3W15B

Structure of peroxisomal targeting signal 2 (pts2) of saccharomyces cerevisiae 3-ketoacyl-coa thiolase in complex with pex7p and pex21p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
72
Chain Sequence
SELQRIATDIVKCCTSSSVESKLSESKFIQLMRNISSGDVTLKSELFSSNNGELVGNRHIFVKDEIHKDILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisomal targeting signal 2 receptor
publication title Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 20
structure length 72
sequence length 92
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3w15B00
3W15B
chains in the Genus database with same CATH superfamily
4U3CA 2XQAA 3CPZA 2F4VT 4OX9T 1YD8G 4GIWA 2K5BB 2X67A 2WU2A 2IDOB 5LG4A 3KV6A 1D0XA 5KDMC 5AQHB 4IT4A 1MNEA 2MBGA 3P4PA 4KMCA 3AE3A 3ZN0B 4CN6A 2E5LT 3VU7H 2BS3A 2VVSA 1UX4A 4H9OC 2HPJA 4BJMA 4KHPT 4GK5E 4F8HA 4NIQA 3SRZA 3F31A 3ZEFB 3K8PC 4IREA 2H3RA 5LHGB 4YJ2E 3RKGA 4JI2T 3KVBA 2JQQA 3RYIE 2Y6XA 5ABGA 2CMRA 4P0AA 3E0ZA 1HNWT 3AXJA 4LMKA 3AEFA 1BR2A 1HNZT 3ETVA 1Y01A 4JI1T 5LMUT 2PBIA 3OTOT 4WYVA 1W09A 3L39A 2C5JA 4CXXA 2CLYB 4M1PA 1KNPA 3TLVA 3O9XA 4OFZA 2NW8A 3RIFA 1J5ET 4LF7T 1OWAA 3CQCB 3UUNA 2E9XC 2V26A 2VURA 3P4QA 5BR8T 4DMWA 2LM2A 1WYCA 3AVRA 2X0YA 3AA6B 2IAKA 3UU8A 2IIUA 1IZNB 1LRZA 4TWFA 1XMOT 1XNRT 1NAFA 1WR0A 3FXEB 3RIUC 2I59A 3LBXB 3UU3A 4HWHA 3RRWA 2D0TA 4DMVA 3FHNA 3O1JA 4MBQA 1MIWA 1MNDA 1YW0A 3KV9A 2YDQA 5LBMA 3ONLC 3KINB 4E7SA 4JEHB 3N9QA 3H37A 5J1GA 2IUBA 4PJMA 4YSYA 1N34T 1CUNA 2BS4A 1U4QA 3N9PA 5LGUB 2BG9C 2KNDA 2AE9A 4PNIA 5L3BB 4ZOLE 1OXZA 3LSVA 1UGOA 3AB3B 5LHHB 3C4XA 2LSIA 4WZXA 4OYJA 4L9IA 5AFUL 4G63A 4H9PC 2Z6EA 5LXTE 3SFDA 2KSRA 3VR9A 2A72A 3CIRA 2YN6A 4YHHT 4O2AE 5HXEA 2UXXB 3AEBA 3UQ7A 5F3JA 5JH7E 3RKOA 3PU8A 3X1DA 2X66A 3I9WA 1MMDA 1S35A 4KP3C 1GQEA 4PK6A 3TLSA 1SA0E 1UX5A 2XSAA 4QX8B 4PK4A 4K0KT 2UXNB 1JNZA 4AQGA 3U78A 3E22E 3FBLA 1VOMA 3N2KE 3AAAB 4MFRA 3RQUA 3GMIA 5JDQA 4UR9A 3O1HA 3PURA 2J47A 4NPPA 1N33T 5F8PA 3Q5WA 4TV9E 3TLUA 4AI6A 4JI0T 5HEOA 2LT3A 4IDPA 2PTFA 5FKYA 5FVKA 4ADZA 4QH4A 2XQ8A 4BAYB 3LFMA 4ZI3D 5AQSB 3VRBA 5L3GB 4Z90A 3ZJ1A 4H9QC 4X62T 4LF5T 4OYKA 3HKCE 1KF6A 1IJ5A 1BR4A 2XAFB 4DV1T 3U3IA 3K3NA 2DNXA 5AQOB 4HWCA 4O4IE 4ZXLA 4HFCA 2V6YA 3W15B 3J7Yq 4UIGA 2NOXA 1YQ3A 2JQKA 2LLYA 3UU6A 2WP9A 2W61A 4HFVA 5HCJA 5F5WA 4QXHB 4I50E 3S4UA 2ACZA 4QKNA 4XBFB 5KX5E 2XQ9A 3LK42 2LKGA 4DR3T 2X9WA 3ZMZB 4OHFA 5AQPB 2L9QA 3BQLA 3I1AA 2A2FX 3V5UA 3I9YA 4B6XA 1B7TA 1HF8A 2CBJA 4AQFC 2XPKA 3PUWF 2UU9T 2ZM0A 2CE7A 3C64A 3TLTA 4PJJA 4JEUB 2LOSA 2XQ6A 5J0ZA 2BBHA 4JI7T 1IJ6A 4IGUA 2M67A 2MOZA 4UVCB 3FXDB 4Z8XA 5FY1A 4P09A 1XDOA 4QXCB 4TWDA 3NRYA 5H6QB 2VL8A 4XAXB 3RHWA 2Q9QA 4TUYE 2CXFA 4O4HE 5DQWA 3AEAA 4UV8B 4YSZA 2ZM6T 5FXWA 1NENA 4UELA 2IC6A 4NUVA 4JV5T 2VK9A 5AQUB 4CZZB 2BKPA 2DI4A 4DR7T 3RYFE 4TNWA 4O2BE 2NW7A 2JIWA 4HE8A 3MZKB 2AXDS 5LHIB 5AQQB 2QVAA 3OBVE 3QOFA 2LHNA 4HFIA 4DR4T 3I0OA 3QUJA 3DJBA 2V7LA 2WQYA 4X20E 2PG8A 1UK5A 1M7KA 3AXJB 4DR1T 2LRKA 4ZI3C 2D2SA 2MAWA 2DCFA 3N5LA 2J4GA 4DBQA 5FXXA 1XDPA 3AEDA 2N9DA 3ZSTA 5AQMB 3PUVF 2BG9B 2VB6A 2XQ3A 4PW8A 1QLBA 4WW0A 3AA7B 5J2TE 4HKAA 5IYZE 2XQYA 4HFHA 4UF0A 3PUQA 5JDNA 2BVMA 1WRDA 3L3PA 3ZMVB 4XZCA 3PJAA 2XJ7A 2DWGA 2FJBA 3HI2A 5LG3A 5EK2A 4KX6A 2YDRA 1W0AA 3OKQA 3C4ZA 4CN4A 3UFEA 4QXBB 2H88A 4HFBA 4WNKA 2V8SV 3UQ4A 4HGAA 2VL0A 4UEMA 5CA1E 5JREA 4JI6T 1SE7A 4JUYA 3RGLA 5FXZA 2YOEA 2CEAA 5AQGB 5ABHA 2D9DA 4TWHA 3QC9A 4ANJA 2V5DA 1ZHCA 1HR0T 4HFEA 4MHCA 2WY2A 2E9XA 4YJ3E 3RH3A 2K48A 1YKHB 4KUMB 3P50A 2E8IA 3C51A 3TKLB 1UCUA 5JDLA 5JTGA 5IHYA 4UV9B 3AAIA 3JCFA 2XHEB 2FJEA 1ZEEA 4Z91A 3RPUA 3RIUA 3JC6D 4LMLA 2EHOA 2A3DA 3N9OA 5AQRB 3EHZA 4IE4A 4CI2B 4I4TE 2RA1A 3NZQA 2X68A 3A7MA 4CXYA 5TAOA 1G8XA 4X5TA 2V7MA 2CBIA 3VRAA 5IWAT 5LBQB 1OEDA 1HX1B 3RYHE 5CA0E 2BG9A 3B13A 4PFPA 5JDFA 2MPKA 1Z8UA 3AE1A 2I6HA 4DUYT 2NTXA 4IL9A 2M6BA 5C3JA 3O4XE 1UURA 3SOLA 3FZLB 3L8RA 3AAEB 3EAMA 2BZBA 3D0TA 5LYJE 3IA3A 4U2YA 3AA0B 1ZP0A 4KHZF 3P4WA 4LFCT 4LF6T 2EHOC 3FZKB 2FJAA 1I94T 5E0OA 1D0ZA 3ANWA 1W9RA 1KK7A 3N9MA 2XM2A 4LF4T 2LSKA 3AEGA 5C2TA 1J5WA 2V6YB 2D0UA 2PFVA 3N9NA 4ZS2A 1SHZC 3AE2A 5LB7B 1E7PA 1OEDC 3AE4A 4AKRB 4F6RC 3AVSA 2YU2A 5L3FB 2JQ9A 2LRLA 2XAJB 4LFAT 4ASKA 1WCRA 2WBLA 2N2NA 3GA8A 3Q5DA 1W0BA 