3RPUA

Crystal structure of the muke-mukf complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
309
Chain Sequence
TVPELVAWARKNDFSISLPVDRLSFLLAVATLNMSEGELVDAFRHVSDAFTIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome partition protein mukF
publication title The role of MukE in assembling a functional MukBEF complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 106
structure length 309
sequence length 321
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpuA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rpuA02
1EH6A 2FMLA 5CVRA 3LFKA 2PMHA 5J6XA 2M45A 2M5WA 3SFZA 1IF1A 4YIFA 5JR3A 2XKPA 4O5VA 2VT2A 2NNNA 5HOOA 5HLHA 1TQMA 3FM5A 1YG2A 2QQBA 4IF4A 2ZMEA 1K78B 1MZBA 1IN6A 1KQ8A 3MCZA 5LHHA 1J9IA 2GXBA 4KIFA 4EV0A 4ZYGA 4I0BA 4BH9A 1QZZA 3BOQA 1H0MA 4M6YA 5CJ9A 2PJPA 1P2FA 3JTGA 3QP6A 3F22A 2OAZA 2EJRA 3LAJA 4A0YA 4R1HA 3JAMZ 2A6EF 2FMYA 1TBXA 5J8FA 1DPUA 4CZZA 1FLIA 1HKSA 5ED4A 2HEOA 5FFXA 3WU0A 3MZHA 4EJWA 1ONVA 3HYIA 5LBQA 3E6MA 3WTXC 2A3SA 3ECOA 1BI2A 1R1UA 1STZA 3PQJA 3LQQA 5L3BA 1DP7P 2EFWA 4ZZDA 3HOSA 5KVRA 4D0PA 1G3WA 3TOAA 3F8CA 1ZLKA 3FXQA 4IVNA 3P9CA 3IRRA 5E18F 3EYIA 4A6DA 5LEJA 4P96A 1O3QA 1ZGAA 1UB9A 3BDDA 5TJJA 4KN4X 5LRRA 1CF7B 1B4AA 3IC7A 3CUQB 1ZRDA 3GWZA 4Q4ZF 2VBYA 4M9SA 2WWYA 1IXRC 1SMTA 5K5OA 2F5DA 1P4XA 2MH2A 1IW7F 4MEYF 4I2OA 3KP3A 3I5UA 1P4WA 3L2CA 2V79A 1FBUA 4OIRF 1HSTA 5AIPA 2Z99A 4BXUA 4N0BA 4RGSA 2VE9A 2M1BA 1QPMA 4HAMA 4UHTA 1FNNA 1AWCA 2FBKA 2RKHA 1ON2A 3ZMTA 1S8NA 4LB5A 1UHWA 5EEGA 4LK1F 4CYDA 1JE8A 1LEAA 4AD9A 2EFPA 3E6BA 4L9VA 1I1SA 5DCMB 1PP7U 3GXOA 5CVIA 2Q2EA 3RTRA 3T8RA 2OZUA 2MD5A 4RGRA 1FWZA 3IL2A 2O6GE 2EV5A 1HKTA 1YTYA 3K69A 1O7LA 2D1HA 1YIOA 2HR3A 2FRHA 4OINF 4HLXA 1QO0D 5LLQA 1T98A 1XMKA 3JTHA 4HDVA 3HIFA 3ERED 4I7HA 2IA0A 5LGNA 2XUBA 1FSEA 3ZQ7A 3C18A 3RIRA 2DI3A 2QWWA 1ULYA 1BIAA 4L18B 1A04A 2FA5A 2XAGA 1KU7A 4G6QA 2VN2A 3GEZA 3I59B 5BMZA 2ZBKA 2R7FA 4U7BA 2NAZA 2CYYA 5DD8A 5H20A 2ZXJA 5JFRA 3ZP5A 4AIKA 1FBQA 1S7AA 3HTUA 2L54A 2O3FA 1YS6A 2NS0A 1B9MA 5LRSA 4XLPF 1JHHA 3F72A 2STTA 1IXCA 4FT8A 2VBZA 1BIBA 5K1YA 1G3YA 1XN7A 4YFXF 5FLXK 1E2XA 2PG4A 5AONA 2KJBA 4QWQA 2L4AA 4MQ9F 1OKRA 1OPCA 2COMA 4N9IA 3KP4A 2LKPA 1ZARA 4B8XA 2KIMA 1WQ2A 1DUXC 2E1CA 5HLIA 2XGXA 4ZYHA 3IKVA 2G7UA 1F9NA 2UXNA 4Q47A 2BV6A 1SD5A 1FZPB 4ESFA 1BBYA 5CVJA 1KQ9A 3TDZC 1MGTA 2W85A 3HSFA 4NHJA 2E7WA 1HW1A 3G3ZA 1FP2A 3M9AA 3LA2A 3E6DA 1LQ1A 2IT0A 4Y15A 4U88A 3LQRA 3RYPA 4EM0B 3G73A 4PDKA 5DDGA 3E5XA 1LB2A 2KKOA 2HGCA 3TDUC 2PEXA 3F8BA 5E20A 1TQIA 1P6RA 5DCMA 4U0VA 3Q9SA 5ILSA 2DQLA 1K6OA 3QU6A 2P5LC 1U6GA 2JPCA 2ZMEB 4HX8A 2PQ8A 4DQ2A 4R8HA 4BHBA 1AOYA 1F1ZA 3KETA 3MQ0A 3KFWX 1ZHFA 5ERIA 2XAQA 4I09A 2ESHA 1LVAA 2RGVA 1R00A 2LF8A 4P9UA 1SD4A 5FLXZ 2UXXA 2ESNA 5LGTA 3WGGA 1FYLA 2HOEA 2O03A 4CGZA 3HTSB 1SD7A 5TRDA 1TLHB 3GFLA 3OV8A 3H3UA 4KIGA 3CUQC 2DU9A 3QRFF 3H92A 2P5KA 4OMZA 2YX4A 1XD7A 4LLGF 5KK1A 2K4JA 5BPDA 1NHAA 1UHMA 1U5TC 3SQNA 1MJAA 2JT1A 3ECHA 2IP2A 2QYOA 4KNYA 1HBXG 3GZ5A 2JSCA 4GCVA 1IZ1A 2VC0A 1B9NA 5E8IA 2MH9A 1OMIA 4LG0A 3GO5A 1ZG1A 4HYEA 1Z6TA 2OQGA 2MC3A 3RPUA 1T2KA 2XHKA 2K02A 5D5WB 4G7HF 4MTEA 1KYZA 4UUVA 5HS8A 1Z91A 4UV9A 5DYMA 1EH7A 3DKWA 3TO7A 1W7PD 2M30A 4JQFA 3NQOA 4IXAA 5D6EA 2Y75A 2DW4A 1R22A 4ZZLA 2VBXA 4A5MA 2ADUA 3WU1B 4EJTA 1MJ9A 2ISYA 3GFMA 2P8TA 2GWRA 5ICEA 4IRGA 2Y0MA 1KYWA 1T0FA 4EMSA 3NRVA 3F23A 4UXNA 3P9IA 4HQMA 2D2WA 4LJZF 4OOIA 1Y0UA 2EWNA 1SFUA 3O3KA 5D4SA 3KEOA 3KP5A 3T5XA 2G7HA 1BC8C 2GZWA 3ZMUA 3QP5A 3KLNA 5DUKA 4HZFA 3IKTA 3MEXA 1RUOA 3R61A 5FO5A 4AIJA 3HRTA 4ZYDA 3SZTA 1TW3A 1WI9A 2OA4A 1Z6RA 3R0AA 2M8EA 2CQKA 3FHZA 4LLNA 1ZN2A 1RNLA 1QBJA 3BY6A 3M8EA 4GYIA 2QLZA 1JXSA 4CDGA 2J5OA 4A2UA 2IRFG 1YQAA 3ZMVA 3N4MA 2P6TA 2JZYA 3KCCA 2FEZA 2P4WA 4KDPA 5FGMA 1ZG3A 1ODDA 5BS6A 1FOKA 1D3YA 3FXRA 4UVCA 1IRFA 2RC4A 1LJ9A 4LGWA 1KQ0A 2XAFA 1XCVA 4I98B 2O61A 1SD6A 1LEBA 4YIIA 1IN7A 2DLLA 3ROUA 1LDKB 2YR2A 4L5IA 3FXUA 2BGCA 5J8CA 1D5VA 2XV4S 3HHHA 1I27A 2L3DA 1FX7A 3R60A 2FNPA 1L3LA 3L9FA 1T39A 2BBYA 3GFIA 4A12A 5DEQA 2XVCA 1QGPA 4HF1A 1ZRCA 4ZH4F 2D45A 3ELKA 3VB2A 4PGGA 3I54A 4O3MA 5ICFA 2DTRA 2FXAA 3V8KA 4MEXF 4LLLA 1O57A 2F2EA 4CICA 5D5UB 1UFMA 1SAXA 2V1UA 5HDNA 3GFJA 3BJ6A 2CG4A 1YYVA 4ENNA 2KRFA 4HV5A 2VXZA 2Z33A 1YW8A 1FYMA 1U3EM 3ABUA 3U1DA 3F6VA 2VBWA 4KUMA 4M9XA 5ILUA 1BI0A 4QLCU 2M87A 1YLFA 2PFBA 1I1GA 2O8XA 4S04A 4BQAA 2ZCWA 4G8XA 4EM2A 3WTYC 2BYVE 2RDPA 1R1VA 1OYWA 4B09A 2X0LA 4JK1X 3VEPA 2W57A 2H6CA 3LA7A 3B02A 5H6RA 2GIVA 4R79A 5FD5A 2FU4A 3WG9A 4U7DA 4ON0A 4A5NA 4ESJA 3O6BB 2LNBA 3J81K 4G6DA 1YW9A 2WTEA 4EGYA 3C7JA 4M73A 2MBFA 3DP7A 1RZ4A 1EH8A 3WTZA 3QPHA 4HOBA 3U2RA 3R6SA 4CO8A 2FOKA 1MD0A 2RV8A 4MTDA 3JW4A 4GGGA 3ZMSA 4M9ZA 2EV6A 3JSOA 1O7FA 4CXFA 1Z9CA 2H94A 3LAPA 2FF4A 2HFHA 1SFEA 2DAOA 1HW5A 1IN4A 4WXDA 2HKXA 2QQ9A 4PZJA 5HS7A 2PMUA 3ZN0A 4KA4A 4LG0B 2AS5F 2IVMA 2VOPA 4IHTA 2H6BA 3BJOA 1GHCA 1LDDA 1ZRFA 4IHSA 3CLOA 3P7NA 3HSEA 1B59A 3LA3A 4RAYA 5CYVA 5K5QA 1RI7A 3B73A 3GUDA 4I02A 1L0OC 2W84A 5IT9K 3D5LA 3DFGA 2A69F 5CLSA 2DO7A 1O3TA 3WTUC 3J81Z 