3W15B

Structure of peroxisomal targeting signal 2 (pts2) of saccharomyces cerevisiae 3-ketoacyl-coa thiolase in complex with pex7p and pex21p
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
92
structure length
72
Chain Sequence
SELQRIATDIVKCCTSSSVESKLSESKFIQLMRNISSGDVTLKSELFSSNNGELVGNRHIFVKDEIHKDILD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of peroxisomal targeting signal-2 bound to its receptor complex Pex7p-Pex21p
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Peroxisomal targeting signal 2 receptor
total genus 20
structure length 72
sequence length 92
ec nomenclature
pdb deposition date 2012-11-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3w15B00
3W15B
chains in the Genus database with same CATH superfamily
2QRXA 4C90A 3OBVE 1B7TA 1W09A 1WFDA 3I0OA 5AQNB 3RYHE 4U3CA 2HHHT 3UU6A 4H63H 2W4XA 3VU7H 4IDOA 5FY0A 3UU3A 5ABHA 3C4XA 3N9MA 5HEJA 5AQJB 3RH3A 3A7MA 4CN6A 2BG9C 2QGSA 4EOZB 3AVRA 2CXLA 3CQCB 5AQOB 2BS4A 3F57A 1KNPA 2EHOA 5F5WA 5HCJA 2W66A 3EAMA 3FXDB 3JADA 4CI1B 3AAEB 2N9DA 3ZYLA 5JDFA 5FVLA 2YDQA 1O3XA 1WYCA 1WYBA 4BJNA 3VKGA 1YXRA 2LRLA 1W0AA 5KXJA 1NWMX 3RYFE 4ILUA 2J1DG 5JDMA 2RPAA 3RC8A 3Q5WA 4BJMA 1OEDE 2CPTA 3UQ4A 5EK2A 1HNWT 1D1CA 4V1Av 3J9X1 5LCYA 5L4HA 1N36T 4NIQA 3NWIA 1KNRA 5JDHA 2XUEA 1YQ4A 4G63A 4H9OC 4KI0F 1HG5A 4DV1T 3VRAA 3UU4A 4ISTA 1MNDA 2FJAA 2BS2A 3ZYKA 3AB3B 5JQGE 4H9QC 2LRKA 2MBGA 2KINB 1V9DA 3H3AA 2FJDA 4CZZB 5L2LA 1UURA 3IBPA 2DHRA 4HFEA 4MALA 3EDUA 2Y48B 2CHOA 2DWKA 4KBMB 5CA0E 4NXNT 2BG9A 4Z90A 3N5LA 3AE6A 2E9XA 2UXXB 2WMNA 3KV5A 3ZMUB 5BR8T 2YINA 1MIYA 2VQET 3U78A 1Z8UA 3B5MA 4B3TT 4QH1A 4UVAB 5AQUB 2H7VC 3BQIA 3OPCA 2LKHA 2EHOD 3ZC1A 4AQYT 5HYAA 4DV5T 1AJ3A 1G8XA 2CA5A 1UGOA 2YDRA 4CN1A 1D1AA 2SPCA 5FVKA 3N9NA 2H89A 4CXWA 3HA4A 3CVRA 3HKBE 3IA3A 3KV9A 1QUUA 4DR1T 2WZIA 2YEVC 2XQ9A 3RHWA 3TLVA 4M1PA 2NTYA 5FXWA 2VKOA 1GQEA 4ADZA 1Y01A 2IMLA 3NZPA 4ZI3C 3FXEB 3FZKB 4COFA 5ABFA 2WSSV 4ILCA 3AE3A 1HNZT 4O4JE 2L3LA 3LJCA 3PJAA 1SHZC 5JRCB 3ZN1B 3CQGB 4XAXB 5HEUA 2Z6EA 3HKCE 3O1HA 3MKDA 2X9XA 3I9WA 4Z8XA 2V7LA 1FJGT 1KEYA 3AA6B 3ZJ1A 3ZT7A 2F4VT 2W2UA 4JI8T 4I50E 5C3JA 4AKHA 2VQFT 3AA1B 2UUBT 5TAOA 4OX9T 5J2TE 2XSAA 3PURA 2E9XD 2CWYA 2G0UA 4H63V 4HWIB 3WAKA 3IHRA 3CWZB 3AAAB 4JBWF 5AQKB 1DU2A 2KWIB 4ANJA 4JLEA 2B1EA 2W0GA 2XASB 3P4QA 3RYIE 4YSYA 2W00A 3B13A 4LFAT 4K0KT 4U74A 4P0BA 5AQTB 2JMHA 1S35A 4G2AA 3CPZA 4PJNA 2FUPA 4AKLA 4HWFA 4ZHQE 2OV9A 1I6ZA 1YW0A 4QXBB 3C4WA 2NP9A 2XQ7A 2E9XC 2LT3A 1IAPA 4LMLA 5ADXL 2XQ8A 1T8BA 3AE5A 3LBXB 5FL0A 5HCMA 2JRKA 3AEEA 3AEDA 3FBLA 3KVBA 5LNKA 1KNZA 4X62T 3R84B 5ABFB 2M6IA 5AQMB 2BKOA 4KP3C 2ACZA 3LBXA 5IHYA 5ABEA 5J2UE 4UXNB 3AECA 4H9PC 4UF0A 3ZT6A 4GYRA 3RGLA 2LM2A 5JDNA 1HNXT 2I6HA 4YT0A 1QSDA 5E0OA 3Q9DA 5ETWA 2K3WA 4YSXA 5LB7B 4P1NA 4ZEYA 2K5BB 2AXDS 4JUYA 4KHZF 3HR0A 4AIUA 3KINB 5LG3A 4OK0A 4WNKA 2DI4A 2ZM6T 2XQ6A 4DV7T 1LVFA 3L3PA 2KWHA 4L9IA 4JV5T 3H37A 4P09A 2JPFA 2BG9B 5HXHA 4UV9B 5FMNA 2XAHB 1WRDA 2V8SV 3MZKB 4WBOA 3RI5A 2X67A 2ZM8A 5IUXA 4HWCA 4TUYE 1J5WA 4KHPT 1MMNA 2K9AA 1KF6A 2V6XA 4EXTA 1YKHB 4JI4T 3MK7C 2NW9A 1D0ZA 2C5KT 3AE9A 3ZYMA 3ABVA 2V6YB 2YDSA 3PJAJ 4DVDA 4GK5E 4DV4T 2LHRA 2K24A 4DV6T 4H9SE 3ONXA 1FIOA 2YU1A 5FXXA 4LF4T 4PFPA 1XNQT 1HCIA 3RLFF 3F2EA 1G73A 2BS3A 2R6GF 2JJ9A 2ZLYA 3ZKRA 5LGTB 4NUVA 2KXPB 5HEHA 3KFWX 3SS1A 1MNEA 4U31A 1MMGA 1LKXA 2E8IA 3L09A 4O4LE 4IE5A 4X5TA 2Q9QD 3UT5E 5KDMC 5L3GB 5AQHB 2ACXA 3CX7B 2HPJA 2V7JA 1NAFA 2RP4A 2D2SA 4J2CA 3GA8A 3IEEA 5HEOA 4YTPA 1OEDA 2XM1A 4EZ4A 1HG2A 4I55E 3JAEA 2CXDA 4DR7T 3AAIA 3EUHA 4IE0A 4ZI2D 3ZMVB 2M67A 4A97A 5AQGB 1WR0A 2CMRA 4DR2T 4IDZA 1S94A 3I0QA 4YTNA 5KX5E 2WMOA 4IDQA 3AE1A 2V7IA 4ZS2A 4YSZA 4B3ST 4JI0T 3NRYA 4I4TE 3AE7A 3ZLIA 2X66A 1OEDC 1E2AA 2KLQA 2NTXA 3MXZA 4O2BE 4X66T 5LHHB 4EV6A 3JCFA 4ZS3A 2ZM2A 3UUMA 1ZOYA 2DCFA 2V5DA 3H3MA 4PFOA 4QHOA 5C8YE 1ZP0A 3K3QC 2CBIA 4Z91A 2A2FX 4HFHA 4EEDA 3AEBA 3R6NA 3TKLB 3UTKA 2IIUA 4HEAA 3AEAA 3ZSSA 5HXEA 2VB6A 2QA7A 4TV9E 3RYCE 2BG9E 4HFBA 4O2AE 4QH4A 4XBFB 2VL8A 3L39A 5LJNA 2L9QA 1YKEB 1BR0A 3BK9A 3CMLA 1US7B 2XPKA 2PTFA 3FHNA 3FZMB 5AQIB 3ZSTA 2Q9QA 2NR4A 2CCQA 1ZHCA 2DLRA 2DNXA 1M7KA 3NBXX 3P8CD 2MTQA 4HN9A 3ZMTB 1OEDB 3O1JA 1MIVA 3K8PC 3KBTA 3OVUA 1KK7A 4IDNA 4F6RC 