3M3ZB 3MXZA 4HWDA 5A1LA 2KWHA 1G73A 2GK9A 3RI5A 4YTPA 1JNRA 4IE0A 4IDOA 4L5GA 4UVAB 2W63A 2W00A 2RPAA 5AQKB 2VKDA 1L0VA 4GKJT 4WBNE 3BQIA 1Z0PA 2ZLYA 2XAHB 4HEAA 4PK5A 3VHLA 4Q25A 1QSDA 4A56A 4MLKA 2C0SA 3NRXA 3PUZF 1HTJF 1HX8A 4IL4A 1T72A 4O8SA 3F57A 2H89A 2Q9QB 3JC6C 3OJAA 3ZPOA 3ZN1B 4GKKT 3GN5A 2WZHA 1H7CA 3KBUA 5FY7A 2JQHA 3K1SA 4X64T 3ZYMA 2IW5B 2CCQA 3WAJA 3L09A 2JPFA 2DWKA 4K0UA 2V7KA 2V1DB 2FUPA 4OK0A 3Q5EA 2V6XA 4IE6A 2E5VA 4YXDA 4ILAA 3SWHA 4AQFA 4QHOA 2W62A 1X9BA 3NBXX 3ZKRA 1KEYA 2XY8B 4JBWF 4NXMT 2WDRA 3C50A 4YT0A 3CWZB 1HG2A 3OYZA 1YXRA 3ZLIA 2X51A 2XQ5A 5L3CB 2NW9A 1T98A 2WM9A 3QNUA 4ILUA 3UU5A 2HPLA 2X0LB 4IE5A 5DABA 3UUXB 3F2EA 2BG9E 5KMGP 2VWAA 2YEVC 4YY3T 4X66T 3M65A 2WDVA 4TZ4C 2YINA 5C8YE 4UF0B 3B57A 1MIYA 3UU4A 3G06A 5JDMA 4ISSA 3VR8A 3FZHB 4DIDB 4DVDA 3P4SA 1T8BA 2W0GA 3LDQB 4EZHA 5LA6E 1I6ZA 5ABFA 4AKGA 3ZMSB 4EV6A 1N32T 1IBMT 4AKIA 2PJQA 2WCAA 1HG5A 5ADXL 4LF9T 2V7IA 1J1JA 4JYAT 4EZ4A 3JAFA 2IC9A 1FJGT 4ISTA 3SS1A 2X9HA 4BA9A 2JRKA 4HWIB 2KLQA 3EVYA 3CVRA 3WI3A 3OYXA 4ZHQE 2VQFT 3AA1B 4DR2T 1NWMX 1V9DA 3C98B 4TV8E 4YSXA 3UT5E 3ZCIA 1T7SA 4QWNB 3ZT5A 3HL6A 2CHNA 5JRCA 4ZI7E 4U33A 3ZT6A 3QK6A 3ESLA 5AQJB 3P7IA 2E9XB 4ZS3A 5LNKA 4BJNA 5JQGE 5L4EA 4NXNT 1SUMB 2XZEA 1D0YA 3ZSSA 4U7IA 3N2GE 3PE0A 2K3WA 1D1CA 1FMWA 2QYWA 1LKXA 2WZIA 2QGSA 4X65T 2WB5A 5HEGA 3IEEA 2EHOB 4CI1B 3CX7B 2UUBT 2E2AA 3K3QC 4H63V 1KFYA 3RYCE 4J2CA 4L0RA 4EAHA 3ONXA 4X1KE 3I0QA 1O3XA 2N1GA 3HA4A 4KBMB 2YDSA 3UUBA 2HH7A 3IHRA 3KVAA 5ETWA 2BS2A 2IMLA 1OEDB 3AECA 2VKOA 2BVLA 2UUCT 2DL1A 4JI3T 4DV3T 5KXJA 3AEEA 3HKDE 4DV0T 2L8KA 4X1IE 4U72A 2WMOA 2UXBT 4P0BA 4TX5A 5HWXA 3EUHA 3PTRB 4CI3B 4UVBB 2LM9A 4ERRA 3ANWB 3TLWA 1AJ3A 4ZI2D 2ES0A 3MK7C 4H63H 2VKJA 4EXTA 2VKHA 2OV9A 5LGNB 3EDUA 2D5UA 5LOVE 3MACA 3Q9DA 2K24A 3AE9A 2LSJA 2HN1A 2ZM2A 2VVNA 3PUAA 4NUUA 4QX7B 3Q5XA 2MTQA 1LVFA 2NP9A 4HWFA 4YLHA 3KV5A 2WS3A 2W4XA 3DP7A 3P4RA 3MKDA 2JMKA 4PAGA 1R8IA 3E08A 3NKZA 4ZZBA 2J1DG 3ZMUB 4AISA 2WDQA 4ZEYA 4LFBT 5HXSA 2H7VC 4FI5A 3RX6A 3SFEA 2C5IT 4CXWA 3K3OA 3AE8A 3B5MA 3ZYLA 4I43B 2ZM8A 3LJCA 2HHHT 3GN5B 5JDHA 3N9LA 4C90A 3DTOA 2CPTA 4IDQA 3PUXF 2BKOA 4I55E 5AQIB 3PUSA 4AQYT 2LJLA 2WMNA 2P9BA 5LJNA 1QUUA 2A9UA 5HEUA 2XQ7A 1Y64B 2X0HA 4LMJA 2R6GF 2CRBA 1E2AA 4YTMA 3JADA 1HFAA 2YU1A 3OVUA 2KINB 4AKLA 3RC8A 3ZMTB 4JI8T 2KT9A 3HKBE 3V5SA 4YTNA 5M4YA 4KI0F 1NEKA 5HAXA 2VQET 2LEHA 1D1AA 3LK2B 3PU3A 1BR1A 1FMVA 1XZYA 5J2UE 2LHRA 4C91A 2V7JA 3UTKA 4YHJA 4DR6T 4IE7A 1VCTA 4EEDA 2I0MA 2X9YA 3UFGA 3ETUA 4X1YE 4TNVA 1XNQT 3FBZA 5JDGA 3KDSE 4PJNA 5EK3A 4DV2T 4ZI2C 1LVKA 4IDZA 4DBRA 5JR9A 4IHJE 1WFDA 5FYMA 5AQLB 2HN2A 2ZMAA 2OA5A 3EABA 4A98A 4ILCA 3VKGA 4DV5T 4FJOA 3FZFB 3EDVA 5DJQC 2K9AA 3RLFF 4B3RT 3CMLA 2B1EA 2H7OA 3AE5A 5GONE 5ABFB 2WAUA 1DU2A 2C5KT 2ODUA 4H9SE 3RQWA 3QB5A 3T1YT 5ABEA 3KFWX 4A5XA 3RF1A 1KNZA 4B3MT 2ACXA 3O1IA 2BKNA 4DNDA 3AE6A 3CX8B 4LF8T 5FL1A 3MJXA 4GOUA 4I0UA 2KZ7B 4TN7B 1HCIA 4UXNB 3H3MA 2CWOA 5LP6E 5CGMA 5AQNB 5AQFB 3T1HT 2XUEA 5JR9C 2J62A 1ZKEA 3ONJA 5JRCB 2CXDA 4U7YA 2JJ9A 1WR6A 3NZPA 4AXPA 2KXPB 2WWUA 4EIWA 2X9XA 3KV4A 2NR4A 3GWHA 5AQTB 1HNXT 4DV6T 3CQGB 4EGWA 3PUGA 4U31A 4O4LE 5EK4A 3WAKA 3ZT7A 5FY0A 4JI5T 4JLEA 3FZMB 4EB6E 2CWYA 3PV0F 5L47A 1N36T 3HKEE 3RC3A 3ZJ2A 1X79A 2QA7A 4PJLA 5HEJA 5CFBA 1HS7A 2MYSA 2Q9QD 2KMFA 3LBXA 4PFOA 2OLTA 5LGTB 2UXCT 3A8YC 4GK0E 3ABVA 1IBKT 1OEDE 3NVOA 5L3DB 1IBLT 2W67A 5L3EB 2FJDA 3PUYF 4DUZT 3NWIA 2CLYC 4G2AA 1YKEB 2XM1A 1MMGA 4IDNA 2SPCA 1U5PA 4EYYR 1ZV4X 3RRCA 2XASB 5L4HA 1VCSA 2FBWA 2RP4A 5L2LA 2W2UA 2XAQB 5CB4E 5HCMA 2NTYA 5BMVE 5FP3A 4EOZB 2DLRA 3ZYKA 1S94A 4B3TT 4YFSA 3VKHA 1MIVA 3ZC1A 3ZCJA 4EYUA 4HTEA 2Y48B 4H9NC 1MMAA 2DHRA 4O4JE 3CKDA 4QH5A 1CHUA 2ODVA 5LJMA 2BBJA 4GYSA 5LMNT 2G0UA 1D1BA 3J9X1 2M6IA 2WWVA 3BK9A 3HR0A 4QH1A 3C4WA 4CN1A 3T8OA 3P8CD 2NWBA 5HXHA 4ZZCA 1XMQT 2XQ4A 5H6RB 2BDEA 4DV7T 1KNRA 5FMNA 5HYAA 5IUXA 1US7B 3MA9A 3LG7A 4DR5T 4E7ZA 2XSBA 4U74A 2UUAT 5HEHA 5EZYE 2Y8DA 1IAPA 3IBPA 3EI0A 5LCYA 3PJAJ 5AQVB 1FEWA 4AKHA 1EZ3A 1FIOA 3ZC0A 3BQKA 2YK0A 4COFA 2LSYA 4GYRA 2CA5A 1WLXA 5FXVA 2IHR1 5CJ5A 4B3ST 4HFDA 5FVLA 4U2ZA 5FL0A 3UULA 3QB5K 2E9XD 5JVDE 2L3LA 2Q9QC 2CHOA 2W66A 3IF8B 4HN9A 4H9RC 3PDYA 4A97A 3A5XA 4AIUA 4EEBA 1XWMA 3OPCA 2WSSV 1UUSA 3R84B 3AE7A 4DO0A 2JMHA 3CX6B 4IIJE 4MALA 2LSGA 3Q2MA 2LOPA 5FNVE 3JAEA 3UUMA 2EHOD 2CM0A 4WBOA 1BR0A 4N78D 3KBTA 2B76A 5HWYA 2XAGB 4ILBA 3N2OA 4P1NA 1M62A 1E1HB 1MMNA 4DV4T 1ZOYA 3RIAA 3FB2A 2KWIB 1WYBA 2LE8A 3LK3B 4JI4T 2WU5A 3CQXC 1VRBA 2CXLA 3CK6A 1YQ4A 2LKHA 4CQIA 2QRXA 2UXDT 5DQVA 5HXCA 5HXRA 2XTLA 3R6NA 2V5CA 5JR9B 3H3AA 2YKSA 4V1Av 2VASA
