3RPUA

Crystal structure of the muke-mukf complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
309
Chain Sequence
TVPELVAWARKNDFSISLPVDRLSFLLAVATLNMSEGELVDAFRHVSDAFTIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of MukE in assembling a functional MukBEF complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
total genus 106
structure length 309
sequence length 321
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpuA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rpuA02
3F8CA 2ESNA 3WODF 3BROA 3R61A 3TDZC 2FOKA 2D2WA 2P5VA 5L3EA 3SXYA 4D0PA 1SD7A 1R1UA 1S7OA 3KEOA 2J5PA 4O5VA 1BI2A 3MZHA 3JTHA 4RGXA 4KDPA 1XSDA 1XCBA 1ZLJA 2QYOA 1ODDA 5FFXA 1FYKA 2A6EF 4RB3C 1AOYA 4EJUA 3KP3A 4I7HA 3W6JB 2DT5A 2OQGA 4XLNF 1XGNA 3IWZA 3F8MA 2ZKZA 5K1YA 3LFKA 4CYDA 4BYYA 1G6NA 2M1BA 2VBZA 2DI3A 4I02A 4FHTA 3RKWA 2KIFA 1T98A 1SMTA 3EYYA 1KYZA 1IN5A 3ABUA 3KFWX 5L3DA 4BNCA 1FC3A 4O6JA 3ZN0A 5EEGA 2DQRA 4M74A 3O2PE 2FU4A 2QQBA 2Y75A 1F5TA 3BP8A 2WC2A 1W7PB 4HAMA 2RNJA 4ENJA 2A61A 4NQWA 4Q5SF 5D8KB 1BI0A 4R79A 1ONVA 1W7PA 1UHMA 4HQMA 4H0EA 1KU7A 2DQLA 4MHGA 4EGYA 4U0YA 3KP7A 2OAZA 4RS8A 3HRSA 2FXAA 1LJ9A 3IC7A 1I1SA 1NHAA 2XVCA 2ZNYA 2QQAA 1FWZA 1BOAA 4WWCA 3U9GA 3FM3A 2EJRA 1XN7A 4LFUA 3CO7C 4Q47A 2ZCWA 4QLCU 4WXHA 5CVIA 4BXUA 3GZ5A 1SAXA 2KRFA 3TOBA 5JVTA 3GUDA 5CVVA 3E97A 4IRIA 3IRRA 1G3YA 1QGPA 2IA1A 4CICA 2O61A 2W84A 1USTA 2O0YA 3HTSB 1SFXA 4LGWA 2V1DA 1UB9A 2XIGA 3DPLC 4EJOA 4PZJA 2PFBA 3SQNA 1YS7A 4UVCA 2V79A 2Q8KA 3ECHA 1P2FA 4I09A 3E6DA 4Y13A 2XROA 4MTDA 1IW7F 3L09A 4UV9A 3M8EA 3I4PA 1ZYRF 5ILVA 3I64A 3C1DA 4LMYA 3NQOA 4UUVA 1XGMA 1DUXC 2RQPA 1JE8A 2W85A 2QBYB 2EK5A 3I54A 4U7DA 3JW4A 5L3CA 3BDDA 3WTVC 5E18F 1FT9A 2LSOA 1WKMA 2STWA 3M7GA 3CUQB 1AWCA 1IUYA 1IN8A 2HQRA 3K0LA 2VOPA 2MH2A 2JPBA 1XCVA 5LEJA 3QOPA 4IJAA 4PDKA 1R22A 4YFKF 2HEOA 4F7ZA 4EM0B 4N0BA 3KLOA 4NB5A 3HIFA 4YIIA 1HW1A 1IXRC 1Q1HA 5HLIA 3JTGA 1L0OC 2K4BA 1GXPA 2EFWA 2VN2A 2DO7A 2XAGA 4L9JA 4MGRA 3HRMA 4MEYF 5FD6A 1YS6A 4OIOF 4IHSA 3SHFA 3QU6A 1YW7A 2XAHA 1ZRCA 3I58A 4UVBA 3ZMSA 4LG0B 2E7XA 1XMAA 2UXXA 4AD9A 3V7CA 1T38A 3ISPA 4PGHA 4P9FA 1CF7A 5K5RA 4MNUA 4TV7A 1O3TA 2HR3A 4ZYEA 4BQAA 3KP5A 5BS6A 2XUBA 3P7NA 2IVMA 4YFXF 2LF8A 1YW9A 4LK1F 2GAUA 3MWMA 5TRDA 4OOIA 3VB2A 2DTRA 5D5UB 1ZG1A 1G4DA 3RDIA 5JR3A 1SFEA 4LLLA 2MLKA 4HQEA 2XRNA 4E70A 4P96A 1MD0A 3FM5A 1YLFA 3KLNA 5FGMA 3GF2A 3FZVA 2VE8A 5K5OA 2EV5A 3GYHX 2UWMA 1P4WA 1S6LA 4AIJA 4LB6B 3WTYC 1KA8A 5HS7A 1TNSA 2HS5A 2Z3YA 4I01A 3LA2A 3CLOA 3WTSC 2Q2EA 3GFJA 2FMLA 4R8HA 4XSXF 4IRHA 1FY7A 1DPRA 2V1XA 1OPCA 3BJAA 2HQNA 1U8RA 1MGTA 3E5XA 4AVPA 3E3VA 2GQQA 3DQVC 3H92A 2FBHA 1FLIA 1HBXG 1B59A 1HXDA 3MFKA 1ZH5A 3TOAA 5J6XA 2L3DA 5LGUA 1ZG3A 3G73A 5ICFA 1L3LA 4YG2F 2R3SA 2K7LA 1SD4A 3U2RA 5E1WA 4LLGF 2OD5A 4MQ9F 5D5XB 3L7WA 1CGPA 2VBXA 1DP7P 5DCMA 2HKOA 5H20A 4DNCA 2QWWA 5TJJA 1K79A 3GVAA 2HTSA 5AONA 2LNBA 1P4XA 1IZ1A 2GA1A 3BWGA 3BJOA 1D3YA 3B73A 1P4AA 2L54A 4S05A 5D4SA 3BY6A 5HLHA 3EYIA 4M9SA 4A0YA 1X3UA 3KP6A 1Z1DA 4RB0A 2G7HA 4HZFA 4U0WA 4BAYA 2ZXJA 3RYPA 4Y15A 1FP2A 1RI7A 3ROUA 2HDCA 4HF2A 2OA4A 1FOKA 1TQPA 2CGPA 4M6XA 2STTA 1ON2A 3ZP5A 3H3ZA 4UV8A 1QBJA 4N9HA 4M6YA 3COAC 3ZMVA 2VBYA 4RGUA 4Q48A 2K02A 3C3WA 2VODA 2W25A 4LK0F 3J80K 1R7JA 4L9VA 1USSA 1V4RA 2FNPA 3U1DA 3MAJA 3WTZA 5JHUA 1O3SA 3J81Z 4G94A 2G7UA 2HFHA 4N9IA 2YR2A 3QPTA 4RB2C 3WTTC 3LSTA 2EFQA 1LDKB 2MD5A 5HDNA 2BEOA 2OQRA 3TKYA 3WTWC 3DFGA 1FP1D 3VEPA 1XGOA 4AIKA 1D8KA 2ETHA 1HW5A 3WU1B 5BPIA 1CF7B 1QQIA 3C18A 3V7SA 4IVNA 3D5LA 1U5TA 2Z33A 1R36A 2Z5UA 1STZA 3BOQA 3P9IA 3N97A 2OU2A 2RGVA 3EETA 5FD5A 1U5TB 5AIQA 4EGZA 3DEUA 4JQFA 2EA2A 4B09A 4UVAA 4OINF 1K78A 1IRGA 5K5QA 1UHWA 3J81K 1R1VA 1FBUA 3B02A 1ZRDA 1BC7C 2PMUA 5DDGA 3KE2A 3CUQA 5E17F 3ZMTA 1W7PD 3ZMDA 1DDNA 2LKPA 3ULQB 2ISZA 1EV7A 2FF4A 1E2XA 3ML6A 3GXOA 4EJTA 3E6MA 2VC0A 5DUIA 3WGGA 5BOXA 3PFIA 1D5VA 1B6AA 1LDJA 1FBQA 2L02A 4KIFA 6PAXA 3KETA 1D8JA 4ZYHA 5D4RA 3KZZA 5HS9A 2VONA 3I59A 1YYVA 4A12A 3G3ZA 4U88A 4XBFA 3T8TA 4HX8A 2OBPA 5E1XA 3V8JA 2QZ8A 1P6RA 2EWNA 3TO9A 3JAMZ 3MEXA 2UXNA 1ZGJA 2CQKA 1KU2A 1ZN2A 2DLLA 4GXOA 5ED4A 1OYYA 2V9VA 2X0LA 2PI0A 3DPTA 2DPUA 1PP7U 3PQJA 2P6TA 4WXDA 4M9XA 4JBAA 4WF2A 1RIOH 2E7WA 1OR7A 4BHPA 5DEQA 1I5ZA 1QPMA 4IXAA 3R6SA 2D1VA 4LLNA 3AAFA 2ACJA 4RAZA 4BHCA 5FLXZ 5ICGA 2H6CA 4KN4X 1EH7A 5F1RA 4QWQA 5L3BA 5CJ9A 4HV5A 4P55A 4S04A 2ADUA 3FXUA 2QENA 4L9TA 3W6KB 4FX4A 4GCVA 1OKRA 1QO0D 2ZO4A 2FQ3A 4CXFA 4P5OA 3C7JA 4U7BA 3F21A 4OIPF 1SFUA 3SZTA 1ZLKA 2XGXA 4ZH4F 4HOBA 2M45A 4WK8F 2NS0A 3ERED 1O57A 4G7HF 4ASNA 2NNNA 2H27A 2D45A 3Q9SA 2JSCA 4KIBA 2ZBKA 1O7FA 2YX4A 5LGNA 3ZN1A 2KKOA 4KNYA 4HW0A 3R4KA 2BBYA 3GZ6A 1QZYA 1TBXA 1U2WA 1LQ1A 1TW3A 5ERIA 2W24A 4HX7A 3IHUA 1RUOA 3M9AA 3K1PA 5ILUA 3M1EA 3HHGA 3FXQA 3O3KA 2VXZA 4AWXB 1UCRA 2F2EA 3V7RA 2GXBA 4KIGA 1LDDA 2H09A 3K1NA 5DUKA 4LB5A 3Q9VA 1S29A 1J9IA 3LA7A 3LQQA 4EMSA 1F4KA 4KN7X 3HSFA 1Z6TA 3V8KA 4P9UA 1FYLA 2CWEA 5CVJA 3FX3A 3HYIA 4DQ2A 3RIRA 4OIRF 1U3EM 1T6SA 2IT0A 1GVJA 2ZMEB 3FXRA 3L2CA 3HRUA 1REPC 1KQ0A 