4NIQA

Crystal structure of vps4 mit-vfa1 mim2
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
82
structure length
82
Chain Sequence
b'MSTGDFLTKGIELVQKAIDLDTATQYEEAYTAYYNGLDYLMLALKYEKNPKSKDLIRAKFTEYLNRAEQLKKHLESEEANAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar protein sorting-associated protein 4
publication title Vfa1 Binds to the N-terminal Microtubule-interacting and Trafficking (MIT) Domain of Vps4 and Stimulates Its ATPase Activity.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 38
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04212 MIT MIT (microtubule interacting and transport) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 4niqA00
2V6YA 3ZT6A 2JQKA 4IT4A 2CRBA 2LRKA 4U31A 4A5XA 4CN1A 4P1NA 4U2YA 4U2ZA 3ZSSA 4U7IA 2DL1A 4U7YA 4CN6A 2MPKA 2CPTA 5FVKA 2V6YB 5LB7B 4ZEYA 2A9UA 2WY2A 2LRLA 5CJ5A 4CN4A 2K3WA 3EABA 2RPAA 2JQHA 2XZEA 4NIQA 4WZXA 3ZT5A 1WFDA 1YXRA 3K1SA 3ZSTA 1WR0A 5FVLA 1WCRA 4U33A 3ZT7A 2V6XA 4U3CA 5CGMA 2W2UA 2JQ9A 2WWVA
chains in the Genus database with same CATH superfamily
3ETUA 4AKIA 2LSJA 3OJAA 1XZYA 4JBWF 5EK2A 2X68A 2WZIA 4GOUA 3RYHE 3EHZA 3C4XA 4AQFA 3A5XA 1HNZT 5HYAA 4I50E 2LOPA 4B3TT 4IHJE 1ZEEA 5L4HA 2J4GA 4ZS3A 1I94T 2XUEA 4DMVA 5DJQC 4LF7T 5FVKA 2JJ9A 3AE6A 5LBQB 2LRLA 3KINB 1XDOA 2FJBA 1Y64B 4AKGA 3N9LA 2CWYA 4QKNA 3SFEA 4GYSA 3DTOA 4TWFA 2PBIA 4I55E 4IT4A 3LBXA 2W67A 4JI8T 4FJOA 3QB5A 2UU9T 3N9PA 1FMWA 3KBTA 3UFGA 4I0UA 4PJJA 5JREA 2KWIB 1X79A 1IJ5A 5KMGP 5FY0A 1QUUA 2KZ7B 4DR3T 3UQ4A 3D0TA 4EEDA 4B3MT 5CFBA 5L3CB 3CIRA 2V5CA 2CWOA 1MMGA 4QH5A 1HTJF 4Z91A 1KNRA 3T1YT 3H37A 2V7JA 3FHNA 4DR6T 4PFPA 1OXZA 2LEHA 2W00A 2WS3A 4ILBA 5ETWA 4ILCA 3WI3A 5KDMC 3UTKA 3K8PC 4GK0E 3I9WA 2CHNA 3K3OA 4LF5T 3KV9A 2DWKA 5M4YA 2BS3A 4ZZBA 3RKOA 2H3RA 5C8YE 5FY7A 5L47A 5L3DB 2XHEB 3OYZA 1T72A 2UXCT 2LHRA 3AE4A 4ILAA 4CXXA 4EAHA 3O4XE 5JR9A 4PJMA 5AQSB 4AI6A 4YSXA 5AQUB 5HEUA 5CB4E 3P4SA 4E7SA 2XAQB 1XNQT 2J47A 5FY1A 1L0VA 3ZYLA 2IC9A 2JMKA 2X9HA 3WAKA 5LBMA 5HWXA 4H9NC 4B3ST 2K48A 4JI7T 1KEYA 4UF0A 2IAKA 4H63V 4KHPT 3BQKA 5JRCB 3UU5A 4UR9A 4DVDA 4IE4A 2LM2A 2EHOC 2DLRA 3H3MA 3AE9A 4ZI7E 1V9DA 2W0GA 3MA9A 4NXNT 3C50A 3EDVA 4JYAT 2E9XD 5JDHA 2X0LB 4EEBA 1HFAA 2JQ9A 5AQQB 4JEHB 3KFWX 5LJNA 2HH7A 2YU1A 3QC9A 3RQUA 4JI0T 2HN2A 4MLKA 4TV9E 4XBFB 1OEDE 4AKRB 2XQ9A 4UELA 1UCUA 2I6HA 4HWIB 2VKDA 2ZLYA 4YHJA 2WZHA 2BKOA 5AQNB 2JQQA 4DR2T 3MJXA 5LNKA 2FJDA 4EOZB 2QVAA 3I0OA 4U7IA 1CHUA 3RIUC 1T98A 4L5GA 3JAFA 4I43B 3QK6A 1VCTA 2FJAA 1WR0A 3U3IA 5CGMA 2VKJA 1E7PA 4AQGA 2V7KA 3N2OA 2D0TA 2LSKA 3EDUA 3ZJ2A 3PJAJ 1O3XA 1E2AA 3P4PA 4MBQA 1WYBA 2VQET 2C5KT 2YDRA 1FIOA 1YD8G 2XQ6A 5ADXL 1OEDB 1SA0E 4GIWA 3O1JA 4YLHA 5LGTB 3FZLB 2N2NA 3FXEB 2XJ7A 3RPUA 4V1Av 3ZMZB 5HXHA 4JV5T 2CM0A 2XZEA 2LM9A 3K1SA 4WW0A 4P0AA 3SRZA 5JQGE 3SOLA 3EUHA 4EYUA 3PUQA 2PJQA 2CE7A 5KX5E 3HKEE 4HFBA 3VRAA 2C5JA 