chains in the Genus database with same CATH topology
3SWHA 3CPZA 4AQFA 2X9YA 4QHOA 2W62A 3ETUA 3RYFE 4X1YE 3NBXX 4O2BE 1YD8G 2NW7A 4GIWA 3FBZA 2K5BB 4HE8A 5JDGA 2X67A 3MZKB 3C50A 3KDSE 4PJNA 3CWZB 5LHIB 5LG4A 5EK3A 3KV6A 1HG2A 1D0XA 1LVKA 3OBVE 4ZI2C 4IDZA 3OYZA 4DBRA 5KDMC 5JR9A 4IHJE 1MNEA 3ZLIA 2X51A 2MBGA 5L3CB 2LHNA 2NW9A 5FYMA 1T98A 2WM9A 3I0OA 4KMCA 3QUJA 2ZMAA 4ILUA 3ZN0B 2OA5A 3DJBA 2V7LA 3VU7H 3VKGA 4X20E 2PG8A 1UX4A 2HPLA 4H9OC 2HPJA 2X0LB 4IE5A 5DABA 4FJOA 3UUXB 3F2EA 4BJMA 4GK5E 5KMGP 2VWAA 2YEVC 3SRZA 3F31A 3EDVA 4ZI3C 3M65A 5DJQC 4TZ4C 2D2SA 2K9AA 3ZEFB 3K8PC 2H3RA 5LHGB 2YINA 4YJ2E 3CMLA 5C8YE 2B1EA 2H7OA 5GONE 2DCFA 2WAUA 3KVBA 3N5LA 4UF0B 2C5KT 2JQQA 2ODUA 3B57A 3RYIE 4H9SE 4DBQA 5FXXA 2Y6XA 3KFWX 2CMRA 1MIYA 1KNZA 2ACXA 2N9DA 3E0ZA 3O1IA 4P0AA 4DNDA 5JDMA 4ISSA 1BR2A 2VB6A 3ETVA 4DVDA 3CX8B 4PW8A 4WW0A 3MJXA 2W0GA 3AA7B 4GOUA 2PBIA 4EZHA 5J2TE 5LA6E 4HKAA 2KZ7B 4TN7B 1HCIA 2XQYA 5IYZE 2C5JA 4AKGA 4UF0A 3ZMSB 3PUQA 2CLYB 4CXXA 5JDNA 4UXNB 4AKIA 2BVMA 2PJQA 1WRDA 4M1PA 3L3PA 3O9XA 4OFZA 3ZMVB 2CWOA 5LP6E 1HG5A 2NW8A 4XZCA 5ADXL 2V7IA 2XUEA 2DWGA 1OWAA 3HI2A 5JR9C 1ZKEA 3CQCB 4EZ4A 3UUNA 5JRCB 2CXDA 2IC9A 5EK2A 4ISTA 2JJ9A 3SS1A 2E9XC 2V26A 2X9HA 4BA9A 3OKQA 2JRKA 1WR6A 3C4ZA 4DMWA 2KLQA 3NZPA 3EVYA 4AXPA 2KXPB 3CVRA 3WI3A 3OYXA 4ZHQE 2WWUA 1WYCA 4EIWA 3AVRA 3AA1B 3UFEA 1NWMX 1V9DA 3AA6B 4QXBB 2IAKA 3C98B 2X9XA 4TV8E 3KV4A 4WNKA 4HGAA 3UT5E 3ZCIA 3GWHA 4UEMA 5CA1E 1IZNB 5JREA 4QWNB 1LRZA 4JUYA 3HL6A 5JRCA 1NAFA 3CQGB 4ZI7E 3QK6A 3ESLA 3PUGA 4O4LE 5FXZA 3FXEB 5EK4A 3P7IA 3WAKA 2I59A 2E9XB 3LBXB 4ZS3A 4BJNA 5LNKA 5JQGE 5FY0A 2CEAA 3RRWA 2D0TA 4DMVA 3FHNA 4JLEA 3O1JA 4MBQA 2CWYA 1MIWA 4EB6E 1MNDA 1YW0A 3KV9A 5LBMA 1D0YA 3QC9A 3HKEE 3RC3A 3KINB 3ZJ2A 4ANJA 1X79A 4E7SA 3N2GE 4JEHB 2QA7A 4PJLA 3N9QA 1ZHCA 3H37A 3PE0A 4MHCA 5J1GA 1D1CA 1FMWA 1LKXA 1HS7A 2QGSA 2MYSA 4PJMA 2Q9QD 2KMFA 1CUNA 2E9XA 3LBXA 1U4QA 4PFOA 4YJ3E 3N9PA 3RH3A 5LGTB 2K48A 3IEEA 1YKHB 4GK0E 4KUMB 2EHOB 4CI1B 5LGUB 2KNDA 3CX7B 2E8IA 3C51A 3K3QC 4PNIA 3TKLB 4H63V 5L3BB 1UCUA 4ZOLE 5L3DB 1OXZA 5JDLA 5IHYA 3RYCE 5L3EB 4J2CA 3AB3B 4UV9B 2CLYC 3AAIA 4L0RA 4G2AA 4EAHA 1YKEB 5LHHB 2XHEB 3C4XA 1ZEEA 1MMGA 3ONXA 2LSIA 3I0QA 4X1KE 3RPUA 4OYJA 1O3XA 2N1GA 4L9IA 3JC6D 3HA4A 4KBMB 2EHOA 2A3DA 3N9OA 2HH7A 3IHRA 2SPCA 1U5PA 3KVAA 4G63A 4H9PC 5ETWA 2Z6EA 4IE4A 4CI2B 5AFUL 4I4TE 4EYYR 1ZV4X 2RA1A 3RRCA 5LXTE 2XASB 3NZQA 2X68A 2VKOA 2RP4A 2A72A 2BVLA 5L2LA 4CXYA 5TAOA 1G8XA 2XAQB 4O2AE 5CB4E 5HXEA 2UXXB 2NTYA 5BMVE 5FP3A 4EOZB 2V7MA 3HKDE 2DLRA 5F3JA 5JH7E 3ZYKA 1S94A 4YFSA 3PU8A 3RKOA 2L8KA 2X66A 4X1IE 3VKHA 5LBQB 3I9WA 4U72A 1MIVA 1MMDA 1S35A 2WMOA 3RYHE 4KP3C 5CA0E 4P0BA 3B13A 3ZC1A 4TX5A 4PFPA 3ZCJA 5JDFA 4PK6A 5HWXA 4EYUA 4HTEA 3EUHA 2Y48B 3PTRB 4CI3B 4H9NC 4UVBB 2LM9A 1MMAA 1SA0E 2NTXA 2DHRA 1UX5A 4ERRA 4QX8B 3O4XE 3SOLA 4PK4A 4O4JE 2UXNB 3CKDA 3ANWB 2ODVA 4AQGA 3U78A 3E22E 3FBLA 5LJMA 1VOMA 3N2KE 3AAEB 4GYSA 1AJ3A 3AAAB 4MFRA 2BZBA 4ZI2D 3D0TA 3GMIA 2ES0A 5LYJE 2G0UA 3MK7C 5JDQA 1D1BA 4H63H 2VKJA 3J9X1 4EXTA 2VKHA 3BK9A 5LGNB 3AA0B 3O1HA 3EDUA 3PURA 2D5UA 5LOVE 3MACA 2EHOC 3HR0A 5F8PA 3Q5WA 3C4WA 4TV9E 5E0OA 3T8OA 1D0ZA 3P8CD 3ANWA 4AI6A 3Q9DA 2LT3A 1KK7A 2K24A 3N9MA 2NWBA 5HXHA 2LSJA 4ADZA 4BAYB 5H6RB 2BDEA 2LSKA 3LFMA 4ZI3D 2ZM2A 5L3GB 3ZJ1A 5FMNA 3PUAA 5HYAA 2D0UA 1US7B 4H9QC 2PFVA 3N9NA 3MA9A 3LG7A 4NUUA 4QX7B 4ZS2A 4OYKA 3HKCE 1SHZC 4E7ZA 1IJ5A 1BR4A 4U74A 3Q5XA 2MTQA 4AKRB 4F6RC 5EZYE 3AVSA 2YU2A 2XAFB 2Y8DA 5L3FB 2XAJB 1LVFA 2NP9A 1IAPA 3U3IA 3IBPA 4YLHA 3KV5A 4ASKA 5LCYA 2WBLA 2N2NA 3K3NA 2DNXA 4O4IE 3DP7A 3GA8A 3W15B 3J7Yq 1FEWA 4AKHA 1EZ3A 1FIOA 3MXZA 3ZC0A 4UIGA 5A1LA 2KWHA 1G73A 3BQKA 3MKDA 2GK9A 2NOXA 2YK0A 2JMKA 2LSYA 4PAGA 2W61A 3E08A 4GYRA 2CA5A 4HFVA 1WLXA 5FXVA 4QXHB 2J1DG 3ZMUB 4IE0A 4I50E 3S4UA 4L5GA 4QKNA 5HXSA 3UULA 4UVAB 2W63A 