5ILVA 4PCQA 1OYYA 3K1MA 5A2QZ 2CFXA 1YFHA 4HF2A 2STWA 3HRSA 1USTA 3I64A 4Q48A 4P5OA 4XBFA 2A61A 1TNTA 1HXDA 1ZH5A 4A0XA 3ML6A 5JI6A 2BEOA 4OIOF 1OYIA 3V7RA 1R1TA 3L09A 1J59A 4IRHA 1WSUA 1UCRA 2Q8KA 4BYYA 3BPVA 2YX7A 1BOAA 3ZN1A 1ZLJA 4WF2A 2CW0F 2L01A 5D5VB 1IN8A 1XGMA 1JGSA 1U8RA 3TO9A 1FBSA 4I01A 4CHUA 1H9GA 1KA8A 3MFKA 3WE2A 3ZMZA 1MKMA 2IW5A 3E3VA 2V1XA 2MA3A 2R3SA 2HTJA 1V4RA 2WC2A 4MHGA 5E1XA 3RPQA 4M71A 1ZAOA 3T8TA 4KT5C 2KJCA 1GXPA 1WWXA 5CVVA 3IWFA 3BZ6A 5BQTA 1XGNA 3PQKA 5IT9Z 3SZPA 3T0YA 5JHUA 2EK5A 3RDIA 3TO6A 1R58A 2HZTA 2OU2A 4G94A 2DPUA 1P4AA 1FY7A 3FX3A 3WTWC 4XLNF 2HQRA 1W7PA 3MWMA 1BI1A 3HRUA 2V6CA 3TOBA 3VODA 4DNCA 2ZFWA 3WE3A 3LSTA 3K1PA 1U2WA 1KU9A 3N97A 1D8JA 2Z5UA 4TV7A 1W5SA 1SMYF 4AVPA 1Q1HA 3K9TA 2PBIA 2OD5A 4L9TA 1LDJA 1J75A 3P9KA 3AAFA 5LEKA 2XAHA 2OBPA 3M7GA 4RB3C 2CWEA 3DPTA 1S6LA 4EQQA 1K79A 1W5TA 2W24A 4M6XA 2XKOA 3JSPA 3RKYA 2VC1A 1IXSB 5E17F 2FSWA 2UWMA 3BP8A 2FQ3A 1XDUA 2QBYA 2QVOA 2EFOA 2F5FA 2W25A 3F3XA 4UVAA 3I53A 3FMQA 4Y13A 2CGPA 4LB6B 3KP7A 1IAWA 4RB2C 1X3UA 5BOXA 3V7CA 1R36A 4EM1A 4MQVA 2QM3A 1HSJA 3WTTC 1REPC 2AXLA 4NB5A 3C3WA 1XB4A 1R5HA 4L0ZB 4WXCA 3TGNA 3WGHA 2J5PA 1FSHA 1HKQA 5D8LB 4KIBA 2QENA 3IHUA 4KYWA 1FP1D 1TW2A 2HWVA 3KP6A 1R7JA 3DV8A 1MDMB 5HS9A 5E8GA 3W6KB 2IJLA 4FX4A 3MAJA 1B6AA 1Z05A 1Z1DA 2XRNA 4LK0F 1IRGA 2UZKA 5D4RA 1RUNA 2ETHA 5F1RA 1WKMA 4MGRA 1J0RA 3J7AO 2RVCA 4P9FA 2DK8A 4ENJA 3HOTA 2ZNZA 4XSZF 3I4PA 3L7WA 4HBLA 1YW7A 2WV0A 2C6YA 3CJNA 5H6QA 2K27A 3RKXA 2O0YA 1T38A 1ZGJA 4XRFA 2DBBA 5DUIA 2RQPA 1PP8F 2ZKZA 1I6XA 3EUHA 3Q5FA 2MLKA 3R0JA 3EDPA 1XDSA 2JTVA 4YG2F 4KMUX 3SHFA 2Y48A 2HKOA 5DD4A 4BNCA 4RGXA 4ZYEA 2KIUA 2P7CB 5JVTA 1O3RA 2TDXA 3TQNA 2XAJA 1LNWA 5L3DA 5CVUA 4Y17A 3PFIA 2K86A 4RB0A 4L5JA 1GVJA 4PGHA 2EV0A 3QPTA 1OR7A 2VONA 2HTSA 2HDCA 2HYFA 2A5YB 2H09A 2VT3A 3K0LA 3GZ6A 1B1BA 2GA2A 2DQRA 2EFQA 2QUFA 3FMSA 2FBHA 1D8KA 4FHTA 3BJAA 5LHGA 4RAZA 2CO5A 3V8LA 5D8KB 1G3SA 1SFXA 3K2ZA 2EB7A 2PI0A 2VE8A 4LMYA 3EYYA 2FE3A 2QQAA 3RYRA 3TKYA 4KN7X 2H27A 2MLGA 4WCGA 4HX7A 1KU2A 3GF2A 1U5TB 3WODF 4U0YA 3ISPA 1I5ZA 3CDHA 3DEUA 3KZZA 3CO7C 4EJUA 1XGSA 2BE5F 3V8JA 3H3ZA 3L00A 2Q0OA 4MNUA 2VOOA 3KE2A 4HQEA 4G7ZF 1S7OA 4N9HA 2LDUA 1W4MA 4M74A 2IPQX 2IA1A 3WGIA 1ON1A 4I0AA 1O3SA 1MJBA 2R7DA 1TQPA 3ABTA 3VOEA 2ELHA 1G3TA 5LGUA 4ENMA 4Q5SF 3HHGA 3OOPA 5HDKA 2LSOA 4GYGA 1MDMA 3I71A 4OIPF 1ZREA 2ZO4A 3M1EA 1ZYRF 3KP2A 4WXHA 3U9GA 3F8NA 4HF0A 2RN7A 3BROA 4OMYA 3DPLC 1K78A 4M72A 4KICA 3GLXA 5A2QK 2P6SA 3QAHA 1XSXA 4HLYA 3GYHX 3F8FA 3ZMDA 2GQQA 1P92A 1J2XA 5FB2A 4WWCA 2P5VA 2YU3A 2V1DA 3W6JB 2F5CA 2YPRA 1GXQA 2HYGD 1K7AA 4ESBA 3WTVC 4XSXF 3I58A 4Z2YA 3FM3A 2Z3YA 2GAUA 3S2WA 2XROA 4UV8A 2JPBA 4L9JA 4KMFA 2EA2A 1S29A 3CUOA 5D5XB 2KIFA 3GVAA 3GW2A 5DV5A 2YSRA 3IRQA 3Q9VA 1W7PB 1BC7C 2IA2A 2NNYA 4L9NA 2FBIA 3C1DA 3KEQA 2NYXA 1BI3A 1E17A 3R4KA 3RJPA 5E1ZB 4YFNF 3EQLF 3GX4X 5F64A 1CGPA 2F5EA 4WX9A 3BWGA 3KZYA 1F5TA 1XCBA 4OIQF 4IPAA 4IJAA 3SXYA 5EEHA 1JHFA 3ULQB 2RNJA 1XSVA 3DF8A 3F21A 1R5GA 3K1NA 6PAXA 3V7SA 3HRMA 5AIQA 3J80K 5ICGA 2CSOA 4E70A 1BM9A 1CF7A 4BHPA 3CUQA 5HVQC 2LF7A 1VTNC 1IUYA 4WK8F 1QQIA 1FC3A 2QBYB 4RS8A 2B0LA 4HW0A 5K5RA 2QZ8A 5ICCA 4YFKF 4RGUA 3O2PE 2D1VA 2GXGA 1YS7A 1U5TA 3CO6C 2L4MA 3M8FA 2PN6A 1QNTA 4P55A 4UVBA 5HLGA 2K7LA 3KLOA 2XASA 3CTAA 4K2EA 1FT9A 4IRIA 3T1BA 4EVIA 1S3JA 4FX0A 5LHIA 3WTSC 2ACJA 5IT3A 1J5YA 4EJVA 1PUEE 3DXJF 1HQCA 2P7VB 1R23A 3E6CC 2E7XA 1RIOH 2EA4A 4EGZA 4G9YA 4HA8A 4L0YB 1XMAA 3RI4A 2DPDA 3E97A 5L3CA 5BPIA 4A0ZA 3F8MA 1Z7UA 1F4KA 1TTYA 5F6FA 2X4HA 2A68F 4UNOA 1C0WA 3COAC 2FNAA 2EFNA 3VFZA 1TNSA 4HV6A 1PDNC 1FPQA 1J7KA 3I0TA 3QOPA 3NEUA 3REOA 4GXOA 5HDGA 4JBAA 1FYKA 3F6OA 3HUGA 1T6SA 4RB1A 3BPXA 5DCFA 3J80Z 3FWEA 4LFUA 2L02A 4BAYA 1XSDA 1DDNA 3FZVA 4ENKA 2NRAC 1EV7A 4GO1A 1YO5C 3I59A 5D6FA 1G4DA 1U78A 2G9WA 3ZPLA 3QU3A 2DFIA 4NQWA 3RKWA 4U0WA 3E5UA 1WRJA 3IWZA 5L3FA 1V3FA 1BJAA 3HSRA 2DK5A 4KFCA 2XIGA 1HW2A 4AWXB 3FF5A 5FFZA 3MZYA 4A6EA 2DT5A 3LWFA 5FD6A 3D0SA 4ASNA 4LD5A 2VODA 1XGOA 1QZYA 3JAMK 2GA1A 2HQNA 5E1WA 4ETSA 2HS5A 1G6NA 1DPRA 1KU3A 4AIHA 2ISZA 2V9VA 3EETA 2A6HF 5L3GA 1ZG5A 1KGSA 3E5QA 4HX4A 4H0EA 2OQRA 3FMRA 4F7ZA 2K4BA 3DQVC 5L3EA 2ZJ2A 4S05A 4OU0A 4HDUA 3V4GA 2E1NA 2ZNYA 2A07F 4G7OF 4O6JA 2PLYA 4EJOA 1H9TA 1BN5A 2OZ6A 2Z9OA 1IN5A 1USSA 4BHCA 2JRTA
chains in the Genus database with same CATH superfamily