2WWUA 1IBMT 3OTOT 3Q5DA 2OA5A 2L8KA 4TWDA 2X9WA 3JC6C 4CI2B 2HPLA 4IE4A 2N2NA 3E08A 3P4PA 2B76A 2A3DA 3QNUA 2CXFA 2XQ4A 4PK5A 2WQYA 2E5LT 1MMDA 4YJ2E 5AQVB 3PUWF 2FBWA 2LOSA 5AQPB 1I94T 4HWHA 4EEBA 3PUVF 3SFDA 3AA7B 3QC9A 1JNRA 3PV0F 4O4IE 3IF8B 2CLYC 2YKSA 2LKGA 3PUGA 4TNVA 4UIGA 5H6QB 1IBKT 1HF8A 1YD8G 2DWGA 4Q25A 4WYVA 3O9XA 5DQWA 1NEKA 3AE4A 4UELA 4A56A 4TZ4C 5DJQC 4HKAA 3TLTA 4PJJA 3HKDE 3AVSA 3AA0B 2KMFA 3ANWA 1IJ5A 3KV4A 3PU3A 1YQ3A 3EVYA 4IGUA 3GN5A 4GYSA 1FMVA 2XQ3A 4TNWA 3AXJB 4JI5T 4QKNA 5FP3A 2X9HA 5J1GA 3LK3B 3RF1A 4YXDA 1IJ6A 3RKGA 2D0UA 3SFEA 5JH7E 4IE7A 1X79A 2UXBT 1D0XA 3QOFA 2ODVA 2LSYA 5LA6E 2ZMAA 3M65A 3AXJA 3RRCA 4DR6T 4OFZA 4DUYT 5LHIB 4ILAA 5HXRA 3RIUA 1Y64B 4LMKA 2BZBA 3BQLA 2CWOA 4LF7T 5BMVE 5L3EB 2VWAA 5LGNB 3MJXA 4EGWA 4OYKA 2XY8B 4FI5A 5FYMA 2KNDA 1BR4A 2BKPA 2XHEB 3N9OA 2CEAA 3QB5K 4IL4A 4DNDA 5FY7A 5AFUL 3N2KE 5L3BB 2WBLA 2WS3A 2Y6XA 3PTRB 2X0LB 3QUJA 4MFRA 2YN6A 3DJBA 4TN7B 3VRBA 2PJQA 2YK0A 4YHHT 2ZM0A 5HAXA 2JMKA 2WDRA 3HI2A 3AEFA 3OKQA 2PBIA 4HGAA 4L5GA 1ZV4X 4XZCA 4EB6E 1VCSA 3CK6A 2WDVA 1HR0T 3C64A 2NWBA 4JI6T 3EI0A 1MMAA 2LSIA 3X1DA 2IC6A 3ZMSB 1R8IA 1XZYA 5JDGA 5LBMA 2UU9T 5C2TA 2VASA 2XQYA 2E5VA 3CX6B 4N78D 3MA9A 2WWVA 1SA0E 1XDOA 3UU5A 3OJAA 4DBRA 4X65T 1SE7A 4A98A 4UVCB 4UVBB 5AQLB 1Z0PA 5LG4A 2Q9QB 2KSRA 1T98A 3LG7A 4WW0A 1OXZA 1FMWA 1BR2A 3PUSA 2IUBA 3RX6A 4P0AA 2E9XB 4HFDA 1UUSA 3FZLB 5AQFB 5L47A 4JEUB 2AE9A 2W61A 4HFVA 3L8RA 3ZPOA 1N32T 3GMIA 3LK42 5LYJE 1UX5A 2UXNB 2JIWA 5L4EA 1IZNB 1XDPA 3UU8A 4E7SA 4QWNB 5H6RB 1IBLT 4JEHB 4PJLA 4PJMA 5DQVA 3E22E 1CUNA 2KT9A 2VKJA 3KVAA 4QH5A 3UFGA 3ZCJA 3M3ZB 4ASKA 5LMUT 4DV0T 4L0RA 4AKGA 1OWAA 4B3MT 3O4XE 5M4YA 2W62A 4ZI2C 4YHJA 4PAGA 3QB5A 4CQIA 5LOVE 4YY3T 2WY2A 4IREA 2CHNA 2LJLA 3ETUA 2N1GA 1M62A 3UQ7A 2NW7A 2HN2A 2X51A 2BBJA 2LEHA 2Y8DA 2BKNA 3RRWA 4DMWA 3C4ZA 5EK4A 2KZ7B 2YU2A 3Q2MA 1WLXA 4DR5T 4UV8B 2MAWA 4LMJA 2EHOC 3UUNA 3WI3A 4LF5T 4AKRB 3I9YA 4DR4T 4IL9A 2XAJB 2CLYB 2PFVA 2D0TA 3UFEA 3D0TA 2CRBA 3N2OA 3ONJA 4DV3T 4PW8A 2WZHA 3T1HT 1XMOT 4OHFA 4DBQA 2GK9A 3AE2A 3J7Yq 4H9NC 2UXCT 4HWDA 1WCRA 1X9BA 3P4WA 2OLTA 3RQWA 5HXSA 2V5CA 2V7KA 4IT4A 4CXYA 4X1YE 2VKDA 3FZHB 2BVLA 4CI3B 4PK6A 5JREA 4PK4A 2LOPA 5JDQA 3U3IA 3CX8B 1E1HB 4DMVA 3NZQA 4MLKA 3RIFA 2QVAA 2XAGB 2IW5B 2ES0A 4LF6T 3OYXA 2A9UA 4GIWA 2YOEA 5A1LA 1SUMB 1J1JA 4HE8A 2UXDT 4ZXLA 4LFBT 3SWHA 1HX1B 2I59A 4HFIA 3B57A 1XWMA 3KV6A 4WZXA 3RIUC 4ZZCA 2J47A 5LJMA 3N2GE 5L3CB 1FEWA 5FXZA 1ZKEA 3SOLA 5CB4E 2E2AA 2JQQA 2H7OA 3A5XA 3PUAA 2WB5A 1N34T 1MIWA 2LSKA 2W67A 3K3OA 2VVNA 4HFCA 4KMCA 3MACA 4TX5A 2XQAA 2CE7A 4MBQA 2NW8A 2X9YA 4A5XA 4AXPA 5LMNT 2M6BA 2JQKA 3UULA 4DV2T 4I43B 4GKJT 1HFAA 5FNVE 4GKKT 3VR8A 3PU8A 1U5PA 2RA1A 2X68A 3A8YC 4ILBA 4JI3T 2C5JA 3ZT5A 2BBHA 2CM0A 3KDSE 3N9QA 4H9RC 3F31A 5JR9B 2XZEA 1CHUA 5F8PA 2VKHA 3C50A 5HEGA 4F8HA 4E7ZA 5FKYA 2LE8A 1XNRT 4IDPA 3LFMA 4JYAT 3RPUA 3LSVA 3ESLA 2V6YA 5LBQB 3TLWA 4EAHA 4EZHA 4U2YA 3I1AA 5IWAT 4LF9T 3NRXA 1VCTA 3CKDA 3O1IA 3ONLC 4QXHB 2D9DA 3CIRA 3TLUA 2QYWA 3ETVA 4U33A 4EYUA 5CFBA 5FL1A 4GOUA 4WBNE 5HWXA 1XMQT 2WU2A 2WM9A 4AISA 1L0VA 1VOMA 2FJBA 3GWHA 4JI2T 2XM2A 4MHCA 3AEGA 3GN5B 2WDQA 4NXMT 5JTGA 5CJ5A 3RC3A 3W15B 1J5ET 3DTOA 5AQSB 4X64T 3EHZA 3EABA 4O4HE 3ZCIA 3P7IA 4ZI3D 3EDVA 3LK2B 3P50A 3RIAA 4NUUA 5J0ZA 2LM9A 4U2ZA 4TWFA 2PG8A 1BR1A 4BA9A 2XQ5A 2J4GA 5AQQB 3PUXF 2IDOB 3NKZA 5HXCA 4K0UA 5L3FB 5JDLA 3DP7A 1KFYA 2I0MA 3PUZF 1N33T 5JR9A 1ZEEA 4YTMA 4LFCT 2BDEA 5L3DB 1D0YA 2LSJA 2XSBA 3JC6D 4DO0A 1UCUA 5CA1E 1WR6A 5EK3A 2LHNA 3N9PA 1HS7A 4AI6A 2VVSA 1LVKA 2V1DB 2JQ9A 3FZFB 4QX8B 3VR9A 4B6XA 3QK6A 3V5SA 4C91A 2NOXA 2EHOB 2V7MA 2VK9A 3FB2A 2X0YA 2XAQB 1W0BA 2W63A 2XTLA 1VRBA 1U4QA 1W9RA 2D5UA 2WU5A 4FJOA 4O8SA 4UEMA 3RKOA 5F3JA 3PUQA 3N9LA 2UUAT 3VHLA 3S4UA 4NPPA 2H88A 2WCAA 4DIDB 3LDQB 5EZYE 2C5IT 2IAKA 3PDYA 5FXVA 3BQKA 3Q5EA 5GONE 5JVDE 3RQUA 3ZJ2A 3UUBA 4JI7T 3AE8A 3C98B 2MYSA 4U72A 4AQFA 3FBZA 4QXCB 3K1SA 2HH7A 3T8OA 4IHJE 2XJ7A 1QLBA 2H3RA 3T1YT 1UX4A 3C51A 4U7IA 3TLSA 4ZOLE 1H7CA 4TWHA 3ZC0A 1T72A 3ZMZB 5LP6E 4X1KE 2A72A 4KX6A 4ZI7E 2IHR1 4JI1T 4DUZT 4U7YA 2X0HA 2V26A 3NVOA 4KUMB 5ABGA 1EZ3A 4B3RT 3VKHA 3UUXB 5JRCA 3SRZA 2XAFB 4EYYR 3PE0A 2MOZA 2CBJA 4X20E 5FY1A 4ZZBA 2BVMA 3HL6A 3P4SA 4IIJE 4AQFC 3CQXC 2VL0A 3ZN0B 2LLYA 2HN1A 2ODUA 4YLHA 2IC9A 3G06A 3K3NA 4YFSA 4BAYB 4AQGA 5DABA 2WP9A 2Q9QC 4IE6A 4AKIA 4CXXA 1E7PA 1LRZA 4DR3T 2J62A 4CN4A 5IYZE 4ISSA 5HWYA 2C0SA 2UUCT 4X1IE 4QX7B 1HTJF 3PUYF 2K48A 4LF8T 5KMGP 4UR9A 3Q5XA 4OYJA 3WAJA 2JQHA 3KBUA 4HTEA 3HKEE 4I0UA 4PNIA 5AQRB 1T7SA 4UF0B 2VURA 2MPKA 3JAFA 3P4RA 5JR9C 5LHGB 4GK0E 4TV8E 3ZEFB 1D1BA 5CGMA 3ANWB 5LXTE 1UK5A 2FJEA 4YJ3E 2WAUA 4EIWA 1NENA 3OYZA 1JNZA 2DL1A 2LSGA 4ERRA 5LGUB 2P9BA 3E0ZA 1HX8A 3V5UA
