3RPUA

Crystal structure of the muke-mukf complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
309
Chain Sequence
TVPELVAWARKNDFSISLPVDRLSFLLAVATLNMSEGELVDAFRHVSDAFTIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of MukE in assembling a functional MukBEF complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
molecule keywords Chromosome partition protein mukF
total genus 106
structure length 309
sequence length 321
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpuA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rpuA02
2ZO4A 4JQFA 1RUOA 1B6AA 1LQ1A 1LVAA 2KIFA 2DQLA 4AIKA 4ON0A 4XRFA 2NAZA 3HSEA 4HQEA 4A6EA 4LGWA 4CXFA 3DPTA 4PZJA 2JRTA 4EM1A 3ZMVA 1B4AA 1TW2A 2K02A 3COAC 2OZ6A 1Q1HA 1V4RA 1OYWA 3DF8A 1E17A 1P4AA 2HZTA 2XRNA 4UV8A 1F1ZA 4G7ZF 2D2WA 3ABTA 2WWYA 2IW5A 5D5WB 4MEXF 4MGRA 1GHCA 1Y0UA 3FX3A 3AAFA 3WGHA 4GYGA 4LLNA 2EK5A 4ZYEA 3V7CA 1HQCA 2E7XA 4LFUA 1TTYA 4CO8A 2RVCA 3IC7A 3PFIA 2QYOA 3E6DA 2IVMA 1ZRDA 1FX7A 3ML6A 1KA8A 4BYYA 4RB2C 1QZYA 3V7RA 1O3RA 4IRIA 3FWEA 4OIQF 5D6EA 4ETSA 1T39A 2OQRA 4LMYA 3WE3A 1B9MA 4ZYDA 1K6OA 1KQ0A 3CJNA 3WTYC 1ZGAA 3VEPA 1TQPA 1BI0A 3TO9A 4YFNF 1BI1A 2VN2A 1OYIA 4HX7A 1O3QA 2QQBA 5FB2A 5E1XA 1HW5A 2M1BA 3L7WA 4L9TA 4HZFA 5K5RA 3ROUA 2HYGD 2F2EA 3FMSA 3FXQA 2EJRA 3QP5A 5H6RA 4U0VA 2A5YB 4M73A 5ILVA 1LDJA 2ISYA 2HYFA 1S29A 1KQ9A 3OV8A 3VB2A 2VBZA 2W25A 3KEQA 3DPLC 4M6YA 4CZZA 2NS0A 4HF1A 3WU0A 4M9XA 4YIIA 4QLCU 1S3JA 4I01A 2VOPA 2EA4A 4GGGA 5CVUA 2ZKZA 3E3VA 3KP6A 1W7PA 2JZYA 2F5DA 5AIPA 4P55A 2D1VA 3P7NA 3JTHA 2PQ8A 3M8EA 5LEJA 2A68F 1O7FA 1HW2A 1R00A 5AIQA 3TOBA 1J59A 2V1DA 2WTEA 3JW4A 1FY7A 3TOAA 4YFKF 5LRRA 5HOOA 1K79A 5H6QA 1IN4A 1GXPA 2HTSA 1P6RA 3BPVA 5H20A 4UHTA 1ZN2A 5DDGA 3FXRA 2AS5F 4Q4ZF 2FE3A 2LF7A 2KJBA 5FLXZ 3RYRA 5LGNA 2WV0A 3FMRA 1MD0A 2F5EA 4M9SA 3I71A 1KYZA 5JI6A 4A2UA 1BC7C 2JSCA 3SZTA 5DUIA 5HVQC 3WU1B 2MC3A 3DQVC 1R5GA 1Z1DA 1PP7U 3F72A 4ENMA 1FOKA 2XAGA 4EV0A 3BPXA 2ZJ2A 1O7LA 3CDHA 3V8LA 2FF4A 3BY6A 1XDSA 3R61A 2P7VB 3I0TA 5L3CA 2PN6A 2DW4A 5DCMA 4FX0A 1HKTA 1USTA 2FMYA 3MAJA 3WGIA 2KKOA 3WGGA 1XCVA 3F6OA 1T38A 1G4DA 2QUFA 1P4XA 4ESJA 3V7SA 1J7KA 2P6SA 4EM2A 3GFJA 4P9UA 1IAWA 4I7HA 5E8IA 2L4AA 1TLHB 3F3XA 3KETA 5HLIA 5FD5A 2XIGA 2L3DA 3TDZC 4O5VA 3EYYA 2VT3A 4KYWA 2NRAC 2EWNA 1IRGA 1S6LA 1QO0D 3RI4A 2GZWA 1XMKA 1BIAA 3K9TA 1SMTA 3QOPA 3NEUA 4M6XA 4RGXA 2GA1A 2JT1A 4ENJA 5BS6A 3M1EA 4Y13A 2O0YA 1Z91A 2HEOA 2RDPA 2V9VA 3CUQA 3PQJA 4HW0A 1LDDA 3L00A 1YW8A 3BDDA 1AWCA 1J75A 4IRHA 1T6SA 2V79A 3BOQA 2Z99A 2UXXA 1OR7A 4RAZA 2RQPA 1YFHA 1XGNA 3ZN0A 2Y48A 2PG4A 5E18F 1AOYA 4KDPA 4EMSA 4MTEA 1D8JA 1R23A 3F22A 5LHIA 1SD6A 1P2FA 2PMHA 3EQLF 1OYYA 3RIRA 2A07F 2HKOA 4GO1A 4ENKA 5J8CA 4HOBA 3RJPA 1R5HA 3VODA 1DPUA 3BJOA 5FGMA 1RI7A 3GFLA 1TNTA 1U78A 4MNUA 1FNNA 5HS7A 2VONA 3I53A 2ESHA 2HQRA 5A2QZ 3WTUC 4KN4X 3GFMA 1ON2A 2Z3YA 2KIMA 1W7PB 1IW7F 3KE2A 5ILUA 2DPDA 3SQNA 4NB5A 4OMYA 2P7CB 3BJAA 4RGRA 3RKYA 2P5LC 2XUBA 4ESFA 2P5VA 2PFBA 3SFZA 2IA0A 5LBQA 3NRVA 1I1SA 1MJAA 4EJVA 3Q5FA 2BGCA 5ICEA 3GFIA 4LD5A 1Z9CA 4YIFA 4WXHA 2ZXJA 1S7AA 5CYVA 2HGCA 2G7UA 2EV6A 4IHTA 4HV5A 2FOKA 2YX4A 4OINF 4IF4A 2VBWA 2ADUA 3JAMK 2DQRA 4L0YB 2VT2A 1ZARA 2OU2A 3GEZA 3F6VA 4A0YA 5DYMA 4WXDA 3BJ6A 1LJ9A 2E1NA 1XGOA 2O3FA 2GA2A 3GYHX 5JFRA 2H6BA 4P5OA 5TRDA 5FLXK 3KP5A 2IA1A 3KZZA 4U7DA 1C0WA 2QBYB 2Z9OA 4HF2A 3EETA 3GO5A 2HOEA 3E6BA 3NQOA 3LQRA 3GW2A 4R1HA 1ODDA 2OZUA 3HRUA 1YS6A 1IXSB 1UHMA 1U8RA 1XMAA 4HDVA 3T5XA 2UXNA 1J5YA 2QLZA 4I09A 3O3KA 3KLOA 4U7BA 3MZHA 4HYEA 1XDUA 3K1PA 3GZ6A 1TQMA 4UVBA 1PDNC 1OKRA 6PAXA 1SD5A 3GF2A 2ISZA 3HSFA 1YG2A 4LK0F 4EQQA 2B0LA 2XKOA 3CO7C 2MH9A 2K7LA 1EH6A 5E17F 1R1VA 1XB4A 3T8RA 5BMZA 4GXOA 2ZCWA 2CG4A 1YTYA 1YS7A 2XAQA 1HKSA 1W5SA 2CWEA 2J5PA 3W6KB 5DCMB 1DUXC 5F64A 4Y17A 5CVRA 5DEQA 3TQNA 2A61A 4HQMA 3DXJF 2QQ9A 2LSOA 4BH9A 4KT5C 1XD7A 4IPAA 3DP7A 2QBYA 3ZMUA 4KICA 2STTA 4EM0B 1KQ8A 2R7DA 4KIGA 4L5JA 4EJTA 3IWFA 2RGVA 1QPMA 4RAYA 3QP6A 4M71A 3TDUC 3KP2A 4CGZA 5DCFA 5DD8A 3HSRA 4I0BA 4HLXA 4BHCA 4YG2F 3GWZA 2QWWA 2H6CA 3K1MA 3CO6C 3QPTA 4E70A 2H94A 3O2PE 2DPUA 2HR3A 1ZHFA 4B09A 3IWZA 5D8LB 4MQVA 1ZG1A 2R7FA 1IN7A 4ZH4F 2GAUA 1KU9A 2DI3A 2XV4S 4HBLA 4PGHA 4G7OF 2BV6A 2JPCA 2STWA 2K4JA 2QENA 1FP1D 2EB7A 4P96A 5DUKA 3U2RA 1FPQA 2DAOA 5L3FA 3J7AO 3WTXC 1LB2A 1YLFA 1KYWA 2FA5A 3F8MA 2IA2A 4A0XA 4L9JA 3T0YA 2NNYA 2IPQX 3EYIA 1BN5A 1F5TA 3K2ZA 3BZ6A 3WTZA 2HKXA 4MTDA 4PCQA 2QM3A 1U5TB 1SFEA 3V4GA 3ZMZA 3U1DA 1NHAA 3CUOA 3H3UA 2LDUA 2MLKA 2O6GE 2IRFG 2DK5A 2FXAA 3CUQC 2V6CA 3F8CA 1B9NA 1IRFA 1J9IA 3CTAA 4LLGF 1I5ZA 2PBIA 3M8FA 3IHUA 3BWGA 3TKYA 1UCRA 3HIFA 2K27A 2F5FA 1REPC 2F5CA 1WKMA 5CVVA 5KVRA 2K4BA 5HS8A 3CUQB 1MDMA 2VXZA 1UB9A 1BM9A 1I27A 1O57A 1JHHA 2WC2A 3WTVC 3F23A 1TW3A 3ZN1A 4Q47A 5BPDA 1FP2A 3W6JB 3QAHA 1BI2A 4I2OA 2GXGA 5F1RA 1XGSA 5CLSA 2DO7A 1DP7P 1G6NA 1E2XA 2K86A 4CICA 4EVIA 5JVTA 1WQ2A 5K5OA 4Q5SF 1ULYA 3JTGA 5ILSA 3HUGA 5FO5A 1K78B 1P92A 2XVCA 3J80Z 2Z33A 1K7AA 1PUEE 3QU6A 3TO7A 5E20A 1BBYA 3ULQB 2AXLA 4HDUA 1ZRCA 4A12A 4G6QA 2VBYA 