2H7VC 4FI5A 2W00A 4XBFB 5KX5E 3RX6A 2E9XD 2VKDA 5JVDE 2L3LA 2Q9QC 2C5IT 3LK42 4WBNE 4CXWA 3BQIA 1Z0PA 3IF8B 2ZLYA 3K3OA 2XAHB 4HEAA 4HN9A 2X9WA 3ZMZB 4H9RC 4OHFA 3PDYA 2L9QA 4PK5A 3VHLA 3A5XA 3ZYLA 3BQLA 4I43B 1QSDA 3I1AA 2WSSV 2A2FX 2ZM8A 4A56A 3LJCA 3GN5B 4MLKA 3V5UA 3I9YA 2C0SA 3NRXA 3R84B 4B6XA 5JDHA 4DO0A 1B7TA 3N9LA 1HTJF 4C90A 1HX8A 2JMHA 3CX6B 1HF8A 3DTOA 4IIJE 4MALA 2LSGA 3Q2MA 2LOPA 4AQFC 4I55E 4O8SA 5FNVE 3F57A 3PUSA 3UUMA 2LJLA 2WMNA 2ZM0A 2CE7A 2EHOD 2P9BA 2Q9QB 3C64A 3JC6C 2CM0A 3OJAA 5LJNA 1QUUA 4JEUB 2LOSA 4PJJA 4WBOA 1BR0A 4N78D 1IJ6A 3ZPOA 3KBTA 3ZN1B 4IGUA 5HWYA 1Y64B 2XAGB 2M67A 2MOZA 3N2OA 3GN5A 4UVCB 3FXDB 1H7CA 3KBUA 5FY7A 4Z8XA 3ZYMA 5FY1A 1E1HB 1MMNA 4P09A 4QXCB 5H6QB 3NRYA 2VL8A 3FB2A 2IW5B 2KWIB 1HFAA 1WYBA 2CCQA 2LE8A 2YU1A 3LK3B 4XAXB 3WAJA 3L09A 2KINB 4AKLA 3RC8A 3ZMTB 2Q9QA 2KT9A 3CQXC 1VRBA 3HKBE 2CXLA 2JPFA 2DWKA 4K0UA 3V5SA 5M4YA 2V7KA 4TUYE 4CQIA 2CXFA 5HAXA 4O4HE 5DQWA 2LEHA 2V1DB 4UV8B 4OK0A 5DQVA 1D1AA 3LK2B 5FXWA 3PU3A 1BR1A 1FMVA 2XTLA 5HXCA 5HXRA 3R6NA 4UELA 5JR9B 2IC6A 4NUVA 5J2UE 2LHRA 3H3AA 2VK9A 4C91A 2V7JA 4V1Av 4IE6A 3UTKA 4YHJA 4CZZB 4IE7A 2VASA 2DI4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W15 B; 
#chains in the Genus database with same CATH topology
 4U3C A;  2XQA A;  3CPZ A;  2F4V T;  4OX9 T;  1YD8 G;  4GIW A;  2K5B B;  2X67 A;  2WU2 A;  2IDO B;  5LG4 A;  3KV6 A;  1D0X A;  5KDM C;  5AQH B;  4IT4 A;  1MNE A;  2MBG A;  3P4P A;  4KMC A;  3AE3 A;  3ZN0 B;  4CN6 A;  2E5L T;  3VU7 H;  2BS3 A;  2VVS A;  1UX4 A;  4H9O C;  2HPJ A;  4BJM A;  4KHP T;  4GK5 E;  4F8H A;  4NIQ A;  3SRZ A;  3F31 A;  3ZEF B;  3K8P C;  4IRE A;  2H3R A;  5LHG B;  4YJ2 E;  3RKG A;  4JI2 T;  3KVB A;  2JQQ A;  3RYI E;  2Y6X A;  5ABG A;  2CMR A;  4P0A A;  3E0Z A;  1HNW T;  3AXJ A;  4LMK A;  3AEF A;  1BR2 A;  1HNZ T;  3ETV A;  1Y01 A;  4JI1 T;  5LMU T;  2PBI A;  3OTO T;  4WYV A;  1W09 A;  3L39 A;  2C5J A;  4CXX A;  2CLY B;  4M1P A;  1KNP A;  3TLV A;  3O9X A;  4OFZ A;  2NW8 A;  3RIF A;  1J5E T;  4LF7 T;  1OWA A;  3CQC B;  3UUN A;  2E9X C;  2V26 A;  2VUR A;  3P4Q A;  5BR8 T;  4DMW A;  2LM2 A;  1WYC A;  3AVR A;  2X0Y A;  3AA6 B;  2IAK A;  3UU8 A;  2IIU A;  1IZN B;  1LRZ A;  4TWF A;  1XMO T;  1XNR T;  1NAF A;  1WR0 A;  3FXE B;  3RIU C;  2I59 A;  3LBX B;  3UU3 A;  4HWH A;  3RRW A;  2D0T A;  4DMV A;  3FHN A;  3O1J A;  4MBQ A;  1MIW A;  1MND A;  1YW0 A;  3KV9 A;  2YDQ A;  5LBM A;  3ONL C;  3KIN B;  4E7S A;  4JEH B;  3N9Q A;  3H37 A;  5J1G A;  2IUB A;  4PJM A;  4YSY A;  1N34 T;  1CUN A;  2BS4 A;  1U4Q A;  3N9P A;  5LGU B;  2BG9 C;  2KND A;  2AE9 A;  4PNI A;  5L3B B;  4ZOL E;  1OXZ A;  3LSV A;  1UGO A;  3AB3 B;  5LHH B;  3C4X A;  2LSI A;  4WZX A;  4OYJ A;  4L9I A;  5AFU L;  4G63 A;  4H9P C;  2Z6E A;  5LXT E;  3SFD A;  2KSR A;  3VR9 A;  2A72 A;  3CIR A;  2YN6 A;  4YHH T;  4O2A E;  5HXE A;  2UXX B;  3AEB A;  3UQ7 A;  5F3J A;  5JH7 E;  3RKO A;  3PU8 A;  3X1D A;  2X66 A;  3I9W A;  1MMD A;  1S35 A;  4KP3 C;  1GQE A;  4PK6 A;  3TLS A;  1SA0 E;  1UX5 A;  2XSA A;  4QX8 B;  4PK4 A;  4K0K T;  2UXN B;  1JNZ A;  4AQG A;  3U78 A;  3E22 E;  3FBL A;  1VOM A;  3N2K E;  3AAA B;  4MFR A;  3RQU A;  3GMI A;  5JDQ A;  4UR9 A;  3O1H A;  3PUR A;  2J47 A;  4NPP A;  1N33 T;  5F8P A;  3Q5W A;  4TV9 E;  3TLU A;  4AI6 A;  4JI0 T;  5HEO A;  2LT3 A;  4IDP A;  2PTF A;  5FKY A;  5FVK A;  4ADZ A;  4QH4 A;  2XQ8 A;  4BAY B;  3LFM A;  4ZI3 D;  5AQS B;  3VRB A;  5L3G B;  4Z90 A;  3ZJ1 A;  4H9Q C;  4X62 T;  4LF5 T;  4OYK A;  3HKC E;  1KF6 A;  1IJ5 A;  1BR4 A;  2XAF B;  4DV1 T;  3U3I A;  3K3N A;  2DNX A;  5AQO B;  4HWC A;  4O4I E;  4ZXL A;  4HFC A;  2V6Y A;  3W15 B;  3J7Y q;  4UIG A;  2NOX A;  1YQ3 A;  2JQK A;  2LLY A;  3UU6 A;  2WP9 A;  2W61 A;  4HFV A;  5HCJ A;  5F5W A;  4QXH B;  4I50 E;  3S4U A;  2ACZ A;  4QKN A;  4XBF B;  5KX5 E;  2XQ9 A;  3LK4 2;  2LKG A;  4DR3 T;  2X9W A;  3ZMZ B;  4OHF A;  5AQP B;  2L9Q A;  3BQL A;  3I1A A;  2A2F X;  3V5U A;  3I9Y A;  4B6X A;  1B7T A;  1HF8 A;  2CBJ A;  4AQF C;  2XPK A;  3PUW F;  2UU9 T;  2ZM0 A;  2CE7 A;  3C64 A;  3TLT A;  4PJJ A;  4JEU B;  2LOS A;  2XQ6 A;  5J0Z A;  2BBH A;  4JI7 T;  1IJ6 A;  4IGU A;  2M67 A;  2MOZ A;  4UVC B;  3FXD B;  4Z8X A;  5FY1 