chains in the Genus database with same CATH topology
4C90A 3OBVE 1B7TA 3I0OA 3RYHE 3VU7H 4H63H 5FY0A 3C4XA 3N9MA 3RH3A 2QGSA 4EOZB 3AVRA 2CXLA 3CQCB 3F57A 2EHOA 3FXDB 4CI1B 3AAEB 2N9DA 3ZYLA 5JDFA 4BJNA 1O3XA 1WYCA 1WYBA 3VKGA 1NWMX 3RYFE 4ILUA 2J1DG 5JDMA 3RC8A 3Q5WA 4BJMA 5EK2A 1D1CA 4V1Av 3J9X1 5LCYA 5JDHA 2XUEA 4G63A 4H9OC 1HG5A 4ISTA 1MNDA 3ZYKA 5JQGE 3AB3B 4H9QC 2MBGA 2KINB 1V9DA 3H3AA 4CZZB 5L2LA 3IBPA 2DHRA 4MALA 1KNZA 3EDUA 2Y48B 2DWKA 4KBMB 5CA0E 3N5LA 2E9XA 2UXXB 2WMNA 3KV5A 3ZMUB 2YINA 1MIYA 3U78A 4UVAB 2H7VC 3BQIA 2EHOD 3ZC1A 5HYAA 1AJ3A 1G8XA 2CA5A 1D1AA 2SPCA 4CXWA 3N9NA 3HA4A 3CVRA 3HKBE 3KV9A 1QUUA 2YEVC 4M1PA 2NTYA 5FXWA 2VKOA 4ADZA 3NZPA 4ZI3C 3FXEB 2WSSV 4O4JE 2L3LA 3LJCA 1SHZC 5JRCB 3ZN1B 3CQGB 4XAXB 2Z6EA 3HKCE 3O1HA 3MKDA 2X9XA 3I9WA 4Z8XA 2V7LA 3AA6B 3ZJ1A 4AKHA 4I50E 3AA1B 5TAOA 5J2TE 3PURA 2E9XD 2CWYA 2G0UA 4H63V 3WAKA 3IHRA 3CWZB 3AAAB 2KWIB 4ANJA 4JLEA 2B1EA 2W0GA 2XASB 3RYIE 2W00A 3B13A 4U74A 4P0BA 4AKLA 2JMHA 1S35A 4G2AA 3CPZA 4PJNA 4ZHQE 1YW0A 4QXBB 3C4WA 2NP9A 5ADXL 2E9XC 2LT3A 1IAPA 3LBXB 5LNKA 2JRKA 3FBLA 3KVBA 3R84B 4KP3C 3LBXA 5IHYA 5J2UE 4UXNB 4H9PC 4UF0A 4GYRA 5JDNA 1QSDA 5E0OA 3Q9DA 5ETWA 2K5BB 4JUYA 3HR0A 3KINB 4OK0A 4WNKA 2DI4A 1LVFA 3L3PA 2KWHA 4L9IA 3H37A 4P09A 2JPFA 5HXHA 4UV9B 5FMNA 2XAHB 1WRDA 3MZKB 4WBOA 2X67A 2ZM8A 4TUYE 1MMNA 2K9AA 4EXTA 1YKHB 3MK7C 2NW9A 1D0ZA 2C5KT 3ZYMA 4DVDA 4GK5E 2LHRA 2K24A 4H9SE 3ONXA 1FIOA 2YU1A 5FXXA 4PFPA 1HCIA 3F2EA 1G73A 5LGTB 2JJ9A 2ZLYA 4NUVA 2KXPB 3SS1A 3KFWX 1MNEA 1MMGA 1LKXA 2E8IA 3L09A 4O4LE 4IE5A 3UT5E 2Q9QD 5L3GB 2ACXA 3CX7B 2HPJA 2V7JA 1NAFA 2RP4A 2D2SA 4J2CA 3GA8A 3IEEA 4EZ4A 1HG2A 4I55E 2CXDA 3AAIA 3EUHA 4IE0A 4ZI2D 3ZMVB 2M67A 2CMRA 4IDZA 1S94A 3I0QA 5KX5E 2WMOA 4ZS2A 2V7IA 3NRYA 4I4TE 3ZLIA 2X66A 2KLQA 2NTXA 3MXZA 4O2BE 5LHHB 4ZS3A 2ZM2A 3UUMA 2DCFA 4PFOA 4QHOA 5C8YE 3K3QC 2A2FX 3R6NA 3TKLB 3UTKA 4HEAA 2VB6A 2QA7A 4TV9E 3RYCE 4O2AE 4XBFB 2VL8A 5LJNA 2L9QA 1YKEB 1BR0A 3BK9A 3CMLA 1US7B 3FHNA 2Q9QA 2CCQA 1ZHCA 2DLRA 2DNXA 3NBXX 3P8CD 4HN9A 2MTQA 3ZMTB 4DNDA 3O1JA 4F6RC 1MIVA 3K8PC 3KBTA 1KK7A 2WWUA 2OA5A 2L8KA 2X9WA 3JC6C 4CI2B 2HPLA 4IE4A 2N2NA 3E08A 2A3DA 4PK5A 2CXFA 1MMDA 4YJ2E 2LOSA 3AA7B 3QC9A 4O4IE 3IF8B 2CLYC 3PUGA 4UIGA 5H6QB 1HF8A 1YD8G 2DWGA 3O9XA 5DQWA 4UELA 4A56A 4TZ4C 5DJQC 4HKAA 4PJJA 3HKDE 3AVSA 3AA0B 2KMFA 3ANWA 1IJ5A 3KV4A 3PU3A 3EVYA 4IGUA 3GN5A 4GYSA 1FMVA 4QKNA 5FP3A 2X9HA 5J1GA 3LK3B 5JH7E 1IJ6A 2D0UA 4IE7A 1X79A 1D0XA 2ODVA 2LSYA 5LA6E 2ZMAA 3M65A 3RRCA 4OFZA 5LHIB 5HXRA 1Y64B 2BZBA 3BQLA 2CWOA 5BMVE 5L3EB 2VWAA 5LGNB 3MJXA 4OYKA 4FI5A 5FYMA 2KNDA 1BR4A 2XHEB 3N9OA 2CEAA 5L3BB 5AFUL 5FY7A 3N2KE 2WBLA 3QUJA 2Y6XA 3PTRB 2X0LB 4MFRA 4TN7B 3DJBA 5HXEA 5KDMC 2PJQA 2YK0A 2ZM0A 5HAXA 2JMKA 3HI2A 3OKQA 4L5GA 4EB6E 2PBIA 4HGAA 1ZV4X 4XZCA 3C64A 2NWBA 1MMAA 2LSIA 2IC6A 3ZMSB 5JDGA 5LBMA 2VASA 2XQYA 3CX6B 4N78D 3MA9A 4DBRA 1SA0E 3OJAA 4UVCB 4UVBB 1Z0PA 5LG4A 2Q9QB 1T98A 3LG7A 4WW0A 1OXZA 1FMWA 1BR2A 3PUSA 3RX6A 4P0AA 2E9XB 4JEUB 3ZPOA 2W61A 4HFVA 3GMIA 3LK42 5LYJE 1UX5A 2UXNB 1IZNB 4E7SA 4QWNB 5H6RB 4JEHB 4PJLA 4PJMA 5DQVA 3E22E 1CUNA 2KT9A 2VKJA 3KVAA 3ZCJA 4ASKA 4AKGA 4L0RA 1OWAA 3O4XE 5M4YA 2W62A 4ZI2C 4YHJA 4PAGA 4CQIA 5LOVE 2LJLA 3ETUA 2N1GA 2NW7A 2Y8DA 2X51A 2LEHA 3RRWA 4DMWA 3C4ZA 5EK4A 2KZ7B 2YU2A 3Q2MA 1WLXA 4UV8B 2EHOC 3UUNA 3WI3A 4AKRB 3I9YA 2XAJB 2CLYB 2PFVA 2D0TA 3UFEA 3D0TA 3N2OA 4PW8A 4OHFA 4DBQA 2GK9A 3J7Yq 4H9NC 5HXSA 4CXYA 2V7KA 4X1YE 2VKDA 2BVLA 4CI3B 4PK6A 5JREA 4PK4A 2LOPA 5JDQA 3U3IA 3CX8B 1E1HB 4DMVA 3NZQA 4MLKA 2XAGB 2IW5B 2ES0A 3OYXA 4GIWA 5A1LA 4HE8A 3SWHA 2I59A 3B57A 3KV6A 5LJMA 3N2GE 5L3CB 1FEWA 5FXZA 1ZKEA 3SOLA 5CB4E 2JQQA 2H7OA 3A5XA 3PUAA 1MIWA 2LSKA 3K3OA 4KMCA 3MACA 4TX5A 2CE7A 4MBQA 2NW8A 2X9YA 