3LDQB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3ldqB00
1T7SA 5AQHB 5AQQB 2D9DA 5AQMB 3FZFB 1M7KA 5AQRB 5AQGB 3A8YC 1HX1B 5AQKB 4HWCA 3FZHB 4HWFA 5AQFB 1UK5A 5AQNB 5AQSB 5AQJB 4HWDA 1M62A 1I6ZA 3FZMB 4HWIB 1UGOA 5AQLB 5AQOB 3LDQB 5AQTB 5AQIB 3FZLB 5AQUB 4HWHA 3M3ZB 5AQVB 5AQPB 3FZKB
chains in the Genus database with same CATH superfamily
2V5CA 3CX7B 2E9XA 5FL0A 3EUHA 4IDOA 2WU2A 3N9MA 4P0AA 3RLFF 3FZFB 3ZKRA 2BKOA 5LJMA 4JLEA 1W0BA 3O1JA 2LHRA 4C91A 2CHNA 3VRBA 2Q9QC 4CXYA 1XWMA 4X1YE 3ZJ2A 2KWHA 1KEYA 4KP3C 4DBRA 4B6XA 3GN5B 2BBJA 3JC6C 3OYZA 3DTOA 1Y01A 2N9DA 3AEFA 4HWCA 3UU4A 5CA1E 4DV5T 4KBMB 4TN7B 5LOVE 2KINB 4CN6A 4A5XA 5CB4E 4LF4T 2NP9A 4YT0A 2LRKA 3B5MA 1UGOA 3UU5A 2WDRA 4AQGA 2XY8B 4X1IE 3UT5E 4O4LE 4F8HA 3UUXB 2CM0A 4PJJA 4ILAA 4DR7T 2K24A 2W0GA 2M6IA 3LK3B 4EOZB 1J5ET 2A3DA 2Q9QA 3P50A 1ZOYA 5HEGA 4YFSA 2A9UA 3ZN1B 3F31A 1W9RA 1UX4A 2UXDT 1NEKA 4LF6T 1M7KA 5DQWA 2X66A 4IGUA 2BS2A 1MIVA 3OVUA 1HX1B 4QKNA 2L3LA 4H9QC 3QC9A 1OEDB 3AAAB 4GK0E 2V6YA 2BKNA 2YDRA 2LM9A 3LK42 4JI3T 2FUPA 4HE8A 5AQNB 5JVDE 3JADA 3ONXA 4XZCA 2C5KT 5HWXA 2VL8A 5C2TA 4LMKA 3BQLA 3QOFA 2WWVA 4DR3T 2IAKA 5HXSA 3RYHE 4TV9E 2LJLA 3JAEA 4YTPA 2H88A 4H9SE 3FZLB 2VQFT 1HR0T 2DWGA 5AQUB 4YHHT 2V7KA 3O1HA 4YTMA 2CMRA 2XQ7A 2YEVC 3CVRA 2V5DA 1I94T 1CUNA 2NWBA 3IEEA 1T7SA 3IF8B 4QH1A 4UF0B 3RIFA 1E7PA 4WW0A 4LMLA 2BG9B 5IUXA 4NPPA 4I0UA 5L3CB 1HNWT 1ZKEA 4IL9A 3ESLA 3N9NA 4U72A 4UEMA 3ZPOA 3A5XA 5FVLA 3WAJA 2H7OA 4X65T 2UUAT 4MFRA 4HKAA 1HCIA 3P4RA 4H9NC 1T72A 1HX8A 3AXJB 2NTXA 4WBOA 4WNKA 3TLSA 1WFDA 2CBJA 3ABVA 3QB5A 4JEHB 4PAGA 4DV7T 2DWKA 4HWDA 3RX6A 3PV0F 3SFDA 2X67A 4PJLA 5F3JA 3AA1B 2L9QA 3QUJA 2E9XC 5AQLB 2QRXA 3C4WA 1NAFA 1MIYA 4A97A 2LSKA 2WWUA 4IE7A 1IZNB 3NVOA 5BR8T 4JI6T 4PK5A 5GONE 4IL4A 5LA6E 2X51A 4DR2T 3ZYLA 2ZM0A 4QX8B 4ERRA 4E7ZA 3I1AA 1WYBA 1HNXT 3TLVA 5AFUL 4JYAT 3RI5A 5J2TE 2D9DA 1FIOA 3C64A 2Z6EA 4Z8XA 3RYCE 1G73A 3ZT7A 2XSAA 1FMWA 3UUBA 3W15B 4AIUA 4YXDA 4DR4T 4HFDA 3BQKA 5HCJA 3F2EA 2LSYA 2UXBT 4U7IA 1BR1A 1HG2A 2JMKA 3GMIA 3ONJA 4HWFA 4X66T 3LBXB 3FXEB 3MA9A 3SS1A 3KDSE 3ETVA 4X5TA 2IDOB 1UUSA 2QGSA 2WZIA 2VWAA 2XAFB 1OWAA 1SE7A 2CWYA 4O4HE 2V6YB 3E0ZA 5AQIB 3L8RA 4AKGA 2E8IA 2OV9A 5EK4A 5LCYA 1FMVA 4CQIA 5J1GA 2RA1A 3LG7A 4NXMT 3ZC1A 2ES0A 1WR6A 2JPFA 3UU3A 4CI1B 5HXCA 5FKYA 3EDUA 3PTRB 3OBVE 2KT9A 2WDQA 2X9WA 3AE1A 3PU3A 3DJBA 2DI4A 1S35A 3MKDA 3P4PA 5AQMB 5FNVE 3B13A 2XTLA 2JQQA 3EVYA 4IREA 5JR9A 3KV6A 5L4EA 3PUWF 4KUMB 4MALA 3LBXA 3N2KE 2BDEA 2WAUA 3MK7C 3PURA 4X64T 4JV5T 2V7JA 3AECA 4WZXA 5FVKA 3B57A 4XAXB 2IUBA 1R8IA 2LRLA 4LMJA 4ZXLA 4ZI7E 1X9BA 4GYRA 5L3BB 4B3ST 2WQYA 3O4XE 1VCSA 3VKHA 1MMAA 2FJDA 1YQ3A 4KI0F 2W63A 3P7IA 3HI2A 1J5WA 2ZLYA 4EYYR 4HN9A 4JI0T 3G06A 4ZS3A 3PUGA 4ASKA 