A;  4P09 A;  1XDO A;  4QXC B;  4TWD A;  3NRY A;  5H6Q B;  2VL8 A;  4XAX B;  3RHW A;  2Q9Q A;  4TUY E;  2CXF A;  4O4H E;  5DQW A;  3AEA A;  4UV8 B;  4YSZ A;  2ZM6 T;  5FXW A;  1NEN A;  4UEL A;  2IC6 A;  4NUV A;  4JV5 T;  2VK9 A;  5AQU B;  4CZZ B;  2BKP A;  2DI4 A;  4DR7 T;  3RYF E;  4TNW A;  4O2B E;  2NW7 A;  2JIW A;  4HE8 A;  3MZK B;  2AXD S;  5LHI B;  5AQQ B;  2QVA A;  3OBV E;  3QOF A;  2LHN A;  4HFI A;  4DR4 T;  3I0O A;  3QUJ A;  3DJB A;  2V7L A;  2WQY A;  4X20 E;  2PG8 A;  1UK5 A;  1M7K A;  3AXJ B;  4DR1 T;  2LRK A;  4ZI3 C;  2D2S A;  2MAW A;  2DCF A;  3N5L A;  2J4G A;  4DBQ A;  5FXX A;  1XDP A;  3AED A;  2N9D A;  3ZST A;  5AQM B;  3PUV F;  2BG9 B;  2VB6 A;  2XQ3 A;  4PW8 A;  1QLB A;  4WW0 A;  3AA7 B;  5J2T E;  4HKA A;  5IYZ E;  2XQY A;  4HFH A;  4UF0 A;  3PUQ A;  5JDN A;  2BVM A;  1WRD A;  3L3P A;  3ZMV B;  4XZC A;  3PJA A;  2XJ7 A;  2DWG A;  2FJB A;  3HI2 A;  5LG3 A;  5EK2 A;  4KX6 A;  2YDR A;  1W0A A;  3OKQ A;  3C4Z A;  4CN4 A;  3UFE A;  4QXB B;  2H88 A;  4HFB A;  4WNK A;  2V8S V;  3UQ4 A;  4HGA A;  2VL0 A;  4UEM A;  5CA1 E;  5JRE A;  4JI6 T;  1SE7 A;  4JUY A;  3RGL A;  5FXZ A;  2YOE A;  2CEA A;  5AQG B;  5ABH A;  2D9D A;  4TWH A;  3QC9 A;  4ANJ A;  2V5D A;  1ZHC A;  1HR0 T;  4HFE A;  4MHC A;  2WY2 A;  2E9X A;  4YJ3 E;  3RH3 A;  2K48 A;  1YKH B;  4KUM B;  3P50 A;  2E8I A;  3C51 A;  3TKL B;  1UCU A;  5JDL A;  5JTG A;  5IHY A;  4UV9 B;  3AAI A;  3JCF A;  2XHE B;  2FJE A;  1ZEE A;  4Z91 A;  3RPU A;  3RIU A;  3JC6 D;  4LML A;  2EHO A;  2A3D A;  3N9O A;  5AQR B;  3EHZ A;  4IE4 A;  4CI2 B;  4I4T E;  2RA1 A;  3NZQ A;  2X68 A;  3A7M A;  4CXY A;  5TAO A;  1G8X A;  4X5T A;  2V7M A;  2CBI A;  3VRA A;  5IWA T;  5LBQ B;  1OED A;  1HX1 B;  3RYH E;  5CA0 E;  2BG9 A;  3B13 A;  4PFP A;  5JDF A;  2MPK A;  1Z8U A;  3AE1 A;  2I6H A;  4DUY T;  2NTX A;  4IL9 A;  2M6B A;  5C3J A;  3O4X E;  1UUR A;  3SOL A;  3FZL B;  3L8R A;  3AAE B;  3EAM A;  2BZB A;  3D0T A;  5LYJ E;  3IA3 A;  4U2Y A;  3AA0 B;  1ZP0 A;  4KHZ F;  3P4W A;  4LFC T;  4LF6 T;  2EHO C;  3FZK B;  2FJA A;  1I94 T;  5E0O A;  1D0Z A;  3ANW A;  1W9R A;  1KK7 A;  3N9M A;  2XM2 A;  4LF4 T;  2LSK A;  3AEG A;  5C2T A;  1J5W A;  2V6Y B;  2D0U A;  2PFV A;  3N9N A;  4ZS2 A;  1SHZ C;  3AE2 A;  5LB7 B;  1E7P A;  1OED C;  3AE4 A;  4AKR B;  4F6R C;  3AVS A;  2YU2 A;  5L3F B;  2JQ9 A;  2LRL A;  2XAJ B;  4LFA T;  4ASK A;  1WCR A;  2WBL A;  2N2N A;  3GA8 A;  3Q5D A;  1W0B A;  3M3Z B;  3MXZ A;  4HWD A;  5A1L A;  2KWH A;  1G73 A;  2GK9 A;  3RI5 A;  4YTP A;  1JNR A;  4IE0 A;  4IDO A;  4L5G A;  4UVA B;  2W63 A;  2W00 A;  2RPA A;  5AQK B;  2VKD A;  1L0V A;  4GKJ T;  4WBN E;  3BQI A;  1Z0P A;  2ZLY A;  2XAH B;  4HEA A;  4PK5 A;  3VHL A;  4Q25 A;  1QSD A;  4A56 A;  4MLK A;  2C0S A;  3NRX A;  3PUZ F;  1HTJ F;  1HX8 A;  4IL4 A;  1T72 A;  4O8S A;  3F57 A;  2H89 A;  2Q9Q B;  3JC6 C;  3OJA A;  3ZPO A;  3ZN1 B;  4GKK T;  3GN5 A;  2WZH A;  1H7C A;  3KBU A;  5FY7 A;  2JQH A;  3K1S A;  4X64 T;  3ZYM A;  2IW5 B;  2CCQ A;  3WAJ A;  3L09 A;  2JPF A;  2DWK A;  4K0U A;  2V7K A;  2V1D B;  2FUP A;  4OK0 A;  3Q5E A;  2V6X A;  4IE6 A;  2E5V A;  4YXD A;  4ILA A;  3SWH A;  4AQF A;  4QHO A;  2W62 A;  1X9B A;  3NBX X;  3ZKR A;  1KEY A;  2XY8 B;  4JBW F;  4NXM T;  2WDR A;  3C50 A;  4YT0 A;  3CWZ B;  1HG2 A;  3OYZ A;  1YXR A;  3ZLI A;  2X51 A;  2XQ5 A;  5L3C B;  2NW9 A;  1T98 A;  2WM9 A;  3QNU A;  4ILU A;  3UU5 A;  2HPL A;  2X0L B;  4IE5 A;  5DAB A;  3UUX B;  3F2E A;  2BG9 E;  5KMG P;  2VWA A;  2YEV C;  4YY3 T;  4X66 T;  3M65 A;  2WDV A;  4TZ4 C;  2YIN A;  5C8Y E;  4UF0 B;  3B57 A;  1MIY A;  3UU4 A;  3G06 A;  5JDM A;  4ISS A;  3VR8 A;  3FZH B;  4DID B;  4DVD A;  3P4S A;  1T8B A;  2W0G A;  3LDQ B;  4EZH A;  5LA6 E;  1I6Z A;  5ABF A;  4AKG A;  3ZMS B;  4EV6 A;  1N32 T;  1IBM T;  4AKI A;  2PJQ A;  2WCA A;  1HG5 A;  5ADX L;  4LF9 T;  2V7I A;  1J1J A;  4JYA T;  4EZ4 A;  3JAF A;  2IC9 A;  1FJG T;  4IST A;  3SS1 A;  2X9H A;  4BA9 A;  2JRK A;  4HWI B;  2KLQ A;  3EVY A;  3CVR A;  3WI3 A;  3OYX A;  4ZHQ E;  2VQF T;  3AA1 B;  4DR2 T;  1NWM X;  1V9D A;  3C98 B;  4TV8 E;  4YSX A;  3UT5 E;  3ZCI A;  1T7S A;  4QWN B;  3ZT5 A;  3HL6 A;  2CHN A;  5JRC A;  4ZI7 E;  4U33 A;  3ZT6 A;  3QK6 A;  