2ZMEA 2RDPA 4HLYA 3ZMUA 1YG2A 2XV4S 2PBIA 2PJPA 2PN6A 4HDUA 2IJLA 5D8LB 3I5UA 4CDGA 4EV0A 3ELKA 5HS8A 2C6YA 4CHUA 2CG4A 2EFOA 3F6VA 1EH6A 2XAJA 4A6DA 1BN5A 1O7LA 2XKOA 3BJ6A 3O6BB 4L9NA 5IT9K 5FLXK 2XAQA 5ILSA 1TW2A 1JGSA 1MZBA 1U6GA 2VT3A 4KMUX 3TDUC 4ESBA 2JRTA 1WI9A 4HA8A 4WXCA 2E1NA 2DW4A 5D5VB 2VC1A 4HDVA 3WU0A 3I71A 4Y17A 5IT3A 1ZRFA 3MQ0A 5E8IA 4RGSA 3OOPA 1ZREA 3CJNA 3DKWA 2JTVA 5D6FA 2FMYA 2P4WA 3KZYA 4YIFA 3GWZA 4KA4A 5KK1A 4G6QA 1W5SA 4HF0A 2RKHA 5EEHA 2FEZA 4B8XA 3JAMK 2FRHA 5H6QA 2FBIA 2DAOA 2HOEA 5LRRA 4L5JA 1T0FA 1ZGAA 1TNTA 5HOOA 3F23A 1XMKA 2CFXA 2WV0A 3FMSA 2X4HA 1SD5A 2CO5A 3RPUA 3ECOA 4EVIA 3GFMA 5F64A 1KU9A 3J7AO 3TQNA 1MJAA 1FZPB 1R5GA 2IPQX 3VFZA 2J5OA 2IA0A 1QNTA 3I59B 2QUFA 5D5WB 2EV6A 2QLZA 2KJBA 3IRQA 3V4GA 2GA2A 4OIQF 4GYIA 3OV8A 4ZZLA 3BPVA 3QP6A 4ZZDA 3KP2A 1TQIA 4M73A 2V6CA 1K6OA 1V3FA 4UNOA 3NRVA 1OYWA 5E1ZB 2A68F 2XKPA 1S3JA 1JXSA 2EA4A 3F8NA 2O3FA 5LLQA 2O03A 5J8CA 4Q4ZF 2F5CA 3KP4A 1R58A 2PQ8A 1EH8A 1KQ9A 1U5TC 1WWXA 4I0BA 2YU3A 3WG9A 1SMYF 4EJVA 2GWRA 2E1CA 1XSVA 1PP8F 3DP7A 2JT1A 1GXQA 5LHIA 1YW8A 3GFIA 2F5DA 3RPQA 2Z99A 5LHGA 2Y0MA 3QAHA 5DD4A 3TGNA 4BHBA 3T0YA 1YFHA 1OMIA 1SD6A 5DD8A 5L3FA 2PMHA 4AIHA 3E5QA 2ISYA 3LAPA 2DBBA 1MKMA 2RC4A 3IKTA 2P7CB 2Q0OA 2M5WA 2JPCA 5DCFA 4OMYA 1XDSA 4JK1X 4HYEA 2XHKA 2MC3A 1G3TA 5E20A 4ENKA 3RI4A 2P7VB 1ULYA 2AS5F 4MQVA 2P5KA 1RUNA 1TQMA 4HF1A 3EUHA 3HOTA 3J80Z 4L5IA 1FSEA 1F9NA 2YX7A 4HBLA 3RKXA 1B1BA 4R1HA 5BQTA 4ENNA 4CZZA 2LDUA 2DU9A 4M71A 3VOEA 5L3GA 2KIUA 2P5LC 2HZTA 1S8NA 1KGSA 3GX4X 2AXLA 3IWFA 1R00A 3SFZA 2BE5F 3RYRA 4A2UA 2FSWA 2L4AA 1G3SA 1ZHFA 1Z91A 1MJBA 3QPHA 2WWYA 3NEUA 2MLGA 2BYVE 2L01A 2FE3A 4G7OF 3WTUC 2EFPA 3JSOA 1YIOA 3WTXC 5F6FA 4IRGA 2V1UA 3R0AA 4IPAA 5FO5A 5ICEA 2JZYA 4NHJA 1YTYA 4I98B 2ZJ2A 1BI1A 1R1TA 2P6SA 2EV0A 1ZAOA 2H6BA 2G9WA 3S2WA 1HKTA 3RKYA 1KYWA 3QU3A 5LEKA 2ZNZA 2A5YB 1I27A 3GLXA 2UZKA 3CUQC 5FFZA 3RJPA 3T8RA 4EM2A 1FBSA 4LD5A 5A2QK 1A04A 4A0ZA 1U78A 4G7ZF 3TO7A 5E8GA 1TLHB 3JSPA 4I0AA 1BIBA 1IXSB 2DFIA 4ZYGA 2O6GE 1ZARA 3N4MA 1J59A 3R60A 4L18B 4GO1A 3MCZA 4M9ZA 3K2ZA 2FBKA 3Q5FA 3CO6C 2CW0F 5LRSA 4HX4A 1PDNC 3T1BA 3LQRA 1GHCA 4XSZF 1IN4A 2IP2A 1FSHA 1RZ4A 4WCGA 2K27A 4U0VA 1KQ8A 3REOA 3FHZA 3F6OA 3V8LA 5DYMA 3DV8A 2RVCA 1Z7UA 3HRTA 2DK5A 2D1HA 1IRFA 4A6EA 2BGCA 3EDPA 1WRJA 3E5UA 1K7AA 3LWFA 2VE9A 2P8TA 3L9FA 1WQ2A 5D6EA 3GO5A 2QVOA 1HW2A 1FPQA 3P9CA 5CVUA 3BZ6A 3I53A 2VOOA 3E6CC 2PLYA 3GFLA 3E6BA 1C0WA 4G8XA 4L0YB 3MZYA 2A07F 3R0JA 2H94A 1BBYA 4LG0A 3VODA 3CTAA 1B9MA 2F5FA 5CLSA 1HKQA 1IN7A 3FWEA 5HDGA 4ON0A 1LVAA 1LEBA 3K9TA 2ELHA 1Z05A 5CVRA 1R23A 1P92A 2M8EA 2XAFA 1TTYA 1BI3A 2YSRA 4G6DA 1J0RA 2R7DA 4I2OA 1WSUA 1I6XA 3K69A 3IKVA 1BIAA 1Z9CA 3WGIA 4EM1A 1IXCA 2COMA 2K4JA 2PEXA 2HKXA 2GZWA 2RN7A 4IF4A 4ESJA 1XB4A 4RGRA 3F8FA 1XDUA 5LHHA 2NAZA 1VTNC 1H9TA 1XSXA 1F1ZA 2QM3A 4MEXF 4RB1A 5LBQA 1J75A 3GEZA 3QRFF 5DV5A 1G3WA 4OMZA 2IRFG 2A69F 2NYXA 4KICA 2F5EA 3KEQA 3KCCA 4UHTA 1HSTA 4UXNA 2KJCA 1OYIA 2W57A 3WGHA 4EJWA 1UFMA 2A3SA 5H6RA 2CSOA 1S7AA 4ETSA 3FMRA 3WE3A 3PQKA 4HV6A 4PGGA 5HDKA 4LJZF 2EFNA 1BJAA 1LB2A 1IAWA 3F3XA 4K2EA 2NRAC 4GGGA 5DCMB 2TDXA 2HYGD 2LF7A 2MH9A 2FA5A 1IF1A 1Y0UA 2HGCA 2HTJA 2NNYA 2XASA 2DK8A 5A2QZ 5BPDA 1BM9A 3RTRA 3WE2A 2CYYA 1ZG5A 1IN6A 5HLGA 4A0XA 4G9YA 5JI6A 2IA2A 2K86A 1HQCA 5IT9Z 3EQLF 3IL2A 2B0LA 5JFRA 1XGSA 3D0SA 1Z6RA 2ZFWA 4CGZA 4OU0A 1YQAA 1FYMA 3FF5A 1J7KA 1BC8C 4IHTA 4A5NA 1QZZA 3F72A 2M87A 3ZQ7A 1XD7A 1H9GA 1JHHA 4HLXA 2DPDA 4FX0A 4GYGA 2OZUA 2RV8A 1LNWA 3CDHA 5HVQC 4EQQA 1PUEE 3H3UA 3M8FA 3FMQA 2GXGA 3ZPLA 4RAYA 4MTEA 1FX7A 4Z2YA 1KU3A 1R5HA 5FB2A 3QP5A 3SZPA 4WX9A 3P9KA 1RNLA 1MJ9A 2FNAA 2PG4A 1O3QA 1LEAA 1H0MA 3HSEA 4A5MA 2IW5A 1B4AA 2YPRA 4BH9A 3BPXA 2VBWA 4KYWA 1E17A 4CO8A 5KVRA 1O3RA 3ZMZA 4O3MA 2QQ9A 1B9NA 2L4MA 2HWVA 5J8FA 3L00A 3HUGA 2HYFA 3LAJA 3LA3A 4KFCA 1FNNA 1J2XA 4XLPF 1T2KA 2MBFA 1MDMA 3K1MA 3HSRA 2R7FA 4YFNF 1W5TA 3I0TA 2EB7A 2KIMA 4KUMA 4FT8A 3ABTA 4KT5C 1MDMB 2BV6A 4ENMA 2A6HF 1YO5C 1J5YA 2M30A 5LGTA 5CYVA 1T39A 2GIVA 2Z9OA 2Y48A 5BMZA 4ZYDA 3DF8A 2QBYA 1DPUA 3HTUA 4L0ZB 4M72A 2MA3A 3TO6A 3CUOA 1K78B 4KMFA 1HKSA 2VT2A 3T5XA 5ICCA 2O8XA 3GW2A 1W4MA 3F8BA 1HSJA 4ESFA 3HOSA 3F22A 2ESHA 3HHHA 3DXJF 2OZ6A 5AIPA 4PCQA 1JHFA 4XRFA 1ON1A 1I1GA 2WTEA
chains in the Genus database with same CATH superfamily
