3W15B

Structure of peroxisomal targeting signal 2 (pts2) of saccharomyces cerevisiae 3-ketoacyl-coa thiolase in complex with pex7p and pex21p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
72
Chain Sequence
b'SELQRIATDIVKCCTSSSVESKLSESKFIQLMRNISSGDVTLKSELFSSNNGELVGNRHIFVKDEIHKDILD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisomal targeting signal 2 receptor
publication title Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 20
structure length 72
sequence length 92
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3w15B00
3W15B
chains in the Genus database with same CATH superfamily
4IDQA 2CBJA 4I50E 2Y8DA 3P4SA 4U7YA 1J5ET 2A3DA 4JI3T 3WAKA 2YDQA 4ILCA 2J4GA 4MFRA 3P7IA 2ZM6T 4AKRB 4A98A 4ADZA 1SA0E 4QXCB 2JQ9A 3QB5A 2X0HA 3PUYF 4KHPT 2V7MA 2E8IA 1D0YA 3R6NA 1YKHB 4YTNA 2CE7A 4AKGA 5L3CB 3RRCA 1UGOA 2BG9B 3NZPA 3KINB 1WCRA 1N36T 4QHOA 2NP9A 3MACA 4JI5T 4M1PA 5CFBA 1W09A 5HEOA 4KBMB 4WBOA 2BBJA 4LFBT 3IA3A 3N5LA 1MNEA 4DMVA 4IT4A 4F8HA 5L4EA 3C4ZA 4IGUA 4Z90A 4A5XA 4ZZBA 2WU5A 4HEAA 4DR7T 2QGSA 1KNZA 3I0OA 2EHOC 4L9IA 4MLKA 3PUGA 3B13A 1YD8G 3PUQA 5LGUB 3NKZA 4HFVA 4KP3C 3UU6A 1UCUA 5ABFA 2XQ5A 2HH7A 5JDGA 4GK5E 3GWHA 3RPUA 2W00A 4IE6A 3DP7A 3FBLA 3QC9A 4PJJA 3ONJA 1W0BA 2KINB 3HKCE 3ZCJA 5LA6E 1Y01A 5KX5E 4DVDA 4EGWA 4ZI2C 3U78A 4AQFC 2E2AA 3ZT6A 1O3XA 4DV6T 3O1JA 5LG3A 2JPFA 4A97A 3F57A 2JIWA 2L3LA 4ZS2A 3JADA 1EZ3A 5C2TA 2LM9A 1JNRA 3HL6A 3ZC1A 1H7CA 4DR6T 2X66A 4CQIA 2HHHT 2XM2A 5FL0A 4OYKA 4EEDA 3H37A 3ETVA 3DJBA 4QH1A 2FBWA 3HR0A 2X0LB 3AE1A 5FKYA 5LBMA 2KWHA 4QKNA 3FZHB 5AQNB 3B57A 1HG2A 4BJMA 2XTLA 5LB7B 5EK3A 3KFWX 3MXZA 3PUWF 2N9DA 1J5WA 3ZMSB 4NIQA 3CK6A 3E08A 3LDQB 3FZMB 3C4XA 2V1DB 4JI0T 4NUVA 3FZKB 4G63A 3L39A 2M67A 5JDQA 3NRYA 3WI3A 1E1HB 2DWGA 5AQIB 5CA0E 5DABA 2LHRA 3GA8A 3RC3A 5LCYA 4DV1T 2W2UA 4X5TA 2E9XB 3LSVA 3SS1A 1V9DA 3HI2A 3AAIA 4IDPA 3K1SA 3AXJA 5J2UE 1S35A 3LK2B 3RGLA 4OFZA 3AXJB 2VURA 3VR8A 4PJMA 3OBVE 4U33A 1HCIA 4PW8A 5LHHB 5HCMA 1YXRA 2W63A 1E2AA 4H9SE 5J0ZA 1BR4A 3TLVA 2UXBT 5IHYA 4IIJE 4HWFA 2KNDA 2K5BB 5JDNA 1AJ3A 2XQ9A 4LF6T 4B6XA 5KMGP 4ANJA 1G73A 1MMDA 2ACZA 3E0ZA 2XAQB 4AKLA 2V7JA 3UT5E 1MIYA 4JBWF 4PAGA 1XDPA 3ONXA 4WZXA 4AIUA 3V5SA 4YLHA 4U31A 3AECA 5HXHA 5HEUA 2BVMA 2EHOD 4ZOLE 5AQPB 2WSSV 3RKGA 4IL4A 4ILAA 3CPZA 2NTXA 3BQIA 3TKLB 2X9HA 4YY3T 2FJEA 1Z0PA 4LMKA 3N9LA 1I6ZA 1WLXA 3A7MA 2V6XA 4PJNA 3AE7A 2IHR1 3AE3A 3H3AA 2V6YB 2VWAA 4U2YA 1BR2A 2F4VT 3RLFF 3MK7C 4FI5A 1IBLT 4JEHB 5EZYE 4H9RC 2LLYA 4QX8B 4TV8E 2ZM0A 3AE4A 1Z8UA 2YEVC 1XZYA 4F6RC 3C4WA 5LXTE 3VKHA 2PG8A 2WZIA 4L5GA 2VKHA 3UQ7A 4JI8T 3T1YT 2B76A 5AQQB 3NWIA 5FP3A 2CLYB 4H9QC 3OKQA 1MIWA 2WWUA 2NOXA 2W62A 3NVOA 2E5VA 4C90A 5FYMA 4QX7B 5LHIB 5HWYA 5CA1E 4JI1T 2VKDA 1QUUA 4ERRA 2XHEB 3VHLA 3EAMA 2IUBA 4DR4T 5JR9B 3HKBE 5JDLA 2LKGA 5JR9C 2DWKA 1IBKT 3SFDA 2IW5B 4JLEA 1MIVA 2CWOA 2K9AA 3RKOA 4KUMB 1D1AA 1FEWA 4JI6T 4X1YE 2UU9T 5DQVA 4PK5A 4CN6A 3RQUA 1UUSA 4XBFB 2JRKA 4LMJA 4UEMA 5KDMC 1OEDA 3FXDB 5FY0A 2J1DG 2XQ4A 2LJLA 1OEDB 2ODVA 2XM1A 1SHZC 1UX5A 4HFDA 2Q9QD 4UVCB 2Y48B 4IE5A 4ISTA 3RYFE 2KZ7B 4I4TE 2B1EA 2A72A 3DTOA 5L3GB 4YHJA 1YKEB 2V7LA 3RX6A 4HFHA 4K0UA 5FL1A 4AKIA 4B3ST 3J7Yq 5FVKA 4DV2T 2BKOA 3TLSA 2XASB 2KXPB 2WB5A 2NR4A 5HEJA 2MTQA 4ZI3D 5EK4A 3L8RA 3G06A 4QXHB 4P0AA 5AQFB 4UF0B 3UU3A 2UUCT 1NWMX 1BR0A 2W4XA 2NW7A 1VCSA 3NRXA 2HN2A 5L3DB 1U4QA 2G0UA 2QVAA 3C50A 2WU2A 3KVBA 5CJ5A 2VL0A 2WZHA 4C91A 2WWVA 4UIGA 1WFDA 2MBGA 3EABA 2JQHA 3AB3B 4E7SA 4UVBB 2VVNA 2DLRA 4EEBA 1IZNB 3SWHA 3ZLIA 2BG9A 4AXPA 3AEAA 2D9DA 4HGAA 3ZC0A 3UUXB 2DNXA 5FY7A 3V5UA 3T1HT 3ZSTA 3Q5XA 5LJNA 5L47A 3LK42 5L4HA 2XAFB 3LK3B 4CXXA 3RIUC 2XQ3A 3AE6A 4U3CA 2YK0A 3UTKA 2VKOA 2EHOB 3AAEB 3N2GE 3ZYLA 4O8SA 3S4UA 3JAFA 2UXCT 3ZMUB 5F5WA 2V5CA 2VQET 3AEBA 5AFUL 3PDYA 4UVAB 2CXFA 5AQMB 1CHUA 2YINA 2BZBA 1FIOA 4GKKT 5AQGB 5AQOB 4GYSA 5JREA 2NWBA 4ILBA 3C98B 4O2BE 4OHFA 4CXYA 5FXWA 2YN6A 4LF8T 3I1AA 2V8SV 5CB4E 4H9NC 4U2ZA 4A56A 3P50A 3P8CD 3ZT7A 1NAFA 2BS3A 3K3NA 4IDOA 5J2TE 2E5LT 5JRCB 1KNRA 2MYSA 3PE0A 3OVUA 4O4HE 4GIWA 5DQWA 1T7SA 2XQYA 4X1IE 3PURA 4L0RA 5HXCA 3ABVA 3CMLA 4IE7A 5JDMA 4LF9T 1NENA 2ZLYA 4U72A 4CXWA 2WS3A 4IREA 2X9XA 4GOUA 2N1GA 4QWNB 1R8IA 1T72A 3U3IA 4MALA 