3RPUA

Crystal structure of the muke-mukf complex
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
321
structure length
309
Chain Sequence
b'TVPELVAWARKNDFSISLPVDRLSFLLAVATLNMSEGELVDAFRHVSDAFTIGVRANNAINDMVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQREFSTLRLSMQLSIVAGELKRAADAAEEGGDEFHWHRNVYAPLKYSVAEIFDSIDLTQRLMDEQQQQVKDDIAQLLNKDWRAAISSCELLLSETSGTLRELQDTLEAAGDKLQANLLRIQDATMTHDDLHFVDRLVFDLQSKLDRIISWGQQSIDLWIGYDRHVHKFIRTAIDMDKNRVFAQRLRQSVQTYFDEPWALTYANADRLLDMR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromosome partition protein mukF
publication title The role of MukE in assembling a functional MukBEF complex.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Cell cycle
total genus 106
structure length 309
sequence length 321
chains with identical sequence B, X
ec nomenclature
pdb deposition date 2011-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03882 KicB MukF winged-helix domain
A PF17192 MukF_M MukF middle domain
A PF17193 MukF_C MukF C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3rpuA01
1.20.58.590 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3rpuA02
1B9NA 2HEOA 4IXAA 4UVCA 5H20A 2GAUA 2QWWA 1T6SA 2DAOA 4JBAA 2RKHA 5HDNA 1FY7A 5EEGA 1HSTA 4HA8A 2V79A 4I09A 3V8KA 2G9WA 1GVJA 1S29A 3BZ6A 2QBYB 3CLOA 3CTAA 4HZFA 3I53A 1R23A 5LEKA 2RQPA 1GXQA 2MA3A 2L54A 1TTYA 1IXCA 3WG9A 1FWZA 1LDKB 2QQAA 5DD4A 2O6GE 3M8EA 1QNTA 4O6JA 4PGGA 4XBFA 1YW8A 2F5CA 1USSA 4KN7X 3JSOA 5D4RA 2P5KA 1S7OA 3DV8A 1JE8A 4HLXA 5DUIA 1D8KA 2A07F 2IRFG 4L9TA 2WV0A 5D5WB 2OZ6A 2COMA 2W57A 2ZJ2A 5K5RA 4N9HA 4Y17A 3R0JA 3DEUA 4A0XA 1FT9A 1J59A 1W7PB 3GO5A 1RUOA 3ZN0A 1HQCA 2FMYA 2GXGA 1CGPA 3GF2A 2PMHA 2PBIA 4FHTA 3WGIA 1G4DA 4A12A 3WU1B 1TW2A 1Z05A 5L3CA 5D6EA 2EV5A 4CGZA 4PDKA 2MLGA 3ZMTA 3E6CC 5AIPA 3TGNA 2JSCA 4HDVA 4WK8F 4Q4ZF 4CXFA 4FX0A 5ED4A 1DDNA 1HSJA 3G73A 3HUGA 2BV6A 4A0ZA 2O03A 5D6FA 2M8EA 1CF7B 4WX9A 1FBQA 3IC7A 4CO8A 5FFZA 1QBJA 3WTVC 1X3UA 1XB4A 1DP7P 4OMYA 5F1RA 2H6BA 1UCRA 2YX7A 2ZKZA 1G3WA 1XGSA 4FX4A 3DPTA 3I64A 4PGHA 1K78A 3M8FA 2LF8A 3DQVC 2DI3A 3GEZA 3LA7A 5CLSA 3KEQA 2L4AA 3EDPA 2ZO4A 3H3ZA 1F5TA 4EM0B 1XCBA 2A68F 3HRSA 1V3FA 3E5XA 2C6YA 1YFHA 2JTVA 5IT9K 3G3ZA 2EV6A 4LD5A 1PDNC 5JI6A 4BH9A 3ABTA 2IPQX 3V8JA 2FMLA 4G6QA 1LEBA 2VBWA 5LHIA 4ZZLA 5E17F 3SZTA 5BPIA 3C18A 4B09A 2Q2EA 2F5DA 2R7FA 3HSEA 4EJWA 2W24A 4CYDA 3LWFA 5JHUA 2MH9A 1F9NA 3SFZA 4HLYA 4N9IA 4L9JA 1BI2A 4IHSA 3SHFA 2WWYA 1BI0A 3HRUA 3CJNA 3KCCA 3VFZA 4ASNA 3WTWC 1LJ9A 3IL2A 3NEUA 4LMYA 4YFNF 1TQPA 1ZGJA 4MEXF 3O3KA 2F2EA 4M6YA 4M71A 4A6EA 4ESJA 5E1ZB 3K0LA 1KU3A 1S8NA 4GXOA 4CDGA 1YS7A 3MZHA 1RUNA 1OYIA 4LK1F 2RV8A 2G7HA 2V1DA 5DV5A 1NHAA 3DPLC 4O3MA 4KICA 1ODDA 4NHJA 4P96A 5CVJA 5L3DA 2OD5A 1E2XA 3W6KB 2B0LA 3HOSA 1FC3A 1BN5A 2HQNA 3TO6A 3WGHA 2E1NA 3TKYA 1ZRDA 3T1BA 3LSTA 1Z6RA 3IWFA 2QENA 1O7FA 4L9NA 2O0YA 2DTRA 3REOA 3HSRA 1HXDA 1D8JA 1IRFA 2HKXA 3L09A 2HYGD 3TO7A 5HOOA 2X4HA 2DFIA 3QPHA 4R1HA 3QPTA 1DPUA 1BI1A 2RGVA 1PP8F 3HHHA 3KE2A 4M74A 1KQ9A 4Q47A 3BPVA 3IRRA 5J8FA 4KDPA 5IT3A 4G94A 4ON0A 4LFUA 1ZHFA 4PCQA 4BYYA 4XLNF 1FX7A 3C3WA 3L2CA 4EMSA 1ZYRF 5LLQA 3HTUA 1EH7A 1R58A 5HVQC 2ACJA 3SQNA 3ZP5A 5H6RA 4CZZA 4YFXF 4YIIA 4MGRA 2RC4A 2QVOA 1U78A 2A61A 2GXBA 1SD6A 4A5MA 3RDIA 2VC0A 1ZARA 1QPMA 5CJ9A 2LKPA 3T8TA 5E8GA 2Q0OA 5D8KB 3GLXA 1SAXA 1SFXA 5FD6A 1WKMA 2HS5A 3BROA 2XKPA 3QU6A 1UHWA 4Q5SF 2W84A 2YR2A 1DUXC 5FB2A 1VTNC 2EFNA 2XAQA 5D5XB 3WGGA 2BGCA 3U9GA 1FP2A 2K27A 1SD7A 4L18B 1G3SA 1LVAA 2MH2A 5HS9A 4AD9A 3P9CA 1W5SA 2Y75A 1XGMA 5L3BA 3QRFF 5CYVA 2IVMA 4KUMA 4EQQA 5E8IA 3E6BA 1H0MA 2KIMA 1QZYA 5BQTA 1R5HA 1IXRC 1B4AA 3ELKA 2DT5A 3V7SA 2QBYA 1BIBA 1STZA 3ML6A 3W6JB 1K79A 5BMZA 4LGWA 2ZXJA 4P5OA 1RI7A 1TBXA 3RJPA 2CG4A 2FE3A 2XRNA 4OIPF 4UVAA 5AONA 5ILVA 2FU4A 1J2XA 4HX4A 1Z91A 1L3LA 2A6EF 1JHFA 3EQLF 3HIFA 1YG2A 2M1BA 1FNNA 1YW9A 4L5IA 4S04A 4MEYF 2CO5A 4ESBA 4WWCA 4U0WA 2BYVE 4IPAA 4LLLA 3WTSC 4KIGA 4HYEA 3OOPA 2PI0A 2STWA 4QLCU 4ZH4F 2VODA 4D0PA 3GFLA 2KJBA 4M9SA 3ROUA 5HS8A 4EVIA 4Y13A 1G3YA 2A3SA 4I7HA 3F21A 3LAJA 2D1VA 5E1WA 3FMRA 2XAFA 2F5EA 2E7WA 1A04A 3J81K 3ECHA 2FBIA 2RDPA 4U7DA 3R60A 2V1XA 4DQ2A 4AIJA 2NS0A 5HS7A 2Z99A 3LQRA 4UV8A 5ICEA 3LAPA 4ESFA 1P4WA 4IHTA 1U3EM 2ISZA 4U0YA 3B73A 3I0TA 1BC7C 3M9AA 1ON2A 1FBSA 2L3DA 5JVTA 2CWEA 4OOIA 4B8XA 2EWNA 3N4MA 1FBUA 1MDMA 2XUBA 4BHCA 2R3SA 1O3TA 3GFJA 2HQRA 2H09A 3I59A 4LB5A 2KJCA 1SD4A 5E1XA 2XKOA 3P7NA 5DDGA 4Q48A 1B1BA 1W7PD 5JFRA 1YTYA 1TNSA 3L00A 3J7AO 3ABUA 4A2UA 2RVCA 2NRAC 1HKSA 3V4GA 4ZYHA 2FA5A 1ZN2A 3P9IA 2Z3YA 3RIRA 3CDHA 2VBYA 4CICA 2FBHA 2W25A 3AAFA 3GVAA 3FZVA 2IJLA 4GO1A 5DCMA 3O6BB 1MD0A 2XASA 3F6OA 4WXDA 2RN7A 3ZMUA 2FNPA 5H6QA 2IT0A 5CVVA 1BBYA 3I4PA 1ZG3A 3EETA 4LG0B 3Q5FA 4GCVA 1ZRFA 3FM3A 3ISPA 2LF7A 2V1UA 2IA1A 2ISYA 5F64A 2PLYA 2HWVA 5LHGA 2BBYA 3F8MA 1J9IA 2EA4A 2J5OA 3D0SA 2HKOA 4HAMA 1XD7A 3BWGA 1R36A 1J7KA 4G9YA 1PUEE 3GZ6A 1EV7A 2YPRA 4KN4X 1UB9A 2PQ8A 3R4KA 2X0LA 3ECOA 2A69F 1FZPB 3V8LA 2H6CA 3KEOA 2XIGA 4RB3C 3U1DA 2PFBA 5LGTA 3PQJA 3ZMZA 3J81Z 1SD5A 1QQIA 1GHCA 3KP2A 4RAYA 1DPRA 3JW4A 3WE2A 1WI9A 2K02A 3F3XA 