2HTJA 5JHUA 2BBYA 4UVCA 1EV7A 4K2EA 5L3GA 2O03A 3VOEA 3SXYA 4G94A 3P9KA 3QU3A 5LEKA 5EEHA 3QPHA 2VBXA 1FYLA 4BNCA 2EFWA 1X3UA 4AVPA 2FSWA 3R0AA 3V8KA 1XSVA 4HA8A 1JE8A 1I1GA 1YO5C 4XBFA 3T1BA 4O3MA 2XROA 3ZMTA 3C1DA 4D0PA 1F4KA 5D6FA 2A6EF 2CYYA 4FHTA 1FYMA 3D0SA 5HDGA 1YW7A 4AIHA 1XN7A 3MQ0A 1R22A 4GYIA 1JGSA 5D5UB 4KA4A 3ZP5A 4I98B 5E1ZB 2IT0A 5D4SA 1ON1A 3KFWX 2RV8A 2DK8A 4U0WA 5L3DA 2ZNZA 2ZMEA 2VOOA 5JR3A 5F6FA 4IVNA 1YQAA 3JSOA 1XSXA 3EDPA 4HX8A 1Z05A 2LNBA 2DBBA 1YYVA 1FT9A 4NHJA 4UUVA 1U2WA 4N0BA 1VTNC 2IP2A 4RGUA 3JAMZ 1ZLKA 2RC4A 3E6CC 2ESNA 3H92A 4RGSA 1QQIA 1KGSA 1B59A 5CVJA 1F9NA 1W4MA 4ZYHA 1CGPA 4L18B 3J80K 5L3BA 3GX4X 4CDGA 5ERIA 4OMZA 3I58A 1ZH5A 2E1CA 4FX4A 3LSTA 3R4KA 4A5NA 3E5XA 3LAJA 1ZG3A 1LDKB 2PLYA 4BHBA 2QVOA 2ELHA 3B02A 1GVJA 2HDCA 3RKWA 5ICFA 1G3SA 2XAHA 1RIOH 2FQ3A 4U88A 1TNSA 2EV5A 1IN8A 1WWXA 3BP8A 4RS8A 4ASNA 2MH2A 3LAPA 1MDMB 3DFGA 3KCCA 2R3SA 1QNTA 5IT9Z 1FSHA 4LG0A 5D8KB 5FD6A 2FRHA 1S7OA 4G7HF 1SFUA 1L3LA 4R8HA 2ZBKA 5E8GA 2XHKA 4KIFA 1BOAA 2YPRA 4ZYGA 3KP3A 1KU2A 2LKPA 4EJUA 2DLLA 4OIOF 4WWCA 5BOXA 2XKPA 3IKVA 1IUYA 3FXUA 4UVAA 1SAXA 3RYPA 4YFXF 4G6DA 4B8XA 1WI9A 1G3YA 5CVIA 1U3EM 2HWVA 3F8NA 3D5LA 4OU0A 3WTWC 2FNPA 4TV7A 3KP7A 1R36A 1MJ9A 4PGGA 1OPCA 4HF0A 3KEOA 1KU3A 4L9NA 3MEXA 4M9ZA 2YU3A 3MWMA 3I59B 5LGTA 1PP8F 3ZMSA 4MHGA 3GXOA 5K1YA 4G9YA 2PMUA 1D5VA 4I02A 3HRTA 5FFZA 2DT5A 2YSRA 3K0LA 4KNYA 2GXBA 1J0RA 5HS9A 3ZPLA 3K69A 1EH8A 2OAZA 5HDNA 1IXCA 2P4WA 3GVAA 3HRMA 3BROA 4R79A 3P9CA 2M8EA 1IN6A 2VE8A 3WG9A 2GWRA 4AD9A 2FU4A 5E1WA 2CW0F 1XGMA 1QGPA 2XAJA 2M87A 1GXQA 2KJCA 3RTRA 2Q8KA 2Q2EA 3HOTA 1H9TA 1WSUA 1FZPB 4M72A 3PQKA 1Z7UA 2YR2A 3N4MA 1UFMA 1OMIA 2Y0MA 4DQ2A 1J2XA 3KZYA 4IRGA 4FT8A 1FC3A 2W57A 4UXNA 5BPIA 1ZRFA 3I4PA 1HXDA 5EEGA 4Z2YA 1ONVA 3LFKA 4KMUX 5K5QA 1BC8C 3JSPA 2GQQA 3B73A 3C18A 1H0MA 3REOA 2DFIA 1W7PD 3HTSB 3DV8A 1XSDA 2O61A 2OD5A 2OA4A 1P4WA 4RB3C 3M7GA 1SD7A 2DTRA 1R58A 3I59A 4KIBA 4WXCA 3LA2A 2FEZA 1K78A 4BQAA 2HS5A 2RNJA 2FNAA 1T0FA 2FBHA 1ZGJA 4O6JA 2A69F 4HAMA 2TDXA 2A3SA 3DKWA 1L0OC 3HHHA 4A0ZA 2C6YA 2BE5F 2E7WA 1D3YA 4BAYA 3SHFA 5BQTA 2EFQA 2HFHA 2G9WA 1HBXG 3P9IA 2QZ8A 1DDNA 3EUHA 1R7JA 4P9FA 2IJLA 1SD4A 5AONA 3FMQA 1RUNA 3O6BB 3R0JA 5DV5A 4N9HA 5A2QK 1W5TA 1DPRA 1STZA 1Z6RA 2PEXA 4ENNA 1V3FA 3R60A 3ISPA 3C7JA 3HTUA 4LG0B 3S2WA 3E6MA 1EH7A 2M45A 1LEBA 4I0AA 3CLOA 2M30A 3G3ZA 2A6HF 4BHPA 3IRRA 4Q48A 2EFOA 2V1XA 1HSTA 1FSEA 1IF1A 2Q0OA 3TO6A 5L3EA 3J81K 4IHSA 2BEOA 1S8NA 3HOSA 1U5TA 3E97A 3DEUA 2MD5A 3KLNA 1MZBA 1FBSA 2ZNYA 5LGUA 5J6XA 4U0YA 1IZ1A 3RPQA 2D1HA 4UNOA 2HQNA 1QBJA 2ACJA 4JBAA 3HYIA 1CF7A 2D45A 2EV0A 2NNNA 2CQKA 3RPUA 2EA2A 5D4RA 2PJPA 5LHGA 2UWMA 3ZMDA 5D5VB 4RB1A 1T98A 1ZLJA 2L4MA 3R6SA 4F7ZA 4N9IA 2CSOA 3H3ZA 5KK1A 4OOIA 1BIBA 4LLLA 3FZVA 4IJAA 2OQGA 4MEYF 3IRQA 1USSA 5ICCA 1HKQA 4OIPF 1H9GA 3I54A 3LQQA 2O8XA 2ZFWA 2COMA 2G7HA 3J81Z 2P5KA 2J5OA 3GZ5A 1JHFA 3I64A 4CHUA 1ZYRF 3HHGA 4HLYA 3LA7A 2GIVA 3RDIA 3QRFF 4LJZF 1R1UA 2FBKA 2FMLA 1SFXA 2CGPA 5LHHA 2VODA 4L5IA 2L01A 5IT9K 1ZAOA 1YW9A 4IXAA 2MBFA 3IL2A 5IT3A 1HW1A 3Q9VA 3MZYA 4JK1X 3MFKA 2KIUA 1FLIA 2W84A 2X0LA 3WTSC 4LB5A 2QQAA 1FBUA 4EJOA 3ABUA 5LRSA 4ZZDA 2JTVA 4HV6A 5CJ9A 3FHZA 1SMYF 1U5TC 1O3SA 2RN7A 1TQIA 3FF5A 2ZMEB 1IXRC 4CYDA 3IKTA 4M74A 2NYXA 1RNLA 1FBQA 2H27A 3LA3A 2PI0A 1BI3A 4UV9A 4XSXF 4LB6B 4PDKA 5ICGA 3ECOA 4Y15A 3ECHA 1Z6TA 1MJBA 2DU9A 1HSJA 4WF2A 4XSZF 3G73A 3MCZA 1RZ4A 4QWQA 3F8FA 4AIJA 5HLGA 3SZPA 1KU7A 2VC0A 3T8TA 2V1UA 3ZQ7A 1ZG5A 2H09A 3ELKA 2Y75A 3Q9SA 4A6DA 1G3TA 2W85A 3E5UA 2BYVE 4ESBA 3GLXA 5HDKA 2KRFA 4KMFA 1QZZA 3FM3A 3LWFA 4KUMA 2EFNA 4L9VA 4KFCA 5LLQA 2CFXA 2MA3A 4KN7X 1FWZA 2XGXA 1LNWA 1A04A 4WX9A 2LF8A 3F8BA 3V8JA 4S04A 3N97A 4MQ9F 2L02A 3WODF 2XAFA 3RKXA 1D8KA 1JXSA 1R1TA 2YX7A 1MKMA 2XASA 1O3TA 4EGYA 1LEAA 3GUDA 4HX4A 4RB0A 1FYKA 2X4HA 3U9GA 3C3WA 1MGTA 3KP4A 4XLPF 2P6TA 3M9AA 4WCGA 1I6XA 1IN5A 2EFPA 2Z5UA 3L9FA 2ETHA 5J8FA 3L2CA 2L54A 2UZKA 2W24A 1BJAA 2VE9A 2JPBA 4AWXB 2OBPA 3TGNA 4G8XA 3VFZA 2M5WA 3HRSA 4DNCA 1YIOA 1WRJA 4BXUA 3I5UA 4L0ZB 1ZREA 4A5MA 5HLHA 4XLNF 4OIRF 3FM5A 1B1BA 3OOPA 3L09A 5FFXA 5ED4A 4EGZA 1UHWA 1CF7B 4H0EA 3F21A 2RKHA 4LK1F 2CO5A 2VC1A 2MLGA 3K1NA 4GCVA 3WTTC 1TBXA 5DD4A 5D5XB 4S05A 2FBIA 4WK8F 4ZZLA 1G3WA 4EJWA 2P8TA 3ERED 1XCBA 3WE2A 5TJJA 1U6GA 4NQWA 1T2KA 3E5QA
chains in the Genus database with same CATH superfamily
