3RPUA

Crystal structure of the muke-mukf complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
309
Chain Sequence
TVPELVAWARKNDFSISLPVDRLSFLLAVATLNMSEGELVDAFRHVSDAFTIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
publication title The role of MukE in assembling a functional MukBEF complex.
pubmed doi rcsb
source organism Escherichia coli
total genus 106
structure length 309
sequence length 321
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpuA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rpuA02
5E17F 1QQIA 4L18B 5FGMA 5L3EA 3GZ5A 2RQPA 2QM3A 5E1WA 2FA5A 5BPIA 1XSXA 2VN2A 2W24A 3EQLF 2EB7A 2D1HA 4HF0A 4EJUA 2FEZA 1HW1A 1WRJA 2YSRA 4BYYA 1F5TA 3I58A 1JHFA 2L3DA 1ZARA 4M71A 3V8KA 3BJOA 1YTYA 1XCVA 5D6FA 3L7WA 1IF1A 2RN7A 3MQ0A 2LSOA 2JSCA 2C6YA 2QENA 3BJAA 4M72A 3VFZA 5HS7A 4UV9A 1FYKA 3MAJA 4HDVA 2OQRA 1J7KA 2FNPA 3BY6A 2HTJA 2FNAA 2KRFA 1YFHA 3O2PE 2QWWA 5E18F 3KP3A 2PLYA 3RI4A 5J8FA 5LHIA 1EH6A 3QAHA 4WWCA 1H0MA 1J59A 1XD7A 2CQKA 2IW5A 3GLXA 5E20A 2QQAA 1SD6A 3HRUA 1ZG5A 2YX7A 2DAOA 4XLPF 4KYWA 4H0EA 3RIRA 2EA2A 4K2EA 2ADUA 3LQRA 1H9TA 1FSHA 2XIGA 1OPCA 4OMZA 4YFXF 1J9IA 3V8JA 5J6XA 3ZMTA 1A04A 3P7NA 1FZPB 1T38A 4BHPA 2Z99A 1O57A 2MH2A 1J75A 4P9FA 2O6GE 2L4MA 1K78A 4I0BA 2P4WA 1HKSA 1RIOH 4R8HA 1UHWA 4KICA 1XMAA 1ZG1A 5BPDA 3JAMK 3V7SA 3QPHA 4IRHA 5AIPA 1MDMB 2KKOA 3GFLA 2EV5A 5ICGA 2OA4A 3QU3A 1CGPA 1T6SA 4IRGA 4ZYEA 2E1NA 3TOBA 4PCQA 1E17A 2XUBA 3GZ6A 2LNBA 2QQBA 3RYRA 2CGPA 2UXXA 4R79A 2HYGD 3IKVA 2ESNA 2AXLA 5H6QA 2VONA 3L2CA 3FZVA 1HQCA 4ZZDA 2FMYA 4MNUA 1FY7A 1Z05A 1STZA 2V79A 1R23A 4DQ2A 3LFKA 1L0OC 2ZMEA 4Q5SF 2JT1A 5DUKA 1BN5A 4EQQA 5CYVA 4QLCU 4JQFA 2ACJA 3U9GA 3CJNA 3P9CA 2F5EA 3F3XA 2YPRA 5DD8A 3SZPA 3FXUA 3TDUC 2KIFA 4KN4X 4RB1A 2X0LA 4U0WA 5ERIA 2HFHA 4P5OA 4O3MA 3M9AA 4FHTA 4LB5A 3C1DA 2KIUA 3WGGA 2NNYA 3KCCA 1O7FA 5L3CA 1TBXA 1FX7A 3FX3A 1FBSA 3F8FA 3IHUA 4R1HA 1KQ0A 2AS5F 1LB2A 4HOBA 2F5DA 2ETHA 1ODDA 3FXQA 3KEQA 2MC3A 1IW7F 2FQ3A 2W57A 5ICEA 4HF2A 2L4AA 4RAYA 4HQEA 4UV8A 2ISYA 1YIOA 4ZYHA 4ESJA 4D0PA 1S29A 5KVRA 4HF1A 4LK0F 3FHZA 5CJ9A 2VBYA 2P8TA 3EUHA 4RGXA 2GIVA 2QZ8A 2DO7A 3D5LA 2F5FA 2HGCA 2XAJA 2J5PA 2DT5A 1DPUA 4HV6A 5FFXA 4I09A 2FMLA 2P7VB 3R0AA 2HZTA 2DK5A 5HLGA 2HYFA 1KYZA 3WU0A 3DEUA 4I0AA 4ENNA 2DQRA 1LJ9A 3V7CA 2FF4A 1IAWA 2R7DA 3BPXA 1B9MA 5E1XA 1R36A 3RJPA 1FP1D 4JBAA 4ESBA 1KU9A 1SD4A 3ZN0A 4GGGA 4BHBA 3KP7A 4KDPA 1IXRC 2B0LA 2P5LC 4NQWA 4HV5A 3R6SA 1ZG3A 1JHHA 5FB2A 2IA1A 3LAPA 2UWMA 3RKWA 3CUQB 3ELKA 5ED4A 3LA2A 3P9IA 3T8TA 1G3WA 4A5MA 3TKYA 2RV8A 1ZLKA 4A2UA 1CF7B 4RGSA 1UHMA 3WG9A 4ZYGA 1VTNC 1FBQA 3ABTA 3LA7A 4IHTA 3DPTA 2HWVA 2Z33A 4CO8A 5A2QK 2M45A 3ZP5A 2V6CA 2K7LA 2FXAA 2YX4A 4UVCA 2W84A 2GWRA 2P5VA 4HX7A 3I59A 2DQLA 1RUNA 2DFIA 4EJTA 1QO0D 3K1MA 4Y17A 2XKOA 4Y13A 3CDHA 4S05A 5D5VB 3M8EA 3GWZA 3GW2A 1YQAA 1FOKA 1ZGJA 3WTVC 3M8FA 5HDNA 3F21A 5JR3A 1IN6A 1HSJA 1V4RA 1XGSA 4G94A 1HKTA 2D1VA 2E7XA 1UB9A 4WF2A 2PQ8A 3ERED 2EJRA 4LMYA 1FLIA 1W7PA 4RS8A 2RNJA 3HRSA 4L5IA 2GQQA 3VODA 1XB4A 2H27A 1G3TA 3ZMZA 4CHUA 4ZYDA 3RTRA 1PUEE 2G7UA 4HAMA 4IVNA 3HSFA 4M9SA 1T39A 3E6MA 3GYHX 2CSOA 4MQVA 2DK8A 2XAQA 5D8KB 2PJPA 4ON0A 1YW7A 5HDKA 1MGTA 4TV7A 3HSRA 5DV5A 1BI1A 1TW3A 4KNYA 4IJAA 4XLNF 3U2RA 1XCBA 2OBPA 3EYYA 1FYMA 1G3YA 4KIFA 2IJLA 1BC8C 4HX4A 2O03A 3JTGA 3QRFF 2XVCA 2GZWA 1O3SA 1R22A 1ZAOA 1B6AA 1FSEA 4KIGA 2HDCA 4RB3C 2JTVA 2QYOA 2Y0MA 5FO5A 1PP8F 2D2WA 5LRRA 1R1TA 1SMYF 4YG2F 1U78A 4CYDA 4EJWA 3COAC 1D3YA 4CICA 4WXDA 2EK5A 4EJOA 3JW4A 4L9VA 5LEJA 2VE9A 2HOEA 3ECOA 1TQPA 2V1XA 3IKTA 2XKPA 4MQ9F 3LQQA 1U2WA 2HR3A 3S2WA 3I53A 2M87A 4BNCA 5K5RA 2Z3YA 1JGSA 2K4BA 4Y15A 3IWZA 4KA4A 1SFUA 3BP8A 3FM3A 3TO6A 3LA3A 3TGNA 2NS0A 1R5GA 2XRNA 2ZFWA 5CVUA 1IUYA 3PQKA 3OV8A 4PDKA 4UVAA 5FFZA 1D5VA 4L0ZB 1XDUA 4FX4A 2V9VA 3WTSC 4Q4ZF 2K02A 3KP6A 2EV6A 3KEOA 4P55A 3FXRA 2NYXA 4GYGA 1ON2A 1J0RA 1B1BA 3CTAA 4YIFA 4FT8A 1B4AA 3LAJA 3WTZA 2CO5A 1KU3A 4N0BA 4G7ZF 1B9NA 1KYWA 2HQNA 3GF2A 4GYIA 1BC7C 3GVAA 1U5TB 2XHKA 1PDNC 2FBHA 2WV0A 2OU2A 3MZHA 3MEXA 4Q47A 4BAYA 1OYWA 4MEYF 5LEKA 2WTEA 4AIHA 2JRTA 3KP5A 1TNTA 1B59A 5D8LB 1TQMA 3ZMSA 4MTDA 5E8GA 3REOA 2IPQX 3RPUA 1ZN2A 3WTYC 1BIAA 3PFIA 2YR2A 4LG0B 5DCFA 1TW2A 3M7GA 1IZ1A 1FPQA 4AWXB 1Q1HA 2BEOA 2FSWA 3K0LA 4N9HA 1UFMA 1FYLA 2P6SA 5LLQA 5DEQA 4I98B 3F6VA 2E1CA 3ZMDA 1LEAA 2ZBKA 1IXSB 4A5NA 4A0ZA 5L3GA 3AAFA 1KQ8A 3L09A 4L9TA 3EYIA 3WE3A 1TTYA 4ZZLA 2HKOA 1S6LA 2Z5UA 2DLLA 3VOEA 2R3SA 3BDDA 3E5QA 2A6EF 2IT0A 2IA0A 2MBFA 4EM0B 4KN7X 5A2QZ 2XAFA 4UVBA 3C18A 4IPAA 4BXUA 1ZYRF 3WU1B 3BZ6A 2PBIA 2X4HA 1J2XA 2VC0A 2NRAC 4RB0A 3J80K 5HLIA 4GCVA 3FMRA 3KFWX 4A0YA 2K4JA 1OYYA 1T0FA 5E1ZB 4LG0A 4LB6B 3HOTA 2VT2A 4N9IA 1IN8A 5JI6A 2VBWA 3F22A 3VB2A 2A61A 1U3EM 4B8XA 1MJ9A 5HLHA 3E97A 4WX9A 3HOSA 1DUXC 5F1RA 3TO7A 2E7WA 4BHCA 2XAGA 1MDMA 4YIIA 1P4XA 4CXFA 4WCGA 1R1VA 1USSA 1MD0A 3NRVA 2PG4A 1WWXA 3WGHA 4A6DA 2IVMA 3CUOA 1BI3A 4HQMA 1QNTA 1REPC 2R7FA 4FX0A 1PP7U 3ZMUA 2OQGA 4KT5C 1QZZA 6PAXA 2EWNA 2VE8A 2PN6A 4Q48A 3IRQA 1LVAA 1Z1DA 1O3TA 3JSOA 2W25A 