2VB6A 5AQLB 4C90A 3JC6C 5LGNB 4CQIA 3HA4A 4AKHA 2CLYC 2VQFT 2BKPA 3P4WA 1BR0A 2P9BA 2IW5B 3CX7B 4CI2B 3C4WA 3ZSSA 2X9YA 2LSYA 2ZM0A 2MOZA 3ZCJA 1D0YA 1WCRA 4DNDA 2XM1A 2E9XB 4EYYR 2PTFA 2CA5A 4JEUB 3PJAA 2OLTA 4UEMA 5FMNA 3L39A 3ZMUB 3SFDA 2PG8A 2V8SV 2M6BA 4DV7T 5AQPB 4ERRA 1H7CA 4AIUA 4PAGA 2ES0A 4ISTA 2AE9A 3V5SA 2J1DG 5EK3A 1B7TA 4HTEA 3TLSA 4LFCT 2IIUA 2VVSA 5IYZE 5C2TA 3CKDA 5L3GB 1WYCA 2CEAA 5IHYA 2W66A 3ZMVB 3ZT6A 3K3QC 3P50A 5J1GA 2V1DB 2WB5A 1N34T 3B5MA 4JLEA 3IEEA 5LJMA 4LMKA 4ZHQE 3AA6B 2WSSV 3L09A 3AEFA 4HN9A 2B76A 4MALA 3T1HT 4EZHA 2C0SA 5JH7E 4A98A 5H6QB 3AEGA 1QSDA 2LE8A 1W0AA 2UXNB 5LHGB 5LMUT 4BJMA 4GK5E 2Q9QB 2NTYA 5HEJA 3ZYKA 4IL4A 5LOVE 1VCSA 4X64T 4EV6A 2X9WA 3KDSE 1QLBA 4NPPA 3HI2A 4UV9B 1JNRA 4QWNB 3R6NA 1OWAA 3EI0A 3ZN0B 2VASA 2H88A 3EVYA 1ZV4X 2K24A 3JCFA 4ASKA 3DP7A 5AQTB 3S4UA 2Q9QA 1WRDA 4IREA 5A1LA 2ZMAA 4DV5T 1D1CA 2VK9A 5J2TE 3WAJA 4YFSA 3F2EA 5JDGA 4DR4T 4AXPA 4HFIA 2L8KA 2L3LA 3NVOA 3LBXB 1IBLT 4HFHA 1HX8A 3OYXA 3GWHA 1MNEA 3ZYMA 2CBIA 1FEWA 4XAXB 3CQXC 4ZI2C 2YOEA 2FJEA 2DL1A 4O4IE 1ZKEA 1CUNA 4P0BA 4X62T 1WFDA 3AA7B 2FBWA 1VRBA 2V6YA 2KLQA 2YK0A 4U31A 3CQCB 3IA3A 2Y48B 1G8XA 2HPLA 1IZNB 3CQGB 3CPZA 4HFDA 4DR7T 4IDOA 3TLTA 4BA9A 3AA0B 1W9RA 3N9QA 4QH1A 3NZQA 4GYRA 1IBKT 2BG9C 4UV8B 4DV0T 3ETVA 3C98B 3PURA 1IAPA 1HS7A 2LKGA 4X1IE 2EHOA 2KSRA 3MACA 3PV0F 2ODVA 2UXBT 5AQOB 1IBMT 4NIQA 1HCIA 3ZSTA 4HFCA 5AQVB 3FZMB 2MAWA 2M6IA 5AQIB 2JQKA 2YEVC 4HWDA 1HG2A 4KHZF 3UUXB 2BS2A 3AA1B 5JR9B 2JQHA 5LXTE 4AISA 4DV3T 1MIVA 3ZC0A 1LRZA 4QX7B 2UUAT 4JI5T 2H89A 3RC8A 4HE8A 1XMOT 3MZKB 4HWCA 3RIUA 3BQIA 5CA0E 4HEAA 3NZPA 4LFAT 1BR1A 5AQGB 4NXMT 4JI3T 3KV6A 5HXEA 3ZT7A 2K5BB 5AQMB 5FP3A 4X66T 1XMQT 2QRXA 2RP4A 4UF0B 2LSIA 2XAJB 4H9PC 2MTQA 3Q5XA 4H9RC 3PU8A 2UXXB 4YHHT 5LP6E 3ZMTB 4BJNA 3ZEFB 4L9IA 3KV4A 3OKQA 4YTMA 3UT5E 2DI4A 1E1HB 3CWZB 5LYJE 1D0XA 5LGUB 5JTGA 2A9UA 5DQVA 2YKSA 3QUJA 4QHOA 5AQHB 4Z90A 3QB5K 1Z8UA 4C91A 3B13A 1SHZC 5F3JA 2WU2A 4YSYA 2E8IA 3AE8A 1U5PA 3AEAA 2AXDS 5J2UE 2VWAA 4F6RC 2XQ7A 4YTPA 2BBJA 2QGSA 2XQYA 3Q5EA 2VKHA 4X1YE 3ZCIA 3VHLA 3L8RA 1XNRT 3VKGA 1KF6A 4TUYE 5C3JA 3I1AA 1I6ZA 4HGAA 4OFZA 3AE7A 1ZP0A 2YDSA 4EZ4A 3GMIA 3RIFA 4O4LE 2X0YA 4HFEA 3PUGA 4CN1A 2DCFA 2JPFA 1T7SA 2WU5A 2B1EA 4DMWA 4ANJA 3UFEA 3NRXA 4PK6A 2CCQA 2LJLA 3AAIA 1JNZA 3E0ZA 1NEKA 2KWHA 4OYKA 2WBLA 4WNKA 5HEOA 3FBLA 2SPCA 2MYSA 3HKCE 4P1NA 1MNDA 3N9NA 2XAFB 4IDQA 4NUUA 2J62A 2XQ8A 3RIAA 4X1KE 2V26A 2H7VC 3PUZF 4P09A 5JVDE 2IDOB 4WBNE 4YT0A 1X9BA 2Q9QD 2LLYA 3JAEA 2KXPB 5FYMA 3FB2A 3RKGA 1HNXT 5EK4A 4QH4A 3UU3A 3AE2A 3ABVA 4H9OC 4KMCA 2D0UA 2BKNA 2XAGB 3UU8A 4HKAA 4OX9T 3IHRA 1AJ3A 3UU4A 4CI1B 3SWHA 3AEDA 5HEHA 4YJ3E 3N9MA 2XM2A 4ZOLE 2WY2A 4DIDB 5BR8T 5LMNT 2XQ4A 3RX6A 5JDNA 1R8IA 3FZFB 3VRBA 2BG9E 2H7OA 1MMAA 2HHHT 2YN6A 3AE3A 2DNXA 1FMVA 4DR5T 3RGLA 5L3BB 4O2AE 3RF1A 1M7KA 3UULA 5FXVA 2VVNA 5LA6E 3CVRA 4HWHA 