3W15B

Structure of peroxisomal targeting signal 2 (pts2) of saccharomyces cerevisiae 3-ketoacyl-coa thiolase in complex with pex7p and pex21p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
72
Chain Sequence
SELQRIATDIVKCCTSSSVESKLSESKFIQLMRNISSGDVTLKSELFSSNNGELVGNRHIFVKDEIHKDILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peroxisomal targeting signal 2 receptor
publication title Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 20
structure length 72
sequence length 92
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3w15B00
3W15B
chains in the Genus database with same CATH superfamily
2WZHA 5JR9C 2YOEA 3PTRB 4KBMB 2LKGA 3WAJA 1SUMB 4X20E 1IBMT 4LFBT 1LVFA 3FZLB 2NW8A 3PJAJ 4AISA 2IHR1 3GN5A 5L4EA 5CA0E 3QB5K 3CQCB 4ILBA 5LCYA 5HEJA 1XWMA 2HHHT 2JRKA 4IDNA 3N2KE 3C50A 3I0QA 3VKHA 4OX9T 3P4WA 2VK9A 5JR9A 5AQSB 2FJEA 4AXPA 3CIRA 5FXZA 1UURA 2VL8A 1MIYA 2CCQA 4JYAT 2N9DA 2BKOA 2LM9A 2J1DG 2XQ6A 4ADZA 2CM0A 4NXMT 4DO0A 1OWAA 5HXSA 4YJ3E 2ODUA 1AJ3A 2WZIA 4YY3T 3ZSSA 1MIWA 4B3TT 5TAOA 4B3MT 3JAFA 4OK0A 2QVAA 4QXHB 3RLFF 4GKKT 2D5UA 1T98A 5FVLA 4N78D 3L8RA 3NRXA 5HXHA 2KXPB 4DV2T 4ILAA 4IHJE 4HFVA 3VRBA 5KXJA 1BR4A 3SRZA 2VB6A 5KX5E 4QWNB 2UUCT 3E08A 1ZOYA 4DMWA 5L3EB 5AQOB 3UT5E 4MBQA 1QSDA 3Q5EA 5JDFA 4I50E 1LKXA 2KNDA 2WU5A 2H88A 5H6QB 2H7OA 3M3ZB 4HFHA 5JVDE 5L4HA 4HWCA 4F8HA 4JI2T 5LGNB 4YXDA 3OJAA 3Q9DA 4YJ2E 2KSRA 3RIFA 2CMRA 4IL4A 5JDLA 2LRLA 3B57A 2WY2A 5FXWA 2XAGB 2V7IA 5IHYA 2W62A 1J1JA 3OPCA 2V8SV 4UEMA 1SA0E 2V6YA 1I6ZA 5LB7B 4H9SE 4DBRA 3RHWA 5JDNA 5AQRB 4DV5T 3I9WA 3P4PA 3N9NA 4XBFB 4LMKA 5FMNA 2FBWA 3ZPOA 2LJLA 4UV8B 2X67A 4BJNA 1XMQT 4PK4A 4IDQA 2M6IA 2BS3A 2MBGA 1T8BA 2W66A 1HTJF 4TZ4C 4Z90A 1XDPA 4BA9A 4YFSA 2MPKA 4NPPA 1D0XA 4K0UA 1M7KA 4AKHA 3ZMZB 2E9XB 3LJCA 5CB4E 4EXTA 3EAMA 4ZI3C 4FI5A 4PW8A 3PUGA 1HNXT 2Z6EA 4PAGA 4JEHB 2V5DA 3N9PA 3O1IA 4NIQA 3FZMB 4P09A 2OV9A 5LXTE 5HYAA 2XSBA 4KP3C 4H9RC 2W0GA 4KUMB 3I1AA 2CPTA 1FMVA 2VURA 4U7YA 3ZT7A 3KFWX 4TWDA 3RQWA 3RI5A 3MZKB 4DR3T 3B13A 2JQ9A 1FMWA 4EEBA 3VRAA 2DCFA 1FJGT 1D1AA 2K9AA 5BR8T 4H9OC 2CXFA 3AEEA 1EZ3A 4YLHA 3NRYA 5HCMA 4EEDA 2LEHA 4HFBA 4I55E 2WM9A 2W00A 4JLEA 2YK0A 4DVDA 3KV5A 4IE7A 4E7SA 5L3BB 3ABVA 1HF8A 4DR5T 2KWHA 2YKSA 2PFVA 4X1YE 5JRCB 2YN6A 2VVNA 5HAXA 5DQVA 2CBIA 4I43B 5JDMA 3JCFA 5LP6E 4ZZCA 4X1IE 1UUSA 1FEWA 4DR4T 4YT0A 3VKGA 5ETWA 4LFAT 2UXNB 5FY0A 4H9PC 4GOUA 5L2LA 4XAXB 2Q9QB 3ANWA 2KWIB 1WR6A 3KDSE 3C4WA 3LFMA 3CPZA 4JI5T 2UXXB 1Y01A 4DR6T 3VHLA 4QHOA 3AAEB 3ZSTA 4GK0E 2E8IA 3AE6A 2XQ5A 5ABFA 2XY8B 2XAFB 4KHPT 2X51A 1U5PA 3UTKA 2G0UA 3MJXA 4CN1A 1E1HB 2WDVA 3C4ZA 5DQWA 2X9HA 2LT3A 4TWFA 3KBUA 2BBHA 4H63H 3NKZA 4TN7B 4ZOLE 4ANJA 2PG8A 3PUSA 5LHHB 3G06A 4HEAA 3L3PA 4EYYR 4IL9A 3CKDA 4IT4A 1W0AA 2ZM2A 4H63V 2J62A 5ABHA 2M67A 4DV6T 5LHGB 2VKHA 2PJQA 4F6RC 4CXWA 4MALA 2L9QA 4B3RT 2VWAA 3ZCJA 1Z0PA 5LBMA 2JIWA 1VCTA 5HEUA 4DR7T 3R6NA 4EZ4A 4LFCT 3EHZA 2X9YA 5AQIB 3RYFE 5LHIB 2MOZA 5L3DB 3N5LA 3BQIA 1X9BA 2NTYA 3TLVA 1G8XA 1J5WA 2CXDA 3HKBE 1US7B 3OYZA 4GK5E 1N34T 3AA1B 2E5VA 3PUYF 3HKDE 2HPJA 3UULA 1DU2A 4EIWA 3PDYA 4COFA 2CWYA 4TUYE 2WMNA 3RYCE 2CLYC 5JRCA 3N9LA 2LLYA 5C3JA 4WNKA 2OLTA 2V26A 2DWGA 2NWBA 3EVYA 3QUJA 1D1CA 3AECA 1ZEEA 3LG7A 1YXRA 5L3CB 5IWAT 4L0RA 2W67A 3Q5DA 1OXZA 3MXZA 3RKGA 3EI0A 5EK4A 1BR1A 4YTMA 2VASA 5DABA 1WRDA 3N9OA 3UUBA 5JDQA 4KHZF 3CX7B 2XAJB 1WYCA 1XNQT 2L3LA 4O4IE 3ZT6A 3OYXA 2L8KA 5ABEA 3AEDA 2ACXA 3L09A 4LF7T 4CZZB 3E22E 2RA1A 3J7Yq 2YINA 4DUYT 1UK5A 3OKQA 3LBXB 3QOFA 3AE9A 5IYZE 1NEKA 5F5WA 1HNWT 2QGSA 2YDSA 3T8OA 5LJNA 5HXCA 3RYHE 2WAUA 3SFDA 1XMOT 4MFRA 4QX8B 2I6HA 3DTOA 3CX6B 3S4UA 3NVOA 2RP4A 3V5UA 2MYSA 2WS3A 2LHRA 4ILUA 4QH5A 4Z91A 4DV0T 2E5LT 5LG4A 5FXVA 1XZYA 3PUWF 2ZM0A 3AE2A 2BG9E 3C64A 4H9QC 4KI0F 2YU1A 4KX6A 4HFEA 1B7TA 5KDMC 4PFOA 3RIAA 5ABGA 4CXYA 3HKEE 1J5ET 4CN6A 2CRBA 5JQGE 2XAHB 2A2FX 4ZS3A 4JV5T 4O4LE 4K0KT 2W61A 2CA5A 3EDVA 4OYJA 5L3GB 4U72A 3RPUA 3F2EA 2NR4A 4EAHA 2LM2A 5JREA 4A98A 5EK2A 2RPAA 2EHOB 4DNDA 4ZI3D 2V7KA 1QLBA 2BS2A 4JI4T 4Z8XA 2XHEB 5J0ZA 1HS7A 2XM2A 3JC6C 4WYVA 2QYWA 3FHNA 5HXRA 5LGUB 1MNDA 3CQGB 4YTNA 4DR1T 3ZLIA 2ZM8A 3EDUA 4LMJA 2CEAA 4ZI2C 4UVBB 3ONXA 2IC9A 4IREA 1IAPA 4G2AA 5AQGB 3MKDA 4P0BA 3N9MA 