1EH6A 4JI1T 3QB5A 4DR6T 2FMLA 4OAZA 1J09A 5CVRA 4MFRA 2CPTA 2WY2A 3A5XA 1HLVA 3D1NI 2ZM6T 3BR2A 3LFKA 3B5MA 3ASNH 4D7NA 1YHQI 3QPSA 2PMHA 5J6XA 4XR6A 2IDOB 2M45A 2M5WA 3SFZA 1IF1A 3ZQQA 2WBLA 3F9KA 4II3A 4B3AA 4YIFA 2DA5A 1LFPA 3UTKA 3AB3B 5JR3A 2XKPA 4O5VA 2JVHA 5J40A 2VT2A 2R7SA 2NNNA 1SA0E 1X9BA 2BG9B 3Q2MA 4L5GA 3RYHE 4BA9A 4IDOA 3S1RJ 1RKTA 2BKNA 5HOOA 5HLHA 4QKNA 1TQMA 1X3ZB 2ZLYA 3FM5A 4CCLA 2MFZA 1YKEB 2M4GA 1LFUP 1YG2A 4ZDLA 2DCFA 3KV5A 1E0EA 2QQBA 4IF4A 2JSPA 2ZMEA 1K78B 4U7YA 2EILH 1DU6A 1A35A 1MZBA 1A6QA 2HXIA 3KV6A 1IN6A 3A1YA 4ZDOA 1KQ8A 4DR5T 3TLWA 3MCZA 2RNGA 3CX8B 5KAIC 5LHHA 1J9IA 5M3FJ 2LOPA 4XNFA 1QVUA 4KIFA 4EV0A 4ZYGA 4DGWB 4I0BA 2GXBA 3RC3A 4BH9A 3H1CA 4WBOA 2WB1A 1QZZA 3BQKA 1KNRA 2WDVA 3CMLA 3J9X1 1Y0NA 3BOQA 1H0MA 4DOZA 4M6YA 5CJ9A 3EABA 2R7VA 2X6OA 2PJPA 1P2FA 1GLNA 5J47A 2CFOA 3JTGA 3QP6A 3F22A 2WAEA 3CESA 4J2CA 4WBNE 2OAZA 2V7KA 2R4GA 2EJRA 2HN2A 1ZGWA 1DGWY 1ETQA 3LAJA 2E19A 4A0YA 2X1DA 4QSHA 4R1HA 2LY2A 3JAMZ 4JI3T 2A6EF 3SEQA 1I3QJ 2FMYA 2OCEA 1TBXA 4D7MA 5CKTA 3S3NA 1JKQC 5J8FA 4UV8B 5FY0A 4FISA 2X68A 3F0CA 4E7SA 3ONXA 1DPUA 4CZZA 1FLIA 2IUBA 4TN7B 2BS4A 5HODA 1HKSA 5ED4A 2WMNA 3WG7H 2IEKA 2HEOA 3JC6C 2Y30A 5FFXA 1QHHD 3WU0A 1E2AA 1VZ0A 3MZHA 4G2AA 4DR1T 4AU7A 1ONVA 4EJWA 1JUSA 2E2HJ 5C2TA 1G8XA 2TRTA 3HYIA 2RREA 4DV2T 5LBQA 5CQEA 5IHYA 3E6MA 3WTXC 2ODUA 4EOZB 4NC7A 2NTYA 5KHDA 4EZ4A 2LG4A 1CUNA 4GRIA 2HZDA 2R5YA 3RC8A 2A3SA 3ECOA 5EJCA 1BI2A 1R1UA 1STZA 2NS7A 3PQJA 4ZYAA 3KDSE 2DA7A 3RQWA 2W48A 3LQQA 2OUMA 5L3BA 3RYIE 1WVRA 1DP7P 4C3IJ 2EFWA 2DA6A 4ZZDA 2VURA 3HOSA 5KVRA 1U4QA 2WV1A 4D0PA 1G3WA 4HFHA 4CN1A 2HVRA 1G59A 3PUQA 3LSVA 3TOAA 2V9PA 3F8CA 3L1PA 4FCYA 3AXJA 1GV5A 3IHRA 1ZLKA 3K4NA 4A56A 2BXYA 3AAIA 3FXQA 1S9HA 3MKWB 4YSYA 4IVNA 3P9CA 2EIJH 3EVYA 1OWAA 1ZKGA 1QHGA 1TP4A 4UY8I 5E3OA 1IG7A 3IRRA 2ME0A 2I10A 4O2AE 5E18F 3EYIA 4A6DA 5LEJA 2Y0SA 4RLFA 4LFCT 3U21A 2FJBA 4P96A 1PJRA 4CI2B 3AG3H 1O3QA 1ZGAA 1UB9A 2Z2SB 4E7KA 1B7TA 2WM9A 3BDDA 5TJJA 5GAGJ 4BEHB 1ZKEA 1QU3A 1WFXA 4KN4X 1A6IA 2F48A 5LRRA 2XQ6A 4ZC3A 2WY7Q 1CF7B 4B43A 1DQUA 1B4AA 4L0RA 2VKEA 3IC7A 3CUQB 1ZRDA 2M34A 1NH3A 3GWZA 4DBRA 2LEHA 3ZSTA 4Q4ZF 4NIQA 3H9JA 4HPQA 2VBYA 4M9SA 1WPKA 2WWYA 1IXRC 1SMTA 5K5OA 2JA7J 2F5DA 2LBFB 4V1Av 4DV7T 5GP9A 1P4XA 2MH2A 2B76A 1IW7F 1OLTA 2DFFA 4MEYF 3H5RA 5EK3A 2VL8A 4NUBA 4ZJZA 1WRDA 4I2OA 2WZIA 1OCOH 2K9QA 3KP3A 3CJQB 1YXRA 1JJ8C 2DOEA 1OJLA 3I5UA 1P4WA 4KITB 3L2CA 5HNFA 1XDPA 3ZYLA 1UCUA 2V79A 1FBUA 5BNGA 2QSFX 4OIRF 1HX8A 2V7LA 1HSTA 3TLSA 2WB1N 2Z99A 5AIPA 2LY1A 3CQZJ 2B9SA 3FBLA 4BXUA 4UVBB 1N32T 3CKDA 4DV0T 5LG4A 4N0BA 4V2FA 5FNVE 4RGSA 1UX5A 2KXPB 1GV2A 5F08A 3ZXSA 3JRDA 2XGCA 5HXRA 2VE9A 3OMYA 2XGEA 2XASB 4LF7T 1XMXA 2M1BA 3TLVA 5CJ5A 1QPMA 2DFHA 2VKOA 2CJJA 4D9JA 2V1NA 4H9PC 4HAMA 4UHTA 1FNNA 1XWMA 4MO7A 3S2HJ 4H63V 5AQVB 2BS3A 3FBNB 4CUGA 1AWCA 5LHIB 2FBKA 4KHPT 2RKHA 1ON2A 3ZMTA 1OEDB 4HFDA 3L2WA 3J7YJ 3W2WA 5FXXA 1S8NA 4EYYR 2E5VA 3RIUC 4LB5A 4H4KC 1UHWA 3BQYA 3QYEA 4LK1F 5EEGA 4A3KJ 2YINA 4XN3A 1VQNI 3D5RC 1BR4A 4CYDA 5EDNA 1JE8A 2W4SA 2MABA 2XQ5A 5J2UE 1LEAA 2B63J 4AD9A 4LF9T 1RETA 3AAEB 1JKRC 2EFPA 5KMGP 4CCOA 3E6BA 1HNXT 4L9VA 2JA8J 1I1SA 2M2EA 2OLTA 5FL0A 3KV9A 3I56I 5DCMB 5JR9B 1PP7U 3GXOA 3L2QA 3LK2B 5L3CB 3N2OA 1WJ5A 2Q2EA 5CVIA 2BG9A 2Q9QD 3O4XE 3RTRA 1WCRA 3I1AA 4QXHB 3T8RA 1FJLA 2OZUA 2QKLB 2MD5A 4RGRA 1FWZA 4AC0A 3IL2A 2O6GE 3HZJA 2A6TA 2EV5A 2FJEA 1HKTA 2XSDC 1YTYA 2OF7A 3K69A 2YU9J 1O7LA 2H1LA 4K0UA 2D1HA 3CMMA 3JR9A 2NTXA 4CH7A 1YIOA 2HR3A 2FRHA 5B5EC 3TL4X 3TKLB 4OINF 4HLXA 2ZJPF 5DABA 1QO0D 4U74A 5LLQA 3FXDB 3PL8A 2BG9E 2W63A 5GONE 3S16J 1I3AA 1T98A 1R49A 5IP6A 4GK0E 1XMKA 3JTHA 2DYRH 4HDVA 3HIFA 4DV3T 4AIUA 1OR7C 1JKPC 3ERED 1D1CA 2GIZA 4I7HA 2Y0SN 2IA0A 2EHOC 3AFHA 2LOOA 3HUGB 1HOMA 3RKOA 2M0CA 1QLBA 2Q1ZB 3CMYA 5EYRA 2UV1A 5LGNA 2NVXJ 2L5QA 3H35A 1VQ4I 2XUBA 1FSEA 1Y8RB 4DIQA 3ZQ7A 2IS4A 3C18A 3O8HA 4O4JE 3U3IA 1JGGA 5BR8T 3RIRA 2KIQA 2CV2A 2CMPA 2LFBA 4BAYB 2DI3A 2ZXIA 4S0HB 1O3XA 1W36C 3S93A 4ILCA 3VRBA 3LL7A 2QWWA 3QYFA 4YRVA 4CXYA 4X66T 3PUVF 1ULYA 1BIAA 1X58A 4L18B 2W2UA 1A04A 2FA5A 2XAGA 1KU7A 4G6QA 2VN2A 3GEZA 4M1PA 3A03A 3C4XA 3RIFA 5TGTA 3GTGJ 2TCTA 4H9RC 3I59B 2XSBA 1QRYA 4QH5A 5BMZA 2ZBKA 3ZRGA 2R7FA 2OPTA 1XX5A 3OIQA 1O4XA 5LJNA 4U7BA 4DMWA 2V6XA 2NAZA 1MNEA 2HQ5A 2G0UA 1ETVA 5KX5E 2CYYA 5DD8A 4NQWB 2ZXJA 5H20A 5JFRA 3ZP5A 4AIKA 3AA7B 1ZELA 5LG3A 1FBQA 1A5JA 3G1LA 5HEOA 1YQ3A 1S7AA 4YSZA 4A3JJ 3DPUA 3HTUA 5L3FB 2L54A 2L0KA 4A93J 2O3FA 3CMAI 3S2DJ 4M3GA 3PUGA 3L2RA 1YS6A 4YY3T 2NS0A 4X20E 3E22E 2JQHA 1LE8B 1B9MA 4JI5T 3ETUA 3ZT5A 5J4VA 2E71A 5LRSA 3LK42 2Y8DA 4JI6T 4JOMA 4XLPF 2V7IA 1JHHA 1UELB 3F72A 3H9GA 2CQXA 2STTA 1IXCA 4IL9A 2WZHA 4FT8A 1J1JA 1MBEA 2VBZA 1V9DA 2K5BB 3EDVA 5K7FA 4UR9A 2CV1A 3ANWA 1BIBA 4PJLA 5K1YA 3I9YA 4QHOA 3K7AJ 1G3YA 1XN7A 3A4CA 4YFXF 1VF9A 1FTTA 3Q5XA 1YW0A 5FLXK 1E2XA 1JUMA 5FKYA 3ZOBA 2PG4A 1VCTA 4PFOA 5AONA 1TL8A 1OQYA 4BEHA 4ADZA 2LRDA 2VB6A 2KJBA 3FZFB 2XSAA 2E5NA 3DU5A 3S15J 2HI3A 3OSGA 4QWQA 2L4AA 1Z7LA 4MQ9F 1OKRA 3AL0B 1IJ6A 3PNYA 3CPZA 4X1YE 5CA0E 1OPCA 2COMA 3RGLA 3GCMA 5ABGA 2ES0A 4NC6A 1I94T 4L9IA 4N9IA 3KP4A 2LBFA 2LKPA 1HCRA 2K9LA 5L3GB 2ZMAA 2MGQA 1FIPA 1ZARA 2RAEA 1YX3A 3S3OA 2VPRA 2DOFA 4B8XA 2KIMA 1WQ2A 1DUXC 1K4TA 5HLIA 2XGXA 4ZYHA 3OY9A 3IAM2 2E1CA 4IDQA 3I55I 5E3LA 2VK9A 4LMLA 4YTMA 4JI4T 1I6ZA 1RR8C 2NS8A 3IKVA 2G7UA 1F9NA 3IV5A 2KP6A 1L0VA 2NW9A 3QODA 2QEXI 1VQ5I 2UXNA 4Q47A 2D2SA 2H8RA 1PUFB 3TP3A 2BV6A 1SD5A 1FZPB 5HEJA 2LH9A 4ESFA 2E9XB 3ABVA 2UXCT 3QPLA 1BBYA 2QQ8A 5CVJA 4F91B 4Z91A 1KQ9A 2LSIA 3O9XA 3TDZC 5A1LA 4C2MJ 1MGTA 3HR0A 4A3DJ 2W85A 3HSFA 1VQPI 4NHJA 2E7WA 5HEHA 2HDDA 2HDWA 2XUEA 1V55H 1HW1A 3G3ZA 2FX0A 3VRAA 3P4QA 5HWYA 