4G7ZF 5BOXA 4M9XA 3F8FA 1B9MA 1B6AA 4I0BA 3E6MA 2P6TA 4M72A 3JAMZ 2FQ3A 2YU3A 1MJAA 1QZZA 4UNOA 4L0YB 2LDUA 3MAJA 1JGSA 3R0AA 3QP5A 1BM9A 3HSFA 1KU7A 2E1CA 3I71A 3E97A 3KZYA 4HW0A 1G3TA 3BJ6A 3DFGA 2VE9A 3CO7C 3RKXA 3IHUA 1Y0UA 4I01A 5KVRA 4O5VA 1RIOH 2H94A 2DPUA 2J5PA 1KQ8A 1IAWA 2K4BA 2QQBA 4G8XA 5DD8A 4XRFA 2OU2A 2DK5A 4EJTA 1RZ4A 4EJUA 2CQKA 4BXUA 3MFKA 3LFKA 2HGCA 3KLNA 1OKRA 5D5VB 1BOAA 1O3QA 2DLLA 5FFXA 5A2QZ 4HX8A 4M9ZA 3LQQA 2W85A 2MLKA 4MHGA 2ZFWA 4XLPF 1JHHA 1I5ZA 3GXOA 2XAJA 2VBXA 2R7DA 1TQMA 3E6DA 2ZNYA 1OYYA 3WTZA 2EK5A 2DU9A 3DP7A 3FMQA 1SMYF 1ONVA 3CUOA 5D5UB 1REPC 1J75A 5LGNA 2NNYA 1HW2A 2V6CA 3HYIA 3JTGA 2CSOA 2UXNA 1HKQA 5HDKA 3KP3A 1LEAA 4EGYA 2QZ8A 3E5QA 4OIOF 1T98A 5HDGA 1C0WA 2DBBA 3H92A 3R6SA 2KIFA 1YO5C 3FHZA 1XMAA 4I02A 1UHMA 4XSXF 5CVRA 4AIHA 2O8XA 2ZBKA 1D3YA 1OR7A 2EV0A 3N97A 2D45A 1S6LA 4HQMA 4I2OA 3T5XA 5E18F 2AS5F 3WTUC 5HLGA 1FOKA 1XSDA 4I0AA 3WODF 5DEQA 5CVIA 3F6VA 2JT1A 3BDDA 3Q9SA 1U5TB 5FO5A 2IW5A 2VOOA 1MJ9A 3CO6C 1MJBA 5DYMA 3V7RA 2CGPA 1G6NA 1TQIA 1KU2A 2ZMEB 5LGUA 4UHTA 1IN4A 6PAXA 3GX4X 4YG2F 4BQAA 4HDUA 2P7CB 1HKTA 2G7UA 1YQAA 5K1YA 1KA8A 2P5VA 3S2WA 1HW1A 3RTRA 3F8CA 2XGXA 3HTSB 3LA3A 1Z7UA 1B59A 5EEHA 2M5WA 1FLIA 1GXPA 4HX7A 2GA2A 4RAZA 1ZG5A 4P9FA 3TDUC 4EJOA 1TLHB 1P92A 1P4XA 1LQ1A 3PQKA 2H27A 1Z6TA 3GFIA 4TV7A 3I54A 4Z2YA 2OA4A 2FNAA 1W5TA 4MQ9F 4BHPA 3OV8A 1S7AA 3C7JA 2VE8A 1IF1A 4HF2A 4UUVA 4ENNA 3EUHA 2ETHA 3RI4A 5E20A 5DCFA 1Z9CA 1IUYA 1FSHA 2QM3A 2UZKA 1TW3A 2FEZA 5D4SA 1YS6A 4EM1A 5KK1A 3BJAA 2MBFA 2Y0MA 3BPXA 5LHHA 2P5LC 3FXRA 5K5OA 2ZCWA 1U8RA 1IXSB 2IP2A 5JR3A 3F22A 1XMKA 2XROA 3WTXC 4RGSA 1XSXA 5D8LB 2XHKA 1YW7A 2GIVA 2HTSA 4KNYA 4BNCA 2WTEA 2XAGA 3M1EA 1W7PA 3O2PE 1UFMA 2BEOA 1T38A 4U88A 4KIFA 4EGZA 3FF5A 3MCZA 1IN5A 3BJOA 3BOQA 4LLGF 4N0BA 1USTA 1FYLA 2HR3A 3IKTA 2BE5F 3EYYA 2P6SA 2Z5UA 1O7LA 2HYFA 1MKMA 1P4AA 1HW5A 1U2WA 3DF8A 4G7HF 1ZREA 2XV4S 3QP6A 4PZJA 2EJRA 1LDJA 1FSEA 4LJZF 2KRFA 4CHUA 1XGNA 2XVCA 2MD5A 1TNTA 4KFCA 3KFWX 2GQQA 1T2KA 4IVNA 1YYVA 2GZWA 3BY6A 4GYIA 2KIUA 3KLOA 1W4MA 3JAMK 2O61A 2CYYA 3JSPA 1ZLJA 1Z1DA 3B02A 1CF7A 3CUQB 4QWQA 3GYHX 2DQRA 4JQFA 3J80Z 2EA2A 5LEJA 2MC3A 4F7ZA 2Z9OA 1MGTA 3RKWA 3COAC 4KA4A 4IRIA 2V9VA 4HF1A 3BP8A 3V7CA 4UXNA 1XDSA 3RKYA 1R00A 2HTJA 2FRHA 4HV6A 3VODA 2Y48A 2NYXA 1J0RA 4HF0A 3FXUA 3GFMA 1AOYA 2OBPA 3ULQB 3TDZC 5CVUA 2ELHA 3WU0A 3LA2A 2HFHA 2EFOA 1JXSA 3HRTA 3JTHA 1ZLKA 4GYGA 4ETSA 3IRQA 3HOTA 4YIFA 4ZYDA 4RB0A 5L3EA 4MQVA 1LB2A 3K9TA 4H0EA 1BIAA 1FPQA 1IZ1A 5A2QK 2VN2A 2M87A 1XSVA 4Y15A 4L0ZB 4AIKA 4DNCA 2M30A 1WSUA 2VBZA 1V4RA 5ICFA 3ZMSA 4G6DA 2VOPA 1XGOA 2FSWA 2CW0F 2HZTA 2NNNA 3P9KA 2FOKA 3TOBA 3KP6A 2RNJA 3IWZA 4NQWA 3E3VA 4A5NA 1OPCA 2QQ9A 5FLXZ 5ILUA 1O3RA 2VT3A 2QLZA 1U5TC 3KP4A 2K4JA 4U7BA 4HOBA 1MDMB 3Q9VA 4BHBA 4ZYGA 4KIBA 5LBQA 5BPDA 3I59B 2AXLA 5F6FA 2A5YB 2QYOA 1ULYA 2P8TA 4EV0A 1WRJA 3WTYC 3E5UA 2PN6A 1QO0D 4KMUX 1KGSA 4RB2C 1WWXA 3RYRA 2LNBA 4RGXA 1ZH5A 1IW7F 2P7VB 1ON1A 3MWMA 2A6HF 4IRHA 4WXCA 1BJAA 2UXXA 1ZAOA 2NAZA 5ICCA 2JZYA 3TQNA 1IRGA 5DCMB 4LLNA 3K69A 5TRDA 5J8CA 2UWMA 4MNUA 2FF4A 2DQLA 4L9VA 4R79A 3DKWA 3T8RA 3F8BA 5L3FA 1RNLA 1QGPA 5LRSA 4ZYEA 2LSOA 4OMZA 1KYWA 4BAYA 4UV9A 2P4WA 3WE3A 4P9UA 3F8NA 2OQGA 1IN8A 3ZQ7A 3NQOA 2WC2A 4OIQF 3K2ZA 3RPUA 5HLHA 3QOPA 3IKVA 3RYPA 2D2WA 3FXQA 1KYZA 4KT5C 1S3JA 1R1TA 3GZ5A 1I1SA 3FM5A 3ERED 3KP7A 4K2EA 4S05A 4E70A 1U5TA 4AWXB 4YFKF 1FYKA 3VEPA 1R5GA 1P6RA 3PFIA 1XN7A 1K78B 2FBKA 1T39A 4ENJA 2Z33A 1HBXG 2L01A 3TO9A 2ESHA 1IN7A 2ZMEA 4KYWA 2HDCA 3U2RA 4MTDA 3FWEA 3RPQA 1SMTA 2DW4A 2Q8KA 1R22A 1E17A 2ADUA 4MTEA 1K7AA 3L7WA 4M6XA 2EFPA 3FMSA 2O3FA 5BS6A 4L5JA 3M7GA 4RB1A 3ZMDA 1I27A 3CUQC 5FD5A 1EH6A 3GW2A 3EYIA 1MZBA 4WXHA 2L4MA 1O3SA 1LNWA 1YLFA 4OU0A 5ILSA 3L9FA 4NB5A 1OMIA 5K5QA 2EFQA 4IJAA 2DPDA 2OZUA 4GGGA 5LRRA 2PJPA 1FYMA 3I5UA 2KKOA 3D5LA 3GWZA 3K1MA 2XAHA 3J80K 2DK8A 2JRTA 5L3GA 3KETA 1LDDA 2M45A 1PP7U 4ENMA 3VB2A 2CFXA 2GA1A 1R1UA 3ZPLA 3HHGA 5HLIA 3QU3A 3ZMVA 2FXAA 4U0VA 1F4KA 3MQ0A 5IT9Z 4EJVA 4LK0F 3FX3A 5FGMA 2OAZA 3F72A 4LB6B 4HV5A 2JPBA 3WTTC 2IA2A 4OIRF 2PMUA 4IRGA 3ZN1A 3K1NA 1WQ2A 2VXZA 1F1ZA 2JPCA 4I98B 3HRMA 1H9TA 1KQ0A 3NRVA 2YX4A 3DXJF 2EFWA 4IF4A 4G7OF 3MEXA 1EH8A 2K86A 2VT2A 5J6XA 4OINF 3GUDA 5DUKA 3K1PA 2F5FA 4M73A 1ZGAA 4A6DA 4P55A 2VC1A 5ICGA 2YSRA 4HQEA 1T0FA 3CUQA 1KU9A 1R7JA 4RS8A 1K6OA 1D5VA 1Q1HA 1L0OC 3KP5A 4WF2A 3VOEA 1P2FA 1I6XA 1IN6A 1XCVA 2EB7A 4AVPA 3QAHA 1U6GA 2TDXA 4ENKA 3SZPA 3MZYA 1J5YA 1BC8C 1O57A 2HOEA 5FLXK 4FT8A 1XDUA 1H9GA 3F23A 1YIOA 1ZRCA 2ZNZA 3KZZA 4ZZDA 2D1HA 4KMFA 2K7LA 1ZG1A 2E7XA 3TOAA 3I58A 4WCGA 3C1DA 3H3UA 2OQRA 2IA0A 4RGUA 2PEXA 1FP1D 3SXYA 5TJJA 4HBLA 1AWCA 1SFUA 1SFEA 4XSZF 1I1GA 1BI3A 2GWRA 2ESNA 2STTA 3T0YA 2L02A 4JK1X 4LG0A 2VONA 1R1VA 5AIQA 4R8HA 2QUFA 2DO7A 4RGRA 4UVBA 3R61A 4A0YA 2PG4A 1OYWA 4EM2A 5ERIA
chains in the Genus database with same CATH superfamily