3I9YA 3ZN1B 2XQAA 2BZBA 3QOFA 4DV2T 4PJNA 2NP9A 3RRCA 4JI2T 5JDFA 4EGWA 2XQ5A 3P8CD 2MPKA 2EHOD 1US7B 4CN4A 1WLXA 2CMRA 2XY8B 4LMJA 3H3AA 4O4JE 4LMLA 4GKJT 2CXFA 2XSBA 4IDPA 3EAMA 5LCYA 5L3FB 4DV1T 1UUSA 3ZC1A 4QXCB 5ABFB 1DU2A 3R84B 4IE0A 4TNWA 3C51A 2BVMA 3F57A 1YXRA 2X67A 3IBPA 4IDZA 5DQWA 4HWFA 2A3DA 3PTRB 4DUYT 3KV5A 1YQ4A 3AECA 4K0UA 2LOSA 4KP3C 2CPTA 4ZEYA 1LVFA 1NAFA 4ZI3D 2E5LT 3TLVA 5AQRB 3BK9A 2QA7A 2XPKA 4HFVA 3HL6A 4X20E 5ABFA 2BG9A 4OK0A 1XDPA 4X65T 2JMHA 4U7YA 3NRYA 1OEDC 2NWBA 2K3WA 2WDQA 1KFYA 5FXXA 3PDYA 2D2SA 4TN7B 4CI3B 4O8SA 2V5DA 4LFBT 3TKLB 2N1GA 4JI6T 2VURA 4QXHB 1KK7A 4EXTA 3RRWA 4TV8E 4IE7A 2WMNA 3ONJA 2VL0A 3F31A 2XTLA 2W63A 5J0ZA 2WWVA 5IUXA 2V7IA 4IGUA 3UU6A 3CMLA 2G0UA 1MMDA 2WMOA 1YKHB 3LSVA 4QX8B 2X66A 2V6YB 4UVAB 3QNUA 3HKDE 5HXSA 1EZ3A 2MBGA 1BR4A 4CXWA 3VR8A 5TAOA 1J1JA 2BS4A 3JC6D 4IE6A 2L9QA 1N36T 2KINB 3JADA 3TLUA 4NUVA 3ZMSB 3ZPOA 2BVLA 4OYJA 2ACZA 4PW8A 4O4HE 2Y6XA 3VU7H 2E9XC 1Y01A 2C5IT 2YINA 2LHNA 3PUWF 2EHOB 3C64A 1UX4A 3RH3A 4DV6T 2X9XA 2YDQA 3LK3B 4U74A 5FKYA 2X0HA 2I0MA 2IHR1 2A72A 3PUYF 3AAAB 3T8OA 2NOXA 5LB7B 5ABGA 3NBXX 1HG5A 2BBHA 4CZZB 2WP9A 5EZYE 2ZM2A 4WBOA 5HXCA 4DV4T 3A7MA 2CRBA 4A5XA 2UXDT 3O1HA 4CXYA 1VOMA 2WDVA 3NWIA 4N78D 2CXLA 3UUBA 4O2BE 3DJBA 4KBMB 2UUCT 4YXDA 2W2UA 2W61A 4ZS2A 3LK2B 2IC6A 2WQYA 4DR1T 2LT3A 3MKDA 5L2LA 3IF8B 3M65A 4H63H 3ESLA 4ILUA 2WWUA 2RPAA 3E08A 3PUAA 5JDLA 3Q5DA 2NW9A 4JUYA 2QYWA 3X1DA 2V6XA 3FXDB 2NTXA 2E5VA 4IDNA 2W4XA 5H6RB 2N9DA 3J9X1 4GKKT 2ACXA 1NWMX 2D9DA 3LFMA 5LHIB 4KUMB 4MFRA 5L4EA 3KVAA 1SUMB 3O9XA 4FI5A 1N32T 2Q9QC 4PJLA 2ZM6T 5HXRA 2K9AA 5HAXA 3V5UA 4Z8XA 1YQ3A 4U2YA 2VL8A 4LF9T 4CN6A 2LKHA 4UXNB 4JI4T 1LVKA 4AQFC 5JDMA 4PK5A 1MIWA 3AEEA 3AVSA 1ZHCA 3N9OA 2ODUA 1NENA 2NW7A 1MIYA 3OVUA 3ZJ1A 2CLYB 3AE5A 2YU2A 3A8YC 3B57A 2XSAA 1D1AA 4AKLA 3PUXF 5LG3A 3NKZA 1HR0T 3OBVE 3RQWA 4ADZA 4DBQA 1YW0A 1HNWT 3RYCE 3K3NA 5CJ5A 4B6XA 5IWAT 2M67A 3VR9A 4ZXLA 1Z0PA 3P4QA 4ZI2D 3PE0A 5FL0A 1UURA 4A56A 5HCMA 1ZOYA 2E2AA 1YKEB 2NW8A 5AQFB 4XZCA 3MXZA 3VKHA 4TZ4C 3J7Yq 2IUBA 4EIWA 5HEGA 5FNVE 1D0ZA 2CHOA 3RYFE 5JRCA 3LK42 2DWGA 4DUZT 3AB3B 2UUBT 3CX8B 5FXWA 3KBUA 3UUMA 3Q2MA 1G73A 4X5TA 4A97A 4IL9A 1HF8A 2D5UA 2WDRA 1UX5A 4PNIA 4ZI3C 3EABA 3AEBA 4YTNA 4B3RT 4M1PA 3HKBE 2GK9A 3O1IA 5JR9C 5DABA 5L3EB 3ZKRA 4PFOA 4DBRA 3KVBA 2HN1A 3Q5WA 2KT9A 1XWMA 4LF8T 4E7ZA 2DHRA 3ANWB 3GN5B 2Y8DA 2XASB 1WR6A 2PFVA 3AXJB 1LKXA 4L0RA 2IMLA 3ONLC 3UQ7A 4OHFA 2NR4A 4U33A 2OA5A 5KXJA 2VKOA 2F4VT 3HR0A 4H9SE 1OEDA 2V7LA 2W62A 3ANWA 5BMVE 3N5LA 3GN5A 3ZLIA 4TWHA 4H9QC 4KX6A 3AXJA 5HCJA 4F8HA 4WYVA 3RI5A 4TX5A 2CXDA 1S94A 3RHWA 1KNZA 3FZHB 1J5ET 2WCAA 3PUSA 3M3ZB 1N33T 5ABEA 4UVBB 1MMNA 4U72A 1T8BA 3PUVF 4WZXA 2OV9A 3GA8A 4DO0A 5ABHA 1U4QA 1J5WA 1IJ6A 3ONXA 4JI1T 1W09A 2WM9A 3AVRA 3BQLA 2KMFA 5F8PA 5GONE 2BDEA 3FZKB 3CK6A 4ZZCA 3RLFF 3AE1A 1M62A 3Q9DA 3MK7C 3LJCA 