1FP2A 1Y39A 3ONJA 3M9AA 4A97A 3LA2A 3E6DA 1LQ1A 2IT0A 4Y15A 2VQET 4U88A 3LQRA 3DBLB 3RYPA 4EM0B 4LIVA 2CQ7A 3G73A 4PDKA 5DDGA 2Y9ZA 3E5XA 2DWKA 2HPLA 4UB6C 4O4HE 3L2VA 3SZGA 1WJFA 2V4JC 1LB2A 2KKOA 2HGCA 3BG6A 3PIPF 2IGOA 1LUJB 3TDUC 5J1RA 2PEXA 4CSWA 5JDLA 1W5CC 4D5FA 1XNQT 1R5ID 3F8BA 5E20A 2LMDA 4P0AA 2ZXHA 1PVEA 1TQIA 1P6RA 3SWHA 5DCMA 3EUKL 4U0VA 1UG2A 4BACA 3X1DA 3Q9SA 4D5CA 1FMWA 1OEDE 3G71I 5ILSA 2DQLA 2LT3A 3UNGC 4IZZA 1K6OA 2QSGX 3QU6A 4JP0A 1FOYA 4IE6A 3RYFE 2P5LC 3AAAB 1U6GA 4MALA 4MIMA 5JREA 3K70C 2YKSA 1FOXA 2KFDA 1TC3C 3BTIA 2JPCA 2QA7A 1MBKA 4YJ3E 2ZMEB 3G4SI 4HX8A 2PQ8A 1SFOJ 4DQ2A 3AEAA 4CZCA 1X1CA 2GK9A 4R8HA 2X1EA 4BHBA 1AOYA 2B7EA 1F1ZA 3KETA 3MQ0A 1RR7A 1K61A 3KFWX 1ZHFA 4IGUA 5LHHB 1Z0XA 2ZB9A 5ERIA 5GTHC 1H89C 4IDZA 4WZXA 5ETWA 3OS2A 2XAQA 4I09A 4MHCA 3Q0UA 3C98B 2HNHA 5DTDA 2ESHA 3Q0WA 1LVAA 4DYRA 3ZT7A 2H1KA 2RGVA 1R00A 2WP9A 4IEJA 2DMTA 2LF8A 3OOUA 4P9UA 1UUSA 1SD4A 2JUCA 5FLXZ 3OYNA 3OL4A 3KYCB 5AQIB 2UXXA 3ZSSA 4OX9T 4X6AJ 5K7ZA 3PSIA 4E7ZA 5AQNB 2ESNA 1GT0C 5LGTA 3WGGA 3GZNB 2HOEA 1FYLA 2O03A 4CGZA 4B6XA 4M3DA 3HTSB 1SD7A 3V5SA 2E2IJ 1Q1VA 5TRDA 1TLHB 3PTRB 2WADA 2V7MA 3S8PA 5FRNA 2DJNA 3GFLA 3KIOA 3OV8A 4FETA 3H3UA 3JAEA 3RQUA 2LJLA 4PK6A 2VQFT 4KIGA 2NP9A 3CUQC 3M07A 3MD2A 2VASA 2DU9A 1IJ5A 5LBQB 3QRFF 3H92A 1JNRA 2NW7A 4N78D 2DTZA 3ZCJA 2EBIA 4X62T 2R5YB 1E3PA 2P5KA 4OMZA 3BZCA 2YX4A 2IC9A 1XD7A 4LLGF 2NVUB 1HDDC 4DVDA 5HYAA 3FXLA 5KK1A 1X4OA 2K4JA 2EZIA 2L8KA 5BPDA 5L3BB 4H9SE 1JKOC 1NHAA 2BZTA 3HOUJ 1UHMA 1U5TC 1FIOA 4IIJE 3BTCA 4DW6A 3JRAA 4DUZT 3SQNA 1T33A 5CQGA 4C3JJ 1MJAA 2L9RA 2H7OA 2JT1A 3ECHA 4LOCA 4BJMA 3AXJB 4JBWF 2IP2A 2QYOA 3GWHA 4KNYA 1HBXG 3OL3A 3GZ5A 2YK0A 2JSCA 4I6ZA 4GCVA 1D0XA 5AFUL 1LE8A 5LNKA 5F0HA 3J7Yq 3MK7C 4XICA 1VQ6I 2XM2A 2IGMA 1B8IA 2EIMH 1IZ1A 3S3MA 2VC0A 2NW8A 4G6TB 2L3LA 4ZZCA 2K9AA 4AKLA 4LIUA 4KBMB 5B3SH 3VKGA 3CCJI 1B9NA 2KDOA 5E8IA 4TWFA 2MH9A 3QQAA 1OMIA 4LG0A 2AXDS 2ECCA 3DWLE 2WAQA 1OEDC 3GO5A 4M6VA 1ZK8A 1ZG1A 2V5DA 4QPOA 5HNHA 4HYEA 1Z6TA 3MKDA 5C4JJ 2OQGA 2MC3A 3UKGA 1IGNA 2F4IA 3RPUA 1OCTC 1T2KA 5FXVA 1BR1A 2XHKA 1H7CA 1D0ZA 3ZCIA 3CJTB 3HOXJ 2HHHT 2K02A 2WA0A 2ME6A 3AE8A 4ZI2C 2CW8A 2W7NA 1JTXA 2VQHA 3GTLJ 3OS1A 5D5WB 5E0OA 4G7HF 3CCMI 3P4WA 2P81A 2J47A 5JR9C 4MTEA 1KYZA 4UUVA 5AQLB 1W1WE 3HPGA 1U0JA 5HS8A 2QSHX 1Z91A 5B1BH 4V19K 4UV9A 5DYMA 1EH7A 1SFKA 3DKWA 3TO7A 1W7PD 5C8YE 2M30A 1E3OC 1M1EB 4JQFA 3NQOA 4IXAA 5IYCJ 4A3CJ 3ZJ1A 3BG3A 5D6EA 4AVZA 1UJ8A 2E5LT 2Y75A 3VU7H 4DZPA 2FBWA 3UUNA 2DW4A 2JJ7A 1T8IA 1AKHA 2BVLA 3T8OA 3BG9A 4BQNA 1R22A 4ZZLA 4XIDA 3WAJA 2IAIA 2JN6A 1T7SA 5M4YA 3BR1A 3PSFA 2VBXA 5KDMC 4A5MA 3I0QA 4IE7A 4ZZBA 2V6EA 4HEAA 2ADUA 3WU1B 2VJJA 1MJ9A 4Y7NJ 4EJTA 2ISYA 2V7JA 3GFMA 1Y64B 2P8TA 2GWRA 3N9QA 2K5CA 5ICEA 4E7LA 4IRGA 2L2OA 4B48A 4FE4A 2C5KT 3ZMTB 1WJCA 3BR3A 4XORA 3FBZA 4HWFA 2Y0MA 3MZKB 1KYWA 5J3LA 2M0MA 3TBIA 1T0FA 1HNZT 4EMSA 1ETWA 5F04A 1AJ3A 3V5UA 1EKEA 3NRVA 4Y4RA 2UUCT 3F23A 4UXNA 3S1QJ 4A3LJ 4BBSJ 2X0LB 3I0OA 1X2NA 2ZXWH 1VQ8I 1X1PA 3P9IA 4UUSA 1N34T 4HQMA 1K4SA 3JC6D 4EEFG 2D2WA 3RX6A 1M62A 4LJZF 5EK2A 4IE0A 2VXDA 4CN4A 3P4RA 5JH7E 2Q2EB 4OOIA 1Y0UA 2EWNA 1SFUA 2YN6A 3OYJA 3O3KA 4I0UA 2OCCH 2LSJA 3OYMA 5D4SA 3TMOA 3KEOA 3KP5A 3T5XA 3LFMA 3DTEA 2G7HA 1BC8C 2GZWA 4YTNA 3BQZA 3QP5A 2XDVA 3ZMUA 4FQGA 2JVGA 3HKEE 4JEUB 4EGWA 3KLNA 5DUKA 4HZFA 3IKTA 3CCEI 3LSPA 3MEXA 4B47A 2VI6A 1WR0A 3OBVE 1RUOA 5LMUT 3P50A 3R61A 5FO5A 1WH5A 2A5WA 1KEYA 1GDTA 4AIJA 3HRTA 3H37A 4ZYDA 4BE0A 3SZTA 2A2FX 3CD6I 1X2MA 4FI5A 3OYKA 1TW3A 3K8PC 1WI9A 2HXOA 2OA4A 2N1GA 2DT6A 1Z6RA 3R0AA 3PUXF 2M8EA 5HEGA 1U9OA 1S72I 2CQKA 3FXKA 2CA5A 1IV8A 1X79A 3FHZA 4Q25A 4LLNA 1ZN2A 2X66A 1RNLA 1QBJA 4GDFA 3BY6A 3G6EI 2M6IA 1MBFA 3M8EA 4GYIA 2QLZA 3JRFA 2HOTA 1ORKA 2WAQN 4IQ4A 5DM6F 1JXSA 5LGNB 4CDGA 1Z67A 2NWBA 2J5OA 3N5LA 4AQGA 3PE0A 3BZKA 4XMYA 4DZJA 4A2UA 5KAFC 3DTOA 2DFEA 2IRFG 1YQAA 3GMEA 1XPXA 5TISC 4ZDPA 2QKMB 3G1MA 3CCSI 1N33T 3LMMA 3ZMVA 3CCQI 3PO3J 3N4MA 3PUAA 2P6TA 3OYIA 2Z16A 2JZYA 3KCCA 2FEZA 4JI0T 2P4WA 4JYKA 1J5ET 2XAGB 2DN0A 3O1IA 2WWUA 4KDPA 5FY7A 5FGMA 1ZG3A 1DP3A 4LF5T 4B1RA 1ETYA 1RPWA 3PIOF 1ODDA 4TZ4C 2DMUA 5BS6A 3AL0C 3H0GJ 2CMRA 3S1NJ 2L7FP 1KFYA 1FOKA 1D3YA 2DHRA 5E79C 3FXRA 3I4MJ 2IAKA 1MSFC 2WB5A 4UVCA 2NVQJ 1IRFA 1EA3A 2RC4A 3CJRB 1LJ9A 4LGWA 4YSXA 2HVSA 1EZ3A 2Z6EA 5LP6E 4B4CA 1KQ0A 2LLKA 3CZ6A 3TW7A 4HWIB 3S14J 3UU4A 2R6GF 2XAFA 1XCVA 4I98B 2FJAA 1UURA 2QVAA 2J1DG 4ANJA 3ZQCA 2O61A 2VKHA 3DTIA 1X3WB 4I99C 2CWYA 3H0DA 4O4IE 3UUXB 2LHRA 3OS0A 4AI6A 3FZMB 1SD6A 2O7OA 3H5AA 1LEBA 2K3FA 3UU3A 4YIIA 3BCBA 1IN7A 4G12A 1IDYA 2D0TA 2H3RA 2DLLA 2E9XC 4X1EA 2L7MP 3ROUA 5HEUA 2NOGA 1LDKB 2YR2A 5LFAA 4CYCA 1B72A 4L5IA 3C50A 4XZCA 1E7PA 3KYLA 5M3MJ 2JPFA 4AUXA 2X9YA 3FXUA 2BGCA 2ECBA 4IL6C 5J8CA 3A0HC 2X0HA 1MMDA 4CXXA 1D5VA 1QSDA 2PMZA 3VHLA 1Y56A 1ZTRA 2XV4S 3HHHA 1I27A 4YT0A 3ANWB 1WFDA 3OYFA 2L3DA 2R7UA 1IRZA 1FX7A 4QWNB 3R60A 3K4BA 3HM5A 2X9XA 5HAXA 1YOVB 2XQAA 2FNPA 1L3LA 1SHZC 3L9FA 4ZTFA 1T39A 2BBYA 2VVSA 3A8YC 2R7RA 3GFIA 1ITYA 4A12A 4BXXJ 