3ESL A;  5AQJ B;  3P7I A;  2E9X B;  4ZS3 A;  5LNK A;  4BJN A;  5JQG E;  5L4E A;  4NXN T;  1SUM B;  2XZE A;  1D0Y A;  3ZSS A;  4U7I A;  3N2G E;  3PE0 A;  2K3W A;  1D1C A;  1FMW A;  2QYW A;  1LKX A;  2WZI A;  2QGS A;  4X65 T;  2WB5 A;  5HEG A;  3IEE A;  2EHO B;  4CI1 B;  3CX7 B;  2UUB T;  2E2A A;  3K3Q C;  4H63 V;  1KFY A;  3RYC E;  4J2C A;  4L0R A;  4EAH A;  3ONX A;  4X1K E;  3I0Q A;  1O3X A;  2N1G A;  3HA4 A;  4KBM B;  2YDS A;  3UUB A;  2HH7 A;  3IHR A;  3KVA A;  5ETW A;  2BS2 A;  2IML A;  1OED B;  3AEC A;  2VKO A;  2BVL A;  2UUC T;  2DL1 A;  4JI3 T;  4DV3 T;  5KXJ A;  3AEE A;  3HKD E;  4DV0 T;  2L8K A;  4X1I E;  4U72 A;  2WMO A;  2UXB T;  4P0B A;  4TX5 A;  5HWX A;  3EUH A;  3PTR B;  4CI3 B;  4UVB B;  2LM9 A;  4ERR A;  3ANW B;  3TLW A;  1AJ3 A;  4ZI2 D;  2ES0 A;  3MK7 C;  4H63 H;  2VKJ A;  4EXT A;  2VKH A;  2OV9 A;  5LGN B;  3EDU A;  2D5U A;  5LOV E;  3MAC A;  3Q9D A;  2K24 A;  3AE9 A;  2LSJ A;  2HN1 A;  2ZM2 A;  2VVN A;  3PUA A;  4NUU A;  4QX7 B;  3Q5X A;  2MTQ A;  1LVF A;  2NP9 A;  4HWF A;  4YLH A;  3KV5 A;  2WS3 A;  2W4X A;  3DP7 A;  3P4R A;  3MKD A;  2JMK A;  4PAG A;  1R8I A;  3E08 A;  3NKZ A;  4ZZB A;  2J1D G;  3ZMU B;  4AIS A;  2WDQ A;  4ZEY A;  4LFB T;  5HXS A;  2H7V C;  4FI5 A;  3RX6 A;  3SFE A;  2C5I T;  4CXW A;  3K3O A;  3AE8 A;  3B5M A;  3ZYL A;  4I43 B;  2ZM8 A;  3LJC A;  2HHH T;  3GN5 B;  5JDH A;  3N9L A;  4C90 A;  3DTO A;  2CPT A;  4IDQ A;  3PUX F;  2BKO A;  4I55 E;  5AQI B;  3PUS A;  4AQY T;  2LJL A;  2WMN A;  2P9B A;  5LJN A;  1QUU A;  2A9U A;  5HEU A;  2XQ7 A;  1Y64 B;  2X0H A;  4LMJ A;  2R6G F;  2CRB A;  1E2A A;  4YTM A;  3JAD A;  1HFA A;  2YU1 A;  3OVU A;  2KIN B;  4AKL A;  3RC8 A;  3ZMT B;  4JI8 T;  2KT9 A;  3HKB E;  3V5S A;  4YTN A;  5M4Y A;  4KI0 F;  1NEK A;  5HAX A;  2VQE T;  2LEH A;  1D1A A;  3LK2 B;  3PU3 A;  1BR1 A;  1FMV A;  1XZY A;  5J2U E;  2LHR A;  4C91 A;  2V7J A;  3UTK A;  4YHJ A;  4DR6 T;  4IE7 A;  1VCT A;  4EED A;  2I0M A;  2X9Y A;  3UFG A;  3ETU A;  4X1Y E;  4TNV A;  1XNQ T;  3FBZ A;  5JDG A;  3KDS E;  4PJN A;  5EK3 A;  4DV2 T;  4ZI2 C;  1LVK A;  4IDZ A;  4DBR A;  5JR9 A;  4IHJ E;  1WFD A;  5FYM A;  5AQL B;  2HN2 A;  2ZMA A;  2OA5 A;  3EAB A;  4A98 A;  4ILC A;  3VKG A;  4DV5 T;  4FJO A;  3FZF B;  3EDV A;  5DJQ C;  2K9A A;  3RLF F;  4B3R T;  3CML A;  2B1E A;  2H7O A;  3AE5 A;  5GON E;  5ABF B;  2WAU A;  1DU2 A;  2C5K T;  2ODU A;  4H9S E;  3RQW A;  3QB5 A;  3T1Y T;  5ABE A;  3KFW X;  4A5X A;  3RF1 A;  1KNZ A;  4B3M T;  2ACX A;  3O1I A;  2BKN A;  4DND A;  3AE6 A;  3CX8 B;  4LF8 T;  5FL1 A;  3MJX A;  4GOU A;  4I0U A;  2KZ7 B;  4TN7 B;  1HCI A;  4UXN B;  3H3M A;  2CWO A;  5LP6 E;  5CGM A;  5AQN B;  5AQF B;  3T1H T;  2XUE A;  5JR9 C;  2J62 A;  1ZKE A;  3ONJ A;  5JRC B;  2CXD A;  4U7Y A;  2JJ9 A;  1WR6 A;  3NZP A;  4AXP A;  2KXP B;  2WWU A;  4EIW A;  2X9X A;  3KV4 A;  2NR4 A;  3GWH A;  5AQT B;  1HNX T;  4DV6 T;  3CQG B;  4EGW A;  3PUG A;  4U31 A;  4O4L E;  5EK4 A;  3WAK A;  3ZT7 A;  5FY0 A;  4JI5 T;  4JLE A;  3FZM B;  4EB6 E;  2CWY A;  3PV0 F;  5L47 A;  1N36 T;  3HKE E;  3RC3 A;  3ZJ2 A;  1X79 A;  2QA7 A;  4PJL A;  5HEJ A;  5CFB A;  1HS7 A;  2MYS A;  2Q9Q D;  2KMF A;  3LBX A;  4PFO A;  2OLT A;  5LGT B;  2UXC T;  3A8Y C;  4GK0 E;  3ABV A;  1IBK T;  1OED E;  3NVO A;  5L3D B;  1IBL T;  2W67 A;  5L3E B;  2FJD A;  3PUY F;  4DUZ T;  3NWI A;  2CLY C;  4G2A A;  1YKE B;  2XM1 A;  1MMG A;  4IDN A;  2SPC A;  1U5P A;  4EYY R;  1ZV4 X;  3RRC A;  2XAS B;  5L4H A;  1VCS A;  2FBW A;  2RP4 A;  5L2L A;  2W2U A;  2XAQ B;  5CB4 E;  5HCM A;  2NTY A;  5BMV E;  5FP3 A;  4EOZ B;  2DLR A;  3ZYK A;  1S94 A;  4B3T T;  4YFS A;  3VKH A;  1MIV A;  3ZC1 A;  3ZCJ A;  4EYU A;  4HTE A;  2Y48 B;  4H9N C;  1MMA A;  2DHR A;  4O4J E;  3CKD A;  4QH5 A;  1CHU A;  2ODV A;  5LJM A;  2BBJ A;  4GYS A;  5LMN T;  2G0U A;  1D1B A;  3J9X 1;  2M6I A;  2WWV A;  3BK9 A;  3HR0 A;  4QH1 A;  3C4W A;  4CN1 A;  3T8O A;  3P8C D;  2NWB A;  5HXH A;  4ZZC A;  1XMQ T;  2XQ4 A;  5H6R B;  2BDE A;  4DV7 T;  1KNR A;  5FMN A;  5HYA A;  5IUX A;  1US7 B;  3MA9 A;  3LG7 A;  4DR5 T;  4E7Z A;  2XSB A;  4U74 A;  2UUA T;  5HEH A;  5EZY E;  2Y8D A;  1IAP A;  3IBP A;  3EI0 A;  5LCY A;  3PJA J;  5AQV B;  1FEW A;  4AKH