3NZPA 4C90A 4QKNA 2K5BB 3UU5A 2D0UA 2XQ3A 3UQ7A 3RX6A 5JDHA 4UV9B 1HFAA 2HN2A 3ZMVB 1SE7A 4AQGA 2KLQA 3O1JA 2ZLYA 3C51A 3SS1A 1YKHB 1OEDB 3D0TA 3P4SA 3MACA 2DNXA 4AQYT 5FVKA 4GYRA 2D9DA 4CI3B 3E0ZA 2C5JA 5LOVE 5L3FB 2YDQA 3RIUA 2KT9A 4I4TE 3ZN1B 3KBTA 1UX5A 3P8CD 1YD8G 3RKOA 3AVRA 1ZV4X 2WSSV 3KV6A 2IUBA 4LF5T 2HH7A 4GIWA 2DLRA 5LA6E 3UUMA 3O9XA 4PJLA 4UVCB 3ZYKA 2E2AA 5JDGA 5M4YA 1E7PA 4O4HE 2UXDT 1R8IA 4IE5A 4DV3T 3MA9A 1HCIA 4UVAB 3K3QC 2KINB 5AQUB 2PTFA 2XQ8A 4X64T 3IEEA 1MNEA 4ILCA 4P1NA 5LYJE 3ZC1A 2W63A 4WBOA 2LE8A 2NOXA 2GK9A 4HWFA 3OTOT 1IJ6A 5FL1A 2D2SA 4TV9E 3UUNA 4JBWF 3OBVE 3RRCA 3O1HA 3F31A 2K3WA 4CN4A 1SHZC 1IBLT 1S94A 5E0OA 4HGAA 3QC9A 3IHRA 3JADA 3PUVF 2XASB 5AQFB 4I0UA 2XTLA 1VRBA 3VR8A 2XQAA 3AEFA 1X79A 3VR9A 2YDRA 4L9IA 2EHOA 1MMNA 4HTEA 4OYKA 3BQLA 2XQYA 1LVKA 5L47A 3EABA 3CWZB 3P7IA 1JNZA 5LBQB 3ESLA 3LSVA 5CGMA 3RRWA 2JQHA 3R84B 1QUUA 4EGWA 3O4XE 2LSYA 4JEUB 1XDOA 4U7IA 3FZFB 4TV8E 1HX8A 3GMIA 4XZCA 3PURA 4WBNE 3TLTA 2X0HA 5AFUL 2IW5B 1W9RA 3H3MA 5HEHA 2FJBA 5LGTB 2W2UA 4A56A 3ZMUB 2E9XC 4QXCB 2BKPA 4GYSA 1HG5A 3T1HT 4G63A 3L39A 4X1KE 2CHOA 3AE7A 2LSKA 3HKCE 3UU4A 2IAKA 2V7MA 3I0OA 3U78A 3AE8A 2V7JA 1LRZA 2K48A 2WWVA 2JMHA 2BG9B 4E7ZA 4NUUA 4YTPA 2E9XA 4TNWA 2XM1A 3KINB 4NXNT 1UCUA 1UX4A 2J4GA 5JR9B 3AA0B 3PUAA 1OEDE 2C5KT 5CFBA 4LF4T 1HG2A 3TLUA 3AXJB 1T7SA 5J2UE 2JJ9A 1D1BA 3I9YA 2M6BA 3KV9A 4LF8T 3HL6A 5AQTB 4BJMA 5HXEA 3C4XA 5EZYE 4EOZB 3SFEA 3IA3A 2I59A 3ZJ2A 2D0TA 2FUPA 1CUNA 4U2YA 3CK6A 1H7CA 3QB5A 4PK5A 5J2TE 3H37A 2JPFA 2XJ7A 4DIDB 2FJAA 2H7VC 4GKJT 2Q9QC 3PE0A 1E2AA 3JAEA 4DV7T 3AEAA 3LK2B 1M62A 3ZT5A 2LHNA 4CI2B 5LNKA 4O2BE 3H3AA 4ZHQE 2PBIA 4PJJA 3GA8A 3ZC0A 4JI7T 2IDOB 3PUQA 4O4JE 3TLWA 2WB5A 4O2AE 4AKLA 3NZQA 2IC6A 3LDQB 3AAIA 4J2CA 1NENA 4X65T 4PJMA 2B76A 2CXLA 2XAQB 2Q9QA 3LK42 4PFPA 2XQ7A 5HCJA 1WCRA 4KMCA 5HEGA 3FXDB 4DBQA 1CHUA 2XZEA 3HA4A 4UF0B 4X5TA 3HR0A 2CE7A 3PUZF 4YSYA 2DI4A 4TNVA 2LSIA 2V6YB 4A97A 3AAAB 2UXCT 3ZJ1A 4AKRB 3NBXX 3ZEFB 4V1Av 2DHRA 3OVUA 4MLKA 4UIGA 5FY7A 2MTQA 3FBZA 1ZHCA 4TWHA 5JTGA 2A9UA 2BG9A 4HFDA 2VVSA 2BS4A 3M65A 2ES0A 3Q2MA 5LG3A 4OFZA 2C5IT 4ASKA 3JC6D 3AE4A 4U74A 5FP3A 5HEOA 3AXJA 1KNPA 3AE5A 5AQLB 4ZI2D 3UFEA 4YSXA 2BZBA 3MK7C 1I94T 2VKOA 1WFDA 2CBJA 5AQHB 3ZMTB 2ODVA 1Y64B 3ONJA 1VCSA 5AQKB 4DUZT 3IF8B 2KZ7B 2BBJA 3PJAA 5BMVE 4UXNB 3VU7H 4HWHA 1BR2A 4Q25A 3IBPA 2XQ4A 2ACZA 2HN1A 2WWUA 5IUXA 3F57A 2NW9A 4C91A 2BDEA 4ISTA 5AQMB 3ZMSB 5CJ5A 5AQVB 1IBKT 4TX5A 4HKAA 1D0YA 3N2OA 1W09A 1JNRA 4LF6T 1YQ4A 1KFYA 2HPLA 4EZHA 1NAFA 4P0AA 5LMNT 5J1GA 5F3JA 3WAKA 1Z8UA 2VL0A 2UU9T 1NWMX 2X68A 3AEBA 1L0VA 2VQET 3ZYMA 2LRKA 1KK7A 3RGLA 3AEGA 3A7MA 1U4QA 5FL0A 1T72A 2UUBT 3RIUC 4M1PA 5FYMA 4NUVA 2EHOD 4UF0A 1KNZA 4AIUA 3Q5WA 2W4XA 2X9WA 5DJQC 3FXEB 3RQUA 4AQFC 3ANWB 3FBLA 3CMLA 3CQXC 1V9DA 3K8PC 2X0LB 5HWYA 5H6RB 3EUHA 2J47A 2A72A 2NP9A 4YSZA 4IGUA 1WR0A 4FJOA 3V5SA 5ABFB 3ETUA 3LBXA 3Q5XA 3KVAA 4PJNA 1WYBA 4AQFA 5FXXA 4UR9A 3QK6A 5AQQB 1S35A 4ISSA 4U2ZA 2F4VT 4MHCA 1MMDA 1YQ3A 2R6GF 3CX8B 4ZZBA 3P4QA 3X1DA 1XNRT 2JMKA 1N32T 4EV6A 3FB2A 2SPCA 2XUEA 2QA7A 4IDPA 2H89A 1HR0T 4X62T 3ZYLA 3AVSA 5A1LA 3UU6A 3BQKA 1N33T 2E9XD 1KF6A 2H3RA 2IMLA 4YHHT 4DV4T 2EHOC 3P50A 2ZM6T 4QX7B 4QH1A 4JI6T 1IJ5A 5FNVE 3K1SA 1IZNB 4HN9A 2YU2A 5FY1A 4CQIA 3KVBA 2AE9A 3FZKB 2B1EA 2C0SA 5KMGP 4HFCA 3PV0F 2WBLA 2VKDA 4WW0A 4LMLA 3LK3B 3ZCIA 5FKYA 4U31A 4WZXA 2CWOA 2I0MA 2LKHA 5EK3A 3SWHA 4JI1T 3TKLB 1KNRA 4ZS2A 1G73A 3GWHA 3SOLA 4AI6A 3UUXB 1OEDC 1ZP0A 1KEYA 5GONE 1N36T 3A8YC 2P9BA 2FJDA 4HFIA 3UQ4A 3DJBA 2BKNA 5C8YE 4L5GA 2ZMAA 1MMAA 2WP9A 4U33A 4AKIA 4HWIB 5LMUT 2KMFA 3PUXF 4JI3T 1YW0A 3K3OA 2V7LA 3B5MA 2JQQA 5JH7E 1D0ZA 2UXBT 3KV4A 4H9NC 1OEDA 3HI2A 1HX1B 3AE3A 2LOPA 1FIOA 2Y6XA 3RC3A 2CLYB 2XQ9A 4AKGA 3WI3A 2UUAT 2WDQA 2Q9QD 3K3NA 5CA1E 2XSAA 2V1DB 2DWKA 4QXBB 3GN5B 3W15B 3A5XA 4CXXA 4EB6E 2DL1A 2V5CA 2NW7A 4QH4A 2WMOA 2LSJA 2MAWA 2WQYA 4A5XA 2WDRA 3P4RA 1W0BA 3N2GE 4IDOA 4B6XA 2V6XA 5F8PA 1MIVA 4ZXLA 3AE1A 4ERRA 3ZN0B 4DR2T 4CI1B 3C98B 3RH3A 4O8SA 4PK6A 4HWDA 2K24A 4IDZA 5LJMA 2LSGA 4IE0A 4YHJA 2JQKA 3RF1A 3QNUA 5AQJB 4DMVA 2X9XA 1UGOA 4IIJE 4EYUA 4ZI7E 3NWIA 4IE4A 4LF9T 3RC8A 2BVMA 2XPKA 2A3DA 4JI0T 4JI8T 3J9X1 3FZHB 2IIUA 4U3CA 2BVLA 2Y8DA 1WLXA 2VKJA 2YEVC 2N1GA 2X0YA 3AB3B 3ETVA 3AA7B 3ONLC 1MMGA 3UU3A 1HNZT 2WU2A 4X66T 4OHFA 1O3XA 3UFGA 3AA6B 5C2TA 3N9QA 2CHNA 2N2NA 3T1YT 2AXDS 3ZKRA 5AQPB 3BK9A 2VQFT 4UELA 3CVRA 3U3IA 4IE6A 1VOMA 2OA5A 3PU8A 4BAYB 3DP7A 4JUYA 4PNIA 3UU8A 5AQNB 3RYIE 4ZEYA 1GQEA 4HE8A 4DV1T 5ADXL 1BR0A 5HWXA 2BG9C 2X66A 3TLSA 1ZKEA 3PU3A 2Y48B 2WCAA 2NTXA 2LOSA 1YKEB 2QRXA 4B3ST