3F8CA 3FXOA 2ESNA 3WODF 3BROA 3PUSA 3R61A 3SYTA 5IP6A 4UY8I 1KFYA 3C51A 3TDZC 2ZSIB 3FK7A 2FOKA 5EGOA 2NVXJ 2LY9A 3R6NA 3PO3J 2D2WA 2P5VA 5L3EA 2VVNA 5DQVA 2DA5A 3SXYA 2HQAA 4D0PA 4PFPA 1MSFC 2A05A 1SD7A 3CD6I 2NVTJ 3HKEE 2VKJA 1R9TJ 3RC3A 1R1UA 2I10A 1T8IA 3EVYA 1LVKA 1S7OA 2J5PA 3KEOA 4O5VA 2QGUA 1BI2A 1FEWA 2VKEA 3MZHA 3AE2A 2XF7A 3LK3B 4JBWF 3RGLA 4HTEA 4CN4A 2HOAA 1EKEA 3JTHA 1H88C 1X19A 4HSRA 4RGXA 4KDPA 1XSDA 2LT3A 1XCBA 4CN1A 4YTNA 1ZLJA 3H9JA 2E9XC 3RIUA 3A1YA 2QYOA 1ODDA 1ZEEA 5FFXA 2KPMA 4JI2T 2DA6A 2Y0SA 4BE0A 1FYKA 3K4CA 1X79A 5GADJ 1NK2P 2A6EF 4RB3C 4DYQA 2E9XA 3FZMB 3BZCA 3S3NA 1AOYA 1E3PA 4EJUA 4BS9A 5J2UE 1BJZA 4E7ZA 1U4QA 3F57A 3KP3A 4B6XA 4I7HA 3EDVA 2CUFA 3W6JB 4OYKA 4PJJA 2DT5A 2XQ8A 2H89A 2OQGA 5FJ8J 4XLNF 1XGNA 2WS3A 3IWZA 3F8MA 2ZKZA 5K1YA 3PO2J 3LFKA 4HWIB 5F0HA 4PJLA 2EIJH 2NW7A 5JR9C 4CYDA 3BR3A 3AE7A 4BYYA 4LOCA 5C4XJ 4O2BE 3ZC0A 1G6NA 2XASB 5LP6E 2M1BA 2VBZA 4A3CJ 2DI3A 2L2OA 2YKSA 4I02A 1UCUA 3K3NA 4FHTA 3RKWA 4CCLA 2KIFA 1T98A 3MA9A 2SPCA 3WG7H 1SMTA 4X5TA 3UULA 4A56A 3EYYA 4PJNA 4HFBA 1KYZA 4H9SE 1IN5A 3ABUA 3KFWX 3PUFA 2LC2A 5L3DA 4BNCA 1FC3A 4O6JA 4RDUA 3ZN0A 2XDVA 5KAFC 1E3HA 5EEGA 2FJBA 2WP9A 2DQRA 4M74A 3O2PE 2FU4A 3G1MA 4NUBA 3AECA 1IRZA 2QQBA 4IZZA 1WH5A 2Y75A 4E6KG 4TX5A 4C3IJ 1F5TA 4BY7J 3FK6A 3B6CA 2XQAA 4XIDA 5KX5E 3BP8A 2WC2A 5DABA 4MFEA 4GFBA 1W7PB 3RSNA 2W2UA 4N4NB 4HAMA 2EHOD 2RNJA 4ENJA 4AYBN 4JYAT 3TLWA 2A61A 4NQWA 4Q5SF 1US7B 4YELA 2K3PA 5D8KB 5LBMA 4MBQA 3VYUB 1BI0A 4R79A 2OCCH 3LJCA 5AQMB 1SFKA 5FP3A 5HCJA 1SEUA 2R92J 3DPUA 1ONVA 1W7PA 1UHMA 4HQMA 1JUSA 4H0EA 1KU7A 2DQLA 4MHGA 1AHDP 4EGYA 3SEZA 4MO7A 4U0YA 3KP7A 1PUFB 2OAZA 3FBZA 1Z3YA 3RQ4A 1TL8A 3VWBA 4YEJA 4RS8A 2DOFA 2K9NA 3HRSA 1N75A 3HKZA 3CC2I 5B1BH 2KXPB 2DHRA 2FXAA 5LHHB 2X48A 5FLVA 2L9SA 4ZI3D 1LJ9A 3VSKA 1AJ3A 2Y9YA 2VJ5A 1FIOA 2L7FP 3IC7A 3S15J 3HG9A 4ZC3A 2XPVA 5E3NA 4BA9A 3QNUA 1I1SA 2WBLA 3WAKA 2EZKA 1NHAA 3LSKA 1J1JA 2DA2A 2WB1N 2XVCA 2ZNYA 4NC6A 3OSFA 4IQJA 2LHRA 2QQAA 1FWZA 1BOAA 1D0YA 3BC8A 3L39A 4F3QA 4WWCA 2WMOA 3U9GA 3ZMUB 3FM3A 2QVAA 1QUUA 1YJ9I 1VCSA 3N9LA 3P4WA 4UF0B 2EJRA 1WI3A 3PUXF 3K3OA 1YJWI 1LFUP 4PSWA 4AUXA 2Y31A 4H63H 4JP0A 2E71A 1XN7A 3IV5A 4LFUA 5H6RB 5EEAA 3CO7C 5JDLA 2Q2EB 4Q47A 3RCOA 2KT9A 3KIOA 1MMDA 3PNTA 2JQ7A 3HOVJ 2ZCWA 4ZI2C 4PAGA 4UXNB 4AYBA 4QLCU 4L0RA 4WXHA 1TWFJ 2LY1A 3AE5A 2BY3A 5CVIA 4BJ5C 2JQKA 2XGEA 1LE8B 3PUQA 4BXUA 1JGGA 3GZ5A 2BG9C 1QVTA 1SAXA 2KRFA 1X4OA 3QYBA 5GAEJ 5KNLA 3I4MJ 3TOBA 2V9KA 5JVTA 5HXCA 3CJQB 4CCOA 4DZJA 5IHYA 2NVQJ 2VQCA 2KISA 5IPAA 1JUPA 1W5CC 3GUDA 2LK2A 5CVVA 1N36T 3E97A 3OVUA 4IRIA 4XR6A 3IRRA 1G3YA 3TLTA 3OBVE 2WU5A 2MGQA 3SRZA 1QGPA 2IA1A 4CICA 2O61A 3RYCE 3AA1B 2H3RA 4YXDA 2W84A 2R6GF 1USTA 2O0YA 2DMUA 3HTSB 3HBLA 3TLVA 3CESA 1IV8A 5CKTA 3JRIA 1SFXA 4LGWA 3JADA 2V1DA 3UFGA 1OEDA 2WWUA 2W00A 3UUMA 1UB9A 4RA2A 3CC7I 5IYCJ 4LIUA 4LMJA 4AISA 2XIGA 3DPLC 2EH3A 4HFHA 3AFHA 2JUGA 3HKZN 1U8BA 4EJOA 4PZJA 1FTTA 3OKQA 2NP9A 2PFBA 4DV6T 5JRCB 1TT5B 4CCJA 3SQNA 1YS7A 1W09A 4DR5T 4AIUA 4OYJA 4UVCA 2V79A 4F91B 2XUEA 4CCNA 2Q8KA 3SFEA 4OAZA 3ECHA 4XNFA 3ZQFA 2BKNA 1P2FA 1QHGA 4UV9B 3RZOJ 4EB6E 4I09A 5HODA 3DU6A 3E6DA 4A3FJ 3K4MA 2JK3A 2CE7A 4QPQA 4Y13A 2XROA 2ES0A 2Y48B 2A2FX 5F3JA 4X20E 4CI3B 2M6IA 4MTDA 5AQKB 2CQQA 4DR7T 1IW7F 1I6ZA 3L09A 4UV9A 4O8SA 4EV6A 3M8EA 3I4PA 4U3CA 3DJBA 1ZYRF 5ILVA 2Y0SN 1QA6A 1VQLI 3BCBA 3I64A 2B76A 2L0KA 2ZXWH 1UZCA 3C1DA 2W66A 4V1Av 2DMNA 2R7WA 4LMYA 4LFCT 1V5EA 3M8JA 3NQOA 4UUVA 1MIWA 4FI5A 1XGMA 1DUXC 2IC9A 4UELA 1MIYA 4B3XA 4UVAB 2RQPA 1JE8A 4LF6T 4BAYB 2J47A 2QKMB 2W85A 3E1SA 2QBYB 2EK5A 2KNDA 3I54A 4JX5A 4U7DA 2VPLA 3JW4A 4ZJZA 2ZSHB 5L3CA 2HPMA 3BDDA 2IUBA 3WTVC 5E18F 1YI2I 3ZLIA 1FT9A 4TNVA 2LSOA 2VB6A 1WKMA 1Z3XA 4HEAA 4C2UA 2STWA 3M7GA 3Q0UA 2XJ7A 3CUQB 2RREA 2W1OA 3I3LA 1AWCA 1IUYA 2UUCT 2XSDC 3IA3A 5H2FC 4BJMA 2LY2A 1IN8A 2YN6A 2DMPA 2HQRA 3CKDA 3K0LA 2XGCA 2KLQA 1DQUA 1I1GA 2VOPA 3JRDA 2CJJA 2MH2A 2JPBA 1XCVA 5FKOA 3H3VK 5F04A 3CQXC 3BK9A 4IE7A 5LEJA 3QOPA 2FQ4A 4IJAA 3O8HA 4PDKA 2WY7Q 1R22A 4YFKF 2HEOA 3F0CA 1FOYA 4F7ZA 4EM0B 3BG9A 1JI8A 3MKZA 2HPLA 3F9KA 3E0JB 4N0BA 3KLOA 4NB5A 1PVEA 2NXNB 1YXRA 4IHVA 3HIFA 4YIIA 3PUWF 3TLSA 4Y52J 1HW1A 4HEA2 1IXRC 5LCYA 1HS7A 1Q1HA 3CP2A 2IAKA 2OV7A 1ZKGA 5HLIA 2C0SA 3RHWA 3UU6A 4P1WA 2O7OA 3RQIA 3CQZJ 1X1CA 2JRMA 3JTGA 1UK5A 4TV9E 3ZMVB 1ZK8A 5AQSB 3LSIA 1L0OC 1KK7A 2K4BA 3N5LA 4JI4T 1GXPA 2F4IA 1WJ5A 3KYDB 2QSGX 3S2HJ 2LOPA 4DNDA 2VI6A 3EDUA 5EG0A 1K4SA 2VQFT 5C3JA 2DFFA 4IHYA 5J3LA 2KZ7B 4LMKA 4YHJA 2EFWA 1V5GA 2BY2A 4M3BA 2VKDA 2GOXB 2VN2A 3E0ZA 2DO7A 2FOWA 3FISA 2XAGA 4L9JA 4MGRA 3LNQA 4YFSA 3U78A 3HRMA 2XAJB 1QHHD 1LUJB 3CP8A 3H5AA 1A31A 5FYMA 2P0WA 2HH7A 5CJ5A 4MEYF 1E7PA 3WHBA 5FD6A 4UUTA 3NRXA 1YS6A 4OIOF 2DCFA 4IHSA 4UVBB 4BJNA 4C90A 2MD0A 3SHFA 4P1NA 3QU6A 1W36D 2X1DA 3ZR8X 3CMEI 1H89C 1LVFA 3PJAA 4Q25A 1EA3A 1YW7A 2XAHA 1ZRCA 4PK4A 1OXZA 3NRYA 1X3WB 1W0TA 3I58A 4AQGA 4D1QA 4UVBA 3OYLA 3H5RA 3J9X1 3ZMSA 1XTAA 5C44J 2Z6EA 4LG0B 3KV9A 4CXYA 2E7XA 1OEDE 3AA7B 5FXVA 5AQLB 1XMAA 3G1LA 5LHGB 2UXXA 4AD9A 3V7CA 1T38A 4V2GA 1D5YA 2IGMA 3ISPA 1KZHA 1HTJF 3U1KA 3KV4A 4PGHA 4HFIA 4P9FA 1CF7A 4ILAA 3ZMSB 4M3DA 2DDAA 5K5RA 1MIVA 1E0EA 2OJED 4M3FA 1KNPA 4MNUA 3H0DA 3DWLE 3JRBA 4TV7A 3ZGKA 1O3TA 2HR3A 4AM3A 5DQWA 4ZYEA 1YHQI 4BQAA 3KP5A 2R7VA 5BS6A 2XUBA 3QOEA 2Z16A 2DOAA 3OS1A 2XB5A 2C5JA 3VPRA 3P7NA 2IVMA 1B8IA 4ISTA 4YFXF 1ZGWA 2LF8A 1YW9A 5LFAA 4LK1F 1BW5A 1SA0E 2GAUA 2DLRA 3MWMA 5TRDA 2Y30A 3N2OA 4IDNA 4OOIA 3VB2A 1WR0A 2DTRA 3CF2A 5D5UB 4LF8T 2VLAA 1ZG1A 1VQPI 1F36A 2EPFA 3AKZA 2LR8A 1G4DA 4F92B 3BTLA 1TZLA 2B9SA 3RDIA 3I9YA 5JR3A 3H36A 1BR0A 4YRVA 1SFEA 4LLLA 2MLKA 4HQEA 2XRNA 2E19A 4E70A 5J1UA 1KNZA 3NWIA 4P96A 3IH2A 2CLYC 4AI6A 3RI5A 