4Z8XA 4H9PC 1XWMA 1LVFA 5HXRA 3P4PA 4TX5A 1US7B 2BKNA 2YOEA 1JNZA 4K0KT 1KF6A 3CX7B 2V7KA 2UXDT 3RRWA 4NXNT 2XAJB 1N32T 3CWZB 2LSIA 3HA4A 5BMVE 4YXDA 3AA7B 1FMWA 2Z6EA 1IBMT 4EZHA 1LVKA 2Q9QB 2OLTA 4PFPA 5L3BB 2Q9QC 3QK6A 3K8PC 2DL1A 3RHWA 2LRLA 2A2FX 3EHZA 1E7PA 3RIFA 1M7KA 3RC8A 2HN1A 1MNDA 4LFAT 4TWFA 2JJ9A 2IDOB 3PJAJ 5J1GA 1XMQT 3IHRA 2E9XA 1M62A 3ANWB 2FJAA 1IJ5A 5GONE 4YHHT 2C0SA 1KFYA 2XY8B 4V1Av 2LEHA 2XAGB 1YQ4A 2CRBA 3PUSA 2CHNA 3Q2MA 2LOSA 4ZI3C 5DJQC 2KWIB 3PV0F 2JMHA 5FY1A 2LSKA 4TN7B 4XZCA 4EB6E 4P09A 3PUAA 2NW9A 3AEFA 1VRBA 3L09A 2IC9A 2J62A 2X67A 4HWIB 1HR0T 2VL8A 2XPKA 4CN4A 3KBTA 3LJCA 4AI6A 5IUXA 4PK6A 5JDHA 3CIRA 3PUZF 3UU8A 2WCAA 4U74A 3HKDE 4PK4A 4TWDA 1Y64B 5ABEA 4GKJT 3ZMZB 4UXNB 1G8XA 3O1HA 5AQHB 4JI4T 5LBQB 2P9BA 3PJAA 4PJLA 2H89A 4IHJE 3AVSA 5C3JA 2V6YA 4EAHA 4H63H 3SOLA 1ZHCA 2BS4A 2XQ8A 3UUNA 3KDSE 5TAOA 2KT9A 1T8BA 3N9NA 4HFEA 1LRZA 4MBQA 2GK9A 2WBLA 3ZN1B 4NPPA 5IWAT 2H3RA 1HX8A 1X79A 2ODUA 1HNZT 4JUYA 3UULA 3OTOT 2BS2A 3M65A 2RP4A 2XQAA 2WP9A 3CX8B 2XSAA 4JEUB 1FMVA 4DUZT 4E7ZA 2BKPA 3WAJA 2A9UA 3I9WA 1UURA 5LP6E 2VQFT 4CI1B 2H7OA 3JC6D 4J2CA 3IBPA 3AVRA 3C64A 5JR9A 1SUMB 3O1IA 3VRBA 1W0AA 3B5MA 3VKGA 2D2SA 2IMLA 1VCTA 2VKJA 1XDOA 5HAXA 5LGNB 4U7IA 3EDVA 3W15B 4ZXLA 2XSBA 5HYAA 5ETWA 3UFGA 4LF4T 5AQSB 5FMNA 5ADXL 3ZMTB 4ZEYA 3EUHA 1WYBA 2WDRA 4ISSA 3VR9A 3C51A 4DR2T 2VVSA 3OYZA 4O4LE 1D1CA 5AQVB 3P4WA 4WNKA 5LG4A 3ZN0B 4TNWA 3MZKB 3EI0A 3N9OA 3ZYKA 3N2KE 4NUUA 4CI2B 2LRKA 2CBIA 4ZHQE 3ZMVB 5HCJA 5ABHA 5FXXA 3F2EA 4AISA 2MPKA 2PFVA 4B3MT 4X20E 4UV8B 3O9XA 1KNPA 5LYJE 2X0YA 3FZLB 4AKHA 4UF0A 2HPJA 2K3WA 3QUJA 3BQKA 4GK0E 2LOPA 4ZI7E 3CKDA 4I43B 3QNUA 4TV9E 2AXDS 2D0TA 2XQ6A 1ZP0A 2MAWA 2M6IA 3JAEA 5CGMA 1HNXT 1D0XA 3O4XE 4LF7T 4HE8A 4P0BA 3AA1B 4H9OC 3TLTA 2VK9A 1B7TA 3Q5DA 1XNQT 2IC6A 5LMNT 3N2OA 2CPTA 2IAKA 1QSDA 2D0UA 4X62T 2BG9E 4COFA 4TUYE 3QOFA 3PUXF 4H63V 5HEHA 4YTMA 4HN9A 2KMFA 2X51A 2LT3A 2M6BA 3FZFB 4FJOA 3RI5A 2JMKA 3SFEA 4EYUA 3D0TA 4YSXA 2BG9C 2JQKA 5LOVE 4DR5T 3RIUA 4QH5A 2I6HA 2WY2A 4OYJA 2EHOA 3CQXC 3ZSSA 2L8KA 4XAXB 5IYZE 2LSGA 4QXBB 3PTRB 4NXMT 4DV3T 4EXTA 2ZMAA 2WQYA 5F8PA 4EV6A 3FHNA 4HFIA 4KHZF 1HS7A 3ZCIA 2I59A 3ZJ1A 2YDRA 5LJMA 2PBIA 3PUVF 2JQQA 3T8OA 4TNVA 2UXXB 5LMUT 4JI2T 2YU1A 4HKAA 3Q5EA 4KMCA 4TWHA 3RIAA 5AQTB 4YSZA 1HNWT 4YT0A 4AQFA 5ABFB 3UUMA 3OJAA 4EYYR 5A1LA 3ZT5A 3I9YA 4JYAT 4PFOA 3ZEFB 5HEGA 2XQ7A 5LGTB 5JRCA 4X65T 4P1NA 5H6QB 2V5DA 3KV5A 4QH4A 4OX9T 4UR9A 3GN5A 5LNKA 3GN5B 5FVLA 5ABGA 4YJ2E 4X66T 5HXSA 1XNRT 4DO0A 5C8YE 2VASA 3AA0B 3KV9A 3CQCB 2XUEA 4DUYT 3Q9DA 4DMWA 2CA5A 4B3TT 2CXLA 5HXEA 3PU8A 3UFEA 1XMOT 1T98A 1MMNA 3JC6C 2WDQA 5BR8T 2YU2A 3AEGA 2C5IT 3EVYA 3TLUA 1L0VA 1OWAA 3K3QC 1IAPA 4BA9A 4IDNA 3AEDA 3K3OA 3NZQA 3MKDA 3CX6B 3N9QA 1CUNA 3L3PA 2I0MA 4LMLA 5EK2A 3KV6A 2LE8A 4CZZB 4DNDA 3IEEA 3BQLA 3J9X1 2LM2A 2NTYA 1X9BA 2W67A 2Q9QA 3HKEE 3RF1A 3Q5WA 2UUAT 3X1DA 2XZEA 5JVDE 1W9RA 4YFSA 4KI0F 4DV5T 3PU3A 1WRDA 1ZOYA 4UV9B 1KEYA 2X9YA 3UQ4A 3CVRA 3P4RA 4X1KE 3ANWA 4CI3B 2DI4A 3UU5A 5JTGA 1QLBA 2CWYA 2OV9A 2XAHB 3FXEB 2WM9A 1I94T 4AQGA 1GQEA 2VB6A 3AE2A 1HX1B 3LG7A 5L3FB 3P4QA 1SE7A 4HFBA 2E9XC 2H7VC 4EZ4A 1ZKEA 4CN1A 3ESLA 4DV0T 5AQLB 2PJQA 1IJ6A 4PNIA 1DU2A 2BDEA 2J47A 4EOZB 4DR3T 4DV7T 4AQYT 3QB5K 2K24A 2CHOA 2WAUA 5FXZA 3CQGB 1HF8A 2ACXA 2YDSA 4WW0A 1WYCA 5F3JA 2D5UA 2FJBA 2K48A 4HWHA 3AE5A 3NBXX 2XJ7A 5FNVE 1WR6A 3LFMA 2QA7A 1MMGA 4DBQA 1NEKA 2MOZA 4KX6A 3VU7H 3ONLC 1ZEEA 4I55E 4N78D 3M3ZB 2C5JA 4G2AA 4DR1T 3ZPOA 3N9MA 1MMAA 3ZYMA 3JCFA 4IL9A 5E0OA 1D0ZA 4X64T 5JDFA 5JH7E 4LFCT 5HWXA 3MJXA 2RA1A 4OK0A 2N2NA 1BR1A 2UXNB 3GMIA 2CCQA 3N9PA 3ZKRA 3OPCA 2CMRA 4LF5T 1FJGT 4HFCA 2WMNA 3AE9A 2BVLA 1HTJF 4Z91A 3KV4A 4O4JE 2LKHA 2R6GF 2W61A 4Q25A 3AEEA 4ZI2D 2WMOA 4HTEA 2AE9A 4BAYB 4EIWA 1HFAA 4MHCA 3UU4A 1VOMA 2DHRA 4DBRA 5H6RB 2C5KT 5L3EB 3SRZA 5LHGB 3AA6B 2HPLA 1D1BA 1U5PA 2SPCA 5AQUB 2CLYC 3KBUA 4B3RT 2PTFA 4GYRA 2LHNA 1YQ3A 3AAAB 2W0GA 2QRXA 2CM0A 1OXZA 4IDZA 3KVAA 4JV5T 3I0QA 4ZS3A 1N34T 2WDVA 4JI7T 4WBNE 1S94A 1OEDE 4BJNA 5FXVA 3OYXA 5M4YA 5KXJA 3UUBA 4YJ3E 3A5XA 1KK7A 2X9WA 4ASKA 4I0UA 2Y6XA 4HWCA 2LSJA 3LBXA 4YSYA 2NW8A 5AQKB 4YTPA 2ZM2A 1N33T 3LBXB 3EDUA 2X68A 3A8YC 2W66A 3RYHE 4ILUA 1OEDC 2QYWA 5AQRB 3RYCE 2IIUA 1YW0A 1ZV4X 1UK5A 2ZM8A 3ETUA 2H88A 2YKSA 2DCFA 3E22E 2KLQA 3VRAA 3RQWA 2RPAA 2KSRA 2L9QA 2ES0A 2E9XD 2FJDA 3MA9A 3FBZA 4IE4A 3BK9A 3H3MA 4DIDB 3RH3A 2LSYA 3F31A 4DV4T 3R84B 4ZZCA 4O4IE 1UX4A 3AE8A 4WYVA 4UELA 5L2LA 2FUPA 2BBHA 2UUBT 3FB2A 2CXDA 1HG5A 4TZ4C 3ZJ2A 1LKXA 4O2AE 2V26A 2V7IA 2OA5A 1J1JA 3IF8B 1WR0A 4HWDA 5AQJB 5JQGE 3TLWA 4IE0A 3RYIE 2CEAA