chains in the Genus database with same CATH topology
4H63H 2NOXA 5JR9C 2GK9A 4TN7B 2HPLA 3PTRB 4ZOLE 4KBMB 4ANJA 3WAJA 2PG8A 3PUSA 5LHHB 1IJ6A 4EZHA 4X20E 1NAFA 4P0AA 1LVFA 5J1GA 2D2SA 4HEAA 5F3JA 3L3PA 4TV9E 3WAKA 2NW8A 3UUNA 4EYYR 1NWMX 2X68A 3GN5A 3CKDA 5CA0E 3CQCB 3OBVE 3RRCA 3O1HA 3F31A 1SHZC 5LCYA 2ZM2A 3ZYMA 1S94A 5E0OA 1KK7A 4HGAA 3QC9A 4H63V 3IHRA 2JRKA 1U4QA 2M67A 3N2KE 5LHGB 3C50A 2VKHA 3I0QA 3VKHA 2PJQA 2XASB 4M1PA 4F6RC 4CXWA 5FYMA 4MALA 4NUVA 2EHOD 2L9QA 2VK9A 4UF0A 5JR9A 2VWAA 2XTLA 1VRBA 3ZCJA 1Z0PA 5LBMA 1X79A 1KNZA 3R6NA 4AXPA 4L9IA 5FXZA 4EZ4A 2EHOA 1MMNA 2VL8A 4HTEA 3Q5WA 2X9YA 4OYKA 1MIYA 2CCQA 2X9WA 3BQLA 2XQYA 3FXEB 5DJQC 2N9DA 4AQFC 2LM9A 2J1DG 1LVKA 3ANWB 3RYFE 5LHIB 4ADZA 2CM0A 3FBLA 3CWZB 4DO0A 1OWAA 2MOZA 3CMLA 3CQXC 3P7IA 1V9DA 3N5LA 5L3DB 5HXSA 3K8PC 4YJ3E 2X0LB 5LBQB 5HWYA 5H6RB 3BQIA 2ODUA 3ESLA 3EUHA 1AJ3A 2A72A 2NP9A 3RRWA 3R84B 2NTYA 4IGUA 1QUUA 3O4XE 4FJOA 2LSYA 1G8XA 2CXDA 3V5SA 4JEUB 3HKBE 1US7B 3OYZA 4GK5E 1MIWA 3ETUA 3LBXA 3Q5XA 5TAOA 3AA1B 4TV8E 3KVAA 1HX8A 3GMIA 4OK0A 3HKDE 4XZCA 2HPJA 4QXHB 3UULA 4PJNA 3PURA 4EIWA 4WBNE 2D5UA 5AFUL 1T98A 3PDYA 2IW5B 4N78D 1WYBA 4AQFA 2CWYA 4TUYE 5LGTB 2WMNA 3RYCE 2CLYC 3NRXA 5FXXA 4A56A 5HXHA 2KXPB 3ZMUB 4IHJE 5JRCA 2E9XC 3QK6A 4HFVA 1S35A 4ISSA 4QXCB 3N9LA 4MHCA 1MMDA 4GYSA 1HG5A 1BR4A 3SRZA 4G63A 2VB6A 4X1KE 3CX8B 2LSKA 4WNKA 3HKCE 5KX5E 4QWNB 2V26A 2DWGA 2NWBA 3E08A 3EVYA 3QUJA 2JMKA 2IAKA 2V7MA 3I0OA 3FB2A 4DMWA 5L3EB 2SPCA 2XUEA 1D1CA 2QA7A 3UT5E 4MBQA 1QSDA 5JDFA 3ZYLA 3AVSA 1LKXA 4I50E 1ZEEA 5A1LA 3U78A 2KNDA 3LG7A 2V7JA 1LRZA 2K48A 5L3CB 3BQKA 2JMHA 2E9XD 4L0RA 5H6QB 2H7OA 5JVDE 4E7ZA 1OXZA 2H3RA 3MXZA 2EHOC 4NUUA 5EK4A 2E9XA 4QX7B 1BR1A 3KINB 1UCUA 2VASA 1UX4A 5DABA 1IJ5A 5FNVE 5LGNB 5JR9B 3OJAA 3AA0B 1WRDA 3PUAA 3Q9DA 3N9OA 4YJ2E 1IZNB 4HN9A 5JDQA 2YU2A 2C5KT 3CX7B 1HG2A 2CMRA 5FY1A 4CQIA 5JDLA 3B57A 2XAJB 1WYCA 3KVBA 2L3LA 4O4IE 5FXWA 2XAGB 2B1EA 2L8KA 3OYXA 2C0SA 2V7IA 5IHYA 5KMGP 2ACXA 3L09A 2W62A 5J2UE 2JJ9A 4CZZB 1D1BA 2WBLA 3E22E 3I9YA 2VKDA 4WW0A 2RA1A 4UEMA 1SA0E 3J7Yq 2YINA 3KV9A 3LK3B 3ZCIA 3OKQA 3LBXB 3HL6A 2CWOA 4H9SE 5EK3A 5IYZE 3SWHA 3TKLB 4BJMA 5HXEA 4DBRA 3C4XA 5EZYE 5JDNA 4ZS2A 4EOZB 1G73A 3GWHA 2QGSA 2I59A 3SOLA 4AI6A 3I9WA 3ZJ2A 3UUXB 3T8OA 5LJNA 2D0TA 5HXCA 3RYHE 2WAUA 1CUNA 5GONE 1H7CA 4MFRA 4QX8B 3DTOA 3CX6B 3N9NA 4XBFB 3S4UA 4PK5A 2P9BA 2RP4A 3V5UA 5FMNA 5J2TE 2MYSA 4ILUA 2LHRA 3H37A 3ZPOA 2LJLA 4UV8B 3DJBA 2JPFA 2X67A 5C8YE 4BJNA 4L5GA 2ZMAA 1MMAA 5LG4A 2H7VC 5FXVA 2Q9QC 3PE0A 4PK4A 4AKIA 3LK2B 2ZM0A 2MBGA 3C64A 2LHNA 2KMFA 1YW0A 3K3OA 1HTJF 4TZ4C 4H9QC 2V7LA 2JQQA 4CI2B 5JH7E 1D0ZA 2YU1A 4BA9A 4YFSA 3KV4A 5LNKA 1B7TA 4H9NC 4O2BE 3HI2A 3H3AA 5KDMC 1D0XA 4ZHQE 2PBIA 4K0UA 2LOPA 4PJJA 3GA8A 1FIOA 3ZC0A 2Y6XA 3RC3A 2CLYB 3PUQA 4O4JE 4PFOA 4AKHA 3WI3A 4AKGA 4O2AE 4AKLA 3ZMZB 2E9XB 3NZQA 2IC6A 2Q9QD 4CXYA 3K3NA 3LJCA 3AAIA 5CA1E 4J2CA 2V1DB 2DWKA 4QXBB 5CB4E 3GN5B 3HKEE 4EXTA 5L3BB 4ZI3C 4PJMA 2XAQB 2CXLA 4FI5A 3W15B 5JQGE 2Q9QA 3A5XA 2XAHB 2A2FX 3LK42 4ZS3A 4PW8A 3PUGA 4CXXA 2Z6EA 4O4LE 4PAGA 4PFPA 4JEHB 4EB6E 2W61A 3N9PA 3O1IA 4KMCA 2CA5A 3EDVA 4P09A 4OYJA 5L3GB 4U72A 3FXDB 2NW7A 5LXTE 2WMOA 4DBQA 2LSJA 3RPUA 3F2EA 5HYAA 4KP3C 4H9RC 2W0GA 4EAHA 4KUMB 3HA4A 3I1AA 4UF0B 1FMVA 3HR0A 5JREA 5EK2A 2CE7A 3N2GE 3KFWX 2EHOB 2DI4A 4DNDA 2V7KA 4ZI3D 2LSIA 4B6XA 3MZKB 3AAAB 5F8PA 3B13A 3ZJ1A 4Z8XA 2XHEB 4AKRB 1FMWA 3NBXX 1HS7A 1MIVA 3ZEFB 3JC6C 4V1Av 4ERRA 2DCFA 2DHRA 3ZN0B 1D1AA 2K9AA 3FHNA 4CI1B 4H9OC 4MLKA 3C98B 2CXFA 4O8SA 3RH3A 4UIGA 5FY7A 5HXRA 1EZ3A 5LGUB 2MTQA 4YLHA 3FBZA 1ZHCA 4PK6A 1MNDA 3CQGB 3NRYA 3ZLIA 2K24A 2ZM8A 3EDUA 4ZI2C 2CEAA 4UVBB 2LEHA 3ONXA 4IDZA 4I55E 2IC9A 2WM9A 2LSGA 2W00A 4IE0A 5LJMA 4YHJA 1IAPA 3M65A 2ES0A 4G2AA 4JLEA 4DMVA 3Q2MA 2YK0A 3MKDA 4DVDA 3KV5A 2X9XA 4IE7A 4P0BA 4E7SA 3N9MA 3NZPA 