2O5RA 1LKXA 4OWRB 1MD0A 3FM5A 5F5WA 3VHLA 1Y8QB 1YLFA 1ZHCA 3N9QA 2MAWA 5FY7A 3I55I 1I94T 3KLNA 5FGMA 3GF2A 3ESLA 3FZVA 3CF5F 3LMMA 4ZI3C 5LXTE 1ETYA 2YK0A 2VE8A 2ZXHA 5K5OA 2DA1A 2EV5A 3QYFA 3GYHX 3RZDJ 2KDZA 4C9YA 3FIWA 2UWMA 1P4WA 1M7KA 1S6LA 1APLC 3CCVI 4AIJA 2P9BA 2M6BA 4LB6B 5F08A 4X64T 4EZHA 1B7TA 3F2EA 3H3MA 4LITA 1GDTA 2HYJA 3WTYC 3SFDA 1KA8A 2JA7J 2E2IJ 5HS7A 3U21A 4O4LE 2ZM6T 2E5LT 3ZQIA 3KINB 1BW6A 4HWFA 3SFIA 4F6RC 4DVDA 1TNSA 4YTMA 5ABGA 1XDPA 4ISSA 2HS5A 2Z3YA 4I01A 2QCOA 3LA2A 1Z0XA 4B3AA 3CLOA 5J4YA 5J4VA 3WTSC 2Q2EA 4TWHA 1T95A 3GFJA 1UG2A 1G73A 3CLQA 2YS9A 5FROA 2WAQA 2FMLA 2EZIA 3M65A 4R8HA 2OF7A 4XSXF 4IRHA 3TMOA 3WU2C 4XLFA 1FY7A 3GTKJ 1DPRA 2VURA 1UELB 1OCOH 2IGNA 2V1XA 1OPCA 1U5PA 3BJAA 2HQNA 4HG2A 1U8RA 4DYRA 4XBFB 2CU7A 1MGTA 1JTXA 2DJNA 3E5XA 1CQTA 2EHOA 4AVPA 4ZI7E 3K10A 2H8RA 2B7EA 3E3VA 3PU3A 2GQQA 4DGWB 2CXLA 3DQVC 2EILH 4A93J 3H92A 4AQFA 1I6HJ 2D9DA 2FBHA 3BQKA 3BTJA 3FHNA 1FLIA 5LGUB 3PSIA 1HBXG 1B59A 1HXDA 3MFKA 2JJ9A 1ZH5A 1IDYA 2Y8DA 4B3RT 2WDVA 3TOAA 4HNTA 3EI0A 3S93A 5J6XA 3T8OA 1HCIA 2Y6XA 2L3DA 2UUZA 5E3MA 2R7TA 5LGUA 1ZG3A 1ETXA 1ITYA 3LSGA 3G73A 1HX8A 5IP9J 5ICFA 1L3LA 1MSEC 4YG2F 2IS1A 2OV9A 2R3SA 2K7LA 4UB6C 2CBJA 2QEXI 1SD4A 4FTHA 3U2RA 2XZEA 3M07A 4E4HA 5E1WA 2A72A 4YJ3E 2CM0A 2WWVA 3K8PC 4YSYA 4LLGF 4ADZA 2OD5A 1OQYA 4XN3A 5TAOA 4MQ9F 3K2AA 4EXTA 5KXJA 2D5VA 2WDRA 1XPXA 3W2WA 5D5XB 2R7SA 3L7WA 1CGPA 3DKYA 2VBXA 1DP7P 4XLAA 5DCMA 4IX7A 3Q2MA 1IC8A 2X0HA 2QSHX 4B3MT 1ZV4X 2HKOA 5H20A 1SUMB 2K24A 2NWBA 4DNCA 2QWWA 5TJJA 2OPTA 4AKIA 4WZXA 2BS4A 1K79A 1OCRH 3IH4A 3F31A 1MNDA 4XQFA 3GVAA 4ANJA 4E7SA 4F55A 2HTSA 3AB3B 2O9LA 5AONA 4HRIA 2LNBA 3BR5A 1SC7A 2BDEA 2BZBA 4QHOA 2XRLA 4X6AJ 1P4XA 1IZ1A 2GA1A 2R0QC 2HXOA 3BWGA 2NTXA 3BJOA 1D3YA 3A5XA 3O9XA 3B73A 3FBNB 3GTJJ 1P4AA 2ZB9A 4II2A 4NXMT 3P7IA 2IGKA 2L54A 1Y64B 2M0MA 5IYBJ 3M4OJ 1FMVA 4BQOA 2ME6A 3LK2B 2M8GX 4ZXLA 4S05A 3HGGA 1HNWT 5D4SA 3BY6A 1WYCA 1T0FC 2D2SA 3PUVF 5B5EC 4LMLA 3U3IA 1VOMA 5HLHA 2BZTA 4AKRB 4EZ4A 4K0KT 3EYIA 3FZFB 5JDMA 4M9SA 2CRBA 4YT0A 4A0YA 1E1HB 3BT9A 1X3UA 3KP6A 3FKJA 1YRNB 1Z1DA 2BXYA 4RB0A 2LJLA 3S4UA 4TN7B 1SANA 2G7HA 2LYCA 4HZFA 3BG6A 1SVLA 4B43A 4BJ6C 1HCRA 4U0WA 4BAYA 4DR1T 5FLMJ 4DBQA 3H1CA 2ZXJA 5HEHA 3PM1A 3V42A 2ID3A 3S1NJ 3RYPA 1D1CA 4Y15A 1FP2A 2KFDA 1RI7A 1I3QJ 2Q1ZB 3ROUA 4A3KJ 2ECBA 2HDCA 4HF2A 3TP0A 2OA4A 4NXNT 4ZHQE 1FOKA 1MNEA 3S1QJ 3GBGA 2GLOA 5EF6A 4PK5A 2ZJQF 3JR9A 1TQPA 4A3JJ 3MZ8A 2CGPA 4M6XA 2STTA 4XZCA 1ON2A 2XB0X 4M3GA 3H3ZA 3ZP5A 3PUZF 3QODA 5EZHA 2WM9A 4JV5T 4UV8A 2YINA 5L4HA 1XNQT 1MBJA 5J0ZA 1QBJA 3CMYA 4N9HA 5FVLA 2C5IT 4DZPA 4BEHA 4M6YA 3RIUC 3KYCB 1NENA 3I1AA 3COAC 2NVYJ 2HHHT 2D5UA 3ZMVA 4TUYE 1UUSA 3W3CA 1J09A 3FZHB 3Q3SA 2IBDA 2VBYA 4RGUA 3CK6A 2CW7A 4Q48A 2K02A 1D0XA 3C3WA 2CQXA 4NC8A 2HXIA 2VODA 2CH0A 1QVUA 2W25A 2ACZA 2CRGA 2WAFA 1DGWY 2VKOA 4LK0F 2EQRA 2GIZA 3OL3A 3ZN1B 4XL9A 4CI1B 5M4YA 1OLTA 2XM1A 2CS3A 2H1KA 4D5FA 3J80K 2DT6A 1R7JA 4L9VA 1VQ5I 5JDHA 1FJLA 3HUGB 1USSA 2KRCA 1V4RA 2FNPA 3U1DA 4X0GA 3P4RA 1IDZA 3MAJA 3WTZA 1WJEA 1X1BA 5JHUA 1O3SA 5FL1A 3J81Z 3HEFA 4G94A 3GTMJ 4U2YA 2G7UA 2HFHA 2NW9A 4N9IA 3RYHE 2YR2A 1N34T 4E7IA 3QPTA 3N9OA 4BXFA 4RB2C 3WTTC 4HWCA 4IDPA 3LSTA 2EFQA 1ZKEA 4RLQA 1YX5A 3GTQJ 1LDKB 2MD5A 5HDNA 3MKDA 1GV2A 2BEOA 2OQRA 3NWTA 3H35A 3TKYA 3WTWC 1AKHA 3DFGA 1FP1D 2JN6A 1XMOT 1NG6A 1XGOA 3VEPA 4AIKA 2HDDA 1YKHB 1D8KA 4B3ST 5J47A 1VQMI 3P50A 2ETHA 3VDXA 1HW5A 3WU1B 5BPIA 1CF7B 2HN2A 3VKGA 1QQIA 3C18A 3IP4B 3RPUD 3UR3C 2CHNA 3IH3A 3V7SA 4FQGA 4IVNA 2K3WA 3T1HT 4FJOA 3D5LA 1U5TA 4MIMA 2Z33A 1IAPA 4IL6C 1R36A 3BR2A 5IOYA 5J40A 2Z5UA 3N2GE 2V6YA 1STZA 3BOQA 3P9IA 3N97A 4IIJE 2OU2A 2RGVA 3EETA 5FD5A 3NZPA 1U5TB 4W97A 5AIQA 5IYZE 5KHDA 2V7MA 1BR1A 3ZCJA 5LGTB 5LMUT 4EGZA 2K9QA 2E5VA 3DEUA 1JNRA 5HEGA 2W63A 5KDMC 5GAGJ 4AVZA 4XRMA 1ZELA 4JQFA 3AE1A 5JLWA 4DYCA 2HQ5A 2K3FA 2QQ8A 2WU2A 3OYXA 2EA2A 2MC4A 3PJRA 3CCRI 1D0ZA 1RKWA 2EZHA 3E22E 3GWHA 2M4GA 1L0VA 4B09A 1BOBA 2VQET 4UVAA 5J2TE 1GQEA 2UUBT 3V5UA 4OINF 2L3LA 3C2HA 4GKKT 2CCQA 2LVSA 1K78A 1IRGA 5GTHC 5K5QA 4BE2A 3ANWB 3FXKA 1UHWA 2J1DG 2P81A 4ZS3A 4DV5T 3J81K 2HN1A 1R1VA 1FBUA 3B02A 3QQAA 1ZRDA 2GM4A 1WLXA 2JQHA 3ZEFB 1BC7C 2ZMEC 5IP7J 3S3OA 2PMUA 5DDGA 2VWAA 3KE2A 2XQ3A 3RIFA 2UXBT 4IEJA 3LSPA 3CUQA 3ZPOA 5E17F 3WAJA 1HNZT 3ZMTA 1W7PD 2ZXIA 2CMPA 3ZMDA 3UUNA 3OSGA 1DDNA 3DTIA 2LKPA 4I0UA 3ZXSA 1JTYA 3ULQB 2ISZA 1EV7A 2FF4A 5EGOB 4U7IA 1E2XA 3ML6A 3N2KE 4LF5T 3GXOA 1NG7A 2UV1A 4EJTA 3UFEA 4EOZB 5JR9A 3E6MA 2VC0A 3ZKRA 1RKTA 5HXHA 4AQYT 2K85A 5DUIA 1FTZA 1QLBA 5HCMA 2V26A 4O4HE 1RPWA 3WGGA 3BR6A 5BOXA 2KP6A 5DM6F 3PFIA 1D5VA 2LKHA 1DU0A 1B6AA 2CFOA 2QRXA 3FB2A 4KITB 2AE9A 1Q1VA 1LDJA 4UB8C 2W48A 2I8DA 2DXIA 2R93J 1FBQA 2L02A 4KIFA 4CYCA 3KETA 3HGYA 6PAXA 1D8JA 3TBIA 2D0TA 1XMQT 4ZYHA 1V55H 1YIJI 5D4RA 3KZZA 5HS9A 1HG5A 2VONA 5F27A 4UR9A 1WJDA 3MKYB 1X2NA 2XTLA 1NEKA 3I59A 1YYVA 3UU5A 1N77A 1ERDA 4A12A 3A4CA 2OA5A 3CIRA 3TLUA 3PV0F 5AQFB 3KX2A 3K4KA 3G3ZA 3TKLB 1ZQ3P 2XQYA 2X9DA 4U88A 3M3ZB 4XBFA 3PIOF 