3GFMA 5DYMA 2A68F 2VT3A 1SD5A 2PMUA 2XROA 2XASA 3FMQA 5TRDA 2STWA 2XGXA 3B73A 4EMSA 1D8KA 2Q0OA 2COMA 2FOKA 4JK1X 3QOPA 3Q9SA 2EFQA 2EA4A 4EM2A 1FBUA 3E6CC 1BJAA 3DXJF 1R00A 3K1NA 3WTTC 1ZRDA 4WK8F 1ZH5A 4HX8A 1KGSA 4I02A 5FLXK 2CWEA 1EH8A 4EVIA 2QBYB 2EFNA 4NHJA 1S3JA 4UHTA 1BM9A 3TQNA 2BBYA 3RKYA 3Q9VA 5L3DA 3T8RA 2P7CB 1XMKA 2H94A 5F6FA 3BOQA 2RGVA 4OIRF 3MZYA 4CGZA 4LLLA 4P9UA 5ILUA 3ZMVA 4BH9A 2UXNA 1HBXG 3N97A 2ZKZA 1U8RA 1ZHFA 1TQIA 3I5UA 3WE2A 1Y0UA 1O3RA 1K7AA 1TLHB 3BJ6A 4ZH4F 1YLFA 2IP2A 3PQJA 3V8LA 2IA2A 3SFZA 3HRTA 4ESFA 3B02A 3G3ZA 2DU9A 3IWFA 5CVJA 3ECHA 3ML6A 1WSUA 1HSTA 2G7HA 4QWQA 4G8XA 4U88A 3IC7A 2Q8KA 2LF8A 3DF8A 1V3FA 2QBYA 2JPBA 4UXNA 1HKQA 3I54A 2GAUA 2VC1A 3WGIA 5LGTA 1IXCA 1LQ1A 1ZRCA 3J7AO 1P4WA 4KIBA 1FNNA 1E2XA 3NQOA 1WQ2A 3HYIA 1OYIA 1S7AA 4L9NA 4EJVA 2A3SA 5IT9K 2QUFA 4UUVA 1R1UA 5FD6A 3ZQ7A 3F8MA 1USTA 1W7PD 1AOYA 3CUQA 4Z2YA 4GO1A 5DCMB 3T0YA 2MH9A 2P5KA 4ENMA 1BIBA 3W6JB 3T1BA 1CF7A 4A6EA 2RDPA 3JAMZ 3ZN1A 3FWEA 4AD9A 3KLNA 5DUIA 3E5UA 1X3UA 1SAXA 2ELHA 1MZBA 3ISPA 4A0XA 2K86A 3EETA 4RB2C 1YW8A 4WXHA 4KMFA 2KJCA 4YFKF 5LRSA 2PI0A 3F6OA 3BROA 5H20A 1IRGA 4I01A 2DPUA 4MTEA 4CZZA 3MWMA 1F4KA 5ICFA 3J81K 5JFRA 5BQTA 3ROUA 1FWZA 3GFJA 4PZJA 3DQVC 3J80Z 2ZJ2A 1FP2A 3V7RA 5DDGA 5DD4A 1G3SA 4XSZF 1KU7A 4G6DA 3R0JA 3GFIA 4CDGA 2UZKA 1EV7A 5DCMA 3OOPA 2LKPA 2ISZA 3NEUA 4LK1F 2NAZA 4XSXF 4G7HF 1XGOA 3E6BA 1AWCA 2VBZA 1JE8A 1J5YA 3K1PA 1LDKB 4U7DA 5CVVA 1DDNA 1XGNA 1W5SA 5HOOA 1P92A 2MD5A 4KUMA 5D5WB 3CO6C 3G73A 5EEHA 5F64A 1R58A 3D0SA 2RVCA 3HHGA 3R61A 2ZNYA 5K1YA 4HYEA 1Z7UA 4U0YA 1BI2A 1Z9CA 2HS5A 4OIQF 5HDGA 3HHHA 1SFEA 3HTSB 1YG2A 2CFXA 3W6KB 4HW0A 1OMIA 1P4AA 2STTA 1YS6A 2A6HF 2PMHA 4OOIA 1SFXA 2O0YA 2Y75A 4S04A 2VOPA 3H3UA 3WTUC 3TOAA 3HTUA 1GXQA 1LDDA 1Z6RA 1D8JA 4F7ZA 1OKRA 3RDIA 2HEOA 1K78B 4KMUX 3FF5A 4PGGA 1C0WA 3C3WA 2GXBA 1F9NA 4B09A 2NNNA 1ZLJA 2P6TA 1S8NA 2OZUA 2BV6A 4P96A 1F1ZA 3HRMA 4IXAA 4AIJA 4M6YA 5J8CA 1YS7A 4L9JA 1ON1A 3K69A 5FLXZ 1W4MA 1ONVA 1ULYA 4M74A 3MFKA 3SHFA 1HW5A 3L00A 3KLOA 3EDPA 1ZREA 3R60A 1U6GA 2VXZA 2XV4S 3VEPA 3K9TA 4LLNA 2BYVE 2HTSA 5HS8A 1DP7P 1IN7A 3HSEA 3E5XA 4G9YA 2GA2A 3F23A 4LGWA 4HLYA 2ZMEB 4RAZA 2M30A 4ENJA 5KK1A 3GO5A 2RKHA 1RUOA 5ILVA 1K79A 2TDXA 3C7JA 4IHSA 4HA8A 4I7HA 1U5TA 4UNOA 3KZZA 3H3ZA 2V1UA 4OINF 3BPVA 3KP4A 3ULQB 3IL2A 5L3BA 5BOXA 5FD5A 4WXCA 1TNSA 3SZTA 1T2KA 1ZRFA 3HUGA 1YW9A 1BI0A 3I64A 4M73A 5LBQA 1SD7A 4IF4A 3ABUA 1DPRA 2YU3A 2EFWA 2M8EA 3P9KA 2DTRA 5K5QA 1SMTA 5E8IA 4L5JA 2M1BA 3V4GA 4NB5A 2DI3A 3SXYA 2HQRA 1XN7A 3F8NA 4OIOF 5IT9Z 3F72A 4RGUA 5JVTA 5EEGA 4AVPA 4MGRA 4GXOA 3DKWA 3GXOA 1FT9A 1W5TA 4DNCA 3JSPA 2L01A 1R7JA 2KIMA 2V1DA 4LFUA 2O61A 1O7LA 1OR7A 4LJZF 3CUQC 2FE3A 5CVIA 1P2FA 1O3QA 2XAHA 1LNWA 4M6XA 2J5OA 3O6BB 2MA3A 3LWFA 3E6DA 1BOAA 3CLOA 3DV8A 3F8CA 5HS9A 3KETA 3I71A 3BWGA 1HW2A 1IN4A 3I4PA 4BQAA 2M5WA 1QGPA 2ZXJA 4U0VA 3KZYA 2EV0A 3RYPA 1RNLA 3E3VA 5CVRA 2G9WA 3J81Z 1KA8A 1I5ZA 3SQNA 1I6XA 4E70A 3GEZA 2DW4A 3L9FA 1LDJA 3QU6A 2Y48A 5AIQA 1L3LA 2EFOA 3R4KA 2H09A 1I27A 1QZYA 2OAZA 5BS6A 3KE2A 2A5YB 3DFGA 2H6CA 2ZCWA 1GHCA 4EV0A 3I0TA 1Z6TA 2OZ6A 4LLGF 4ETSA 2ZNZA 2VBXA 3F8BA 2FU4A 5K5OA 2ESHA 3DP7A 3M1EA 2FRHA 5AONA 2IRFG 4G7OF 5LGUA 2RC4A 3GUDA 2K27A 4OU0A 2QQ9A 4EM1A 4EGZA 5ILSA 3Q5FA 4G6QA 1MKMA 1RI7A 3MCZA 2CG4A 1YO5C 5TJJA 4U7BA 3I59B 1Z91A 3U1DA 1BBYA 2F5CA 5H6RA 1GXPA 1LEBA 3WTXC 3QP5A 1XSDA 4XBFA 4AIKA 4MEXF 2O8XA 5L3FA 2ZO4A 1XDSA 1FC3A 2LF7A 3T5XA 1HXDA 2FBIA 2JZYA 2GXGA 1XGMA 2LDUA 4YFNF 2QVOA 1W7PB 1XSVA 2MLKA 2QLZA 1K6OA 5CLSA 3RKXA 3ZPLA 3KP2A 2KJBA 4L0YB 2A07F 5D5UB 2DBBA 3CO7C 2HKXA 4M9XA 3O3KA 5HVQC 4XRFA 2W85A 3DPLC 2Z9OA 3WTWC 5JHUA 1G6NA 3N4MA 5ICCA 2EFPA 1R5HA 3FMSA 1RZ4A 4HDUA 2A69F 1KU2A 3H92A 2VODA 1QBJA 4LD5A 3FM5A 1G4DA 5IT3A 1I1GA 2WC2A 3QP6A 4HZFA 2GA1A 5D4RA 4M9ZA 2VOOA 4O5VA 1ZGAA 4IRIA 2BGCA 2L54A 1WKMA 2BE5F 2H6BA 1MJBA 4RGRA 4A12A 5D6EA 3TDZC 3LSTA 2MLGA 2PFBA 1IN5A 2DPDA 1JXSA 3HIFA 4ASNA 4OMYA 4HBLA 5D5XB 4HLXA 2FBKA 4O6JA 3K2ZA 5LHHA 1MJAA 1WI9A 4ENKA 1U5TC 2OD5A 2D45A 3QPTA 1NHAA 3TO9A 2Q2EA 4I2OA 1IRFA 1GVJA 1YYVA 2PEXA 3GX4X 5BMZA 2CW0F 4KFCA 3IRRA 1S7OA 1H9GA 2CYYA 5LHGA 1KQ9A 2O3FA 1P6RA 2WWYA 4OIPF 4EGYA 4PGHA 1UCRA 1EH7A 4MHGA 3JTHA 5LGNA 3RPQA 1T98A 1I1SA 5D4SA 2F2EA 1QPMA 2L02A 2JPCA 3WODF
chains in the Genus database with same CATH superfamily