4IIJE 4C90A 4OFZA 4EYUA 2C5IT 4ASKA 3JC6D 4IE4A 4QKNA 2K5BB 4ZI7E 4U74A 1HF8A 2D0UA 5FP3A 3RX6A 5JDHA 4UV9B 1HFAA 3RC8A 3ZMVB 2BVMA 2KWHA 2A3DA 4AQGA 2KLQA 3O1JA 2ZLYA 3C51A 3J9X1 2PFVA 4X1YE 5JRCB 3SS1A 1YKHB 4ZI2D 3D0TA 3UFEA 2BZBA 3MK7C 5HAXA 5DQVA 3MACA 4I43B 5JDMA 2BVLA 2Y8DA 1WLXA 2DNXA 2VKJA 2YEVC 4X1IE 2N1GA 5LP6E 2VKOA 3AB3B 1FEWA 3ETVA 3AA7B 4GYRA 3ZMTB 1MMGA 3VKGA 5ETWA 4CI3B 2ODVA 3E0ZA 2C5JA 1Y64B 5LOVE 2UXNB 5L3FB 4OHFA 2KT9A 4I4TE 1O3XA 5FY0A 4H9PC 3KBTA 3ZN1B 4GOUA 1UX5A 3AA6B 3IF8B 2Q9QB 4XAXB 5L2LA 3ANWA 3P8CD 2KWIB 2KZ7B 1WR6A 3KDSE 3N9QA 1YD8G 3RKOA 3C4WA 3AVRA 3LFMA 3CPZA 1ZV4X 2WSSV 2N2NA 3KV6A 2UXXB 5BMVE 4UXNB 2HH7A 4GIWA 3BK9A 4UELA 2DLRA 3VHLA 5LA6E 3CVRA 3U3IA 4QHOA 4IE6A 3UUMA 1VOMA 3AAEB 3O9XA 4PJLA 3VU7H 2OA5A 1BR2A 3PU8A 4GK0E 4BAYB 2E8IA 4UVCB 3ZYKA 3IBPA 5JDGA 2XAFB 4O4HE 5M4YA 3DP7A 4JUYA 2WWUA 3F57A 4IE5A 2NW9A 4C91A 2X51A 3MA9A 4PNIA 3RYIE 1HCIA 4UVAB 2BDEA 3K3QC 1U5PA 2KINB 4HE8A 3UTKA 2G0UA 3IEEA 3MJXA 4ISTA 1E1HB 5ADXL 1BR0A 5HWXA 3ZMSB 1MNEA 3C4ZA 5DQWA 2X9HA 5LYJE 2LT3A 3ZC1A 2X66A 1ZKEA 3KBUA 2W63A 3PU3A 2Y48B 4TX5A 2NTXA 2LOSA 1YKEB 4HKAA 1D0YA 3N2OA 4WBOA 2LE8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W15 B; 
#chains in the Genus database with same CATH topology
 2WZH A;  5JR9 C;  2YOE A;  3PTR B;  4KBM B;  2LKG A;  3WAJ A;  1SUM B;  4X20 E;  1IBM T;  4LFB T;  1LVF A;  3FZL B;  2NW8 A;  3PJA J;  4AIS A;  2IHR 1;  3GN5 A;  5L4E A;  5CA0 E;  3QB5 K;  3CQC B;  4ILB A;  5LCY A;  5HEJ A;  1XWM A;  2HHH T;  2JRK A;  4IDN A;  3N2K E;  3C50 A;  3I0Q A;  3VKH A;  4OX9 T;  3P4W A;  2VK9 A;  5JR9 A;  5AQS B;  2FJE A;  4AXP A;  3CIR A;  5FXZ A;  1UUR A;  2VL8 A;  1MIY A;  2CCQ A;  4JYA T;  2N9D A;  2BKO A;  2LM9 A;  2J1D G;  2XQ6 A;  4ADZ A;  2CM0 A;  4NXM T;  4DO0 A;  1OWA A;  5HXS A;  4YJ3 E;  2ODU A;  1AJ3 A;  2WZI A;  4YY3 T;  3ZSS A;  1MIW A;  4B3T T;  5TAO A;  4B3M T;  3JAF A;  4OK0 A;  2QVA A;  4QXH B;  3RLF F;  4GKK T;  2D5U A;  1T98 A;  5FVL A;  4N78 D;  3L8R A;  3NRX A;  5HXH A;  2KXP B;  4DV2 T;  4ILA A;  4IHJ E;  4HFV A;  3VRB A;  5KXJ A;  1BR4 A;  3SRZ A;  2VB6 A;  5KX5 E;  4QWN B;  2UUC T;  3E08 A;  1ZOY A;  4DMW A;  5L3E B;  5AQO B;  3UT5 E;  4MBQ A;  1QSD A;  3Q5E A;  5JDF A;  4I50 E;  1LKX A;  2KND A;  2WU5 A;  2H88 A;  5H6Q B;  2H7O A;  3M3Z B;  4HFH A;  5JVD E;  5L4H A;  4HWC A;  4F8H A;  4JI2 T;  5LGN B;  4YXD A;  3OJA A;  3Q9D A;  4YJ2 E;  2KSR A;  3RIF A;  2CMR A;  4IL4 A;  5JDL A;  2LRL A;  3B57 A;  2WY2 A;  5FXW A;  2XAG B;  2V7I A;  5IHY A;  2W62 A;  1J1J A;  3OPC A;  2V8S V;  4UEM A;  1SA0 E;  2V6Y A;  1I6Z A;  5LB7 B;  4H9S E;  4DBR A;  3RHW A;  5JDN A;  5AQR B;  4DV5 T;  3I9W A;  3P4P A;  3N9N A;  4XBF B;  4LMK A;  5FMN A;  2FBW A;  3ZPO A;  2LJL A;  4UV8 B;  2X67 A;  4BJN A;  1XMQ T;  4PK4 A;  4IDQ A;  2M6I A;  2BS3 A;  2MBG A;  1T8B A;  2W66 A;  1HTJ F;  4TZ4 C;  4Z90 A;  1XDP A;  4BA9 A;  4YFS A;  2MPK A;  4NPP A;  1D0X A;  4K0U A;  1M7K A;  4AKH A;  3ZMZ B;  2E9X B;  3LJC A;  5CB4 E;  4EXT A;  3EAM A;  4ZI3 C;  4FI5 A;  4PW8 A;  3PUG A;  1HNX T;  2Z6E A;  4PAG A;  4JEH B;  2V5D A;  3N9P A;  3O1I A;  4NIQ A;  3FZM B;  4P09 A;  2OV9 A;  5LXT E;  5HYA A;  2XSB A;  4KP3 C;  4H9R C;  2W0G A;  4KUM B;  3I1A A;  2CPT A;  1FMV A;  2VUR A;  4U7Y A;  3ZT7 A;  3KFW X;  4TWD A;  3RQW A;  3RI5 A;  3MZK B;  4DR3 T;  3B13 A;  2JQ9 A;  1FMW A;  4EEB A;  3VRA A;  2DCF A;  1FJG T;  1D1A A;  2K9A A;  5BR8 T;  4H9O C;  2CXF A;  3AEE A;  1EZ3 A;  4YLH A;  3NRY A;  5HCM A;  4EED A;  2LEH A;  4HFB A;  4I55 E;  2WM9 A;  2W00 A;  4JLE A;  2YK0 A;  4DVD A;  3KV5 A;  4IE7 A;  4E7S A;  5L3B B;  3ABV A;  1HF8 A;  4DR5 T;  2KWH A;  2YKS A;  2PFV A;  4X1Y E;  5JRC B;  2YN6 A;  2VVN A;  5HAX A;  5DQV A;  2CBI A;  4I43 B;  5JDM A;  3JCF A;  5LP6 E;  4ZZC A;  4X1I E;  1UUS A;  1FEW A;  4DR4 T;  4YT0 A;  3VKG A;  5ETW A;  4LFA T;  2UXN B;  5FY0 A;  4H9P C;  4GOU A;  5L2L A;  4XAX B;  2Q9Q B;  3ANW A;  2KWI B;  1WR6 A;  3KDS E;  3C4W A;  3LFM A;  3CPZ A;  4JI5 T;  2UXX B;  1Y01 A;  4DR6 T;  3VHL A;  4QHO A;  3AAE B;  3ZST A;  4GK0 E;  2E8I A;  3AE6 A;  2XQ5 A;  5ABF A;  2XY8 B;  2XAF B;  4KHP T;  2X51 A;  1U5P A;  3UTK A;  2G0U A;  3MJX