2ZO4A 3S16J 3D0TA 5AQJB 2LEHA 1OCPA 3AEEA 4JQFA 1VQ5I 4QHOA 1RUOA 2RAEA 2QSHX 1B6AA 3HL6A 1LQ1A 1LVAA 4YSZA 4F52A 2KIFA 2VUMJ 1R5ID 2DQLA 4ZYAA 4AIKA 4JI0T 4HWHA 2C5JA 3RPUD 3HR0A 2XF6A 4ON0A 4XRFA 2NAZA 1ETOA 3HSEA 4HQEA 1IBLT 4QH1A 5IYCJ 2E35A 4HN9A 4A6EA 3ZN1B 3F0CA 4XL9A 3AFHA 4LGWA 4CXFA 1MW7A 2DDAA 2IEKA 4EEBA 4HEA2 3DPTA 2Y0SN 2JRTA 4PZJA 3ZMVA 4EM1A 2JIWA 2D2SA 1OCTC 1B4AA 1TW2A 2K02A 3FZKB 3COAC 2N2NA 3LK42 4B6XA 2OZ6A 4AKHA 2KDZA 3K4CA 4YTNA 3EAMA 3AE4A 1Q1HA 3CK6A 2CFOA 2WAQN 4IIJE 1V4RA 3BTIA 2CA5A 2YDSA 3KDSE 4KJZA 2ZMEC 2BS3A 3TLUA 1OYWA 2VJ5A 3DF8A 2HXOA 4B3RT 1D0XA 2XPWA 4A3EJ 3CC2I 2F48A 2K9MA 2VXDA 3PUAA 4H9PC 1E17A 2KZGA 1P4AA 4HRIA 2XQ7A 2Y9ZA 4U2ZA 1AKHB 4JX4A 2HZTA 5AQQB 2XRNA 4UV8A 4A3GJ 1F1ZA 2I8DA 4G7ZF 3FXMA 2D2WA 5AQTB 2CW8A 2WWYA 2LVSA 1VNDA 3J7YJ 4X66T 4PFPA 2VKOA 2IW5A 5D5WB 4MEXF 3TEDA 5IP7J 1YKHB 2WBMA 4MGRA 1A6QA 4AYBA 1GHCA 1OEDC 3H37A 1Y0UA 1BR1A 4E7LA 2CXLA 3FX3A 3FXJA 2JVHA 3AAFA 3WGHA 2XB0X 4GYGA 2RPAA 4OYJA 4MLOA 4IE4A 4LLNA 4P0AA 2JSPA 2KFDA 3OYJA 2CM0A 2EK5A 5J0ZA 4YY3T 2XTLA 4ZYEA 5L3DB 2WMNA 3UU8A 3V7CA 1HQCA 2E1MC 2E7XA 3P4PA 4LFUA 5GP9A 1TTYA 4CO8A 4HWDA 4E4HA 4MBQA 2RVCA 3IC7A 3PFIA 2KSRA 2QYOA 3NARA 3ZJ1A 3E6DA 1FOWA 1P9QC 5C44J 2IIUA 2YDRA 3AL0C 3SDGA 2IC9A 1JT0A 4XRMA 5FNVE 2IVMA 3P4QA 1ZRDA 3K8PC 2M8GX 3ZQLA 5CA1E 1JKPC 2RQQA 1FX7A 1WHUA 4XKVA 3ML6A 1QVTA 3RF1A 1WLXA 2K24A 1KA8A 4BYYA 4IOAF 4RB2C 2XPVA 5F1JA 4JI5T 3VYTB 1APLC 2CHOA 1M1EB 1QZYA 3ERMA 3LMMA 3V7RA 1O3RA 2HOAA 3FWEA 3MKZA 4IRIA 1EF4A 3HKBE 3EPZA 4OIQF 1SE7A 2K40A 1UZCA 1Z7LA 5D6EA 2LKXA 4ETSA 3QOEA 2WU2A 4LF8T 2H7VC 1T39A 2UUBT 2GBYA 2OCEA 2K3FA 2OQRA 2XDVA 4C9YA 2PG8A 3QC9A 1W09A 3A02A 4LMYA 3ZT5A 1PVEA 1WFXA 3WE3A 1B9MA 3ZCOA 3BZCA 3LBXB 3WI3A 3I0QA 4IDNA 2Z16A 4DBRA 1A6IA 2XPUA 4ZYDA 1UG2A 4ISSA 1K6OA 1KQ0A 2CRGA 1IG7A 4H9SE 4M1PA 2V6EA 3CWZB 3UU6A 3CJNA 1ZKEA 3CCLI 3AG3H 3G06A 1X2MA 3PSIA 1XS9A 1HDDC 2A5WA 4JYAT 3U1KA 2NVTJ 1YQ4A 1HTJF 2WCAA 3WTYC 1ZGAA 5FKOA 3VEPA 4CSWA 1TQPA 2BXZA 1K4TA 3EUHC 4HFBA 3E08A 1BI0A 1YXRA 3VSKA 3TO9A 3ZMVB 3VDXA 4YFNF 2CWYA 4JI4T 1BI1A 2VN2A 1OYIA 3GTJJ 1UURA 4HX7A 4LF6T 2KIQA 4BL0B 1O3QA 2B76A 2QQBA 2W7NA 1WFDA 3A0BC 5FB2A 2IHR1 5E1XA 3PJAA 2D0UA 1HW5A 1X3ZB 1VQKI 5EK4A 4JI2T 2M1BA 3L7WA 4L9TA 3K3NA 3OKQA 4HZFA 5K5RA 3ROUA 2HYGD 2F2EA 1R8IA 4UXNB 2WS3A 4XKCA 3JRGA 3FMSA 1X19A 3UUNA 2HQAA 3FXQA 5M4YA 2KXPB 2EJRA 1EZ3A 2PTFA 4H9QC 3KV5A 4I50E 4Z91A 2VI6A 1V9DA 2X51A 2X9HA 3QP5A 4HNTA 5H6RA 2VB6A 4U0VA 2Y31A 2ELJA 1X1BA 2A5YB 4M73A 4XMYA 5ILVA 1Y6IA 3TL4X 2VKVA 1LDJA 2ISYA 2WU5A 1Y1WJ 2NW9A 4X1YE 2HYFA 1ETYA 2IGMA 1JUPA 1KEYA 2X0HA 3N2OA 4AIUA 5LP6E 1S29A 1HOMA 3MMYB 1VQNI 4CCNA 1KQ9A 2P9BA 3OV8A 2BY3A 1R71A 4YHJA 3VB2A 4Z6YA 2KPMA 2VBZA 4XLAA 2JQHA 3PV0F 4U72A 2W25A 3KEQA 3DPLC 4M6YA 2LM9A 3HB9A 3AA6B 3C4WA 3UQ4A 3LSPA 1W0AA 2KMUA 4QX8B 3S2DJ 4CZZA 2Y48B 4IDOA 2NS0A 4HF1A 4A3MJ 3WU0A 3PUZF 1KNRA 4P1NA 3BR1A 4M9XA 4YIIA 2CUZA 2AQFA 2F4IA 4QLCU 4HFCA 1S3JA 1OISA 1GV2A 4I01A 2VOPA 1MNMC 2EA4A 1BJZA 4GGGA 2ZKZA 5CVUA 5HWXA 3BK9A 2DA7A 5LMUT 3E3VA 2KWIB 1YJWI 4IDZA 5F5WA 3KP6A 1W7PA 4U3CA 3QYBA 2V5DA 3TLTA 5TAOA 1WH5A 4H4KC 3FZLB 4JEHB 2JZYA 2F5DA 5AIPA 2EIJH 2LBFA 1ITYA 3G1OA 4P55A 2D1VA 3P7NA 3G71I 3JTHA 3CMLA 2PQ8A 3M8EA 3GTQJ 3OYHA 5LEJA 2A68F 2I5UA 3CKDA 3I4NJ 2MGQA 1O7FA 4U74A 1HW2A 2FJBA 3ANWB 1R00A 1LPQA 5F04A 2A9UA 2WSSV 4OAYA 5AIQA 3TOBA 1J59A 3N9LA 3I4MJ 4AQFA 5JDMA 4I4TE 4TWFA 2V1DA 2W4XA 3I1AA 3H0DA 2X6XA 4UUTA 4E7JA 5HYAA 3O1JA 2BW3B 2XF7A 3G1MA 3EDUA 2DMNA 4JP0A 1MBKA 2WTEA 4XLCA 2A3DA 4PSWA 3JW4A 5B1BH 1AHDP 2IS4A 3CCUI 3KINB 1FY7A 3TOAA 1OLTA 2V9KA 4LG3A 4YFKF 2H8WA 5LRRA 5HOOA 1K79A 5FY1A 3RYHE 4DMWA 4JYKA 1WR0A 2IMLA 5H6QA 2ELKA 2Y2ZA 1IN4A 1GXPA 3X1DA 4TWHA 3HGGA 4I99C 2XQ3A 4O4HE 1G2HA 2X68A 5AQIB 5JQGE 5IPAA 2XQ4A 2HTSA 3KX2A 3B13A 4FISA 1T95A 4IHYA 2E19A 1S94A 3JR9A 3RRWA 3ZEFB 1P6RA 3BPVA 5H20A 4CH7A 2VKEA 4UHTA 1ZN2A 4HNUA 5DDGA 3HOUJ 3FXRA 4GK5E 2AS5F 2JA2A 2V6YA 4Q4ZF 5CKTA 2FE3A 3ZQQA 1E3HA 2LF7A 1FMVA 3H36A 2KJBA 2X1EA 3IAS2 5FLXZ 1IRZA 3RYRA 5LGNA 2X0YA 4AI6A 2LE8A 2W2UA 1JUMA 4GDFA 2YU9J 5L3EB 2WV0A 1YHQI 3FMRA 5HEUA 1WYBA 1MBGA 3CQCB 1MD0A 3CF2A 5DABA 3NBXX 2JA8J 1UMQA 2F5EA 4M9SA 2K9SA 3I71A 4TV8E 3FXKA 1I6HJ 1SHZC 2DLRA 2IAKA 2O7OA 2I59A 3MXZA 1F43A 1KYZA 2HXIA 5JHFA 2K85A 5JI6A 4A2UA 4X1KE 1BC7C 2JSCA 3SZTA 5DUIA 4HFIA 3LSRA 4DR7T 1SANA 4OK0A 5JH7E 5HVQC 3WU1B 3BT9A 3JCFA 2MC3A 3SEZA 3DQVC 2IGNA 1R5GA 1Z1DA 1PP7U 2ZM8A 3F72A 2WY8Q 4ENMA 1LE8A 2XAGA 5DM7F 1FOKA 2E2JJ 3AVSA 3UFEA 4WNKA 5E3MA 3SFDA 3DWLE 4EV0A 3ZCJA 1QSDA 3S3OA 2EZKA 1OJLA 1W36C 3BTJA 2CQ7A 1ZP0A 3BPXA 3N9QA 2ZJ2A 3HPHA 1DU6A 4H9NC 4DV7T 4NXMT 1NEKA 2CMPA 1O7LA 3CDHA 4OAZA 3V8LA 3RGLA 5L3GB 2W4SA 3OYEA 4P09A 4TV9E 2UUCT 2FF4A 3BY6A 1XDSA 3R61A 3RQ4A 2P7VB 3I0TA 1W5CC 2FUPA 3HA4A 2DOEA 2NVQJ 4GYRA 3SFEA 5L3CA 2LSKA 2PN6A 2DW4A 5DCMA 4B3AA 1E2AA 3ZC1A 3CQZJ 4FX0A 2JA6J 1HKTA 1USTA 4Y33A 2FMYA 2ME6A 3MAJA 2BXYA 4NQWB 5E3LA 2M6IA 3DPUA 3LSMA 2ZB9A 3KEYA 2KKOA 1MMDA 1XCVA 3WGGA 3F6OA 4AVZA 3WGIA 1V5FA 5KAIC 3CMAI 3ETUA 2ZM0A 1OCZH 1T38A 1G4DA 4HWFA 2QUFA 1FJGT 2HPJA 1P4XA 3CESA 3ZMZB 3HOXJ 4ESJA 4MO7A 2K9QA 3KBTA 5HCMA 3V7SA 1J7KA 2P6SA 2OV9A 4EM2A 4DYQA 4XRSG 2JQKA 3TLWA 2CEAA 2JUCA 3GFJA 3K4LA 4P9UA 4BBRJ 1XX5A 2JMHA 1IAWA 4I7HA 5E8IA 3VWBA 2CWOA 1PYVA 5EF6A 2M0CA 2L4AA 1TLHB 3F3XA 4NNJA 3KETA 5HLIA 2YUSA 5FD5A 3OL4A 2YOEA 2XIGA 3FZMB 2A05A 2GK9A 5HXRA 4P0BA 2L3DA 4GK0E 1GDTA 3TDZC 4O5VA 3EYYA 2MSYA 4LITA 2VT3A 2DA4A 1T7SA 4KYWA 2VURA 2NRAC 2EWNA 4XLFA 1MH4A 1IRGA 2DFHA 2Q9QD 4KBMB 1S6LA 2E9XD 3ONQA 2WQYA 4PK6A 4L0RA 2PMZA 1QO0D 5AQMB 5M3FJ 3RI4A 2LK2A 5HLTA 3KBUA 2XQ6A 2GZWA 2L3LA 1XMKA 5DJQC 1UUSA 1BIAA 3K9TA 1HR0T 