A;  1EZ3 A;  1FIO A;  3ZC0 A;  3BQK A;  2YK0 A;  4COF A;  2LSY A;  4GYR A;  2CA5 A;  1WLX A;  5FXV A;  2IHR 1;  5CJ5 A;  4B3S T;  4HFD A;  5FVL A;  4U2Z A;  5FL0 A;  3UUL A;  3QB5 K;  2E9X D;  5JVD E;  2L3L A;  2Q9Q C;  2CHO A;  2W66 A;  3IF8 B;  4HN9 A;  4H9R C;  3PDY A;  4A97 A;  3A5X A;  4AIU A;  4EEB A;  1XWM A;  3OPC A;  2WSS V;  1UUS A;  3R84 B;  3AE7 A;  4DO0 A;  2JMH A;  3CX6 B;  4IIJ E;  4MAL A;  2LSG A;  3Q2M A;  2LOP A;  5FNV E;  3JAE A;  3UUM A;  2EHO D;  2CM0 A;  4WBO A;  1BR0 A;  4N78 D;  3KBT A;  2B76 A;  5HWY A;  2XAG B;  4ILB A;  3N2O A;  4P1N A;  1M62 A;  1E1H B;  1MMN A;  4DV4 T;  1ZOY A;  3RIA A;  3FB2 A;  2KWI B;  1WYB A;  2LE8 A;  3LK3 B;  4JI4 T;  2WU5 A;  3CQX C;  1VRB A;  2CXL A;  3CK6 A;  1YQ4 A;  2LKH A;  4CQI A;  2QRX A;  2UXD T;  5DQV A;  5HXC A;  5HXR A;  2XTL A;  3R6N A;  2V5C A;  5JR9 B;  3H3A A;  2YKS A;  4V1A v;  2VAS A; 
#chains in the Genus database with same CATH homology
 3SWH A;  3CPZ A;  4AQF A;  2X9Y A;  4QHO A;  2W62 A;  3ETU A;  3RYF E;  4X1Y E;  3NBX X;  4O2B E;  1YD8 G;  2NW7 A;  4GIW A;  3FBZ A;  2K5B B;  4HE8 A;  5JDG A;  2X67 A;  3MZK B;  3C50 A;  3KDS E;  4PJN A;  3CWZ B;  5LHI B;  5LG4 A;  5EK3 A;  3KV6 A;  1HG2 A;  1D0X A;  1LVK A;  3OBV E;  4ZI2 C;  4IDZ A;  3OYZ A;  4DBR A;  5KDM C;  5JR9 A;  4IHJ E;  1MNE A;  3ZLI A;  2X51 A;  2MBG A;  5L3C B;  2LHN A;  2NW9 A;  5FYM A;  1T98 A;  2WM9 A;  3I0O A;  4KMC A;  3QUJ A;  2ZMA A;  4ILU A;  3ZN0 B;  2OA5 A;  3DJB A;  2V7L A;  3VU7 H;  3VKG A;  4X20 E;  2PG8 A;  1UX4 A;  2HPL A;  4H9O C;  2HPJ A;  2X0L B;  4IE5 A;  5DAB A;  4FJO A;  3UUX B;  3F2E A;  4BJM A;  4GK5 E;  5KMG P;  2VWA A;  2YEV C;  3SRZ A;  3F31 A;  3EDV A;  4ZI3 C;  3M65 A;  5DJQ C;  4TZ4 C;  2D2S A;  2K9A A;  3ZEF B;  3K8P C;  2H3R A;  5LHG B;  2YIN A;  4YJ2 E;  3CML A;  5C8Y E;  2B1E A;  2H7O A;  5GON E;  2DCF A;  2WAU A;  3KVB A;  3N5L A;  4UF0 B;  2C5K T;  2JQQ A;  2ODU A;  3B57 A;  3RYI E;  4H9S E;  4DBQ A;  5FXX A;  2Y6X A;  3KFW X;  2CMR A;  1MIY A;  1KNZ A;  2ACX A;  2N9D A;  3E0Z A;  3O1I A;  4P0A A;  4DND A;  5JDM A;  4ISS A;  1BR2 A;  2VB6 A;  3ETV A;  4DVD A;  3CX8 B;  4PW8 A;  4WW0 A;  3MJX A;  2W0G A;  3AA7 B;  4GOU A;  2PBI A;  4EZH A;  5J2T E;  5LA6 E;  4HKA A;  2KZ7 B;  4TN7 B;  1HCI A;  2XQY A;  5IYZ E;  2C5J A;  4AKG A;  4UF0 A;  3ZMS B;  3PUQ A;  2CLY B;  4CXX A;  5JDN A;  4UXN B;  4AKI A;  2BVM A;  2PJQ A;  1WRD A;  4M1P A;  3L3P A;  3O9X A;  4OFZ A;  3ZMV B;  2CWO A;  5LP6 E;  1HG5 A;  2NW8 A;  4XZC A;  5ADX L;  2V7I A;  2XUE A;  2DWG A;  1OWA A;  3HI2 A;  5JR9 C;  1ZKE A;  3CQC B;  4EZ4 A;  3UUN A;  5JRC B;  2CXD A;  2IC9 A;  5EK2 A;  4IST A;  2JJ9 A;  3SS1 A;  2E9X C;  2V26 A;  2X9H A;  4BA9 A;  3OKQ A;  2JRK A;  1WR6 A;  3C4Z A;  4DMW A;  2KLQ A;  3NZP A;  3EVY A;  4AXP A;  2KXP B;  3CVR A;  3WI3 A;  3OYX A;  4ZHQ E;  2WWU A;  1WYC A;  4EIW A;  3AVR A;  3AA1 B;  3UFE A;  1NWM X;  1V9D A;  3AA6 B;  4QXB B;  2IAK A;  3C98 B;  2X9X A;  4TV8 E;  3KV4 A;  4WNK A;  4HGA A;  3UT5 E;  3ZCI A;  3GWH A;  4UEM A;  5CA1 E;  1IZN B;  5JRE A;  4QWN B;  1LRZ A;  4JUY A;  3HL6 A;  5JRC A;  1NAF A;  3CQG B;  4ZI7 E;  3QK6 A;  3ESL A;  3PUG A;  4O4L E;  5FXZ A;  3FXE B;  5EK4 A;  3P7I A;  3WAK A;  2I59 A;  2E9X B;  3LBX B;  4ZS3 A;  4BJN A;  5LNK A;  5JQG E;  5FY0 A;  2CEA A;  3RRW A;  2D0T A;  4DMV A;  3FHN A;  4JLE A;  3O1J A;  4MBQ A;  2CWY A;  1MIW A;  4EB6 E;  1MND A;  1YW0 A;  3KV9 A;  5LBM A;  1D0Y A;  3QC9 A;  3HKE E;  3RC3 A;  3KIN B;  3ZJ2 A;  4ANJ A;  1X79 A;  4E7S A;  3N2G E;  4JEH B;  2QA7 A;  4PJL A;  3N9Q A;  1ZHC A;  3H37 A;  3PE0 A;  4MHC A;  5J1G A;  1D1C A;  1FMW A;  1LKX A;  1HS7 A;  2QGS A;  2MYS A;  4PJM A;  2Q9Q D;  2KMF A;  1CUN A;  2E9X A;  3LBX A;  1U4Q A;  4PFO A;  4YJ3 E;  3N9P A;  3RH3 A;  5LGT B;  2K48 A;  3IEE A;  1YKH B;  4GK0 E;  4KUM B;  2EHO B;  4CI1 B;  5LGU B;  2KND A;  3CX7 B;  2E8I A;  3C51 A;  3K3Q C;  4PNI A;  3TKL B;  4H63 V;  5L3B B;  1UCU A;  4ZOL E;  5L3D B;  1OXZ A;  5JDL A;  5IHY A;  3RYC E;  5L3E B;  4J2C A;  3AB3 B;  4UV9 B;  2CLY C;  3AAI A;  4L0R A;  4G2A A;  4EAH A;  1YKE B;  5LHH B;  2XHE B;  3C4X A;  1ZEE A;  1MMG A;  3ONX A;  2LSI A;  3I0Q A;  4X1K E;  