A;  4CN1 A;  1E1H B;  2WDV A;  3C4Z A;  5DQW A;  2X9H A;  2LT3 A;  4TWF A;  3KBU A;  2BBH A;  4H63 H;  3NKZ A;  4TN7 B;  4ZOL E;  4ANJ A;  2PG8 A;  3PUS A;  5LHH B;  3G06 A;  4HEA A;  3L3P A;  4EYY R;  4IL9 A;  3CKD A;  4IT4 A;  1W0A A;  2ZM2 A;  4H63 V;  2J62 A;  5ABH A;  2M67 A;  4DV6 T;  5LHG B;  2VKH A;  2PJQ A;  4F6R C;  4CXW A;  4MAL A;  2L9Q A;  4B3R T;  2VWA A;  3ZCJ A;  1Z0P A;  5LBM A;  2JIW A;  1VCT A;  5HEU A;  4DR7 T;  3R6N A;  4EZ4 A;  4LFC T;  3EHZ A;  2X9Y A;  5AQI B;  3RYF E;  5LHI B;  2MOZ A;  5L3D B;  3N5L A;  3BQI A;  1X9B A;  2NTY A;  3TLV A;  1G8X A;  1J5W A;  2CXD A;  3HKB E;  1US7 B;  3OYZ A;  4GK5 E;  1N34 T;  3AA1 B;  2E5V A;  3PUY F;  3HKD E;  2HPJ A;  3UUL A;  1DU2 A;  4EIW A;  3PDY A;  4COF A;  2CWY A;  4TUY E;  2WMN A;  3RYC E;  2CLY C;  5JRC A;  3N9L A;  2LLY A;  5C3J A;  4WNK A;  2OLT A;  2V26 A;  2DWG A;  2NWB A;  3EVY A;  3QUJ A;  1D1C A;  3AEC A;  1ZEE A;  3LG7 A;  1YXR A;  5L3C B;  5IWA T;  4L0R A;  2W67 A;  3Q5D A;  1OXZ A;  3MXZ A;  3RKG A;  3EI0 A;  5EK4 A;  1BR1 A;  4YTM A;  2VAS A;  5DAB A;  1WRD A;  3N9O A;  3UUB A;  5JDQ A;  4KHZ F;  3CX7 B;  2XAJ B;  1WYC A;  1XNQ T;  2L3L A;  4O4I E;  3ZT6 A;  3OYX A;  2L8K A;  5ABE A;  3AED A;  2ACX A;  3L09 A;  4LF7 T;  4CZZ B;  3E22 E;  2RA1 A;  3J7Y q;  2YIN A;  4DUY T;  1UK5 A;  3OKQ A;  3LBX B;  3QOF A;  3AE9 A;  5IYZ E;  1NEK A;  5F5W A;  1HNW T;  2QGS A;  2YDS A;  3T8O A;  5LJN A;  5HXC A;  3RYH E;  2WAU A;  3SFD A;  1XMO T;  4MFR A;  4QX8 B;  2I6H A;  3DTO A;  3CX6 B;  3S4U A;  3NVO A;  2RP4 A;  3V5U A;  2MYS A;  2WS3 A;  2LHR A;  4ILU A;  4QH5 A;  4Z91 A;  4DV0 T;  2E5L T;  5LG4 A;  5FXV A;  1XZY A;  3PUW F;  2ZM0 A;  3AE2 A;  2BG9 E;  3C64 A;  4H9Q C;  4KI0 F;  2YU1 A;  4KX6 A;  4HFE A;  1B7T A;  5KDM C;  4PFO A;  3RIA A;  5ABG A;  4CXY A;  3HKE E;  1J5E T;  4CN6 A;  2CRB A;  5JQG E;  2XAH B;  2A2F X;  4ZS3 A;  4JV5 T;  4O4L E;  4K0K T;  2W61 A;  2CA5 A;  3EDV A;  4OYJ A;  5L3G B;  4U72 A;  3RPU A;  3F2E A;  2NR4 A;  4EAH A;  2LM2 A;  5JRE A;  4A98 A;  5EK2 A;  2RPA A;  2EHO B;  4DND A;  4ZI3 D;  2V7K A;  1QLB A;  2BS2 A;  4JI4 T;  4Z8X A;  2XHE B;  5J0Z A;  1HS7 A;  2XM2 A;  3JC6 C;  4WYV A;  2QYW A;  3FHN A;  5HXR A;  5LGU B;  1MND A;  3CQG B;  4YTN A;  4DR1 T;  3ZLI A;  2ZM8 A;  3EDU A;  4LMJ A;  2CEA A;  4ZI2 C;  4UVB B;  3ONX A;  2IC9 A;  4IRE A;  1IAP A;  4G2A A;  5AQG B;  3MKD A;  4P0B A;  3N9M A;  3NZP A;  4C90 A;  4QKN A;  2K5B B;  3UU5 A;  2D0U A;  2XQ3 A;  3UQ7 A;  3RX6 A;  5JDH A;  4UV9 B;  1HFA A;  2HN2 A;  3ZMV B;  1SE7 A;  4AQG A;  2KLQ A;  3O1J A;  2ZLY A;  3C51 A;  3SS1 A;  1YKH B;  1OED B;  3D0T A;  3P4S A;  3MAC A;  2DNX A;  4AQY T;  5FVK A;  4GYR A;  2D9D A;  4CI3 B;  3E0Z A;  2C5J A;  5LOV E;  5L3F B;  2YDQ A;  3RIU A;  2KT9 A;  4I4T E;  3ZN1 B;  3KBT A;  1UX5 A;  3P8C D;  1YD8 G;  3RKO A;  3AVR A;  1ZV4 X;  2WSS V;  3KV6 A;  2IUB A;  4LF5 T;  2HH7 A;  4GIW A;  2DLR A;  5LA6 E;  3UUM A;  3O9X A;  4PJL A;  4UVC B;  3ZYK A;  2E2A A;  5JDG A;  5M4Y A;  1E7P A;  4O4H E;  2UXD T;  1R8I A;  4IE5 A;  4DV3 T;  3MA9 A;  1HCI A;  4UVA B;  3K3Q C;  2KIN B;  5AQU B;  2PTF A;  2XQ8 A;  4X64 T;  3IEE A;  1MNE A;  4ILC A;  4P1N A;  5LYJ E;  3ZC1 A;  2W63 A;  4WBO A;  2LE8 A;  2NOX A;  2GK9 A;  4HWF A;  3OTO T;  1IJ6 A;  5FL1 A;  2D2S A;  4TV9 E;  3UUN A;  4JBW F;  3OBV E;  3RRC A;  3O1H A;  3F31 A;  2K3W A;  4CN4 A;  1SHZ C;  1IBL T;  1S94 A;  5E0O A;  4HGA A;  3QC9 A;  3IHR A;  3JAD A;  3PUV F;  2XAS B;  5AQF B;  4I0U A;  2XTL A;  1VRB A;  3VR8 A;  2XQA A;  3AEF A;  1X79 A;  3VR9 A;  2YDR A;  4L9I A;  2EHO A;  1MMN A;  4HTE A;  4OYK A;  3BQL A;  2XQY A;  1LVK A;  5L47 A;  3EAB A;  3CWZ B;  3P7I A;  1JNZ A;  5LBQ B;  3ESL A;  3LSV A;  5CGM A;  3RRW A;  2JQH A;  3R84 B;  1QUU A;  4EGW A;  3O4X E;  2LSY A;  4JEU B;  1XDO A;  4U7I A;  3FZF B;  4TV8 E;  1HX8 A;  3GMI A;  4XZC A;  3PUR A;  4WBN E;  3TLT A;  2X0H A;  5AFU L;  2IW5 B;  1W9R A;  3H3M A;  5HEH A;  2FJB A;  5LGT B;  2W2U A;  4A56 A;  3ZMU B;  2E9X C;  4QXC B;  2BKP A;  4GYS A;  1HG5 A;  3T1H T;  4G63 A;  3L39 A;  4X1K E;  2CHO A;  3AE7 A;  2LSK A;  3HKC E;  3UU4 A;  2IAK A;  2V7M A;  3I0O A;  3U78 A;  3AE8 A;  2V7J A;  