1B9NA 2HEOA 2ZXWH 3PUVF 4IXAA 3GMEA 1ORKA 3CDLA 4YJ2E 1IBKT 4UVCA 2IGMA 5H20A 5EZGA 1ZOYA 1HDPA 2GAUA 2E5VA 4KUMB 2QWWA 1N36T 4YHHT 1T6SA 4YELA 2DAOA 3ZCIA 3S15J 2ID3A 4FASD 4JBAA 4IREA 2RKHA 5HDNA 1FY7A 4X64T 3P4PA 4C30A 2BG9C 5EEGA 2OV9A 1HSTA 4Z6YA 4HA8A 4YIRX 2DXIA 4FI5A 3C4ZA 4IHXA 2V79A 4I09A 2E2JJ 3V8KA 2G9WA 4U2YA 2XUEA 4H9NC 1GVJA 2K9QA 1S29A 4X62T 3BZ6A 2W7NA 2QBYB 2K5BB 3S3MA 2MG4A 3CLOA 5FNVE 5F3JA 4HGAA 3UFGA 2CM0A 3CTAA 4HZFA 3I53A 1R23A 3WU2C 5LEKA 1YJWI 5FXZA 2RQPA 1GXQA 3FXKA 2ELJA 5IPAA 2IXSA 2MA3A 2BY1A 5JHFA 1A31A 3A8YC 2L54A 2K9AA 4BJNA 1R71A 5JDNA 1TTYA 1IXCA 3WG9A 3IF8B 4I4TE 1FWZA 1LDKB 2QQAA 5DD4A 5EEAA 2ME6A 3OYKA 2O6GE 1OEDE 3VHLA 3M8EA 4AI6A 1QNTA 4O6JA 5F0FA 4EATA 3CCQI 3EUKL 4UVAB 4PGGA 2YUSA 4XBFA 3OYGA 3SFEA 5LCYA 3C4XA 1YW8A 2B63J 2F5CA 2WB1N 3CPZA 4DBRA 5LB7B 5CGMA 1USSA 3N9NA 4KN7X 2BBHA 5F1JA 3JSOA 2CQQA 3UU5A 3LJCA 5D4RA 3RSNA 2E36A 2P5KA 1JT0A 2FBWA 1S7OA 3DV8A 4BS9A 3PV0F 5LHHB 1MH3A 1JE8A 4HLXA 4XKBA 5DUIA 1D8KA 2CUJA 2A07F 2XQ5A 3OYXA 1KNZA 2IRFG 2IGOA 1SFKA 4L9TA 3AE9A 2WV0A 4IZZA 3U21A 5D5WB 2OZ6A 3N9OA 4DBQA 3RC8A 2B7EA 3WI3A 2COMA 2W57A 4A3EJ 3OVUA 3ZSSA 1Y1VJ 4DV3T 2ZJ2A 2R7WA 2XGDA 5CQEA 2P0WA 4N9HA 5K5RA 4Y17A 1U5PA 3R0JA 5LOVE 1PUFB 3CCRI 2G0UA 1M1EB 3BK9A 3DEUA 4A0XA 1NK2P 1FT9A 2R7QA 1J59A 2R7XA 2XAGB 3FB2A 4HFIA 4TV8E 1W7PB 3GO5A 3TBIA 3KDSE 2CRBA 2NVQJ 2QYWA 1TZLA 1RUOA 1AKHA 2BBJA 3ZN0A 1HQCA 2FMYA 2GXGA 4ASKA 3IHRA 1CGPA 3GF2A 1WZ2A 2K9LA 2LKXA 3A02A 4MLOA 2PMHA 4X1IE 2PBIA 1N32T 4FHTA 3WGIA 4BXXJ 1G4DA 4O4LE 3PUZF 4IL6C 3CF5F 4A12A 2C5JA 3S1MJ 4BJ5C 4ZI3D 3WU1B 1TW2A 1LE8B 1US7B 1JT6A 1POGA 1Z05A 1W36C 5L3CA 2MGQA 5FKKA 4QHOA 4IE0A 5D6EA 2EV5A 3ZQIA 4PDKA 2MLGA 3ZMTA 4CGZA 2CPTA 3E6CC 2CMRA 5AIPA 2ECBA 3TGNA 2JSCA 4HDVA 3KPHA 4DJAA 3S1NJ 4BJ6C 4WK8F 1IO2A 3T1YT 4Q4ZF 5HWYA 4AKHA 1W0BA 4CXFA 2WSSV 3UNGC 2DI4A 4QH5A 4UF0B 2OV7A 4MFDA 4C90A 5E0OA 3RQIA 3AE7A 4YSXA 3HJEA 3I9YA 3LSIA 4MO7A 3A0HC 4RMNA 4FX0A 4I43B 1YXRA 5ED4A 1WJEA 4LMJA 1DDNA 1HSJA 1MBKA 4PJJA 3G73A 2A5WA 3BZCA 4KHPT 3O9XA 2WM9A 3HUGA 3JCUC 2XC7A 1GV2A 2BV6A 2CQXA 4A0ZA 2O03A 5D6FA 1YI2I 1IRZA 2Z6EA 1D1CA 4E7IA 2BHYA 2M8EA 1CF7B 4WX9A 2K3WA 1FBQA 2A05A 4B4CA 3IC7A 4CO8A 1J5ET 5FFZA 2KZGA 1QBJA 5GP9A 1GQEA 3CX7B 3WTVC 2L9NA 2R5YB 3JAEA 1X3UA 4UIGA 2X9WA 1XB4A 2LRLA 1DP7P 4U74A 4EM2A 4OMYA 4UB8C 3J7ZI 1FJLA 1KF6A 4IL4A 2BHZA 2ZSHB 2YKSA 4XRMA 3L39A 5F1RA 2H6BA 1UCRA 2YX7A 2ZKZA 1G3WA 1XGSA 4OAZA 3BG6A 2B76A 4EOZB 1WI3A 2ID6A 2EZKA 5BR8T 1XC5A 4FX4A 5L4HA 1QVTA 3DPTA 3I64A 3UU6A 4F6RC 4P1NA 4PGHA 1K78A 1YRNB 1E0EA 2LE8A 2XSAA 1SVLA 2Y48B 1B72A 3M8FA 3CX8B 2DJIA 2LF8A 3LDQB 3VKHA 1MIJA 1JGGA 3HR0A 3AE1A 2VQGA 3DQVC 2DI3A 4U2ZA 2V7MA 3N9PA 2KFDA 1H89C 3GEZA 3LA7A 4U3CA 5CLSA 2L7ZA 4J2CA 3KEQA 1T7SA 4WNKA 2L4AA 1H7CA 3ONQA 3EDPA 1FEXA 2ZO4A 3RI5A 2HVQA 2WAUA 3BR5A 2H89A 3H3ZA 1JNRA 2L9SA 4JX4A 1F5TA 3F31A 4EM0B 1R5ID 1XCBA 3LSKA 2A68F 2LY2A 2VKHA 3HRSA 1V55H 1Y01A 5EK4A 4V2FA 3UT5E 1V3FA 3BTLA 4IDZA 5EZHA 3BG3A 4KISA 2WU5A 4WYVA 3E5XA 1Y0NA 2C6YA 4C3IJ 1YFHA 2JTVA 3AFHA 5L3EB 5IT9K 2CBIA 3RF1A 4DV5T 3G3ZA 2EV6A 4XICA 3QB5A 4LD5A 4IE4A 2PMZA 2HPIA 1PDNC 5JI6A 4HSTA 2E9XD 3JCFA 2H7VC 2XQ3A 4BH9A 1TT5B 3ABTA 2IPQX 3V8JA 5JRCA 3MKWB 3K6GA 2FMLA 1YJNI 3C64A 4TNVA 2HPJA 4IEJA 2ICWG 4DMVA 2VVNA 1E2AA 2M8GX 2XQAA 4G6QA 2ACZA 1LEBA 2DWKA 3ZOBA 3LSRA 3PJAJ 2VBWA 4U7IA 5LHIA 2N8GA 5JR9A 4YTNA 4ZZLA 3HGYA 2VB6A 2E9XB 5E17F 3SZTA 2M67A 2WZIA 5BPIA 4JBWF 2CV0A 1HOMA 2VL8A 3C18A 3OL4A 2B9SA 4B09A 1ETOA 3OYMA 4ZDPA 4ISSA 3ZCJA 2Q2EA 5KAIC 2F5DA 1UJ8A 2R7FA 1IDZA 3RIAA 3HSEA 1FIOA 1VOMA 3L2WA 3BCBA 2XGEA 2W24A 4EJWA 4CYDA 4JI5T 1W0AA 1Q1VA 1VQOI 3LWFA 5JHUA 1XMQT 3BQKA 3DLLF 3QPSA 5LHGB 2MH9A 1F9NA 3QPLA 3SFZA 4HLYA 4N9IA 1ERDA 2ODUA 4L9JA 3LK2B 1BI2A 3ABMH 2QCOA 4IHSA 2CW7A 3N2KE 2R7OA 4EEBA 4X65T 2D5VA 4P0BA 3SHFA 4XM3A 4NQWB 1SFOJ 1K4SA 2WWYA 1BI0A 3HRUA 3CJNA 1WR0A 3SS1A 1UG0A 3DKYA 3KCCA 1ETYA 2X6YA 3V5SA 4KT6A 3VFZA 4Y7NJ 4U87A 4ASNA 3WTWC 1JI8A 2JQ9A 1KEYA 1LJ9A 3IL2A 3NEUA 4LMYA 4YFNF 2MD0A 1TQPA 1ZGJA 4DIQA 4NC7A 4MEXF 3O3KA 5KDMC 2F2EA 1NTCA 1Z0XA 4M6YA 1U4QA 4IHJE 4M71A 4A6EA 2GLOA 4ESJA 1WGXA 3PU8A 3QC9A 5E1ZB 3OR1C 2X0LB 1MNEA 1JKOC 2KINB 5LBQB 3HOWJ 3K0LA 3UTKA 1KU3A 3I9V2 2NVTJ 1S8NA 4GXOA 2F4MB 4CDGA 1YS7A 3MZHA 2FUPA 1RUNA 1UUSA 2X1CA 4HPQA 2QVAA 1OYIA 4LK1F 2RV8A 3DCFA 2G7HA 4TV9E 5EK2A 2JRKA 2V1DA 1TWGJ 4Z91A 2OF7A 3MKDA 3AE4A 2XB0X 5DV5A 4A3JJ 2X0HA 5GONE 2IIUA 1NHAA 3DPLC 5FJ8J 1DU0A 4O3MA 4KICA 3HOVJ 3JC6D 1ODDA 4NHJA 5IOYA 2BY2A 4P96A 5CVJA 2CW8A 5L3DA 3I55I 2OD5A 1E2XA 3W6KB 3KV5A 5AQKB 4S0HB 2B0LA 5EGOB 2YDQA 4JYKA 1W5CC 3ZMZB 1ETXA 5HCJA 4YRVA 3HOSA 3IH4A 5AQTB 1K6YA 2HNHA 2D9DA 1FC3A 1BN5A 2HQNA 3NWTA 5CB4E 2BS4A 2EHOD 3TO6A 3WGHA 3N9LA 3MKYB 2E1NA 1LFUP 3TKYA 3OYIA 1R4NB 1ZRDA 4AYBA 1WRDA 2DWGA 3JREA 1SA0E 4YSZA 5FKLA 3LSTA 3T1BA 1Z6RA 4CCLA 2DOAA 3IWFA 2O5RA 2QENA 1O7FA 2EZIA 4L9NA 2XM2A 2O0YA 2UXXB 5CPRB 4L5EA 4HWFA 2DTRA 1Y8QB 3REOA 4F92B 1OEDB 1GLNA 2SPCA 2V7JA 4E7ZA 4KHZF 5M3MJ 3JRDA 3HSRA 1HXDA 1D8JA 1SUMB 2AE9A 3RYCE 1IRFA 2EHOB 5FKNA 4RLQA 3EDUA 2OUMA 2HKXA 4GFBA 1B8IA 3EAMA 4CI1B 4ZI7E 3L09A 2HYGD 2WADA 3TO7A 4TN7B 5HOOA 2X4HA 2DFIA 3QPHA 2K3FA 4N4NB 5J1RA 4R1HA 2X0YA 1D0ZA 2X6XA 3QPTA 1DPUA 2A72A 2FJBA 3ZT7A 5L3FB 4OX9T 1BI1A 1KNPA 2RGVA 1PP8F 3A0BC 3E7LA 3AVRA 2WBMA 3HHHA 