4AXPA 3UULA 4I43B 1HFAA 5FNVE 3PU8A 1U5PA 2RA1A 2X68A 2C5JA 2CM0A 3KDSE 3N9QA 4H9RC 3F31A 5JR9B 5F8PA 2VKHA 3C50A 4E7ZA 2LE8A 3LFMA 3RPUA 3ESLA 5LBQB 4EAHA 4EZHA 3I1AA 3NRXA 3CKDA 3O1IA 4QXHB 4EYUA 3ETVA 4GOUA 4WBNE 5HWXA 2WM9A 1VOMA 3GWHA 4MHCA 3GN5B 3RC3A 3W15B 3DTOA 4O4HE 3ZCIA 3P7IA 4ZI3D 3EDVA 3LK2B 4NUUA 2LM9A 2PG8A 1BR1A 4BA9A 5HXCA 4K0UA 5L3FB 5JDLA 3DP7A 5JR9A 1ZEEA 2BDEA 5L3DB 1D0YA 2LSJA 3JC6D 5CA1E 4DO0A 1UCUA 1WR6A 5EK3A 2LHNA 3N9PA 1HS7A 4AI6A 1LVKA 2V1DB 4QX8B 4B6XA 3QK6A 3V5SA 4C91A 2NOXA 2EHOB 2V7MA 2VK9A 3FB2A 2XAQB 2XTLA 2W63A 4FJOA 1VRBA 1U4QA 4O8SA 2D5UA 4UEMA 3RKOA 5F3JA 3PUQA 3N9LA 3VHLA 3S4UA 5EZYE 2C5IT 2IAKA 3PDYA 5FXVA 3BQKA 5GONE 5JVDE 3ZJ2A 3C98B 4AQFA 2MYSA 4U72A 3FBZA 4QXCB 2HH7A 3T8OA 4IHJE 2H3RA 1UX4A 3C51A 4ZOLE 1H7CA 3ZC0A 3ZMZB 5LP6E 4X1KE 2A72A 4ZI7E 2V26A 3VKHA 4KUMB 1EZ3A 3UUXB 5JRCA 3SRZA 2XAFB 4EYYR 3PE0A 2MOZA 4X20E 5FY1A 2BVMA 3HL6A 4IIJE 4AQFC 3CQXC 3ZN0B 2ODUA 4YLHA 2IC9A 3K3NA 4YFSA 4BAYB 4AQGA 5DABA 2Q9QC 4IE6A 4AKIA 4CXXA 1LRZA 5IYZE 4ISSA 5HWYA 2C0SA 4X1IE 4QX7B 1HTJF 2K48A 5KMGP 3Q5XA 4OYJA 3WAJA 4HTEA 3KBUA 4PNIA 3HKEE 4UF0B 5JR9C 5LHGB 4GK0E 4TV8E 3ZEFB 1D1BA 3ANWB 5LXTE 4YJ3E 2WAUA 4EIWA 3OYZA 2LSGA 4ERRA 5LGUB 2P9BA 3E0ZA 1HX8A 3V5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W15 B; 
#chains in the Genus database with same CATH topology
 2QRX A;  4C90 A;  3OBV E;  1B7T A;  1W09 A;  1WFD A;  3I0O A;  5AQN B;  3RYH E;  4U3C A;  2HHH T;  3UU6 A;  4H63 H;  2W4X A;  3VU7 H;  4IDO A;  5FY0 A;  3UU3 A;  5ABH A;  3C4X A;  3N9M A;  5HEJ A;  5AQJ B;  3RH3 A;  3A7M A;  4CN6 A;  2BG9 C;  2QGS A;  4EOZ B;  3AVR A;  2CXL A;  3CQC B;  5AQO B;  2BS4 A;  3F57 A;  1KNP A;  2EHO A;  5F5W A;  5HCJ A;  2W66 A;  3EAM A;  3FXD B;  3JAD A;  4CI1 B;  3AAE B;  2N9D A;  3ZYL A;  5JDF A;  5FVL A;  2YDQ A;  1O3X A;  1WYC A;  1WYB A;  4BJN A;  3VKG A;  1YXR A;  2LRL A;  1W0A A;  5KXJ A;  1NWM X;  3RYF E;  4ILU A;  2J1D G;  5JDM A;  2RPA A;  3RC8 A;  3Q5W A;  4BJM A;  1OED E;  2CPT A;  3UQ4 A;  5EK2 A;  1HNW T;  1D1C A;  4V1A v;  3J9X 1;  5LCY A;  5L4H A;  1N36 T;  4NIQ A;  3NWI A;  1KNR A;  5JDH A;  2XUE A;  1YQ4 A;  4G63 A;  4H9O C;  4KI0 F;  1HG5 A;  4DV1 T;  3VRA A;  3UU4 A;  4IST A;  1MND A;  2FJA A;  2BS2 A;  3ZYK A;  3AB3 B;  5JQG E;  4H9Q C;  2LRK A;  2MBG A;  2KIN B;  1V9D A;  3H3A A;  2FJD A;  4CZZ B;  5L2L A;  1UUR A;  3IBP A;  2DHR A;  4HFE A;  4MAL A;  3EDU A;  2Y48 B;  2CHO A;  2DWK A;  4KBM B;  5CA0 E;  4NXN T;  2BG9 A;  4Z90 A;  3N5L A;  3AE6 A;  2E9X A;  2UXX B;  2WMN A;  3KV5 A;  3ZMU B;  5BR8 T;  2YIN A;  1MIY A;  2VQE T;  3U78 A;  1Z8U A;  3B5M A;  4B3T T;  4QH1 A;  4UVA B;  5AQU B;  2H7V C;  3BQI A;  3OPC A;  2LKH A;  2EHO D;  3ZC1 A;  4AQY T;  5HYA A;  4DV5 T;  1AJ3 A;  1G8X A;  2CA5 A;  1UGO A;  2YDR A;  4CN1 A;  1D1A A;  2SPC A;  5FVK A;  3N9N A;  2H89 A;  4CXW A;  3HA4 A;  3CVR A;  3HKB E;  3IA3 A;  3KV9 A;  1QUU A;  4DR1 T;  2WZI A;  2YEV C;  2XQ9 A;  3RHW A;  3TLV A;  4M1P A;  2NTY A;  5FXW A;  2VKO A;  1GQE A;  4ADZ A;  1Y01 A;  2IML A;  3NZP A;  4ZI3 C;  3FXE B;  3FZK B;  4COF A;  5ABF A;  2WSS V;  4ILC A;  3AE3 A;  1HNZ T;  4O4J E;  2L3L A;  3LJC A;  3PJA A;  1SHZ C;  5JRC B;  3ZN1 B;  3CQG B;  4XAX B;  5HEU A;  2Z6E A;  3HKC E;  3O1H A;  3MKD A;  2X9X A;  3I9W A;  4Z8X A;  2V7L A;  1FJG T;  1KEY A;  3AA6 B;  3ZJ1 A;  3ZT7 A;  2F4V T;  2W2U A;  4JI8 T;  4I50 E;  5C3J A;  4AKH A;  2VQF T;  3AA1 B;  2UUB T;  5TAO A;  4OX9 T;  5J2T E;  2XSA A;  3PUR A;  2E9X D;  2CWY A;  2G0U A;  4H63 V;  4HWI B;  3WAK A;  3IHR A;  3CWZ B;  3AAA B;  4JBW F;  5AQK B;  1DU2 A;  2KWI B;  4ANJ A;  4JLE A;  2B1E A;  2W0G A;  2XAS B;  3P4Q A;  3RYI E;  4YSY A;  2W00 A;  3B13 A;  4LFA T;  4K0K T;  4U74 A;  4P0B A;  5AQT B;  2JMH A;  1S35 A;  4G2A A;  3CPZ A;  4PJN A;  2FUP A;  4AKL A;  4HWF A;  4ZHQ E;  2OV9 A;  1I6Z A;  1YW0 A;  4QXB B;  3C4W A;  2NP9 A;  2XQ7 A;  2E9X C;  2LT3 A;  1IAP A;  4LML A;  5ADX L;  2XQ8 A;  1T8B A;  3AE5 A;  3LBX B;  5FL0 A;  5HCM A;  2JRK A;  3AEE A;  3AED A;  3FBL A;  3KVB A;  5LNK A;  1KNZ A;  4X62 T;  3R84 B;  5ABF B;  2M6I A;  5AQM B;  2BKO A;  4KP3 C;  2ACZ A;  3LBX A;  5IHY A;  5ABE A;  5J2U E;  4UXN B;  3AEC A;  4H9P