3T8TA 4HX8A 1E3OC 4H9RC 4DV4T 3BTIA 5B1AH 2EHOB 1IUFA 2R7QA 3M3YJ 3Q5XA 2OBPA 5FKNA 5E1XA 1W0BA 4EEBA 2ZJRF 4U31A 2QYWA 4IGUA 4H9PC 2HOSA 3V8JA 3DCFA 4JI6T 3GTOJ 2QZ8A 1P6RA 2EWNA 3TO9A 3KVAA 5L47A 2XAQB 1ETKA 2B1EA 3JAMZ 2CMRA 1HFAA 2E1MB 3MEXA 3SDBA 2WDQA 5F1JA 1HOMA 1VQ6I 2IC6A 2UXNA 4JI7T 1ZGJA 2CQKA 3NZQA 1J5ET 1KU2A 1ZN2A 2DLLA 2XSBA 4GXOA 4E7HA 3GLLA 3SEQA 3CCLI 5C2TA 5ED4A 3OYKA 1OYYA 1YE9A 2V9VA 5FRMA 2V7FA 2PMZA 4Y33A 1NWMX 1LFPA 3QB5K 3J7ZI 3UQ4A 3MKLA 3G1OA 3OJAA 1K83J 2KDOA 3OYHA 2CXDA 2X0LA 5IY5H 3TL4X 3HKDE 3OYIA 2PI0A 5ABFB 3JRHA 3QWLA 3DPTA 2UXXB 3A8YC 3AAAB 4B48A 3FXDB 1PP7U 2DPUA 2CEAA 2J4GA 1KF6A 2MYSA 3PQJA 4IL4A 2LSGA 3IAS2 3CVRA 2P6TA 3VU7H 4CUGA 4QH1A 4WXDA 4L5EA 4M9XA 4XICA 3IAM2 3LL7A 4JBAA 4WF2A 5EZGA 2E7WA 1RIOH 5M5XJ 1OR7A 4BHPA 2LKGA 2PJRA 1HDDC 2YUSA 3NKZA 3PUGA 5DEQA 2ODVA 1I5ZA 1QPMA 4IXAA 4C3HJ 3R6SA 2D1VA 4LLNA 5BMVE 2KINB 2E2HJ 1N78A 4CQIA 3FDYA 3P8CD 4ZZCA 3DTKA 4GOUA 4BE1A 1WHUA 3AE6A 3AAFA 2ACJA 2JWTA 4RAZA 4BHCA 5FLXZ 5ICGA 3LBXA 5H6QB 3HM5A 2LE8A 2H6CA 4KN4X 1EH7A 3ZQLA 3BR1A 4LG3A 5CFBA 1UMQA 5F1RA 1F43A 2IXSA 4QWQA 5L3BA 5CJ9A 1VI0A 2VASA 4CZCA 3RH3A 4EEDA 3CJRB 4YIRX 5ABFA 2V5CA 2XF6A 4QX8B 3IHRA 1JNZA 4HV5A 4P55A 3FKIJ 1YITI 1WVRA 4S04A 3ZYKA 3QK6A 3A0BC 4JI1T 2ADUA 5AQNB 4OHFA 3FXUA 2QENA 2LKSA 2KWIB 2PX9A 4JI5T 3K4LA 4L9TA 3W6KB 4FX4A 4GCVA 4JX6A 5KCMA 1OKRA 1QO0D 1U0JA 2VK9A 2ZO4A 2FQ3A 1VQ4I 4CXFA 3UUBA 1HF0A 4P5OA 3ZT6A 3OPCA 3C7JA 4X1IE 4U7BA 2DTZA 3F21A 4WBNE 1YJNI 2ME0A 4IOAF 2NOGA 3K3QC 4QX7B 4OIPF 3JCFA 3BQYA 4OFZA 1SFUA 3VR9A 1W9RA 3SZTA 3OTOT 1ZLKA 4C91A 5LBQB 2XGXA 3O1JA 5FKMA 3BLYA 2Y69H 5GPAA 4ZH4F 3CMMA 4HOBA 1T56A 2M45A 2BHYA 4X1EA 2XQ5A 3W2VA 4WK8F 4ERRA 4A3GJ 1TWGJ 2NS0A 4UV8B 5AFUL 2Q9QB 1JJ6C 5M5YJ 2KLOA 3DEEA 4HGAA 5JTGA 2EBIA 3ERED 1O57A 3H3AA 4G7HF 2H8WA 1DP3A 3ESWB 4EEFG 4ASNA 1IO2A 2NNNA 2H27A 2PTFA 5LG4A 1ZR2A 2D45A 3Q9SA 4F52A 2JSCA 4E7JA 2DNXA 4KIBA 4QSHA 5EYRA 2ZBKA 4IDZA 1O7FA 2BY0A 5LYJE 2VL0A 2CQ7A 2YX4A 3R84B 5LGNA 3ZN1A 4BBRJ 2RP4A 2KKOA 4KNYA 4HW0A 4XOPA 3VRAA 3R4KA 4LIVA 1RRJA 2CW8A 5CA0E 1Z7LA 2BBYA 4YSZA 3PNVA 3UU4A 1ETWA 1T8BA 1XZYA 4I4TE 2KL4A 3OYEA 3GZ6A 2JA2A 4EIWA 2QA4I 3BG5A 1QZYA 3OYGA 3S1MJ 2CV2A 2M9HA 1MIJA 1WPKA 3SJMA 1TBXA 5EJCA 4DMWA 1U2WA 3H5NA 1LQ1A 2VVSA 1TW3A 3J7AY 1RETA 2E60A 5ERIA 3RKGA 2W24A 2V5DA 4HX7A 3IHUA 2XQ6A 1RUOA 3ASOH 5FKLA 3HL2A 3GMEA 3M9AA 3K1PA 5ILUA 1OCPA 2JVGA 1HX1B 2J62A 5FXWA 5A1LA 3GA8A 3M1EA 3ZRGA 3P4QA 5CA1E 3PE0A 3VYTB 4B3TT 3ERMA 3HHGA 2G0EA 3FXQA 3O3KA 4HFVA 3AG3H 4DUZT 3ZOBA 2VXZA 4ZTFA 4WBOA 4AWXB 1UCRA 2F2EA 3V7RA 2GXBA 3OYNA 4XKBA 4KIGA 2ID6A 1LDDA 2H09A 5FVKA 4X62T 3K1NA 5DUKA 3C4ZA 2BW3B 4LB5A 4N4OB 3Q9VA 1A6QA 1S29A 4C2MJ 1J9IA 1TP4A 1O3XA 1VQOI 3LA7A 4JEUB 3LQQA 5ABEA 4XOTA 3AG1H 3NWSA 3PTRB 3RQWA 5K7HA 4EMSA 1F4KA 1WYBA 4PJ0C 4P09A 4KN7X 3D0TA 4NDLA 3P5JA 3HSFA 1Z6TA 3V8KA 4P9UA 1FYLA 3D5RC 2V7JA 2CWEA 3AEFA 5CVJA 2IS2A 3FX3A 3CCJI 1TWAJ 3HYIA 4DQ2A 4CXWA 4PJMA 3RIRA 4OIRF 1U3EM 1T6SA 3AG4H 1TWHJ 2IT0A 1GVJA 2EZLA 2ZMEB 3LDQB 3ANWA 2FUPA 3CX6B 1H8AC 2VJIA 4W1UA 1Y0NA 1B72A 3FXRA 2HPJA 1MBFA 1VNDA 3K70D 2BG9B 5GP9A 3L2CA 2M67A 5JDFA 3HRUA 1REPC 1KQ0A 1UURA 1ZTRA 4EAHA 1W0UA 2N8GA 1WZ2A 2E5NA 2JMWA 2KMFA 2ZMEA 4XKWA 3BG7A 2JA5J 1CUNA 5L3CB 2DWKA 2RDPA 5B3SH 2JSPA 4HLYA 3ZMUA 1YG2A 1GVDA 4B44A 4OK0A 3ZT7A 1VQ8I 2XV4S 1GLNA 2V9PA 3MMYB 4NNJA 3W6VA 2BG9E 1Y6IA 2XQ4A 2PBIA 5L2LA 3CQGB 4B4CA 5AQUB 4XMYA 2PJPA 5FY0A 4QTRA 4N78D 5EK4A 3UQ7A 4I99C 2DYRH 1QZEA 4ZTJA 1K61A 2PN6A 3ONQA 3DLAA 4HDUA 2I59A 5GAHJ 3ZYLA 2W7NA 3SOLA 3RX6A 3ZMTB 2IJLA 2WY8Q 5D8LB 5HNFA 2FBWA 3I5UA 5FY1A 4CDGA 1UG0A 1X58A 3ELKA 4EV0A 2MG4A 2R7OA 2CHOA 3PJAJ 1XMXA 4AKGA 5HS8A 2JA6J 4HFDA 4FISA 2C6YA 4CHUA 3OS0A 4ZOLE 2CG4A 2EFOA 3E7LA 4V2FA 4Y4RA 3AL0B 2ZLYA 3PFYA 4I76A 3F6VA 3S32A 5FRNA 3GZNB 3ZQQA 1EH6A 1HA8A 3PUAA 2XAJA 3LSMA 4A6DA 2UXDT 2E34A 5JQGE 1GUUA 1K6YA 5K7ZA 2LRKA 1BN5A 3RRWA 3ZT5A 4DIDB 1O7LA 3DLLF 2XAUA 2XKOA 1OISA 3D5SC 4ZI2D 2VXDA 3BJ6A 3O6BB 3CJTB 4L9NA 5EK2A 1P7IA 5IT9K 5FLXK 1NH3A 2K9MA 2XAQA 5ILSA 4U87A 1TW2A 1JGSA 1MZBA 1U6GA 2VT3A 4KMUX 1BA5A 2RA1A 3C50A 3TDUC 2VUMJ 3QOFA 1MBHA 2WAEA 4ESBA 4PUSA 2JRTA 1YX3A 4B1RA 2L5QA 5F0CA 2IEKA 1K4TA 2BOLA 3OIQA 4G6TB 2YU1A 1WI9A 3CCYA 1HLVA 1SHZC 1XWMA 4HA8A 4WXCA 3J7Yq 2E1NA 3TEDA 2DW4A 1X9BA 1SFOJ 5D5VB 2VC1A 4YJ2E 4HDVA 1FOXA 4XONA 2WY2A 3GCMA 3WU0A 1FEXA 4NIQA 3I71A 3VYRB 4QXHB 3V5SA 2MPKA 2ELJA 3ONJA 4Y17A 3BG3A 5CQGA 2JMKA 2DA4A 3G4SI 5IT3A 4AU7A 1VF9A 1ZRFA 2W61A 3MQ0A 4P0AA 5E8IA 4RGSA 3A03A 4AIDA 1WCRA 3OOPA 1WJAA 1EJ9A 3IUOA 4TZ4C 4OX9T 2M4KA 2FD5A 2A3DA 5HLTA 2X6XA 4UEMA 1ZREA 1N32T 1R5ID 1ENHA 3CJNA 3QYEA 1B8IB 1V5FA 5LD2C 5JLXA 3DKWA 2E5ZA 2JPFA 2LLYA 4J01A 3B5MA 1P7JA 2CWOA 2JTVA 4LFAT 4JI8T 3O1IA 5D6FA 2FMYA 4KISA 3ZSTA 2P4WA 1X1PA 3KZYA 3H37A 4YIFA 3GWZA 4KA4A 3VSLA 2LSJA 5KK1A 2DODA 4G6QA 1W5SA 2WB1A 2AO9A 1GT0C 2EIKH 4HF0A 3WHCA 2RKHA 3ABMH 5EEHA 3FBIB 4YHHT 2CLYB 2FEZA 4B8XA 3LFMA 3JAMK 4IHJE 2FRHA 5H6QA 3CC4I 2FBIA 4KHZF 1RESA 2DAOA 3O4XE 3M1CA 2HOEA 