3J7AY 1BJZA 5DEQA 2XVCA 1QGPA 5ABEA 4HF1A 1ZRCA 3PM1A 2F4OB 4ZH4F 2D45A 3ELKA 3VB2A 2OTJI 3S4UA 4Z6YA 2K9MA 4PGGA 4PK4A 3KZIC 2M6BA 3I54A 4O3MA 5ICFA 2VL0A 2AXTC 5HCJA 1XG1A 2DTRA 5J1GA 2SPCA 2FXAA 2G0EA 3V8KA 2HPJA 1JT0A 4MEXF 4RMNA 1O57A 2F2EA 2LVSA 4LLLA 4CICA 5JLWA 5D5UB 3Q5EA 5M5XJ 4GKKT 5JDFA 1UFMA 2X1CA 2EZHA 2NVTJ 3GMIA 1SAXA 2L7KA 2W1OA 2V1UA 5HDNA 4KJZA 3GFJA 2XPUA 2ZMEC 3BJ6A 3VWBA 2CG4A 1GQEA 1YYVA 3C2GA 2KRFA 4ENNA 2UXNB 3C4WA 3N9LA 4HV5A 4TV8E 4FE7A 3UU6A 2Q9QA 3RZOJ 2ACZA 2CHOA 3QUJA 4FJOA 2VXZA 2Z33A 1XNRT 1YW8A 1FYMA 4HFEA 1U3EM 2GLOA 2QF7A 3ABUA 3U1DA 4A3FJ 3F6VA 1ZV4X 1Z21A 2VBWA 3P5JA 4MBQA 2CS3A 4KUMA 3NZQA 2M7AA 2Y31A 3BC8A 1AHDP 4E6KG 1N78A 3KPHA 2RPAA 4M9XA 5ILUA 1BI0A 4QLCU 2XF5A 2M87A 3GLLA 2RP4A 3UT5E 4TWHA 1DU0A 1YLFA 2PFBA 1MIJA 2QA4I 1I1GA 3WHCA 2EHOD 2MOZA 2O8XA 3TW6A 3HKCE 5HXEA 4S04A 4BQAA 2J62A 5J1UA 2ZCWA 1LFBA 4G8XA 1HFAA 4EM2A 3P4SA 5JTGA 3PV0F 4C2UA 3PO2J 4XBFB 2K85A 1OXZA 3WTYC 3IAS2 2BYVE 2RDPA 3PU8A 3OR2C 1S5LC 1R1VA 3RYCE 1OYWA 1MH4A 2XPWA 2H8WA 2MG4A 4B09A 5JLXA 3E0JB 1W36D 3A7MA 5DJQC 4ZEYA 2F4VT 3BT9A 2X0LA 2JQ9A 3CQGB 5FVKA 4JK1X 2WAUA 3QB5K 3VEPA 5L4EA 4BGDA 3HJEA 4MLOA 3F2EA 4I43B 5IOZA 2W57A 2H6CA 2ZSHB 3GTQJ 3LA7A 4LMKA 3B02A 2D5UA 5H6RA 2GIVA 2E2JJ 5CB4E 4JUYA 2ZFUA 4R79A 5FD5A 1MIYA 1S7EA 3CP8A 2FU4A 2KNDA 3UU8A 3ZQFA 4RAGA 3WG9A 3AEDA 4U7DA 2PFVA 4ON0A 1VQ7I 4PNIA 4A5NA 2DA2A 4ESJA 3O6BB 1J5WA 1T72A 2LNBA 3N9MA 3N9OA 4RLQA 3OYGA 4HTEA 1GVDA 2KISA 2ZM0A 2MBGA 2JRKA 3CWZB 1DGRM 2XHEB 1G73A 3J81K 1HC8A 2XAQB 4G6DA 5LB7B 1YW9A 2LTPA 2MYSA 2WTEA 2CXDA 2LSYA 4EXTA 4EGYA 5LMNT 2PMZN 3C7JA 4PK5A 4M73A 4PFPA 2MBFA 1S94A 2OV7A 3DP7A 4BKXA 1TZLA 5GAEJ 2WCAA 3KBUA 5F3JA 1RZ4A 1HNWT 4XRSA 3OJAA 1VCSA 3CCLI 1EH8A 1RESA 2LREA 3WTZA 1ERDA 4WYVA 3QPHA 1YX5A 2PG8A 4HOBA 4J19A 2CLYB 2UXXB 3U2RA 4EV6A 4F93B 3R6SA 4N4NB 5LGTB 4CO8A 4U7IA 2FOKA 1YITI 4V2GA 4NUVA 1H8AC 2M3AA 1MD0A 2KRCA 2RV8A 5CGMA 5JVGF 1IAPA 3LSMA 3MJXA 2XQ8A 4IHJE 2YUSA 4JX4A 4MTDA 2N9DA 3JW4A 1EJ9A 3NZPA 4GGGA 4CA0A 2LSKA 4TNWA 2BHZA 3RHWA 4DV4T 3ZMSA 2Z1DA 5JDHA 2EIKH 5J2TE 1MMAA 4M9ZA 3PURA 2EV6A 1O7FA 3JSOA 2A3DA 4CXFA 2NR4A 2WBMA 5E3MA 5LD2C 1Z9CA 4P0BA 5FKMA 4Z90A 4A5XA 2H94A 3LAPA 2FF4A 4A69C 2HFHA 2QGSA 2R7OA 1ETKA 1SFEA 2DAOA 2C5JA 1HW5A 2XY8B 3R6NA 4DR4T 1POGA 2UXDT 1V5GA 4IHYA 5HXCA 1YKHB 1IN4A 4W97A 5HXSA 4WXDA 2DMNA 3AVRA 2AE9A 4TNVA 2HKXA 1X19A 4DNDA 3QWLA 4JV5T 2LOSA 2X85A 4RDUA 4XKCA 3RQIA 5IPAA 2QQ9A 2ZJRF 4E7JA 2CE7A 4QXCB 3VYUB 1B8IB 4RA2A 4O2BE 4N4OB 5L2LA 4CN6A 4PZJA 4OYJA 5HS7A 4QXBB 2PMUA 2JIWA 3HG9A 2VLAA 3E1SA 3ZN0A 5KXJA 4KA4A 4LG0B 2AS5F 3DBHB 2IVMA 4II2A 4B44A 2EPFA 2VOPA 2CQQA 4IHTA 1XMOT 2H6BA 3BJOA 1GHCA 3S32A 1LDDA 2I8DA 3AG4H 2LHNA 3HKDE 2ELKA 1ZRFA 4IHSA 3RKQA 2LKXA 1X4PA 4HRIA 3A2KA 4IT4A 4UF0B 4AQFA 3CLOA 5FL1A 5C4XJ 3PFYA 2K9NA 2E36A 3P7NA 2VKJA 3HSEA 3ZYKA 2FUG2 3JRGA 1B59A 3LA3A 1G2HA 2LM9A 4RAYA 5CYVA 5K5QA 1FEXA 3C51A 1RI7A 2XB5A 2BG9C 3B73A 3GUDA 2XPVA 2DDBA 4I02A 4F3QA 2R93J 4U31A 1MMGA 4A3GJ 2OJED 4U3CA 2JA2A 4UV9B 1L0OC 2W84A 3PUSA 3U78A 5IT9K 3D5LA 3CDIA 3DFGA 2CUEA 2X9HA 2A69F 5CLSA 2DO7A 4Y3OA 2PJQA 3QOEA 3K70D 1W0AA 4X5TA 3CQXC 3ZC0A 3FXOA 2IGNA 1O3TA 4C90A 4XLEA 4KP3C 2MTQA 3WTUC 3J81Z 2WWVA 5ILVA 3CC2I 1MMSA 1APLC 1UG0A 4DJAA 2V9KA 2I0MA 3MKZA 1AKHB 3AVSA 1D5YA 5L4HA 4PW8A 2KZ7B 4PCQA 4YFSA 2LM2A 1OYYA 2F5VA 1D1BA 3K1MA 2EH3A 2IHR1 1QZEA 1BR0A 5A2QZ 1Y6IA 2CFXA 1YFHA 4HF2A 1X1DA 2STWA 3HRSA 1USTA 3I64A 1EF4A 4Q48A 4C3HJ 2B1EA 2LRKA 4P5OA 4XBFA 4IQJA 4JI7T 2Y69H 3P8CD 5KNLA 1SANA 3RF1A 2JK3A 4BE1A 2XPKA 4Z8XA 2A61A 1TNTA 1HXDA 4UXNB 5AQGB 1U9NA 1ZH5A 4A0XA 3ML6A 5JI6A 2BEOA 4UUSB 4X65T 4OIOF 3PNVA 1KK7A 4BDZA 4ERRA 1YJ9I 1OYIA 3H5NA 2GOMA 3V7RA 3PUYF 1WYCA 2CEAA 1R1TA 3MACA 1T56A 3L09A 2GXAA 4IHWA 1J59A 4IRHA 5ADXL 2HN1A 4XK4A 1WSUA 5FY1A 1UCRA 2Q8KA 2KPMA 3BK9A 4BYYA 3HC7A 2K48A 2X6YA 2L9NA 3HEFA 3MKLA 2CXFA 3ZMUB 4E4HA 3BPVA 2YX7A 1BOAA 3ZN1A 1ZLJA 2L9VA 2CW0F 2L01A 4WF2A 5FKNA 1IN8A 5D5VB 2KDZA 1XGMA 1JGSA 1VQLI 3K3OA 2X48A 1U8RA 1HA8A 3ZLIA 3ZCOA 2WU5A 1TT5B 4XLCA 2R7QA 3O8GA 5ABFB 5AQUB 3F57A 1MBJA 2V7FA 2LD5A 1W09A 3TO9A 1FBSA 4I01A 2YS9A 5JDNA 2BY1A 4CHUA 1H9GA 3W15B 1P7JA 1KA8A 1VQMI 4YHHT 3VR9A 2PX9A 3MFKA 3FXMA 1VI0A 3WE2A 3ZMZA 1MKMA 2IW5A 4XLFA 3CMEI 3N9PA 3E3VA 4ZS3A 4BUPA 2O9LA 2V1XA 1R6RA 2MA3A 4GYSA 2R3SA 4J01A 3UULA 3FXJA 2UUAT 2BBHA 2HTJA 1V4RA 2WC2A 1R4NB 4JX6A 4MHGA 1FEWA 3CCYA 1TWAJ 2DMQA 2O5RA 2XF7A 3KYDB 2H7VC 1XDOA 4NUUA 5E1XA 3ZMVB 3A01A 3RPQA 1BW5A 4ABZA 1VFCA 2NVYJ 4JLEA 5L47A 4M71A 3UFGA 1MIWA 3RRWA 1ZAOA 4AQFC 3T8TA 1IO2A 4KT5C 2KJCA 3R84B 2W4XA 2GOXB 4BJ6C 5IY5H 1GXPA 1WWXA 4QTRA 3PJRA 5CVVA 2UXBT 2KSRA 2X67A 3IWFA 4ZI2D 2P0WA 3BZ6A 5BQTA 3CC4I 4O8SA 2CRGA 3M3ZB 2X9DA 1YJWI 5AQMB 3P4PA 4BBRJ 2L7ZA 3CVRA 1XGNA 3PQKA 3OYZA 1FJGT 3IUOA 1K6YA 1QVTA 3SZPA 5IT9Z 3T0YA 4UVCB 3B6CA 5C44J 4EB6E 2LY9A 4HWHA 1Y8QB 3I9V2 2XAFB 4CI1B 2LKSA 4HWDA 1Z0PA 2WU2A 5JHUA 2EK5A 1KONA 2E34A 4DR7T 5IYZE 3RDIA 3TO6A 2DA4A 1R58A 2HZTA 1A31A 4DO0A 1RRJA 2OU2A 4G94A 2DPUA 