  2NP9 A;  2ZM8 A;  4I43 B;  4WBO A;  5L3G B;  3L8R A;  1VCS A;  2ACZ A;  2XSA A;  5EK2 A;  5J2U E;  5JR9 B;  1D1A A;  5LHI B;  4H9O C;  4X65 T;  3AEB A;  3AAA B;  5FXZ A;  5LG4 A;  3UU6 A;  4OX9 T;  1WFD A;  3RYC E;  5HEO A;  2BKO A;  3FXD B;  3Q5D A;  4ZI7 E;  4A56 A;  3BQK A;  2YOE A;  5M4Y A;  3OKQ A;  2J1D G;  2MBG A;  4ANJ A;  2CMR A;  2WBL A;  4X66 T;  2FBW A;  1BR4 A;  4U7I A;  3EDV A;  1JNR A;  2LRK A;  1V9D A;  5KMG P;  3UUM A;  5HXC A;  5L3D B;  1LVF A;  4ADZ A;  3K1S A;  2X9X A;  1T8B A;  4PAG A;  3AE9 A;  3AED A;  5FKY A;  2LEH A;  4IE5 A;  3KV9 A;  3JAF A;  2R6G F;  3ZYM A;  4U3C A;  1BR2 A;  3VHL A;  3VKG A;  4PJL A;  5AQF B;  3ZMZ B;  1W9R A;  5TAO A;  3CML A;  5BR8 T;  4B3S T;  1XMO T;  2LOS A;  3OBV E;  2IIU A;  4X5T A;  2CLY C;  3DJB A;  5L47 A;  1WYC A;  2RPA A;  2VB6 A;  3KV4 A;  5AQQ B;  2WB5 A;  2DL1 A;  2VQE T;  5L3E B;  5A1L A;  2L3L A;  2V1D B;  3PJA A;  4X1K E;  1UUS A;  1T7S A;  5HEU A;  2MTQ A;  4C90 A;  2D5U A;  2XM2 A;  1Y64 B;  2IAK A;  2CEA A;  1D1C A;  2BS2 A;  1KFY A;  2CWO A;  2MAW A;  4B3M T;  3KBU A;  2BKP A;  1VRB A;  3RPU A;  3JAD A;  4JI3 T;  3RIF A;  4DUY T;  4QWN B;  1Z0P A;  4YJ2 E;  3PTR B;  2C5K T;  4G2A A;  4UR9 A;  2W4X A;  5AQM B;  3NZQ A;  4X62 T;  2VKO A;  4YFS A;  1LKX A;  5ETW A;  4IDP A;  2HH7 A;  2DHR A;  3RI5 A;  2XAS B;  4Z90 A;  2LSG A;  4DV6 T;  4TWD A;  2QGS A;  3B13 A;  3PUY F;  2I59 A;  4EED A;  3AE7 A;  1OXZ A;  2HHH T;  1MND A;  2KT9 A;  3ZT6 A;  4UF0 A;  2BG9 C;  2XAJ B;  5F8P A;  2CLY B;  4H9P C;  1E7P A;  2VL8 A;  2E9X C;  1HFA A;  4CXX A;  4I0U A;  3PUA A;  2M6B A;  1MMN A;  3GWH A;  4YSY A;  2BG9 A;  4KUM B;  2VKD A;  3ZJ1 A;  3RGL A;  5J1G A;  2E9X A;  1KNZ A;  2XAQ B;  4U72 A;  4A97 A;  5L3B B;  4DV3 T;  2UUC T;  2DLR A;  1YD8 G;  4QKN A;  2LSJ A;  4YLH A;  2X66 A;  3HA4 A;  3I0Q A;  4I55 E;  2LT3 A;  2KMF A;  2FJA A;  2W67 A;  3OYZ A;  5J0Z A;  2W2U A;  3MKD A;  3X1D A;  1W09 A;  2V7J A;  2OV9 A;  4PJJ A;  5FL0 A;  1NWM X;  3N9O A;  2CE7 A;  2KXP B;  2LHR A;  1ZP0 A;  2WDV A;  1ZKE A;  2JJ9 A;  4Z91 A;  4UF0 B;  2HN2 A;  4ZI2 C;  4QHO A;  4IHJ E;  4P0A A;  3P7I A;  4H9R C;  4HWH A;  3AA0 B;  2H7V C;  2B76 A;  4MHC A;  3EAB A;  1KNP A;  3EVY A;  4H9N C;  4OK0 A;  2H88 A;  2BG9 B;  2A3D A;  3A5X A;  2P9B A;  5HWY A;  3ZCJ A;  2LM2 A;  2V7I A;  3FZH B;  2DWK A;  1Y01 A;  2E9X B;  4U74 A;  3LJC A;  2JRK A;  2WWU A;  1BR1 A;  2Y6X A;  5JRE A;  4AKR B;  2WP9 A;  4DUZ T;  2CBJ A;  2AE9 A;  2W62 A;  3MZK B;  5LGU B;  3H3M A;  3EUH A;  3UUB A;  3UUL A;  5J2T E;  1UX4 A;  1ZHC A;  3CQG B;  4Q25 A;  4DBR A;  1D0X A;  2Q9Q D;  3AA6 B;  4DBQ A;  2CA5 A;  3T1Y T;  1MMG A;  1FMV A;  2D0U A;  4EYY R;  5AQU B;  4L5G A;  1HNW T;  4O4L E;  4IE7 A;  5LNK A;  5HEG A;  1I6Z A;  4H63 V;  1Z8U A;  5AQR B;  4V1A v;  4WBN E;  2WCA A;  1SE7 A;  3QC9 A;  3OPC A;  5LBQ B;  3AVS A;  3K3Q C;  1D1B A;  5JDN A;  1UK5 A;  1FEW A;  2XQ8 A; 
#chains in the Genus database with same CATH homology
 1WFD A;  3ZST A;  2CRB A;  2CPT A;  2LRL A;  2W2U A;  4NIQ A;  2A9U A;  5FVK A;  2RPA A;  3ZT5 A;  5CGM A;  4ZEY A;  4U3C A;  2JQK A;  4IT4 A;  2K3W A;  4CN4 A;  4U7I A;  4U7Y A;  2V6Y A;  5LB7 B;  4A5X A;  2LRK A;  2V6Y B;  2DL1 A;  4U2Y A;  4U31 A;  2WY2 A;  3EAB A;  2WWV A;  2JQ9 A;  2MPK A;  1YXR A;  2V6X A;  2JQH A;  2XZE A;  3K1S A;  4U2Z A;  4WZX A;  3ZT6 A;  5CJ5 A;  4P1N A;  3ZT7 A;  4CN1 A;  1WR0 A;  1WCR A;  3ZSS A;  4U33 A;  5FVL A;  4CN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...