4YY3T 1FJGT 4KI0F 3LDQB 2BG9B 4J2CA 3RC3A 4UIGA 2R6GF 4G63A 5LG4A 4YSZA 2E9XA 3UUNA 2LSGA 4IIJE 4U3CA 3P7IA 1W0BA 2JIWA 2LRKA 5F5WA 5AQKB 2XAHB 3AAEB 3CX6B 4ISSA 2HPJA 4IE5A 2A2FX 4COFA 1GQEA 5CA1E 4EB6E 5HWYA 3W15B 1UK5A 3LG7A 4TWDA 2XQ3A 3RYIE 3N2KE 2WAUA 4AQYT 2V7MA 5JDQA 3PU3A 2FUPA 5FVLA 4LF6T 5FXZA 5LHHB 3E22E 5E0OA 3I0QA 2I59A 4PK4A 3TLWA 3FBZA 4G2AA 5AQJB 2JRKA 2RA1A 4TNVA 2Z6EA 2KNDA 1S35A 3ZT5A 1UGOA 1BR2A 5AFUL 3G06A 4I4TE 4QXBB 1SE7A 3SS1A 2X51A 4Q25A 4K0KT 4UVCB 1KNPA 4MHCA 1HX1B 1D1BA 4U2ZA 4YJ2E 3P4RA 4BAYB 5FL1A 3OTOT 3OPCA 3L3PA 3U78A 2CBJA 3C4ZA 4LF4T 2ZM8A 3N2GE
chains in the Genus database with same CATH topology
2V6YA 3ZT6A 2JQKA 4IT4A 2CRBA 2LRKA 4U31A 4A5XA 4CN1A 4P1NA 4U2YA 4U2ZA 3ZSSA 4U7IA 2DL1A 4U7YA 4CN6A 2MPKA 2CPTA 5FVKA 2V6YB 5LB7B 4ZEYA 2A9UA 2WY2A 2LRLA 5CJ5A 4CN4A 2K3WA 3EABA 2RPAA 2JQHA 2XZEA 4NIQA 4WZXA 3ZT5A 1WFDA 1YXRA 3K1SA 3ZSTA 1WR0A 5FVLA 1WCRA 4U33A 3ZT7A 2V6XA 4U3CA 5CGMA 2W2UA 2JQ9A 2WWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2V6Y A;  3ZT6 A;  2JQK A;  4IT4 A;  2CRB A;  2LRK A;  4U31 A;  4A5X A;  4CN1 A;  4P1N A;  4U2Y A;  4U2Z A;  3ZSS A;  4U7I A;  2DL1 A;  4U7Y A;  4CN6 A;  2MPK A;  2CPT A;  5FVK A;  2V6Y B;  5LB7 B;  4ZEY A;  2A9U A;  2WY2 A;  2LRL A;  5CJ5 A;  4CN4 A;  2K3W A;  3EAB A;  2RPA A;  2JQH A;  2XZE A;  4NIQ A;  4WZX A;  3ZT5 A;  1WFD A;  1YXR A;  3K1S A;  3ZST A;  1WR0 A;  5FVL A;  1WCR A;  4U33 A;  3ZT7 A;  2V6X A;  4U3C A;  5CGM A;  2W2U A;  2JQ9 A;  2WWV A; 
#chains in the Genus database with same CATH topology
 3ETU A;  4AKI A;  2LSJ A;  3OJA A;  1XZY A;  4JBW F;  5EK2 A;  2X68 A;  2WZI A;  4GOU A;  3RYH E;  3EHZ A;  3C4X A;  4AQF A;  3A5X A;  1HNZ T;  5HYA A;  4I50 E;  2LOP A;  4B3T T;  4IHJ E;  1ZEE A;  5L4H A;  2J4G A;  4ZS3 A;  1I94 T;  2XUE A;  4DMV A;  5DJQ C;  4LF7 T;  5FVK A;  2JJ9 A;  3AE6 A;  5LBQ B;  2LRL A;  3KIN B;  1XDO A;  2FJB A;  1Y64 B;  4AKG A;  3N9L A;  2CWY A;  4QKN A;  3SFE A;  4GYS A;  3DTO A;  4TWF A;  2PBI A;  4I55 E;  4IT4 A;  3LBX A;  2W67 A;  4JI8 T;  4FJO A;  3QB5 A;  2UU9 T;  3N9P A;  1FMW A;  3KBT A;  3UFG A;  4I0U A;  4PJJ A;  5JRE A;  2KWI B;  1X79 A;  1IJ5 A;  5KMG P;  5FY0 A;  1QUU A;  2KZ7 B;  4DR3 T;  3UQ4 A;  3D0T A;  4EED A;  4B3M T;  5CFB A;  5L3C B;  3CIR A;  2V5C A;  2CWO A;  1MMG A;  4QH5 A;  1HTJ F;  4Z91 A;  1KNR A;  3T1Y T;  3H37 A;  2V7J A;  3FHN A;  4DR6 T;  4PFP A;  1OXZ A;  2LEH A;  2W00 A;  2WS3 A;  4ILB A;  5ETW A;  4ILC A;  3WI3 A;  5KDM C;  3UTK A;  3K8P C;  4GK0 E;  3I9W A;  2CHN A;  3K3O A;  4LF5 T;  3KV9 A;  2DWK A;  5M4Y A;  2BS3 A;  4ZZB A;  3RKO A;  2H3R A;  5C8Y E;  5FY7 A;  5L47 A;  5L3D B;  2XHE B;  3OYZ A;  1T72 A;  2UXC T;  2LHR A;  3AE4 A;  4ILA A;  4CXX A;  4EAH A;  3O4X E;  5JR9 A;  4PJM A;  5AQS B;  4AI6 A;  4YSX A;  5AQU B;  5HEU A;  5CB4 E;  3P4S A;  4E7S A;  2XAQ B;  1XNQ T;  