3M3ZB 1S94A 2CCQA 1D0ZA 1YKEB 2YN6A 4OYKA 5LJNA 4PK6A 2WMNA 4P0BA 2YK0A 4E7SA 4EEDA 4GYSA 5JRCA 5AQHB 5A1LA 2UU9T 1YQ4A 2K5BB 1MMGA 3FBZA 4ADZA 3D0TA 4DV0T 2LKHA 2J4GA 4YJ2E 3J9X1 2JQKA 4P1NA 5ABHA 1MNEA 3ONLC 3FHNA 2YINA 3NZPA 3O1IA 5M4YA 1DU2A 2LT3A 4I55E 2X9YA 4I43B 5AQKB 5FYMA 3UUMA 4BA9A 5JDNA 4ZI2D 1QUUA 2YDSA 1UX5A 4PJNA 5LG3A 2V7IA 1QLBA 3PUQA 4ZOLE 5ABFB 4DUYT 3FZMB 2BBHA 2RPAA 3MJXA 4DUZT 4OFZA 4UVAB 3MXZA 4HFCA 1VCTA 4U7YA 4PJMA 5JR9B 3AEDA 2A2FX 4LF7T 4TWHA 3PDYA 3AEBA 2XM2A 2M67A 3AVRA 1XDOA 3TKLB 4ZI3D 1IBLT 2EHOD 2XZEA 2BS3A 1GQEA 2XQ6A 5FXWA 1T98A 4AKIA 2IMLA 5IWAT 2VL0A 5L2LA 2YOEA 5LP6E 5DJQC 3FBLA 1OEDC 3KVAA 3RC8A 5AQRB 1ZEEA 3N2OA 4GKJT 1KNRA 4EXTA 4DV2T 3RKGA 2PBIA 2JMHA 2WS3A 2OLTA 2V26A 2XPKA 3LFMA 4WYVA 4Z90A 3H3AA 3ZYKA 5LMNT 4K0KT 2WMOA 2XQ8A 4H63V 4YSYA 3I9WA 4TX5A 5LBMA 2NW9A 3P4SA 2H89A 3ZSSA 2FBWA 2FJAA 2XHEB 3CQCB 2YDQA 1XNQT 2VKOA 4B3RT 3ETUA 1HF8A 2D0TA 3C50A 3TLUA 2V1DB 3ZCJA 4CZZB 5LHIB 2C0SA 4QXCB 4ZI2C 2J62A 4L5GA 5H6QB 2XASB 1N34T 4ILCA 4DBQA 2XQ5A 3VHLA 2QA7A 2XQYA 3UTKA 4O4IE 5J2UE 2LOSA 5L3EB 3OTOT 2H7VC 3ZC0A 4U33A 5HEUA 5ABEA 2Y48B 3Q5XA 1XZYA 2NTYA 4PW8A 3UQ4A 2QYWA 4DMWA 2GK9A 3WI3A 3CQGB 3VR8A 3RPUA 2JRKA 2LSGA 4OYJA 4HGAA 2IW5B 3V5UA 4PFOA 4EGWA 1VRBA 2E9XB 5FY7A 2WCAA 1HFAA 3KBUA 3NKZA 3OYXA 2LKGA 3UULA 2XQ4A 2EHOC 2P9BA 5F8PA 2KLQA 3RIUC 4JI5T 3Q5DA 4KX6A 4QHOA 2D0UA 5HXRA 5LYJE 4WBNE 1ZV4X 2BVLA 3PUXF 3AE6A 4YJ3E 2VKHA 4BAYB 2YU1A 4JI8T 1I6ZA 4CN4A 2WU5A 4O2BE 3GN5A 4GK5E 3X1DA 2WY2A 4ISSA 1MMNA 1XDPA 2WB5A 4AQFA 4TWDA 4X62T 3AE8A 5FMNA 5BMVE 1QSDA 3PJAA 1WYCA 2CRBA 4HWHA 3RYFE 1XNRT 1JNZA 1ZHCA 2R6GF 5AQPB 2V8SV 4AI6A 3FZKB 3Q5WA 3UQ7A 3P4QA 2H3RA 1BR2A 3NBXX 2LEHA 2N2NA 4KHZF 2MPKA 4IE5A 5AQQB 4YLHA 3O9XA 2UXNB 3NRXA 2JJ9A 2ZM2A 4HFIA 5EK3A 3N2GE 2HN2A 3ZCIA 3ZT6A 2CE7A 3N9PA 4PFPA 2CXDA 1V9DA 4U74A 5DABA 4AKRB 1W09A 3UFGA 3IA3A 1UCUA 3FZHB 3IBPA 4HFEA 4O8SA 5AQFB 3QB5K 4QH5A 4DR6T 2N1GA 2E9XD 2X9XA 3F57A 2XSBA 4COFA 1OEDA 3EI0A 3RGLA 5JTGA 2X0HA 3VR9A 5EK2A 3MACA 4KHPT 4I4TE 2KMFA 3AA7B 5LBQB 1N32T 2W4XA 2LOPA 2VKJA 4KMCA 5E0OA 1YKHB 2J1DG 2K3WA 5JH7E 1XMQT 3AE2A 2Q9QD 2RP4A 3ZMSB 5CGMA 5JDMA 2ACXA 1FJGT 2HH7A 4QH4A 3DP7A 2MYSA 4ISTA 2W66A 2VQET 2XQAA 3EABA 4X20E 4ZEYA 2WSSV 1VOMA 2NR4A 3N5LA 3SWHA 3ZLIA 3C98B 5LB7B 4U2YA 2E5LT 1OXZA 2BG9C 5HYAA 5ABFA 2LM2A 3FXDB 1D0YA 4UF0A 5FXVA 4UVBB 3C51A 3HR0A 3MZKB 3RRCA 3BQIA 2BG9A 4AKLA 1BR4A 3CKDA 3ZT5A 4AQFC 3VKGA 4QXHB 1WR0A 2SPCA 3HL6A 3PUVF 3ANWA 1N33T 1ZP0A 1D1BA 2CEAA 4ILBA 5CJ5A 3K8PC 3GA8A 3RC3A 5AQOB 2Y8DA 2HPLA 5KMGP 2UUCT 3AEEA 2DCFA 4LFCT 2JQHA 3N9OA 3QNUA 4X1KE 3K3OA 3N9QA 2W61A 4PNIA 1KFYA 2NW7A 1W0AA 3CIRA 3GWHA 3LSVA 3WAKA 2F4VT 4HFHA 4TV8E 1LKXA 1HTJF 3NWIA 4NXNT 3CX8B 5FY0A 3TLWA 1IBMT 