3RRCA 5E17F 1QQIA 4II2A 2PTFA 3S4UA 2K9NA 4PJLA 4L18B 3IV5A 4CI3B 3A8YC 5FGMA 2ICWG 5L3EA 1XNRT 2IAIA 4LF9T 3GZ5A 2RQPA 4M3DA 1WJCA 5J40A 3PUQA 3QC9A 3G4SI 2XF7A 3CCQI 5LHIB 1KNPA 2NR4A 2QM3A 5E1WA 2FA5A 2HZDA 2FJAA 1WPKA 3C50A 3LFMA 4X66T 5BPIA 5HWXA 1OR7C 2W00A 2NW8A 1XSXA 1WLXA 2VN2A 2W24A 2D9DA 4UUSA 3EQLF 2EB7A 2BZBA 3RKOA 4MLKA 2D1HA 4HF0A 2XAUA 4WYVA 3I4NJ 4CN6A 3A0HC 4EJUA 2X9XA 1OCZH 5HLTA 4LF4T 3S1QJ 4ZTFA 5DM6F 2FEZA 3FIWA 4U2ZA 3RF1A 1HW1A 3OIOA 2IS1A 2BBJA 2IIUA 2YU1A 3RIFA 1WRJA 2YSRA 4AIUA 4EGWA 4BYYA 3ZLIA 4F55A 4BEHA 1F5TA 3I58A 3N2GE 4QH4A 5LCYA 1JHFA 2L3DA 5M3FJ 1VFCA 1ZARA 4M71A 1B8IB 2QYWA 3V8KA 3BJOA 1YTYA 5C3EJ 4ZS3A 3CQGB 2K9QA 3CQCB 1XCVA 4TUYE 5D6FA 5AQHB 3L7WA 2Q9QC 2V7KA 4DV1T 3HJEA 1YKHB 3ZMSB 1IF1A 5LOVE 3UU5A 3E08A 2W66A 2RN7A 3MQ0A 3A01A 2LSOA 2JSCA 2C6YA 2QENA 2X6XA 4IL4A 4RA2A 3LG7A 2DFHA 3DU5A 5FRNA 2YK0A 4NPPA 4YFSA 3BJAA 2VWAA 4M72A 1POGA 2BXYA 2ODUA 3VFZA 5HS7A 3Q9DA 4HWCA 4A3FJ 1VQLI 4UV9A 4DUZT 3RQ4A 5B1AH 5FL0A 2K9SA 3BQYA 2PX9A 3MAJA 3ZQIA 1FYKA 4HDVA 3O8HA 1I50J 2OQRA 2MFZA 2R93J 2X1DA 1W0BA 1J7KA 1FMVA 1WFXA 3KYCB 1QZEA 2FNPA 2HTJA 2FNAA 3BY6A 2KRFA 2IDOB 5AQPB 3VDXA 2WY8Q 5J1RA 2E2JJ 1IJ6A 2XGCA 2OTLI 5AQMB 3HKCE 5LA6E 4EOZB 1S9HA 1PYVA 3O2PE 4D1QA 1RESA 2QWWA 1YFHA 2V6YB 4HFIA 4O4HE 4DV3T 3KZIC 2RPAA 1Z7LA 5E18F 2FJDA 2L8KA 1ETWA 5JDLA 3KP3A 2PLYA 5HEHA 1KNRA 1SHZC 3RI4A 1VCSA 5J8FA 5LHIA 2GM4A 1EH6A 2OCCH 1X3ZB 1ETKA 2DA2A 4CXYA 2DCEA 3QAHA 4WWCA 3P50A 1H0MA 4H4KC 1J59A 4QTRA 1XD7A 2WV1A 3C4ZA 4CCKA 2CQKA 1MW7A 2IW5A 3GLXA 5E20A 3AAIA 3AVSA 2QQAA 1SD6A 1X4OA 3HRUA 3CMYA 1ZG5A 2D0TA 4ZI3D 2YX7A 2DAOA 4XLPF 1UG0A 1SVOA 1K61A 4C9YA 4KYWA 3RC3A 2MD0A 4H0EA 3Q5DA 3AEAA 3WI3A 3RIRA 2ODVA 3CX8B 5JDGA 3CCVI 2HOSA 4NXNT 2EA2A 2UXXB 2VVNA 4K2EA 3BLYA 2ADUA 2XAFB 3ESWB 2E9XD 3LQRA 4UVBB 2K9AA 1H9TA 1OEDC 1FSHA 2XIGA 5HXCA 3ZCIA 1XDPA 1OPCA 4OMZA 1B8IA 2BY3A 3LFUA 4YFXF 1J9IA 2E1OA 4YTMA 3V8JA 5J6XA 3ZMTA 4HKAA 4CXWA 1A04A 1K6YA 3P7NA 1FZPB 2D5VA 2X6WA 1T38A 4BHPA 2Z99A 3F0CA 1O57A 2LOPA 2NOXA 2MH2A 1J75A 2BY1A 3R6NA 4YRVA 4ZS2A 1JJ6C 4P9FA 5LYJE 2O6GE 3RH3A 3T1YT 2L4MA 2LHRA 1WCMJ 4LIVA 1K78A 4H63V 1X58A 4I0BA 2O8KA 2P4WA 1HKSA 1RIOH 1Z3YA 4E7JA 3W6VA 3VYSB 1CQTA 4DW6A 3U3IA 3BTIA 2V7FA 4R8HA 2CV2A 3N5LA 4U33A 1UHWA 2YDSA 3KDSE 4KICA 1JT6A 3J7Yq 2VQFT 1XMAA 1ZG1A 3WHBA 2BBHA 1AJ3A 5BPDA 1YQ3A 3G1MA 4XOTA 3JAMK 1KF6A 3V7SA 2V6YA 2RNGA 3Q0WA 3M3ZB 3QPHA 2QKLB 1XS9A 1ITYA 4IRHA 1MIYA 2X0HA 2XAGB 5AIPA 1MDMB 2FJ1A 2JQQA 2YU2A 2KKOA 3I0OA 2OUMA 3GFLA 4NUBA 4NUVA 4QPQA 2EV5A 5ICGA 2B76A 5FL1A 3HOWJ 2ME0A 1JKOC 2OA4A 3QU3A 5AQVB 5J1UA 3AEBA 1CGPA 4EAHA 1T6SA 4IRGA 4ZYEA 3H5AA 2E1NA 4EYYR 3O1IA 3TOBA 4PCQA 1E17A 4TN7B 3UU4A 4BY7J 2XUBA 2CQ7A 4KT6A 3GZ6A 4X20E 1UJ8A 2LNBA 2CJJA 3B57A 2QQBA 2W0GA 3RYRA 2CGPA 1SANA 3B6CA 1A5JA 4Z91A 2UXXA 4R79A 4YHJA 2HYGD 3IKVA 2ZJPF 2V7IA 2ESNA 1WGXA 1KK7A 2AXLA 1HS7A 5H6QA 3AECA 3KVBA 2VONA 3V42A 2CUJA 4XK4A 1X1DA 4NBQA 3L2CA 1OQYA 3UU8A 2XGEA 1HQCA 3FZVA 3JREA 1HFAA 4ZZDA 4DV2T 2MBGA 3S17J 2FMYA 4EEFG 5K7FA 4MNUA 5LXTE 2WM9A 3CDLA 1FY7A 3M1CA 1VRBA 2JMHA 1Z05A 3M65A 1STZA 3PE0A 4H9RC 3VR8A 2W61A 3PIOF 4XMYA 3H3MA 3PU3A 2V79A 1R23A 2PMZN 5F04A 1FEXA 1ZOYA 2Y9YA 4JEHB 4DQ2A 2IXSA 3LFKA 2C0SA 3OOUA 2WP9A 1L0OC 2G0UA 5BR8T 2ZMEA 1N75A 4Q5SF 2JT1A 3JAFA 1ZKGA 4YTNA 2PMZA 4X1EA 5DUKA 1SVMA 2BG9E 4TNWA 3C4WA 4IREA 4UV8B 4BJ6C 3SWHA 2Z2SB 1BN5A 4EQQA 4E7KA 4L5EA 5CYVA 3PTRB 4QLCU 4JQFA 2ACJA 3U9GA 2BKNA 3CJNA 3P9CA 2E5ZA 4H9PC 2K5CA 3EVYA 3JRFA 3AE6A 1BR4A 1NENA 2XASB 3PJAA 2F5EA 2QQ8A 3CQZJ 3F3XA 1TC3C 5EK3A 1VF9A 3G1OA 2YPRA 3OYMA 5DD8A 3SZPA 3H3AA 1JNZA 1VQPI 2CA5A 3FXUA 3IHRA 2NP9A 2VJ5A 4M3EA 3TDUC 4UUTA 5A1LA 2LRDA 2LSIA 3IEEA 1E3OC 2KIFA 4RLFA 4TNVA 4KN4X 3OYXA 3HKZN 4RB1A 2X0LA 4RLQA 3MKDA 4U0WA 5ERIA 4HWDA 3PU8A 2HFHA 2PFVA 4Q25A 4P5OA 1FIPA 3IP4B 3OYAA 3AE9A 3BQZA 3M9AA 4FHTA 4LB5A 4O3MA 3HKZA 3ONXA 3C1DA 2KIUA 1NK3P 3WGGA 2NNYA 2IHR1 2Y6XA 3KCCA 2LM2A 2UXBT 2DOAA 3L2RA 1O7FA 2W62A 5JREA 5L3CA 3BZCA 3DTEA 2DLRA 1TBXA 2R5ZB 3HOVJ 2WBMA 3E22E 3KV4A 1OLTA 2E5VA 2Q9QD 4BJ5C 3OVUA 1M1EB 3TW6A 1VQ8I 2GLOA 3Q5WA 4MFEA 2YDRA 1X1CA 4MIMA 3QYBA 4GKKT 5B66C 2M7BA 1FX7A 2DFEA 3P4QA 3UFGA 2EZKA 3FX3A 1FBSA 3FXKA 3M3YJ 3F8FA 3K7AJ 3CD6I 3UU6A 3IHUA 3JCFA 4DOZA 1J1JA 2HDDA 3ESLA 5JDQA 1T8IA 4R1HA 4C3JJ 5EJCA 3QNUA 1V9DA 1MMSA 1RPWA 1KQ0A 4LFAT 2O9LA 2AS5F 2IC9A 1LB2A 4DO0A 4HOBA 2F5DA 4JI3T 3Q3SA 4HFEA 1R5ID 3QK6A 2HOAA 3G6EI 2ETHA 1MNEA 1ODDA 3FXQA 3KEQA 3JRCA 3VRAA 2MC3A 1IW7F 4U3CA 2FQ3A 2DMUA 3HXLA 1IAPA 2WSSV 2W57A 4KJZA 5ICEA 4TWFA 4HF2A 2L4AA 4RAYA 5EYRA 4HQEA 4UV8A 2ISYA 4EZ4A 2LYCA 1YIOA 2AQEA 4ZYHA 2IC6A 2CLYB 3FKIJ 4L9IA 4XZCA 4X64T 5AQKB 4MFRA 4U74A 3ZMVB 2OV7A 4NQWB 4ESJA 4JUYA 4O8SA 3ZQGA 4D0PA 1BA5A 1S29A 3DJBA 2WQYA 5KVRA 1YHQI 1HCRA 3JRAA 1U9OA 3VSLA 3CCRI 4HF1A 3I9YA 4LK0F 2DA1A 3FHZA 4U2YA 5CJ9A 3I3LA 3C4XA 4E7SA 5F27A 2KLQA 3GN5A 4HNUA 3HOZJ 1WYBA 4QH5A 5IYZE 3OYIA 3JCUC 4AI6A 2VBYA 2P8TA 3LSHA 5EK2A 2EHOC 3EUHA 4RGXA 4KP3C 2VQLA 4PSWA 3K4KA 1K83J 2V4JC 1LPQA 4QH1A 1R4MB 3IUOA 2CXDA 3Q2MA 3A7MA 3BTJA 3RIAA 2GIVA 2QZ8A 2DO7A 2K3FA 3D5LA 4P1WA 2WMNA 4F93B 3GMEA 5FKMA 4P09A 3A1YA 2G0EA 3KX2A 1WR0A 2F5FA 2HGCA 2OV9A 2XAJA 4BJTA 5J47A 2J5PA 3C2GA 3PNYA 2DT5A 4QSHA 3AA7B 3OS1A 2XJ7A 1OCTC 3ZQCA 1DPUA 4HV6A 5FFXA 2ZM8A 3FZMB 4BBSJ 4I09A 2E1MC 3NRXA 2FMLA 2P7VB 3R0AA 4B43A 2HZTA 5E3MA 3FBNB 2R5ZA 4BDZA 3AAEB 5AQJB 2Z6EA 1HOMA 2DK5A 3PUAA 2ZM2A 5HLGA 2X51A 1S35A 2HYFA 1KYZA 3WU0A 3KEYA 1MBKA 3PJRA 2JRMA 2Z16A 4I99C 3PUWF 4ZZCA 1N36T 1JGGA 3LK2B 3DEUA 4I0AA 4ENNA 2DQRA 1LJ9A 3V7CA 2QRXA 2FF4A 1P7IA 1IAWA 2R7DA 3BPXA 2DA7A 2FD5A 3KBUA 4GYSA 3MACA 1B9MA 5E1XA 4V2FA 1R36A 1JUMA 2IUBA 1VNDA 3RJPA 1QRYA 1FP1D 