3CDIA 2WV1A 1FIPA 3FXJA 5LRRA 3TP3A 3L2UA 3K70C 1ETOA 1ETQA 4RAFA 3CCQI 3PL8A 4O4IE 4L5JA 4RM3A 3Q5WA 1T0FA 1ZGAA 4NUUA 1OCCH 4QXBB 2CXFA 5ABHA 5HWYA 2OC6A 1TNTA 5HOOA 3HKBE 4DR3T 3F23A 4PNIA 1NAFA 2CUZA 2OTJI 3AEGA 2ZM8A 4XRSG 4DUYT 3N9PA 1XMKA 4K0UA 2CFXA 4BKXA 1HNXT 4Y3OA 3VKHA 2WV0A 1X1AA 3FMSA 2X9WA 5JREA 2X4HA 1SD5A 2CO5A 2MW8A 3CCUI 4ZS2A 3RPUA 3ECOA 4EVIA 3GFMA 5F64A 1KU9A 3J7AO 3TQNA 3HPGA 4B47A 1MJAA 4A3LJ 2GK9A 3I9WA 5L3EB 1FZPB 1UHSA 3RRCA 1R5GA 2IPQX 3HZJA 3VFZA 1SVMA 3RLFF 2J5OA 4IOCF 2IA0A 1QNTA 2LFBA 1VFCA 3EABA 3C4WA 2HOTA 2R7XA 3I59B 2QUFA 5D5WB 2EV6A 2QLZA 2KJBA 4M6VA 3GTGJ 4ZDPA 2Q9QC 2H1LA 1NTCA 3IRQA 3DTOA 4MFRA 3V4GA 2V7IA 2GA2A 2VQLA 1Z67A 4OIQF 4GYIA 2Q9QA 3OV8A 4ZZLA 3ZCOA 3BPVA 3H9QA 3QP6A 4ZZDA 3OS2A 4EGWA 3RYIE 2LRLA 3KP2A 2K9AA 1TWCJ 2NTYA 1TQIA 2FUG2 4M73A 2BBJA 1XNRT 1XDOA 2V6CA 3ZC1A 1K6OA 1V3FA 1WR6A 4UNOA 2LSIA 3NRVA 1OYWA 4DV1T 2X85A 3B57A 3L3PA 5E1ZB 2EINH 2G0UA 2LM9A 2A68F 5J1YA 4KX6A 2XKPA 3ABLH 1S3JA 4EATA 3PU8A 1JXSA 3C4XA 4TWFA 2EA4A 3BZKA 4H9NC 4U2ZA 5LGNB 5IYDJ 3CQCB 3DEWA 3F8NA 2BKPA 2CUJA 2O3FA 5LLQA 2DL1A 5FL0A 1MBEA 2E9XB 2O03A 3H0GJ 4Z6YA 2W67A 5J8CA 3CPZA 4Q4ZF 3I56I 2F5CA 3KP4A 4ZYAA 3MKWB 4X1KE 4KHPT 1R58A 5LHIB 1D1BA 2PQ8A 3S14J 1EH8A 4IDOA 4AQFC 1KQ9A 1U5TC 1WWXA 2HPIA 4I0BA 5HYAA 3Q0WA 3N05A 3G06A 2YU3A 2LOOA 3WG9A 1SMYF 4EJVA 2GWRA 1XSVA 2E1CA 3HDDA 1Y56A 3DP7A 3HXLA 2JT1A 1GXQA 5LHIA 1PP8F 2E2AA 1YW8A 4QKNA 3GFIA 2F5DA 1ORKA 3HJEA 3RPQA 2Z99A 1IJWC 2AXDS 3AE8A 3QPSA 3FXMA 2LG4A 2WADA 5LHGA 2X51A 5J1RA 2Y0MA 1MBKA 3QAHA 4ZDOA 5DD4A 2RAEA 1R49A 3TGNA 5L3FB 4BHBA 4PSXA 3T0YA 1YFHA 1OMIA 3PUYF 4JUYA 1SD6A 3UUXB 5DD8A 2XPUA 4O2AE 5JRCA 2W82A 1AU7A 2HVQA 4XKVA 4XLHA 5L3FA 2PMHA 4AIHA 3E5QA 2ISYA 3LAPA 2DBBA 2OLTA 1MKMA 4II3A 4U7YA 1HC8A 2ZFUA 3RYFE 1HG2A 1IBKT 4G12A 2RC4A 3IKTA 2WCAA 2P7CB 2Q0OA 2IGOA 2TCTA 2PJRB 2M5WA 2JPCA 3MVPA 5DCFA 1KONA 1A35A 3AAEB 4OMYA 3EHZA 1XDSA 1OWAA 4JK1X 4HYEA 2XHKA 4MFDA 2MC3A 1G3TA 5E20A 5IOZA 3G71I 4ENKA 1OR7C 2X66A 2DFHA 1NK3P 3RI4A 4U72A 3OIOA 2HI3A 1WCMJ 2P7VB 1ULYA 2KT0A 2JA8J 2PJQA 2AS5F 4MQVA 2P5KA 1I3AA 3J7YJ 2ZJPF 4O4JE 4EYYR 2ZC2A 2DOEA 3PIPF 1JJ8C 1W0AA 5LJNA 2OUMA 3LSHA 1RUNA 1TQMA 4HF1A 3KDSE 2LREA 2M7BA 2YU2A 3ONLC 4Z90A 5CGMA 3FXLA 3EUHA 3LBXB 3HOTA 3J80Z 1UX5A 4L5IA 2E1OA 2LHNA 1FSEA 1F9NA 2VPRA 2YX7A 4HBLA 1UGOA 2XSAA 3AA6B 3SS1A 3RKXA 2X1CA 1B1BA 3MD2A 2LKXA 4R1HA 5BQTA 4BY1J 4ENNA 4CZZA 1OCZH 2LDUA 4Y7NJ 3A01A 2JUCA 3K4BA 1S72I 2DU9A 1SAUA 2KZGA 4M71A 3VOEA 5L3GA 1B72B 4WW0A 2KIUA 5E0OA 3QPLA 3HOWJ 3GN5B 2KRHA 2A6TA 2P5LC 4QXCB 3RIAA 3RQUA 4HFEA 5LA6E 2HZTA 1S8NA 3W15B 2OCEA 4DMVA 1KGSA 3OYAA 3GX4X 2AXLA 3IWFA 1JT0A 2JRKA 4GYSA 1R00A 1UJ8A 3SFZA 2AQFA 2BE5F 3RYRA 2O8KA 4DO0A 4XK4A 3AVRA 1YRNA 1YOVB 4A2UA 2FSWA 2L4AA 1CHUA 1S94A 2YEVC 1G3SA 1ZHFA 1Z91A 2K5BB 2E2JJ 1MJBA 3OYCA 4BACA 3ABVA 3AEDA 4YTPA 2ODUA 3QPHA 2DI4A 2WWYA 4BJTA 2JVHA 5M3MJ 5E3OA 3NEUA 2WZIA 5DJQC 2A5WA 2MLGA 3KZIC 2PFVA 2W0GA 4QH4A 2BYVE 3S3MA 3ETUA 2L01A 2FE3A 4S0HB 4ZDLA 5EDNA 1LRZA 3HOZJ 3O1HA 4ABZA 4G7OF 3PURA 3WTUC 4IE4A 2EFPA 1SVOA 3JSOA 2MBGA 3OYBA 1YIOA 4DR4T 3WTXC 2DN0A 2AXTC 2Z1DA 5F6FA 4BL0B 2R5ZB 3S1RJ 1DU6A 2YDRA 4ILUA 2KWHA 2KIQA 4M1PA 4IRGA 4UIGA 4JI0T 4A3DJ 4DV3T 2V1UA 3R0AA 1T7SA 4IPAA 3G6EI 1O4XA 4BUPA 2ZMAA 1Z21A 2XPWA 5FO5A 5LJMA 2LOSA 2E8IA 1Y1WJ 3AAIA 4A3MJ 1M62A 5ICEA 2JZYA 5KMGP 3KBUA 5LNKA 3BQIA 1YTYA 3HPHA 4NHJA 4M3EA 4D7NA 1OCTC 4GRIA 4I98B 5ADXL 5FMNA 2ZJ2A 1BI1A 2W4XA 1R1TA 2P6SA 4HSTA 2QA7A 2EV0A 3KV5A 2LMDA 1ZAOA 1N25A 3ONXA 2H6BA 2G9WA 2BVLA 3S2WA 1HKTA 3DBHB 3ABKH 3RKYA 1KYWA 2GBYA 2N2NA 3DU5A 2QSFX 3QU3A 5LEKA 3OL4A 3EUKL 1Y01A 1MW7A 4UVCB 2ZNZA 4HWDA 2A5YB 1I27A 2F6CA 3GLXA 2UZKA 3CUQC 5FFZA 3RJPA 1MMSA 4RAGA 2E9XD 3T8RA 4AC0A 2N9DA 4EM2A 1HR0T 1FBSA 2UUAT 4FE7A 4LD5A 5KAIC 1U9OA 3S2DJ 5BR8T 3UTKA 3SDGA 4DOZA 4A69C 5A2QK 1A04A 4A0ZA 2R5YA 4G7ZF 1U78A 4IHXA 4A3IJ 2ICWG 3TO7A 4FCYA 2DDBA 4TWDA 5HXSA 5E8GA 4X65T 1TLHB 3LSJA 3JSPA 1AKHB 4I0AA 1GV5A 4NBQA 1BIBA 1X4PA 5J1GA 2ZM2A 1IXSB 2DFIA 2DYSH 4ZYGA 2HVSA 4HNUA 1JUMA 1ZARA 2FJ1A 3JRAA 2O6GE 3N4MA 1J59A 2R7UA 4H9QC 1J5WA 3R60A 4L18B 3UU3A 2E35A 4GO1A 2X6OA 3B6AA 3MCZA 4M9ZA 1MBGA 3K2ZA 2MSYA 5IWAT 1RR7A 2K40A 2OTLI 3NBXX 1OEDC 2FBKA 3Q5FA 3CO6C 4MLKA 2CW0F 3CDLA 5LRSA 2N1GA 4HX4A 2CPTA 5JDNA 2L9QA 3DKXA 4DJAA 4F93B 3S17J 5C8YE 5HEUA 1PDNC 3T1BA 1ETVA 3GTPJ 3C2BA 3LQRA 2NR4A 1Z77A 1XG1A 1GHCA 3CWZB 3OYZA 4GYRA 4KMCA 1JKQC 1DGRM 2I6HA 4XSZF 1IN4A 2IP2A 1R4MB 5HEOA 1FJGT 4NPPA 2QKLB 3EUHC 2KMUA 2BBHA 1FSHA 2ELKA 5AQGB 1RZ4A 3OIPA 4GK5E 4Z8XA 2IIUA 4WCGA 2CV1A 2FJEA 2K27A 4U0VA 2BG9A 4U74A 1KQ8A 5B66C 2FJDA 1N33T 4GKJT 3REOA 2YDSA 3FHZA 5FXXA 2XF5A 5JVDE 2JMHA 4C2TA 3F6OA 3V8LA 5DYMA 2WQYA 2X68A 3DV8A 2RVCA 3IEEA 2YDQA 1MMGA 1Z7UA 4RMNA 3HRTA 2DK5A 2AHQA 5F0FA 1WRDA 3L2RA 3AE9A 2H7OA 3IBPA 5DM7F 2D1HA 2CUEA 1G2HA 3AL0C 1V9DA 2NW8A 4GIWA 4E7KA 1IRFA 4IE6A 4A6EA 1JKRC 2MTQA 2BGCA 3EDPA 4D5CA 1WRJA 2DMQA 3E5UA 4WYVA 1YQ3A 4BEHB 1K7AA 3LWFA 2HZDA 2NVUB 1R4NB 1G8XA 3UNGC 2VE9A 4PW8A 