3BG3A 1SMTA 3QOPA 3NEUA 1LVFA 4JX6A 3ZPOA 4M6XA 5K7FA 4RGXA 1KFYA 3C4ZA 2F4VT 5IYDJ 1Q1VA 4KHPT 4CI1B 3A03A 2GA1A 2E5ZA 1EJ9A 2IW5B 2XAGB 2X0LB 2JT1A 4ENJA 5BS6A 4BJMA 3M1EA 4Y13A 2O0YA 1Z91A 4XOPA 5J1YA 2HEOA 5AQVB 2RDPA 1ZHCA 5LMNT 2V9VA 3GN5B 3TLSA 4XONA 5FRNA 2UXXB 1XWMA 2L8KA 3G1LA 3CUQA 1ERDA 3PQJA 2JPFA 3JC6D 4HW0A 3VR9A 1LDDA 1U0JA 3L00A 1YW8A 4RM3A 3BDDA 1AWCA 5FJ8J 3OYZA 3LSKA 3RIFA 4IE0A 1J75A 4IRHA 1T6SA 3P4SA 2GXAA 1ETKA 1MH3A 5B66C 2V79A 1I50J 3BOQA 3ONJA 3ZLIA 2Z99A 2UXXA 3ETVA 1SAUA 5GTIC 1OR7A 4ANJA 3I55I 3JADA 4RAZA 2BHZA 1QHHD 2RQPA 5GONE 3UKGA 1YFHA 3RYIE 4YJ3E 4C2TA 4BXFA 4M3BA 3A4CA 3SOLA 2Q1ZB 2V6YB 1XGNA 2LM2A 3H35A 3ZN0A 4D5CA 5IYBJ 2F4OB 5EG0B 2Y48A 2PG4A 5E18F 3OYCA 3D1NI 1A5JA 4KDPA 2I10A 3NAUA 4GRIA 1AOYA 4QKNA 4EMSA 4MTEA 4OX9T 4YHHT 3ABLH 1QU3A 3L2WA 1D8JA 1WJFA 3O8GA 2V7IA 1R23A 3F22A 3TBIA 4X65T 5LHIA 4BQQA 1X4PA 4Q25A 3FXDB 3MKWB 1YW0A 1SD6A 4I76A 1P2FA 5FVLA 5TISC 4IL4A 2XC7A 3IH4A 2PMHA 3OMYA 1V5GA 3EQLF 2HH7A 4PUSA 3I56I 2IUBA 1OYYA 3RIRA 3EI0A 2A07F 2K5CA 3IAM2 4DIQA 2HKOA 3OTOT 4GO1A 4ENKA 5J8CA 3S3NA 4HOBA 3RJPA 1YOVB 2FUG2 4CYCA 2I6HA 2IDOB 1R5HA 1ACIA 3PUVF 3VODA 3AKZA 3SS1A 3OS0A 1DPUA 2JQ7A 2XSBA 3BJOA 4NDLA 5FGMA 4EEFG 3BQLA 1RI7A 3GFLA 1TNTA 4O2AE 3OY9A 1R9TJ 1U78A 2EHOA 5LBQB 5EYRA 4MNUA 3RCOA 2QGUA 4DR3T 2X6WA 1E3PA 2R7ZJ 1FNNA 3H5NA 5DQWA 3UUBA 4C3IJ 4DUYT 1XTAA 5HS7A 5ABFA 2VONA 3WAJA 3I53A 1S35A 1KF6A 2LSIA 2ESHA 2HQRA 5A2QZ 3WTUC 4FI5A 3HEFA 4KN4X 3QYFA 3GLLA 1SVOA 2WADA 1N75A 2E8IA 2HOSA 5J3LA 5B5EC 2ZJRF 4M3FA 4EIWA 3T1HT 1VQ6I 3GFMA 2WWUA 1SA0E 1ON2A 2Z3YA 3UTKA 1YX3A 2KIMA 3DCFA 4C90A 4UF0A 1W0UA 3TLVA 4ILAA 1D0ZA 1W7PB 3AG1H 2R7RA 4OFZA 1HNXT 1JGGA 1IW7F 3KE2A 5ILUA 3LSHA 2DPDA 3RYFE 2UXDT 3SQNA 4NB5A 4RA2A 3RLFF 3CCVI 1NG6A 2CQXA 4EATA 3MA9A 4OMYA 2P7CB 3C98B 4B3ST 3BJAA 3QQAA 3CP8A 2G0UA 1XNQT 3PDYA 1M7KA 4RGRA 3RKYA 3U21A 2XUBA 2P5LC 2EPFA 5LB7B 4A56A 2MPKA 4ESFA 2HN1A 2P5VA 3BCAA 3DU5A 5JDQA 2LJLA 2PFBA 1CQTA 2QYWA 2SPCA 3SFZA 4TWDA 2QRXA 2IA0A 3AE8A 3KIOA 1YIJI 5LBQA 1MMGA 2XPKA 3G4SI 2JQQA 4OHFA 3NRVA 2N9DA 5C2TA 1I1SA 1MJAA 5EJCA 4EJVA 3Q5FA 2BGCA 3RKGA 4Y52J 5ICEA 3GFIA 1A35A 3S1NJ 5IOZA 2V8SV 4LD5A 3KVBA 3R84B 1Z9CA 2PMZN 2CV2A 4YIFA 2LTPA 4WXHA 5K7HA 4E7SA 5LHIB 2ZXJA 1S7AA 2JJ7A 2V1NA 2HVSA 2W61A 4XN3A 5CYVA 4ZXLA 5ABGA 2HGCA 2G7UA 2EV6A 4IHTA 4HV5A 3I9V2 3Q5EA 2FOKA 5EG0A 4EV6A 2YX4A 3GZNB 1FIAA 4HFVA 4A3JJ 4OINF 4IF4A 2XUEA 2EZLA 2VBWA 3B6CA 2KRCA 3A8YC 4QXCB 2ADUA 1QLBA 3JAMK 2DQRA 2BOLA 2VT2A 4L0YB 3S93A 1WJDA 3K1SA 5AQSB 1BR0A 2XAFB 2XASB 1ZARA 1NAFA 2CUJA 2OU2A 2E36A 3D5RC 2E60A 3F6VA 2MFZA 3DEEA 3GEZA 4A0YA 4O4IE 3CDIA 2VASA 5DYMA 2DJIA 5K7ZA 3KV4A 4RDUA 4LF7T 4WXDA 3JC6C 5F08A 4O4JE 2HNHA 3W15B 3BJ6A 1LJ9A 5FY0A 2E1NA 4J2CA 2DYRH 1XGOA 5ABEA 2O3FA 3WAKA 2FBWA 2GA2A 2JUGA 2WB5A 2DWKA 3GYHX 5JFRA 3CP2A 5JDFA 2DL1A 4KT6A 3S1RJ 4XR6A 2H6BA 4P5OA 3IBPA 2IS6A 3RC3A 1UX5A 5H6QB 4V1Av 5TRDA 2EIKH 5FLXK 5JR9B 3KP5A 3NWSA 2CXFA 1IDZA 2R5ZB 2JQ9A 3PIPF 2VPLA 4XORA 4JI3T 3AE2A 3CVRA 2IA1A 2W1OA 3KZZA 3K4MA 4U7DA 5JR9A 1TP4A 1C0WA 2L7MP 1YRNA 2QBYB 2CBIA 2Z9OA 2Q9QA 3CX7B 5FKYA 4ASKA 4HF2A 3EETA 1S7EA 2JVGA 2EBIA 2HOEA 2VQLA 3GO5A 3M8JA 2XAUA 3E6BA 3K70C 3NQOA 5L47A 4B3TT 3LQRA 2WAEA 2H88A 4PSXA 1QZEA 3GW2A 4R1HA 4X0GA 4CN4A 1ODDA 2OZUA 3HRUA 1YS6A 5FXZA 2M2EA 4ZI2C 3Q9DA 5FLVA 4NXNT 2DODA 2F4MB 2LH9A 1ZQ3P 2Z6EA 1IXSB 2JA7J 1D1AA 1UHMA 3NVOA 1K83J 1U8RA 1XMAA 4HDVA 3T5XA 2Y8DA 2UXNA 3QK6A 1Z77A 1J5YA 5EGOB 1Y39A 2CU7A 3ESWB 4PNIA 2UXCT 4ZTFA 1MIWA 3FBNB 2QLZA 4I09A 3O3KA 3EABA 4FTHA 2WZIA 3KLOA 4U7BA 5JDGA 1MNEA 3VKHA 1RKWA 2LY2A 3MZHA 4HYEA 1HNZT 1XDUA 2E1OA 3K1PA 3GZ6A 1IV8A 2OV7A 1TQMA 3BG6A 3OR2C 1YJ9I 4UVBA 1PDNC 1OKRA 5EZGA 6PAXA 1ZKGA 3RRCA 3V5UA 4DGWB 1SD5A 3GF2A 3CCQI 1HNWT 4H9OC 5IWAT 2CMRA 1T8BA 1T33A 2ISZA 4DV1T 4AQGA 2WM9A 4F55A 1IGNA 4ZI7E 2XGCA 3HSFA 2G0EA 2ZM2A 3HKCE 3MKYB 1YG2A 5GAHJ 2WP9A 3C4XA 4GKKT 4LK0F 4EQQA 1PUFB 2B0LA 2XKOA 3CO7C 3ZQGA 3DKYA 2MH9A 4Y4RA 2K7LA 1HF8A 1OCOH 2ZXWH 2DXIA 1EH6A 3EUAA 5E17F 2OF7A 3PUQA 4KX6A 1R1VA 3HJEA 1JUSA 1XB4A 4A3BJ 1OR7C 3M3YJ 3T8RA 5BMZA 1JKRC 3N2GE 4GXOA 2ZCWA 4UUSA 2CG4A 2O8KA 1SUMB 4HWCA 4CXYA 4LF9T 1YTYA 3BCBA 3ABVA 1X9BA 2X9XA 1YS7A 4JLEA 2XAQA 1HKSA 4MLKA 3OYFA 1MNDA 1W5SA 2CWEA 2CV1A 2DCFA 2J5PA 3OYLA 2YEVC 3W6KB 4GKJT 3NRYA 4OYKA 2QEXI 5DCMB 9ANTA 1M62A 2W0GA 5B1AH 5EEAA 2J62A 1DUXC 1GV5A 5F64A 3JAEA 5HCJA 4AUXA 5HEJA 4TUYE 5F27A 1OEDA 4TNVA 2DA3A 4Y17A 4DNDA 5IYZE 4KITB 5CVRA 5DEQA 3TQNA 3A5XA 2A61A 2F6CA 2NR4A 3BTCA 4HQMA 3HDDA 4QH5A 3DXJF 1K61A 2WDQA 2WWVA 1J09A 2HYJA 2WDVA 5C3JA 1YJNI 4AYBN 3W2WA 1ENHA 2QQ9A 2LSOA 1HLVA 5J1UA 4IHVA 2YU2A 4UV8B 3MKDA 3UUXB 4BH9A 4KT5C 4A3LJ 1XD7A 4IPAA 4B4CA 2CLYB 3DP7A 1FOYA 2QBYA 4IQ4A 3CJQB 1OCCH 3ZMUA 4KICA 2K9LA 2OUMA 2STTA 1IC8A 4EM0B 2LRDA 1KQ8A 2R7DA 4KIGA 2V5CA 3MJXA 4A98A 3I9YA 5AQFB 2XQ9A 2UUAT 3JRHA 1RKTA 3E0JB 4L5JA 4EJTA 3E0ZA 1D0YA 3IWFA 4BBSJ 4TZ4C 2RGVA 1QPMA 1RPWA 3ASOH 1XZYA 3PUWF 5LYJE 4RAYA 2X9DA 4WW0A 1J1JA 3QP6A 3JRDA 1WZ2A 4M71A 3TDUC 3KP2A 