2J47 A;  5FY1 A;  1L0V A;  3ZYL A;  2IC9 A;  2JMK A;  2X9H A;  3WAK A;  5LBM A;  5HWX A;  4H9N C;  4B3S T;  2K48 A;  4JI7 T;  1KEY A;  4UF0 A;  2IAK A;  4H63 V;  4KHP T;  3BQK A;  5JRC B;  3UU5 A;  4UR9 A;  4DVD A;  4IE4 A;  2LM2 A;  2EHO C;  2DLR A;  3H3M A;  3AE9 A;  4ZI7 E;  1V9D A;  2W0G A;  3MA9 A;  4NXN T;  3C50 A;  3EDV A;  4JYA T;  2E9X D;  5JDH A;  2X0L B;  4EEB A;  1HFA A;  2JQ9 A;  5AQQ B;  4JEH B;  3KFW X;  5LJN A;  2HH7 A;  2YU1 A;  3QC9 A;  3RQU A;  4JI0 T;  2HN2 A;  4MLK A;  4TV9 E;  4XBF B;  1OED E;  4AKR B;  2XQ9 A;  4UEL A;  1UCU A;  2I6H A;  4HWI B;  2VKD A;  2ZLY A;  4YHJ A;  2WZH A;  2BKO A;  5AQN B;  2JQQ A;  4DR2 T;  3MJX A;  5LNK A;  2FJD A;  4EOZ B;  2QVA A;  3I0O A;  4U7I A;  1CHU A;  3RIU C;  1T98 A;  4L5G A;  3JAF A;  4I43 B;  3QK6 A;  1VCT A;  2FJA A;  1WR0 A;  3U3I A;  5CGM A;  2VKJ A;  1E7P A;  4AQG A;  2V7K A;  3N2O A;  2D0T A;  2LSK A;  3EDU A;  3ZJ2 A;  3PJA J;  1O3X A;  1E2A A;  3P4P A;  4MBQ A;  1WYB A;  2VQE T;  2C5K T;  2YDR A;  1FIO A;  1YD8 G;  2XQ6 A;  5ADX L;  1OED B;  1SA0 E;  4GIW A;  3O1J A;  4YLH A;  5LGT B;  3FZL B;  2N2N A;  3FXE B;  2XJ7 A;  3RPU A;  4V1A v;  3ZMZ B;  5HXH A;  4JV5 T;  2CM0 A;  2XZE A;  2LM9 A;  3K1S A;  4WW0 A;  4P0A A;  3SRZ A;  5JQG E;  3SOL A;  3EUH A;  4EYU A;  3PUQ A;  2PJQ A;  2CE7 A;  5KX5 E;  3HKE E;  4HFB A;  3VRA A;  2C5J A;  2VB6 A;  5AQL B;  4C90 A;  3JC6 C;  5LGN B;  4CQI A;  3HA4 A;  4AKH A;  2CLY C;  2VQF T;  2BKP A;  3P4W A;  1BR0 A;  2P9B A;  2IW5 B;  3CX7 B;  4CI2 B;  3C4W A;  3ZSS A;  2X9Y A;  2LSY A;  2ZM0 A;  2MOZ A;  3ZCJ A;  1D0Y A;  1WCR A;  4DND A;  2XM1 A;  2E9X B;  4EYY R;  2PTF A;  2CA5 A;  4JEU B;  3PJA A;  2OLT A;  4UEM A;  5FMN A;  3L39 A;  3ZMU B;  3SFD A;  2PG8 A;  2V8S V;  2M6B A;  4DV7 T;  5AQP B;  4ERR A;  1H7C A;  4AIU A;  4PAG A;  2ES0 A;  4IST A;  2AE9 A;  3V5S A;  2J1D G;  5EK3 A;  1B7T A;  4HTE A;  3TLS A;  4LFC T;  2IIU A;  2VVS A;  5IYZ E;  5C2T A;  3CKD A;  5L3G B;  1WYC A;  2CEA A;  5IHY A;  2W66 A;  3ZMV B;  3ZT6 A;  3K3Q C;  3P50 A;  5J1G A;  2V1D B;  2WB5 A;  1N34 T;  3B5M A;  4JLE A;  3IEE A;  5LJM A;  4LMK A;  4ZHQ E;  3AA6 B;  2WSS V;  3L09 A;  3AEF A;  4HN9 A;  2B76 A;  4MAL A;  3T1H T;  4EZH A;  2C0S A;  5JH7 E;  4A98 A;  5H6Q B;  3AEG A;  1QSD A;  2LE8 A;  1W0A A;  2UXN B;  5LHG B;  5LMU T;  4BJM A;  4GK5 E;  2Q9Q B;  2NTY A;  5HEJ A;  3ZYK A;  4IL4 A;  5LOV E;  1VCS A;  4X64 T;  4EV6 A;  2X9W A;  3KDS E;  1QLB A;  4NPP A;  3HI2 A;  4UV9 B;  1JNR A;  4QWN B;  3R6N A;  1OWA A;  3EI0 A;  3ZN0 B;  2VAS A;  2H88 A;  3EVY A;  1ZV4 X;  2K24 A;  3JCF A;  4ASK A;  3DP7 A;  5AQT B;  3S4U A;  2Q9Q A;  1WRD A;  4IRE A;  5A1L A;  2ZMA A;  4DV5 T;  1D1C A;  2VK9 A;  5J2T E;  3WAJ A;  4YFS A;  3F2E A;  5JDG A;  4DR4 T;  4AXP A;  4HFI A;  2L8K A;  2L3L A;  3NVO A;  3LBX B;  1IBL T;  4HFH A;  1HX8 A;  3OYX A;  3GWH