2LY9A 4JBAA 5AQRB 4ESBA 2PG8A 3C64A 1O3XA 2HQ5A 1KU9A 1SD4A 3H0GJ 2KDZA 3QB5A 2WZHA 4IE4A 5CA1E 2JQ9A 2E35A 3ZN0A 4Y52J 4GGGA 3PUFA 4BHBA 3L8RA 3SS1A 3GWHA 3KP7A 4KDPA 1I94T 1IXRC 3S1RJ 2LOSA 4CI2B 2B0LA 4CSWA 3PUXF 2P5LC 3DWLE 4NQWA 4P0BA 4HV5A 3R6SA 3PSFA 1ZG3A 3AB3B 1BL0A 1JHHA 1D0ZA 5FB2A 2IA1A 3HI2A 2WWVA 4BXXJ 1HNWT 5IOZA 2M0MA 3LAPA 3KV5A 2UWMA 2JPFA 2KL4A 3RKWA 3CUQB 1VZ0A 4OYKA 4YEJA 3ELKA 4JP0A 3LSVA 4NXMT 2IGNA 5ED4A 3LA2A 1YJWI 3P9IA 3T8TA 1G3WA 4A5MA 4AQYT 5JRCA 4D7MA 1RR7A 3CX7B 3TKYA 2RV8A 3TLWA 2NW7A 5K7ZA 1ZLKA 2LY1A 3AKZA 4A2UA 2KSRA 2EIMH 2VJJA 1CF7B 4RGSA 4HNVA 1A35A 3RGLA 4DR3T 1UHMA 3ZQFA 3ZKRA 2BXZA 3WG9A 4ZYGA 3ZXSA 1VTNC 1FBQA 1K4SA 1FTZA 2QGSA 2CW7A 2KQRA 3OYBA 5L4EA 3ABTA 3LA7A 4IHTA 3DPTA 2HWVA 2Z33A 4IE6A 5KX5E 2R7XA 4HFHA 4XLFA 4PJ0C 4CO8A 5HNHA 5A2QK 2B9SA 1HF8A 2XAQB 5ABEA 1EA3A 2A2FX 5HXHA 2M45A 4EYUA 3ZC1A 1X2NA 2OJED 4PK4A 1YJNI 2CE7A 4JBWF 2JRKA 5FVLA 4J01A 5JVDE 4LF7T 3L2QA 3ZP5A 1GT0C 2V6CA 2K7LA 4MO7A 2FXAA 2YX4A 2V5CA 1SA0E 3BQKA 4UVCA 2W84A 4A3KJ 2ID3A 2GWRA 2P5VA 4HX7A 4KHPT 3I59A 2BZTA 4ASKA 5ETWA 2LBFA 3S2DJ 2DQLA 2DMQA 3CMEI 4DV4T 1RUNA 3CKDA 2CXFA 2DFIA 4EJTA 3EHZA 1QO0D 3BR5A 2HU9A 3K1MA 4Y17A 2XKOA 4Y13A 4XKCA 3CDHA 4FCYA 4S05A 2ZMAA 5D5VB 4K0KT 3M8EA 2CEAA 3GWZA 3GW2A 1YQAA 1FOKA 4IDZA 1ZGJA 5JQGE 3WTVC 3M8FA 1N34T 5HDNA 3F21A 5JR3A 4IHJE 3ZT7A 2A3DA 3DBHB 1IN6A 1E7PA 1APLC 3MJXA 2QSFX 1HSJA 1V4RA 1VOMA 4A98A 3GTJJ 1XGSA 1UX5A 4G94A 5LP6E 3LMMA 1HKTA 1ACIA 1XX5A 2D1VA 2E7XA 1UB9A 2R7OA 2PQ8A 4WF2A 3PM1A 2EJRA 4CCLA 3ERED 4LMYA 4A3IJ 1FLIA 1W7PA 2Y31A 4RS8A 4F3QA 1OEDE 2RNJA 2Z1DA 2EZIA 3HRSA 2DDAA 4L5IA 5DQWA 2GQQA 5DQVA 2YOEA 2E19A 2J1DG 4AKIA 4GKJT 3VODA 2YINA 4OAZA 2JMWA 1XB4A 2H27A 1G3TA 3TBIA 3VWBA 1QVUA 5IWAT 3ZMZA 2KP6A 4IDOA 2FQ4A 2HPMA 1FMWA 1S5LC 4CHUA 2DWKA 4HN9A 1FOYA 4ZYDA 2Y30A 3N05A 3E7LA 3RTRA 1PUEE 2G7UA 4HAMA 4IVNA 2BOLA 1WR6A 4HWIB 2MGQA 3HSFA 4M9SA 4EATA 1TWCJ 2EZLA 3AL0B 2IS4A 1T39A 3E6MA 3GYHX 3ZQLA 1JTYA 2CSOA 3BC8A 4DV5T 4MQVA 2IGOA 4ZI2C 3RLFF 2DK8A 2XAQA 5D8KB 2PJPA 2HYJA 2XQ4A 4ON0A 2KISA 2L9SA 1YW7A 4QKNA 4YJ2E 5HDKA 4FETA 4WBOA 5GAEJ 1OJLA 1MGTA 4TV7A 4WW0A 2UU9T 3WHCA 4JLEA 3VYRB 3CVRA 2BW3B 3HSRA 5E3NA 1IRXA 2R7QA 4QHOA 5DV5A 4A56A 1BI1A 5F0HA 4XN0A 1TW3A 3CQXC 3OSFA 2LM9A 5F5WA 2PJRB 1NG7A 4KNYA 4IJAA 3MZKB 2LTPA 4JI1T 1PJRA 2ECBA 4XLNF 3U2RA 4XICA 5HNFA 2K5BB 3AA0B 1XCBA 2OBPA 1LVKA 3EYYA 2LREA 2VQGA 4DR1T 3LL7A 2R7UA 5LFAA 1FYMA 1HX1B 3T8OA 1G3YA 4KIFA 2N1GA 3PUGA 2IJLA 3S3MA 3ERMA 2YKSA 1D1BA 1BC8C 3RIUA 3DEWA 4HX4A 4KITB 2O03A 3AXJA 4UVAB 4AQGA 5LJNA 2DA3A 1OFCX 3JTGA 2QA4I 4JOMA 1AU7A 3JADA 5TAOA 4MBQA 2V9PA 5F0CA 1TZLA 4J19A 3QRFF 4DUYT 2XVCA 1E3HA 2GZWA 1O3SA 4EB6E 1R22A 1UCUA 4B6XA 4WBNE 2CPTA 4GDFA 4DV6T 1ZAOA 2LSKA 1UGOA 1B6AA 3ZCOA 4ZI7E 3UTKA 1FSEA 4KIGA 2L9QA 3BG3A 3PIPF 2HDCA 4RB3C 2JTVA 1UZCA 2QYOA 1VCTA 1W36C 4XLCA 4HFCA 5FNVE 4JX6A 3ZGKA 4BUPA 2Y0MA 5FO5A 4Y4RA 1PP8F 2D2WA 4JI2T 4F6RC 5LRRA 5F0FA 1R1TA 1SMYF 2ZMEC 4YG2F 1U78A 4CYDA 3K3NA 5IHYA 2L7MP 3NWSA 1D3YA 4EJWA 3COAC 4YT0A 3RZOJ 4CICA 4O2AE 3RYHE 2XTLA 4OK0A 4A3BJ 2ES0A 4WXDA 2EK5A 3N9MA 1O4XA 1VQKI 1UMQA 1DQUA 4EJOA 3BQLA 3JW4A 4L9VA 3MMYB 2IEKA 4BGDA 1BR0A 5LEJA 2YDQA 2F48A 5IYCJ 2VE9A 4LFBT 2HOEA 2KZGA 3ECOA 1TQPA 3G2BA 1HCIA 2V1XA 4CZCA 3OYEA 4UY8I 2SPCA 3IKTA 2XKPA 4MQ9F 3LQQA 4A3GJ 1U2WA 2HR3A 1MH4A 3S2WA 1X1AA 4IT4A 3H3VK 3I53A 3DTOA 2M87A 5CPRB 4BNCA 5J0ZA 2MW8A 5K5RA 2R5YB 2X85A 2Z3YA 2BG9B 1JGSA 4B44A 2K4BA 2BDEA 4Y15A 3IWZA 4KA4A 4O2BE 4A3DJ 1M62A 4I55E 4BAYB 3KYDB 1SFUA 2TRTA 1D1CA 3BP8A 3FM3A 3TO6A 4B48A 3HOUJ 2FOWA 3LA3A 4JI6T 3TGNA 2A05A 2NS0A 1G2HA 2H88A 3N9PA 4TV8E 1AA7A 2CWYA 2E5LT 5JHFA 1R5GA 5ABFA 2ECCA 2MTQA 2NW9A 4XNFA 2XRNA 1US7B 2ZFWA 2C5IT 2XQ5A 3VHLA 1B72B 1WZ2A 5CGMA 5CVUA 1IUYA 5JR9B 3PQKA 4IQ4A 3OV8A 4JYKA 5CQEA 2KMFA 2GOXB 4PDKA 1TP4A 3LSGA 4UVAA 5FFZA 3OYFA 2E9XB 1D5VA 3KV6A 4L0ZB 1XDUA 4FX4A 2V9VA 3AE3A 3MN2A 3WTSC 1ZR2A 3QWLA 4Q4ZF 2K02A 4JX4A 2X66A 3KP6A 2EV6A 4XAXB 4X1KE 5JDNA 3RYCE 3KEOA 4P55A 1DU2A 1MBEA 2K85A 2DL1A 3H5NA 3AE2A 3FXRA 3HGYA 2I8DA 2HHHT 5M5YJ 2NYXA 4GYGA 1ON2A 3HGGA 2MAWA 2XSJC 2ZSIB 5DS9A 1Y64B 2CUZA 5L4HA 2H8WA 1J0RA 3FXOA 4ANJA 1XPXA 1B1BA 3CTAA 4YIFA 1IBKT 3W2AA 3NRYA 4QXCB 4FT8A 4NNJA 1B4AA 3LAJA 4XL9A 1WJ5A 3WTZA 2CO5A 1KU3A 4N0BA 2DTZA 4IZZA 4G7ZF 1B9NA 3ABVA 1KYWA 5FYMA 5L3GB 2HQNA 1VQ6I 4PK6A 3GF2A 3QOEA 4U7IA 2N9DA 3OWTA 4GYIA 1ZV4X 1BC7C 4D5FA 3GVAA 1JTXA 5AQLB 1U5TB 3KBTA 3JRDA 2XHKA 1W0TA 3CF5F 3NZPA 3VSKA 4HGAA 4CCNA 3ASOH 1PDNC 1Y8QB 2FBHA 1UAAA 2WV0A 3P4PA 3PV0F 4NIQA 3JAEA 4CUGA 3ETUA 5L3BB 2OU2A 2BG9A 3MZHA 2VL8A 3EUHC 4IE0A 4UF0B 2R7RA 1UURA 4KMCA 3MEXA 2YS9A 1MIVA 3H1CA 2M2EA 4Q47A 4BAYA 3JRGA 5LBQB 1OYWA 2LFBA 3RYFE 1IRZA 4MEYF 5LEKA 1YXRA 1YQ4A 2JA8J 2V8SV 2WTEA 4IDPA 2NVXJ 3QYFA 4AIHA 3S1NJ 3IAS2 2JRTA 3KP5A 4H63H 2WY7Q 1ORKA 1TNTA 3GTKJ 1B59A 4HTEA 4IKFA 5L47A 1LVFA 5D8LB 3UUBA 5JR9A 2VK9A 1XMOT 1TQMA 4Y3OA 2IAKA 3ZMSA 4MTDA 2VL0A 5E8GA 5TGTA 4V19K 2YEVC 4CN1A 5F08A 4AIDA 3REOA 4ZZBA 4CI1B 1LUJB 2JJ9A 