4A56A 1O3XA 2QVAA 3Q5EA 4V1Av 5JQGE 4CI3B 4B3MT 2PJQA 3CQXC 3SFEA 4ANJA 3AA0B 2UXXB 4P09A 3PUYF 3RH3A 4EZHA 5HEJA 3KFWX 4FI5A 2HPJA 3PUZF 4HFVA 4GOUA 1H7CA 4IE6A 5LHGB 3AE5A 3VRAA 3L3PA 4EAHA 4ZZCA 5ADXL 5L4HA 2XQ9A 1D0XA 4TNWA 3CK6A 5FXZA 5AQTB 4UV8B 2J47A 1MMDA 4H9RC 4LFBT 3AEGA 3KV9A 4HEAA 4NUUA 4UVCB 3J7Yq 1N36T 4LF9T 1YXRA 1KNPA 4O2AE 3PUSA 2FJEA 2KWIB 2DL1A 3HKDE 3P4WA 1IJ5A 4OK0A 2E5VA 1EZ3A 1IJ6A 2IC6A 2XM1A 2YU2A 3BK9A 5AQGB 3AE9A 3K1SA 4F6RC 4U3CA 4UXNB 2ACZA 4ZZBA 1CHUA 2CHOA 3ZJ1A 2CA5A 3E08A 5L47A 2WZHA 3AE4A 3CPZA 2JQ9A 3AE3A 4GIWA 2IC9A 3HKEE 5LG4A 2W00A 2YKSA 3LJCA 4HFBA 2VVSA 3ZSTA 5HXEA 2KXPB 3SRZA 4TUYE 2CWOA 3T1HT 3K3QC 4DMVA 2AE9A 3RF1A 3RIAA 3ZMUB 3CX6B 2UUBT 4TNVA 2XAJB 5C3JA 4IDQA 1UURA 1D1CA 3AAIA 4G63A 5IHYA 1FEWA 3PU8A 1WCRA 1LVFA 2CBIA 4ZHQE 4H9PC 3RHWA 4EEBA 2CLYC 4DR1T 4LFAT 3NZQA 2LSJA 4TZ4C 5JDFA 2XJ7A 2IIUA 3I0OA 4JUYA 4QWNB 2CXFA 3ZEFB 3PJAJ 3V5SA 3M65A 3ZMZB 3AB3B 4ILUA 2DLRA 2VKDA 4UV9B 2K9AA 3UU6A 2EHOB 1KNZA 2KNDA 1B7TA 1KK7A 4IE4A 4ZS2A 5KDMC 2HHHT 1AJ3A 4CXWA 4MHCA 2LE8A 1HG5A 1X79A 4HTEA 5FY1A 1IAPA 2M6BA 3L39A 3T8OA 3UUNA 5CA0E 2DNXA 2V6XA 4IE0A 1G8XA 3JAFA 4TWFA 5HEOA 1UK5A 4EZ4A 5AQJB 3H37A 1E2AA 1Z0PA 2HN1A 4JI2T 1M62A 5H6RB 4JI1T 5JDHA 2MAWA 4DVDA 3LDQB 1SA0E 5LXTE 2G0UA 2Q9QB 2BZBA 2XQ3A 3ZMTB 4PK4A 3AEAA 4UIGA 3JC6D 2V7LA 1U4QA 2W2UA 4U31A 2EHOA 2BVMA 2JIWA 2X68A 3EAMA 3CWZB 5HEHA 4JI7T 2OA5A 4M1PA 1Y64B 2VK9A 2XAGB 5HCMA 1YD8G 2BG9E 4Q25A 4A98A 3H3MA 3RRWA 4BJMA 3AE7A 2ZM6T 3RQWA 1WRDA 4IT4A 4YHJA 4IHJE 2XAQB 3TLTA 4DNDA 2KZ7B 1WLXA 4K0UA 4YSZA 5FXXA 2C5JA 5JDLA 4JEUB 1MNDA 2XUEA 2W62A 4UELA 4UR9A 5EZYE 5TAOA 2B1EA 4OX9T 4U2ZA 3I9YA 2ODVA 1MIWA 2VURA 5KX5E 1KF6A 5L3DB 5J0ZA 2C5IT 4MLKA 4IDNA 5IYZE 1YW0A 5ABGA 2E2AA 2MTQA 3SOLA 5L3FB 2XAHB 3ANWB 4AISA 2LHNA 4I50E 2K48A 1HNZT 5JRCB 3E22E 1OEDE 3L09A 3PUAA 3HKCE 5HAXA 4JI4T 2AXDS 2PFVA 4H63H 4YTNA 1XMOT 4GKKT 4CN1A 3LK2B 3P8CD 4DV3T 2VASA 3EHZA 5LGUB 3C4ZA 4BJNA 3KBTA 3U3IA 4CI2B 4JBWF 4LF5T 3AXJA 3OJAA 3AA6B 5KXJA 3ZMVB 4YSXA 2MOZA 4IDPA 2VVNA 2L8KA 2B76A 4IIJE 2X0LB 2VB6A 1J1JA 4ZI3C 2NOXA 4AXPA 2PTFA 4DV1T 2Y6XA 4EV6A 3VU7H 1NENA 2WBLA 2LLYA 5AQSB 3RKOA 4NUVA 1LRZA 1Z8UA 3JCFA 2PG8A 4N78D 3RYIE 5JR9C 5LHHB 5LGTB 2D2SA 1US7B 2FJBA 2WDVA 3S4UA 5HWYA 4YY3T 5F5WA 1U5PA 3ZYMA 2BS4A 4O4JE 3UU8A 4QXBB 1HS7A 3CMLA 3UFEA 3Q2MA 2X0YA 2I6HA 2ZM8A 2BKPA 3T1YT 2W67A 5AQVB 4LF8T 5DQVA 5L3GB 2KSRA 4DR5T 4CXXA 4EYUA 1LVKA 4AKHA 4H9OC 1SUMB 3IHRA 3C4XA 2A72A 2NW8A 5FL1A 2I59A 4OHFA 3AAEB 3ZN0B 4NIQA 2ZMAA 3AVSA 3HA4A 3OKQA 1T8BA 3I0QA 3QK6A 4J2CA 1NWMX 2CXLA 2LSIA 3FB2A 2X9HA 3A8YC 4L0RA 2DHRA 5FP3A 2WP9A 4QX7B 1L0VA 5LMUT 4DV6T 5JDGA 4C90A 5C8YE 3RIUA 3PE0A 1IBKT 2UXCT 3KV5A 4DV4T 2MBGA 3U78A 2CPTA 5LGNB 2ODUA 4HWIB 4DIDB 2CLYB 2D5UA 4DO0A 5JREA 4B3TT 1BR0A 3OPCA 3NRYA 4MBQA 2I0MA 3R6NA 3KVBA 4AQYT 4XBFB 3N9LA 4EB6E 1E1HB 1JNRA 3Q9DA 4Z91A 1D1AA 3K3NA 3KV4A 5ETWA 3A7MA 3EDVA 3R84B 5HXHA 2V7MA 2WM9A 4L9IA 4FJOA 5CFBA 3HKBE 4G2AA 3RQUA 5JDQA 4EIWA 5LNKA 1SHZC 3KINB 2IHR1 4IDZA