4A97A 4RLQA 2LR8A 4CGZA 2M7AA 5DCFA 1UCUA 2CLYC 4G63A 4IL9A 4ZS3A 3RIAA 3GTMJ 4CQIA 5DD8A 3G2BA 3HSRA 4MFDA 3W6VA 4I0BA 3G6EI 1BW5A 3FBZA 3UUMA 2R93J 4CXXA 4HLXA 1WJ5A 1LFPA 3J7AY 4BHCA 4YG2F 2OJED 1W0TA 3GWZA 1HA8A 2ICWG 2NXNB 2QWWA 2H6CA 3K1MA 3CO6C 3QPTA 4E70A 1N78A 4EOZB 1IBMT 2H94A 2P0WA 4RAGA 3PE0A 2FJAA 4PW8A 3O2PE 2DPUA 1UK5A 4DV2T 2HR3A 1ZHFA 3AA1B 4CI2B 3HKEE 4B09A 4EGWA 1WGXA 2DMQA 3IWZA 5D8LB 2NW8A 3QOFA 4MQVA 5GAGJ 2WMOA 1ZG1A 5FKMA 2R7FA 1IN7A 3NWTA 4ZH4F 2GAUA 3BR2A 1AJ3A 4ZI2D 1KU9A 2DI3A 2XV4S 4HBLA 4PGHA 3CCJI 2HN2A 4BDYA 4G7OF 3O8HA 3M4OJ 3CJRB 2BV6A 2JPCA 2K4JA 2STWA 1JJ8C 3N5LA 1X2NA 3QB5K 2EQRA 3AEDA 1JI8A 4IHJE 4AQYT 3H9QA 2QENA 4DOZA 1FP1D 4RBOA 2EB7A 2XM1A 4P96A 2KISA 5DUKA 3U2RA 2XZEA 2VQHA 3L2RA 3GTKJ 1IJ5A 4MFRA 1HFAA 3CIRA 1FPQA 2OA5A 2ODVA 3LSVA 2DAOA 5AQGB 5L3CB 5L3FA 3A0HC 3J7AO 4XN0A 4JOMA 3DKXA 3TMOA 3UULA 3WTXC 1LB2A 3ZMSB 1YLFA 5GTHC 1VQLI 3AA0B 1CUNA 3V5SA 1KYWA 2FA5A 3R6NA 3F8MA 2YINA 2IA2A 3QNUA 4A0XA 4RM2A 2WB1A 2C0SA 2KDOA 4L9JA 1DU2A 3T0YA 2DMUA 2NNYA 2LKSA 2IPQX 2VLAA 3EYIA 2IS1A 3K3QC 4ILCA 1BN5A 3GMIA 1ETQA 2RNGA 2HVRA 4CCMA 1F5TA 1Z0XA 4BACA 3HOVJ 1VCSA 3K2ZA 4LIVA 2KRHA 3BZ6A 4L5EA 3WTZA 3KV6A 4FJOA 2HKXA 1NENA 4X20E 2DFEA 3DLAA 2DJNA 3SEQA 3UFGA 1X1CA 2QGSA 2WB1N 1UGOA 2W00A 4MTDA 4NBQA 4PCQA 5LJMA 4DZJA 4X1IE 2QM3A 2CW7A 1U5TB 2DT6A 2FOWA 1SFEA 2R4GA 3V4GA 5C4JJ 2K3WA 3ZKRA 2TCTA 3ZMZA 1MBJA 1UX4A 2LP0A 4EZ4A 3U1DA 4JI8T 2HOTA 2TRTA 5FL1A 1NHAA 2E71A 1B72B 3TW6A 5M5YJ 3CUOA 3H3UA 2LDUA 2MLKA 3PIOF 2O6GE 4BGDA 2UXNB 2IRFG 2CCQA 5HODA 3AVRA 2DK5A 3OWTA 3OS2A 2FXAA 5F0HA 2MABA 1Z8UA 2J47A 4DV4T 2DOAA 4UB8C 1VFCA 2R5YB 1D1BA 5FLMJ 3CUQC 2KINB 2BDEA 2V6CA 3LSGA 5AQHB 2KNDA 3UU3A 3F8CA 5LJNA 2UUZA 4FETA 4AQFC 1XMQT 1B9NA 2V7FA 1IRFA 1YD8G 2HVQA 1J9IA 2IBDA 3CTAA 1OFCX 2VVNA 1T2KA 1U9NA 4LLGF 3ZJ2A 1I5ZA 1JNZA 4LMKA 2PBIA 3M8FA 5HAXA 3IHUA 1Z67A 2W63A 2QVAA 3BWGA 4WBOA 1Z3YA 3TKYA 1UCRA 3HIFA 4XOTA 2K27A 2LKHA 3ZSSA 5JDLA 1E3OC 3IV5A 2F5FA 2CQQA 1REPC 2Q9QB 4E7IA 2F5CA 1WKMA 3QWLA 5CVVA 5KVRA 2K4BA 4A3IJ 2NS8A 1Y1VJ 3PJRA 5AQPB 1BR2A 3VPRA 5HS8A 3CUQB 2VXZA 1MDMA 1UB9A 1DGWY 3DTOA 4BJ5C 1I39A 3HL2A 1BM9A 1HCIA 1I27A 1O57A 3AEGA 1Z3XA 2P81A 1JHHA 2WC2A 3FXOA 2BZBA 2MD0A 3M07A 3WTVC 4PJJA 3F23A 2VWAA 1TW3A 3ZN1A 2EZHA 4Q47A 3ZT6A 2ZFUA 2YK0A 5BPDA 5CB4E 1FP2A 3W6JB 1PUFA 2EHOC 1POGA 2VKDA 3QAHA 1BI2A 4I2OA 1N36T 2AO9A 2XQ8A 3CCYA 4DW6A 4K0UA 1JKOC 2GXGA 3W2VA 1TWFJ 4BUPA 2XSJC 5J40A 1MSFC 5F1RA 1XGSA 5CLSA 2DO7A 1DP7P 3FBIB 2XM2A 3N9MA 1NK2P 4V2GA 2LREA 1G6NA 1E2XA 2WAUA 4AKLA 2H8RA 2K86A 4UUSB 5DS9A 2L2OA 3BG5A 4CICA 4EVIA 5JVTA 4NUVA 3CMYA 3E7LA 2CQNA 4QPOA 3UT5E 1X1DA 3QPSA 1WQ2A 4C3JJ 5K5OA 4Q5SF 2JRKA 1ULYA 2QKMB 3JTGA 1IBKT 5ILSA 2V26A 3HUGA 2ZC2A 3ZXSA 2DA5A 5FO5A 5KAFC 2E9XC 2LOSA 2Y6XA 1K78B 5EGOA 2JMKA 1P92A 2DOFA 2L7KA 2XVCA 4E7ZA 2DYSH 4AISA 2X67A 3J80Z 4ISTA 2Z33A 5DM6F 2BW3A 1K7AA 1PUEE 1FMWA 3QU6A 3TO7A 4ERRA 2L7FP 3ASNH 1E7PA 2LY1A 5E20A 3OVUA 1BBYA 2GOMA 1KNPA 3ULQB 3VSLA 2AXLA 4U7IA 5EK2A 3KYDB 4HDUA 3BR3A 4U2YA 2E2AA 3LJCA 1N34T 4M3GA 1ZRCA 2LMDA 4G6QA 4A12A 4UF0B 2VBYA 1TWHJ 1YRNB 1VQ7I 5LGTB 4HEAA 4ZS2A 5JR9C 2HTJA 3C50A 5JDHA 4ZI3D 5JHUA 1H88C 4YEJA 2BBYA 4RMNA 1EV7A 4UVCA 4K2EA 5L3GA 3OPCA 2CUFA 4O4LE 3P8CD 2O03A 3VOEA 4IDQA 2FJDA 1RC9A 3SXYA 4G94A 4D7NA 2YU1A 4QH4A 4IL6C 3I0OA 5IP6A 3P9KA 4BDZA 3HKZA 3H3VK 5LHHB 3QU3A 5EEHA 5LEKA 4ZI3C 5LGUB 3QPHA 5JRCA 1SVLA 3RQWA 4A3FJ 1L0VA 2VBXA 2H3RA 2ZSHB 3CZ6A 1FYLA 4BNCA 3RI5A 2EFWA 4L9IA 5C8YE 3AE6A 1HG5A 1V5EA 1X3UA 3JRCA 2R5YA 4BY7J 1QA6A 2VKHA 1FIPA 2KP6A 5GADJ 1LE8B 4DR2T 1YQ3A 2LFBA 3DTEA 5EDNA 4AVPA 2WDRA 2EINH 2FSWA 1S5LC 3N9NA 2EHOB 1JTXA 4MIMA 3B5MA 3R0AA 1S9HA 3SFIA 5F3JA 4UIGA 4ZDLA 1OCRH 3V8KA 2KT9A 3T8OA 3FB2A 3CCEI 5A1LA 3FXEB 1XSVA 5CJ5A 4HA8A 1JE8A 4GFBA 1I1GA 2LY9A 1VOMA 5HXEA 1YO5C 4XBFA 4IE6A 4U87A 3T1BA 3GA8A 4C2UA 1OWAA 4AC0A 3H3AA 4O3MA 2XROA 2MG4A 2X6YA 4B48A 2BKNA 3CCMI 1JJ6C 3D5SC 2OTLI 4XBFB 3ZMTA 3FKIJ 3C1DA 3ONLC 1MIYA 2XB5A 4D0PA 1VQ4I 4QTRA 3HBLA 5D6FA 3ZQFA 1F4KA 2A6EF 2PJQA 2FJEA 2D5VA 2JMWA 5H2FC 3OS1A 3FHNA 3OSFA 3BR0A 5HEGA 4RAFA 4XNFA 5TGTA 4PFOA 2CYYA 4FHTA 5E79C 1T8IA 1FYMA 3D0SA 5B3SH 1EKEA 5HDGA 2E9XB 2XAJB 1YW7A 1IZNB 4AIHA 4QXBB 4AKRB 1XN7A 3MQ0A 5FROA 1R22A 4GYIA 3ZN0B 1JGSA 3HM5A 5D5UB 4KA4A 2HDDA 4AM3A 2LRLA 3AAIA 3ZP5A 1MBEA 2DA1A 2OPTA 3BG7A 1T56A 4UV9B 2LOOA 1W0BA 1GT0C 4P1WA 5AQRB 3NKZA 2M7BA 4QIWN 4I98B 5E1ZB 3FBLA 2IT0A 2HHHT 5L3BB 4HSTA 5D4SA 2VVSA 3AEBA 1ON1A 1X1PA 3KFWX 3VYUB 3RIUA 4D7MA 3S2HJ 2IS2A 2RV8A 2DK8A 3PUFA 5AQKB 4U0WA 5L3DA 4BE0A 2EHOD 4X6AJ 3O9XA 2ZNZA 3IP4B 2ZMEA 3GN5A 3NWIA 4HE8A 2VOOA 2QF7A 5JR3A 4C3HJ 5F6FA 3WG7H 4AU7A 3BR5A 4JX5A 4IVNA 4D1QA 1YQAA 1XSXA 3EDPA 4HX8A 3JSOA 4WBNE 5KNLA 1Z05A 2R7WA 3GWHA 5HWYA 3T1YT 2CRBA 2AQEA 2LNBA 2WAQA 2DBBA 1Y56A 5FKKA 2M67A 1YYVA 1FT9A 3GTLJ 1SVMA 2Y9YA 2V4JC 1U2WA 4N0BA 1W36D 4NHJA 2NVYJ 1VTNC 4UUVA 2BKOA 2LLYA 4L5GA 2IP2A 2X48A 4RGUA 3V42A 1ORKA 3JAMZ 2NP9A 1ZLKA 1VQ9I 3MVPA 3HI2A 4JI7T 2NWBA 2RC4A 3E6CC 1UG0A 5E0OA 