2IPQX 2JA7J 3EPZA 3RPUA 1SE7A 1ZN2A 3QYEA 3MXZA 3WTYC 1BIAA 3CIRA 3PFIA 4KBMB 3CF2A 2YR2A 3F2EA 4IIJE 4LG0B 5DCFA 5LG3A 3BTCA 1TW2A 3M7GA 2HVSA 2K3WA 2KT0A 1IZ1A 2OCEA 3QUJA 2IGMA 2JVGA 1EF4A 5FXWA 4HSRA 1H88C 1FPQA 4AWXB 3MVPA 1Q1HA 2BEOA 2F4OB 2FSWA 3K0LA 1UFMA 4N9HA 4CQIA 1FYLA 4HNTA 2P6SA 5LLQA 1T95A 5DEQA 5J1YA 4I98B 3F6VA 3KYLA 2E1CA 3ZMDA 1LEAA 1SUMB 3K8PC 4HWFA 4ZI2D 2ZBKA 4QWNB 1MIJA 1IXSB 4J00A 3RC8A 4PK5A 5TISC 3PL8A 4A5NA 4A0ZA 5L3GA 1HA8A 2CLYC 2LJLA 4ZXLA 3UUMA 3AAFA 4PNIA 1KQ8A 4GRIA 1H89C 3OYGA 3L09A 2I6HA 2V1DB 4L9TA 2ID6A 3WE3A 3EYIA 4RMNA 2EIKH 1TTYA 1Z3XA 2XRLA 4ZZLA 2K3PA 2VQHA 1JI8A 2I5UA 3VPRA 2HKOA 1S6LA 3ZOBA 1XZYA 4AQFA 2Z5UA 2DLLA 2XY8B 2LHNA 2NTYA 3VOEA 3EDVA 2I0MA 2YU9J 4JI8T 2R3SA 3BDDA 2K9MA 3Q5EA 2WA0A 3E5QA 2A6EF 2LG4A 2XQ3A 4NC8A 3I9V2 2IT0A 2IA0A 2MBFA 4EM0B 2HPIA 2LC2A 4KN7X 5C8YE 5A2QZ 2XAFA 4UVBA 2A9UA 3E1SA 3C18A 4XLHA 3WAKA 4IPAA 4BXUA 1ZYRF 3LSRA 3WU1B 2LLYA 3ZMUB 3BZ6A 1YI2I 1LFPA 2PBIA 4G2AA 2MPKA 3SOLA 5FKOA 1L0VA 3H0DA 2X4HA 1J2XA 2HNHA 4RM3A 4W97A 2VC0A 2X67A 2NRAC 4RB0A 5HYAA 2K40A 3J80K 4PFPA 1N33T 5HLIA 4E4HA 3MKYB 4GCVA 1Z0PA 3Q0VA 4PAGA 1J5ET 4XRSG 3FMRA 3KFWX 4A0YA 2K4JA 2WBLA 3E0JB 2UXCT 2E36A 3BR0A 1W36D 1OYYA 2L0KA 5IP6A 1T0FA 5E1ZB 3CWZB 2Y69H 2EBIA 4LG0A 4LB6B 3A02A 1ENHA 2A6TA 2VT2A 3HOTA 4N9IA 2DOFA 4X0GA 3J7ZI 1IN8A 5JI6A 3DLLF 3EABA 5HEOA 4HRIA 5F3JA 3F57A 2VBWA 4IDQA 3F22A 2A61A 3AG4H 3VB2A 3RQWA 1U3EM 4B8XA 1MJ9A 4QX7B 5HLHA 4GOUA 2LP0A 3E97A 4F91B 4EEBA 1IZNB 2LOOA 2X9YA 1U0JA 1OCOH 4WX9A 4BY1J 4A3LJ 1Z77A 2E71A 3QQAA 2LMDA 3HOSA 1DU0A 1DUXC 2X9HA 3WU2C 2ZM0A 2GXAA 3ZCJA 1MNDA 2XDVA 3K4JA 3TO7A 5F1RA 4A3JJ 4UB6C 2HOTA 2CHOA 5ABGA 2E7WA 2WADA 1UHSA 4BHCA 2CM0A 2XAGA 4B1RA 1MDMA 3FB2A 3ONJA 4YIIA 1Z8UA 2W1OA 5FKNA 1P4XA 1HG2A 2NWBA 1WYCA 1NTCA 3K3OA 2CU7A 1SFOJ 4CXFA 4WCGA 1R1VA 5DTDA 3FXMA 3TMOA 5EEAA 5LMNT 2F4MB 1ETQA 1USSA 1MD0A 2L7FP 3NRVA 4QX8B 3PO2J 2KDOA 2PG4A 1HTJF 3OJAA 4YSYA 3BTLA 5CJ5A 2DT7B 1I6ZA 4JX5A 1ETXA 1WWXA 2XSBA 2XC7A 1TWGJ 3WGHA 4CA0A 4A6DA 2IVMA 2V9KA 3CUOA 2KXPB 3LJCA 3OSGA 1BI3A 4HQMA 1QNTA 5AQOB 1GLNA 2KRCA 1REPC 5BMVE 3VR9A 5M5WJ 1T08B 2R7FA 4FX0A 5C4XJ 1PP7U 5M3MJ 3BR6A 3CLQA 3ZMUA 2OQGA 2WAUA 2D2SA 2K9LA 4KT5C 2WMOA 1QZZA 4U31A 3TKLB 5IUXA 4ILAA 1OEDB 1G59A 5FVKA 3TP0A 1YIJI 6PAXA 3A5XA 1JNRA 1FIAA 2BY0A 2N8GA 2EWNA 3OS0A 2VE8A 3RZDJ 2PN6A 3FZHB 4Q48A 1Y39A 1X79A 3CC2I 1WHUA 3FHNA 2LKSA 5L3DB 9ANTA 1R49A 4ZHQE 3NVOA 3IRQA 3B6AA 2Y2ZA 4W1UA 5KNLA 3K2AA 5M5XJ 2LLKA 1LVAA 3QPLA 2XPVA 1Z1DA 1JUSA 1O3TA 3HEFA 3JSOA 2W25A 2DA5A 3Q5XA 3IH2A 1I6HJ 2ZJRF 3RX6A 3GFMA 4ZYAA 3S3OA 5HXSA 3ZJ2A 5DYMA 2UXNB 2A68F 2VT3A 1SD5A 2PMUA 5IP9J 2XROA 3ZT6A 3EUKL 4ZDLA 2HQAA 1OXZA 2EPFA 3OKQA 3RQUA 5FXVA 4EXTA 5B1BH 2XASA 2KHMA 5H6RB 3FMQA 5TRDA 1MSEC 2STWA 2XGXA 3B73A 4C3IJ 1A31A 4DR2T 2EIJH 4EMSA 1D8KA 1RKTA 2GOMA 1ZKEA 3S8PA 4AM3A 2WAFA 2OTJI 3RIUC 2Q0OA 2R7WA 2XGDA 2WAEA 2COMA 2VQCA 3UKGA 5FKLA 2FOKA 5L3FB 1V55H 4JK1X 2W7NA 2KWHA 1VQ7I 3QOPA 3Q9SA 2EFQA 3FDYA 1TWAJ 2EA4A 3OL4A 2LSJA 4EM2A 1FBUA 1BR1A 3E6CC 3VKGA 3UUNA 4XKWA 3ZQQA 1BJAA 5HODA 5IOYA 3DXJF 3PO3J 1R00A 4I43B 3K1NA 5JTGA 2JA5J 3WTTC 1ZRDA 4WK8F 1JKPC 1ZH5A 2JK3A 4HX8A 1YX5A 1KGSA 2OC6A 4I02A 4IGUA 3VU7H 4RBOA 2R92J 4XOPA 5J4YA 5FLXK 3KV9A 4RAFA 2CWEA 4GFBA 2LRLA 2KRHA 4IO9F 1EH8A 3EAMA 4EVIA 2TCTA 4ZTJA 4ILUA 4TX5A 3HB9A 4ZJZA 2EFNA 3ABKH 3BZKA 3SEQA 3K70C 2QBYB 4NHJA 1OEDA 4UXNB 5CQGA 2LR8A 2RQQA 4Z8XA 1Y8RB 4YY3T 3TLVA 1S3JA 1W5CC 2X6YA 3GLLA 2XZEA 4UHTA 1BM9A 2XPKA 1Y6IA 2LRKA 2DFFA 3TQNA 5LGTB 2BBYA 3JR9A 4UIGA 2L5QA 3V5SA 4XM3A 3RKYA 2WB5A 1P9QC 3Q9VA 4IHXA 1Y01A 5L3DA 3T8RA 2P7CB 2X9WA 1XMKA 2H94A 2R0QC 3IBPA 3A2KA 1ERDA 2LT3A 3FK6A 4U7YA 5F6FA 1XC5A 3BOQA 1MNMC 4BE2A 4A3EJ 2OF7A 2RGVA 3OR1C 1XMXA 2F4IA 4OIRF 3MZYA 4F92B 5GONE 1RKWA 4CGZA 5AQQB 2V6XA 4LLLA 1VQ5I 2GIZA 4P9UA 5ILUA 4BJNA 2LKGA 4I0UA 3ZMVA 4LG3A 5KXJA 4BH9A 1Q1VA 2UXNA 4FASD 2UXDT 3HKEE 1N77A 1HBXG 1E0EA 2VKJA 2KMUA 5IP7J 3N97A 4HE8A 2FJBA 1E1HB 2ZKZA 1U8RA 4DR4T 4ILBA 1ZHFA 2M8GX 1EZ3A 4JI5T 1TQIA 3I5UA 3WE2A 5GP9A 1Y0UA 2MG4A 1O3RA 1K7AA 2V26A 2ZXIA 1TLHB 1FOWA 3AE1A 3BJ6A 4H9NC 4C2TA 2CV1A 3N9QA 1TWHJ 4ZH4F 1YLFA 5C3JA 2IP2A 2EQRA 4PW8A 3N2OA 2L9NA 3CCYA 1X9BA 3PQJA 3V8LA 2IA2A 2W4SA 3SFZA 1W0UA 2PJQA 5GTHC 3ZYLA 2ZJQF 5DM7F 3HRTA 4ESFA 5HCJA 4BQQA 2W48A 3P4SA 5LNKA 3B02A 3G3ZA 3ZN1B 2ME6A 3DBLB 3MKWB 4AXPA 1DP3A 2DU9A 3IWFA 3H36A 3FXLA 5CVJA 3ECHA 3KVAA 3ML6A 2HN2A 3BQIA 1WSUA 5JH7E 1HSTA 2G7HA 2KZ7B 2KNDA 4GIWA 4QWQA 1LE8B 4G8XA 1M7KA 5FXZA 2EINH 1GV5A 3IC7A 3GZNB 4U88A 5GPAA 2Q8KA 2JJ7A 2LK2A 3ONQA 2WWUA 2LF8A 3AA6B 3W2WA 1VI0A 4C3HJ 5C4JJ 3OYJA 3DF8A 2H3RA 1V3FA 2JUCA 4L0RA 4WZXA 2QBYA 2JPBA 3CCEI 3AAAB 4UXNA 4UELA 1G8XA 2DMNA 3L2WA 1HKQA 3OIQA 3I54A 2GAUA 4ILCA 4D9JA 2VC1A 4AU7A 3OYCA 3D5SC 3C51A 3RCOA 5EGOB 5LGTA 3WGIA 1IXCA 1LQ1A 1ZRCA 1NEKA 3J7AO 1P4WA 4KIBA 2CRBA 2V5DA 3KINB 3AA1B 1FNNA 4G12A 4ERRA 4CZZB 1E2XA 2H7OA 3ANWB 3PUYF 2XQ9A 3NQOA 5EF6A 4CCJA 1WQ2A 1RR8C 1FIOA 2EILH 4PJNA 3CCSI 3SDBA 2CMRA 3AEGA 2LH9A 