3AE3A 1QPIA 2P8TA 2XSJC 4CH7A 3L9FA 1WQ2A 5HWXA 4YSXA 3OY9A 3ZMZB 3VR8A 5D6EA 3FZLB 3GO5A 2QVOA 4WNKA 2V7LA 5AQPB 4ASKA 4TV8E 3HA4A 3AXJA 1HW2A 2AQEA 4X1YE 5JDQA 1BR2A 2F4OB 3DBLB 4IO9F 1FPQA 3P9CA 5HEJA 5CVUA 3BZ6A 3I53A 2VOOA 4DV7T 3FXEB 2W4SA 3E6CC 2V4JC 1E2AA 5EG0B 1VQKI 5K7FA 3AXJB 5LMNT 2PLYA 1YD8G 1WGXA 3GFLA 2MOZA 4I55E 2XAHB 3E6BA 1C0WA 3C64A 3OYMA 4G8XA 4L0YB 3MZYA 2UXNB 4MLOA 2A07F 5HXRA 3R0JA 2H94A 2BS2A 2BHZA 1BBYA 2YU9J 4LG0A 3OMYA 2LSKA 2Y2ZA 3VODA 4QH5A 4RM2A 3CTAA 3X2QH 3ZCIA 3ZQCA 1B9MA 3E08A 2F5FA 4KJZA 1HKQA 5CLSA 4COFA 1IN7A 3NARA 4QIWN 3FWEA 5HDGA 3RKQA 1MNMC 2HVRA 2V7KA 3K1SA 4F8HA 4JEHB 4ON0A 3OOUA 1VQ9I 1LVAA 2VIXA 1YKEB 1X2MA 3UT5E 2VJ4A 1LEBA 3K9TA 3NAUA 2ELHA 3I4NJ 2UXCT 1Z05A 5CVRA 1R23A 3K6GA 1P92A 2M8EA 4V19K 4KBMB 2XGDA 1WJCA 2XAFA 1TTYA 1BI3A 4HN9A 3OR1C 2ECCA 3OR2C 2BVMA 2YSRA 3CMLA 1A5JA 3ZQGA 2QF7A 2JIWA 4KP3C 4G6DA 1J0RA 2R7DA 3KEYA 3C98B 4I2OA 5GONE 1WSUA 1W1WE 1I6XA 2COBA 3K69A 5E79C 2ZM0A 5FNVE 3D1NI 4ILCA 3CCMI 2L7KA 3L2VA 3IKVA 1BIAA 2TRTA 5HNHA 3CMAI 3VRBA 4LFBT 5HXEA 2KHMA 1Z9CA 3WGIA 4IKFA 4EM1A 3HOUJ 1IXCA 2COMA 1HF8A 2X6WA 2K4JA 2PEXA 2HKXA 2WMNA 1IBLT 4C3JJ 2GZWA 2K5CA 2L9RA 5L3BB 4DBRA 3MACA 2RN7A 4H63V 3A02A 1U9NA 3SWHA 3UU8A 3JREA 2LD5A 2VQGA 4IF4A 4ESJA 1XB4A 2BY1A 1MH4A 1WH7A 2IDOB 3LSVA 3HL6A 4RGRA 3A01B 3F8FA 1XDUA 4XM3A 1YW0A 2DA3A 3ASNH 2QGSA 1I50J 2IAIA 5LHHA 2CA5A 1FMWA 4CCMA 4J2CA 2NAZA 3HB9A 2LM2A 1VTNC 1WFDA 1AA7A 4RLFA 3KBTA 5JDGA 1UX4A 1H9TA 2VQHA 3TW7A 1XSXA 1EF4A 3LFUA 3CX7B 4DR6T 1R6RA 1BL0A 1TC3C 5JR9B 1WFXA 1PUFA 4A3BJ 1F1ZA 1LFBA 2QM3A 3K4NA 4H4KC 3OYJA 4MEXF 2KZVA 5LBQA 4RB1A 3BQLA 3MZKB 4UF0A 4ZEYA 1J75A 3GEZA 3CCEI 4BXXJ 1VZ0A 3QRFF 4IE0A 1PJRA 5DV5A 5DS9A 1ACIA 2EHOC 3PDYA 1G3WA 2M7AA 3A2KA 4OAYA 1BR4A 3KYLA 1DU2A 2DCEA 4OMZA 2WZHA 2ACXA 3LSRA 2IS4A 1S9HA 3CCSI 2A69F 2NYXA 4KICA 2F5EA 2IRFG 4Z91A 1W36C 3KEQA 3KCCA 3Q5DA 4UHTA 2DT7B 3BCAA 2IS6A 1HSTA 4UXNA 2KJCA 1JT6A 2X6YA 3MN2A 1OYIA 2DA7A 5M3FJ 3JC6D 3LG7A 3I0QA 2C5KT 2K48A 3EUAA 2W57A 3WGHA 1OFCX 2M3AA 4EJWA 3O8GA 2CQNA 4ZZBA 4GDFA 2X67A 3HC7A 3ZJ1A 1UFMA 3H9GA 2A3SA 3OYDA 5H6RA 5E3LA 3RKOA 1XC5A 2CSOA 4LF7T 1KEYA 3TW6A 2NOXA 1S7AA 3Q0VA 4BQNA 4ETSA 3S16J 3FMRA 3WE3A 2XQ7A 4NUVA 4JX4A 3PQKA 4I6ZA 4HNVA 3HR0A 4HV6A 2K9SA 4D7MA 4MALA 3AVSA 2X1EA 4FASD 5FXZA 3EPZA 4PGGA 1QSDA 5HDKA 1LE8A 1YQ4A 4LJZF 1Y8RB 2EFNA 2K9LA 3AG2H 2V6EA 1BJAA 4XKCA 3QUJA 1LB2A 4GK0E 3L1PA 3L2WA 1IAWA 3F3XA 1Y1VJ 1OEDB 4K2EA 3W2AA 2NRAC 2IMLA 1IBMT 4GGGA 1H7CA 4PK6A 2DFEA 5L3DB 5LG3A 1IGNA 2LBFB 1A6IA 1MMAA 5DCMB 2TDXA 2HYGD 4D9JA 3VYSB 2LF7A 2MH9A 3MJXA 4HKAA 3ZN0B 2FA5A 1IF1A 1Y0UA 2WAUA 2HGCA 2X0YA 2DWGA 5FKYA 1UAAA 2HTJA 1T08B 2NNYA 4L5GA 5AQVB 1HDPA 2XASA 4I43B 2DK8A 4DIQA 3KPHA 2X9YA 2H7VC 2FX0A 5A2QZ 3A7MA 5BPDA 2LBFA 1BM9A 2RNGA 4IQ4A 3RTRA 3WE2A 2H88A 4ILBA 5EK3A 5F8PA 3LOCA 2CYYA 2M34A 3LK42 2W62A 1QRYA 2V1DB 5CQEA 2EIMH 1ZG5A 4A97A 1IN6A 3ETVA 4IREA 3OWTA 4EYUA 3K4JA 1Z0PA 5HLGA 4DW6A 3I9V2 4DR2T 4A0XA 3Q5EA 4G9YA 5AQHB 5JI6A 2I5UA 3PSFA 5JHFA 2DJIA 5L4EA 2IA2A 2K86A 1HQCA 1JKOC 3JRGA 5IT9Z 1IJ6A 3QC9A 4P0BA 5AQRB 3EQLF 3IL2A 1Z8UA 3JAEA 2B0LA 4JYKA 5JFRA 2Q9QD 4HE8A 4J00A 4IT4A 5LB7B 2L9VA 2KSRA 1XGSA 2VKVA 3D0SA 2R5YB 1Z6RA 4LF9T 1QU3A 1T72A 2ZFWA 4CGZA 2L9NA 1MMNA 1XS9A 1POGA 4PFOA 4OU0A 1YQAA 3CZ6A 5CPRB 4BDZA 1FYMA 3FZKB 3MK7C 3FF5A 4H9OC 5AQQB 1J7KA 2F48A 4NQWB 1BC8C 4IHTA 2WAQN 2F4MB 3QB5A 4HWHA 4A5NA 2M0CA 3T1YT 2M2EA 1R8IA 1QZZA 3F72A 2BW3A 4CSWA 2M87A 5ETWA 3ZQ7A 5GPCA 4HPQA 1XD7A 4CA0A 4XAXB 5HAXA 1H9GA 2V8SV 2XY8B 1JHHA 4HLXA 3JRFA 3HOXJ 4C30A 1S5LC 5TISC 3AEAA 1LPQA 2V6XA 4CZZB 2BS3A 2HDWA 2DPDA 3L8RA 1X1DA 4FX0A 4GYGA 3WI3A 2OZUA 3S8PA 2CBIA 2E1MC 4YY3T 3P4SA 4XLEA 4HFCA 5L3GB 1V54H 2RV8A 1LNWA 2VKHA 1IZNB 3GN5A 3CDHA 3DBRB 2V1NA 3N9MA 1FIAA 5DTDA 5HVQC 5IUXA 2LTPA 4EQQA 3FBLA 1D1AA 2L7MP 5M5WJ 2VL8A 1G59A 1VQNI 4DV2T 4FETA 2B63J 4CN6A 1PUEE 1S35A 2UU9T 3H3UA 2DMTA 1IV6A 3M8FA 3FMQA 2GXGA 3SZGA 3ZPLA 2IHR1 2NS7A 4XRSA 1A36A 2X9XA 3AA0B 2LEHA 3HI2A 4RAYA 4MTEA 3ZJ2A 5GTIC 1MH3A 3BR0A 4A5XA 4CI2B 3AE4A 3ZYMA 1FX7A 3K7AJ 3AEBA 3CX8B 4Z2YA 1KU3A 4G2AA 5CB4E 1R5HA 5FB2A 4RBOA 3QP5A 2BXZA 3SZPA 4WX9A 5C4JJ 1IRXA 4CYCB 4JI3T 3P9KA 2VJJA 3KVBA 4BGDA 2Z2SB 2R5ZA 4E7LA 1IJ5A 2KQRA 1RNLA 2HNHA 3BTCA 4A98A 1MJ9A 2FNAA 2RQQA 2PG4A 2LP0A 4FE4A 2XHEB 3IF8B 1O3QA 1LEAA 1S7EA 5C3EJ 1H0MA 3HSEA 4A5MA 2L8KA 2IW5A 3MXZA 5JVGF 2CWYA 1B4AA 3L2QA 2YPRA 5FKKA 3RC8A 3GTLJ 4BH9A 4IE5A 2XAGB 2X0LB 3BPXA 3JAFA 2VBWA 4KYWA 2XQ9A 1E17A 3G2BA 4CO8A 3GMIA 5KVRA 4I50E 2IW5B 2LRDA 1WJBA 1RC9A 4KT6A 2I0MA 1O3RA 2YOEA 4ITVA 3ZMZA 1PYVA 4O3MA 2QQ9A 2GOMA 3B13A 5AQIB 2R7RA 5JH7E 1B9NA 2X9HA 1P9QC 2L4MA 2LH9A 3DTEA 2CV0A 2HWVA 4UUSA 5J8FA 3L00A 3HUGA 1R71A 1ZOYA 3JC6C 3ZSSA 2JJ7A 2PG8A 2HYFA 3LAJA 2LSYA 3PUBA 3LA3A 2XM2A 4KI0F 3EAMA 2PMZN 4XLCA 1FNNA 4KFCA 1JKPC 1J2XA 4XLPF 1XX5A 4UUSB 2JQQA 1IG7A 4TNWA 1VRBA 1T2KA 4KUMB 2F4VT 1WJFA 1T33A 1Y39A 1I39A 2MBFA 1MDMA 2BKOA 3K1MA 3HSRA 3A0HC 2F5VA 3ZQHA 4CCKA 2R7FA 4YFNF 1W5TA 3I0TA 3JRCA 1SE7A 