C;  4UF0 A;  3ZT6 A;  4GYR A;  3RGL A;  2LM2 A;  5JDN A;  1HNX T;  2I6H A;  4YT0 A;  1QSD A;  5E0O A;  3Q9D A;  5ETW A;  2K3W A;  4YSX A;  5LB7 B;  4P1N A;  4ZEY A;  2K5B B;  2AXD S;  4JUY A;  4KHZ F;  3HR0 A;  4AIU A;  3KIN B;  5LG3 A;  4OK0 A;  4WNK A;  2DI4 A;  2ZM6 T;  2XQ6 A;  4DV7 T;  1LVF A;  3L3P A;  2KWH A;  4L9I A;  4JV5 T;  3H37 A;  4P09 A;  2JPF A;  2BG9 B;  5HXH A;  4UV9 B;  5FMN A;  2XAH B;  1WRD A;  2V8S V;  3MZK B;  4WBO A;  3RI5 A;  2X67 A;  2ZM8 A;  5IUX A;  4HWC A;  4TUY E;  1J5W A;  4KHP T;  1MMN A;  2K9A A;  1KF6 A;  2V6X A;  4EXT A;  1YKH B;  4JI4 T;  3MK7 C;  2NW9 A;  1D0Z A;  2C5K T;  3AE9 A;  3ZYM A;  3ABV A;  2V6Y B;  2YDS A;  3PJA J;  4DVD A;  4GK5 E;  4DV4 T;  2LHR A;  2K24 A;  4DV6 T;  4H9S E;  3ONX A;  1FIO A;  2YU1 A;  5FXX A;  4LF4 T;  4PFP A;  1XNQ T;  1HCI A;  3RLF F;  3F2E A;  1G73 A;  2BS3 A;  2R6G F;  2JJ9 A;  2ZLY A;  3ZKR A;  5LGT B;  4NUV A;  2KXP B;  5HEH A;  3KFW X;  3SS1 A;  1MNE A;  4U31 A;  1MMG A;  1LKX A;  2E8I A;  3L09 A;  4O4L E;  4IE5 A;  4X5T A;  2Q9Q D;  3UT5 E;  5KDM C;  5L3G B;  5AQH B;  2ACX A;  3CX7 B;  2HPJ A;  2V7J A;  1NAF A;  2RP4 A;  2D2S A;  4J2C A;  3GA8 A;  3IEE A;  5HEO A;  4YTP A;  1OED A;  2XM1 A;  4EZ4 A;  1HG2 A;  4I55 E;  3JAE A;  2CXD A;  4DR7 T;  3AAI A;  3EUH A;  4IE0 A;  4ZI2 D;  3ZMV B;  2M67 A;  4A97 A;  5AQG B;  1WR0 A;  2CMR A;  4DR2 T;  4IDZ A;  1S94 A;  3I0Q A;  4YTN A;  5KX5 E;  2WMO A;  4IDQ A;  3AE1 A;  2V7I A;  4ZS2 A;  4YSZ A;  4B3S T;  4JI0 T;  3NRY A;  4I4T E;  3AE7 A;  3ZLI A;  2X66 A;  1OED C;  1E2A A;  2KLQ A;  2NTX A;  3MXZ A;  4O2B E;  4X66 T;  5LHH B;  4EV6 A;  3JCF A;  4ZS3 A;  2ZM2 A;  3UUM A;  1ZOY A;  2DCF A;  2V5D A;  3H3M A;  4PFO A;  4QHO A;  5C8Y E;  1ZP0 A;  3K3Q C;  2CBI A;  4Z91 A;  2A2F X;  4HFH A;  4EED A;  3AEB A;  3R6N A;  3TKL B;  3UTK A;  2IIU A;  4HEA A;  3AEA A;  3ZSS A;  5HXE A;  2VB6 A;  2QA7 A;  4TV9 E;  3RYC E;  2BG9 E;  4HFB A;  4O2A E;  4QH4 A;  4XBF B;  2VL8 A;  3L39 A;  5LJN A;  2L9Q A;  1YKE B;  1BR0 A;  3BK9 A;  3CML A;  1US7 B;  2XPK A;  2PTF A;  3FHN A;  3FZM B;  5AQI B;  3ZST A;  2Q9Q A;  2NR4 A;  2CCQ A;  1ZHC A;  2DLR A;  2DNX A;  1M7K A;  3NBX X;  3P8C D;  2MTQ A;  4HN9 A;  3ZMT B;  1OED B;  3O1J A;  1MIV A;  3K8P C;  3KBT A;  3OVU A;  1KK7 A;  4IDN A;  4F6R C;  2WWU A;  1IBM T;  3OTO T;  3Q5D A;  2OA5 A;  2L8K A;  4TWD A;  2X9W A;  3JC6 C;  4CI2 B;  2HPL A;  4IE4 A;  2N2N A;  3E08 A;  3P4P A;  2B76 A;  2A3D A;  3QNU A;  2CXF A;  2XQ4 A;  4PK5 A;  2WQY A;  2E5L T;  1MMD A;  4YJ2 E;  5AQV B;  3PUW F;  2FBW A;  2LOS A;  5AQP B;  1I94 T;  4HWH A;  4EEB A;  3PUV F;  3SFD A;  3AA7 B;  3QC9 A;  1JNR A;  3PV0 F;  4O4I E;  3IF8 B;  2CLY C;  2YKS A;  2LKG A;  3PUG A;  4TNV A;  4UIG A;  5H6Q B;  1IBK T;  1HF8 A;  1YD8 G;  2DWG A;  4Q25 A;  4WYV A;  3O9X A;  5DQW A;  1NEK A;  3AE4 A;  4UEL A;  4A56 A;  4TZ4 C;  5DJQ C;  4HKA A;  3TLT A;  4PJJ A;  3HKD E;  3AVS A;  3AA0 B;  2KMF A;  3ANW A;  1IJ5 A;  3KV4 A;  3PU3 A;  1YQ3 A;  3EVY A;  4IGU A;  3GN5 A;  4GYS A;  1FMV A;  2XQ3 A;  4TNW A;  3AXJ B;  4JI5 T;  4QKN A;  5FP3 A;  2X9H A;  5J1G A;  3LK3 B;  3RF1 A;  4YXD A;  1IJ6 A;  3RKG A;  2D0U A;  3SFE A;  5JH7 E;  4IE7 A;  1X79 A;  2UXB T;  1D0X A;  3QOF A;  2ODV A;  2LSY A;  5LA6 E;  2ZMA A;  3M65 A;  3AXJ A;  3RRC A;  4DR6 T;  4OFZ A;  4DUY T;  5LHI B;  4ILA A;  5HXR A;  3RIU A;  1Y64 B;  4LMK A;  2BZB A;  3BQL A;  2CWO A;  4LF7 T;  5BMV E;  5L3E B;  2VWA A;  5LGN B;  3MJX A;  4EGW A;  4OYK A;  2XY8 B;  4FI5 A;  5FYM A;  2KND A;  1BR4 A;  2BKP A;  2XHE B;  3N9O A;  2CEA A;  3QB5 K;  4IL4 A;  4DND A;  5FY7 A;  5AFU L;  3N2K E;  5L3B B;  2WBL A;  2WS3 A;  2Y6X A;  3PTR B;  2X0L B;  3QUJ A;  4MFR A;  2YN6 A;  3DJB A;  4TN7 B;  3VRB A;  2PJQ A;  2YK0 A;  4YHH T;  2ZM0 A;  5HAX A;  2JMK A;  2WDR A;  3HI2 A;  3AEF A;  3OKQ A;  2PBI A;  4HGA A;  4L5G A;  1ZV4 X;  4XZC A;  4EB6 E;  1VCS A;  3CK6 A;  2WDV A;  1HR0 T;  3C64 A;  2NWB A;  4JI6 T;  3EI0 A;  1MMA A;  2LSI A;  3X1D A;  2IC6 A;  3ZMS B;  1R8I A;  1XZY A;  5JDG A;  5LBM A;  2UU9 T;  5C2T A;  2VAS A;  2XQY A;  2E5V A;  3CX6 B;  4N78 D;  3MA9 A;  2WWV A;  1SA0 E;  1XDO A;  3UU5 A;  3OJA A;  4DBR A;  4X65 T;  1SE7 A;  4A98 A;  