chains in the Genus database with same CATH topology
1T7SA 5AQHB 5AQQB 2D9DA 5AQMB 3FZFB 1M7KA 5AQRB 5AQGB 3A8YC 1HX1B 5AQKB 4HWCA 3FZHB 4HWFA 5AQFB 1UK5A 5AQNB 5AQSB 5AQJB 4HWDA 1M62A 1I6ZA 3FZMB 4HWIB 1UGOA 5AQLB 5AQOB 3LDQB 5AQTB 5AQIB 3FZLB 5AQUB 4HWHA 3M3ZB 5AQVB 5AQPB 3FZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7S A;  5AQH B;  5AQQ B;  2D9D A;  5AQM B;  3FZF B;  1M7K A;  5AQR B;  5AQG B;  3A8Y C;  1HX1 B;  5AQK B;  4HWC A;  3FZH B;  4HWF A;  5AQF B;  1UK5 A;  5AQN B;  5AQS B;  5AQJ B;  4HWD A;  1M62 A;  1I6Z A;  3FZM B;  4HWI B;  1UGO A;  5AQL B;  5AQO B;  3LDQ B;  5AQT B;  5AQI B;  3FZL B;  5AQU B;  4HWH A;  3M3Z B;  5AQV B;  5AQP B;  3FZK B; 
#chains in the Genus database with same CATH topology
 2V5C A;  3CX7 B;  2E9X A;  5FL0 A;  3EUH A;  4IDO A;  2WU2 A;  3N9M A;  4P0A A;  3RLF F;  3FZF B;  3ZKR A;  2BKO A;  5LJM A;  4JLE A;  1W0B A;  3O1J A;  2LHR A;  4C91 A;  2CHN A;  3VRB A;  2Q9Q C;  4CXY A;  1XWM A;  4X1Y E;  3ZJ2 A;  2KWH A;  1KEY A;  4KP3 C;  4DBR A;  4B6X A;  3GN5 B;  2BBJ A;  3JC6 C;  3OYZ A;  3DTO A;  1Y01 A;  2N9D A;  3AEF A;  4HWC A;  3UU4 A;  5CA1 E;  4DV5 T;  4KBM B;  4TN7 B;  5LOV E;  2KIN B;  4CN6 A;  4A5X A;  5CB4 E;  4LF4 T;  2NP9 A;  4YT0 A;  2LRK A;  3B5M A;  1UGO A;  3UU5 A;  2WDR A;  4AQG A;  2XY8 B;  4X1I E;  3UT5 E;  4O4L E;  4F8H A;  3UUX B;  2CM0 A;  4PJJ A;  4ILA A;  4DR7 T;  2K24 A;  2W0G A;  2M6I A;  3LK3 B;  4EOZ B;  1J5E T;  2A3D A;  2Q9Q A;  3P50 A;  1ZOY A;  5HEG A;  4YFS A;  2A9U A;  3ZN1 B;  3F31 A;  1W9R A;  1UX4 A;  2UXD T;  1NEK A;  4LF6 T;  1M7K A;  5DQW A;  2X66 A;  4IGU A;  2BS2 A;  1MIV A;  3OVU A;  1HX1 B;  4QKN A;  2L3L A;  4H9Q C;  3QC9 A;  1OED B;  3AAA B;  4GK0 E;  2V6Y A;  2BKN A;  2YDR A;  2LM9 A;  3LK4 2;  4JI3 T;  2FUP A;  4HE8 A;  5AQN B;  5JVD E;  3JAD A;  3ONX A;  4XZC A;  2C5K T;  5HWX A;  2VL8 A;  5C2T A;  4LMK A;  3BQL A;  3QOF A;  2WWV A;  4DR3 T;  2IAK A;  5HXS A;  3RYH E;  4TV9 E;  2LJL A;  3JAE A;  4YTP A;  2H88 A;  4H9S E;  3FZL B;  2VQF T;  1HR0 T;  2DWG A;  5AQU B;  4YHH T;  2V7K A;  3O1H A;  4YTM A;  2CMR A;  2XQ7 A;  2YEV C;  3CVR A;  2V5D A;  1I94 T;  1CUN A;  2NWB A;  3IEE A;  1T7S A;  3IF8 B;  4QH1 A;  4UF0 B;  3RIF A;  1E7P A;  4WW0 A;  4LML A;  2BG9 B;  5IUX A;  4NPP A;  4I0U A;  5L3C B;  1HNW T;  1ZKE A;  4IL9 A;  3ESL A;  3N9N A;  4U72 A;  4UEM A;  3ZPO A;  3A5X A;  5FVL A;  3WAJ A;  2H7O A;  4X65 T;  2UUA T;  4MFR A;  4HKA A;  1HCI A;  