A;  1MNE A;  3ZYM A;  2CBI A;  1FEW A;  4XAX B;  3CQX C;  4ZI2 C;  2YOE A;  2FJE A;  2DL1 A;  4O4I E;  1ZKE A;  1CUN A;  4P0B A;  4X62 T;  1WFD A;  3AA7 B;  2FBW A;  1VRB A;  2V6Y A;  2KLQ A;  2YK0 A;  4U31 A;  3CQC B;  3IA3 A;  2Y48 B;  1G8X A;  2HPL A;  1IZN B;  3CQG B;  3CPZ A;  4HFD A;  4DR7 T;  4IDO A;  3TLT A;  4BA9 A;  3AA0 B;  1W9R A;  3N9Q A;  4QH1 A;  3NZQ A;  4GYR A;  1IBK T;  2BG9 C;  4UV8 B;  4DV0 T;  3ETV A;  3C98 B;  3PUR A;  1IAP A;  1HS7 A;  2LKG A;  4X1I E;  2EHO A;  2KSR A;  3MAC A;  3PV0 F;  2ODV A;  2UXB T;  5AQO B;  1IBM T;  4NIQ A;  1HCI A;  3ZST A;  4HFC A;  5AQV B;  3FZM B;  2MAW A;  2M6I A;  5AQI B;  2JQK A;  2YEV C;  4HWD A;  1HG2 A;  4KHZ F;  3UUX B;  2BS2 A;  3AA1 B;  5JR9 B;  2JQH A;  5LXT E;  4AIS A;  4DV3 T;  1MIV A;  3ZC0 A;  1LRZ A;  4QX7 B;  2UUA T;  4JI5 T;  2H89 A;  3RC8 A;  4HE8 A;  1XMO T;  3MZK B;  4HWC A;  3RIU A;  3BQI A;  5CA0 E;  4HEA A;  3NZP A;  4LFA T;  1BR1 A;  5AQG B;  4NXM T;  4JI3 T;  3KV6 A;  5HXE A;  3ZT7 A;  2K5B B;  5AQM B;  5FP3 A;  4X66 T;  1XMQ T;  2QRX A;  2RP4 A;  4UF0 B;  2LSI A;  2XAJ B;  4H9P C;  2MTQ A;  3Q5X A;  4H9R C;  3PU8 A;  2UXX B;  4YHH T;  5LP6 E;  3ZMT B;  4BJN A;  3ZEF B;  4L9I A;  3KV4 A;  3OKQ A;  4YTM A;  3UT5 E;  2DI4 A;  1E1H B;  3CWZ B;  5LYJ E;  1D0X A;  5LGU B;  5JTG A;  2A9U A;  5DQV A;  2YKS A;  3QUJ A;  4QHO A;  5AQH B;  4Z90 A;  3QB5 K;  1Z8U A;  4C91 A;  3B13 A;  1SHZ C;  5F3J A;  2WU2 A;  4YSY A;  2E8I A;  3AE8 A;  1U5P A;  3AEA A;  2AXD S;  5J2U E;  2VWA A;  4F6R C;  2XQ7 A;  4YTP A;  2BBJ A;  2QGS A;  2XQY A;  3Q5E A;  2VKH A;  4X1Y E;  3ZCI A;  3VHL A;  3L8R A;  1XNR T;  3VKG A;  1KF6 A;  4TUY E;  5C3J A;  3I1A A;  1I6Z A;  4HGA A;  4OFZ A;  3AE7 A;  1ZP0 A;  2YDS A;  4EZ4 A;  3GMI A;  3RIF A;  4O4L E;  2X0Y A;  4HFE A;  3PUG A;  4CN1 A;  2DCF A;  2JPF A;  1T7S A;  2WU5 A;  2B1E A;  4DMW A;  4ANJ A;  3UFE A;  3NRX A;  4PK6 A;  2CCQ A;  2LJL A;  3AAI A;  1JNZ A;  3E0Z A;  1NEK A;  2KWH A;  4OYK A;  2WBL A;  4WNK A;  5HEO A;  3FBL A;  2SPC A;  2MYS A;  3HKC E;  4P1N A;  1MND A;  3N9N A;  2XAF B;  4IDQ A;  4NUU A;  2J62 A;  2XQ8 A;  3RIA A;  4X1K E;  2V26 A;  2H7V C;  3PUZ F;  4P09 A;  5JVD E;  2IDO B;  4WBN E;  4YT0 A;  1X9B A;  2Q9Q D;  2LLY A;  3JAE A;  2KXP B;  5FYM A;  3FB2 A;  3RKG A;  1HNX T;  5EK4 A;  4QH4 A;  3UU3 A;  3AE2 A;  3ABV A;  4H9O C;  4KMC A;  2D0U A;  2BKN A;  2XAG B;  3UU8 A;  4HKA A;  4OX9 T;  3IHR A;  1AJ3 A;  3UU4 A;  4CI1 B;  3SWH A;  3AED A;  5HEH A;  4YJ3 E;  3N9M A;  2XM2 A;  4ZOL E;  2WY2 A;  4DID B;  5BR8 T;  5LMN T;  2XQ4 A;  3RX6 A;  5JDN A;  1R8I A;  3FZF B;  3VRB A;  2BG9 E;  2H7O A;  1MMA A;  2HHH T;  2YN6 A;  3AE3 A;  2DNX A;  1FMV A;  4DR5 T;  3RGL A;  5L3B B;  4O2A E;  3RF1 A;  1M7K A;  3UUL A;  5FXV A;  2VVN A;  5LA6 E;  3CVR A;  4HWH A;  3I9Y A;  3ZN1 B;  2XQA A;  2BZB A;  3QOF A;  4DV2 T;  4PJN