1WJFA 4XLCA 1QHGA 3KE2A 5FKOA 2PX9A 3RPUD 1HDDC 5J2UE 3AEEA 4DV4T 4M74A 4XN3A 1KQ9A 4Q47A 2JVGA 3EUHC 2XZEA 4GDFA 3BPVA 3IRRA 4F8HA 5J8FA 2V6YB 4BAYB 4KDPA 5IT3A 3PJRA 4E7LA 1GT0C 2DN0A 4CYCA 1YOVB 4OK0A 4G94A 3IA3A 4LF4T 4ON0A 4LFUA 3A2KA 2CLYB 1ZHFA 2DHRA 1HC8A 1LRZA 1JTYA 4PCQA 3AAAB 3CZ6A 4BYYA 4UELA 4P0AA 4XLNF 2CHNA 3HEFA 5HEHA 2DDBA 2M9HA 4A3KJ 1FX7A 4AUXA 4AIDA 1XTAA 3IBPA 3H3VK 3C3WA 3L2CA 2G0EA 3G06A 3ETVA 4EMSA 3P4RA 2XF6A 2NS8A 1ZYRF 5LLQA 5FXWA 3M8JA 3G6EI 4V19K 3HTUA 4BKXA 1EH7A 4GOUA 1LFPA 4PW8A 1T56A 1R58A 5HVQC 2LY1A 2NVYJ 3AL0B 2ACJA 3IEEA 3L8RA 5L2LA 3SQNA 5CA1E 3ZP5A 5H6RA 1UX4A 4CZZA 3HKZA 4YFXF 3FISA 1HNZT 4YIIA 2MBGA 1ZTRA 4MGRA 1JKQC 2RC4A 2QVOA 1U78A 2A61A 2GXBA 1SD6A 4A5MA 3FZKB 5FL0A 4A98A 3RDIA 1MIYA 1IBLT 2VC0A 1ZARA 1MBEA 1QPMA 5CJ9A 4I0UA 9ANTA 3B13A 1A35A 3I4NJ 2LKPA 3FDYA 4X1YE 4LIVA 1ZELA 3T8TA 2VQLA 3H0DA 5E8GA 2XQ7A 2TRTA 2Q0OA 4PJMA 5F0CA 5K7HA 5D8KB 3GLXA 4E6KG 1SAXA 2HXOA 5LG3A 4JI4T 1SFXA 5FD6A 4BGDA 2GM4A 1WKMA 2KPMA 2HS5A 3O8GA 3QWLA 1H8AC 3BROA 3BCAA 3PTRB 2JVHA 2M6IA 2JMHA 2JPFA 4CN6A 3AEGA 2XKPA 3QU6A 1UHWA 1Z7LA 4Q5SF 2CU7A 2PJRA 2W84A 3FZLB 2YR2A 1DUXC 4AXPA 5FB2A 1WHUA 2DOEA 1VTNC 2E2HJ 3DU5A 1OQYA 2EFNA 2LC2A 2XAQA 5D5XB 2K9NA 1RETA 2DMUA 1XDPA 3WGGA 3NRXA 1M62A 5CKTA 2UUZA 4ZI3C 2UXBT 1PJRA 2BGCA 4TWHA 3U9GA 1FP2A 2K27A 1SD7A 2LHNA 4EYYR 4L18B 1Z0PA 2RP4A 4YY3T 5EF6A 4JYAT 1BA5A 1MNDA 1G3SA 1LVAA 2MH2A 1YQ3A 4B3XA 4J00A 3S4UA 2VXDA 2LJLA 5HS9A 4AD9A 2W63A 3P9CA 4M3FA 1W5SA 2EZLA 2Y75A 1XGMA 4A5XA 3DBRB 5L3BA 1RPWA 5B66C 3QRFF 2WZHA 3P4SA 1XNRT 5CYVA 2H1LA 4HTEA 4L9IA 3ASOH 4YTPA 2IVMA 4KUMA 2CCQA 4EQQA 5E8IA 1ZQ3P 3C51A 2LSKA 1Y64B 1W9RA 3E6BA 4AM3A 2NW7A 5ADXL 1K61A 1H0MA 2CXDA 1VF9A 2VQHA 2NP9A 4EAHA 2KIMA 4ZXLA 4BA9A 1QZYA 1FEWA 2HXIA 1SC7A 1MMDA 2H3RA 5TISC 3ZGKA 5BQTA 3PSFA 3A01B 1Z77A 3EUAA 4IHWA 1R5HA 1IXRC 1B4AA 2VJ5A 2DT5A 3ELKA 3ZC0A 3DTEA 3V7SA 2QBYA 1BIBA 2X51A 1STZA 3ML6A 3W6JB 4A3MJ 1K79A 2VQFT 5BMZA 3ZYLA 1OCCH 4MLKA 3TLWA 3F9KA 4ZS2A 3A03A 2WAQN 2YDSA 3RCOA 3H35A 2LOSA 3RKQA 4ZDLA 2VJJA 4LGWA 2XDVA 2XHEB 5C3EJ 3FZMB 2ZM8A 3ZJ1A 5JDHA 2ZXJA 4P5OA 3GTMJ 4RLFA 4LIUA 1RI7A 1TBXA 3K4BA 3RJPA 1FMVA 4PNIA 2WA0A 2CG4A 2FE3A 1P7JA 2XRNA 2IGKA 4OIPF 1YW0A 5JDMA 4UVAA 4JI2T 2W00A 2KLOA 5CFBA 5AONA 3N9MA 5FVLA 3BR6A 5ILVA 3SWHA 4ERRA 2DLRA 3PM1A 2FU4A 2C0SA 4ILUA 3ETUA 1J2XA 3QODA 1VQ9I 2M0MA 4HX4A 1Z91A 3L2RA 4ZZCA 1L3LA 2A6EF 2IW5B 3IH3A 1JHFA 3EQLF 1SHZC 4H9PC 3HIFA 4IKFA 1YG2A 2V5DA 3K4KA 2M1BA 1FNNA 1YW9A 4L5IA 4M3DA 4BQOA 4S04A 2XAHB 3KBUA 4MEYF 4DR6T 5IOZA 1QLBA 2CO5A 3AE5A 2BXYA 5AQQB 4ESBA 4WWCA 5L3GB 1MW7A 2JUGA 5LBMA 3ONJA 4U0WA 2KLQA 3J7AY 2BYVE 4IPAA 4Z90A 5GAHJ 2DJNA 5HAXA 3ASNH 1VFCA 1XZYA 4NUBA 3OYDA 4LLLA 2R92J 3WTSC 1T8BA 2L9VA 2A6TA 4KIGA 1BW6A 4D7NA 2JQKA 4HYEA 3OOPA 2PI0A 2YOEA 3UUBA 5LGUB 1T72A 1W1WE 5C4XJ 1PUFA 2E1MB 3CF2A 3OIOA 5ETWA 3L2UA 2STWA 4PJ0C 3G1MA 4QLCU 2X9XA 2JJ7A 2GIZA 3OPCA 5KMGP 1W0TA 4ZH4F 3CVRA 4AQYT 4PJNA 5FY0A 2VODA 4D0PA 3A1YA 1KK7A 3GFLA 2KJBA 3VWBA 2R93J 1VCSA 2CWYA 2PFVA 4M9SA 3ROUA 5M5YJ 5HXEA 5HS8A 2FJAA 4UR9A 2W66A 2VLAA 2QGUA 4I55E 4AKLA 1QZEA 2ME0A 4EVIA 1ETKA 4Y13A 2E9XC 1G3YA 1KONA 2A3SA 3LOCA 3S1QJ 2HZDA 4I7HA 3F21A 1TC3C 3LAJA 3HL6A 2LLYA 4H9RC 3WAKA 2D1VA 5E1WA 3I4MJ 3FMRA 1XS9A 1E3HA 1MBFA 1E3OC 2XAFA 1APLC 2F5EA 4CN1A 3AA1B 2E7WA 3BZKA 4WBNE 1A04A 2ZM2A 4B3TT 4UUSA 5J3LA 3J81K 3ECHA 3NBXX 2FBIA 2RDPA 3QB5K 1V5EA 4U7DA 4U33A 5TGTA 3AA6B 3R60A 2V1XA 4XONA 4DQ2A 2V7FA 3W2WA 2NS0A 5HS7A 2QF7A 5EG0A 4AIJA 2OA5A 4UF0A 4XN0A 2Z99A 3LQRA 4UV8A 5ICEA 3LAPA 2DA5A 5KXJA 4ESFA 1P4WA 4BEHB 4IHTA 1U3EM 2ISZA 4U0YA 4TWDA 5HXCA 2LHRA 2HDWA 3B73A 2XSJC 1XPXA 4E4HA 4BJMA 3I0TA 2BXZA 1BC7C 3M9AA 2F5VA 1ON2A 2XPVA 3BC8A 2BW3B 1FBSA 4IHVA 2WWVA 2K48A 2L3DA 1ZP0A 3M3YJ 5JVTA 4LF5T 2CWEA 1XNQT 2LH9A 4OOIA 2EIKH 3S32A 4B8XA 3CCVI 2EWNA 3C4WA 1NK3P 3FXDB 3N4MA 1FBUA 4DR2T 2V9KA 3MXZA 1MDMA 2BKOA 1SVOA 1OFCX 3X2QH 1LVFA 2XUBA 1S35A 4BHCA 2C5KT 4UUTA 2CA5A 4AKGA 2R3SA 3KEYA 1O3TA 3ABVA 3GFJA 2AHQA 2HQRA 2R5YA 5HCMA 5KHDA 2M7AA 3PUAA 2E71A 2H09A 3I59A 4LB5A 2QRXA 3GWHA 2W2UA 2X66A 2LSGA 2OCCH 2VKOA 5C3JA 2DA7A 2KJCA 1SD4A 4E7HA 5E1XA 3HL2A 3LNQA 1Z3XA 3U3IA 1TWAJ 1Y8RB 2XB5A 4IGUA 4F52A 1O4XA 1ZKGA 2XKOA 3F2EA 3P7NA 5FKMA 5DDGA 1E3PA 4MIMA 4Q48A 3LFMA 1B1BA 2FQ4A 2NVUB 4BBRJ 2I0MA 4DMWA 1FIPA 1I6ZA 1YRNA 1G59A 1W7PD 3I56I 3IP4B 5JFRA 1YJ9I 2CV1A 2YU1A 2Q9QD 1A6QA 4QIWN 1YTYA 1TWHJ 3SFDA 3RKOA 1TNSA 3L00A 2WMOA 4ABZA 3J7AO 3RH3A 3HGGA 5LA6E 3KBTA 3ABUA 3MKLA 3VDXA 5JLWA 4HG2A 1NG7A 3LSHA 4A2UA 5DTDA 4LITA 2RVCA 3K10A 3OKQA 1BR2A 2DA1A 2NRAC 1HKSA 3SEQA 1U8BA 3RIUA 1YKHB 3JC6C 4CCMA 3V4GA 3HOUJ 2LLKA 1IBMT 1N78A 4ZYHA 4IDNA 4BDZA 2FA5A 3S16J 1ZN2A 3RHWA 3RRWA 3P9IA 4HFBA 4HN9A 2Z3YA 3RIRA 2Q9QB 2HU9A 5IP9J 1X1AA 3CDHA 2L3LA 2BOLA 1OEDC 5CQGA 2ZJQF 1PVEA 4YSYA 1WVRA 2WQYA 2VBYA 4CICA 4IHYA 3A4CA 2FBHA 3N5LA 4QXHB 4ZTJA 2W25A 3AAFA 3GVAA 2CV2A 3FZVA 2IJLA 3MZ8A 4GO1A 2JK3A 5DCMA 1ZR4A 2EHOC 3RGLA 4EEDA 3J7YJ 2E60A 3O6BB 2NOXA 3SYTA 4CN4A 1MD0A 3OYAA 4LF9T 2XASA 4LFBT 3PJAA 3H37A 3F6OA 4U31A 4XOPA 1ZKEA 5AQIB 4O4JE 4WXDA 