3LK42 3HYIA 2BG9C 3GTQJ 5FY1A 1OYIA 1UG2A 2CRGA 1S7AA 3D5RC 4HPQA 3OBVE 4L9NA 3PUZF 2Q2EB 3MKLA 3OR2C 4EJVA 1U9NA 4MLOA 3TLSA 2UUCT 2NVUB 3CCJI 2A3SA 1AKHB 1XTAA 5IT9K 2JQKA 2QUFA 2DNXA 4UUVA 1SFKA 3GA8A 3L1PA 1E3PA 2RAEA 1R1UA 4I6ZA 2E8IA 1JJ8C 1ETYA 3ONLC 1S72I 5FD6A 3ZQ7A 5HEJA 3F8MA 2NVQJ 5EG0B 2NOJB 1USTA 1HDDC 5JR9C 4FE7A 1W7PD 2QSHX 1AOYA 3CUQA 4OHFA 2JA6J 1U5PA 4EEDA 4Z2YA 4GO1A 5DCMB 4BXFA 5AFUL 3T0YA 2MH9A 2P5KA 4DJAA 2VKDA 4ENMA 1IV6A 1BIBA 1IJ5A 2XSAA 3CX6B 3W6JB 1D1AA 2RREA 3T1BA 1CF7A 4A6EA 5GTIC 3DKXA 5LB7B 1V5EA 4B47A 2RDPA 2VJIA 3JC6C 2DI4A 3JAMZ 5EDNA 1BJZA 3ZN1A 3FWEA 3K10A 5LGNB 4AD9A 3VKHA 1Z67A 3KLNA 3ZEFB 5DUIA 3E5UA 1X3UA 4CYCB 4M3FA 1SAXA 3LSMA 3FBLA 1JUPA 1HNXT 1LE8A 5J2UE 2ELHA 4X62T 1MZBA 4DGWB 2BKOA 1H7CA 1ZHCA 1YRNB 4AKGA 3ISPA 4A0XA 2K86A 2DMPA 3EETA 1A6IA 3B5MA 5FXXA 1W09A 4RB2C 1QPIA 4B3AA 4KUMB 4E7IA 1YW8A 1HDPA 4WXHA 4KMFA 2CCQA 4FI5A 5L3EB 3L2UA 2KJCA 3CDIA 4YXDA 5IY5H 4DR7T 3N2KE 4YFKF 5GPCA 4IL6C 3C2HA 3G06A 5LRSA 1ETVA 2ZB9A 3X1DA 2PI0A 4JI7T 3DKYA 2B1EA 3LSIA 3F6OA 3BROA 5H20A 1QHGA 4I01A 4AUXA 1IRGA 2WCAA 2DPUA 3AE5A 3NWIA 4MTEA 4CZZA 4YHHT 4AQFC 3MWMA 5DJQC 1F4KA 5ICFA 1TL8A 3J81K 3CC4I 2JUGA 2A5WA 4UUSB 5JFRA 5BQTA 3ROUA 3UQ7A 3VYUB 2XPUA 1FWZA 1BOBA 4D5CA 1TWFJ 3GFJA 2B63J 1NAFA 2VB6A 2P81A 4PZJA 2HDWA 3DQVC 1FJGT 4E7LA 2RP4A 3J80Z 2ZJ2A 1FP2A 3V7RA 5DDGA 1MMDA 5DD4A 3OYNA 1G3SA 2UV1A 4XSZF 2EHOD 3IA3A 2LSGA 1D5YA 3RHWA 2XF6A 1KU7A 2K24A 4BEHB 1VQNI 4E7ZA 1ZTRA 4BQOA 3CC7I 3NARA 3DTKA 4G6DA 2NXNB 3R0JA 5J4VA 3GFIA 3DCFA 4CDGA 2CQNA 1EV7A 5DCMA 2UZKA 1QVTA 3DTIA 3OOPA 1R71A 1WVRA 2LKPA 3UULA 2VI6A 5JLWA 4O4JE 2B7EA 2VJ4A 5CKTA 2ISZA 2KT9A 3NEUA 3OY9A 4LK1F 2DCFA 5L2LA 3T1HT 3TEDA 2NAZA 1T0FC 4XSXF 3N9LA 4TWHA 3CZ6A 4CCOA 4XORA 4G7HF 3CPZA 4G6TB 1XGOA 2FUPA 3E6BA 1XMQT 1AWCA 2VBZA 3K4BA 3FBZA 4UV9B 1TT5B 1X3WB 2WAQN 3BG6A 2DHRA 5FKYA 1JE8A 1J5YA 3K1PA 5AQIB 1GDTA 3VYTB 3K70D 1LDKB 1ZELA 1D0XA 2DJIA 5F1JA 4CYCA 4A3CJ 4U7DA 5CVVA 1DDNA 1OCRH 1XGNA 2JSPA 2WAQA 2H7VC 2XUEA 4DR5T 1W5SA 4G63A 1WCRA 4B3XA 5HOOA 2XHEB 4MHCA 1P92A 2VKVA 5KDMC 3ABLH 2X68A 3RKGA 2MD5A 2OLTA 4DMWA 4B3TT 1BR2A 2IGKA 4DV0T 4KUMA 4XLEA 5D5WB 4YJ3E 2ZC2A 3CO6C 2BW3A 3G73A 2KPMA 5EEHA 5E3LA 5F64A 4E7HA 1R9TJ 5HAXA 2P0WA 2FX0A 1R58A 3D0SA 2RVCA 3HHGA 5FLVA 3O1HA 3P4WA 3R61A 2ZNYA 5K1YA 4HYEA 2CBIA 3K4CA 2PJRA 1Z7UA 3OIPA 4U0YA 4KX6A 1YD8G 1BI2A 4OX9T 3BT9A 1H8AC 1DGWY 1Z9CA 2QA7A 3AEDA 2HS5A 4OIQF 3LSKA 2IW5B 3W2VA 2ZM6T 2DN0A 2M3AA 4PFOA 5HDGA 1HLVA 1JKQC 2V6EA 2LVSA 4HFVA 3HHHA 3GTLJ 1SFEA 1Y1VJ 5EZGA 3HTSB 2IBDA 2J4GA 1YG2A 1QU3A 2CFXA 1MIWA 4HEAA 4LITA 3W6KB 4HW0A 2ZLYA 2XSDC 2HPLA 3OS2A 1OMIA 3DPUA 1QUUA 2L2OA 1P4AA 2STTA 2VKOA 1YS6A 4QXBB 1N25A 2KIQA 2A6HF 3GTOJ 3ETVA 1GVDA 2PMHA 5GADJ 4BDYA 3HC7A 4OOIA 1SFXA 3HPGA 2O0YA 1X19A 2Y75A 3PUBA 3H3UA 4S04A 1K4TA 3WTUC 4BKXA 2VOPA 1XDOA 4UB8C 4LF6T 3TOAA 3VRBA 5FLMJ 3UR3C 3HTUA 2H8RA 2L7ZA 3S93A 2XQ8A 1IDZA 1GXQA 1LDDA 3PURA 1Z6RA 4UR9A 1MSFC 1D8JA 4F7ZA 4E6KG 5EZYE 3PNTA 1OKRA 1FTTA 3RDIA 2HEOA 1K78B 1IBMT 4KMUX 4PJMA 4PJJA 1ETOA 3U1KA 4BA9A 3FF5A 4PGGA 1C0WA 4AISA 4M3BA 2XB0X 4EIWA 3NWTA 2JWTA 3C3WA 3UNGC 1G73A 5GAHJ 3FISA 2FUG2 4F8HA 2YN6A 2GXBA 1F9NA 4B09A 2NNNA 2AXTC 4BQNA 1ZLJA 3H5RA 5IPAA 2P6TA 1S8NA 4AKRB 3BG9A 3L3PA 4DMVA 2XF5A 5FMNA 2OZUA 2BV6A 1OWAA 4AKHA 2R5YA 2WU5A 2R7SA 3O9XA 4B4CA 5HXRA 3MK7C 4P96A 1S7EA 1F1ZA 1W0AA 5IYDJ 3HRMA 4I76A 4IXAA 3HUGB 4AIJA 3H35A 2QCOA 4M6YA 4ZEYA 2BVMA 4FJOA 4JI0T 3ZSTA 2DYRH 5J8CA 1YS7A 2BS2A 3F9KA 2MOZA 4L9JA 4P1NA 2DDBA 4QPOA 4IOAF 3TLTA 1ON1A 3K69A 4A5XA 3FKJA 5FLXZ 2EZHA 3LOCA 1W4MA 3M07A 1ONVA 4OAYA 3ZSSA 1ULYA 4M74A 3MFKA 4BL0B 4O4IE 3DLAA 3SHFA 3S16J 3D0TA 1HW5A 1W1WE 3CCUI 1B72A 3L00A 2DODA 3KLOA 3LK3B 3EDPA 2LKXA 1A6QA 1ZREA 4Y33A 3R60A 2LY2A 2E9XA 2XM2A 3L39A 2AQFA 3WAJA 2E2IJ 2J47A 1U6GA 2XV4S 2VXZA 3VEPA 2F6CA 3RI5A 2BVLA 2BHYA 1W9RA 3UT5E 4BE1A 2XPWA 3K9TA 3RPUD 3CMAI 5H6QB 3CJQB 4LMLA 4LLNA 2VPLA 3PUVF 3EUAA 2I10A 2BYVE 1IV8A 1KZHA 3H9JA 2N2NA 1EKEA 2HTSA 2X9DA 4DZJA 3PJAJ 4Y7NJ 1T56A 3JC6D 4IHVA 4LF8T 5HS8A 5K7HA 1DP7P 1IN7A 3HSEA 4PUSA 3E5XA 4DBQA 4DIDB 4G9YA 1MBFA 3P8CD 1NWMX 2GA2A 3F23A 1XNQT 3EI0A 4LGWA 4U87A 4HLYA 2V1NA 1IUFA 2L9VA 2ZMEB 4F52A 2VURA 5CFBA 1DGRM 3QB5K 3K4LA 3NAUA 4RAZA 3JRHA 5EZHA 2M30A 3FXEB 2V7MA 4FISA 4ENJA 1X1BA 5KK1A 2IMLA 1YX3A 5JVGF 3MD2A 3GO5A 2L7KA 2D0UA 2RKHA 2Y9ZA 3FXJA 5ILVA 1RUOA 2KWIB 1K79A 3W15B 4EV6A 2TDXA 3C7JA 4A93J 2W63A 1WJEA 2KZVA 1QSDA 4IHSA 4HA8A 4GK5E 4LMKA 3H9GA 1U5TA 4I7HA 4UNOA 5LG4A 3KZZA 3H3ZA 2VASA 3ZJ1A 3BR1A 4CH7A 1J09A 4DYCA 2V1UA 2KINB 4OINF 3BPVA 2R7ZJ 3TW7A 4KHZF 3KP4A 4ZC3A 3ULQB 3IL2A 2I59A 5L3BA 5BOXA 4UF0A 3WG7H 3J7AY 5FD5A 2XAHB 4WXCA 1TNSA 3SZTA 1T2KA 1ZRFA 3GCMA 2DT6A 1YOVB 3FBIB 2VLAA 3HUGA 1YW9A 1BI0A 3I64A 4M73A 1V54H 4JI4T 5LBQA 3FZLB 2NS7A 2NS8A 1SD7A 4IHYA 2X0LB 2M7AA 4IF4A 3NBXX 2CFOA 3ABUA 2H1KA 2F4VT 3ZC0A 1DPRA 4A3MJ 2DA4A 2CQQA 3SJMA 4IQJA 4II3A 4XRSA 2JN6A 1WFDA 2YU3A 3CP8A 2EFWA 3PSIA 2ZXWH 2M8EA 2Y8DA 3PUSA 4RAGA 4BJMA 5L3CB 3P9KA 2Q9QB 