3RPU A;  4OYJ A;  1O3X A;  2N1G A;  4L9I A;  3JC6 D;  3HA4 A;  4KBM B;  2EHO A;  2A3D A;  3N9O A;  2HH7 A;  3IHR A;  2SPC A;  1U5P A;  3KVA A;  4G63 A;  4H9P C;  5ETW A;  2Z6E A;  4IE4 A;  4CI2 B;  5AFU L;  4I4T E;  4EYY R;  1ZV4 X;  2RA1 A;  3RRC A;  5LXT E;  2XAS B;  3NZQ A;  2X68 A;  2VKO A;  2RP4 A;  2A72 A;  2BVL A;  5L2L A;  4CXY A;  5TAO A;  1G8X A;  2XAQ B;  4O2A E;  5CB4 E;  5HXE A;  2UXX B;  2NTY A;  5BMV E;  5FP3 A;  4EOZ B;  2V7M A;  3HKD E;  2DLR A;  5F3J A;  5JH7 E;  3ZYK A;  1S94 A;  4YFS A;  3PU8 A;  3RKO A;  2L8K A;  2X66 A;  4X1I E;  3VKH A;  5LBQ B;  3I9W A;  4U72 A;  1MIV A;  1MMD A;  1S35 A;  2WMO A;  3RYH E;  4KP3 C;  5CA0 E;  4P0B A;  3B13 A;  3ZC1 A;  4TX5 A;  4PFP A;  3ZCJ A;  5JDF A;  4PK6 A;  5HWX A;  4EYU A;  4HTE A;  3EUH A;  2Y48 B;  3PTR B;  4CI3 B;  4H9N C;  4UVB B;  2LM9 A;  1MMA A;  1SA0 E;  2NTX A;  2DHR A;  1UX5 A;  4ERR A;  4QX8 B;  3O4X E;  3SOL A;  4PK4 A;  4O4J E;  2UXN B;  3CKD A;  3ANW B;  2ODV A;  4AQG A;  3U78 A;  3E22 E;  3FBL A;  5LJM A;  1VOM A;  3N2K E;  3AAE B;  4GYS A;  1AJ3 A;  3AAA B;  4MFR A;  2BZB A;  4ZI2 D;  3D0T A;  3GMI A;  2ES0 A;  5LYJ E;  2G0U A;  3MK7 C;  5JDQ A;  1D1B A;  4H63 H;  2VKJ A;  3J9X 1;  4EXT A;  2VKH A;  3BK9 A;  5LGN B;  3AA0 B;  3O1H A;  3EDU A;  3PUR A;  2D5U A;  5LOV E;  3MAC A;  2EHO C;  3HR0 A;  5F8P A;  3Q5W A;  3C4W A;  4TV9 E;  5E0O A;  3T8O A;  1D0Z A;  3P8C D;  3ANW A;  4AI6 A;  3Q9D A;  2LT3 A;  1KK7 A;  2K24 A;  3N9M A;  2NWB A;  5HXH A;  2LSJ A;  4ADZ A;  4BAY B;  5H6R B;  2BDE A;  2LSK A;  3LFM A;  4ZI3 D;  2ZM2 A;  5L3G B;  3ZJ1 A;  5FMN A;  3PUA A;  5HYA A;  2D0U A;  1US7 B;  4H9Q C;  2PFV A;  3N9N A;  3MA9 A;  3LG7 A;  4NUU A;  4QX7 B;  4ZS2 A;  4OYK A;  3HKC E;  1SHZ C;  4E7Z A;  1IJ5 A;  1BR4 A;  4U74 A;  3Q5X A;  2MTQ A;  4AKR B;  4F6R C;  5EZY E;  3AVS A;  2YU2 A;  2XAF B;  2Y8D A;  5L3F B;  2XAJ B;  1LVF A;  2NP9 A;  1IAP A;  3U3I A;  3IBP A;  4YLH A;  3KV5 A;  4ASK A;  5LCY A;  2WBL A;  2N2N A;  3K3N A;  2DNX A;  4O4I E;  3DP7 A;  3GA8 A;  3W15 B;  3J7Y q;  1FEW A;  4AKH A;  1EZ3 A;  1FIO A;  3MXZ A;  3ZC0 A;  4UIG A;  5A1L A;  2KWH A;  1G73 A;  3BQK A;  3MKD A;  2GK9 A;  2NOX A;  2YK0 A;  2JMK A;  2LSY A;  4PAG A;  2W61 A;  3E08 A;  4GYR A;  2CA5 A;  4HFV A;  1WLX A;  5FXV A;  4QXH B;  2J1D G;  3ZMU B;  4IE0 A;  4I50 E;  3S4U A;  4L5G A;  4QKN A;  5HXS A;  3UUL A;  4UVA B;  2W63 A;  2H7V C;  4FI5 A;  2W00 A;  4XBF B;  5KX5 E;  3RX6 A;  2E9X D;  2VKD A;  5JVD E;  2L3L A;  2Q9Q C;  2C5I T;  3LK4 2;  4WBN E;  4CXW A;  3BQI A;  1Z0P A;  3IF8 B;  2ZLY A;  3K3O A;  2XAH B;  4HEA A;  4HN9 A;  2X9W A;  3ZMZ B;  4H9R C;  4OHF A;  3PDY A;  2L9Q A;  4PK5 A;  3VHL A;  3A5X A;  3ZYL A;  3BQL A;  4I43 B;  1QSD A;  3I1A A;  2WSS V;  2A2F X;  2ZM8 A;  4A56 A;  3LJC A;  3GN5 B;  4MLK A;  3V5U A;  3I9Y A;  2C0S A;  3NRX A;  3R84 B;  4B6X A;  5JDH A;  4DO0 A;  1B7T A;  3N9L A;  1HTJ F;  4C90 A;  1HX8 A;  2JMH A;  3CX6 B;  1HF8 A;  3DTO A;  4IIJ E;  4MAL A;  2LSG A;  3Q2M A;  2LOP A;  4AQF C;  4I55 E;  4O8S A;  5FNV E;  3F57 A;  3PUS A;  3UUM A;  2LJL A;  2WMN A;  2ZM0 A;  2CE7 A;  2EHO D;  2P9B A;  2Q9Q B;  3C64 A;  3JC6 C;  2CM0 A;  3OJA A;  5LJN A;  1QUU A;  4JEU B;  2LOS A;  4PJJ A;  4WBO A;  1BR0 A;  4N78 D;  1IJ6 A;  3ZPO A;  3KBT A;  3ZN1 B;  4IGU A;  5HWY A;  1Y64 B;  2XAG B;  2M67 A;  2MOZ A;  3N2O A;  3GN5 A;  4UVC B;  3FXD B;  1H7C A;  3KBU A;  5FY7 A;  4Z8X A;  3ZYM A;  5FY1 A;  1E1H B;  1MMN A;  4P09 A;  4QXC B;  5H6Q B;  3NRY A;  2VL8 A;  3FB2 A;  2IW5 B;  2KWI B;  1HFA A;  1WYB A;  2CCQ A;  2LE8 A;  2YU1 A;  3LK3 B;  4XAX B;  3WAJ A;  3L09 A;  2KIN B;  4AKL A;  3RC8 A;  3ZMT B;  2Q9Q A;  2KT9 A;  3CQX C;  1VRB A;  3HKB E;  2CXL A;  2JPF A;  2DWK A;  4K0U A;  3V5S A;  5M4Y A;  2V7K A;  4TUY E;  4CQI A;  2CXF A;  5HAX A;  4O4H E;  5DQW A;  2LEH A;  2V1D B;  4UV8 B;  4OK0 A;  5DQV A;  1D1A A;  3LK2 B;  5FXW A;  3PU3 A;  1BR1 A;  1FMV A;  2XTL A;  5HXC A;  5HXR A;  3R6N A;  4UEL A;  5JR9 B;  2IC6 A;  4NUV A;  5J2U E;  2LHR A;  3H3A A;  2VK9 A;  4C91 A;  2V7J A;  4V1A v;  4IE6 A;  3UTK A;  4YHJ A;  4CZZ B;  4IE7 A;  2VAS A;  2DI4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...