2KWHA 2JQQA 5JDFA 4HWCA 2K40A 2HQAA 2RN7A 2JA2A 3ZMUA 5GPCA 2L7FP 5FMNA 1VQNI 2FNPA 2LK2A 5H6QA 1D0XA 3SDGA 2IT0A 2LRDA 2E5NA 4HNVA 1K83J 1WJCA 5CVVA 2BZBA 4HSRA 4JI0T 1BBYA 3E0JB 3I4PA 4XK4A 1ZG3A 3EETA 2HDDA 3G4SI 3GCMA 4LG0B 1UURA 3Q5FA 4ITVA 3MKZA 2Y9YA 4GCVA 1HF8A 1ZRFA 3FM3A 3LK42 3ISPA 1MSEC 3CCEI 2LF7A 1IC8A 2CQ7A 1T95A 2XGCA 4FETA 4WBOA 5LJMA 2V1UA 2IA1A 3BR0A 4XIDA 5LMNT 2CLYC 2Y6XA 2ISYA 5F64A 1G73A 2IAIA 2NVXJ 4DV0T 5GTHC 5LD2C 2FD5A 2PLYA 5EDNA 2HWVA 1JJ8C 5LHGA 1YE9A 2BBYA 2CUZA 2MPKA 4CUGA 2F4IA 2BG9A 2OTLI 3PFYA 2LD5A 2JUCA 3F8MA 1J9IA 2EA4A 4DOZA 3AA7B 1NWMX 2J5OA 3AG1H 3A5XA 3D0SA 2PG8A 2W48A 2HKOA 2ACXA 3PUQA 4HAMA 1IGNA 4OHFA 1XD7A 5HNFA 3VU7H 3BWGA 1R36A 1J7KA 2HN2A 3VYSB 3H1CA 1D5YA 4NPPA 1RKTA 4G9YA 1BR1A 1PUEE 4M3GA 3GZ6A 2MTQA 1EV7A 3A7MA 3RQUA 2YPRA 3KYCB 4KN4X 4XRSA 3CMEI 4UXNB 3TL4X 2DODA 3CJQB 3BG5A 5DQWA 4CCJA 1FOXA 3DEEA 2VKVA 2KSRA 1UB9A 2PQ8A 3R4KA 1J1JA 1I94T 3VYRB 2X0LA 3TP0A 2MOZA 3ECOA 4EB6E 2A69F 3KV6A 2ZM6T 1MMNA 1N77A 1FZPB 2BDEA 4XBFB 3BG7A 2H6CA 3V8LA 3KEOA 1LKXA 2BZTA 2GXAA 2YU2A 3NKZA 2CBJA 2XIGA 1EKEA 3CP8A 1DGRM 4G12A 4RB3C 5HLTA 4PFOA 2RAEA 2VJ4A 3G1OA 3UU4A 3U1DA 2IS2A 1IDYA 4CI2B 5KNLA 3ANWB 1V5GA 4XRSG 4P1WA 1BOBA 2PFBA 3QNUA 3C2HA 4L0RA 4AVZA 5LGTA 4BQNA 2V6EA 3AECA 3HB9A 2LT3A 1DQUA 3PQJA 3ZQCA 5EGOA 2L0KA 1LVKA 4BE1A 2QSHX 3ZMZA 4MHCA 3J81Z 1SD5A 3H0GJ 4XNFA 1QQIA 4I99C 1J5WA 5F27A 4HWDA 3M1CA 5JREA 4E7SA 2KQRA 1MNMC 4HRIA 1GHCA 1YKEB 5JVDE 5EJCA 2GOMA 5H2FC 3KP2A 2XSBA 2PMZN 1D0YA 1Z3YA 4RAYA 4EV6A 5EK3A 1DPRA 3JW4A 2QEXI 3R6NA 3WE2A 5GADJ 4DYCA 1WI9A 2K02A 3F3XA 3K70D 4G7ZF 2K3PA 2RQQA 3S8PA 4AC0A 5BOXA 3K4LA 4M9XA 1ZEEA 1N75A 3F8FA 3BR2A 4U72A 1HX1B 2GOXB 5J40A 3AE8A 3CDIA 2KMFA 4XLFA 1B9MA 1B6AA 4JEHB 5CJ5A 3ZRGA 4I0BA 2XQ6A 3ZN0B 2XJ7A 3CJRB 3ZEFB 2DMQA 1OISA 1AA7A 2P6TA 3E6MA 4M72A 1PYVA 3H9GA 2LBFB 3OYCA 1AU7A 3DTOA 2KWIB 5DQVA 1WYCA 5HEUA 3JAMZ 4DW6A 2BS2A 1R8IA 2EHOA 4IDPA 5JDGA 2OCEA 2FQ3A 2YU3A 1R9TJ 3CIRA 2KZVA 2XTLA 4LMKA 5GAGJ 2KHMA 2W0GA 1MJAA 3RLFF 1QZZA 4BBSJ 3V42A 3ZMTB 3KINB 1WH7A 1JUPA 3ZMSB 4BQQA 4UNOA 3P4WA 2WY7Q 4L0YB 2MFZA 2LDUA 1X1CA 4BU2A 1OR7C 5JDLA 3MAJA 5FLMJ 3MN2A 1JGSA 1I3AA 3R0AA 3QP5A 2GK9A 3K8PC 2MW8A 1BM9A 2MAWA 3HSFA 4ISTA 1FOWA 3UUNA 3AXJA 4DUYT 2Y69H 3PIOF 1KU7A 1M7KA 2E1CA 3I71A 4QXCB 3TLTA 4A3IJ 2BY3A 2EINH 3E97A 3KZYA 4HW0A 3Q0WA 1G3TA 3BJ6A 2WP9A 2R7ZJ 3JRBA 4YTMA 3DFGA 3W2VA 1GV5A 2VE9A 5ABHA 3CO7C 3HKDE 3GZNB 3RKXA 3IHUA 1Y0UA 3HUGB 4DGWB 4I01A 2XSDC 2ZLYA 4IQJA 2EQRA 2IGNA 5KVRA 1RESA 3OS2A 4O5VA 4C3JJ 2WCAA 1RIOH 4V1Av 2L8KA 2H94A 2BKPA 3OR2C 3RZDJ 2DPUA 2J5PA 2FJEA 1N33T 1KQ8A 2LREA 1IAWA 1BR0A 1SANA 1OCTC 2K4BA 1Y56A 2QKMB 1WJBA 2KT0A 4H63V 1WYBA 2QQBA 3BLYA 5FXVA 4JI6T 4G8XA 3TW7A 1QVUA 1S5LC 3FXEB 4QX7B 5DD8A 2DMNA 3I3LA 2J4GA 1YHQI 3RKGA 3EABA 3CC2I 2ZM0A 3M3ZB 2OU2A 2K85A 1X3WB 4XRFA 2HVRA 3FXMA 2DK5A 4EJTA 3CJTB 1RZ4A 1X19A 4EJUA 3GN5A 2E1MC 4C2TA 1V5FA 2CQKA 4BXUA 2K24A 3MFKA 3Q0UA 1V9DA 2WY8Q 2HI3A 3LFKA 3PUFA 4IL9A 1S7EA 5F04A 5AQSB 4Z8XA 2HGCA 3KLNA 1OKRA 5D5VB 3HOXJ 2VIXA 1BOAA 1O3QA 2DLLA 2GBYA 5FFXA 5A2QZ 4HX8A 4M9ZA 1Y39A 1DU6A 2QGSA 4DV6T 3LQQA 2W85A 3CMMA 3JRIA 4IQ4A 2KZ7B 2MLKA 4JV5T 1X1BA 5LJNA 5L4EA 4MHGA 3N05A 1Z8UA 4A3CJ 4JEUB 2ZFWA 4XLPF 2EPFA 3ZQHA 1JHHA 3CCUI 1I5ZA 3GXOA 3PU3A 2ECCA 2XAJA 2UXCT 2VBXA 4TNWA 4AYBN 4XLHA 2IS6A 2QQ8A 5IY5H 2R7DA 1TQMA 3E6DA 5AQUB 2ZNYA 1OYYA 3SRZA 4D5FA 4UY8I 3ONXA 2E8IA 1R4MB 3WTZA 1XDOA 2EK5A 4C3HJ 2KRCA 1JJ6C 1VQ4I 5FXXA 1CUNA 1MH4A 2DU9A 1HCRA 3D1NI 3GTLJ 3JAFA 3DP7A 1R6RA 3O1JA 4LF6T 2F6CA 3FMQA 4HWIB 2R5ZB 1SMYF 1FOYA 3PNYA 5J4YA 3OYZA 1ONVA 2ZMAA 2WV1A 4MFEA 4LMLA 2IUBA 3CUOA 5D5UB 1REPC 2WDRA 3H5NA 5LGNA 1J75A 2NNYA 2UU9T 5IHYA 1HW2A 2V6CA 3HYIA 2X9DA 5ABEA 5JRCB 3JTGA 2CSOA 2L5QA 2BS3A 2YEVC 4ZZBA 4LFAT 2UXNA 3HZJA 1HKQA 1VQLI 4II2A 1ZGWA 5HDKA 3KP3A 1LEAA 2MABA 4EGYA 1GDTA 1MIWA 3CCSI 3BG9A 3H9JA 1NG6A 2QZ8A 3E5QA 1ITYA 4OIOF 1T98A 2I8DA 3NWSA 3QYBA 5HDGA 5IP7J 1C0WA 3HPHA 1AJ3A 5JR9B 2CUEA 2MYSA 2DBBA 3H92A 3AVSA 4DIDB 4II3A 3CLQA 2KIFA 3FXLA 3R6SA 1YO5C 3OTOT 3FHZA 1XMAA 4I02A 1R49A 1UHMA 2I5UA 1YQ4A 2WDVA 4XSXF 5CVRA 4UV9B 4AIHA 3Q3SA 5M5WJ 4M1PA 2O8XA 2ZBKA 1KFYA 1D3YA 1OR7A 2EV0A 5KAFC 2HOAA 3N97A 1CQTA 5AQGB 2D45A 2IDOB 4B3ST 1S6LA 3CP2A 4FE4A 4HQMA 3ZT5A 4PFPA 4I2OA 3FZHB 1SAUA 1Y6IA 4QPOA 3T5XA 2WDQA 1YX5A 2M34A 3FK7A 5E18F 3CQGB 3K4NA 3BR3A 3OOUA 3E22E 1MSFC 4PUSA 2AS5F 3WTUC 4H63H 3FBIB 5HLGA 4BY1J 1FOKA 1T33A 4I0AA 1XSDA 3HOZJ 3KYDB 1Z67A 3WODF 5LYJE 2KIQA 4RAGA 2LSJA 3DBHB 5AQLB 5DEQA 3EPZA 2CHOA 2DA3A 2E35A 5CVIA 3ZC1A 5K7ZA 2ZXHA 3JR9A 3F6VA 2I10A 1SE7A 2JT1A 3BDDA 4EZHA 3UQ4A 3Q9SA 1U5TB 5FO5A 5EZYE 2IW5A 3OYHA 2VOOA 3HKZN 1E7PA 1MJ9A 1X58A 3CO6C 4ZI2D 2MC4A 1MJBA 5DYMA 3V7RA 3UUXB 3LSVA 1IUFA 2Y9ZA 3DTKA 2DDAA 4M3EA 5JH7E 3KV9A 2F4VT 3OL3A 2CGPA 4X6AJ 2Q9QC 4H9OC 3BTJA 3QYEA 1G6NA 3V5UA 1TQIA 5FROA 4QX8B 1B7TA 4GRIA 3BT9A 1BJZA 2V6XA 4DR4T 1KU2A 2ZMEB 4XLAA 2CS3A 5LGUA 1QPIA 4CA0A 3N2OA 4M3BA 2D0TA 4A69C 4KX6A 2E5LT 4UHTA 1IN4A 6PAXA 3GX4X 2O9LA 4YG2F 4BQAA 3BR1A 4HDUA 3DLAA 2L2OA 2CUFA 1S72I 2P7CB 1HKTA 4GIWA 2AO9A 