4UVC B;  4UVB B;  5AQL B;  1Z0P A;  5LG4 A;  2Q9Q B;  2KSR A;  1T98 A;  3LG7 A;  4WW0 A;  1OXZ A;  1FMW A;  1BR2 A;  3PUS A;  2IUB A;  3RX6 A;  4P0A A;  2E9X B;  4HFD A;  1UUS A;  3FZL B;  5AQF B;  5L47 A;  4JEU B;  2AE9 A;  2W61 A;  4HFV A;  3L8R A;  3ZPO A;  1N32 T;  3GMI A;  3LK4 2;  5LYJ E;  1UX5 A;  2UXN B;  2JIW A;  5L4E A;  1IZN B;  1XDP A;  3UU8 A;  4E7S A;  4QWN B;  5H6R B;  1IBL T;  4JEH B;  4PJL A;  4PJM A;  5DQV A;  3E22 E;  1CUN A;  2KT9 A;  2VKJ A;  3KVA A;  4QH5 A;  3UFG A;  3ZCJ A;  3M3Z B;  4ASK A;  5LMU T;  4DV0 T;  4L0R A;  4AKG A;  1OWA A;  4B3M T;  3O4X E;  5M4Y A;  2W62 A;  4ZI2 C;  4YHJ A;  4PAG A;  3QB5 A;  4CQI A;  5LOV E;  4YY3 T;  2WY2 A;  4IRE A;  2CHN A;  2LJL A;  3ETU A;  2N1G A;  1M62 A;  3UQ7 A;  2NW7 A;  2HN2 A;  2X51 A;  2BBJ A;  2LEH A;  2Y8D A;  2BKN A;  3RRW A;  4DMW A;  3C4Z A;  5EK4 A;  2KZ7 B;  2YU2 A;  3Q2M A;  1WLX A;  4DR5 T;  4UV8 B;  2MAW A;  4LMJ A;  2EHO C;  3UUN A;  3WI3 A;  4LF5 T;  4AKR B;  3I9Y A;  4DR4 T;  4IL9 A;  2XAJ B;  2CLY B;  2PFV A;  2D0T A;  3UFE A;  3D0T A;  2CRB A;  3N2O A;  3ONJ A;  4DV3 T;  4PW8 A;  2WZH A;  3T1H T;  1XMO T;  4OHF A;  4DBQ A;  2GK9 A;  3AE2 A;  3J7Y q;  4H9N C;  2UXC T;  4HWD A;  1WCR A;  1X9B A;  3P4W A;  2OLT A;  3RQW A;  5HXS A;  2V5C A;  2V7K A;  4IT4 A;  4CXY A;  4X1Y E;  2VKD A;  3FZH B;  2BVL A;  4CI3 B;  4PK6 A;  5JRE A;  4PK4 A;  2LOP A;  5JDQ A;  3U3I A;  3CX8 B;  1E1H B;  4DMV A;  3NZQ A;  4MLK A;  3RIF A;  2QVA A;  2XAG B;  2IW5 B;  2ES0 A;  4LF6 T;  3OYX A;  2A9U A;  4GIW A;  2YOE A;  5A1L A;  1SUM B;  1J1J A;  4HE8 A;  2UXD T;  4ZXL A;  4LFB T;  3SWH A;  1HX1 B;  2I59 A;  4HFI A;  3B57 A;  1XWM A;  3KV6 A;  4WZX A;  3RIU C;  4ZZC A;  2J47 A;  5LJM A;  3N2G E;  5L3C B;  1FEW A;  5FXZ A;  1ZKE A;  3SOL A;  5CB4 E;  2E2A A;  2JQQ A;  2H7O A;  3A5X A;  3PUA A;  2WB5 A;  1N34 T;  1MIW A;  2LSK A;  2W67 A;  3K3O A;  2VVN A;  4HFC A;  4KMC A;  3MAC A;  4TX5 A;  2XQA A;  2CE7 A;  4MBQ A;  2NW8 A;  2X9Y A;  4A5X A;  4AXP A;  5LMN T;  2M6B A;  2JQK A;  3UUL A;  4DV2 T;  4I43 B;  4GKJ T;  1HFA A;  5FNV E;  4GKK T;  3VR8 A;  3PU8 A;  1U5P A;  2RA1 A;  2X68 A;  3A8Y C;  4ILB A;  4JI3 T;  2C5J A;  3ZT5 A;  2BBH A;  2CM0 A;  3KDS E;  3N9Q A;  4H9R C;  3F31 A;  5JR9 B;  2XZE A;  1CHU A;  5F8P A;  2VKH A;  3C50 A;  5HEG A;  4F8H A;  4E7Z A;  5FKY A;  2LE8 A;  1XNR T;  4IDP A;  3LFM A;  4JYA T;  3RPU A;  3LSV A;  3ESL A;  2V6Y A;  5LBQ B;  3TLW A;  4EAH A;  4EZH A;  4U2Y A;  3I1A A;  5IWA T;  4LF9 T;  3NRX A;  1VCT A;  3CKD A;  3O1I A;  3ONL C;  4QXH B;  2D9D A;  3CIR A;  3TLU A;  2QYW A;  3ETV A;  4U33 A;  4EYU A;  5CFB A;  5FL1 A;  4GOU A;  4WBN E;  5HWX A;  1XMQ T;  2WU2 A;  2WM9 A;  4AIS A;  1L0V A;  1VOM A;  2FJB A;  3GWH A;  4JI2 T;  2XM2 A;  4MHC A;  3AEG A;  3GN5 B;  2WDQ A;  4NXM T;  5JTG A;  5CJ5 A;  3RC3 A;  3W15 B;  1J5E T;  3DTO A;  5AQS B;  4X64 T;  3EHZ A;  3EAB A;  4O4H E;  3ZCI A;  3P7I A;  4ZI3 D;  3EDV A;  3LK2 B;  3P50 A;  3RIA A;  4NUU A;  5J0Z A;  2LM9 A;  4U2Z A;  4TWF A;  2PG8 A;  1BR1 A;  4BA9 A;  2XQ5 A;  2J4G A;  5AQQ B;  3PUX F;  2IDO B;  3NKZ A;  5HXC A;  4K0U A;  5L3F B;  5JDL A;  3DP7 A;  1KFY A;  2I0M A;  3PUZ F;  1N33 T;  5JR9 A;  1ZEE A;  4YTM A;  4LFC T;  2BDE A;  5L3D B;  1D0Y A;  2LSJ A;  2XSB A;  3JC6 D;  4DO0 A;  1UCU A;  5CA1 E;  1WR6 A;  5EK3 A;  2LHN A;  3N9P A;  1HS7 A;  4AI6 A;  2VVS A;  1LVK A;  2V1D B;  2JQ9 A;  3FZF B;  4QX8 B;  3VR9 A;  4B6X A;  3QK6 A;  3V5S A;  4C91 A;  2NOX A;  2EHO B;  2V7M A;  2VK9 A;  3FB2 A;  2X0Y A;  2XAQ B;  1W0B A;  2W63 A;  2XTL A;  1VRB A;  1U4Q A;  1W9R A;  2D5U A;  2WU5 A;  4FJO A;  4O8S A;  4UEM A;  3RKO A;  5F3J A;  3PUQ A;  3N9L A;  2UUA T;  3VHL A;  3S4U A;  4NPP A;  2H88 A;  2WCA A;  4DID B;  3LDQ B;  5EZY E;  2C5I T;  2IAK A;  3PDY A;  5FXV A;  3BQK A;  3Q5E A;  5GON E;  5JVD E;  3RQU A;  3ZJ2 A;  3UUB A;  4JI7 T;  3AE8 A;  3C98 B;  2MYS A;  4U72 A;  4AQF A;  3FBZ A;  4QXC B;  3K1S A;  2HH7 A;  3T8O A;  4IHJ E;  2XJ7 A;  1QLB A;  2H3R A;  3T1Y T;  1UX4 A;  3C51 A;  4U7I A;  3TLS A;  4ZOL E;  1H7C A;  4TWH A;  3ZC0 A;  1T72 A;  3ZMZ B;  5LP6 E;  4X1K E;  2A72 A;  4KX6 A;  4ZI7 E;  2IHR 1;  4JI1 T;  4DUZ T;  4U7Y A;  2X0H A;  2V26 