5J4YA 2ESNA 3S17J 3H92A 4H63H 4RGSA 4DVDA 1QQIA 1SEUA 1KGSA 1B59A 5CVJA 5ABHA 4ILUA 4ITVA 2QSFX 1F9NA 3ONXA 1W4MA 4ZYHA 1QHGA 2E2IJ 4UVBB 1CGPA 3HOWJ 4L18B 3J80K 5L3BA 4BU2A 3GX4X 4CDGA 5ERIA 1HF0A 4OMZA 4B47A 3I58A 1ZH5A 1LRZA 2E1CA 1W1WE 4FX4A 3H5AA 3LSTA 3R4KA 2ECCA 3B6AA 1IRXA 3H9GA 4A5NA 3E5XA 3LAJA 4PJMA 4DBQA 1MBHA 2MYSA 1ZG3A 1ZV4X 4B44A 4U31A 2N8GA 2H1LA 2WY2A 4PJNA 2UXBT 2KMFA 3M65A 1LDKB 2PLYA 4NIQA 3C2GA 3AE3A 4LMJA 1LUJB 4BHBA 2QVOA 2ELHA 3B02A 2X85A 1GVJA 2HDCA 3DBHB 1MIVA 4LF5T 2LT3A 3AA7B 3RKWA 5ICFA 1G3SA 2E2HJ 1ZOYA 2C5IT 2XAHA 4XKWA 1RIOH 3OBVE 2FQ3A 2NVUB 4U88A 1I94T 1MMSA 2WV1A 1TNSA 2EV5A 1V55H 1IN8A 1WWXA 3BP8A 2HDWA 4RS8A 5BMVE 2Q9QC 4ASNA 2MH2A 1TWGJ 2HPIA 4MHCA 4ZHQE 3CQGB 4EB6E 3CJTB 3LAPA 1MDMB 3O4XE 3PU3A 1R4MB 1WJBA 3CC4I 3DFGA 4HGAA 2EH3A 3ZQIA 3KCCA 2IC6A 5LG3A 1ZTRA 1QNTA 2R3SA 3NZPA 5CGMA 5IT9Z 1FSHA 1NWMX 4B3MT 4XKBA 5LFAA 3Q5DA 4LG0A 4JEUB 1E0EA 4EEDA 5D8KB 1ETWA 5FD6A 1N77A 2FRHA 2NTXA 1S7OA 4G7HF 1SFUA 1L3LA 4R8HA 3QODA 1O3XA 4IREA 5BR8T 2KZ7B 2YN6A 1W9RA 2ZBKA 3BC8A 3K4JA 5E8GA 4BS9A 4I43B 3DBRB 2BVMA 4Z90A 2XHKA 3RC8A 4CN1A 4KIFA 1BOAA 1VQPI 2YPRA 2L7ZA 4ZYGA 2CE7A 3P7IA 2V7LA 1IDYA 1FOXA 2ZXHA 3KP3A 1OEDB 2NW7A 4DO0A 5LCYA 3CF5F 2K9NA 2ECBA 5LHGB 5LG4A 4XK4A 1KU2A 2LKPA 3ZR8X 4EJUA 2DLLA 4OIOF 3E1SA 1WR6A 2X9YA 4WWCA 1FIOA 3DEWA 3Q0WA 1IV6A 1JNRA 5BOXA 5H6RB 4DJAA 2LKGA 2XKPA 3EDVA 3IKVA 1IUYA 3FXUA 4IOCF 4JI6T 4COFA 4UVAA 4C2MJ 4E6KG 1SAXA 4YLHA 3K4NA 2O5RA 3RYPA 2EZIA 1BL0A 2HPLA 4YFXF 2Y0SA 2YKSA 1IO2A 2Z2SB 4G6DA 5LNKA 4B8XA 2BBJA 5HXSA 3HGYA 4HG2A 1WI9A 1G3YA 1I3AA 5CVIA 4FCYA 1U3EM 2HWVA 1SFOJ 3F8NA 4YXDA 3D5LA 4OU0A 2DWGA 4XZCA 3WTWC 4IHWA 3OYAA 2FNPA 3PFYA 1WH7A 4TV7A 1VRBA 2XHEB 3HG9A 3K3OA 3QB5A 3KP7A 4U33A 4A5XA 4I6ZA 2FQ4A 3S32A 3JAFA 2DA2A 4Y7NJ 1R36A 5HXCA 4C91A 1I3QJ 1MJ9A 2ES0A 2DMTA 4PGGA 2H1KA 3P4RA 2IAIA 2PJRB 4FE7A 1OPCA 2OLTA 2R7XA 4HF0A 4ZEYA 2XY8B 3H3MA 1N25A 3A7MA 4DUZT 2V7MA 3KEOA 3RQIA 4IX7A 1KU3A 3PM1A 4L9NA 1WJAA 3MEXA 4M9ZA 3I9WA 4F6RC 1VCTA 2YU3A 5L3FB 1N32T 3H1CA 3MWMA 3I59B 3LK3B 5HNHA 5LGTA 4XM3A 2LHNA 1PP8F 3ZMSA 4MHGA 4S0HB 2JK3A 3GXOA 3I3LA 1ZR2A 4K0KT 3K2AA 1GLNA 5K1YA 5HEOA 4G9YA 4AIDA 1Y0NA 2UU9T 2PMUA 2CHNA 1D5VA 4F91B 2OCCH 4I02A 3HRTA 5FFZA 2R6GF 2DT5A 3KVAA 1T08B 1UELB 2IGKA 2YSRA 4HFEA 3K0LA 4C30A 5CQGA 4QXHB 3GMEA 4D9JA 4KNYA 4X5TA 2NS7A 5JLXA 2ME0A 4EAHA 4HFDA 2GXBA 1J0RA 5HS9A 3ZPLA 3AG2H 1ZELA 3K69A 1EH8A 2OAZA 5HDNA 1IXCA 2P4WA 3GVAA 5FL0A 3VHLA 2BZTA 4GIWA 2R5ZA 4XLEA 3HRMA 3FXLA 2BS2A 5C4XJ 1OXZA 3RQUA 3CCRI 3U3IA 3BROA 4UELA 4DV5T 3AE9A 3LDQB 5CQEA 3QYEA 4DIDB 1O4XA 2R92J 4R79A 3GTGJ 3OYKA 3P9CA 2ACZA 5ABFB 2M8EA 1IN6A 2VE8A 3WG9A 2Q2EB 2PX9A 2GWRA 4W97A 4AD9A 2XAQB 3PNYA 4FE4A 4CZCA 2FU4A 5JREA 4EXTA 5E1WA 2CW0F 1XGMA 4HPQA 1QGPA 2XAJA 3X2QH 2M87A 2AXDS 3AEFA 1GXQA 2KJCA 3ZC0A 3RTRA 5J4VA 1XMOT 3MN2A 4I55E 2Q8KA 1P7JA 2Q2EA 1V54H 2D5UA 3HOTA 1H9TA 1US7B 1WSUA 1FZPB 2R0QC 2NOXA 3ZMTB 4O2BE 1IUFA 4M72A 3VR8A 3PQKA 4NUBA 4EYUA 2K3PA 2DI4A 1Z7UA 2YR2A 2ZSIB 5ADXL 2CH0A 1AKHA 1FTZA 4JUYA 3VYSB 3M1CA 3Q5XA 3N4MA 2LYCA 3DTIA 3K7AJ 1UFMA 1OMIA 2Y0MA 3JREA 3UU5A 4YTMA 1WPKA 3HC7A 4DYCA 4DQ2A 4BA9A 1J2XA 4CN6A 5F0FA 3KZYA 5KDMC 2JN6A 4IRGA 4FT8A 2XSDC 1FC3A 4BXXJ 2J4GA 2W57A 2KLQA 4UXNA 3ZMUB 5BPIA 1ZRFA 4Z8XA 4DR6T 3MKLA 1XNRT 2OC6A 3I4PA 3ZRGA 4A93J 4BAYB 5IUXA 4PJ0C 4FASD 2XSAA 3LFMA 1HDPA 3S1QJ 2KZVA 2LC2A 4PK4A 3OJAA 3K4BA 5KCMA 2WY7Q 1KONA 1G8XA 2NOJB 2V6XA 3ZQHA 1HXDA 4BE1A 5EEGA 4Z2YA 1ONVA 5HNFA 1OEDE 4LF4T 3LFKA 2BVLA 3OIQA 4KMUX 1PJRA 5K5QA 4AKGA 1BC8C 4V2FA 3J9X1 2VQGA 3JSPA 2IXSA 2GQQA 3B73A 3C18A 1BW6A 1H0MA 4XICA 3UNGC 5LA6E 3LSJA 2D0TA 3C2HA 3REOA 1QPIA 2DFIA 1NH3A 2H89A 2K48A 4J01A 1W7PD 2CV0A 1RR7A 3DV8A 3HTSB 3LBXA 1E1HB 2L9VA 1XSDA 1WYCA 5DQVA 5LOVE 1I6ZA 4BKXA 4A3CJ 2O61A 3HKDE 2OD5A 2OA4A 1FEWA 4NC8A 3F9KA 1P4WA 4RB3C 1YITI 5F0CA 2VQFT 1Y8RB 1VQMI 2BG9A 3M7GA 4A69C 3GTOJ 5IOYA 5FXWA 1SD7A 4MFEA 2DTRA 3EVYA 5J2TE 5DTDA 2MC4A 1R58A 1IJ6A 1BOBA 2ID3A 2R7TA 3I59A 4KIBA 3BQKA 2VIXA 5AFUL 1YX5A 5KXJA 1KK7A 2EILH 4WXCA 2WZHA 3BG9A 4DV6T 3LA2A 3BR6A 2FEZA 1K78A 2K9AA 4BQAA 2BG9B 2A72A 5GAEJ 3RZOJ 2XF5A 3LSIA 2GLOA 3RYCE 2ID6A 4V19K 1CHUA 3K10A 3LL7A 4ABZA 5M5XJ 1TWAJ 1KZHA 2HS5A 2RNJA 2FNAA 1X4OA 1T0FA 1R49A 5AQOB 5JTGA 5FKNA 2YDQA 3WU2C 2E5NA 2FBHA 1ZGJA 4O6JA 5JVGF 2B9SA 1ZR4A 2WAFA 2NVXJ 2CXDA 2KHMA 4NUUA 4LFCT 3MZKB 3OYIA 3OL3A 2H7OA 5AQLB 3F2EA 2A69F 3AG4H 4HAMA 2X1CA 3S4UA 2TDXA 2A3SA 3TP3A 1H8AC 3DKWA 4TN7B 1UHSA 1X3WB 3QPLA 4YT0A 2UV1A 1L0OC 3SZGA 3HHHA 2V7JA 2AE9A 2BG9E 3ANWA 3RHWA 3DJBA 4HWIB 4A0ZA 3BLYA 1FJLA 2JA5J 1D1CA 2BE5F 2C6YA 2E7WA 4ZDOA 3P4WA 3U78A 1D3YA 4BAYA 3UR3C 1ZGWA 3SHFA 5BQTA 3AEAA 2EFQA 3HXLA 2HFHA 2G9WA 5IY5H 3N9PA 5GPCA 1HBXG 3P9IA 2L9QA 1WVRA 1K6YA 3PL8A 4II3A 2QZ8A 4H9RC 4CA0A 3EUHA 1DDNA 1R7JA 4P9FA 3IHRA 3OR1C 2IJLA 4IHXA 3ESLA 1SD4A 3DBLB 3FMQA 5AONA 2K5BB 5JVDE 4IDPA 1RUNA 3O6BB 3J7Yq 3SWHA 1TC3C 1R4NB 1X58A 3ZOBA 3R0JA 5DV5A 1IJWC 4N9HA 4HNVA 5FXXA 1N33T 3S1MJ 2FJ1A 5E3OA 2MTQA 4OWRB 5A2QK 1U5PA 