1LRZ A;  2K48 A;  2WWV A;  2JMH A;  2BG9 B;  4E7Z A;  4NUU A;  4YTP A;  2E9X A;  4TNW A;  2XM1 A;  3KIN B;  4NXN T;  1UCU A;  1UX4 A;  2J4G A;  5JR9 B;  3AA0 B;  3PUA A;  1OED E;  2C5K T;  5CFB A;  4LF4 T;  1HG2 A;  3TLU A;  3AXJ B;  1T7S A;  5J2U E;  2JJ9 A;  1D1B A;  3I9Y A;  2M6B A;  3KV9 A;  4LF8 T;  3HL6 A;  5AQT B;  4BJM A;  5HXE A;  3C4X A;  5EZY E;  4EOZ B;  3SFE A;  3IA3 A;  2I59 A;  3ZJ2 A;  2D0T A;  2FUP A;  1CUN A;  4U2Y A;  3CK6 A;  1H7C A;  3QB5 A;  4PK5 A;  5J2T E;  3H37 A;  2JPF A;  2XJ7 A;  4DID B;  2FJA A;  2H7V C;  4GKJ T;  2Q9Q C;  3PE0 A;  1E2A A;  3JAE A;  4DV7 T;  3AEA A;  3LK2 B;  1M62 A;  3ZT5 A;  2LHN A;  4CI2 B;  5LNK A;  4O2B E;  3H3A A;  4ZHQ E;  2PBI A;  4PJJ A;  3GA8 A;  3ZC0 A;  4JI7 T;  2IDO B;  3PUQ A;  4O4J E;  3TLW A;  2WB5 A;  4O2A E;  4AKL A;  3NZQ A;  2IC6 A;  3LDQ B;  3AAI A;  4J2C A;  1NEN A;  4X65 T;  4PJM A;  2B76 A;  2CXL A;  2XAQ B;  2Q9Q A;  3LK4 2;  4PFP A;  2XQ7 A;  5HCJ A;  1WCR A;  4KMC A;  5HEG A;  3FXD B;  4DBQ A;  1CHU A;  2XZE A;  3HA4 A;  4UF0 B;  4X5T A;  3HR0 A;  2CE7 A;  3PUZ F;  4YSY A;  2DI4 A;  4TNV A;  2LSI A;  2V6Y B;  4A97 A;  3AAA B;  2UXC T;  3ZJ1 A;  4AKR B;  3NBX X;  3ZEF B;  4V1A v;  2DHR A;  3OVU A;  4MLK A;  4UIG A;  5FY7 A;  2MTQ A;  3FBZ A;  1ZHC A;  4TWH A;  5JTG A;  2A9U A;  2BG9 A;  4HFD A;  2VVS A;  2BS4 A;  3M65 A;  2ES0 A;  3Q2M A;  5LG3 A;  4OFZ A;  2C5I T;  4ASK A;  3JC6 D;  3AE4 A;  4U74 A;  5FP3 A;  5HEO A;  3AXJ A;  1KNP A;  3AE5 A;  5AQL B;  4ZI2 D;  3UFE A;  4YSX A;  2BZB A;  3MK7 C;  1I94 T;  2VKO A;  1WFD A;  2CBJ A;  5AQH B;  3ZMT B;  2ODV A;  1Y64 B;  3ONJ A;  1VCS A;  5AQK B;  4DUZ T;  3IF8 B;  2KZ7 B;  2BBJ A;  3PJA A;  5BMV E;  4UXN B;  3VU7 H;  4HWH A;  1BR2 A;  4Q25 A;  3IBP A;  2XQ4 A;  2ACZ A;  2HN1 A;  2WWU A;  5IUX A;  3F57 A;  2NW9 A;  4C91 A;  2BDE A;  4IST A;  5AQM B;  3ZMS B;  5CJ5 A;  5AQV B;  1IBK T;  4TX5 A;  4HKA A;  1D0Y A;  3N2O A;  1W09 A;  1JNR A;  4LF6 T;  1YQ4 A;  1KFY A;  2HPL A;  4EZH A;  1NAF A;  4P0A A;  5LMN T;  5J1G A;  5F3J A;  3WAK A;  1Z8U A;  2VL0 A;  2UU9 T;  1NWM X;  2X68 A;  3AEB A;  1L0V A;  2VQE T;  3ZYM A;  2LRK A;  1KK7 A;  3RGL A;  3AEG A;  3A7M A;  1U4Q A;  5FL0 A;  1T72 A;  2UUB T;  3RIU C;  4M1P A;  5FYM A;  4NUV A;  2EHO D;  4UF0 A;  1KNZ A;  4AIU A;  3Q5W A;  2W4X A;  2X9W A;  5DJQ C;  3FXE B;  3RQU A;  4AQF C;  3ANW B;  3FBL A;  3CML A;  3CQX C;  1V9D A;  3K8P C;  2X0L B;  5HWY A;  5H6R B;  3EUH A;  2J47 A;  2A72 A;  2NP9 A;  4YSZ A;  4IGU A;  1WR0 A;  4FJO A;  3V5S A;  5ABF B;  3ETU A;  3LBX A;  3Q5X A;  3KVA A;  4PJN A;  1WYB A;  4AQF A;  5FXX A;  4UR9 A;  3QK6 A;  5AQQ B;  1S35 A;  4ISS A;  4U2Z A;  2F4V T;  4MHC A;  1MMD A;  1YQ3 A;  2R6G F;  3CX8 B;  4ZZB A;  3P4Q A;  3X1D A;  1XNR T;  2JMK A;  1N32 T;  4EV6 A;  3FB2 A;  2SPC A;  2XUE A;  2QA7 A;  4IDP A;  2H89 A;  1HR0 T;  4X62 T;  3ZYL A;  3AVS A;  5A1L A;  3UU6 A;  3BQK A;  1N33 T;  2E9X D;  1KF6 A;  2H3R A;  2IML A;  4YHH T;  4DV4 T;  2EHO C;  3P50 A;  2ZM6 T;  4QX7 B;  4QH1 A;  4JI6 T;  1IJ5 A;  5FNV E;  3K1S A;  1IZN B;  4HN9 A;  2YU2 A;  5FY1 A;  4CQI A;  3KVB A;  2AE9 A;  3FZK B;  2B1E A;  2C0S A;  5KMG P;  4HFC A;  3PV0 F;  2WBL A;  2VKD A;  4WW0 A;  4LML A;  3LK3 B;  3ZCI A;  5FKY A;  4U31 A;  4WZX A;  2CWO A;  2I0M A;  2LKH A;  5EK3 A;  3SWH A;  4JI1 T;  3TKL B;  1KNR A;  4ZS2 A;  1G73 A;  3GWH A;  3SOL A;  4AI6 A;  3UUX B;  1OED C;  1ZP0 A;  1KEY A;  5GON E;  1N36 T;  3A8Y C;  2P9B A;  2FJD A;  4HFI A;  3UQ4 A;  3DJB A;  2BKN A;  5C8Y E;  4L5G A;  2ZMA A;  1MMA A;  2WP9 A;  4U33 A;  4AKI A;  4HWI B;  5LMU T;  2KMF A;  3PUX F;  4JI3 T;  1YW0 A;  3K3O A;  2V7L A;  3B5M A;  2JQQ A;  5JH7 E;  1D0Z A;  2UXB T;  3KV4 A;  4H9N C;  1OED A;  3HI2 A;  1HX1 B;  3AE3 A;  2LOP A;  1FIO A;  2Y6X A;  3RC3 A;  2CLY B;  2XQ9 A;  4AKG A;  3WI3 A;  2UUA T;  2WDQ A;  2Q9Q D;  3K3N A;  5CA1 E;  2XSA A;  2V1D B;  2DWK A;  4QXB B;  3GN5 B;  3W15 B;  3A5X A;  4CXX A;  4EB6 E;  2DL1 A;  2V5C A;  2NW7 A;  4QH4 A;  2WMO A;  2LSJ A;  2MAW A;  2WQY A;  4A5X A;  2WDR A;  3P4R A;  1W0B A;  3N2G E;  4IDO A;  4B6X A;  2V6X A;  5F8P A;  1MIV A;  4ZXL A;  3AE1 A;  4ERR A;  3ZN0 B;  4DR2 T;  4CI1 B;  3C98 