A;  3NVO A;  4KUM B;  5ABG A;  1EZ3 A;  4B3R T;  3VKH A;  3UUX B;  5JRC A;  3SRZ A;  2XAF B;  4EYY R;  3PE0 A;  2MOZ A;  2CBJ A;  4X20 E;  5FY1 A;  4ZZB A;  2BVM A;  3HL6 A;  3P4S A;  4IIJ E;  4AQF C;  3CQX C;  2VL0 A;  3ZN0 B;  2LLY A;  2HN1 A;  2ODU A;  4YLH A;  2IC9 A;  3G06 A;  3K3N A;  4YFS A;  4BAY B;  4AQG A;  5DAB A;  2WP9 A;  2Q9Q C;  4IE6 A;  4AKI A;  4CXX A;  1E7P A;  1LRZ A;  4DR3 T;  2J62 A;  4CN4 A;  5IYZ E;  4ISS A;  5HWY A;  2C0S A;  2UUC T;  4X1I E;  4QX7 B;  1HTJ F;  3PUY F;  2K48 A;  4LF8 T;  5KMG P;  4UR9 A;  3Q5X A;  4OYJ A;  3WAJ A;  2JQH A;  3KBU A;  4HTE A;  3HKE E;  4I0U A;  4PNI A;  5AQR B;  1T7S A;  4UF0 B;  2VUR A;  2MPK A;  3JAF A;  3P4R A;  5JR9 C;  5LHG B;  4GK0 E;  4TV8 E;  3ZEF B;  1D1B A;  5CGM A;  3ANW B;  5LXT E;  1UK5 A;  2FJE A;  4YJ3 E;  2WAU A;  4EIW A;  1NEN A;  3OYZ A;  1JNZ A;  2DL1 A;  2LSG A;  4ERR A;  5LGU B;  2P9B A;  3E0Z A;  1HX8 A;  3V5U A; 
#chains in the Genus database with same CATH homology
 4C90 A;  3OBV E;  1B7T A;  3I0O A;  3RYH E;  3VU7 H;  4H63 H;  5FY0 A;  3C4X A;  3N9M A;  3RH3 A;  2QGS A;  4EOZ B;  3AVR A;  2CXL A;  3CQC B;  3F57 A;  2EHO A;  3FXD B;  4CI1 B;  3AAE B;  2N9D A;  3ZYL A;  5JDF A;  4BJN A;  1O3X A;  1WYC A;  1WYB A;  3VKG A;  1NWM X;  3RYF E;  4ILU A;  2J1D G;  5JDM A;  3RC8 A;  3Q5W A;  4BJM A;  5EK2 A;  1D1C A;  4V1A v;  3J9X 1;  5LCY A;  5JDH A;  2XUE A;  4G63 A;  4H9O C;  1HG5 A;  4IST A;  1MND A;  3ZYK A;  5JQG E;  3AB3 B;  4H9Q C;  2MBG A;  2KIN B;  1V9D A;  3H3A A;  4CZZ B;  5L2L A;  3IBP A;  2DHR A;  4MAL A;  1KNZ A;  3EDU A;  2Y48 B;  2DWK A;  4KBM B;  5CA0 E;  3N5L A;  2E9X A;  2UXX B;  2WMN A;  3KV5 A;  3ZMU B;  2YIN A;  1MIY A;  3U78 A;  4UVA B;  2H7V C;  3BQI A;  2EHO D;  3ZC1 A;  5HYA A;  1AJ3 A;  1G8X A;  2CA5 A;  1D1A A;  2SPC A;  4CXW A;  3N9N A;  3HA4 A;  3CVR A;  3HKB E;  3KV9 A;  1QUU A;  2YEV C;  4M1P A;  2NTY A;  5FXW A;  2VKO A;  4ADZ A;  3NZP A;  4ZI3 C;  3FXE B;  2WSS V;  4O4J E;  2L3L A;  3LJC A;  1SHZ C;  5JRC B;  3ZN1 B;  3CQG B;  4XAX B;  2Z6E A;  3HKC E;  3O1H A;  3MKD A;  2X9X A;  3I9W A;  4Z8X A;  2V7L A;  3AA6 B;  3ZJ1 A;  4AKH A;  4I50 E;  3AA1 B;  5TAO A;  5J2T E;  3PUR A;  2E9X D;  2CWY A;  2G0U A;  4H63 V;  3WAK A;  3IHR A;  3CWZ B;  3AAA B;  2KWI B;  4ANJ A;  4JLE A;  2B1E A;  2W0G A;  2XAS B;  3RYI E;  2W00 A;  3B13 A;  4U74 A;  4P0B A;  4AKL A;  2JMH A;  1S35 A;  4G2A A;  3CPZ A;  4PJN A;  4ZHQ E;  1YW0 A;  4QXB B;  3C4W A;  2NP9 A;  5ADX L;  2E9X C;  2LT3 A;  1IAP A;  3LBX B;  5LNK A;  2JRK A;  3FBL A;  3KVB A;  3R84 B;  4KP3 C;  3LBX A;  5IHY A;  5J2U E;  4UXN B;  4H9P C;  4UF0 A;  4GYR A;  5JDN A;  1QSD A;  5E0O A;  3Q9D A;  5ETW A;  2K5B B;  4JUY A;  3HR0 A;  3KIN B;  4OK0 A;  4WNK A;  2DI4 A;  1LVF A;  3L3P A;  2KWH A;  4L9I A;  3H37 A;  4P09 A;  2JPF A;  5HXH A;  4UV9 B;  5FMN A;  2XAH B;  1WRD A;  3MZK B;  4WBO A;  2X67 A;  2ZM8 A;  4TUY E;  1MMN A;  2K9A A;  4EXT A;  1YKH B;  3MK7 C;  2NW9 A;  1D0Z A;  2C5K T;  3ZYM A;  4DVD A;  4GK5 E;  2LHR A;  2K24 A;  4H9S E;  3ONX A;  1FIO A;  2YU1 A;  5FXX A;  4PFP A;  1HCI A;  3F2E A;  1G73 A;  5LGT B;  2JJ9 A;  2ZLY A;  4NUV A;  2KXP B;  3SS1 A;  3KFW X;  1MNE A;  1MMG A;  1LKX A;  2E8I A;  3L09 A;  4O4L E;  4IE5 A;  3UT5 E;  2Q9Q D;  5L3G B;  2ACX A;  3CX7 B;  2HPJ A;  2V7J A;  1NAF A;  2RP4 A;  2D2S A;  4J2C A;  3GA8 A;  3IEE A;  4EZ4 A;  1HG2 A;  4I55 E;  2CXD A;  3AAI A;  3EUH A;  4IE0 A;  4ZI2 D;  3ZMV B;  2M67 A;  2CMR A;  4IDZ A;  1S94 A;  3I0Q A;  5KX5 E;  2WMO A;  4ZS2 A;  2V7I A;  3NRY A;  4I4T E;  3ZLI A;  2X66 A;  2KLQ A;  2NTX A;  3MXZ A;  4O2B E;  5LHH B;  4ZS3 A;  2ZM2 A;  3UUM A;  2DCF A;  4PFO A;  4QHO A;  5C8Y E;  3K3Q C;  2A2F X;  3R6N A;  3TKL B;  3UTK A;  4HEA A;  2VB6 A;  2QA7 A;  4TV9 E;  3RYC E;  4O2A E;  4XBF B;  2VL8 A;  5LJN A;  2L9Q A;  1YKE B;  1BR0 A;  3BK9 A;  3CML A;  1US7 B;  3FHN A;  2Q9Q A;  2CCQ A;  1ZHC A;  2DLR A;  2DNX A;  3NBX X;  3P8C D;  4HN9 A;  2MTQ A;  3ZMT B;  4DND A;  3O1J A;  4F6R C;  1MIV A;  3K8P C;  3KBT A;  1KK7 A;  2WWU A;  2OA5 A;  2L8K A;  2X9W A;  3JC6 C;  4CI2 B;  2HPL A;  4IE4 A;  2N2N A;  3E08 A;  2A3D A;  4PK5 A;  2CXF A;  1MMD A;  4YJ2 E;  2LOS A;  3AA7 B;  3QC9 A;  