3P4R A;  4H9N C;  1T72 A;  1HX8 A;  3AXJ B;  2NTX A;  4WBO A;  4WNK A;  3TLS A;  1WFD A;  2CBJ A;  3ABV A;  3QB5 A;  4JEH B;  4PAG A;  4DV7 T;  2DWK A;  4HWD A;  3RX6 A;  3PV0 F;  3SFD A;  2X67 A;  4PJL A;  5F3J A;  3AA1 B;  2L9Q A;  3QUJ A;  2E9X C;  5AQL B;  2QRX A;  3C4W A;  1NAF A;  1MIY A;  4A97 A;  2LSK A;  2WWU A;  4IE7 A;  1IZN B;  3NVO A;  5BR8 T;  4JI6 T;  4PK5 A;  5GON E;  4IL4 A;  5LA6 E;  2X51 A;  4DR2 T;  3ZYL A;  2ZM0 A;  4QX8 B;  4ERR A;  4E7Z A;  3I1A A;  1WYB A;  1HNX T;  3TLV A;  5AFU L;  4JYA T;  3RI5 A;  5J2T E;  2D9D A;  1FIO A;  3C64 A;  2Z6E A;  4Z8X A;  3RYC E;  1G73 A;  3ZT7 A;  2XSA A;  1FMW A;  3UUB A;  3W15 B;  4AIU A;  4YXD A;  4DR4 T;  4HFD A;  3BQK A;  5HCJ A;  3F2E A;  2LSY A;  2UXB T;  4U7I A;  1BR1 A;  1HG2 A;  2JMK A;  3GMI A;  3ONJ A;  4HWF A;  4X66 T;  3LBX B;  3FXE B;  3MA9 A;  3SS1 A;  3KDS E;  3ETV A;  4X5T A;  2IDO B;  1UUS A;  2QGS A;  2WZI A;  2VWA A;  2XAF B;  1OWA A;  1SE7 A;  2CWY A;  4O4H E;  2V6Y B;  3E0Z A;  5AQI B;  3L8R A;  4AKG A;  2E8I A;  2OV9 A;  5EK4 A;  5LCY A;  1FMV A;  4CQI A;  5J1G A;  2RA1 A;  3LG7 A;  4NXM T;  3ZC1 A;  2ES0 A;  1WR6 A;  2JPF A;  3UU3 A;  4CI1 B;  5HXC A;  5FKY A;  3EDU A;  3PTR B;  3OBV E;  2KT9 A;  2WDQ A;  2X9W A;  3AE1 A;  3PU3 A;  3DJB A;  2DI4 A;  1S35 A;  3MKD A;  3P4P A;  5AQM B;  5FNV E;  3B13 A;  2XTL A;  2JQQ A;  3EVY A;  4IRE A;  5JR9 A;  3KV6 A;  5L4E A;  3PUW F;  4KUM B;  4MAL A;  3LBX A;  3N2K E;  2BDE A;  2WAU A;  3MK7 C;  3PUR A;  4X64 T;  4JV5 T;  2V7J A;  3AEC A;  4WZX A;  5FVK A;  3B57 A;  4XAX B;  2IUB A;  1R8I A;  2LRL A;  4LMJ A;  4ZXL A;  4ZI7 E;  1X9B A;  4GYR A;  5L3B B;  4B3S T;  2WQY A;  3O4X E;  1VCS A;  3VKH A;  1MMA A;  2FJD A;  1YQ3 A;  4KI0 F;  2W63 A;  3P7I A;  3HI2 A;  1J5W A;  2ZLY A;  4EYY R;  4HN9 A;  4JI0 T;  3G06 A;  4ZS3 A;  3PUG A;  4ASK A;  3M3Z B;  1S94 A;  2CCQ A;  1D0Z A;  1YKE B;  2YN6 A;  4OYK A;  5LJN A;  4PK6 A;  2WMN A;  4P0B A;  2YK0 A;  4E7S A;  4EED A;  4GYS A;  5JRC A;  5AQH B;  5A1L A;  2UU9 T;  1YQ4 A;  2K5B B;  1MMG A;  3FBZ A;  4ADZ A;  3D0T A;  4DV0 T;  2LKH A;  2J4G A;  4YJ2 E;  3J9X 1;  2JQK A;  4P1N A;  5ABH A;  1MNE A;  3ONL C;  3FHN A;  2YIN A;  3NZP A;  3O1I A;  5M4Y A;  1DU2 A;  2LT3 A;  4I55 E;  2X9Y A;  4I43 B;  5AQK B;  5FYM A;  3UUM A;  4BA9 A;  5JDN A;  4ZI2 D;  1QUU A;  2YDS A;  1UX5 A;  4PJN A;  5LG3 A;  2V7I A;  1QLB A;  3PUQ A;  4ZOL E;  5ABF B;  4DUY T;  3FZM B;  2BBH A;  2RPA A;  3MJX A;  4DUZ T;  4OFZ A;  4UVA B;  3MXZ A;  4HFC A;  1VCT A;  4U7Y A;  4PJM A;  5JR9 B;  3AED A;  2A2F X;  4LF7 T;  4TWH A;  3PDY A;  3AEB A;  2XM2 A;  2M67 A;  3AVR A;  1XDO A;  3TKL B;  4ZI3 D;  1IBL T;  2EHO D;  2XZE A;  2BS3 A;  1GQE A;  2XQ6 A;  5FXW A;  1T98 