1WCMJ 2G7UA 2R7VA 3WAJA 1OCPA 1MMGA 4CZCA 1YQAA 3G71I 5K1YA 3SDBA 1GVDA 2OJED 4PAGA 1KA8A 1VQ6I 2P5VA 2ZXIA 3S2WA 3E0ZA 4FTHA 2KDZA 1HG5A 1HW1A 4ZS3A 3NWIA 3ZT6A 3RTRA 4DV2T 3F8CA 3FIWA 2V1NA 3B57A 3QOFA 2E34A 4ILAA 1IAPA 5AQVB 1OCOH 3PUSA 2L7KA 1X2NA 2WB5A 2XGXA 1V54H 5LXTE 4F55A 3HTSB 3QK6A 2J1DG 3HKCE 4IDOA 3LA3A 1Z7UA 1B59A 5EEHA 2M5WA 2KT9A 4A3BJ 4RBOA 4LF8T 1FLIA 2QA4I 3ABLH 4CCNA 1GXPA 3K3NA 4HX7A 2XY8B 2GA2A 4AKIA 4RAZA 1ZG5A 5F8PA 1XWMA 4P9FA 3TDUC 4EJOA 1TLHB 1P92A 4QSHA 1P4XA 1LQ1A 4BEHA 2IS4A 2ZJRF 3PQKA 1AHDP 2D0UA 5F08A 1A36A 4DV7T 2H27A 1Z6TA 4XKVA 3GFIA 3MACA 4MBQA 4A56A 4TV7A 3I54A 4Z2YA 4JLEA 4C91A 2OA4A 2FNAA 3OS0A 1W5TA 3AE3A 2JQHA 5AQPB 4AQFC 2BW3A 2MSYA 4JI1T 1WJDA 3IAS2 2H1KA 1DU2A 4MQ9F 2CMPA 4BHPA 3W3CA 2OLTA 3OV8A 2X1EA 1S7AA 3C7JA 2VE8A 2IBDA 2NXNB 2W67A 1IF1A 2LG4A 4HF2A 2I59A 5FP3A 2N9DA 3P5JA 2WU2A 3B6AA 4UUVA 2LSIA 2VQCA 4ENNA 4RAFA 3EUHA 1UGOA 2ETHA 2VVSA 3FZFB 4O2BE 1JKPC 3RI4A 5E20A 5DCFA 1Z9CA 2V7IA 3T8OA 3VKGA 1HFAA 2IS1A 1IUYA 2VWAA 3BQLA 4G2AA 3O4XE 4A3GJ 4H9QC 3J9X1 1FSHA 1WJ5A 1XX5A 3RX6A 2QM3A 2UZKA 3U78A 3L3PA 1TW3A 2FEZA 4PK5A 3TW6A 2KMUA 1L0VA 1FIAA 5D4SA 1YS6A 2N1GA 3Q0VA 3JRCA 4KJZA 4EM1A 1SEUA 3ZKRA 5KK1A 3L1PA 3AEBA 5FYMA 1ZV4X 4XKCA 4A3FJ 4IIJE 4ZOLE 3BJAA 2MBFA 2Y0MA 3BPXA 2Y0SA 5LHHA 5C4JJ 3W2AA 2HPMA 2DCFA 1T8IA 2YN6A 2L7MP 4XMYA 1ACIA 3MJXA 2UUAT 4QPQA 2Y2ZA 2ES0A 2P5LC 3FXRA 5K5OA 2RA1A 2ZCWA 4HNTA 1U8RA 3H3AA 1IXSB 2IP2A 1YITI 5JR3A 4FJOA 3F22A 1XMKA 2XROA 3BTIA 3ZPOA 4E7JA 3ZMVB 3WTXC 4RGSA 4ZDOA 4TZ4C 1X3ZB 1XSXA 2M4KA 2XHKA 1YW7A 3BTCA 5D8LB 4BUPA 5C44J 5H6RB 2HPLA 4CZZB 5JDQA 3BQZA 2GIVA 1GUUA 2HTSA 2CFOA 4KNYA 2M3AA 5HODA 3FBLA 4BNCA 3PUGA 3J7Yq 2WTEA 3OSFA 2XAGA 2LMDA 3M1EA 1HA8A 2WMNA 1W7PA 1Y1WJ 3O2PE 3H5RA 1UFMA 2BEOA 1T38A 4U88A 3IH2A 4KIFA 4EGZA 2Q9QA 4DNDA 3FF5A 3MCZA 1IN5A 2LKGA 2XRLA 3BJOA 3BOQA 4LLGF 3OIPA 4N0BA 4V2GA 1USTA 4E7KA 3Q2MA 5ABFB 3ZN1B 5JQGE 2BG9E 1FYLA 1UCUA 4B3RT 2NW8A 2LY9A 2HR3A 1LE8A 2DT7B 3IKTA 1HR0T 2BE5F 4ZYAA 3PURA 3EYYA 2P6SA 1FTZA 4O4IE 1S9HA 2Z5UA 3K70C 1O7LA 2HYFA 4FQGA 2W62A 3AE2A 1MKMA 1P4AA 1HW5A 1RR8C 5LP6E 3UUMA 3K7AJ 1U2WA 3DF8A 2ELKA 1WFXA 3GLLA 4G7HF 1ZREA 2XV4S 4GK5E 3QP6A 4PZJA 4IDQA 2EJRA 3VRBA 1LDJA 1FSEA 4HFHA 4LJZF 3ZQQA 3BQYA 2KRFA 1EJ9A 2W4SA 4CHUA 1WCRA 1XGNA 2LKSA 2XVCA 2H8WA 3W15B 2MD5A 1TNTA 4KFCA 1VRBA 2PTFA 3KFWX 4PSWA 4HFEA 2GQQA 4BL0B 2WAFA 1T2KA 4OYJA 3VYUB 2V9PA 2VASA 4IVNA 1YYVA 1UK5A 3VSLA 2GZWA 2XPUA 3VSKA 2W82A 3RYIE 3LSPA 3BY6A 2BY0A 4GYIA 1QA6A 2V26A 3H36A 4AIUA 3G1LA 4PK4A 5B5EC 2KIUA 3KLOA 1W4MA 4LOCA 4D7MA 3VRAA 4MFRA 2BVMA 2XF5A 4OFZA 5L3BB 4AQGA 5M5XJ 3VYTB 3H3MA 4AISA 1TL8A 3JAMK 2O61A 2CYYA 4F93B 3C50A 2ZSIB 3JSPA 1UELB 1ZLJA 2JWTA 1Z1DA 2EH3A 3B02A 3ZSTA 1CF7A 4HKAA 3B5MA 2XF7A 4K0UA 5HWXA 2NS7A 2RPAA 3CUQB 4QWQA 3GYHX 2DQRA 4JQFA 3J80Z 3NZPA 2NOGA 2EA2A 2W1OA 5F0HA 5LEJA 2VUMJ 4AQFA 2MC3A 2JA5J 4HFCA 3WG7H 1YX3A 4F7ZA 3QUJA 1WLXA 2Z9OA 1O3XA 3RYHE 1MGTA 3PUBA 3RKWA 4XQFA 1MMAA 3OYJA 3COAC 2AXTC 4KA4A 4IRIA 4DYRA 2V9VA 4HF1A 1OXZA 2XQ9A 4FISA 2AQEA 3JADA 3Q5EA 3TLVA 3UKGA 4B3MT 2DTZA 1QRYA 3BP8A 5E79C 1EA3A 4KITB 3V7CA 3ESLA 4UXNA 3CC7I 4K0KT 1XDSA 5B1BH 3RKYA 3UU3A 1I39A 1R00A 3OYFA 2HTJA 4BACA 5FL1A 2FRHA 3NZQA 3LBXB 1JUMA 4HV6A 3LSMA 2EILH 2Y48A 2NYXA 4NC8A 3TP3A 3VODA 5A1LA 1J0RA 4HNUA 4HF0A 1TT0A 1H88C 3FXUA 2E19A 3FXOA 4BE2A 2X68A 2YS9A 3GFMA 3MA9A 3BQIA 1TWCJ 5KX5E 1AOYA 1QHHD 2OBPA 3ULQB 5FRMA 4M6VA 2CH0A 1UAAA 4GKJT 4XZCA 2WB1A 3TDZC 5CVUA 3N9QA 3I1AA 2ELHA 4JX6A 2UUBT 2KNDA 3O1HA 3WU0A 1I50J 3LA2A 2HFHA 2EFOA 4I6ZA 2V7LA 5FY1A 1JXSA 3ANWA 3HRTA 3JTHA 1ZLKA 2R4GA 2P81A 4GYGA 2LFBA 4ETSA 2YINA 3IRQA 3QOEA 3GBGA 4YIFA 3HOTA 4ZYDA 3Q5XA 4GYRA 4RB0A 4CH7A 5L3EA 3ZLIA 4B3AA 4MQVA 2V8SV 2CXLA 3O8HA 1LB2A 4NC6A 3K9TA 4IE6A 4IT4A 4P09A 5HEOA 2DA6A 4H0EA 1E1HB 2COBA 1BIAA 1JTXA 2DCEA 1UX5A 3PNVA 4WZXA 2FUG2 3TLUA 1FPQA 1VNDA 1LFBA 1IZ1A 2TCTA 2VKDA 5A2QK 3P50A 2VN2A 2WY2A 5IYZE 1XG1A 5CA0E 5DM6F 1OLTA 2M87A 1XSVA 3G2BA 2V7KA 2X1DA 3MVPA 3PSIA 4A3LJ 5IYCJ 2LBFA 4Y15A 1HNXT 4I76A 5HEGA 3I0QA 4L0ZB 5M4YA 4AIKA 4DNCA 3JRFA 4EYUA 5JR9C 3ZXSA 4D9JA 2E9XA 2IHR1 2M30A 1WSUA 1YIJI 4BE0A 3M4OJ 4YHJA 1VI0A 3I0OA 2VBZA 2E2IJ 1V4RA 4UVBB 5ICFA 5AFUL 3LSGA 3ZMSA 3CKDA 4G6DA 2VOPA 2XAFB 4YLHA 5EYRA 1XGOA 1LUJB 4UUSB 3OSGA 1IJ6A 4UVCB 2FSWA 2CW0F 2HZTA 1ETVA 2IEKA 2NNNA 4RM3A 2D5UA 1NAFA 1UG2A 3DKXA 3C2GA 4X66T 5EG0B 2A2FX 3P9KA 1HF0A 3NAUA 3U1KA 3Q9DA 4UV8B 2FOKA 3RIFA 3GTGJ 1WPKA 3CMLA 3TOBA 3GTKJ 2ZFUA 2IC6A 1MBGA 3PNTA 3KP6A 2RNJA 3IWZA 2W61A 4NQWA 3E3VA 4QKNA 4HFVA 3CCJI 3PL8A 4A5NA 2HVSA 2VPLA 2LYCA 2X85A 1OCZH 1OPCA 3PO2J 2QQ9A 3AL0C 5FLXZ 5ILUA 1O3RA 2VT3A 2QLZA 1CHUA 2R7TA 1U5TC 3KP4A 1RRJA 3OS1A 2M6BA 3DJBA 5J1YA 3IV5A 3CD6I 4IE5A 1G8XA 2K4JA 2LP0A 1VZ0A 1VCTA 2RNGA 3E08A 4U7BA 4HOBA 1MDMB 3S2HJ 1DP3A 4IO9F 3HPGA 5IYDJ 1OCRH 3OJAA 4COFA 2VKEA 4ZTFA 3Q9VA 4HEAA 4BHBA 4ZYGA 2DA4A 4IOCF 4KIBA 4YXDA 1WJAA 3S93A 5LBQA 3VPRA 3GTJJ 4FCYA 5BPDA 2J62A 2RREA 2DNXA 3AAEB 4OYKA 3I59B 4RDUA 2AXLA 5F6FA 5HXHA 2IMLA 1JNZA 4DR1T 4C2MJ 2ZMEC 1IV6A 3P8CD 5AQOB 3M65A 4AU7A 4B44A 2A5YB 2D2SA 