chains in the Genus database with same CATH topology
2XHEB 2NW9A 4DO0A 5C8YE 2VASA 3AA0B 3VHLA 4I50E 2Y8DA 3KV9A 3CQCB 2XUEA 2A3DA 3Q9DA 1VRBA 3WAKA 4DMWA 5JR9B 2CA5A 3HKBE 5JDLA 3L09A 2IC9A 5JR9C 2DWKA 4MFRA 2CXLA 3P7IA 2IW5B 4JLEA 5HXEA 2X67A 3PU8A 3UFEA 1MIVA 2CWOA 4AKRB 4ADZA 1SA0E 2K9AA 2VL8A 3RKOA 4QXCB 4KUMB 1T98A 1MMNA 3KBTA 3JC6C 3LJCA 1D1AA 1FEWA 2YU2A 4X1YE 2C5IT 5DQVA 4AI6A 2V7MA 2E8IA 1D0YA 3EVYA 3R6NA 1YKHB 1OWAA 2CE7A 4PK6A 4PK5A 5JDHA 4AKGA 3K3QC 5L3CB 3RRCA 1IAPA 4XBFB 4U74A 3HKDE 4BA9A 2JRKA 3NZPA 4PK4A 3KINB 4UEMA 5KDMC 1Y64B 3FXDB 5FY0A 2J1DG 3K3OA 3NZQA 2LJLA 4QHOA 2ODVA 3MKDA 3CX6B 3N9QA 3ZMZB 2NP9A 1CUNA 3MACA 1SHZC 3L3PA 4M1PA 4UXNB 1G8XA 1UX5A 3O1HA 4KBMB 2Q9QD 5EK2A 4UVCB 4WBOA 5LBQB 2P9BA 2Y48B 3KV6A 4IE5A 4ISTA 2LE8A 4CZZB 4PJLA 4DNDA 3IEEA 3RYFE 2KZ7B 3N5LA 4IHJE 3BQLA 4I4TE 3J9X1 2B1EA 2A72A 3DTOA 3AVSA 2NTYA 5L3GB 1MNEA 4DMVA 4YHJA 4EAHA 4H63H 1YKEB 2Q9QA 2V7LA 3C4ZA 3HKEE 3RX6A 3SOLA 1ZHCA 4IGUA 3Q5WA 4K0UA 4HEAA 5JVDE 4AKIA 2QGSA 1KNZA 3UUNA 3J7Yq 4YFSA 3I0OA 2EHOC 4L9IA 4MLKA 3PUGA 3KDSE 3PU3A 3B13A 5TAOA 2KT9A 1WRDA 1YD8G 4UV9B 3N9NA 3PUQA 5LGUB 2XASB 4HFVA 2KXPB 1LRZA 4MBQA 2GK9A 4KP3C 2MTQA 2X9YA 2WBLA 3CVRA 4X1KE 3ANWA 1UCUA 4CI3B 2DI4A 2HH7A 5EK4A 4ZI3D 5JDGA 3ZN1B 4GK5E 2H3RA 1HX8A 1X79A 2ODUA 4QXHB 4P0AA 3GWHA 4JUYA 3UULA 2CWYA 4UF0B 3RPUA 3M65A 2W00A 2XAHB 3FXEB 2WM9A 2RP4A 4IE6A 4AQGA 3DP7A 3FBLA 3QC9A 1NWMX 4PJJA 3CX8B 2VB6A 2KINB 4JEUB 1FMVA 3HKCE 3ZCJA 3LG7A 1BR0A 5LA6E 5L3FB 4E7ZA 5KX5E 2NW7A 2E9XC 2H7VC 3NRXA 4EZ4A 3WAJA 5L3DB 4DVDA 1ZKEA 3ESLA 4ZI2C 3U78A 3I9WA 4AQFC 5LP6E 1U4QA 2PJQA 1IJ6A 4CI1B 2G0UA 3C50A 4PNIA 3KVBA 2H7OA 1O3XA 3JC6D 4J2CA 3IBPA 2BDEA 3AVRA 3C64A 5JR9A 3O1JA 4C91A 2JPFA 4EOZB 4UIGA 3O1IA 3VKGA 2MBGA 2D2SA 3F57A 3AB3B 4E7SA 2L3LA 2K24A 2WAUA 5FXZA 4ZS2A 3CQGB 1HF8A 4UVBB 1EZ3A 2DLRA 2LM9A 2ACXA 2VKJA 5HAXA 3HL6A 5LGNB 3ZC1A 3EDVA 1H7CA 3W15B 1IZNB 1WYCA 2X66A 4WW0A 4CQIA 5F3JA 2D5UA 2K48A 3SWHA 4OYKA 5HYAA 5ETWA 3ZLIA 3H37A 4AXPA 3ETVA 3DJBA 3HR0A 5FMNA 5ADXL 2X0LB 3ZMTB 3NBXX 5FNVE 1WR6A 3LFMA 3EUHA 4P09A 1WYBA 4HGAA 2QA7A 5LBMA 3ZC0A 1MMGA 2KWHA 4ISSA 3UUXB 4DBQA 4QKNA 2DNXA 5FY7A 3V5UA 2MOZA 3C51A 3VU7H 3Q5XA 5LJNA 3B57A 1HG2A 1ZEEA 4I55E 4N78D 2C5JA 3OYZA 4G2AA 2XTLA 4O4LE 4BJMA 3ZPOA 1D1CA 5EK3A 3N9MA 1MMAA 4WNKA 5LG4A 3ZYMA 3KFWX 3MXZA 3ZN0B 3LK42 3MZKB 2XAFB 3LK3B 5E0OA 3N9OA 1D0ZA 3ZYKA 5JDFA 4CXXA 3N2KE 5JH7E 2N9DA 4NUUA 5HWXA 3MJXA 3ZMSB 4CI2B 2RA1A 4OK0A 2N2NA 1BR1A 2UXNB 2YK0A 3UTKA 2VKOA 2EHOB 3E08A 3AAEB 4ZHQE 3ZMVB 3N2GE 3C4XA 5FXXA 2V1DB 3GMIA 3ZYLA 2CCQA 3N9PA 3F2EA 4NUVA 4G63A 2CMRA 4O8SA 3S4UA 2PFVA 3ZMUB 2WMNA 4X20E 4UV8B 2M67A 5JDQA 3NRYA 2BVLA 3O9XA 1HTJF 5AFUL 5LYJE 3PDYA 3WI3A 1E1HB 3KV4A 2DWGA 4UVAB 4AKHA 5CA0E 2CXFA 2HPJA 4O4JE 4UF0A 2W61A 5DABA 2LHRA 3GA8A 3QUJA 3BQKA 2YINA 4GK0E 3RC3A 2LOPA 4ZI2D 2BZBA 2WMOA 1FIOA 4HTEA 4ZI7E 3CKDA 4I43B 4TV9E 4BAYB 4EIWA 1HFAA 5LCYA 4MHCA 2D0TA 1VOMA 2DHRA 4GYSA 5H6RB 4DBRA 2C5KT 2NWBA 5JREA 3C98B 2E9XB 4O2BE 5L3EB 4OHFA 3SS1A 1V9DA 3SRZA 5FXWA 4CXYA 5LHGB 3I1AA 3HI2A 5CB4E 3AAIA 3AA6B 1D0XA 1D1BA 2HPLA 4H9NC 1U5PA 3O4XE 2SPCA 4A56A 5J2UE 1S35A 4HE8A 3LK2B 4P0BA 3AA1B 4H9OC 3P8CD 4OFZA 2CLYC 1NAFA 4PJMA 2VK9A 1B7TA 3OBVE 3K3NA 3KBUA 1HCIA 5J2TE 4PW8A 5LHHB 5JRCB 2MYSA 3PE0A 2W63A 4GYRA 2IC6A 2LHNA 4O4HE 4GIWA 3N2OA 3AAAB 2W0GA 4H9SE 2CM0A 1BR4A 5DQWA 2IAKA 1QSDA 1OXZA 5IHYA 4IDZA 2D0UA 3KVAA 3I0QA 4IIJE 4ZS3A 2KNDA 2K5BB 2XQYA 5JDNA 4X1IE 1AJ3A 3PURA 4L0RA 5HXCA 4TUYE 4B6XA 5KMGP 4WBNE 3CMLA 4IE7A 5HXSA 1S94A 4ANJA 4BJNA 5JDMA 1G73A 4H63V 1MMDA 5FXVA 3E0ZA 2XAQB 3OYXA 4HN9A 4AKLA 5M4YA 2V7JA 3UT5E 1MIYA 2KMFA 4YJ3E 2ZLYA 3A5XA 1KK7A 2X9WA 4ASKA 4PAGA 2X51A 2Y6XA 3ONXA 4U72A 4CXWA 2LSJA 3LBXA 2NW8A 2ZM2A 2X9XA 4GOUA 3V5SA 2LT3A 2N1GA 3LBXB 4QWNB 4FJOA 3U3IA 4YLHA 5HXHA 2JMKA 4MALA 