A;  4AKI A;  2IML A;  5IWA T;  2VL0 A;  5L2L A;  2YOE A;  5LP6 E;  5DJQ C;  3FBL A;  1OED C;  3KVA A;  3RC8 A;  5AQR B;  1ZEE A;  3N2O A;  4GKJ T;  1KNR A;  4EXT A;  4DV2 T;  3RKG A;  2PBI A;  2JMH A;  2WS3 A;  2OLT A;  2V26 A;  2XPK A;  3LFM A;  4WYV A;  4Z90 A;  3H3A A;  3ZYK A;  5LMN T;  4K0K T;  2WMO A;  2XQ8 A;  4H63 V;  4YSY A;  3I9W A;  4TX5 A;  5LBM A;  2NW9 A;  3P4S A;  2H89 A;  3ZSS A;  2FBW A;  2FJA A;  2XHE B;  3CQC B;  2YDQ A;  1XNQ T;  2VKO A;  4B3R T;  3ETU A;  1HF8 A;  2D0T A;  3C50 A;  3TLU A;  2V1D B;  3ZCJ A;  4CZZ B;  5LHI B;  2C0S A;  4QXC B;  4ZI2 C;  2J62 A;  4L5G A;  5H6Q B;  2XAS B;  1N34 T;  4ILC A;  4DBQ A;  2XQ5 A;  3VHL A;  2QA7 A;  2XQY A;  3UTK A;  4O4I E;  5J2U E;  2LOS A;  5L3E B;  3OTO T;  2H7V C;  3ZC0 A;  4U33 A;  5HEU A;  5ABE A;  2Y48 B;  3Q5X A;  1XZY A;  2NTY A;  4PW8 A;  3UQ4 A;  2QYW A;  4DMW A;  2GK9 A;  3WI3 A;  3CQG B;  3VR8 A;  3RPU A;  2JRK A;  2LSG A;  4OYJ A;  4HGA A;  2IW5 B;  3V5U A;  4PFO A;  4EGW A;  1VRB A;  2E9X B;  5FY7 A;  2WCA A;  1HFA A;  3KBU A;  3NKZ A;  3OYX A;  2LKG A;  3UUL A;  2XQ4 A;  2EHO C;  2P9B A;  5F8P A;  2KLQ A;  3RIU C;  4JI5 T;  3Q5D A;  4KX6 A;  4QHO A;  2D0U A;  5HXR A;  5LYJ E;  4WBN E;  1ZV4 X;  2BVL A;  3PUX F;  3AE6 A;  4YJ3 E;  2VKH A;  4BAY B;  2YU1 A;  4JI8 T;  1I6Z A;  4CN4 A;  2WU5 A;  4O2B E;  3GN5 A;  4GK5 E;  3X1D A;  2WY2 A;  4ISS A;  1MMN A;  1XDP A;  2WB5 A;  4AQF A;  4TWD A;  4X62 T;  3AE8 A;  5FMN A;  5BMV E;  1QSD A;  3PJA A;  1WYC A;  2CRB A;  4HWH A;  3RYF E;  1XNR T;  1JNZ A;  1ZHC A;  2R6G F;  5AQP B;  2V8S V;  4AI6 A;  3FZK B;  3Q5W A;  3UQ7 A;  3P4Q A;  2H3R A;  1BR2 A;  3NBX X;  2LEH A;  2N2N A;  4KHZ F;  2MPK A;  4IE5 A;  5AQQ B;  4YLH A;  3O9X A;  2UXN B;  3NRX A;  2JJ9 A;  2ZM2 A;  4HFI A;  5EK3 A;  3N2G E;  2HN2 A;  3ZCI A;  3ZT6 A;  2CE7 A;  3N9P A;  4PFP A;  2CXD A;  1V9D A;  4U74 A;  5DAB A;  4AKR B;  1W09 A;  3UFG A;  3IA3 A;  1UCU A;  3FZH B;  3IBP A;  4HFE A;  4O8S A;  5AQF B;  3QB5 K;  4QH5 A;  4DR6 T;  2N1G A;  2E9X D;  2X9X A;  3F57 A;  2XSB A;  4COF A;  1OED A;  3EI0 A;  3RGL A;  5JTG A;  2X0H A;  3VR9 A;  5EK2 A;  3MAC A;  4KHP T;  4I4T E;  2KMF A;  3AA7 B;  5LBQ B;  1N32 T;  2W4X A;  2LOP A;  2VKJ A;  4KMC A;  5E0O A;  1YKH B;  2J1D G;  2K3W A;  5JH7 E;  1XMQ T;  3AE2 A;  2Q9Q D;  2RP4 A;  3ZMS B;  5CGM A;  5JDM A;  2ACX A;  1FJG T;  2HH7 A;  4QH4 A;  3DP7 A;  2MYS A;  4IST A;  2W66 A;  2VQE T;  2XQA A;  3EAB A;  4X20 E;  4ZEY A;  2WSS V;  1VOM A;  2NR4 A;  3N5L A;  3SWH A;  3ZLI A;  3C98 B;  5LB7 B;  4U2Y A;  2E5L T;  1OXZ A;  2BG9 C;  5HYA A;  5ABF A;  2LM2 A;  3FXD B;  1D0Y A;  4UF0 A;  5FXV A;  4UVB B;  3C51 A;  3HR0 A;  3MZK B;  3RRC A;  3BQI A;  2BG9 A;  4AKL A;  1BR4 A;  3CKD