B;  3RH3 A;  4O8S A;  4PK6 A;  4HWD A;  2K24 A;  4IDZ A;  5LJM A;  2LSG A;  4IE0 A;  4YHJ A;  2JQK A;  3RF1 A;  3QNU A;  5AQJ B;  4DMV A;  2X9X A;  1UGO A;  4IIJ E;  4EYU A;  4ZI7 E;  3NWI A;  4IE4 A;  4LF9 T;  3RC8 A;  2BVM A;  2XPK A;  2A3D A;  4JI0 T;  4JI8 T;  3J9X 1;  3FZH B;  2IIU A;  4U3C A;  2BVL A;  2Y8D A;  1WLX A;  2VKJ A;  2YEV C;  2N1G A;  2X0Y A;  3AB3 B;  3ETV A;  3AA7 B;  3ONL C;  1MMG A;  3UU3 A;  1HNZ T;  2WU2 A;  4X66 T;  4OHF A;  1O3X A;  3UFG A;  3AA6 B;  5C2T A;  3N9Q A;  2CHN A;  2N2N A;  3T1Y T;  2AXD S;  3ZKR A;  5AQP B;  3BK9 A;  2VQF T;  4UEL A;  3CVR A;  3U3I A;  4IE6 A;  1VOM A;  2OA5 A;  3PU8 A;  4BAY B;  3DP7 A;  4JUY A;  4PNI A;  3UU8 A;  5AQN B;  3RYI E;  4ZEY A;  1GQE A;  4HE8 A;  4DV1 T;  5ADX L;  1BR0 A;  5HWX A;  2BG9 C;  2X66 A;  3TLS A;  1ZKE A;  3PU3 A;  2Y48 B;  2WCA A;  2NTX A;  2LOS A;  1YKE B;  2QRX A;  4B3S T; 
#chains in the Genus database with same CATH homology
 4H63 H;  2NOX A;  5JR9 C;  2GK9 A;  4TN7 B;  2HPL A;  3PTR B;  4ZOL E;  4KBM B;  4ANJ A;  3WAJ A;  2PG8 A;  3PUS A;  5LHH B;  1IJ6 A;  4EZH A;  4X20 E;  1NAF A;  4P0A A;  1LVF A;  5J1G A;  2D2S A;  4HEA A;  5F3J A;  3L3P A;  4TV9 E;  3WAK A;  2NW8 A;  3UUN A;  4EYY R;  1NWM X;  2X68 A;  3GN5 A;  3CKD A;  5CA0 E;  3CQC B;  3OBV E;  3RRC A;  3O1H A;  3F31 A;  1SHZ C;  5LCY A;  2ZM2 A;  3ZYM A;  1S94 A;  5E0O A;  1KK7 A;  4HGA A;  3QC9 A;  4H63 V;  3IHR A;  2JRK A;  1U4Q A;  2M67 A;  3N2K E;  5LHG B;  3C50 A;  2VKH A;  3I0Q A;  3VKH A;  2PJQ A;  2XAS B;  4M1P A;  4F6R C;  4CXW A;  5FYM A;  4MAL A;  4NUV A;  2EHO D;  2L9Q A;  2VK9 A;  4UF0 A;  5JR9 A;  2VWA A;  2XTL A;  1VRB A;  3ZCJ A;  1Z0P A;  5LBM A;  1X79 A;  1KNZ A;  3R6N A;  4AXP A;  4L9I A;  5FXZ A;  4EZ4 A;  2EHO A;  1MMN A;  2VL8 A;  4HTE A;  3Q5W A;  2X9Y A;  4OYK A;  1MIY A;  2CCQ A;  2X9W A;  3BQL A;  2XQY A;  3FXE B;  5DJQ C;  2N9D A;  4AQF C;  2LM9 A;  2J1D G;  1LVK A;  3ANW B;  3RYF E;  5LHI B;  4ADZ A;  2CM0 A;  3FBL A;  3CWZ B;  4DO0 A;  1OWA A;  2MOZ A;  3CML A;  3CQX C;  3P7I A;  1V9D A;  3N5L A;  5L3D B;  5HXS A;  3K8P C;  4YJ3 E;  2X0L B;  5LBQ B;  5HWY A;  5H6R B;  3BQI A;  2ODU A;  3ESL A;  3EUH A;  1AJ3 A;  2A72 A;  2NP9 A;  3RRW A;  3R84 B;  2NTY A;  4IGU A;  1QUU A;  3O4X E;  4FJO A;  2LSY A;  1G8X A;  2CXD A;  3V5S A;  4JEU B;  3HKB E;  1US7 B;  3OYZ A;  4GK5 E;  1MIW A;  3ETU A;  3LBX A;  3Q5X A;  5TAO A;  3AA1 B;  4TV8 E;  3KVA A;  1HX8 A;  3GMI A;  4OK0 A;  3HKD E;  4XZC A;  2HPJ A;  4QXH B;  3UUL A;  4PJN A;  3PUR A;  4EIW A;  4WBN E;  2D5U A;  5AFU L;  1T98 A;  3PDY A;  2IW5 B;  4N78 D;  1WYB A;  4AQF A;  2CWY A;  4TUY E;  5LGT B;  2WMN A;  3RYC E;  2CLY C;  3NRX A;  5FXX A;  4A56 A;  5HXH A;  2KXP B;  3ZMU B;  4IHJ E;  5JRC A;  2E9X C;  3QK6 A;  4HFV A;  1S35 A;  4ISS A;  4QXC B;  3N9L A;  4MHC A;  1MMD A;  4GYS A;  1HG5 A;  1BR4 A;  3SRZ A;  4G63 A;  2VB6 A;  4X1K E;  3CX8 B;  2LSK A;  4WNK A;  3HKC E;  5KX5 E;  4QWN B;  2V26 A;  2DWG A;  2NWB A;  3E08 A;  3EVY A;  3QUJ A;  2JMK A;  2IAK A;  2V7M A;  3I0O A;  3FB2 A;  4DMW A;  5L3E B;  2SPC A;  2XUE A;  1D1C A;  2QA7 A;  3UT5 E;  4MBQ A;  1QSD A;  5JDF A;  3ZYL A;  3AVS A;  1LKX A;  4I50 E;  1ZEE A;  5A1L A;  3U78 A;  2KND A;  3LG7 A;  2V7J A;  1LRZ A;  2K48 A;  5L3C B;  3BQK A;  2JMH A;  2E9X D;  4L0R A;  5H6Q B;  2H7O A;  5JVD E;  4E7Z A;  1OXZ A;  2H3R A;  3MXZ A;  2EHO C;  4NUU A;  5EK4 A;  2E9X A;  4QX7 B;  1BR1 A;  3KIN B;  1UCU A;  2VAS A;  1UX4 A;  5DAB A;  1IJ5 A;  5FNV E;  5LGN B;  5JR9 B;  3OJA A;  3AA0 B;  1WRD A;  3PUA A;  3Q9D A;  3N9O A;  4YJ2 E;  1IZN B;  4HN9 A;  5JDQ A;  2YU2 A;  2C5K T;  3CX7 B;  1HG2 A;  2CMR A;  5FY1 A;  4CQI A;  5JDL A;  3B57 A;  2XAJ B;  1WYC A;  3KVB A;  2L3L A;  4O4I E;  5FXW A;  2XAG B;  2B1E A;  2L8K A;  3OYX A;  2C0S A;  2V7I A;  5IHY A;  5KMG P;  2ACX A;  3L09 A;  2W62 A;  5J2U E;  2JJ9 A;  4CZZ B;  1D1B A;  2WBL A;  3E22 E;  3I9Y A;  2VKD A;  4WW0 A;  2RA1 A;  4UEM A;  1SA0 E;  3J7Y q;  2YIN A;  3KV9 A;  3LK3 B;  3ZCI A;  3OKQ A;  3LBX B;  3HL6 A;  2CWO A;  4H9S E;  5EK3 A;  5IYZ E;  3SWH A;  3TKL B;  4BJM A;  5HXE A;  4DBR A;  3C4X A;  5EZY E;  5JDN A;  4ZS2 A;  4EOZ B;  1G73 A;  3GWH A;  