4EYUA 4Z8XA 3EDUA 2BVMA 2EHOD 4ZOLE 3D0TA 4H9PC 2X68A 2WSSV 1LVFA 3CPZA 2NTXA 5HXRA 3RYHE 5LOVE 3PUAA 3BQIA 4ILUA 3TKLB 2X9HA 4TX5A 4OYJA 3RYCE 2EHOA 1YW0A 1US7B 1ZV4X 3CQXC 1Z0PA 2L8KA 4XAXB 2ZM8A 3N9LA 5IYZE 3ETUA 3CX7B 1WLXA 2LSGA 2V7KA 4QXBB 3PTRB 3RRWA 2XAJB 4PJNA 3CWZB 4EXTA 2LSIA 2ZMAA 3H3AA 3HA4A 5BMVE 3AA7B 5F8PA 1FMWA 2DCFA 2Z6EA 4EZHA 2VWAA 3E22E 3FHNA 1LVKA 2Q9QB 4PFPA 5L3BB 2KLQA 2Q9QC 1HS7A 3QK6A 3K8PC 1BR2A 3ZCIA 3MK7C 2L9QA 2I59A 2A2FX 3ZJ1A 2ES0A 2E9XD 4FI5A 4JEHB 5LJMA 5EZYE 2PBIA 4H9RC 3MA9A 2JQQA 3T8OA 3FBZA 4QX8B 4IE4A 4TV8E 3RC8A 3BK9A 1MNDA 2ZM0A 3RH3A 2UXXB 2LSYA 3F31A 2JJ9A 2YEVC 2YU1A 4HKAA 5J1GA 4F6RC 3C4WA 4KMCA 3R84B 3IHRA 5LXTE 2E9XA 4O4IE 1UX4A 3ANWB 4AQFA 1IJ5A 4UELA 3VKHA 5L2LA 2PG8A 5GONE 3UUMA 4L5GA 2VKHA 3OJAA 4EYYR 2C0SA 5A1LA 4V1Av 2LEHA 3I9YA 2XAGB 4PFOA 3ZEFB 3FB2A 2CXDA 1HG5A 4TZ4C 5FP3A 3ZJ2A 1LKXA 2CLYB 3PUSA 3Q2MA 4H9QC 3OKQA 4O2AE 1MIWA 5LGTB 2WWUA 2LOSA 2NOXA 2V26A 5JRCA 2V7IA 2OA5A 4ZI3C 5DJQC 5H6QB 3IF8B 2KWIB 2W62A 3KV5A 2JMHA 3GN5A 2LSKA 5FY1A 4C90A 5FYMA 4QX7B 5LHIB 5HWYA 4TN7B 5CA1E 5LNKA 4XZCA 2VKDA 3GN5B 1QUUA 4EB6E 5JQGE 4IE0A 3RYIE 2CEAA 4YJ2E 4ERRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W15 B; 
#chains in the Genus database with same CATH topology
 4IDQ A;  2CBJ A;  4I50 E;  2Y8D A;  3P4S A;  4U7Y A;  1J5E T;  2A3D A;  4JI3 T;  3WAK A;  2YDQ A;  4ILC A;  2J4G A;  4MFR A;  3P7I A;  2ZM6 T;  4AKR B;  4A98 A;  4ADZ A;  1SA0 E;  4QXC B;  2JQ9 A;  3QB5 A;  2X0H A;  3PUY F;  4KHP T;  2V7M A;  2E8I A;  1D0Y A;  3R6N A;  1YKH B;  4YTN A;  2CE7 A;  4AKG A;  5L3C B;  3RRC A;  1UGO A;  2BG9 B;  3NZP A;  3KIN B;  1WCR A;  1N36 T;  4QHO A;  2NP9 A;  3MAC A;  4JI5 T;  4M1P A;  5CFB A;  1W09 A;  5HEO A;  4KBM B;  4WBO A;  2BBJ A;  4LFB T;  3IA3 A;  3N5L A;  1MNE A;  4DMV A;  4IT4 A;  4F8H A;  5L4E A;  3C4Z A;  4IGU A;  4Z90 A;  4A5X A;  4ZZB A;  2WU5 A;  4HEA A;  4DR7 T;  2QGS A;  1KNZ A;  3I0O A;  2EHO C;  4L9I A;  4MLK A;  3PUG A;  3B13 A;  1YD8 G;  3PUQ A;  5LGU B;  3NKZ A;  4HFV A;  4KP3 C;  3UU6 A;  1UCU A;  5ABF A;  2XQ5 A;  2HH7 A;  5JDG A;  4GK5 E;  3GWH A;  3RPU A;  2W00 A;  4IE6 A;  3DP7 A;  3FBL A;  3QC9 A;  4PJJ A;  3ONJ A;  1W0B A;  2KIN B;  3HKC E;  3ZCJ A;  5LA6 E;  1Y01 A;  5KX5 E;  4DVD A;  4EGW A;  4ZI2 C;  3U78 A;  4AQF C;  2E2A A;  3ZT6 A;  1O3X A;  4DV6 T;  3O1J A;  5LG3 A;  2JPF A;  4A97 A;  3F57 A;  2JIW A;  2L3L A;  4ZS2 A;  3JAD A;  1EZ3 A;  5C2T A;  2LM9 A;  1JNR A;  3HL6 A;  3ZC1 A;  1H7C A;  4DR6 T;  2X66 A;  4CQI A;  2HHH T;  2XM2 A;  5FL0 A;  4OYK A;  4EED A;  3H37 A;  3ETV A;  3DJB A;  4QH1 A;  2FBW A;  3HR0 A;  2X0L B;  3AE1 A;  5FKY A;  5LBM A;  2KWH A;  4QKN A;  3FZH B;  5AQN B;  3B57 A;  1HG2 A;  4BJM A;  2XTL A;  5LB7 B;  5EK3 A;  3KFW X;  3MXZ A;  3PUW F;  2N9D A;  1J5W A;  3ZMS B;  4NIQ A;  3CK6 A;  3E08 A;  3LDQ B;  3FZM B;  3C4X A;  2V1D B;  4JI0 T;  4NUV A;  3FZK B;  4G63 A;  3L39 A;  2M67 A;  5JDQ A;  3NRY A;  3WI3 A;  1E1H B;  2DWG A;  5AQI B;  5CA0 E;  5DAB A;  2LHR A;  3GA8 A;  3RC3 A;  5LCY A;  4DV1 T;  2W2U A;  4X5T A;  2E9X B;  3LSV A;  3SS1 A;  1V9D A;  3HI2 A;  3AAI A;  4IDP A;  3K1S A;  3AXJ A;  5J2U E;  1S35 A;  3LK2 B;  3RGL A;  4OFZ A;  3AXJ B;  2VUR A;  3VR8 A;  4PJM A;  3OBV E;  4U33 A;  1HCI A;  4PW8 A;  5LHH B;  5HCM A;  1YXR A;  2W63 A;  1E2A A;  4H9S E;  5J0Z A;  1BR4 A;  3TLV A;  2UXB T;  5IHY A;  4IIJ E;  4HWF A;  2KND A;  2K5B B;  5JDN A;  1AJ3 A;  2XQ9 A;  4LF6 T;  4B6X A;  5KMG P;  4ANJ A;  1G73 A;  1MMD A;  2ACZ A;  3E0Z A;  2XAQ B;  4AKL A;  2V7J A;  3UT5 E;  1MIY A;  4JBW F;  4PAG A;  1XDP A;  3ONX A;  4WZX A;  4AIU A;  3V5S A;  4YLH A;  4U31 A;  3AEC A;  5HXH A;  5HEU A;  2BVM A;  2EHO D;  4ZOL E;  5AQP B;  2WSS V;  3RKG A;  4IL4 A;  4ILA A;  3CPZ A;  2NTX A;  3BQI A;  3TKL B;  2X9H A;  4YY3 T;  2FJE A;  1Z0P A;  4LMK A;  3N9L A;  1I6Z A;  1WLX A;  3A7M A;  2V6X A;  4PJN A;  3AE7 A;  2IHR 1;  3AE3 A;  3H3A A;  2V6Y B;  2VWA A;  4U2Y A;  1BR2 A;  2F4V T;  3RLF F;  3MK7 C;  4FI5 A;  1IBL T;  4JEH B;  5EZY E;  4H9R C;  2LLY A;  4QX8 B;  4TV8 E;  2ZM0 A;  3AE4 A;  1Z8U A;  2YEV C;  1XZY A;  4F6R C;  3C4W A;  5LXT E;  3VKH A;  2PG8 A;  2WZI A;  4L5G A;  2VKH