A;  3ZT5 A;  4AQF C;  3VKG A;  4QXH B;  1WR0 A;  2SPC A;  3HL6 A;  3PUV F;  3ANW A;  1N33 T;  1ZP0 A;  1D1B A;  2CEA A;  4ILB A;  5CJ5 A;  3K8P C;  3GA8 A;  3RC3 A;  5AQO B;  2Y8D A;  2HPL A;  5KMG P;  2UUC T;  3AEE A;  2DCF A;  4LFC T;  2JQH A;  3N9O A;  3QNU A;  4X1K E;  3K3O A;  3N9Q A;  2W61 A;  4PNI A;  1KFY A;  2NW7 A;  1W0A A;  3CIR A;  3GWH A;  3LSV A;  3WAK A;  2F4V T;  4HFH A;  4TV8 E;  1LKX A;  1HTJ F;  3NWI A;  4NXN T;  3CX8 B;  5FY0 A;  3TLW A;  1IBM T;  4A56 A;  1O3X A;  2QVA A;  3Q5E A;  4V1A v;  5JQG E;  4CI3 B;  4B3M T;  2PJQ A;  3CQX C;  3SFE A;  4ANJ A;  3AA0 B;  2UXX B;  4P09 A;  3PUY F;  3RH3 A;  4EZH A;  5HEJ A;  3KFW X;  4FI5 A;  2HPJ A;  3PUZ F;  4HFV A;  4GOU A;  1H7C A;  4IE6 A;  5LHG B;  3AE5 A;  3VRA A;  3L3P A;  4EAH A;  4ZZC A;  5ADX L;  5L4H A;  2XQ9 A;  1D0X A;  4TNW A;  3CK6 A;  5FXZ A;  5AQT B;  4UV8 B;  2J47 A;  1MMD A;  4H9R C;  4LFB T;  3AEG A;  3KV9 A;  4HEA A;  4NUU A;  4UVC B;  3J7Y q;  1N36 T;  4LF9 T;  1YXR A;  1KNP A;  4O2A E;  3PUS A;  2FJE A;  2KWI B;  2DL1 A;  3HKD E;  3P4W A;  1IJ5 A;  4OK0 A;  2E5V A;  1EZ3 A;  1IJ6 A;  2IC6 A;  2XM1 A;  2YU2 A;  3BK9 A;  5AQG B;  3AE9 A;  3K1S A;  4F6R C;  4U3C A;  4UXN B;  2ACZ A;  4ZZB A;  1CHU A;  2CHO A;  3ZJ1 A;  2CA5 A;  3E08 A;  5L47 A;  2WZH A;  3AE4 A;  3CPZ A;  2JQ9 A;  3AE3 A;  4GIW A;  2IC9 A;  3HKE E;  5LG4 A;  2W00 A;  2YKS A;  3LJC A;  4HFB A;  2VVS A;  3ZST A;  5HXE A;  2KXP B;  3SRZ A;  4TUY E;  2CWO A;  3T1H T;  3K3Q C;  4DMV A;  2AE9 A;  3RF1 A;  3RIA A;  3ZMU B;  3CX6 B;  2UUB T;  4TNV A;  2XAJ B;  5C3J A;  4IDQ A;  1UUR A;  1D1C A;  3AAI A;  4G63 A;  5IHY A;  1FEW A;  3PU8 A;  1WCR A;  1LVF A;  2CBI A;  4ZHQ E;  4H9P C;  3RHW A;  4EEB A;  2CLY C;  4DR1 T;  4LFA T;  3NZQ A;  2LSJ A;  4TZ4 C;  5JDF A;  2XJ7 A;  2IIU A;  3I0O A;  4JUY A;  4QWN B;  2CXF A;  3ZEF B;  3PJA J;  3V5S A;  3M65 A;  3ZMZ B;  3AB3 B;  4ILU A;  2DLR A;  2VKD A;  4UV9 B;  2K9A A;  3UU6 A;  2EHO B;  1KNZ A;  2KND A;  1B7T A;  1KK7 A;  4IE4 A;  4ZS2 A;  5KDM C;  2HHH T;  1AJ3 A;  4CXW A;  4MHC A;  2LE8 A;  1HG5 A;  1X79 A;  4HTE A;  5FY1 A;  1IAP A;  2M6B A;  3L39 A;  3T8O A;  3UUN A;  5CA0 E;  2DNX A;  2V6X A;  4IE0 A;  1G8X A;  3JAF A;  4TWF A;  5HEO A;  1UK5 A;  4EZ4 A;  5AQJ B;  3H37 A;  1E2A A;  1Z0P A;  2HN1 A;  4JI2 T;  1M62 A;  5H6R B;  4JI1 T;  5JDH A;  2MAW A;  4DVD A;  3LDQ B;  1SA0 E;  5LXT E;  2G0U A;  2Q9Q B;  2BZB A;  2XQ3 A;  3ZMT B;  4PK4 A;  3AEA A;  4UIG A;  3JC6 D;  2V7L A;  1U4Q A;  2W2U A;  4U31 A;  2EHO A;  2BVM A;  2JIW A;  2X68 A;  3EAM A;  3CWZ B;  5HEH A;  4JI7 T;  2OA5 A;  4M1P A;  1Y64 B;  2VK9 A;  2XAG B;  5HCM A;  1YD8 G;  2BG9 E;  4Q25 A;  4A98 A;  3H3M A;  3RRW A;  4BJM A;  3AE7 A;  2ZM6 T;  