3N9NA 4IL9A 5AQJB 2EB7A 1OJLA 4IHWA 1X3ZB 2LLKA 2KIMA 2HU9A 4KUMA 4FT8A 3HOYJ 3I0OA 3ABTA 4KT5C 1VQ7I 3P4PA 1MDMB 2BV6A 2NS8A 4ENMA 2A6HF 1YO5C 1J5YA 2M30A 5LGTA 5AQOB 5LOVE 3X1DA 4XORA 4CXXA 5CYVA 1T39A 2GIVA 2WBMA 2Z9OA 5BNGA 2R4GA 4L9IA 4AKLA 2Y48A 5BMZA 4ZYDA 2MFZA 4BDYA 1EZ3A 3DF8A 2V6YB 2QBYA 1DPUA 1RR8C 2E36A 3HTUA 4BQQA 4L0ZB 4M72A 2JQ9A 2RPAA 2WB5A 2MA3A 4A3EJ 4AKHA 3TO6A 4XN0A 4QPOA 2MABA 2XAFB 4LF4T 3CUOA 2A9UA 2D0UA 3HKCE 3KV6A 1K78B 3NVOA 5AQTB 5EZYE 4KMFA 2GXAA 4BBSJ 1HKSA 2VT2A 3T5XA 5ICCA 2O8XA 3JCUC 2XC7A 3GW2A 4BU2A 4DV0T 1W4MA 3F8BA 1HSJA 4ESFA 3HOSA 2Y9ZA 4X66T 4AXPA 3Q9DA 4G63A 4MHCA 4J19A 3F22A 1VCTA 2ESHA 3C2GA 2R7ZJ 2NOJB 3HHHA 9ANTA 1FOWA 1ZP0A 1M1EB 2XPKA 3OYFA 3DXJF 2OZ6A 1KNRA 3UKGA 5AIPA 2L7ZA 1TT0A 4PCQA 1ZR4A 4IDQA 3RF1A 2FJAA 1JHFA 4XRFA 4U33A 2WSSV 3PNYA 1ON1A 3BQZA 4NC7A 4QWNB 3AEEA 4JOMA 4JLEA 5TGTA 2WA0A 2WTEA 4YLHA
chains in the Genus database with same CATH topology
3F8CA 2ESNA 3WODF 3BROA 3PUSA 3R61A 3C51A 3TDZC 2FOKA 3R6NA 2D2WA 2P5VA 5L3EA 5DQVA 3SXYA 4D0PA 4PFPA 1SD7A 3HKEE 2VKJA 3RC3A 1R1UA 3EVYA 1S7OA 3KEOA 2J5PA 1LVKA 4O5VA 1FEWA 1BI2A 3MZHA 3LK3B 4HTEA 3JTHA 4RGXA 4KDPA 1XSDA 2LT3A 1XCBA 1ZLJA 2E9XC 2QYOA 1ODDA 1ZEEA 5FFXA 1FYKA 1X79A 2A6EF 4RB3C 2E9XA 1AOYA 4EJUA 5J2UE 4E7ZA 1U4QA 3F57A 3KP3A 4B6XA 4I7HA 3EDVA 3W6JB 4OYKA 4PJJA 2DT5A 2OQGA 4XLNF 1XGNA 3IWZA 3F8MA 2ZKZA 5K1YA 3LFKA 4PJLA 2NW7A 5JR9C 4CYDA 4BYYA 4O2BE 3ZC0A 1G6NA 2XASB 5LP6E 2M1BA 2VBZA 2DI3A 4I02A 1UCUA 3K3NA 4FHTA 3RKWA 2KIFA 1T98A 3MA9A 2SPCA 4A56A 1SMTA 3UULA 3EYYA 4PJNA 1KYZA 4H9SE 1IN5A 3ABUA 3KFWX 5L3DA 4BNCA 1FC3A 4O6JA 3ZN0A 5EEGA 2DQRA 4M74A 3O2PE 2FU4A 2QQBA 2Y75A 4TX5A 1F5TA 5KX5E 3BP8A 2WC2A 5DABA 1W7PB 4HAMA 2EHOD 2RNJA 4ENJA 2A61A 4NQWA 4Q5SF 1US7B 5D8KB 5LBMA 4MBQA 1BI0A 4R79A 3LJCA 5FP3A 1ONVA 1W7PA 1UHMA 4HQMA 4H0EA 1KU7A 2DQLA 4MHGA 4EGYA 3FBZA 4U0YA 3KP7A 2OAZA 4RS8A 3HRSA 2KXPB 2DHRA 2FXAA 5LHHB 1AJ3A 4ZI3D 1LJ9A 1FIOA 3IC7A 4BA9A 1I1SA 3WAKA 1NHAA 2XVCA 2ZNYA 2LHRA 2QQAA 1FWZA 1BOAA 1D0YA 4WWCA 2WMOA 3U9GA 3ZMUB 3FM3A 3N9LA 1QUUA 4UF0B 2EJRA 3K3OA 4H63H 1XN7A 4LFUA 5H6RB 3CO7C 5JDLA 4Q47A 2KT9A 1MMDA 2ZCWA 4ZI2C 4PAGA 4UXNB 4QLCU 4L0RA 4WXHA 5CVIA 3PUQA 4BXUA 3GZ5A 1SAXA 2KRFA 4F6RC 5HXCA 3TOBA 5JVTA 5IHYA 3GUDA 5CVVA 3E97A 4IRIA 3IRRA 1G3YA 3OBVE 3SRZA 1QGPA 2IA1A 4CICA 2O61A 3RYCE 3AA1B 2H3RA 2W84A 1USTA 2O0YA 3HTSB 1SFXA 4LGWA 2V1DA 2WWUA 2W00A 3UUMA 1UB9A 2XIGA 3DPLC 4EJOA 4PZJA 3OKQA 2NP9A 2PFBA 5JRCB 3SQNA 1YS7A 4OYJA 4UVCA 2V79A 2XUEA 2Q8KA 3ECHA 1P2FA 4UV9B 4EB6E 4I09A 3E6DA 2CE7A 4Y13A 2XROA 2ES0A 2Y48B 2A2FX 5F3JA 4X20E 4CI3B 4MTDA 1IW7F 3L09A 4UV9A 4O8SA 3M8EA 3I4PA 3DJBA 1ZYRF 5ILVA 3I64A 3C1DA 4V1Av 4LMYA 3NQOA 4UUVA 1MIWA 4FI5A 1XGMA 1DUXC 2IC9A 4UELA 1MIYA 4UVAB 2RQPA 1JE8A 4BAYB 2W85A 2QBYB 2EK5A 2KNDA 3I54A 4U7DA 3JW4A 5L3CA 3BDDA 3WTVC 5E18F 3ZLIA 1FT9A 2LSOA 2VB6A 1WKMA 4HEAA 2STWA 3M7GA 3CUQB 1AWCA 1IUYA 4BJMA 1IN8A 3CKDA 2HQRA 3K0LA 2KLQA 2VOPA 2MH2A 2JPBA 1XCVA 3CQXC 3BK9A 4IE7A 5LEJA 3QOPA 4IJAA 4PDKA 1R22A 4YFKF 2HEOA 4F7ZA 4EM0B 2HPLA 4N0BA 3KLOA 4NB5A 3HIFA 4YIIA 1HW1A 5LCYA 1IXRC 1Q1HA 2IAKA 5HLIA 2C0SA 4TV9E 3JTGA 3ZMVB 1L0OC 1KK7A 2K4BA 3N5LA 1GXPA 4DNDA 2LOPA 3EDUA 2KZ7B 4YHJA 2EFWA 2VKDA 2VN2A 3E0ZA 2DO7A 2XAGA 4L9JA 4MGRA 4YFSA 3U78A 3HRMA 2XAJB 5FYMA 2HH7A 4MEYF 5FD6A 3NRXA 1YS6A 4OIOF 2DCFA 4IHSA 4UVBB 4BJNA 4C90A 3SHFA 3QU6A 1LVFA 1YW7A 2XAHA 1ZRCA 1OXZA 3NRYA 4PK4A 4AQGA 3I58A 4UVBA 3ZMSA 2Z6EA 4LG0B 3KV9A 4CXYA 2E7XA 3AA7B 5FXVA 1XMAA 5LHGB 2UXXA 4AD9A 3V7CA 1T38A 3O9XA 3ISPA 1HTJF 3KV4A 4PGHA 4P9FA 1CF7A 3ZMSB 5K5RA 1MIVA 4MNUA 4TV7A 1O3TA 2HR3A 5DQWA 4ZYEA 4BQAA 3KP5A 5BS6A 2XUBA 2C5JA 3P7NA 2IVMA 4ISTA 4YFXF 1SA0E 2LF8A 1YW9A 4LK1F 2GAUA 2DLRA 3MWMA 5TRDA 3N2OA 4OOIA 3VB2A 2DTRA 5D5UB 1ZG1A 1G4DA 3RDIA 3I9YA 5JR3A 1BR0A 1SFEA 4LLLA 2MLKA 4HQEA 2XRNA 4E70A 1KNZA 4P96A 2CLYC 4AI6A 1LKXA 1MD0A 3FM5A 3VHLA 1YLFA 1ZHCA 3N9QA 5FY7A 3KLNA 5FGMA 3GF2A 3ESLA 3FZVA 4ZI3C 5LXTE 2YK0A 2VE8A 5K5OA 2EV5A 3GYHX 2UWMA 1P4WA 1S6LA 4AIJA 2P9BA 4LB6B 4EZHA 1B7TA 3F2EA 3WTYC 1KA8A 5HS7A 4O4LE 3KINB 4DVDA 1TNSA 4ISSA 2HS5A 2Z3YA 4I01A 3LA2A 3CLOA 3WTSC 2Q2EA 3GFJA 1G73A 2FMLA 3M65A 4R8HA 4XSXF 4IRHA 1FY7A 1DPRA 2V1XA 1OPCA 1U5PA 3BJAA 2HQNA 1U8RA 4XBFB 1MGTA 3E5XA 2EHOA 4AVPA 4ZI7E 3PU3A 3E3VA 2GQQA 2CXLA 3DQVC 3H92A 4AQFA 2FBHA 3BQKA 3FHNA 1FLIA 5LGUB 1HBXG 1B59A 1HXDA 3MFKA 2JJ9A 1ZH5A 2Y8DA 3TOAA 5J6XA 3T8OA 1HCIA 2Y6XA 2L3DA 5LGUA 1ZG3A 3G73A 1HX8A 5ICFA 1L3LA 4YG2F 2R3SA 2K7LA 1SD4A 3U2RA 5E1WA 2A72A 4YJ3E 2CM0A 3K8PC 4LLGF 4ADZA 2OD5A 5TAOA 4MQ9F 4EXTA 5D5XB 3L7WA 1CGPA 2VBXA 1DP7P 5DCMA 3Q2MA 1ZV4X 2HKOA 5H20A 2K24A 2NWBA 4DNCA 2QWWA 5TJJA 4AKIA 1K79A 3F31A 1MNDA 3GVAA 4ANJA 4E7SA 2HTSA 3AB3B 5AONA 2LNBA 2BZBA 2BDEA 4QHOA 1P4XA 1IZ1A 2GA1A 3BWGA 2NTXA 3BJOA 1D3YA 3A5XA 3B73A 1P4AA 3P7IA 2L54A 1Y64B 1FMVA 3LK2B 4S05A 5D4SA 3BY6A 1WYCA 2D2SA 3U3IA 1VOMA 5HLHA 4AKRB 4EZ4A 3EYIA 5JDMA 4M9SA 4A0YA 1E1HB 1X3UA 3KP6A 1Z1DA 4RB0A 2LJLA 4TN7B 2G7HA 4HZFA 4U0WA 4BAYA 4DBQA