A;  3UQ7 A;  4JI8 T;  3T1Y T;  2B76 A;  5AQQ B;  3NWI A;  5FP3 A;  2CLY B;  4H9Q C;  3OKQ A;  1MIW A;  2WWU A;  2NOX A;  2W62 A;  3NVO A;  2E5V A;  4C90 A;  5FYM A;  4QX7 B;  5LHI B;  5HWY A;  5CA1 E;  4JI1 T;  2VKD A;  1QUU A;  4ERR A;  2XHE B;  3VHL A;  3EAM A;  2IUB A;  4DR4 T;  5JR9 B;  3HKB E;  5JDL A;  2LKG A;  5JR9 C;  2DWK A;  1IBK T;  3SFD A;  2IW5 B;  4JLE A;  1MIV A;  2CWO A;  2K9A A;  3RKO A;  4KUM B;  1D1A A;  1FEW A;  4JI6 T;  4X1Y E;  2UU9 T;  5DQV A;  4PK5 A;  4CN6 A;  3RQU A;  1UUS A;  4XBF B;  2JRK A;  4LMJ A;  4UEM A;  5KDM C;  1OED A;  3FXD B;  5FY0 A;  2J1D G;  2XQ4 A;  2LJL A;  1OED B;  2ODV A;  2XM1 A;  1SHZ C;  1UX5 A;  4HFD A;  2Q9Q D;  4UVC B;  2Y48 B;  4IE5 A;  4IST A;  3RYF E;  2KZ7 B;  4I4T E;  2B1E A;  2A72 A;  3DTO A;  5L3G B;  4YHJ A;  1YKE B;  2V7L A;  3RX6 A;  4HFH A;  4K0U A;  5FL1 A;  4AKI A;  4B3S T;  3J7Y q;  5FVK A;  4DV2 T;  2BKO A;  3TLS A;  2XAS B;  2KXP B;  2WB5 A;  2NR4 A;  5HEJ A;  2MTQ A;  4ZI3 D;  5EK4 A;  3L8R A;  3G06 A;  4QXH B;  4P0A A;  5AQF B;  4UF0 B;  3UU3 A;  2UUC T;  1NWM X;  1BR0 A;  2W4X A;  2NW7 A;  1VCS A;  3NRX A;  2HN2 A;  5L3D B;  1U4Q A;  2G0U A;  2QVA A;  3C50 A;  2WU2 A;  3KVB A;  5CJ5 A;  2VL0 A;  2WZH A;  4C91 A;  2WWV A;  4UIG A;  1WFD A;  2MBG A;  3EAB A;  2JQH A;  3AB3 B;  4E7S A;  4UVB B;  2VVN A;  2DLR A;  4EEB A;  1IZN B;  3SWH A;  3ZLI A;  2BG9 A;  4AXP A;  3AEA A;  2D9D A;  4HGA A;  3ZC0 A;  3UUX B;  2DNX A;  5FY7 A;  3V5U A;  3T1H T;  3ZST A;  3Q5X A;  5LJN A;  5L47 A;  3LK4 2;  5L4H A;  2XAF B;  3LK3 B;  4CXX A;  3RIU C;  2XQ3 A;  3AE6 A;  4U3C A;  2YK0 A;  3UTK A;  2VKO A;  2EHO B;  3AAE B;  3N2G E;  3ZYL A;  4O8S A;  3S4U A;  3JAF A;  2UXC T;  3ZMU B;  5F5W A;  2V5C A;  2VQE T;  3AEB A;  5AFU L;  3PDY A;  4UVA B;  2CXF A;  5AQM B;  1CHU A;  2YIN A;  2BZB A;  1FIO A;  4GKK T;  5AQG B;  5AQO B;  4GYS A;  5JRE A;  2NWB A;  4ILB A;  3C98 B;  4O2B E;  4OHF A;  4CXY A;  5FXW A;  2YN6 A;  4LF8 T;  3I1A A;  2V8S V;  5CB4 E;  4H9N C;  4U2Z A;  4A56 A;  3P50 A;  3P8C D;  3ZT7 A;  1NAF A;  2BS3 A;  3K3N A;  4IDO A;  5J2T E;  2E5L T;  5JRC B;  1KNR A;  2MYS A;  3PE0 A;  3OVU A;  4O4H E;  4GIW A;  5DQW A;  1T7S A;  2XQY A;  4X1I E;  3PUR A;  4L0R A;  5HXC A;  3ABV A;  3CML A;  4IE7 A;  5JDM A;  4LF9 T;  1NEN A;  2ZLY A;  4U72 A;  4CXW A;  2WS3 A;  4IRE A;  2X9X A;  4GOU A;  2N1G A;  4QWN B;  1R8I A;  1T72 A;  3U3I A;  4MAL A;  4Z8X A;  4H9P C;  1XWM A;  1LVF A;  5HXR A;  3P4P A;  4TX5 A;  1US7 B;  2BKN A;  2YOE A;  1JNZ A;  4K0K T;  1KF6 A;  3CX7 B;  2V7K A;  2UXD T;  3RRW A;  4NXN T;  2XAJ B;  1N32 T;  3CWZ B;  2LSI A;  3HA4 A;  5BMV E;  4YXD A;  3AA7 B;  1FMW A;  2Z6E A;  1IBM T;  4EZH A;  1LVK A;  2Q9Q B;  2OLT A;  4PFP A;  5L3B B;  2Q9Q C;  3QK6 A;  3K8P C;  2DL1 A;  3RHW A;  2LRL A;  2A2F X;  3EHZ A;  1E7P A;  3RIF A;  1M7K A;  3RC8 A;  2HN1 A;  1MND A;  4LFA T;  4TWF A;  2JJ9 A;  2IDO B;  3PJA J;  5J1G A;  1XMQ T;  3IHR A;  2E9X A;  1M62 A;  3ANW B;  2FJA A;  1IJ5 A;  5GON E;  4YHH T;  2C0S A;  1KFY A;  2XY8 B;  4V1A v;  2LEH A;  2XAG B;  1YQ4 A;  2CRB A;  3PUS A;  2CHN A;  3Q2M A;  2LOS A;  4ZI3 C;  5DJQ C;  2KWI B;  3PV0 F;  2JMH A;  5FY1 A;  2LSK A;  4TN7 B;  4XZC A;  4EB6 E;  4P09 A;  3PUA A;  2NW9 A;  3AEF A;  1VRB A;  3L09 A;  2IC9 A;  2J62 A;  2X67 A;  4HWI B;  1HR0 T;  2VL8 A;  2XPK A;  4CN4 A;  3KBT A;  3LJC A;  4AI6 A;  5IUX A;  4PK6 A;  5JDH A;  3CIR A;  3PUZ F;  3UU8 A;  2WCA A;  4U74 A;  3HKD E;  4PK4 A;  4TWD A;  1Y64 B;  5ABE A;  4GKJ T;  3ZMZ B;  4UXN B;  1G8X A;  3O1H A;  5AQH B;  4JI4 T;  5LBQ B;  2P9B A;  3PJA A;  4PJL A;  2H89 A;  4IHJ E;  3AVS A;  5C3J A;  2V6Y A;  4EAH A;  4H63 H;  3SOL A;  1ZHC A;  2BS4 A;  2XQ8 A;  3UUN A;  3KDS E;  5TAO A;  2KT9 A;  1T8B A;  3N9N A;  4HFE A;  1LRZ A;  4MBQ A;  2GK9 A;  2WBL A;  3ZN1 B;  4NPP A;  5IWA T;  2H3R A;  1HX8 A;  1X79 A;  2ODU A;  1HNZ T;  4JUY A;  3UUL A;  3OTO T;  2BS2 A;  3M65 A;  2RP4 A;  2XQA A;  2WP9 A;  3CX8 B;  2XSA A;  4JEU B;  1FMV A;  4DUZ T;  4E7Z A;  2BKP A;  3WAJ A;  2A9U A;  3I9W A;  1UUR A;  5LP6 E;  2VQF T;  4CI1 B;  2H7O A;  3JC6 D;  4J2C A;  3IBP A;  3AVR A;  3C64 A;  5JR9 A;  1SUM B;  3O1I A;  3VRB A;  1W0A A;  