3RQW A;  1WRD A;  4IT4 A;  4YHJ A;  4IHJ E;  2XAQ B;  3TLT A;  4DND A;  2KZ7 B;  1WLX A;  4K0U A;  4YSZ A;  5FXX A;  2C5J A;  5JDL A;  4JEU B;  1MND A;  2XUE A;  2W62 A;  4UEL A;  4UR9 A;  5EZY E;  5TAO A;  2B1E A;  4OX9 T;  4U2Z A;  3I9Y A;  2ODV A;  1MIW A;  2VUR A;  5KX5 E;  1KF6 A;  5L3D B;  5J0Z A;  2C5I T;  4MLK A;  4IDN A;  5IYZ E;  1YW0 A;  5ABG A;  2E2A A;  2MTQ A;  3SOL A;  5L3F B;  2XAH B;  3ANW B;  4AIS A;  2LHN A;  4I50 E;  2K48 A;  1HNZ T;  5JRC B;  3E22 E;  1OED E;  3L09 A;  3PUA A;  3HKC E;  5HAX A;  4JI4 T;  2AXD S;  2PFV A;  4H63 H;  4YTN A;  1XMO T;  4GKK T;  4CN1 A;  3LK2 B;  3P8C D;  4DV3 T;  2VAS A;  3EHZ A;  5LGU B;  3C4Z A;  4BJN A;  3KBT A;  3U3I A;  4CI2 B;  4JBW F;  4LF5 T;  3AXJ A;  3OJA A;  3AA6 B;  5KXJ A;  3ZMV B;  4YSX A;  2MOZ A;  4IDP A;  2VVN A;  2L8K A;  2B76 A;  4IIJ E;  2X0L B;  2VB6 A;  1J1J A;  4ZI3 C;  2NOX A;  4AXP A;  2PTF A;  4DV1 T;  2Y6X A;  4EV6 A;  3VU7 H;  1NEN A;  2WBL A;  2LLY A;  5AQS B;  3RKO A;  4NUV A;  1LRZ A;  1Z8U A;  3JCF A;  2PG8 A;  4N78 D;  3RYI E;  5JR9 C;  5LHH B;  5LGT B;  2D2S A;  1US7 B;  2FJB A;  2WDV A;  3S4U A;  5HWY A;  4YY3 T;  5F5W A;  1U5P A;  3ZYM A;  2BS4 A;  4O4J E;  3UU8 A;  4QXB B;  1HS7 A;  3CML A;  3UFE A;  3Q2M A;  2X0Y A;  2I6H A;  2ZM8 A;  2BKP A;  3T1Y T;  2W67 A;  5AQV B;  4LF8 T;  5DQV A;  5L3G B;  2KSR A;  4DR5 T;  4CXX A;  4EYU A;  1LVK A;  4AKH A;  4H9O C;  1SUM B;  3IHR A;  3C4X A;  2A72 A;  2NW8 A;  5FL1 A;  2I59 A;  4OHF A;  3AAE B;  3ZN0 B;  4NIQ A;  2ZMA A;  3AVS A;  3HA4 A;  3OKQ A;  1T8B A;  3I0Q A;  3QK6 A;  4J2C A;  1NWM X;  2CXL A;  2LSI A;  3FB2 A;  2X9H A;  3A8Y C;  4L0R A;  2DHR A;  5FP3 A;  2WP9 A;  4QX7 B;  1L0V A;  5LMU T;  4DV6 T;  5JDG A;  4C90 A;  5C8Y E;  3RIU A;  3PE0 A;  1IBK T;  2UXC T;  3KV5 A;  4DV4 T;  2MBG A;  3U78 A;  2CPT A;  5LGN B;  2ODU A;  4HWI B;  4DID B;  2CLY B;  2D5U A;  4DO0 A;  5JRE A;  4B3T T;  1BR0 A;  3OPC A;  3NRY A;  4MBQ A;  2I0M A;  3R6N A;  3KVB A;  4AQY T;  4XBF B;  3N9L A;  4EB6 E;  1E1H B;  1JNR A;  3Q9D A;  4Z91 A;  1D1A A;  3K3N A;  3KV4 A;  5ETW A;  3A7M A;  3EDV A;  3R84 B;  5HXH A;  2V7M A;  2WM9 A;  4L9I A;  4FJO A;  5CFB A;  3HKB E;  4G2A A;  3RQU A;  5JDQ A;  4EIW A;  5LNK A;  1SHZ C;  3KIN B;  2IHR 1;  4IDZ A; 
#chains in the Genus database with same CATH homology
 1T7S A;  5AQH B;  5AQQ B;  2D9D A;  5AQM B;  3FZF B;  1M7K A;  5AQR B;  5AQG B;  3A8Y C;  1HX1 B;  5AQK B;  4HWC A;  3FZH B;  4HWF A;  5AQF B;  1UK5 A;  5AQN B;  5AQS B;  5AQJ B;  4HWD A;  1M62 A;  1I6Z A;  3FZM B;  4HWI B;  1UGO A;  5AQL B;  5AQO B;  3LDQ B;  5AQT B;  5AQI B;  3FZL B;  5AQU B;  4HWH A;  3M3Z B;  5AQV B;  5AQP B;  3FZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...