2VL0A 4LFAT 4UR9A 1W5TA 1DPRA 1STZA 1Z6RA 2PEXA 4LIUA 4DMVA 3LK2B 3KYCB 4DR4T 4ENNA 1SC7A 1HCRA 2X1DA 3VRAA 1JT6A 1V3FA 4YSXA 3R60A 1XG1A 3ISPA 3C7JA 3HTUA 4LG0B 4B1RA 3S2WA 3E6MA 1EH7A 2E34A 1B8IB 2M45A 2EIMH 3K70D 4I0AA 1LEBA 4X1EA 3CLOA 3PUYF 2M30A 2HQ5A 3G3ZA 3IH2A 1MIJA 1VQ8I 3BQIA 4GOUA 2A6HF 5BNGA 2LG4A 1RR8C 2I0MA 3OYXA 4CCJA 2ZM6T 1D5YA 4BHPA 3MZ8A 3AECA 3IRRA 2J1DG 4N78D 4Q48A 3JCUC 2EFOA 2V1XA 1G73A 1HSTA 1A36A 1FSEA 2W67A 4BQNA 1NK3P 3PNVA 4CCKA 1IF1A 4TNWA 2Q0OA 4HKAA 4KP3C 3TO6A 2DNXA 5L3EA 2XGDA 3J81K 4IHSA 4J00A 2LSYA 3EHZA 2MBGA 2BEOA 1S8NA 3HOSA 2MW8A 4YSYA 2VPRA 2CS3A 1U5TA 3E97A 1X1AA 3N9OA 3DEUA 1AA7A 2E5LT 1DP3A 2MD5A 3KLNA 1MZBA 3DU6A 5M5WJ 2R7VA 4F93B 1U9OA 4MALA 2LD5A 4G2AA 1FBSA 2ZNYA 5GPAA 5LGUA 1TL8A 4WYVA 5J6XA 4U0YA 1IZ1A 2L9NA 4ZTJA 3RPQA 3HZJA 3ZYKA 4YRVA 2E5VA 2D1HA 2Y69H 4G6TB 1VZ0A 4UNOA 1MBFA 1LVKA 3AB3B 4BJNA 4BEHB 2HQNA 4CCOA 3AAEB 2GM4A 1QBJA 3AAAB 2ACJA 4JBAA 4DR5T 3HYIA 1CF7A 2D45A 2HU9A 2EV0A 4F92B 1A31A 2NNNA 4IT4A 3MD2A 4QWNB 4PAGA 2CQKA 2BHYA 2EA2A 3RPUA 4QSHA 5D4RA 1RESA 2PJPA 1KNZA 2ODUA 5LHGA 4ZJZA 5KX5E 2UWMA 4ZC3A 3ZMDA 5D5VB 4RB1A 5JDNA 3AXJB 4F3QA 3FZFB 1EA3A 1T98A 1ZLJA 2L4MA 3R6SA 3TW7A 4F7ZA 4KI0F 4N9IA 2CSOA 3OYGA 3H3ZA 4H63V 3LFUA 5KK1A 4OOIA 3A2KA 1BIBA 3SYTA 2R7SA 1HS7A 4RLFA 3Q3SA 4M3EA 3AE5A 4LLLA 4XLHA 2OTJI 3MACA 2KQRA 3FZVA 2OQGA 4IJAA 4MEYF 2DT7B 3IRQA 4X62T 4B43A 5L4EA 3A01B 1S72I 1USSA 1VF9A 4N4NB 1DU0A 4AKIA 5ICCA 2LLKA 1HKQA 3IF8B 4OIPF 1H9GA 3NRXA 3LOCA 3ZGKA 2BS4A 3AE7A 4U7YA 4UEMA 3PUSA 4DV0T 4M6VA 1T72A 3CMMA 3GCMA 3I54A 3LQQA 2O8XA 3PTRB 4ZZCA 2AXTC 2VQCA 1T0FC 3Q0UA 4W1UA 3DLLF 2ZFWA 3E22E 2DCEA 1R6RA 2D9DA 1YKEB 2W66A 3PUGA 2COMA 5FP3A 2G7HA 3CD6I 3J81Z 4XQFA 2B1EA 3RSNA 3HPGA 3JRAA 2P5KA 3Q2MA 2J5OA 3GZ5A 2ZJQF 4BQOA 1ETVA 4CZZB 3Q0VA 1RETA 1JHFA 3I64A 5LGNB 4CHUA 1OQYA 1ZYRF 2AHQA 3ZT7A 3HHGA 2ZJPF 4YIRX 4HLYA 3H9JA 1DGRM 4AXPA 2QCOA 2ACXA 3L2VA 1ETXA 1FEXA 4M3DA 3LA7A 2GIVA 3RDIA 4DZPA 3OOUA 5FVKA 3QRFF 2V7KA 2W62A 4LJZF 1XDPA 1R1UA 1TZLA 2C5KT 3ZCIA 2FBKA 1UJ8A 1QRYA 1SFXA 2CUEA 2FMLA 2CGPA 2LHRA 4HFHA 2X9WA 1ZEEA 1WRDA 4LMLA 4EYYR 3GTPJ 5LHHA 2VODA 4TX5A 4A3KJ 4L5IA 2BKPA 2L01A 2FX0A 3OSGA 5IT9K 5M3MJ 1ZAOA 1YW9A 4IXAA 5FRMA 2MBFA 3IL2A 2CJJA 2MOZA 2JJ9A 4QX7B 3TP0A 1MSEC 1HX1B 2W48A 1P7IA 5IT3A 1HW1A 1GUUA 3Q9VA 2V1DB 2L5QA 3MZYA 3PO2J 4XAXB 4DR1T 3LG7A 4QPQA 3RZDJ 4JK1X 3K4KA 3BQYA 2Y30A 2KIUA 2VJJA 3MFKA 4BJ6C 1FLIA 2CBJA 5J1GA 2W84A 3H0GJ 2X0LA 3P5JA 2XAHB 3CX8B 2M0MA 3WTSC 3M3ZB 2M9HA 1G59A 4LB5A 2QQAA 3FISA 4WZXA 1FBUA 4EZHA 4EJOA 4BY1J 3ABUA 5LXTE 2W82A 5LRSA 3KPHA 2FD5A 4E7HA 5FXVA 5E3NA 2B63J 4ZZDA 1LKXA 4E7KA 2JTVA 1WJCA 3AXJA 4HV6A 5CJ9A 1Y01A 3FHZA 1SMYF 3CLQA 1Y8QB 3PURA 1U5TC 3CCSI 4LOCA 1O3SA 2M6BA 4ZOLE 2RN7A 1TQIA 1VI0A 3FF5A 2ZMEB 4IEJA 1B72A 1IXRC 4CYDA 1XDOA 1AU7A 3FDYA 3F57A 4ILBA 3CDLA 3IKTA 3PUXF 5FYMA 4BEHA 4M74A 2NYXA 1RNLA 2GOXB 4IZZA 3HOZJ 5FMNA 3SDBA 2QQ8A 4HTEA 1FBQA 4PJLA 5C3EJ 2H27A 3LA3A 3N05A 2PI0A 1BI3A 2X66A 3IA3A 2KL4A 4UV9A 4XSXF 4LB6B 4PDKA 2MAWA 5ICGA 3ECOA 4Y15A 4DYRA 3ECHA 1H89C 4LFBT 1HG2A 4II2A 2L9SA 4G12A 1Z6TA 1MJBA 2DMPA 2DU9A 1HSJA 4WF2A 4XSZF 3G73A 3OIOA 4XRSA 4J19A 3MCZA 1JKQC 2HPMA 2E9XA 1RZ4A 3CX6B 2VJIA 4JI1T 4QWQA 2XRLA 1JTYA 4I0UA 5L4HA 1WCRA 2XQAA 3F8FA 4A3DJ 2DFFA 2N1GA 4AIJA 5HLGA 2BY0A 1MMAA 4UVAB 3SZPA 3ABKH 1KU7A 1TT0A 2R7QA 3VU7H 1F36A 4IQJA 2VC0A 3FKJA 3FK7A 3T8TA 2V1UA 3W2AA 3ZYLA 1GVDA 2L9RA 4JV5T 2CPTA 3AL0B 3ZQ7A 2VK9A 4JBWF 2JWTA 3VKGA 1ZG5A 3C51A 2H09A 3ELKA 3CC7I 1FTTA 3CPZA 4F8HA 4IE7A 2V9PA 2Y75A 3Q9SA 5IP9J 2XJ7A 3KZIC 4A6DA 1G3TA 2W85A 3E5UA 4Y3OA 4KUMB 2BYVE 3LNQA 5LBMA 4ESBA 5J47A 3GLXA 5HDKA 2QA7A 2KRFA 3J7ZI 2LOPA 1NTCA 3SRZA 2M3AA 3K6GA 2DTZA 4KMFA 1XPXA 1B8IA 1MMNA 1UAAA 1J5WA 3PJAJ 3JRIA 2YS9A 3S15J 1QZZA 3P50A 3H5RA 3AE1A 3FM3A 5EZYE 4DV3T 2QA4I 3PNTA 3ZQCA 3LWFA 2RREA 3EUKL 3S3MA 4KUMA 3KV9A 1WCMJ 2EFNA 4ZDPA 4NC7A 3O1HA 3L2QA 4L9VA 4KFCA 4IGUA 3F31A 3PU8A 5LLQA 2CFXA 2M4GA 2MA3A 2NTYA 2DA6A 4KN7X 4CXWA 3RKOA 4IKFA 1FWZA 2XGXA 4UVCB 4ZZBA 2KWHA 3RIUC 3S14J 1LNWA 3PSFA 1A04A 3IH3A 4WX9A 3OYDA 5IHYA 2LF8A 3ZSTA 3MK7C 1Y64B 5JLWA 2BBHA 3F8BA 3L8RA 5ETWA 1J5ET 3V8JA 1Z0PA 4S04A 3N97A 4MQ9F 1NG7A 2L02A 2RP4A 3C64A 3CQXC 1B7TA 2GIZA 2KT0A 2M34A 3WODF 3KYLA 1XC5A 2XAFA 1D8KA 2X6OA 3BQZA 5FKLA 3RKXA 4IO9F 2RA1A 3O1IA 3Q5WA 1JXSA 2IGOA 4ADZA 1R1TA 1XMXA 4KHZF 1TT5B 2YX7A 3N2KE 3ABMH 1MKMA 2XASA 4FQGA 1RRJA 1O3TA 3UQ7A 4EGYA 1LEAA 4D5FA 2QSGX 1LFBA 5AQUB 4B3XA 2XQ5A 3GUDA 4HX4A 1WI3A 4RB0A 5EZHA 1FYKA 1H7CA 3C2BA 3ZYMA 4YJ2E 1TWCJ 4GYSA 2X4HA 2LSGA 3U9GA 2L0KA 2BG9C 3QUJA 5FY7A 3C3WA 3HUGB 1MGTA 3KP4A 4XLPF 1Z21A 2P6TA 3PUBA 3M9AA 1BA5A 4WCGA 1I6XA 1IN5A 2EFPA 1K4SA 4NC6A 3UU4A 3L2UA 2Z5UA 3L9FA 3SJMA 1LFUP 4UY8I 1U4QA 2NOGA 4IE5A 2VJ4A 5CPRB 4CUGA 1DQUA 2ETHA 2LSJA 2WA0A 5J8FA 3FZHB 2M4KA 1QVUA 4N4OB 3OYMA 3L2CA 2ZMAA 5J2UE 2L54A 3L1PA 3L39A 4PK5A 2UZKA 2Z1DA 2W24A 3GBGA 4BE2A 1BJAA 2HI3A 2VE9A 2JPBA 1SFKA 4CI3B 2XQYA 4AWXB 3IEEA 2OBPA 2COBA 5J1RA 3A01A 2WBLA 2R7OA 3TGNA 4X64T 