2QYOA 2ODVA 2Y8DA 2KDOA 5IWAT 2ZJPF 4IE7A 1ULYA 2P8TA 4ZI2C 3FKIJ 4EV0A 3VR9A 1WRJA 4RA2A 3ZQGA 3WTYC 3E5UA 2OPTA 5JTGA 5FLVA 4LF7T 1F36A 4EIWA 3D5RC 2XQYA 5ABGA 2PN6A 1RKWA 5C2TA 1QO0D 3UR3C 2DA2A 4YJ3E 2H88A 4JI7T 4KMUX 4OAYA 5HEJA 1KGSA 4RB2C 1WWXA 1TWFJ 3QYFA 2LNBA 3RYRA 4J01A 3O1IA 4RGXA 2HOTA 4EGWA 3MMYB 3S17J 3ZQLA 1ZH5A 4Y52J 1HS7A 1IW7F 2P7VB 2XQ8A 3HDDA 1ON1A 3MWMA 2A6HF 4IRHA 4WXCA 5GAEJ 2CE7A 5AQRB 4DUZT 1T08B 1BJAA 1JKRC 3F0CA 2H8RA 4LFCT 1FMWA 3UFEA 2UXXA 3OMYA 3HA4A 2V4JC 4DVDA 1ZAOA 1VQMI 5IYBJ 1AKHB 1OEDA 2NAZA 3ESWB 5ICCA 1BL0A 4A97A 2JZYA 5LMUT 2R5ZA 3GMIA 4X1KE 4KP3C 3S1RJ 1OJLA 3TQNA 1VQPI 1IG7A 1OWAA 1X9BA 4I50E 1IRGA 5DCMB 4LLNA 4MALA 2HN1A 2R7UA 2JA7J 2X6OA 5L3CB 3K69A 5TRDA 2XASB 5J8CA 2UWMA 1MBJA 4MNUA 1LPQA 2FF4A 2X48A 5GTIC 2DQLA 4L9VA 4R79A 1TP4A 2WS3A 5J2TE 3CCYA 3DKWA 2EIMH 3ZMUB 3T8RA 3F8BA 5L3FA 1RNLA 5DABA 1QGPA 3RQWA 5LRSA 4NDLA 3IUOA 5BNGA 4ZYEA 5H6QB 4BXFA 2ZC2A 1MMSA 4L5GA 5BMVE 4XAXB 2LSOA 4W1UA 4OMZA 2VURA 3KVAA 4D5CA 3RZOJ 1VQ8I 4NXNT 4CCKA 3CX6B 4X1EA 2JA8J 3SFIA 2JMWA 2V5CA 3K4JA 1KYWA 2V6YA 2R7RA 4BAYA 4NIQA 4UV9A 3LL7A 2WBLA 3MD2A 2P4WA 1P9QC 2X6WA 3S3NA 2LR8A 4NBQA 3WE3A 3CCLI 3SJMA 4P9UA 4U7YA 3F8NA 2OQGA 1IN8A 3ZQ7A 3TEDA 3HXLA 3WHCA 1VQ7I 3QQAA 4BY7J 3AG2H 2M2EA 3NQOA 2WC2A 4JX5A 4OIQF 2YK0A 3K2ZA 3RPUA 2JRMA 3NVOA 3K3OA 4NUVA 5HLHA 5L47A 3QOPA 3CQCB 3HOYJ 3IKVA 2M7BA 2D2WA 3FXQA 3RYPA 2BG9B 1KYZA 4KT5C 2QSFX 2L9QA 2UXDT 5DJQC 4X0GA 1S3JA 2Z1DA 1R1TA 2FX0A 2F48A 1DGWY 5HXRA 3GZ5A 1I1SA 3FM5A 3ERED 4Y3OA 1F43A 2L9RA 3KP7A 4CQIA 3LFUA 4O4HE 1HCIA 4K2EA 4IOAF 5FY7A 5AQJB 3GTOJ 2W4XA 3HKEE 4S05A 4E70A 1W09A 4PSXA 1U5TA 4NNJA 3SEZA 1P7IA 1VQKI 4AWXB 4YFKF 1FYKA 3TMOA 3VEPA 3M07A 1R5GA 4UEMA 1P6RA 3PFIA 3Q5DA 2QKLB 4DR5T 1XN7A 2UUCT 1K78B 2FBKA 1T39A 5J0ZA 2LOOA 4ENJA 1B72B 2Z33A 3CC4I 5AQMB 3KX2A 1HBXG 1BR4A 2L01A 3HC7A 3TO9A 4IX7A 3AB3B 1W0UA 2ESHA 1IN7A 4B47A 2ZMEA 4EEFG 1Z21A 3TLSA 1IJWC 3K1SA 4KYWA 2XM1A 5LNKA 1HTJF 2HDCA 2QA7A 3FBNB 3U2RA 3ZJ2A 2QSGX 4MTDA 5IUXA 3AG3H 4QXBB 3ONLC 2LSYA 1YD8G 3FWEA 3RPQA 3JRAA 1NEKA 5LGTB 1SMTA 3P7IA 2DW4A 3H9QA 2Q8KA 3C98B 3MZKB 1R22A 1E17A 2E2AA 4TWFA 4QTRA 3DPUA 2IAKA 4GK0E 3D0TA 4N78D 2ADUA 2E1OA 5AQHB 4MTEA 1J09A 3PUWF 1IRXA 3WHBA 1K7AA 4N4OB 2EIJH 2Z16A 1W36D 5LG4A 3SZGA 3P4QA 2DYSH 3DEWA 3K4MA 3L7WA 3CWZB 4Y33A 1NENA 2UV1A 3S3OA 4M6XA 2EFPA 1NH3A 3FMSA 2O3FA 5J1UA 4B1RA 2JMKA 5BS6A 4OWRB 4L5JA 3M7GA 1WH5A 3W6VA 1HNWT 1KZHA 1HG2A 1G2HA 4DV1T 4RB1A 3DTIA 3ZMDA 1U9OA 5LHIB 3JRHA 2H7OA 2KXPB 1T0FC 1I27A 3N2GE 3CUQC 5FD5A 1EH6A 4BDYA 2A3DA 2WWUA 3EDVA 4ZC3A 2EZHA 4ZJZA 2X67A 3A01A 2KISA 4YT0A 3GW2A 2Y30A 3DU6A 3EYIA 4PJLA 3FBZA 2Q2EB 4G63A 4GKKT 2DYRH 3ZR8X 1IJ5A 1MZBA 1BW5A 5AQNB 1UHSA 4EZ4A 2DMPA 4WXHA 5E3OA 2CEAA 4ILBA 2L4MA 4C9YA 3AEDA 3ZCOA 3X1DA 3FXJA 3AXJB 1O3SA 3OY9A 2FJ1A 2YDRA 4DO0A 2K9SA 2R7SA 1KNRA 2LM9A 4CXYA 3HM5A 3EVYA 1LNWA 5FRNA 4CI3B 1WR6A 2CWOA 1YLFA 4OU0A 2DMTA 5ILSA 3PIPF 3L9FA 4NB5A 1A5JA 1OMIA 2DFEA 4QWNB 1QU3A 2CJJA 5FVKA 5K5QA 2HH7A 2EFQA 4KI0F 4IJAA 2DPDA 3ABKH 2OZUA 4GGGA 5LRRA 2KRHA 3RRCA 4F3QA 3LSJA 2PJPA 1FYMA 3CMAI 1HX8A 2IC9A 3HI2A 3I5UA 2FOWA 3S14J 2KKOA 3L2VA 1EF4A 4YFSA 3D5LA 3CESA 4ZHQE 3GWZA 3K1MA 1U0JA 4QH4A 3PO3J 2XAHA 1IV8A 1D1AA 4DZPA 3J80K 2DK8A 2BKNA 2JRTA 5L3GA 3KETA 4C2UA 3K2AA 1N34T 3HKBE 1LDDA 2M45A 1PP7U 2LEHA 3AEAA 3PE0A 3UQ7A 4ENMA 3K3QC 3K4CA 3VB2A 2LVSA 5B3SH 2CFXA 2GA1A 1K4TA 2O8KA 3Q5WA 1R1UA 2WAEA 1JUSA 2C5IT 3TKLB 3ZPLA 3HHGA 5HLIA 4KMCA 2F4OB 5J4VA 3B6CA 3KZIC 2NTYA 2R0QC 3QU3A 3ZMVA 4B43A 2FXAA 4U0VA 1F4KA 3GA8A 3MQ0A 2V1DB 5IT9Z 1ZR2A 4EJVA 1ETQA 4LK0F 3FX3A 2DOFA 2CQNA 5FGMA 2KL4A 3GN5B 2OAZA 3F72A 2NWBA 1ETWA 3KYLA 4LB6B 2CRGA 3OYBA 2JJ9A 2Z2SB 2M4GA 3LG7A 4HV5A 2JPBA 5L3DB 3IAM2 4X20E 3WTTC 4HFDA 1RR7A 2IA2A 4RM2A 2CXFA 4OIRF 2R6GF 2DFHA 4YEJA 1VQ5I 2PMUA 5ABFA 4IRGA 3ZN1A 2I6HA 3KVBA 3FKJA 1ENHA 3K1NA 5LFAA 4X5TA 1WQ2A 3DBLB 4JI8T 2XQ4A 2VXZA 2AQFA 2XAJB 1F1ZA 2VJIA 3S2DJ 2JPCA 5TAOA 4I98B 2JA6J 3T1HT 3HRMA 1H9TA 1KQ0A 3NRVA 3AAIA 2YX4A 3AKZA 3UU8A 1EZ3A 3DXJF 2Y31A 4XL9A 2EFWA 4IF4A 3ZYKA 4DZJA 4JP0A 4G7OF 2DFFA 4XKWA 3MEXA 1N25A 1EH8A 2B1EA 2K86A 4TX5A 2LRKA 2VT2A 4J19A 5FKYA 3VR8A 4XOTA 4JUYA 2A9UA 2Q1ZB 3KV4A 3RYFE 5J6XA 3AE6A 4JI3T 4XORA 2JSPA 3HG9A 5K7FA 2HOSA 2LTPA 1X4PA 4OINF 3GUDA 3JRGA 3AEFA 1B8IB 5E3MA 4XLEA 5DUKA 5LGNB 3K1PA 5DS9A 2F5FA 3KIOA 4AKRB 4M73A 4XR6A 4NXMT 1ZGAA 2VI6A 1UMQA 4A6DA 2UXNB 1FTTA 2X9HA 3R84B 5GPAA 3ZYMA 4P55A 3PDYA 2OC6A 1A6IA 5JLXA 4CCOA 3OYNA 4ADZA 2AXDS 2HHHT 2VC1A 2LKHA 5ICGA 3CQZJ 3HBLA 1HLVA 3NRYA 4H9SE 5AQFB 2YSRA 4NUUA 4HQEA 1QSDA 1ZK8A 1D1BA 1T0FA 2O7OA 5E3LA 4JOMA 3CUQA 1KU9A 3DWLE 2XPWA 1R7JA 4FE7A 3OWTA 2NR4A 4RS8A 4F91B 1K6OA 1D5VA 3OIQA 2N2NA 1WFDA 1Q1HA 2EBIA 1L0OC 1QUUA 2NOJB 3UULA 3KP5A 5DM7F 4G6TB 4WF2A 3PUYF 3D5SC 4CYCB 5J1GA 3VOEA 1P2FA 2YU9J 2FJDA 2P9BA 1S94A 2HQ5A 2VK9A 5HNHA 1I6XA 4QH1A 1IN6A 2WAQA 1XCVA 2EB7A 4H4KC 4W97A 4AVPA 1I6HJ 1X1DA 3ZQFA 1MBHA 3L2QA 1SVMA 2K9MA 3QAHA 1U6GA 2TDXA 4ENKA 1X1PA 3LBXA 3FHNA 3SZPA 3MZYA 2BVLA 2OTJI 2JQ7A 2Y0SN 1J5YA 3H5AA 1BC8C 3EI0A 1O57A 1XMOT 2HOEA 2M0CA 3GTQJ 