4Y52J 2KQRA 4IHVA 2RA1A 4IE4A 4UEMA 1P4AA 2HPMA 1FY7A 3RI5A 3FX3A 2E1MB 3WTWC 4GK5E 3CP2A 3M1CA 1P7IA 4NBQA 2EINH 4CYCB 1B72B 2Y48B 4OHFA 4XLNF 2HQRA 3EUAA 1W7PA 5FJ8J 2COBA 3MWMA 3VYRB 1BI1A 3HRUA 3CCVI 1WYBA 4AKIA 4EEDA 2E2AA 2V6CA 3TOBA 2F6CA 3VODA 5IP9J 1S35A 2QRXA 3E0ZA 3M65A 4EIWA 1OCCH 3IBPA 1NWMX 4COFA 4HWCA 2DNXA 2FUPA 2XAJB 4QH1A 4GOUA 4DNCA 2ZFWA 4C30A 1ZP0A 4M3BA 3WE3A 3A02A 3K3QC 3LSTA 4LF6T 3K1PA 1U2WA 3QNUA 2NXNB 3IF8B 1KU9A 4WNKA 3RRCA 3N97A 1D8JA 2ID3A 2Z5UA 4TV7A 1W5SA 1SMYF 2AO9A 4AVPA 3SOLA 5JHFA 1Q1HA 5AQQB 3K9TA 5F8PA 2ZSIB 2PBIA 4UF0A 2EQRA 2OD5A 4L9TA 5FKOA 3L3PA 3CIRA 2YDSA 1LDJA 3GTKJ 1V5EA 2W61A 1J75A 3OSFA 1JI8A 3OWTA 5IP7J 3P9KA 2XB0X 3V42A 3AAFA 1OCZH 2KLOA 3ERMA 5LEKA 2XAHA 2OBPA 1XTAA 4NDLA 3M7GA 3PUBA 2R0QC 4PJNA 2E1OA 4RB3C 4AXPA 5LHGB 5AQJB 2CWEA 3ZKRA 3DPTA 2JA5J 4ZI3C 1S6LA 2Y9YA 4EQQA 1K79A 1W5TA 2W24A 4M6XA 2XKOA 3BQLA 3JSPA 2MSYA 3RKYA 2IC6A 2JUGA 2VC1A 3N2KE 2XSJC 5GPCA 1IXSB 2I6HA 3AE1A 4XKBA 3UFEA 2Q9QB 3M3YJ 4DV1T 4XLHA 3HOWJ 4BJTA 5FRMA 2FSWA 1X1AA 2UWMA 5E17F 3BP8A 2FQ3A 4ILUA 1XDUA 2VPLA 2QBYA 3GTOJ 1HTJF 2ID6A 2QVOA 2EFOA 2F5FA 4BS9A 2XAUA 1X1BA 4KUMB 2W25A 3FKJA 2JWTA 3F3XA 4U33A 1UZCA 1Z3YA 2ZC2A 4UVAA 5EZHA 3I53A 4H9NC 3ZC1A 3FMQA 3LNQA 2R5ZA 4Y13A 2XTLA 1MSEC 3ABMH 4XOPA 2CGPA 2KT0A 1U5PA 4LB6B 4DYCA 3C64A 3UUBA 3JRCA 3KP7A 4AQYT 1BW6A 1IAWA 4RB2C 3RIAA 3MA9A 1X3UA 2H89A 5BOXA 3B6AA 1MNMC 3MXZA 4JX5A 3W2AA 4DIDB 5AQTB 2OA5A 5M5YJ 4KHZF 3V7CA 4O4LE 4EATA 5AQFB 3OYHA 1R36A 4EM1A 4MQVA 3HOYJ 2P9BA 2QM3A 3NAUA 3VDXA 2CHNA 1DU2A 1HSJA 3WTTC 1REPC 4X1KE 3CF5F 1HF8A 4EZHA 2V6YA 2AXLA 4ZXLA 4NB5A 3AE6A 4YXDA 5K7HA 3Q5WA 4FTHA 4OWRB 3C3WA 1XB4A 1R5HA 3GTPJ 1US7B 4E7IA 4L0ZB 2CWOA 5H6RB 3K4KA 4XRSG 4WXCA 1MMNA 3RKGA 4ZS2A 3TGNA 2VJIA 3WGHA 3HOVJ 5LGUB 2J5PA 1FSHA 1HKQA 1HX1B 5D8LB 2VIXA 4KIBA 2QENA 4OFZA 3I3LA 3IHUA 3ZJ2A 4KYWA 3DU6A 1IBMT 3ZQGA 5FLMJ 1FP1D 3DEEA 1YRNA 1TW2A 3S1MJ 1LVFA 3UU5A 5LYJE 2IXSA 4A3EJ 4HEA2 4I50E 1WHUA 2HWVA 3KP6A 1R7JA 3DV8A 3FK7A 1MDMB 5ABFA 1WI3A 3OYEA 5HS9A 3JAFA 5E8GA 3W6KB 2IJLA 1F43A 4KT6A 5GADJ 4FX4A 3MAJA 5CA1E 4GYRA 1B6AA 5JQGE 2MD0A 2E9XD 3BTJA 1Z05A 5IWAT 2E8IA 2AQEA 2GBYA 3H36A 4XOTA 3GA8A 1Z1DA 2XRNA 1TWGJ 4LK0F 3UR3C 2LE8A 3BQIA 1NG7A 1IRGA 1NEKA 3GN5A 2UZKA 3JRHA 5D4RA 4BY7J 3OR1C 5IOYA 1RUNA 3WAKA 5EGOA 2BY2A 2ETHA 5F1RA 3P7IA 1WKMA 4MGRA 1J0RA 4HNTA 3J7AO 1KNPA 4IL4A 2RVCA 2CQNA 5FKLA 4P9FA 4BL0B 3ZQIA 3KINB 3NWSA 4C9YA 2DK8A 2FD5A 3HOTA 4ENJA 2KT9A 3DKXA 2ZNZA 4U87A 4XLAA 4MLKA 4HFCA 2MC4A 4XSZF 4HFBA 4B3TT 1UX4A 3I9WA 4KMCA 2W0GA 2KL4A 3I4PA 2MAWA 1WCMJ 4XQFA 2XQYA 3L7WA 1OCPA 2V1DB 2VKDA 1BR2A 4HBLA 2LKGA 3ZMSB 1YW7A 3C2BA 2WV0A 2V5CA 4CI3B 1HG5A 3W3CA 2JMHA 2IBDA 2BKPA 2CUJA 2C6YA 3HPHA 2JQQA 2YU1A 3CJNA 3K2AA 4QX8B 2A05A 2K27A 5H6QA 4IO9F 5AQPB 3RKXA 1VQ9I 2R7TA 3RIUA 2DYSH 5F0FA 5B1AH 2PJRA 1SVMA 1IZNB 2O0YA 5EZYE 3Q9DA 2QGUA 2HU9A 1ETOA 1VNDA 1OFCX 1T38A 1ZGJA 2LLYA 1NAFA 3K4JA 2M67A 4WW0A 5FP3A 1ZQ3P 2I59A 4XRFA 2DBBA 2CUFA 5JVDE 5DUIA 1NTCA 3SJMA 5IYBJ 2WMOA 2RQPA 1PP8F 5F5WA 2ZKZA 3ZR8X 1I6XA 3LSGA 3M8JA 2JQ7A 3EUHA 3FZHB 3VSLA 4B3XA 3Q5FA 2MLKA 3R0JA 3EDPA 1XDSA 2JTVA 4YG2F 4KMUX 3SHFA 3RLFF 2HQAA 2Y48A 3PUZF 4YJ2E 4M3EA 1SE7A 1TWHJ 3DKYA 2HKOA 5DD4A 3OYBA 3TLTA 4BNCA 1MBHA 1R4MB 3ZGKA 2IS1A 4RGXA 4ZYEA 2KIUA 3K4MA 2P7CB 5JVTA 1O3RA 3BLYA 3T1YT 2TDXA 3SFDA 4BE2A 3ZN0B 1VQKI 4XN0A 2XAJA 3TQNA 1Y01A 3MKYB 3OTOT 4PJJA 1BOBA 1LNWA 1CHUA 3SS1A 3BR5A 3CX6B 4TV9E 3PJAJ 5L3DA 3AG2H 5CVUA 1T0FC 4Y17A 3LDQB 2WQYA 2Y6XA 4DMVA 3PFIA 4QX7B 2XC7A 2K86A 1JNZA 2C5IT 2L9QA 4RB0A 4L5JA 1GVJA 1YE9A 3BR0A 4PGHA 2EV0A 3QPTA 3QYBA 1U8BA 1OR7A 2VONA 2HTSA 3IEEA 4B3RT 2HDCA 2VWAA 4OAYA 2HYFA 5JRCB 4YELA 2EHOA 2A5YB 2H09A 2VT3A 3K0LA 3GZ6A 4AM3A 1B1BA 3OIOA 4MFEA 2GA2A 2DQRA 4XONA 2XZEA 4BXFA 2EFQA 3LG7A 2X6XA 2QUFA 1ZOYA 5HWXA 3FMSA 3HDDA 2I5UA 2FBHA 3HB9A 1ACIA 1D8KA 1WGXA 3LK3B 3CC7I 2DLRA 3M4OJ 4FHTA 3BJAA 5LHGA 5EG0B 3CLQA 4RAZA 3WU2C 2CO5A 1D1AA 3V8LA 1A36A 2O8KA 5D8KB 1G3SA 1SFXA 4ILAA 3Q0VA 3K2ZA 2W00A 2EB7A 4IDNA 2YU2A 2Y2ZA 2PI0A 4XRMA 2VE8A 2NOXA 1NENA 2M7BA 3FBIB 4ZI7E 1I39A 1T8BA 4LMYA 3LOCA 5EZGA 4HFVA 4ZHQE 3QOFA 5JDMA 2E35A 2BY3A 3EYYA 2X0YA 2FE3A 2QQAA 3BR6A 3SDBA 3RYRA 3TKYA 2ICWG 2PTFA 4DV5T 5GPAA 3LSJA 4C2TA 4LFBT 4KN7X 1KZHA 2H27A 1YI2I 4Y33A 2CBIA 2MLGA 1YQ4A 2K9SA 4WCGA 4RM2A 2KZGA 3EPZA 4HX7A 1IV6A 2JA6J 4F8HA 1KU2A 3GF2A 4BDYA 1R71A 2LP0A 2DA1A 4DBQA 3DLLF 1U5TB 1XZYA 4AKGA 3WODF 4U0YA 2V8SV 3ISPA 1I5ZA 3CDHA 3DEUA 3KZZA 3CO7C 4EJUA 3LBXA 3EDUA 1XGSA 4JI2T 2BE5F 3V8JA 4X0GA 3H3ZA 3L00A 4A3MJ 2Q0OA 3AA0B 1HDPA 4RM3A 4ZTJA 3K3NA 4MNUA 2VOOA 1WH7A 3KE2A 5LOVE 3VKHA 4BQQA 4DR3T 5J1YA 5DS9A 4HQEA 1WJEA 3X2QH 4G7ZF 2M4KA 2KMFA 1S7OA 1TWCJ 3ZQLA 4DR2T 1QUUA 2JQKA 4KISA 4N9HA 3TLUA 1WLXA 1ZEEA 3AEBA 3MVPA 3B13A 2BBJA 2LDUA 2FJDA 1W4MA 4M74A 3OPCA 4ISSA 4IDPA 3ASOH 2IPQX 2D9DA 3PUFA 2BW3B 2IA1A 3WGIA 4E7HA 1ON1A 4I0AA 1RKWA 1MJBA 2R7DA 1TQPA 1O3SA 3ABTA 3VOEA 2ELHA 3HGGA 1G3TA 5GTIC 1WJDA 2DOAA 5LGUA 2IGKA 4ENMA 3KVAA 4QH4A 3AEFA 3KV4A 3ZN1B 