A;  2NP9 A;  3RRC A;  4JI2 T;  5JDF A;  4EGW A;  2XQ5 A;  3P8C D;  2MPK A;  2EHO D;  1US7 B;  4CN4 A;  1WLX A;  2CMR A;  2XY8 B;  4LMJ A;  3H3A A;  4O4J E;  4LML A;  4GKJ T;  2CXF A;  2XSB A;  4IDP A;  3EAM A;  5LCY A;  5L3F B;  4DV1 T;  1UUS A;  3ZC1 A;  4QXC B;  5ABF B;  1DU2 A;  3R84 B;  4IE0 A;  4TNW A;  3C51 A;  2BVM A;  3F57 A;  1YXR A;  2X67 A;  3IBP A;  4IDZ A;  5DQW A;  4HWF A;  2A3D A;  3PTR B;  4DUY T;  3KV5 A;  1YQ4 A;  3AEC A;  4K0U A;  2LOS A;  4KP3 C;  2CPT A;  4ZEY A;  1LVF A;  1NAF A;  4ZI3 D;  2E5L T;  3TLV A;  5AQR B;  3BK9 A;  2QA7 A;  2XPK A;  4HFV A;  3HL6 A;  4X20 E;  5ABF A;  2BG9 A;  4OK0 A;  1XDP A;  4X65 T;  2JMH A;  4U7Y A;  3NRY A;  1OED C;  2NWB A;  2K3W A;  2WDQ A;  1KFY A;  5FXX A;  3PDY A;  2D2S A;  4TN7 B;  4CI3 B;  4O8S A;  2V5D A;  4LFB T;  3TKL B;  2N1G A;  4JI6 T;  2VUR A;  4QXH B;  1KK7 A;  4EXT A;  3RRW A;  4TV8 E;  4IE7 A;  2WMN A;  3ONJ A;  2VL0 A;  3F31 A;  2XTL A;  2W63 A;  5J0Z A;  2WWV A;  5IUX A;  2V7I A;  4IGU A;  3UU6 A;  3CML A;  2G0U A;  1MMD A;  2WMO A;  1YKH B;  3LSV A;  4QX8 B;  2X66 A;  2V6Y B;  4UVA B;  3QNU A;  3HKD E;  5HXS A;  1EZ3 A;  2MBG A;  1BR4 A;  4CXW A;  3VR8 A;  5TAO A;  1J1J A;  2BS4 A;  3JC6 D;  4IE6 A;  2L9Q A;  1N36 T;  2KIN B;  3JAD A;  3TLU A;  4NUV A;  3ZMS B;  3ZPO A;  2BVL A;  4OYJ A;  2ACZ A;  4PW8 A;  4O4H E;  2Y6X A;  3VU7 H;  2E9X C;  1Y01 A;  2C5I T;  2YIN A;  2LHN A;  3PUW F;  2EHO B;  3C64 A;  1UX4 A;  3RH3 A;  4DV6 T;  2X9X A;  2YDQ A;  3LK3 B;  4U74 A;  5FKY A;  2X0H A;  2I0M A;  2IHR 1;  2A72 A;  3PUY F;  3AAA B;  3T8O A;  2NOX A;  5LB7 B;  5ABG A;  3NBX X;  1HG5 A;  2BBH A;  4CZZ B;  2WP9 A;  5EZY E;  2ZM2 A;  4WBO A;  5HXC A;  4DV4 T;  3A7M A;  2CRB A;  4A5X A;  2UXD T;  3O1H A;  4CXY A;  1VOM A;  2WDV A;  3NWI A;  4N78 D;  2CXL A;  3UUB A;  4O2B E;  3DJB A;  4KBM B;  2UUC T;  4YXD A;  2W2U A;  2W61 A;  4ZS2 A;  3LK2 B;  2IC6 A;  2WQY A;  4DR1 T;  2LT3 A;  3MKD A;  5L2L A;  3IF8 B;  3M65 A;  4H63 H;  3ESL A;  4ILU A;  2WWU A;  2RPA A;  3E08 A;  3PUA A;  5JDL A;  3Q5D A;  2NW9 A;  4JUY A;  2QYW A;  3X1D A;  2V6X A;  3FXD B;  2NTX A;  2E5V A;  4IDN A;  2W4X A;  5H6R B;  2N9D A;  3J9X 1;  4GKK T;  2ACX A;  1NWM X;  2D9D A;  3LFM A;  5LHI B;  4KUM B;  4MFR A;  5L4E A;  3KVA A;  1SUM B;  3O9X A;  4FI5 A;  1N32 T;  2Q9Q C;  4PJL A;  2ZM6 T;  5HXR A;  2K9A A;  5HAX A;  3V5U A;  4Z8X A;  1YQ3 A;  4U2Y A;  2VL8 A;  4LF9 T;  4CN6 A;  2LKH A;  4UXN B;  4JI4 T;  1LVK A;  4AQF C;  5JDM A;  4PK5 A;  1MIW A;  3AEE A;  3AVS A;  1ZHC A;  3N9O A;  2ODU A;  1NEN A;  2NW7 A;  1MIY A;  3OVU A;  3ZJ1 A;  2CLY B;  3AE5 A;  2YU2 A;  3A8Y C;  3B57 A;  2XSA A;  1D1A A;  4AKL A;  3PUX F;  5LG3 A;  3NKZ A;  1HR0 T;  3OBV E;  3RQW A;  4ADZ A;  4DBQ A;  1YW0 A;  1HNW T;  3RYC E;  3K3N A;  5CJ5 A;  4B6X A;  5IWA T;  2M67 A;  3VR9 A;  4ZXL A;  1Z0P A;  3P4Q A;  