3B5M A;  3VKG A;  2D2S A;  2IML A;  1VCT A;  2VKJ A;  1XDO A;  5HAX A;  5LGN B;  4U7I A;  3EDV A;  3W15 B;  4ZXL A;  2XSB A;  5HYA A;  5ETW A;  3UFG A;  4LF4 T;  5AQS B;  5FMN A;  5ADX L;  3ZMT B;  4ZEY A;  3EUH A;  1WYB A;  2WDR A;  4ISS A;  3VR9 A;  3C51 A;  4DR2 T;  2VVS A;  3OYZ A;  4O4L E;  1D1C A;  5AQV B;  3P4W A;  4WNK A;  5LG4 A;  3ZN0 B;  4TNW A;  3MZK B;  3EI0 A;  3N9O A;  3ZYK A;  3N2K E;  4NUU A;  4CI2 B;  2LRK A;  2CBI A;  4ZHQ E;  3ZMV B;  5HCJ A;  5ABH A;  5FXX A;  3F2E A;  4AIS A;  2MPK A;  2PFV A;  4B3M T;  4X20 E;  4UV8 B;  3O9X A;  1KNP A;  5LYJ E;  2X0Y A;  3FZL B;  4AKH A;  4UF0 A;  2HPJ A;  2K3W A;  3QUJ A;  3BQK A;  4GK0 E;  2LOP A;  4ZI7 E;  3CKD A;  4I43 B;  3QNU A;  4TV9 E;  2AXD S;  2D0T A;  2XQ6 A;  1ZP0 A;  2MAW A;  2M6I A;  3JAE A;  5CGM A;  1HNX T;  1D0X A;  3O4X E;  4LF7 T;  4HE8 A;  4P0B A;  3AA1 B;  4H9O C;  3TLT A;  2VK9 A;  1B7T A;  3Q5D A;  1XNQ T;  2IC6 A;  5LMN T;  3N2O A;  2CPT A;  2IAK A;  1QSD A;  2D0U A;  4X62 T;  2BG9 E;  4COF A;  4TUY E;  3QOF A;  3PUX F;  4H63 V;  5HEH A;  4YTM A;  4HN9 A;  2KMF A;  2X51 A;  2LT3 A;  2M6B A;  3FZF B;  4FJO A;  3RI5 A;  2JMK A;  3SFE A;  4EYU A;  3D0T A;  4YSX A;  2BG9 C;  2JQK A;  5LOV E;  4DR5 T;  3RIU A;  4QH5 A;  2I6H A;  2WY2 A;  4OYJ A;  2EHO A;  3CQX C;  3ZSS A;  2L8K A;  4XAX B;  5IYZ E;  2LSG A;  4QXB B;  3PTR B;  4NXM T;  4DV3 T;  4EXT A;  2ZMA A;  2WQY A;  5F8P A;  4EV6 A;  3FHN A;  4HFI A;  4KHZ F;  1HS7 A;  3ZCI A;  2I59 A;  3ZJ1 A;  2YDR A;  5LJM A;  2PBI A;  3PUV F;  2JQQ A;  3T8O A;  4TNV A;  2UXX B;  5LMU T;  4JI2 T;  2YU1 A;  4HKA A;  3Q5E A;  4KMC A;  4TWH A;  3RIA A;  5AQT B;  4YSZ A;  1HNW T;  4YT0 A;  4AQF A;  5ABF B;  3UUM A;  3OJA A;  4EYY R;  5A1L A;  3ZT5 A;  3I9Y A;  4JYA T;  4PFO A;  3ZEF B;  5HEG A;  2XQ7 A;  5LGT B;  5JRC A;  4X65 T;  4P1N A;  5H6Q B;  2V5D A;  3KV5 A;  4QH4 A;  4OX9 T;  4UR9 A;  3GN5 A;  5LNK A;  3GN5 B;  5FVL A;  5ABG A;  4YJ2 E;  4X66 T;  5HXS A;  1XNR T;  4DO0 A;  5C8Y E;  2VAS A;  3AA0 B;  3KV9 A;  3CQC B;  2XUE A;  4DUY T;  3Q9D A;  4DMW A;  2CA5 A;  4B3T T;  2CXL A;  5HXE A;  3PU8 A;  3UFE A;  1XMO T;  1T98 A;  1MMN A;  3JC6 C;  2WDQ A;  5BR8 T;  2YU2 A;  3AEG A;  2C5I T;  3EVY A;  3TLU A;  1L0V A;  1OWA A;  3K3Q C;  1IAP A;  4BA9 A;  4IDN A;  3AED A;  3K3O A;  3NZQ A;  3MKD A;  3CX6 B;  3N9Q A;  1CUN A;  3L3P A;  2I0M A;  4LML A;  5EK2 A;  3KV6 A;  2LE8 A;  4CZZ B;  4DND A;  3IEE A;  3BQL A;  3J9X 1;  2LM2 A;  2NTY A;  1X9B A;  2W67 A;  2Q9Q A;  3HKE E;  3RF1 A;  3Q5W A;  2UUA T;  3X1D A;  2XZE A;  5JVD E;  1W9R A;  4YFS A;  4KI0 F;  4DV5 T;  3PU3 A;  1WRD A;  1ZOY A;  4UV9 B;  1KEY A;  2X9Y A;  3UQ4 A;  3CVR A;  3P4R A;  4X1K E;  3ANW A;  4CI3 B;  2DI4 A;  3UU5 A;  5JTG A;  1QLB A;  2CWY A;  2OV9 A;  2XAH B;  3FXE B;  2WM9 A;  1I94 T;  4AQG A;  1GQE A;  2VB6 A;  3AE2 A;  1HX1 B;  3LG7 A;  5L3F B;  3P4Q A;  1SE7 A;  4HFB A;  2E9X C;  2H7V C;  4EZ4 A;  1ZKE A;  4CN1 A;  3ESL A;  4DV0 T;  5AQL B;  2PJQ A;  1IJ6 A;  4PNI A;  1DU2 A;  2BDE A;  2J47 A;  4EOZ B;  4DR3 T;  4DV7 T;  4AQY T;  3QB5 K;  2K24 A;  2CHO A;  2WAU A;  5FXZ A;  3CQG B;  1HF8 A;  2ACX A;  2YDS A;  4WW0 A;  1WYC A;  5F3J A;  2D5U A;  2FJB A;  2K48 A;  4HWH A;  3AE5 A;  3NBX X;  2XJ7 A;  5FNV E;  1WR6 A;  3LFM A;  2QA7 A;  1MMG A;  4DBQ A;  1NEK A;  2MOZ A;  4KX6 A;  3VU7 H;  3ONL C;  1ZEE A;  4I55 E;  4N78 D;  3M3Z B;  2C5J A;  4G2A A;  4DR1 T;  3ZPO A;  3N9M A;  1MMA A;  3ZYM A;  3JCF A;  4IL9 A;  5E0O A;  1D0Z A;  4X64 T;  5JDF A;  5JH7 E;  4LFC T;  5HWX A;  3MJX A;  2RA1 A;  4OK0 A;  2N2N A;  1BR1 A;  2UXN B;  3GMI A;  2CCQ A;  3N9P A;  3ZKR A;  3OPC A;  2CMR A;  4LF5 T;  1FJG T;  4HFC A;  2WMN A;  3AE9 A;  2BVL A;  1HTJ F;  4Z91 A;  3KV4 A;  4O4J E;  2LKH A;  2R6G F;  2W61 A;  4Q25 A;  3AEE A;  4ZI2 D;  2WMO A;  4HTE A;  2AE9 A;  4BAY B;  4EIW A;  1HFA A;  4MHC A;  3UU4 A;  1VOM A;  2DHR A;  4DBR A;  5H6R B;  2C5K T;  5L3E B;  3SRZ A;  5LHG B;  3AA6 B;  2HPL A;  1D1B A;  1U5P A;  2SPC A;  5AQU B;  2CLY C;  3KBU A;  4B3R T;  2PTF A;  4GYR A;  2LHN A;  1YQ3 A;  3AAA B;  2W0G A;  2QRX A;  2CM0 A;  1OXZ A;  4IDZ A;  3KVA A;  4JV5 T;  3I0Q A;  4ZS3 A;  1N34 T;  2WDV A;  4JI7 