1R8IA 2HH7A 1T8BA 2CS3A 1DU6A 3Q0UA 2DTRA 1UK5A 2W2UA 5K5QA 2L9RA 4FTHA 2JVHA 5AQTB 1A36A 1SMTA 5E8IA 1WJAA 2DJNA 1WI3A 4BU2A 4XIDA 3LNQA 4L5JA 1B7TA 3TLUA 4YSXA 1P7JA 4GK0E 3S14J 3H9QA 2M1BA 3V4GA 3A0BC 4NB5A 2DI3A 1WJBA 2VPRA 2QVAA 3CCMI 4X5TA 2Q1ZB 3SXYA 2HQRA 4C90A 1MMNA 4FQGA 1XN7A 3F8NA 4OIOF 3HDDA 4EZHA 3SFIA 5IT9Z 2HPJA 4WNKA 2WDRA 5B5EC 1QA6A 4CXXA 3F72A 5J1GA 2WU2A 4RGUA 2KFDA 2D5UA 3CJTB 5JVTA 2X1CA 2XQ6A 5EEGA 4IL9A 4IDNA 3GBGA 4AVPA 3OYKA 3AE4A 4LIUA 3OTOT 4MGRA 2Y48B 4GXOA 1R4NB 5LD2C 1SC7A 2CBJA 1JKRC 3DKWA 2K48A 3CMMA 3GXOA 1FT9A 1W5TA 4DNCA 3JSPA 3RYIE 1V5FA 4YELA 2L01A 1R7JA 2KIMA 2V1DA 3OYHA 2NTXA 2WZIA 5KMGP 4LFUA 1X1PA 2O61A 3AG2H 4J2CA 5LJMA 3BCAA 2AE9A 4P0AA 1FEWA 1VQ9I 4M1PA 3HPHA 1YW0A 4X1IE 1O7LA 1OR7A 3ZQHA 4LJZF 5KAFC 3OYLA 1ZGWA 1LFUP 4KISA 2M4KA 2UUZA 3GN5B 3CUQC 2FE3A 4DNDA 5E79C 2ELKA 5CVIA 2W4XA 1P2FA 1EJ9A 1O3QA 3FXDB 2XAHA 4TZ4C 3HOXJ 1LNWA 1WRDA 4M6XA 3CMLA 3IH4A 4COFA 2J5OA 3O6BB 2MA3A 1N78A 3LWFA 1RC9A 3E6DA 2VUMJ 2JA2A 5BNGA 1BOAA 3FZKB 1SAUA 5LGUB 3CLOA 1GV2A 1PVEA 1KNZA 3DV8A 3M4OJ 3BR3A 3F8CA 3S2HJ 5HS9A 4B3ST 3KETA 2XAJB 3EDUA 3I71A 1T33A 3BWGA 1VQ4I 3C2BA 1HW2A 2RA1A 1IN4A 3X2QH 4DIQA 1QLBA 2MSYA 3GMIA 3ZPOA 2Q9QA 2HI3A 1U4QA 3QODA 1KEYA 3I4PA 1IDYA 4BQAA 2M5WA 1BW6A 1QGPA 2OA5A 2O5RA 2ZXJA 4U0VA 2HVRA 4OYJA 3KZYA 2EV0A 1SEUA 1S94A 3ZR8X 2CQXA 3BK9A 2DXIA 3RYPA 1RRJA 4CCMA 1RNLA 3E3VA 4UEMA 4ZOLE 3SFEA 5CVRA 4CN4A 2G9WA 3W3CA 2A72A 1IJWC 1UX4A 5HWYA 3J81Z 5JDMA 1KA8A 1OISA 2OPTA 5JDHA 1PUFB 1I5ZA 3SQNA 1I6XA 3CESA 4E70A 3GEZA 2DW4A 4XR6A 4YSZA 3DU6A 2ZFUA 4XKVA 2DYSH 4DYRA 1UUSA 4H9SE 2M6BA 3UUXB 3RKQA 2DOEA 5J3LA 3SYTA 4Z90A 4M3GA 2BKPA 4XKBA 2L3LA 2QKMB 3HOYJ 1GQEA 2BS4A 2V7JA 3BR2A 3D1NI 3I9WA 4RM2A 2MC4A 3L9FA 3BCBA 4X1YE 5AQGB 1D0YA 1F36A 2CMPA 3HBLA 1LDJA 2CV0A 2Y0SN 3ZN0B 3QU6A 5CA0E 2LSYA 4XBFB 2Y48A 4N4OB 5AIQA 4XQFA 1ZR4A 1L3LA 3LBXB 4YTPA 2X1EA 2EFOA 2WY2A 3R4KA 4NUUA 1J5WA 1YJ9I 2H09A 1I27A 1QZYA 2OAZA 3A4CA 1LKXA 2Y0SA 4HG2A 5BS6A 3KE2A 2X0YA 1WH5A 2A5YB 3DFGA 2H6CA 2AXDS 1TT0A 2ZCWA 3O8GA 3JRIA 4JYAT 1YITI 4AYBN 2CUFA 1GHCA 5HEGA 4EV0A 3I0TA 3F31A 2M34A 2P9BA 1Z6TA 2OZ6A 4LLGF 1NK2P 5FKKA 4ETSA 4IE5A 2H89A 3E0ZA 2ZNZA 2VBXA 3F8BA 4AYBA 1WH7A 3IF8B 2FU4A 3HG9A 5K5OA 1HR0T 1R6RA 2ESHA 5JRCB 2QF7A 4HSTA 3DP7A 2KLOA 2R6GF 3M1EA 3JRBA 4D7NA 2FRHA 5AONA 2J62A 3K3QC 2IRFG 1WJDA 2NOGA 4FE4A 1VQMI 1IG7A 5B3SH 5LGUA 4G7OF 3R84B 4I50E 2IS2A 3AL0C 4PSXA 1HG5A 3I0QA 2RC4A 3GUDA 2K27A 4OU0A 5AQSB 4S0HB 2QQ9A 3ZT5A 3K6GA 4EM1A 3GTGJ 1I39A 3CCLI 4EGZA 2HXIA 2W82A 4DZPA 2LEHA 3SFDA 1LFBA 5ILSA 1LRZA 3HL6A 1Y1WJ 5DABA 5LBMA 4C91A 3Q5FA 2HN1A 4QIWN 2ZSHB 1V5GA 1MKMA 1RI7A 4G6QA 3MCZA 4IHWA 3GTMJ 2CG4A 1YO5C 3I56I 1T7SA 3M8JA 4HFBA 2VXDA 5TJJA 1XG1A 4C2UA 2VKHA 1MBHA 5E3OA 1ZP0A 2ACZA 2V7LA 4I4TE 4UVCB 4U7BA 4LFCT 3I59B 1PUFA 4B3RT 2F5VA 3HZJA 2LBFB 5KHDA 4O4LE 2WS3A 5AQUB 4ISSA 3IAM2 4JV5T 1HF0A 2X6OA 1WJFA 4XONA 3TL4X 3SDGA 3PDYA 1Z91A 4U72A 4ADZA 2UUBT 1SVLA 4ABZA 4YLHA 3AEEA 5HCMA 3U1DA 1BBYA 1CUNA 2F5CA 4OFZA 3ZMTB 5ADXL 3N9OA 1YE9A 5H6RA 5GAGJ 1GXPA 1LEBA 2JQHA 3P4RA 5CB4E 3V5UA 4A97A 1MBJA 5LMUT 2R7TA 1MMAA 1T72A 1AHDP 3WTXC 3QP5A 2ELJA 4DBRA 1XSDA 4XBFA 2CWOA 3NKZA 5JDFA 4AIKA 2LD5A 3LBXA 3MZ8A 4MEXF 3IH3A 1MBGA 3DBRB 2O8XA 2ZO4A 2E5NA 1XDSA 3RQIA 5L3FA 3BG7A 4BBRJ 1FC3A 2LF7A 3T5XA 1HXDA 2FBIA 3AE8A 4H9QC 2DMTA 2JZYA 3ZYMA 2GXGA 1XGMA 3ASNH 2LDUA 4YFNF 2QVOA 4MFDA 2XM1A 1W7PB 1XSVA 2MLKA 2VKEA 2ZXHA 4XN3A 3S1MJ 2R7VA 3C98B 3CJRB 4KI0F 2QLZA 4LF5T 1K6OA 3B13A 4X6AJ 4IEJA 5CLSA 4TV9E 3RKXA 3ZPLA 3KP2A 4NDLA 4XLAA 3OMYA 3ZMZB 2KJBA 4L0YB 2A07F 4V1Av 4K0UA 5D5UB 3A03A 2DBBA 4N4NB 3CO7C 2HKXA 3H37A 4M9XA 4H9OC 3U21A 4A69C 3O3KA 5HVQC 2XQYA 2AO9A 2HXOA 4BS9A 2NVTJ 2AHQA 4XRFA 3FZFB 2W85A 4DYQA 3DPLC 3K4NA 3K4MA 2Z9OA 4AKLA 4YIRX 3WTWC 5JHUA 1G6NA 2R4GA 3LSJA 5LHHB 1FJLA 3N4MA 1Y0NA 4Z6YA 2EFPA 5ICCA 1ZEEA 4L5GA 3BG5A 3OYZA 3UU3A 1NG6A 4HEA2 1R5HA 1RETA 3FMSA 2GBYA 5ABHA 5IYBJ 1FOXA 1RZ4A 4HDUA 3P5JA 3G1LA 4DVDA 2A69F 2WDVA 1GUUA 4GYRA 2LE8A 5EK4A 1Y56A 2WB1N 3HA4A 4JEUB 5J2TE 1KU2A 1MH3A 2COBA 3H92A 4XRMA 1QBJA 2VODA 4LD5A 4HFDA 4ZI3C 4BACA 5H2FC 3FM5A 2GK9A 3ZRGA 1G4DA 2WB1A 3RRWA 1CHUA 3ZYKA 1XWMA 5IT3A 3CK6A 1I1GA 2WC2A 1X2MA 3PNVA 3S32A 4AC0A 4C30A 3QP6A 1ZK8A 1IC8A 2E34A 3K1SA 2MABA 2E2HJ 4HZFA 2E9XC 2O7OA 3AXJB 2GA1A 4M6VA 2CHNA 3NZQA 2EHOB 5D4RA 3DEEA 4M9ZA 2XQAA 1JT0A 5LHGB 2BHZA 5FP3A 2VOOA 3FK7A 1HNZT 2FBWA 4O5VA 2IS6A 5AQFB 1ZGAA 2UUAT 4N78D 3OYDA 3PFYA 3SEZA 4IRIA 1E2AA 2CXLA 4QXHB 4B3MT 2BGCA 2W67A 4HWHA 2L54A 3J7YJ 1WKMA 2BE5F 2E60A 4LOCA 2H6BA 5C2TA 2VIXA 3HM5A 1MJBA 1X4PA 2H1LA 4NC6A 2JQ7A 1Z0XA 1VQOI 3RSNA 5FRMA 4ISTA 5FJ8J 2E1MB 4RGRA 4A12A 5D6EA 2FJEA 5HXEA 3TDZC 3LSTA 1ZQ3P 2MLGA 4IOCF 2PFBA 1HX8A 1OCPA 2DWGA 1IN5A 1HC8A 2E2AA 2JMKA 1KONA 2DPDA 1JXSA 1IGNA 2VQET 3HIFA 3I1AA 1UELB 3GTPJ 2NVYJ 4ASNA 4AVZA 3KPHA 2MYSA 3G71I 4OMYA 1BW5A 3OL3A 4HBLA 4ZDOA 3LDQB 5FY0A 3SZGA 5D5XB 4IE7A 3UFEA 3AG1H 5EGOA 4HLXA 2FBKA 3AFHA 4O6JA 3I55I 1MMGA 3K2ZA 3LSPA 5FY7A 2ACXA 3AEFA 