3O1JA 3G06A 2RQQA 1MBGA 4Q5SF 2W67A 3HHGA 2CBJA 1XC5A 2J4GA 3OOPA 4G63A 5HDKA 2LSOA 5DM7F 5IYDJ 3BG5A 1N36T 4GYGA 3MN2A 1MDMA 1IC8A 2WDQA 1V54H 3EUHC 2E1MC 2DODA 3I71A 2BY0A 1BL0A 4OIPF 5BMVE 9ANTA 1ZREA 1OISA 1VQOI 5CPRB 3Q5DA 1E1HB 3S17J 2ZO4A 3E08A 3M1EA 3CQCB 4EYUA 3H3VK 1ZYRF 2L9SA 3KP2A 2IW5B 3ZMZB 4WXHA 3LSIA 3U9GA 2KHMA 1IUFA 1XMQT 1IBKT 1IJWC 3OKQA 3F8NA 3RZDJ 5IUXA 1CQTA 4U72A 3T1HT 4B3ST 4HF0A 2RN7A 4L5EA 4B3MT 4HGAA 5LCYA 3BROA 4OMYA 3K6GA 3DPLC 1SVLA 1K78A 4M72A 4KICA 3GLXA 4IOCF 5A2QK 1QPIA 2P6SA 3QAHA 2MW8A 1XSXA 3FK6A 4HLYA 3GYHX 2KZVA 3F8FA 4FASD 3ZMDA 2C0SA 3PDYA 2GQQA 1P92A 1WJAA 3AE5A 3A01B 1P9QC 1W9RA 5FYMA 4W1UA 4LF8T 5FKKA 1J2XA 1N25A 4YIRX 4ZOLE 4XM3A 3EHZA 5FB2A 1VOMA 3H3AA 2M9HA 4WWCA 2LC2A 1YIJI 2ACXA 2P5VA 3IP4B 2YU3A 3HXLA 2V1DA 3GBGA 3W6JB 2F5CA 2YPRA 4LFAT 1GXQA 1KNZA 5GAHJ 2HYGD 1N75A 5EEAA 1K7AA 4ESBA 3AKZA 2K3PA 3NARA 3WTVC 5HCMA 2DCEA 1RC9A 3I58A 4XSXF 1SEUA 5ABHA 4Z2YA 3PU3A 3FM3A 2Z3YA 4LMJA 4LF4T 2GAUA 3S2WA 5LA6E 5FVLA 1PYVA 4H63H 3I4NJ 4DUYT 2XROA 2CW7A 2JPBA 4L9JA 2F4MB 4UV8A 2EA2A 4QPQA 4KMFA 1S29A 1SUMB 2D0UA 2YDQA 3CUOA 2KWIB 1NK2P 1SVOA 3LFUA 1XS9A 1W0BA 2K40A 1JTYA 5D5XB 2KIFA 3NVOA 4P09A 3PNTA 3GVAA 3ONLC 3GW2A 3CDLA 5DV5A 1HR0T 2Q9QC 2YSRA 4PJMA 4IX7A 1ZR4A 5DQVA 1IRXA 1LVKA 1LRZA 2K24A 3IRQA 1UK5A 1MW7A 2VJ4A 2R7ZJ 3Q9VA 1W7PB 3NKZA 4AKHA 5FLVA 4CCNA 4BY1J 1FMVA 1BC7C 2IA2A 2NNYA 1ZR2A 4HKAA 3GTMJ 4L9NA 4RAFA 2BHYA 2FBIA 1GUUA 3FHNA 4IKFA 3C1DA 3KEQA 2NYXA 1BI3A 1Y1WJ 4KX6A 2FQ4A 1E17A 4LITA 3R4KA 3RJPA 2KLQA 4HSRA 3LSKA 5E1ZB 5KCMA 4YFNF 3ABKH 3TEDA 3EQLF 3GX4X 5F64A 4CCJA 1CGPA 4X64T 3ZQHA 2F5EA 3RQ4A 5TAOA 4WX9A 4UELA 4BJ5C 1UGOA 3BWGA 3KZYA 2X9WA 4GKJT 1F5TA 3AE9A 3SRZA 1BA5A 1XCBA 2LSGA 4A3IJ 3PUWF 3AA1B 3AEEA 4OIQF 4DV6T 2BKOA 4IPAA 2WDRA 3Q3SA 1FOWA 4IJAA 2BZBA 5JRCA 3SXYA 3HA4A 3AE2A 4BJNA 5EEHA 4D1QA 4K0KT 2OV9A 3OYXA 1MNDA 1JHFA 2XAHB 3HGYA 3CK6A 3NWIA 3K4LA 3ULQB 2RNJA 1XSVA 3DF8A 3F21A 1R5GA 1FIAA 5DQWA 2LYCA 3K1NA 6PAXA 2CH0A 4ITVA 2CV0A 5EG0A 5B66C 3V7SA 3HRMA 1UHSA 3DCFA 5AIQA 3J80K 5ICGA 2CSOA 2E60A 3H9QA 3CF2A 5AQSB 4E70A 5C3JA 1WR6A 2WS3A 1E3HA 3HL2A 2JMKA 2VJ5A 1BM9A 4F55A 1CF7A 5FMNA 4BHPA 3CUQA 5HVQC 1K83J 2HPIA 4HN9A 3NRYA 2LF7A 2EZLA 4A3BJ 2K3WA 4I76A 1VTNC 1IUYA 2DA3A 3UQ7A 3W2VA 4WK8F 1QQIA 1FC3A 1YD8G 2QBYB 4RS8A 3N05A 2B0LA 4HW0A 1MIVA 3JRIA 3AEGA 4PUSA 5K5RA 3HOZJ 2QZ8A 4CCMA 2LRLA 5ICCA 3EAMA 4RGUA 4YFKF 3HKBE 3O2PE 5F0CA 3KVBA 4UVAB 2D1VA 2R5ZB 1AU7A 4F6RC 4C91A 2DMPA 2CU7A 1AA7A 2GXGA 1YS7A 2XQ4A 1U5TA 2IS6A 3A0BC 3G2BA 3CO6C 5L3EB 2VQGA 4BU2A 2L4MA 1FTZA 4IE5A 2EZKA 3M8FA 2DXIA 2PN6A 1QNTA 4P55A 4UVBA 2W82A 3SEZA 5HLGA 3ESLA 3ETVA 3VSKA 5CFBA 2R7XA 2K7LA 2D5VA 3KLOA 2XASA 3CTAA 4K2EA 1FT9A 4IRIA 3T1BA 4IREA 2XQ9A 2IS2A 3KEYA 3UQ4A 3OIPA 2FOWA 1TWFJ 2M8GX 4EVIA 2V6YB 3QK6A 2W62A 2VUMJ 4GFBA 1S3JA 4FX0A 4NXMT 3CX7B 3IH2A 5LHIA 3WTSC 2ACJA 3C4ZA 2BW3A 5IT3A 4ILBA 3NRXA 1J5YA 3JCUC 1T95A 4EJVA 3N2GE 1OEDA 5LXTE 3VYTB 1PUEE 3DXJF 3WI3A 1HQCA 4AKRB 2P7VB 1R23A 3E6CC 2E7XA 3IA3A 1YJNI 3H3MA 4NC8A 1RIOH 4ISTA 2EA4A 2JRMA 5F1JA 2X51A 1OCRH 5EF6A 3B57A 5FXZA 3JADA 2YEVC 4NPPA 2UUBT 4P1WA 1YRNB 4EGZA 3FISA 3C2HA 4G9YA 4HA8A 3HI2A 4L0YB 3E7LA 2DWGA 1XMAA 5F27A 1JUPA 4AIDA 3RI4A 4AISA 1WJBA 2N2NA 2DPDA 1N77A 5JR9A 3VPRA 3E97A 5L3CA 5BPIA 4A0ZA 3RCOA 3NWTA 5EK4A 2VQCA 4JI8T 3F8MA 1Z7UA 1F4KA 3DLAA 3AE4A 1TTYA 3SDGA 3LJCA 5F6FA 3FB2A 3GN5B 5JDQA 1LKXA 2X4HA 2HH7A 2A68F 2DT7B 4JYAT 5J4YA 3FXEB 2LK2A 5EGOB 3DEWA 2V26A 3MZ8A 4UNOA 1C0WA 3COAC 4YTPA 2ELJA 2FNAA 1MH3A 2EFNA 3AECA 3FDYA 2JJ9A 3RSNA 3VFZA 1D0YA 1TNSA 2W66A 4HV6A 1TT0A 3OYCA 1LPQA 1PDNC 2R92J 1HS7A 1FPQA 4OYKA 2E5ZA 1J7KA 3D5SC 2HYJA 4PSXA 3I0TA 2XRLA 3QOPA 3NEUA 3REOA 4GXOA 2WSSV 4X1IE 4EEBA 4AYBA 3CCUI 1W0UA 4H9OC 2AHQA 5HLTA 3LSRA 1NK3P 3AE3A 4YHJA 5HDGA 3KX2A 4JBAA 2VQLA 1F36A 4HNUA 5H2FC 3L2UA 2CUZA 2JMWA 1FYKA 2YOEA 3BTLA 3GTJJ 4JEHB 5E3NA 3VR8A 4HNVA 2DI4A 2ZM2A 3F6OA 3HUGA 4TX5A 4CCKA 1T6SA 4RB1A 4P1NA 4MFDA 4F52A 3L39A 1JJ6C 2CXLA 3BPXA 3J7ZI 4H9QC 3DJBA 5H6QB 3ZYMA 1H88C 5DCFA 3QC9A 4EAHA 3J80Z 4BQOA 2PJRB 3FWEA 4CQIA 4LFUA 2L02A 2N8GA 4XAXB 3HKZA 3SFIA 3BCAA 4BAYA 4QIWN 4CZZB 1XSDA 3CCRI 1DDNA 3U1KA 3FZVA 1ENHA 4ENKA 3F31A 3ZPOA 4ZI3D 4J00A 3FIWA 3L8RA 1Y1VJ 2NRAC 1EV7A 3WHBA 3IH4A 4GO1A 4OK0A 2XQ3A 1YO5C 3I59A 5D6FA 3JRBA 1G4DA 5FROA 1U78A 2CCQA 2KINB 2XQ7A 4HE8A 3UUMA 2A72A 5LJMA 1UMQA 2G9WA 4A98A 3ZPLA 5AQKB 3QU3A 2DFIA 2KMUA 3ZEFB 4XKVA 4DYQA 1Z8UA 3AE7A 2KRHA 2WY8Q 2BOLA 2VKVA 3K10A 4NQWA 3MMYB 3RKWA 4U0WA 4U2ZA 1NG6A 2WAFA 1JT6A 4U2YA 4XKWA 3E5UA 1WRJA 3IWZA 2BDEA 2LR8A 1I50J 5L3FA 3W6VA 4UB8C 2BVMA 4TUYE 1V3FA 4HSTA 1UAAA 1BJAA 3HSRA 4HG2A 4PSWA 3O1HA 2DL1A 1R8IA 3AA6B 4LG3A 1R9TJ 5HXHA 5L3DB 1Z3XA 3FZKB 2DK5A 1QA6A 4KFCA 2VVNA 1M7KA 2XIGA 2BXZA 1HF0A 4NNJA 1HW2A 2CRBA 4AWXB 4UIGA 3KBTA 3FF5A 5FFZA 3MZYA 2EHOB 4A6EA 1KF6A 2MPKA 2DT5A 3LWFA 4ASKA 1IBLT 2XF6A 5FD6A 2DJIA 1VRBA 3D0SA 4ASNA 2ZJQF 4PAGA 3SYTA 3DBRB 1ZHCA 2IIUA 2UUZA 4LD5A 5AQRB 1T08B 4TWDA 2VODA 5J0ZA 3ESWB 2UU9T 2ODVA 3HL6A 