T;  4WBN E;  1S94 A;  1OED E;  4BJN A;  5FXV A;  3OYX A;  5M4Y A;  5KXJ A;  3UUB A;  4YJ3 E;  3A5X A;  1KK7 A;  2X9W A;  4ASK A;  4I0U A;  2Y6X A;  4HWC A;  2LSJ A;  3LBX A;  4YSY A;  2NW8 A;  5AQK B;  4YTP A;  2ZM2 A;  1N33 T;  3LBX B;  3EDU A;  2X68 A;  3A8Y C;  2W66 A;  3RYH E;  4ILU A;  1OED C;  2QYW A;  5AQR B;  3RYC E;  2IIU A;  1YW0 A;  1ZV4 X;  1UK5 A;  2ZM8 A;  3ETU A;  2H88 A;  2YKS A;  2DCF A;  3E22 E;  2KLQ A;  3VRA A;  3RQW A;  2RPA A;  2KSR A;  2L9Q A;  2ES0 A;  2E9X D;  2FJD A;  3MA9 A;  3FBZ A;  4IE4 A;  3BK9 A;  3H3M A;  4DID B;  3RH3 A;  2LSY A;  3F31 A;  4DV4 T;  3R84 B;  4ZZC A;  4O4I E;  1UX4 A;  3AE8 A;  4WYV A;  4UEL A;  5L2L A;  2FUP A;  2BBH A;  2UUB T;  3FB2 A;  2CXD A;  1HG5 A;  4TZ4 C;  3ZJ2 A;  1LKX A;  4O2A E;  2V26 A;  2V7I A;  2OA5 A;  1J1J A;  3IF8 B;  1WR0 A;  4HWD A;  5AQJ B;  5JQG E;  3TLW A;  4IE0 A;  3RYI E;  2CEA A; 
#chains in the Genus database with same CATH homology
 2XHE B;  2NW9 A;  4DO0 A;  5C8Y E;  2VAS A;  3AA0 B;  3VHL A;  4I50 E;  2Y8D A;  3KV9 A;  3CQC B;  2XUE A;  2A3D A;  3Q9D A;  1VRB A;  3WAK A;  4DMW A;  5JR9 B;  2CA5 A;  3HKB E;  5JDL A;  3L09 A;  2IC9 A;  5JR9 C;  2DWK A;  4MFR A;  2CXL A;  3P7I A;  2IW5 B;  4JLE A;  5HXE A;  2X67 A;  3PU8 A;  3UFE A;  1MIV A;  2CWO A;  4AKR B;  4ADZ A;  1SA0 E;  2K9A A;  2VL8 A;  3RKO A;  4QXC B;  4KUM B;  1T98 A;  1MMN A;  3KBT A;  3JC6 C;  3LJC A;  1D1A A;  1FEW A;  2YU2 A;  4X1Y E;  2C5I T;  5DQV A;  4AI6 A;  2V7M A;  2E8I A;  1D0Y A;  3EVY A;  3R6N A;  1YKH B;  1OWA A;  2CE7 A;  4PK6 A;  4PK5 A;  5JDH A;  4AKG A;  3K3Q C;  5L3C B;  3RRC A;  1IAP A;  4XBF B;  4U74 A;  3HKD E;  4BA9 A;  2JRK A;  3NZP A;  4PK4 A;  3KIN B;  4UEM A;  5KDM C;  1Y64 B;  3FXD B;  5FY0 A;  2J1D G;  3K3O A;  3NZQ A;  2LJL A;  4QHO A;  2ODV A;  3MKD A;  3CX6 B;  3N9Q A;  3ZMZ B;  2NP9 A;  1CUN A;  3MAC A;  1SHZ C;  3L3P A;  4M1P A;  4UXN B;  1G8X A;  1UX5 A;  3O1H A;  4KBM B;  2Q9Q D;  5EK2 A;  4UVC B;  4WBO A;  5LBQ B;  2P9B A;  2Y48 B;  3KV6 A;  4IE5 A;  4IST A;  2LE8 A;  4CZZ B;  4PJL A;  4DND A;  3IEE A;  3RYF E;  2KZ7 B;  3N5L A;  4IHJ E;  3BQL A;  4I4T E;  3J9X 1;  2B1E A;  2A72 A;  3DTO A;  3AVS A;  2NTY A;  5L3G B;  1MNE A;  4DMV A;  4YHJ A;  4EAH A;  4H63 H;  1YKE B;  2Q9Q A;  2V7L A;  3C4Z A;  3HKE E;  3RX6 A;  3SOL A;  1ZHC A;  4IGU A;  3Q5W A;  4K0U A;  4HEA A;  5JVD E;  4AKI A;  2QGS A;  1KNZ A;  3UUN A;  3J7Y q;  4YFS A;  3I0O A;  2EHO C;  4L9I A;  4MLK A;  3PUG A;  3KDS E;  3PU3 A;  3B13 A;  5TAO A;  2KT9 A;  1WRD A;  1YD8 G;  4UV9 B;  3N9N A;  3PUQ A;  5LGU B;  2XAS B;  4HFV A;  2KXP B;  1LRZ A;  4MBQ A;  2GK9 A;  4KP3 C;  2MTQ A;  2X9Y A;  2WBL A;  3CVR A;  4X1K E;  3ANW A;  1UCU A;  4CI3 B;  2DI4 A;  2HH7 A;  5EK4 A;  4ZI3 D;  5JDG A;  3ZN1 B;  4GK5 E;  2H3R A;  1HX8 A;  1X79 A;  2ODU A;  4QXH B;  4P0A A;  3GWH A;  4JUY A;  3UUL A;  2CWY A;  4UF0 B;  3RPU A;  3M65 A;  2W00 A;  2XAH B;  3FXE B;  2WM9 A;  2RP4 A;  4IE6 A;  4AQG A;  3DP7 A;  3FBL A;  3QC9 A;  1NWM X;  4PJJ A;  3CX8 B;  2VB6 A;  2KIN B;  4JEU B;  1FMV A;  3HKC E;  3ZCJ A;  3LG7 A;  1BR0 A;  5LA6 E;  5L3F B;  4E7Z A;  5KX5 E;  2NW7 A;  2E9X C;  2H7V C;  3NRX A;  4EZ4 A;  3WAJ A;  5L3D B;  4DVD A;  1ZKE A;  3ESL A;  4ZI2 C;  3U78 A;  3I9W A;  4AQF C;  5LP6 E;  1U4Q A;  2PJQ A;  1IJ6 A;  4CI1 B;  2G0U A;  3C50 A;  4PNI A;  3KVB A;  2H7O A;  1O3X A;  3JC6 D;  4J2C A;  3IBP A;  2BDE A;  3AVR A;  3C64 A;  5JR9 A;  3O1J A;  4C91 A;  2JPF A;  4EOZ B;  4UIG A;  3O1I A;  3VKG A;  2MBG A;  2D2S A;  3F57 A;  3AB3 B;  4E7S A;  2L3L A;  2K24 A;  2WAU A;  5FXZ A;  4ZS2 A;  3CQG B;  1HF8 A;  4UVB B;  1EZ3 A;  2DLR A;  2LM9 A;  2ACX A;  2VKJ A;  5HAX A;  3HL6 A;  5LGN B;  3ZC1 A;  3EDV A;  1H7C A;  3W15 B;  1IZN B;  1WYC A;  2X66 A;  4WW0 A;  4CQI A;  5F3J A;  2D5U A;  2K48 A;  3SWH A;  4OYK A;  5HYA A;  5ETW A;  3ZLI A;  3H37 A;  4AXP A;  3ETV A;  3DJB A;  3HR0 A;  5FMN A;  5ADX L;  2X0L B;  3ZMT B;  3NBX X;  5FNV E;  1WR6 A;  3LFM A;  3EUH A;  4P09 A;  1WYB A;  4HGA A;  2QA7 A;  5LBM A;  3ZC0 A;  1MMG A;  2KWH A;  4ISS A;  3UUX B;  4DBQ A;  4QKN A;  2DNX A;  5FY7 A;  3V5U A;  2MOZ A;  3C51 A;  3VU7 H;  3Q5X A;  5LJN A;  3B57 A;  1HG2 A;  