4FT8A 5FLXK 1XDUA 1H9GA 3CQXC 4HE8A 4D1QA 3F23A 2XAUA 2JIWA 4ILCA 1YIOA 1UZCA 1ZRCA 4CXXA 4O2AE 2VPRA 2ZNZA 4ANJA 1RC9A 3KZZA 4ZZDA 3NARA 3LMMA 3AG4H 5IP6A 2D1HA 5M3FJ 4PK6A 4KMFA 5F5WA 3RIUC 3RQ4A 2K7LA 2ZB9A 5KCMA 1X4OA 4GYSA 3FK6A 3RC3A 2J47A 1ZG1A 4DR3T 2E7XA 4BJTA 5C8YE 3EHZA 4A93J 4DYQA 3ERMA 3TOAA 3CCMI 3MK7C 4WW0A 2VQET 3I58A 4WCGA 2KP6A 3OYEA 3SOLA 1ZHCA 3C1DA 3H3UA 4Y4RA 5J47A 2OQRA 2K5CA 4KBMB 2IA0A 2E5ZA 4RGUA 2LM2A 2PEXA 3F57A 5HXSA 5HYAA 2NW9A 1FP1D 4DR7T 5B1AH 1X79A 5E3NA 4B6XA 2VKJA 3SXYA 3CK6A 4ZEYA 2XPKA 3CMYA 4UB6C 1U9NA 5TJJA 4HBLA 2JN6A 1AWCA 4HEA2 3PUXF 1SFUA 3GTPJ 4EXTA 2VL0A 2LOPA 4CXWA 3OBVE 1XMXA 1SFEA 2PJRB 1FJGT 3AA0B 1X2MA 4XSZF 2NTXA 2PJQA 4TUYE 1I1GA 4A3DJ 4CSWA 1BI3A 2GWRA 1IZNB 2XAQB 2ESNA 2STTA 1I3QJ 5JVGF 3T0YA 2DL1A 4Q25A 3C2BA 2L02A 4JK1X 2HYJA 4LG0A 2VONA 3OYLA 4O8SA 1R1VA 3E1SA 5AIQA 4R8HA 2QUFA 2X9YA 2DO7A 1MIVA 4HWHA 3I9WA 3LK3B 4RGRA 4UVBA 3R61A 4A0YA 2PG4A 1OYWA 4LG3A 2DT6A 4B48A 5ERIA
chains in the Genus database with same CATH topology
1B9NA 2HEOA 4IXAA 4YJ2E 4UVCA 5H20A 2GAUA 4KUMB 2QWWA 1T6SA 3ZCIA 2DAOA 4JBAA 2RKHA 5HDNA 1FY7A 5EEGA 1HSTA 4HA8A 4FI5A 3C4ZA 2V79A 4I09A 3V8KA 2G9WA 2XUEA 4H9NC 1GVJA 1S29A 3BZ6A 2QBYB 2K5BB 3CLOA 5FNVE 5F3JA 4HGAA 2CM0A 3CTAA 4HZFA 3I53A 1R23A 5LEKA 5FXZA 2RQPA 1GXQA 2MA3A 2L54A 2K9AA 4BJNA 5JDNA 1TTYA 1IXCA 3WG9A 3IF8B 4I4TE 1FWZA 1LDKB 2QQAA 5DD4A 4AI6A 2O6GE 3VHLA 3M8EA 1QNTA 4O6JA 4UVAB 4PGGA 4XBFA 5LCYA 3C4XA 1YW8A 2F5CA 3CPZA 4DBRA 1USSA 3N9NA 4KN7X 3JSOA 3LJCA 5D4RA 2P5KA 1S7OA 3DV8A 5LHHB 1JE8A 4HLXA 5DUIA 1D8KA 2A07F 3OYXA 1KNZA 2IRFG 4L9TA 2WV0A 5D5WB 2OZ6A 3N9OA 4DBQA 3RC8A 3WI3A 2COMA 2W57A 2ZJ2A 5K5RA 4N9HA 1U5PA 5LOVE 4Y17A 3R0JA 2G0UA 3BK9A 3DEUA 4A0XA 1FT9A 1J59A 3FB2A 2XAGB 4TV8E 1W7PB 3GO5A 3KDSE 1RUOA 3ZN0A 1HQCA 2FMYA 2GXGA 4ASKA 3IHRA 1CGPA 3GF2A 4X1IE 2PMHA 2PBIA 4FHTA 3WGIA 1G4DA 4O4LE 4ZI3D 4A12A 2C5JA 3WU1B 1TW2A 1US7B 4QHOA 1Z05A 5L3CA 4IE0A 5D6EA 2EV5A 4CGZA 4PDKA 2MLGA 3ZMTA 3E6CC 2CMRA 5AIPA 3TGNA 2JSCA 4HDVA 4WK8F 4Q4ZF 5HWYA 4AKHA 4CXFA 2WSSV 2DI4A 4UF0B 4C90A 5E0OA 3I9YA 4FX0A 4I43B 5ED4A 1DDNA 1HSJA 4PJJA 3G73A 3O9XA 2WM9A 3HUGA 2BV6A 4A0ZA 2O03A 5D6FA 2Z6EA 1D1CA 2M8EA 1CF7B 4WX9A 1FBQA 3IC7A 4CO8A 5FFZA 3CX7B 1QBJA 3WTVC 1X3UA 4UIGA 2X9WA 1XB4A 1DP7P 4U74A 4OMYA 5F1RA 2H6BA 1UCRA 2YX7A 2ZKZA 1G3WA 1XGSA 4EOZB 4FX4A 4F6RC 3DPTA 3I64A 4PGHA 1K78A 2LE8A 2Y48B 3M8FA 3CX8B 2LF8A 3VKHA 3HR0A 3DQVC 2DI3A 2V7MA 3N9PA 3GEZA 3LA7A 5CLSA 4J2CA 3KEQA 4WNKA 2L4AA 1H7CA 3EDPA 2ZO4A 2WAUA 3H3ZA 1F5TA 3F31A 4EM0B 1XCBA 2A68F 2VKHA 5EK4A 3HRSA 3UT5E 1V3FA 4IDZA 3E5XA 2C6YA 1YFHA 2JTVA 5L3EB 5IT9K 3G3ZA 2EV6A 4LD5A 4IE4A 1PDNC 5JI6A 2E9XD 2H7VC 4BH9A 3ABTA 2IPQX 3V8JA 5JRCA 2FMLA 3C64A 2HPJA 4DMVA 4G6QA 1LEBA 2DWKA 2VBWA 5LHIA 5JR9A 4ZZLA 2VB6A 2E9XB 5E17F 3SZTA 2M67A 5BPIA 2VL8A 3C18A 4B09A 4ISSA 3ZCJA 2Q2EA 2F5DA 2R7FA 3HSEA 1FIOA 1VOMA 4EJWA 2W24A 4CYDA 3LWFA 5JHUA 3BQKA 5LHGB 2MH9A 1F9NA 3SFZA 4HLYA 4N9IA 2ODUA 4L9JA 3LK2B 1BI2A 4IHSA 3N2KE 4P0BA 3SHFA 2WWYA 1BI0A 3HRUA 3CJNA 3SS1A 3KCCA 3V5SA 3VFZA 4ASNA 3WTWC 1LJ9A 3IL2A 3NEUA 4LMYA 4YFNF 1TQPA 1ZGJA 4MEXF 3O3KA 5KDMC 2F2EA 4M6YA 1U4QA 4IHJE 4M71A 4A6EA 4ESJA 3PU8A 3QC9A 5E1ZB 2X0LB 1MNEA 2KINB 5LBQB 3UTKA 3K0LA 1KU3A 1S8NA 4GXOA 4CDGA 1YS7A 3MZHA 1RUNA 1OYIA 4LK1F 2RV8A 2G7HA 5EK2A 4TV9E 2JRKA 2V1DA 3MKDA 5DV5A 5GONE 1NHAA 3DPLC 4O3MA 3JC6D 4KICA 1ODDA 4NHJA 4P96A 5CVJA 5L3DA 2OD5A 1E2XA 3W6KB 3KV5A 2B0LA 3ZMZB 3HOSA 1FC3A 1BN5A 2HQNA 5CB4E 2EHOD 3TO6A 3WGHA 3N9LA 2E1NA 3TKYA 1ZRDA 1WRDA 2DWGA 1SA0E 3T1BA 3LSTA 1Z6RA 3IWFA 2QENA 1O7FA 4L9NA 2O0YA 2UXXB 2DTRA 3REOA 2SPCA 2V7JA 4E7ZA 3HSRA 1HXDA 1D8JA 3RYCE 1IRFA 2EHOB 3EDUA 2HKXA 4CI1B 4ZI7E 3L09A 2HYGD 3TO7A 4TN7B 5HOOA 2X4HA 2DFIA 3QPHA 4R1HA 3QPTA 1DPUA 1D0ZA 2A72A 5L3FB 1BI1A 2RGVA 1PP8F 3AVRA 3HHHA 3KE2A 5J2UE 4M74A 1KQ9A 4Q47A 3BPVA 3IRRA 5J8FA 4BAYB 4KDPA 5IT3A 4OK0A 4G94A 4ON0A 4LFUA 2CLYB 2DHRA 1ZHFA 1LRZA 4P0AA 3AAAB 4PCQA 4UELA 4BYYA 4XLNF 1FX7A 3IBPA 3C3WA 3L2CA 3ETVA 4EMSA 1ZYRF 5LLQA 5FXWA 3HTUA 1EH7A 4GOUA 4PW8A 1R58A 5HVQC 3IEEA 2ACJA 5L2LA 3SQNA 5CA1E 3ZP5A 5H6RA 1UX4A 4CZZA 4YFXF 4YIIA 2MBGA 4MGRA 2RC4A 2QVOA 1U78A 2A61A 2GXBA 1SD6A 4A5MA 3RDIA 1MIYA 2VC0A 1ZARA 1QPMA 5CJ9A 3B13A 2LKPA 4X1YE 3T8TA 5E8GA 2Q0OA 4PJMA 5D8KB 3GLXA 1SAXA 1SFXA 5FD6A 1WKMA 2HS5A 3BROA 3PTRB 2JMHA 2JPFA 2XKPA 3QU6A 1UHWA 4Q5SF 4AXPA 2W84A 2YR2A 1DUXC 5FB2A 1VTNC 2EFNA 2XAQA 5D5XB 3WGGA 3NRXA 4ZI3C 2BGCA 3U9GA 1FP2A 2K27A 1SD7A 2LHNA 4EYYR 4L18B 1Z0PA 2RP4A 1MNDA 1G3SA 1LVAA 2MH2A 3S4UA 2LJLA 5HS9A 4AD9A 2W63A 3P9CA 1W5SA 2Y75A 1XGMA 5L3BA 3QRFF 5CYVA 4HTEA 4L9IA 2IVMA 4KUMA 2CCQA 4EQQA 5E8IA 3C51A 2LSKA 1Y64B 3E6BA 2NW7A 5ADXL 1H0MA 2CXDA 2NP9A 4EAHA 2KIMA 4BA9A 1QZYA 1FEWA 1MMDA 2H3RA 5BQTA 1R5HA 1IXRC 1B4AA 3ELKA 2DT5A 3ZC0A 3V7SA 2QBYA 1BIBA 2X51A 1STZA 3ML6A 3W6JB 1K79A 5BMZA 3ZYLA 4MLKA 4ZS2A 2LOSA 4LGWA 2XHEB 2ZM8A 3ZJ1A 5JDHA 2ZXJA 4P5OA 1RI7A 1TBXA 3RJPA 1FMVA 4PNIA 2CG4A 2FE3A 2XRNA 4OIPF 1YW0A 5JDMA 4UVAA 2W00A 5AONA 3N9MA 3SWHA 5ILVA 4ERRA 2DLRA 2FU4A 2C0SA 4ILUA 3ETUA 1J2XA 4HX4A 1Z91A 1L3LA