2QGS A;  2I59 A;  3SOL A;  4AI6 A;  3I9W A;  3ZJ2 A;  3UUX B;  3T8O A;  5LJN A;  2D0T A;  5HXC A;  3RYH E;  2WAU A;  1CUN A;  5GON E;  1H7C A;  4MFR A;  4QX8 B;  3DTO A;  3CX6 B;  3N9N A;  4XBF B;  3S4U A;  4PK5 A;  2P9B A;  2RP4 A;  3V5U A;  5FMN A;  5J2T E;  2MYS A;  4ILU A;  2LHR A;  3H37 A;  3ZPO A;  2LJL A;  4UV8 B;  3DJB A;  2JPF A;  2X67 A;  5C8Y E;  4BJN A;  4L5G A;  2ZMA A;  1MMA A;  5LG4 A;  2H7V C;  5FXV A;  2Q9Q C;  3PE0 A;  4PK4 A;  4AKI A;  3LK2 B;  2ZM0 A;  2MBG A;  3C64 A;  2LHN A;  2KMF A;  1YW0 A;  3K3O A;  1HTJ F;  4TZ4 C;  4H9Q C;  2V7L A;  2JQQ A;  4CI2 B;  5JH7 E;  1D0Z A;  2YU1 A;  4BA9 A;  4YFS A;  3KV4 A;  5LNK A;  1B7T A;  4H9N C;  4O2B E;  3HI2 A;  3H3A A;  5KDM C;  1D0X A;  4ZHQ E;  2PBI A;  4K0U A;  2LOP A;  4PJJ A;  3GA8 A;  1FIO A;  3ZC0 A;  2Y6X A;  3RC3 A;  2CLY B;  3PUQ A;  4O4J E;  4PFO A;  4AKH A;  3WI3 A;  4AKG A;  4O2A E;  4AKL A;  3ZMZ B;  2E9X B;  3NZQ A;  2IC6 A;  2Q9Q D;  4CXY A;  3K3N A;  3LJC A;  3AAI A;  5CA1 E;  4J2C A;  2V1D B;  2DWK A;  4QXB B;  5CB4 E;  3GN5 B;  3HKE E;  4EXT A;  5L3B B;  4ZI3 C;  4PJM A;  2XAQ B;  2CXL A;  4FI5 A;  3W15 B;  5JQG E;  2Q9Q A;  3A5X A;  2XAH B;  2A2F X;  3LK4 2;  4ZS3 A;  4PW8 A;  3PUG A;  4CXX A;  2Z6E A;  4O4L E;  4PAG A;  4PFP A;  4JEH B;  4EB6 E;  2W61 A;  3N9P A;  3O1I A;  4KMC A;  2CA5 A;  3EDV A;  4P09 A;  4OYJ A;  5L3G B;  4U72 A;  3FXD B;  2NW7 A;  5LXT E;  2WMO A;  4DBQ A;  2LSJ A;  3RPU A;  3F2E A;  5HYA A;  4KP3 C;  4H9R C;  2W0G A;  4EAH A;  4KUM B;  3HA4 A;  3I1A A;  4UF0 B;  1FMV A;  3HR0 A;  5JRE A;  5EK2 A;  2CE7 A;  3N2G E;  3KFW X;  2EHO B;  2DI4 A;  4DND A;  2V7K A;  4ZI3 D;  2LSI A;  4B6X A;  3MZK B;  3AAA B;  5F8P A;  3B13 A;  3ZJ1 A;  4Z8X A;  2XHE B;  4AKR B;  1FMW A;  3NBX X;  1HS7 A;  1MIV A;  3ZEF B;  3JC6 C;  4V1A v;  4ERR A;  2DCF A;  2DHR A;  3ZN0 B;  1D1A A;  2K9A A;  3FHN A;  4CI1 B;  4H9O C;  4MLK A;  3C98 B;  2CXF A;  4O8S A;  3RH3 A;  4UIG A;  5FY7 A;  5HXR A;  1EZ3 A;  5LGU B;  2MTQ A;  4YLH A;  3FBZ A;  1ZHC A;  4PK6 A;  1MND A;  3CQG B;  3NRY A;  3ZLI A;  2K24 A;  2ZM8 A;  3EDU A;  4ZI2 C;  2CEA A;  4UVB B;  2LEH A;  3ONX A;  4IDZ A;  4I55 E;  2IC9 A;  2WM9 A;  2LSG A;  2W00 A;  4IE0 A;  5LJM A;  4YHJ A;  1IAP A;  3M65 A;  2ES0 A;  4G2A A;  4JLE A;  4DMV A;  3Q2M A;  2YK0 A;  3MKD A;  4DVD A;  3KV5 A;  2X9X A;  4IE7 A;  4P0B A;  4E7S A;  3N9M A;  3NZP A;  4IIJ E;  4C90 A;  4OFZ A;  4EYU A;  2C5I T;  4ASK A;  3JC6 D;  4IE4 A;  4QKN A;  2K5B B;  4ZI7 E;  4U74 A;  1HF8 A;  2D0U A;  5FP3 A;  3RX6 A;  5JDH A;  4UV9 B;  1HFA A;  3RC8 A;  3ZMV B;  2BVM A;  2KWH A;  2A3D A;  4AQG A;  2KLQ A;  3O1J A;  2ZLY A;  3C51 A;  3J9X 1;  2PFV A;  4X1Y E;  5JRC B;  3SS1 A;  1YKH B;  4ZI2 D;  3D0T A;  3UFE A;  2BZB A;  3MK7 C;  5HAX A;  5DQV A;  3MAC A;  4I43 B;  5JDM A;  2BVL A;  2Y8D A;  1WLX A;  2DNX A;  2VKJ A;  2YEV C;  4X1I E;  2N1G A;  5LP6 E;  2VKO A;  3AB3 B;  1FEW A;  3ETV A;  3AA7 B;  4GYR A;  3ZMT B;  1MMG A;  3VKG A;  5ETW A;  4CI3 B;  2ODV A;  3E0Z A;  2C5J A;  1Y64 B;  5LOV E;  2UXN B;  5L3F B;  4OHF A;  2KT9 A;  4I4T E;  1O3X A;  5FY0 A;  4H9P C;  3KBT A;  3ZN1 B;  4GOU A;  1UX5 A;  3AA6 B;  3IF8 B;  2Q9Q B;  4XAX B;  5L2L A;  3ANW A;  3P8C D;  2KWI B;  2KZ7 B;  1WR6 A;  3KDS E;  3N9Q A;  1YD8 G;  3RKO A;  3C4W A;  3AVR A;  3LFM A;  3CPZ A;  1ZV4 X;  2WSS V;  2N2N A;  3KV6 A;  2UXX B;  5BMV E;  4UXN B;  2HH7 A;  4GIW A;  3BK9 A;  4UEL A;  2DLR A;  3VHL A;  5LA6 E;  3CVR A;  3U3I A;  4QHO A;  4IE6 A;  3UUM A;  1VOM A;  3AAE B;  3O9X A;  4PJL A;  3VU7 H;  2OA5 A;  1BR2 A;  3PU8 A;  4GK0 E;  4BAY B;  2E8I A;  4UVC B;  3ZYK A;  3IBP A;  5JDG A;  2XAF B;  4O4H E;  5M4Y A;  3DP7 A;  4JUY A;  2WWU A;  3F57 A;  4IE5 A;  2NW9 A;  4C91 A;  2X51 A;  3MA9 A;  4PNI A;  3RYI E;  1HCI A;  4UVA B;  2BDE A;  3K3Q C;  1U5P A;  2KIN B;  4HE8 A;  3UTK A;  2G0U A;  3IEE A;  3MJX A;  4IST A;  1E1H B;  5ADX L;  1BR0 A;  5HWX A;  3ZMS B;  1MNE A;  3C4Z A;  5DQW A;  2X9H A;  5LYJ E;  2LT3 A;  3ZC1 A;  2X66 A;  1ZKE A;  3KBU A;  2W63 A;  3PU3 A;  2Y48 B;  4TX5 A;  2NTX A;  2LOS A;  1YKE B;  4HKA A;  1D0Y A;  3N2O A;  4WBO A;  2LE8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...