5LHHA 3U78A 3UQ4A 1MJAA 1WI9A 4ENKA 3AVRA 1U5TC 2OD5A 3ANWA 3QPSA 2LKHA 2D45A 2CW8A 3QPTA 3N9NA 3O4XE 1OCCH 1IBLT 3HKDE 3OPCA 1NHAA 2QEXI 3ABMH 4IX7A 3SRZA 2HVQA 3TO9A 3MA9A 2Q2EA 4I2OA 4ITVA 5KAIC 1IRFA 1KFYA 1GVJA 1YYVA 1AKHA 4X65T 2VVSA 2WDQA 4LMJA 5F8PA 2BS3A 2M4GA 2QGUA 3AG3H 5AQNB 4TWDA 3HKBE 3S15J 2PEXA 1Z21A 5C44J 4C2MJ 3GX4X 3TP3A 2M0CA 2XQ7A 3O1JA 4ZDPA 1I3AA 5BMZA 5ABFB 2CW0F 5EG0A 4KFCA 2CUEA 3IRRA 5E0OA 1IO2A 3MKZA 3HL2A 2DA6A 1S7OA 3QOFA 3J9X1 1QHHD 3A01B 1H9GA 2YUSA 2EHOA 2CYYA 4DR6T 4MALA 1KQ9A 2EH3A 2M9HA 4NC7A 5KCMA 5LHGA 2O3FA 1P6RA 4OWRB 2WWYA 4BE0A 4OIPF 3L2VA 2M67A 3CP2A 4EGYA 2CH0A 2X48A 4PGHA 5HEUA 2M6IA 1UCRA 5FROA 2C5JA 1N32T 1EH7A 2JIWA 4MHGA 4RDUA 1YKEB 3S3NA 3P7IA 5M4YA 3KIOA 2QSGX 3AE7A 3JTHA 5LGNA 4DV7T 2BY2A 3RPQA 1T98A 1U8BA 4V2GA 1NH3A 1I3QJ 1I1SA 5D4SA 1F43A 5JLXA 2F2EA 2C5KT 3HR0A 3I4MJ 1QPMA 2L02A 2XB5A 2JPCA 3WODF 1YRNA
chains in the Genus database with same CATH topology
3RRCA 5E17F 1QQIA 3S4UA 4PJLA 4L18B 4CI3B 5FGMA 5L3EA 3GZ5A 2RQPA 3PUQA 3QC9A 5LHIB 2QM3A 5E1WA 2FA5A 3C50A 3LFMA 5BPIA 5HWXA 2W00A 2NW8A 1XSXA 1WLXA 2VN2A 2W24A 3EQLF 2EB7A 2BZBA 3RKOA 4MLKA 2D1HA 4HF0A 4EJUA 2X9XA 2FEZA 1HW1A 2YU1A 1WRJA 2YSRA 4BYYA 3ZLIA 1F5TA 3I58A 3N2GE 5LCYA 1JHFA 2L3DA 2V7JA 3DTOA 1ZARA 4M71A 3V8KA 3BJOA 1YTYA 4ZS3A 3CQGB 4TUYE 3CQCB 1XCVA 5D6FA 3L7WA 2Q9QC 2V7KA 1YKHB 3ZMSB 1IF1A 5LOVE 3E08A 2RN7A 3MQ0A 2LSOA 2JSCA 2C6YA 2QENA 3LG7A 2YK0A 4YFSA 3BJAA 2VWAA 4M72A 2ODUA 3VFZA 5HS7A 3Q9DA 4UV9A 1FYKA 3MAJA 4HDVA 2OQRA 1J7KA 1FMVA 2FNPA 3BY6A 2HTJA 2FNAA 2KRFA 1IJ6A 3HKCE 5LA6E 4EOZB 1YFHA 3O2PE 2QWWA 4O4HE 5E18F 2L8KA 5JDLA 3KP3A 2PLYA 1SHZC 3RI4A 5J8FA 5LHIA 1EH6A 4CXYA 3QAHA 4WWCA 1H0MA 1J59A 1XD7A 3C4ZA 2CQKA 2IW5A 3GLXA 5E20A 3AAIA 3AVSA 2QQAA 1SD6A 3HRUA 1ZG5A 2D0TA 4ZI3D 2YX7A 2DAOA 4XLPF 4KYWA 3RC3A 4H0EA 3WI3A 3RIRA 2ODVA 3CX8B 5JDGA 2EA2A 2UXXB 4K2EA 2ADUA 2XAFB 2E9XD 3LQRA 4UVBB 2K9AA 1H9TA 1FSHA 2XIGA 5HXCA 3ZCIA 1OPCA 4OMZA 4YFXF 1J9IA 3V8JA 5J6XA 3ZMTA 4HKAA 4CXWA 1A04A 3P7NA 1FZPB 1T38A 4BHPA 2Z99A 1O57A 2LOPA 2NOXA 2MH2A 1J75A 3R6NA 4ZS2A 5LYJE 4P9FA 2O6GE 3RH3A 2L4MA 2LHRA 1K78A 4H63V 4I0BA 2P4WA 1HKSA 1RIOH 3U3IA 4R8HA 3N5LA 1UHWA 3KDSE 4KICA 3J7Yq 1XMAA 1ZG1A 1AJ3A 5BPDA 3JAMK 3V7SA 3QPHA 4IRHA 1MIYA 2XAGB 5AIPA 1MDMB 2JQQA 2YU2A 2KKOA 3I0OA 3GFLA 4NUVA 2EV5A 5ICGA 2OA4A 3QU3A 1CGPA 4EAHA 1T6SA 4IRGA 4ZYEA 4EYYR 2E1NA 3O1IA 3TOBA 4PCQA 1E17A 4TN7B 2XUBA 3GZ6A 4X20E 2LNBA 3B57A 2QQBA 2W0GA 3RYRA 2CGPA 2UXXA 4R79A 4YHJA 2HYGD 3IKVA 2V7IA 2ESNA 1KK7A 2AXLA 1HS7A 5H6QA 3KVBA 2VONA 3L2CA 3FZVA 1HQCA 1HFAA 4ZZDA 2MBGA 2FMYA 4MNUA 5LXTE 2WM9A 2JMHA 1FY7A 1VRBA 3M65A 4H9RC 1Z05A 1STZA 3PE0A 2W61A 3PU3A 2V79A 1R23A 4JEHB 4DQ2A 3LFKA 2C0SA 1L0OC 2G0UA 2ZMEA 4Q5SF 2JT1A 5DUKA 3SWHA 3C4WA 4UV8B 1BN5A 4EQQA 5CYVA 3PTRB 4QLCU 4JQFA 2ACJA 3U9GA 3CJNA 3P9CA 4H9PC 3EVYA 1BR4A 2XASB 2F5EA 3F3XA 5EK3A 2YPRA 5DD8A 3SZPA 3H3AA 2CA5A 3FXUA 3IHRA 2NP9A 3TDUC 5A1LA 2LSIA 3IEEA 2KIFA 4KN4X 3OYXA 4RB1A 2X0LA 3MKDA 4U0WA 5ERIA 3PU8A 2HFHA 2PFVA 4P5OA 4O3MA 3M9AA 4FHTA 4LB5A 3ONXA 3C1DA 2KIUA 3WGGA 2NNYA 2Y6XA 3KCCA 5JREA 1O7FA 2W62A 5L3CA 2DLRA 1TBXA 3E22E 3KV4A 2Q9QD 3Q5WA 1FX7A 3FX3A 1FBSA 3F8FA 3IHUA 3ESLA 5JDQA 4R1HA 1V9DA 1KQ0A 2AS5F 2IC9A 1LB2A 4DO0A 4HOBA 2F5DA 3QK6A 2ETHA 1ODDA 1MNEA 3FXQA 3KEQA 2MC3A 1IW7F 2FQ3A 1IAPA 2WSSV 2W57A 5ICEA 4HF2A 2L4AA 4RAYA 4HQEA 4UV8A 2ISYA 4EZ4A 1YIOA 4ZYHA 2IC6A 2CLYB 4L9IA 4XZCA 4MFRA 4U74A 3ZMVB 4ESJA 4JUYA 4O8SA 4D0PA 3DJBA 1S29A 5KVRA 4HF1A 5ADXL 3I9YA 4LK0F 3FHZA 5CJ9A 3C4XA 3GN5A 4E7SA 2KLQA 1WYBA 5IYZE 4AI6A 2VBYA 2P8TA 5EK2A 2EHOC 3EUHA 4RGXA 4KP3C 2CXDA 3Q2MA 2GIVA 2QZ8A 2DO7A 3D5LA 2WMNA 4P09A 2F5FA 2HGCA 2XAJA 2J5PA 2DT5A 3AA7B 1DPUA 4HV6A 5FFXA 2ZM8A 3NRXA 4I09A 2FMLA 2P7VB 3R0AA 3AAEB 2HZTA 2Z6EA 2DK5A 3PUAA 2ZM2A 5HLGA 2X51A 1S35A 2HYFA 1KYZA 3WU0A 3LK2B 3DEUA 4I0AA 4ENNA 2DQRA 1LJ9A 3V7CA 2FF4A 1IAWA 2R7DA 3BPXA 3KBUA 4GYSA 3MACA 1B9MA 5E1XA 1R36A 3RJPA 1FP1D 4JBAA 4ESBA 3C64A 1O3XA 1KU9A 1SD4A 4IE4A 5CA1E 3ZN0A 4GGGA 4BHBA 3SS1A 3GWHA 3KP7A 4KDPA 1IXRC 2LOSA 4CI2B 2B0LA 2P5LC 4NQWA 4P0BA 4HV5A 3R6SA 1ZG3A 3AB3B 1JHHA 5FB2A 1D0ZA 2IA1A 3HI2A 3LAPA 3KV5A 2UWMA 2JPFA 3RKWA 3CUQB 4OYKA 3ELKA 5ED4A 3LA2A 3P9IA 3T8TA 1G3WA 4A5MA 5JRCA 3CX7B 3TKYA 2RV8A 2NW7A 1ZLKA 4A2UA 1CF7B 4RGSA 1UHMA 3WG9A 4ZYGA 1VTNC 1FBQA 2QGSA 3ABTA 3LA7A 4IHTA 3DPTA 2HWVA 2Z33A 4IE6A 5KX5E 4CO8A 5A2QK 2XAQB 1HF8A 2A2FX 5HXHA 2M45A 4EYUA 3ZC1A 2CE7A 4PK4A 2JRKA 5JVDE 3ZP5A 2V6CA 2K7LA 2FXAA 2YX4A 1SA0E 3BQKA 4UVCA 2W84A 2GWRA 2P5VA 4HX7A 3I59A 4ASKA 5ETWA 2DQLA 1RUNA 3CKDA 2CXFA 2DFIA 4EJTA 1QO0D 3K1MA 4Y17A 2XKOA 4Y13A 3CDHA 2ZMAA 4S05A 5D5VB 3M8EA 2CEAA 3GWZA 3GW2A 1YQAA 1FOKA 4IDZA 1ZGJA 5JQGE 3WTVC 3M8FA 5HDNA 3F21A 5JR3A 4IHJE 2A3DA 1IN6A 3MJXA 1HSJA 1V4RA 1VOMA 1XGSA 1UX5A 4G94A 5LP6E 1HKTA 2D1VA 2E7XA 1UB9A 4WF2A 2PQ8A 3ERED 2EJRA 4LMYA 1FLIA 1W7PA 4RS8A 2RNJA 3HRSA 4L5IA 5DQWA 2GQQA 5DQVA 4AKIA 2J1DG 3VODA 2YINA 1XB4A 2H27A 1G3TA 3ZMZA 1FMWA 4HN9A 4CHUA 2DWKA 4ZYDA 3RTRA 1PUEE