4G8XA 3VFZA 5EK3A 2O9LA 5F8PA 2R7UA 5JRCB 2A6TA 2M5WA 5CA0E 3TKLB 3WHBA 3L3PA 3HRSA 2KLOA 3FIWA 4O8SA 1WJEA 5LD2C 2LBFB 4DNCA 3RKQA 1YIOA 1WRJA 2DDBA 3DTKA 4BJTA 4BXUA 2BY2A 3B57A 2F5VA 2B7EA 3I5UA 1ZK8A 2VQET 4L0ZB 1ZREA 4XIDA 1YE9A 3HKZN 2XGEA 4A5MA 5HLHA 4KISA 1IAPA 2A2FX 4XLNF 5HEHA 4YELA 5HXHA 3OIPA 3FM5A 1B1BA 4OIRF 4YFSA 5KMGP 2ZXIA 3BTLA 2PJRA 3WHCA 1VQOI 3OOPA 5CFBA 3L09A 2DHRA 3RX6A 3A1YA 5FFXA 5ED4A 3RH3A 4EGZA 1HX8A 1UHWA 2HZDA 4H0EA 1CF7B 3F21A 2LRKA 2RKHA 3BZKA 2CO5A 4LK1F 2VC1A 1X79A 2MLGA 3W3CA 3K1NA 4GCVA 4CCLA 3WTTC 2PFVA 4YTPA 1TBXA 1QUUA 5DD4A 4NPPA 5AQNB 3JRFA 5D5XB 4S05A 2FBIA 1YI2I 4WK8F 4KMCA 3FK6A 4ZZLA 2BY1A 2E1MB 5KHDA 1G3WA 1U8BA 3IUOA 3VRBA 1BR4A 4UB6C 2DN0A 4CYCB 3OYNA 3CMEI 1HC8A 3OYBA 2ZLYA 4EJWA 3PO3J 1GQEA 2QKLB 3S8PA 3VYRB 2JRMA 2P8TA 3ERED 5L2LA 1XCBA 3HOYJ 3WE2A 3JRBA 5TJJA 4HSRA 2VKJA 1U6GA 2VL8A 3NZQA 4NQWA 3ABTA 3E5QA
chains in the Genus database with same CATH topology
2ZO4A 3D0TA 2LEHA 4QHOA 4JQFA 1RUOA 1B6AA 3HL6A 1LQ1A 1LVAA 2KIFA 2DQLA 4AIKA 2C5JA 3HR0A 4ON0A 4XRFA 2NAZA 3HSEA 4HQEA 4HN9A 4A6EA 3ZN1B 4LGWA 4CXFA 3DPTA 4PZJA 2JRTA 4EM1A 3ZMVA 2D2SA 1B4AA 1TW2A 2K02A 3LK42 3COAC 2N2NA 4B6XA 4AKHA 2OZ6A 1Q1HA 4IIJE 1V4RA 2CA5A 3KDSE 1OYWA 3DF8A 1D0XA 3PUAA 4H9PC 1E17A 1P4AA 2HZTA 2XRNA 4UV8A 1F1ZA 4G7ZF 2D2WA 3ABTA 2WWYA 4PFPA 2VKOA 2IW5A 5D5WB 4MEXF 1YKHB 4MGRA 1GHCA 3H37A 1Y0UA 1BR1A 2CXLA 3FX3A 3AAFA 3WGHA 4GYGA 4P0AA 4OYJA 4IE4A 4LLNA 2CM0A 2EK5A 2XTLA 4ZYEA 5L3DB 2WMNA 3V7CA 1HQCA 2E7XA 4LFUA 1TTYA 4CO8A 4MBQA 2RVCA 3IC7A 3PFIA 3ZJ1A 2QYOA 3E6DA 5FNVE 2IC9A 2IVMA 1ZRDA 3K8PC 5CA1E 1FX7A 3ML6A 1WLXA 2K24A 1KA8A 4BYYA 4RB2C 1QZYA 3V7RA 3HKBE 1O3RA 4IRIA 3FWEA 4OIQF 5D6EA 4ETSA 2H7VC 1T39A 2OQRA 2PG8A 3QC9A 4LMYA 3WE3A 3LBXB 1B9MA 3WI3A 3I0QA 4DBRA 4ZYDA 4ISSA 1K6OA 1KQ0A 4M1PA 4H9SE 3CWZB 3CJNA 1ZKEA 1HTJF 3WTYC 1ZGAA 3VEPA 1TQPA 3E08A 1BI0A 3TO9A 3ZMVB 4YFNF 2CWYA 1BI1A 2VN2A 1OYIA 4HX7A 1O3QA 2QQBA 5FB2A 5E1XA 2D0UA 1HW5A 5EK4A 2M1BA 3L7WA 4L9TA 3K3NA 3OKQA 4HZFA 5K5RA 3ROUA 2HYGD 2F2EA 4UXNB 3FMSA 3UUNA 3FXQA 5M4YA 2KXPB 2EJRA 1EZ3A 4H9QC 3KV5A 4I50E 1V9DA 2X51A 2X9HA 3QP5A 5H6RA 2VB6A 4U0VA 2A5YB 4M73A 5ILVA 2NW9A 1LDJA 2ISYA 4X1YE 2HYFA 5LP6E 3N2OA 1S29A 1KQ9A 2P9BA 3OV8A 4YHJA 3VB2A 2VBZA 4U72A 2W25A 3KEQA 3DPLC 4M6YA 2LM9A 3AA6B 3C4WA 4QX8B 4CZZA 2Y48B 2NS0A 4HF1A 3WU0A 4M9XA 4YIIA 4QLCU 1S3JA 4I01A 2VOPA 2EA4A 4GGGA 5CVUA 2ZKZA 5HWXA 3BK9A 3E3VA 2KWIB 4IDZA 3KP6A 1W7PA 5TAOA 4JEHB 2JZYA 2F5DA 5AIPA 4P55A 2D1VA 3P7NA 3JTHA 3CMLA 2PQ8A 3M8EA 5LEJA 2A68F 3CKDA 1O7FA 4U74A 1HW2A 3ANWB 1R00A 2WSSV 5AIQA 3TOBA 1J59A 3N9LA 4AQFA 5JDMA 4I4TE 2V1DA 3I1AA 5HYAA 3O1JA 3EDUA 2WTEA 2A3DA 3JW4A 3KINB 1FY7A 3TOAA 4YFKF 5LRRA 5HOOA 1K79A 5FY1A 3RYHE 4DMWA 5H6QA 1IN4A 1GXPA 4O4HE 2X68A 5JQGE 2HTSA 3B13A 3ZEFB 1S94A 3RRWA 1P6RA 3BPVA 5H20A 4UHTA 1ZN2A 5DDGA 4GK5E 3FXRA 2AS5F 4Q4ZF 2FE3A 2LF7A 1FMVA 2KJBA 5FLXZ 3RYRA 5LGNA 4AI6A 2LE8A 5L3EB 2WV0A 3FMRA 1WYBA 3CQCB 1MD0A 5DABA 3NBXX 2F5EA 4M9SA 3I71A 4TV8E 1SHZC 2DLRA 2IAKA 2I59A 3MXZA 1KYZA 5JI6A 4A2UA 4X1KE 1BC7C 2JSCA 3SZTA 5DUIA 4OK0A 5JH7E 5HVQC 3WU1B 2MC3A 3DQVC 1R5GA 1Z1DA 1PP7U 2ZM8A 3F72A 4ENMA 1FOKA 3UFEA 2XAGA 3AVSA 4WNKA 3ZCJA 4EV0A 1QSDA 3BPXA 3N9QA 2ZJ2A 1O7LA 3CDHA 3V8LA 5L3GB 4P09A 4TV9E 2FF4A 3BY6A 1XDSA 3R61A 2P7VB 3I0TA 4GYRA 3HA4A 5L3CA 2LSKA 2PN6A 2DW4A 5DCMA 3ZC1A 4FX0A 1HKTA 1USTA 2FMYA 3MAJA 3WGIA 2KKOA 3WGGA 1XCVA 1MMDA 3F6OA 3ETUA 2ZM0A 1T38A 1G4DA 2QUFA 2HPJA 1P4XA 3ZMZB 4ESJA 3KBTA 3V7SA 1J7KA 2P6SA 4EM2A 2CEAA 3GFJA 4P9UA 2JMHA 1IAWA 4I7HA 5E8IA 2CWOA 2L4AA 1TLHB 3F3XA 3KETA 5HLIA 5FD5A 2XIGA 2GK9A 5HXRA 4P0BA 2L3DA 4GK0E 3TDZC 4O5VA 3EYYA 2VT3A 4KYWA 2NRAC 2EWNA 1IRGA 2Q9QD 4KBMB 1S6LA 2E9XD 4PK6A 4L0RA 1QO0D 3RI4A 3KBUA 2GZWA 2L3LA 1XMKA 5DJQC 1BIAA 3K9TA 1SMTA 3QOPA 3NEUA 1LVFA 3ZPOA 4M6XA 4RGXA 3C4ZA 4CI1B 2GA1A 2IW5B 2XAGB 2X0LB 2JT1A 4ENJA 5BS6A 4BJMA 3M1EA 4Y13A 2O0YA 1Z91A 2HEOA 2RDPA 1ZHCA 2V9VA 3GN5B 2UXXB 2L8KA 3CUQA 3PQJA 2JPFA 3JC6D 4HW0A 1LDDA 3L00A 1YW8A 3BDDA 1AWCA 3OYZA 4IE0A 1J75A 4IRHA 1T6SA 2V79A 3BOQA 3ZLIA 2Z99A 2UXXA 3ETVA 1OR7A 4ANJA 4RAZA 2RQPA 5GONE 1YFHA 3RYIE 4YJ3E 3SOLA 1XGNA 3ZN0A 4OFZA 2Y48A 2PG4A 5E18F 1AOYA 4KDPA 4QKNA 4EMSA 4MTEA 1D8JA 2V7IA 1R23A 3F22A 5LHIA 3FXDB 1YW0A 1SD6A 1P2FA 2PMHA 3EQLF 2HH7A 1OYYA 3RIRA 2A07F 2HKOA 4GO1A 4ENKA 5J8CA 4HOBA 3RJPA 1R5HA 3VODA 3SS1A 1DPUA 3BJOA 5FGMA 3BQLA 1RI7A 3GFLA 1TNTA 4O2AE 2EHOA 1U78A 5LBQB 4MNUA 1FNNA 5DQWA 5HS7A 2VONA 3WAJA 3I53A 1S35A 2LSIA 2ESHA 2HQRA 5A2QZ 3WTUC 4FI5A 4KN4X 2E8IA 4EIWA 3GFMA 2WWUA 1SA0E 1ON2A 2Z3YA 3UTKA 2KIMA 4C90A 4UF0A 1D0ZA 1W7PB 1IW7F 3KE2A 5ILUA 2DPDA 3RYFE 3SQNA 4NB5A 3MA9A 4OMYA 2P7CB 3C98B 3BJAA 2G0UA 3PDYA 4RGRA 3RKYA 2P5LC 2XUBA 4A56A 4ESFA 2P5VA 5JDQA 2LJLA 2PFBA 5AFUL 2SPCA 3SFZA 2IA0A 5LBQA 1MMGA 4OHFA 2JQQA 3NRVA 2N9DA 1I1SA 1MJAA 4EJVA 3Q5FA 2BGCA 5ICEA 3GFIA 3KVBA 4LD5A 3R84B 1Z9CA 4YIFA 4WXHA 4E7SA 5LHIB 2ZXJA 1S7AA 2W61A 5CYVA 2HGCA 2G7UA 2EV6A 4IHTA 4HV5A 2FOKA 2YX4A 4HFVA 4OINF 4IF4A 2XUEA 4QXCB