1ZEE A;  4I55 E;  4N78 D;  2C5J A;  3OYZ A;  4G2A A;  2XTL A;  4O4L E;  4BJM A;  3ZPO A;  1D1C A;  5EK3 A;  3N9M A;  1MMA A;  4WNK A;  5LG4 A;  3ZYM A;  3KFW X;  3MXZ A;  3ZN0 B;  3LK4 2;  3MZK B;  2XAF B;  3LK3 B;  5E0O A;  3N9O A;  1D0Z A;  3ZYK A;  5JDF A;  4CXX A;  3N2K E;  5JH7 E;  2N9D A;  4NUU A;  5HWX A;  3MJX A;  3ZMS B;  4CI2 B;  2RA1 A;  4OK0 A;  2N2N A;  1BR1 A;  2UXN B;  2YK0 A;  3UTK A;  2VKO A;  2EHO B;  3E08 A;  3AAE B;  4ZHQ E;  3ZMV B;  3N2G E;  3C4X A;  5FXX A;  2V1D B;  3GMI A;  3ZYL A;  2CCQ A;  3N9P A;  3F2E A;  4NUV A;  4G63 A;  2CMR A;  4O8S A;  3S4U A;  2PFV A;  3ZMU B;  2WMN A;  4X20 E;  4UV8 B;  2M67 A;  5JDQ A;  3NRY A;  2BVL A;  3O9X A;  1HTJ F;  5AFU L;  5LYJ E;  3PDY A;  3WI3 A;  1E1H B;  3KV4 A;  2DWG A;  4UVA B;  4AKH A;  5CA0 E;  2CXF A;  2HPJ A;  4O4J E;  4UF0 A;  2W61 A;  5DAB A;  2LHR A;  3GA8 A;  3QUJ A;  3BQK A;  2YIN A;  4GK0 E;  3RC3 A;  2LOP A;  4ZI2 D;  2BZB A;  2WMO A;  1FIO A;  4HTE A;  4ZI7 E;  3CKD A;  4I43 B;  4TV9 E;  4BAY B;  4EIW A;  1HFA A;  5LCY A;  4MHC A;  2D0T A;  1VOM A;  2DHR A;  4GYS A;  5H6R B;  4DBR A;  2C5K T;  2NWB A;  5JRE A;  3C98 B;  2E9X B;  4O2B E;  5L3E B;  4OHF A;  3SS1 A;  1V9D A;  3SRZ A;  5FXW A;  4CXY A;  5LHG B;  3I1A A;  3HI2 A;  5CB4 E;  3AAI A;  3AA6 B;  1D0X A;  1D1B A;  2HPL A;  4H9N C;  1U5P A;  3O4X E;  2SPC A;  4A56 A;  5J2U E;  1S35 A;  4HE8 A;  3LK2 B;  4P0B A;  3AA1 B;  4H9O C;  3P8C D;  4OFZ A;  2CLY C;  1NAF A;  4PJM A;  2VK9 A;  1B7T A;  3OBV E;  3K3N A;  3KBU A;  1HCI A;  5J2T E;  4PW8 A;  5LHH B;  5JRC B;  2MYS A;  3PE0 A;  2W63 A;  4GYR A;  2IC6 A;  2LHN A;  4O4H E;  4GIW A;  3N2O A;  3AAA B;  2W0G A;  4H9S E;  2CM0 A;  1BR4 A;  5DQW A;  2IAK A;  1QSD A;  1OXZ A;  5IHY A;  4IDZ A;  2D0U A;  3KVA A;  3I0Q A;  4IIJ E;  4ZS3 A;  2KND A;  2K5B B;  2XQY A;  5JDN A;  4X1I E;  1AJ3 A;  3PUR A;  4L0R A;  5HXC A;  4TUY E;  4B6X A;  5KMG P;  4WBN E;  3CML A;  4IE7 A;  5HXS A;  1S94 A;  4ANJ A;  4BJN A;  5JDM A;  1G73 A;  4H63 V;  1MMD A;  5FXV A;  3E0Z A;  2XAQ B;  3OYX A;  4HN9 A;  4AKL A;  5M4Y A;  2V7J A;  3UT5 E;  1MIY A;  2KMF A;  4YJ3 E;  2ZLY A;  3A5X A;  1KK7 A;  2X9W A;  4ASK A;  4PAG A;  2X51 A;  2Y6X A;  3ONX A;  4U72 A;  4CXW A;  2LSJ A;  3LBX A;  2NW8 A;  2ZM2 A;  2X9X A;  4GOU A;  3V5S A;  2LT3 A;  2N1G A;  3LBX B;  4QWN B;  4FJO A;  3U3I A;  4YLH A;  5HXH A;  2JMK A;  4MAL A;  4EYU A;  4Z8X A;  3EDU A;  2BVM A;  2EHO D;  4ZOL E;  3D0T A;  4H9P C;  2X68 A;  2WSS V;  1LVF A;  3CPZ A;  2NTX A;  5HXR A;  3RYH E;  5LOV E;  3PUA A;  3BQI A;  4ILU A;  3TKL B;  2X9H A;  4TX5 A;  4OYJ A;  3RYC E;  2EHO A;  1YW0 A;  1US7 B;  1ZV4 X;  3CQX C;  1Z0P A;  2L8K A;  4XAX B;  2ZM8 A;  3N9L A;  5IYZ E;  3ETU A;  3CX7 B;  1WLX A;  2LSG A;  2V7K A;  4QXB B;  3PTR B;  3RRW A;  2XAJ B;  4PJN A;  3CWZ B;  4EXT A;  2LSI A;  2ZMA A;  3H3A A;  3HA4 A;  5BMV E;  3AA7 B;  5F8P A;  1FMW A;  2DCF A;  2Z6E A;  4EZH A;  2VWA A;  3E22 E;  3FHN A;  1LVK A;  2Q9Q B;  4PFP A;  5L3B B;  2KLQ A;  2Q9Q C;  1HS7 A;  3QK6 A;  3K8P C;  1BR2 A;  3ZCI A;  3MK7 C;  2L9Q A;  2I59 A;  2A2F X;  3ZJ1 A;  2ES0 A;  2E9X D;  4FI5 A;  4JEH B;  5LJM A;  5EZY E;  2PBI A;  4H9R C;  3MA9 A;  2JQQ A;  3T8O A;  3FBZ A;  4QX8 B;  4IE4 A;  4TV8 E;  3RC8 A;  3BK9 A;  1MND A;  2ZM0 A;  3RH3 A;  2UXX B;  2LSY A;  3F31 A;  2JJ9 A;  2YEV C;  2YU1 A;  4HKA A;  5J1G A;  4F6R C;  3C4W A;  4KMC A;  3R84 B;  3IHR A;  5LXT E;  2E9X A;  4O4I E;  1UX4 A;  3ANW B;  4AQF A;  1IJ5 A;  4UEL A;  3VKH A;  5L2L A;  2PG8 A;  5GON E;  3UUM A;  4L5G A;  2VKH A;  3OJA A;  4EYY R;  2C0S A;  5A1L A;  4V1A v;  2LEH A;  3I9Y A;  2XAG B;  4PFO A;  3ZEF B;  3FB2 A;  2CXD A;  1HG5 A;  4TZ4 C;  5FP3 A;  3ZJ2 A;  1LKX A;  2CLY B;  3PUS A;  3Q2M A;  4H9Q C;  3OKQ A;  4O2A E;  1MIW A;  5LGT B;  2WWU A;  2LOS A;  2NOX A;  2V26 A;  5JRC A;  2V7I A;  2OA5 A;  4ZI3 C;  5DJQ C;  5H6Q B;  3IF8 B;  2KWI B;  2W62 A;  3KV5 A;  2JMH A;  3GN5 A;  2LSK A;  5FY1 A;  4C90 A;  5FYM A;  4QX7 B;  5LHI B;  5HWY A;  4TN7 B;  5CA1 E;  5LNK A;  4XZC A;  2VKD A;  3GN5 B;  1QUU A;  4EB6 E;  5JQG E;  4IE0 A;  3RYI E;  2CEA A;  4YJ2 E;  4ERR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...