1XGOA 2XM1A 1QZYA 3JAMK 2ZM8A 2GA1A 2HQNA 2HVQA 2YDRA 4IHXA 5E1WA 2XGDA 4ETSA 4YEJA 5LBMA 3D0TA 2OTLI 3EI0A 2QYWA 5AQOB 2HS5A 1G6NA 3VYSB 2IMLA 1Z77A 4I4TE 1DPRA 1KU3A 2CM0A 2OC6A 4AIHA 2H88A 4RBOA 2ISZA 1HG2A 2V9VA 3EETA 2BS2A 3PJAA 3OYAA 3ABLH 3IH3A 1WZ2A 2A6HF 1V5FA 4YLHA 5L3GA 1ZG5A 3OYLA 1KGSA 3K1SA 3G1OA 3E5QA 3DTKA 4NXNT 3TP0A 4HX4A 2NOJB 4H0EA 2OQRA 3FMRA 3NBXX 2LKHA 4F7ZA 2GM4A 5M5WJ 2K4BA 2X6WA 3AG1H 3RH3A 4F92B 3DQVC 3N9NA 2DDAA 2FJ1A 1IDZA 2QCOA 3ZT6A 5L3EA 2ZJ2A 4S05A 5C3EJ 4IOAF 2CLYC 5JDGA 4OU0A 4HDUA 4PJ0C 1PUFA 3HBLA 3LBXB 3OYDA 4UUTA 3V4GA 4AYBN 2E1NA 2ZNYA 2A07F 4G7OF 4O6JA 2PLYA 2E9XA 4CXWA 4EJOA 1H9TA 1SC7A 4GIWA 3OVUA 1BN5A 5AQHB 1HCIA 3FZLB 3FKIJ 4M3FA 2HOSA 3ONQA 3RPUD 2OZ6A 1I6HJ 1ETXA 3JCFA 3BG7A 2AQFA 2Z9OA 3K4CA 2A9UA 1SAUA 3LSHA 1IN5A 2HOAA 4KI0F 4XL9A 3SFEA 4HFIA 1W0TA 4I55E 1USSA 4BHCA 2XJ7A 3HKZN 5FXWA 2JRTA 2KWHA 3JREA 2R7WA
chains in the Genus database with same CATH topology
1EH6A 2FMLA 4MFRA 5CVRA 3A5XA 3LFKA 2PMHA 5J6XA 2M45A 2M5WA 3SFZA 1IF1A 2WBLA 4YIFA 3UTKA 3AB3B 5JR3A 2XKPA 4O5VA 1SA0E 2VT2A 2NNNA 3Q2MA 3RYHE 4L5GA 4BA9A 5HOOA 5HLHA 4QKNA 1TQMA 2ZLYA 3FM5A 1YKEB 2DCFA 1YG2A 3KV5A 2QQBA 4IF4A 2ZMEA 1K78B 1MZBA 3KV6A 1IN6A 1KQ8A 3MCZA 3CX8B 5LHHA 1J9IA 2LOPA 2GXBA 4KIFA 4EV0A 4ZYGA 4I0BA 3RC3A 4BH9A 4WBOA 3BQKA 1QZZA 3J9X1 3CMLA 3BOQA 1H0MA 4M6YA 5CJ9A 2PJPA 1P2FA 3JTGA 3QP6A 3F22A 4J2CA 4WBNE 2OAZA 2V7KA 2EJRA 3LAJA 4A0YA 4R1HA 3JAMZ 2A6EF 2FMYA 1TBXA 5J8FA 4UV8B 5FY0A 2X68A 4E7SA 3ONXA 1DPUA 4CZZA 1FLIA 4TN7B 1HKSA 5ED4A 2WMNA 2HEOA 3JC6C 5FFXA 3WU0A 3MZHA 4G2AA 4EJWA 1ONVA 1G8XA 3HYIA 5LBQA 5IHYA 3E6MA 3WTXC 2ODUA 4EOZB 2NTYA 4EZ4A 1CUNA 3RC8A 2A3SA 3ECOA 1BI2A 1R1UA 1STZA 3KDSE 3PQJA 3LQQA 5L3BA 3RYIE 1DP7P 2EFWA 4ZZDA 3HOSA 5KVRA 1U4QA 4D0PA 1G3WA 3PUQA 3TOAA 3F8CA 3IHRA 1ZLKA 4A56A 3AAIA 3FXQA 4IVNA 3P9CA 3EVYA 1OWAA 4O2AE 3IRRA 5E18F 3EYIA 4A6DA 5LEJA 4P96A 4CI2B 1O3QA 1ZGAA 1UB9A 2WM9A 1B7TA 3BDDA 5TJJA 1ZKEA 4KN4X 5LRRA 1CF7B 1B4AA 4L0RA 3IC7A 3CUQB 1ZRDA 3GWZA 2LEHA 4DBRA 4Q4ZF 2VBYA 4M9SA 2WWYA 4V1Av 1IXRC 1SMTA 5K5OA 2F5DA 1P4XA 2MH2A 1IW7F 4MEYF 5EK3A 2VL8A 1WRDA 4I2OA 3KP3A 3I5UA 1P4WA 3L2CA 3ZYLA 1UCUA 2V79A 1FBUA 4OIRF 1HX8A 2V7LA 1HSTA 5AIPA 2Z99A 3FBLA 4UVBB 4BXUA 3CKDA 5LG4A 4N0BA 5FNVE 4RGSA 1UX5A 2KXPB 5HXRA 2VE9A 2XASB 2M1BA 1QPMA 2VKOA 4H9PC 4HAMA 4UHTA 1FNNA 4H63V 1AWCA 5LHIB 2FBKA 2RKHA 1ON2A 3ZMTA 5FXXA 1S8NA 4EYYR 4LB5A 1UHWA 2YINA 5EEGA 4LK1F 4CYDA 1JE8A 1BR4A 5J2UE 1LEAA 4AD9A 3AAEB 2EFPA 5KMGP 3E6BA 4L9VA 1I1SA 3KV9A 5DCMB 5JR9B 1PP7U 3GXOA 5L3CB 3LK2B 3N2OA 5CVIA 2Q2EA 2Q9QD 3O4XE 3RTRA 3I1AA 4QXHB 3T8RA 2OZUA 2MD5A 4RGRA 1FWZA 3IL2A 2O6GE 2EV5A 1HKTA 1YTYA 3K69A 1O7LA 4K0UA 2D1HA 2NTXA 1YIOA 2HR3A 2FRHA 3TKLB 4OINF 4HLXA 5DABA 1QO0D 4U74A 5LLQA 3FXDB 2W63A 5GONE 1T98A 4GK0E 1XMKA 3JTHA 4HDVA 3HIFA 3ERED 4I7HA 1D1CA 2IA0A 2EHOC 3RKOA 5LGNA 2XUBA 1FSEA 3ZQ7A 3C18A 4O4JE 3U3IA 3RIRA 4BAYB 2DI3A 1O3XA 2QWWA 4CXYA 1ULYA 1BIAA 4L18B 1A04A 2FA5A 2XAGA 1KU7A 4G6QA 2VN2A 3GEZA 4M1PA 3C4XA 4H9RC 3I59B 5BMZA 2ZBKA 2R7FA 5LJNA 4U7BA 4DMWA 2NAZA 1MNEA 2G0UA 5KX5E 2CYYA 5DD8A 5H20A 2ZXJA 5JFRA 3ZP5A 4AIKA 3AA7B 1FBQA 1S7AA 3HTUA 5L3FB 2L54A 2O3FA 3PUGA 1YS6A 2NS0A 4X20E 3E22E 1B9MA 3ETUA 5LRSA 3LK42 2Y8DA 4XLPF 2V7IA 1JHHA 3F72A 2STTA 1IXCA 4FT8A 2VBZA 1V9DA 2K5BB 3EDVA 3ANWA 1BIBA 5K1YA 4PJLA 3I9YA 4QHOA 1G3YA 1XN7A 4YFXF 3Q5XA 1YW0A 5FLXK 1E2XA 2PG4A 4PFOA 5AONA 2VB6A 2KJBA 4QWQA 2L4AA 4MQ9F 4X1YE 1OKRA 1IJ6A 3CPZA 5CA0E 1OPCA 2COMA 2ES0A 4L9IA 4N9IA 3KP4A 2LKPA 5L3GB 2ZMAA 1ZARA 4B8XA 2KIMA 1WQ2A 1DUXC 2E1CA 5HLIA 2XGXA 4ZYHA 2VK9A 3IKVA 2G7UA 1F9NA 2NW9A 2UXNA 4Q47A 2D2SA 2BV6A 1SD5A 1FZPB 4ESFA 2E9XB 1BBYA 5CVJA 1KQ9A 2LSIA 3O9XA 3TDZC 5A1LA 1MGTA 3HR0A 2W85A 3HSFA 4NHJA 2E7WA 2XUEA 1HW1A 3G3ZA 5HWYA 1FP2A 3M9AA 3LA2A 3E6DA 1LQ1A 2IT0A 4Y15A 4U88A 3LQRA 3RYPA 4EM0B 3G73A 4PDKA 5DDGA 3E5XA 2DWKA 2HPLA 4O4HE 1LB2A 2KKOA 2HGCA 3TDUC 2PEXA 5JDLA 3F8BA 5E20A 4P0AA 1TQIA 1P6RA 3SWHA 5DCMA 4U0VA 3Q9SA 1FMWA 5ILSA 2DQLA 2LT3A 1K6OA 4IE6A 3QU6A 3RYFE 2P5LC 3AAAB 1U6GA 4MALA 5JREA 2QA7A 2JPCA 4YJ3E 2ZMEB 4HX8A 2PQ8A 4DQ2A 2GK9A 4R8HA 4BHBA 1AOYA 1F1ZA 3KETA 3MQ0A 3KFWX 1ZHFA 4IGUA 5LHHB 5ERIA 4IDZA 5ETWA 2XAQA 4I09A 4MHCA 3C98B 2ESHA 1LVAA 2RGVA 1R00A 2LF8A 4P9UA 1SD4A 5FLXZ 2UXXA 4E7ZA 2ESNA 5LGTA 3WGGA 1FYLA 2HOEA 2O03A 4CGZA 4B6XA 3HTSB 3V5SA 1SD7A 5TRDA 1TLHB 3PTRB 2V7MA 3GFLA 3OV8A 3H3UA 2LJLA 4PK6A 4KIGA 2NP9A 3CUQC 2VASA 2DU9A 1IJ5A 5LBQB 3QRFF 3H92A 2NW7A 4N78D 3ZCJA 2P5KA 4OMZA 2YX4A 2IC9A 1XD7A 4LLGF 4DVDA 5HYAA 5KK1A 2K4JA 2L8KA 5BPDA 5L3BB 4H9SE 1NHAA 1UHMA 1U5TC 1FIOA 4IIJE 3SQNA 1MJAA 2H7OA 2JT1A 3ECHA 4BJMA 2IP2A 2QYOA 3GWHA 4KNYA 1HBXG 3GZ5A 2YK0A 2JSCA 4GCVA 1D0XA 5AFUL 5LNKA 3J7Yq 3MK7C 1IZ1A 2VC0A 2NW8A 2L3LA 2K9AA 4AKLA 4KBMB 3VKGA 1B9NA 5E8IA 2MH9A 1OMIA 4LG0A 3GO5A 1ZG1A 4HYEA 1Z6TA 3MKDA 2OQGA 2MC3A 3RPUA 1T2KA 5FXVA 1BR1A 2XHKA 1H7CA 1D0ZA 3ZCIA 2K02A 4ZI2C 5D5WB 5E0OA 4G7HF 5JR9C 4MTEA 1KYZA 4UUVA 5HS8A 1Z91A 4UV9A 5DYMA 1EH7A 3DKWA 3TO7A 1W7PD 5C8YE