4ZI2 D;  3PE0 A;  5FL0 A;  1UUR A;  4A56 A;  5HCM A;  1ZOY A;  2E2A A;  1YKE B;  2NW8 A;  5AQF B;  4XZC A;  3MXZ A;  3VKH A;  4TZ4 C;  3J7Y q;  2IUB A;  4EIW A;  5HEG A;  5FNV E;  1D0Z A;  2CHO A;  3RYF E;  5JRC A;  3LK4 2;  2DWG A;  4DUZ T;  3AB3 B;  2UUB T;  3CX8 B;  5FXW A;  3KBU A;  3UUM A;  3Q2M A;  1G73 A;  4X5T A;  4A97 A;  4IL9 A;  1HF8 A;  2D5U A;  2WDR A;  1UX5 A;  4PNI A;  4ZI3 C;  3EAB A;  3AEB A;  4YTN A;  4B3R T;  4M1P A;  3HKB E;  2GK9 A;  3O1I A;  5JR9 C;  5DAB A;  5L3E B;  3ZKR A;  4PFO A;  4DBR A;  3KVB A;  2HN1 A;  3Q5W A;  2KT9 A;  1XWM A;  4LF8 T;  4E7Z A;  2DHR A;  3ANW B;  3GN5 B;  2Y8D A;  2XAS B;  1WR6 A;  2PFV A;  3AXJ B;  1LKX A;  4L0R A;  2IML A;  3ONL C;  3UQ7 A;  4OHF A;  2NR4 A;  4U33 A;  2OA5 A;  5KXJ A;  2VKO A;  2F4V T;  3HR0 A;  4H9S E;  1OED A;  2V7L A;  2W62 A;  3ANW A;  5BMV E;  3N5L A;  3GN5 A;  3ZLI A;  4TWH A;  4H9Q C;  4KX6 A;  3AXJ A;  5HCJ A;  4F8H A;  4WYV A;  3RI5 A;  4TX5 A;  2CXD A;  1S94 A;  3RHW A;  1KNZ A;  3FZH B;  1J5E T;  2WCA A;  3PUS A;  3M3Z B;  1N33 T;  5ABE A;  4UVB B;  1MMN A;  4U72 A;  1T8B A;  3PUV F;  4WZX A;  2OV9 A;  3GA8 A;  4DO0 A;  5ABH A;  1U4Q A;  1J5W A;  1IJ6 A;  3ONX A;  4JI1 T;  1W09 A;  2WM9 A;  3AVR A;  3BQL A;  2KMF A;  5F8P A;  5GON E;  2BDE A;  3FZK B;  3CK6 A;  4ZZC A;  3RLF F;  3AE1 A;  1M62 A;  3Q9D A;  3MK7 C;  3LJC A;  4YY3 T;  1FJG T;  4KI0 F;  3LDQ B;  2BG9 B;  4J2C A;  3RC3 A;  4UIG A;  2R6G F;  4G63 A;  5LG4 A;  4YSZ A;  2E9X A;  3UUN A;  2LSG A;  4IIJ E;  4U3C A;  3P7I A;  1W0B A;  2JIW A;  2LRK A;  5F5W A;  5AQK B;  2XAH B;  3AAE B;  3CX6 B;  4ISS A;  2HPJ A;  4IE5 A;  2A2F X;  4COF A;  1GQE A;  5CA1 E;  4EB6 E;  5HWY A;  3W15 B;  1UK5 A;  3LG7 A;  4TWD A;  2XQ3 A;  3RYI E;  3N2K E;  2WAU A;  4AQY T;  2V7M A;  5JDQ A;  3PU3 A;  2FUP A;  5FVL A;  4LF6 T;  5FXZ A;  5LHH B;  3E22 E;  5E0O A;  3I0Q A;  2I59 A;  4PK4 A;  3TLW A;  3FBZ A;  4G2A A;  5AQJ B;  2JRK A;  2RA1 A;  4TNV A;  2Z6E A;  2KND A;  1S35 A;  3ZT5 A;  1UGO A;  1BR2 A;  5AFU L;  3G06 A;  4I4T E;  4QXB B;  1SE7 A;  3SS1 A;  2X51 A;  4Q25 A;  4K0K T;  4UVC B;  1KNP A;  4MHC A;  1HX1 B;  1D1B A;  4U2Z A;  4YJ2 E;  3P4R A;  4BAY B;  5FL1 A;  3OTO T;  3OPC A;  3L3P A;  3U78 A;  2CBJ A;  3C4Z A;  4LF4 T;  2ZM8 A;  3N2G E; 
#chains in the Genus database with same CATH homology
 2V6Y A;  3ZT6 A;  2JQK A;  4IT4 A;  2CRB A;  2LRK A;  4U31 A;  4A5X A;  4CN1 A;  4P1N A;  4U2Y A;  4U2Z A;  3ZSS A;  4U7I A;  2DL1 A;  4U7Y A;  4CN6 A;  2MPK A;  2CPT A;  5FVK A;  2V6Y B;  5LB7 B;  4ZEY A;  2A9U A;  2WY2 A;  2LRL A;  5CJ5 A;  4CN4 A;  2K3W A;  3EAB A;  2RPA A;  2JQH A;  2XZE A;  4NIQ A;  4WZX A;  3ZT5 A;  1WFD A;  1YXR A;  3K1S A;  3ZST A;  1WR0 A;  5FVL A;  1WCR A;  4U33 A;  3ZT7 A;  2V6X A;  4U3C A;  5CGM A;  2W2U A;  2JQ9 A;  2WWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...