4O4I E;  3IF8 B;  2CLY C;  3PUG A;  4UIG A;  5H6Q B;  1HF8 A;  1YD8 G;  2DWG A;  3O9X A;  5DQW A;  4UEL A;  4A56 A;  4TZ4 C;  5DJQ C;  4HKA A;  4PJJ A;  3HKD E;  3AVS A;  3AA0 B;  2KMF A;  3ANW A;  1IJ5 A;  3KV4 A;  3PU3 A;  3EVY A;  4IGU A;  3GN5 A;  4GYS A;  1FMV A;  4QKN A;  5FP3 A;  2X9H A;  5J1G A;  3LK3 B;  5JH7 E;  1IJ6 A;  2D0U A;  4IE7 A;  1X79 A;  1D0X A;  2ODV A;  2LSY A;  5LA6 E;  2ZMA A;  3M65 A;  3RRC A;  4OFZ A;  5LHI B;  5HXR A;  1Y64 B;  2BZB A;  3BQL A;  2CWO A;  5BMV E;  5L3E B;  2VWA A;  5LGN B;  3MJX A;  4OYK A;  4FI5 A;  5FYM A;  2KND A;  1BR4 A;  2XHE B;  3N9O A;  2CEA A;  5L3B B;  5AFU L;  5FY7 A;  3N2K E;  2WBL A;  3QUJ A;  2Y6X A;  3PTR B;  2X0L B;  4MFR A;  4TN7 B;  3DJB A;  5HXE A;  5KDM C;  2PJQ A;  2YK0 A;  2ZM0 A;  5HAX A;  2JMK A;  3HI2 A;  3OKQ A;  4L5G A;  4EB6 E;  2PBI A;  4HGA A;  1ZV4 X;  4XZC A;  3C64 A;  2NWB A;  1MMA A;  2LSI A;  2IC6 A;  3ZMS B;  5JDG A;  5LBM A;  2VAS A;  2XQY A;  3CX6 B;  4N78 D;  3MA9 A;  4DBR A;  1SA0 E;  3OJA A;  4UVC B;  4UVB B;  1Z0P A;  5LG4 A;  2Q9Q B;  1T98 A;  3LG7 A;  4WW0 A;  1OXZ A;  1FMW A;  1BR2 A;  3PUS A;  3RX6 A;  4P0A A;  2E9X B;  4JEU B;  3ZPO A;  2W61 A;  4HFV A;  3GMI A;  3LK4 2;  5LYJ E;  1UX5 A;  2UXN B;  1IZN B;  4E7S A;  4QWN B;  5H6R B;  4JEH B;  4PJL A;  4PJM A;  5DQV A;  3E22 E;  1CUN A;  2KT9 A;  2VKJ A;  3KVA A;  3ZCJ A;  4ASK A;  4AKG A;  4L0R A;  1OWA A;  3O4X E;  5M4Y A;  2W62 A;  4ZI2 C;  4YHJ A;  4PAG A;  4CQI A;  5LOV E;  2LJL A;  3ETU A;  2N1G A;  2NW7 A;  2Y8D A;  2X51 A;  2LEH A;  3RRW A;  4DMW A;  3C4Z A;  5EK4 A;  2KZ7 B;  2YU2 A;  3Q2M A;  1WLX A;  4UV8 B;  2EHO C;  3UUN A;  3WI3 A;  4AKR B;  3I9Y A;  2XAJ B;  2CLY B;  2PFV A;  2D0T A;  3UFE A;  3D0T A;  3N2O A;  4PW8 A;  4OHF A;  4DBQ A;  2GK9 A;  3J7Y q;  4H9N C;  5HXS A;  4CXY A;  2V7K A;  4X1Y E;  2VKD A;  2BVL A;  4CI3 B;  4PK6 A;  5JRE A;  4PK4 A;  2LOP A;  5JDQ A;  3U3I A;  3CX8 B;  1E1H B;  4DMV A;  3NZQ A;  4MLK A;  2XAG B;  2IW5 B;  2ES0 A;  3OYX A;  4GIW A;  5A1L A;  4HE8 A;  3SWH A;  2I59 A;  3B57 A;  3KV6 A;  5LJM A;  3N2G E;  5L3C B;  1FEW A;  5FXZ A;  1ZKE A;  3SOL A;  5CB4 E;  2JQQ A;  2H7O A;  3A5X A;  3PUA A;  1MIW A;  2LSK A;  3K3O A;  4KMC A;  3MAC A;  4TX5 A;  2CE7 A;  4MBQ A;  2NW8 A;  2X9Y A;  4AXP A;  3UUL A;  4I43 B;  1HFA A;  5FNV E;  3PU8 A;  1U5P A;  2RA1 A;  2X68 A;  2C5J A;  2CM0 A;  3KDS E;  3N9Q A;  4H9R C;  3F31 A;  5JR9 B;  5F8P A;  2VKH A;  3C50 A;  4E7Z A;  2LE8 A;  3LFM A;  3RPU A;  3ESL A;  5LBQ B;  4EAH A;  4EZH A;  3I1A A;  3NRX A;  3CKD A;  3O1I A;  4QXH B;  4EYU A;  3ETV A;  4GOU A;  4WBN E;  5HWX A;  2WM9 A;  1VOM A;  3GWH A;  4MHC A;  3GN5 B;  3RC3 A;  3W15 B;  3DTO A;  4O4H E;  3ZCI A;  3P7I A;  4ZI3 D;  3EDV A;  3LK2 B;  4NUU A;  2LM9 A;  2PG8 A;  1BR1 A;  4BA9 A;  5HXC A;  4K0U A;  5L3F B;  5JDL A;  3DP7 A;  5JR9 A;  1ZEE A;  2BDE A;  5L3D B;  1D0Y A;  2LSJ A;  3JC6 D;  5CA1 E;  4DO0 A;  1UCU A;  1WR6 A;  5EK3 A;  2LHN A;  3N9P A;  1HS7 A;  4AI6 A;  1LVK A;  2V1D B;  4QX8 B;  4B6X A;  3QK6 A;  3V5S A;  4C91 A;  2NOX A;  2EHO B;  2V7M A;  2VK9 A;  3FB2 A;  2XAQ B;  2XTL A;  2W63 A;  4FJO A;  1VRB A;  1U4Q A;  4O8S A;  2D5U A;  4UEM A;  3RKO A;  5F3J A;  3PUQ A;  3N9L A;  3VHL A;  3S4U A;  5EZY E;  2C5I T;  2IAK A;  3PDY A;  5FXV A;  3BQK A;  5GON E;  5JVD E;  3ZJ2 A;  3C98 B;  4AQF A;  2MYS A;  4U72 A;  3FBZ A;  4QXC B;  2HH7 A;  3T8O A;  4IHJ E;  2H3R A;  1UX4 A;  3C51 A;  4ZOL E;  1H7C A;  3ZC0 A;  3ZMZ B;  5LP6 E;  4X1K E;  2A72 A;  4ZI7 E;  2V26 A;  3VKH A;  4KUM B;  1EZ3 A;  3UUX B;  5JRC A;  3SRZ A;  2XAF B;  4EYY R;  3PE0 A;  2MOZ A;  4X20 E;  5FY1 A;  2BVM A;  3HL6 A;  4IIJ E;  4AQF C;  3CQX C;  3ZN0 B;  2ODU A;  4YLH A;  2IC9 A;  3K3N A;  4YFS A;  4BAY B;  4AQG A;  5DAB A;  2Q9Q C;  4IE6 A;  4AKI A;  4CXX A;  1LRZ A;  5IYZ E;  4ISS A;  5HWY A;  2C0S A;  4X1I E;  4QX7 B;  1HTJ F;  2K48 A;  5KMG P;  3Q5X A;  4OYJ A;  3WAJ A;  4HTE A;  3KBU A;  4PNI A;  3HKE E;  4UF0 B;  5JR9 C;  5LHG B;  4GK0 E;  4TV8 E;  3ZEF B;  1D1B A;  3ANW B;  5LXT E;  4YJ3 E;  2WAU A;  4EIW A;  3OYZ A;  2LSG A;  4ERR A;  5LGU B;  2P9B A;  3E0Z A;  1HX8 A;  3V5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...