3LDQB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3ldqB00
1I6ZA 4HWDA 5AQNB 3FZHB 3FZLB 5AQVB 5AQTB 5AQLB 1M62A 5AQMB 4HWIB 1M7KA 2D9DA 5AQHB 5AQRB 1HX1B 3FZMB 4HWCA 5AQGB 5AQFB 3FZKB 5AQUB 1UGOA 3FZFB 5AQIB 5AQOB 1T7SA 3LDQB 3M3ZB 1UK5A 5AQPB 5AQJB 5AQQB 3A8YC 5AQSB 5AQKB 4HWFA 4HWHA
chains in the Genus database with same CATH superfamily
4GIWA 2I59A 4ZOLE 3A7MA 4L5GA 1Z8UA 2UXNB 4YTPA 5JH7E 1BR4A 2L3LA 3FZMB 5J1GA 5L2LA 3S4UA 3ZT6A 4FJOA 3SS1A 1FJGT 3QB5K 5AQOB 4LFCT 2CRBA 2VK9A 5C3JA 4M1PA 2YEVC 2MOZA 3IA3A 2NW7A 2DWGA 2UXCT 4DR4T 3RIFA 2XM1A 3NRXA 1NEKA 5HWXA 3H3MA 4AIUA 3AA7B 2CWYA 1D0XA 4JV5T 2ACXA 4AKRB 2D5UA 2WWVA 1WCRA 2CCQA 2GK9A 3AE3A 4C91A 3HR0A 4DR6T 3PUGA 4KX6A 5JREA 2KT9A 4BAYB 4O4HE 3AE1A 4GYSA 3RKOA 3ETUA 4U3CA 2KWIB 2HHHT 2YINA 2JJ9A 4QHOA 1WR6A 4IREA 3RYHE 2ZM6T 2E5LT 1E7PA 3KV5A 4ZI3D 5AQJB 1Z0PA 2BVMA 4UF0A 2CLYB 3KVBA 3RHWA 4GYRA 3Q9DA 4AKLA 3NZQA 2LKHA 3P4QA 3PUXF 2V7LA 2ODVA 3EABA 1MIYA 3RKGA 2XY8B 2WS3A 2I0MA 3PE0A 4HFEA 4UVBB 1UX5A 5CJ5A 2JRKA 4YSZA 3OYXA 4DR5T 5DQVA 2V1DB 4X1YE 4JI8T 4LF7T 3ZSSA 1X9BA 3Q2MA 3CMLA 4AQYT 4ILUA 3AB3B 4H9QC 2UUBT 3VKHA 2KXPB 3BQLA 4NPPA 2IHR1 2Q9QC 2Q9QD 3I0QA 5FXWA 2WP9A 3ZT7A 2WDRA 3UUBA 5L3GB 1ZKEA 3GN5B 1UK5A 3C64A 2JQHA 4EEDA 2NW8A 1KNRA 2E8IA 2LJLA 5JDNA 3ZN1B 1WYBA 4CN6A 1XDPA 4CI1B 3PJAA 3J9X1 2V6YB 2W63A 4PJNA 2L8KA 2H3RA 4E7SA 3UQ4A 2ZLYA 1O3XA 2V6XA 2XQ7A 5ABFB 4PNIA 2Q9QA 2BKNA 4X65T 5A1LA 5FL0A 2UXDT 4AKIA 1HX8A 2E9XB 4IE0A 3C4XA 2A2FX 2CE7A 2R6GF 4ZEYA 4ILAA 1UURA 3ETVA 5AQUB 2ES0A 4X5TA 4P0AA 1L0VA 3A8YC 1Y01A 5HXCA 3PUWF 2WCAA 1KNZA 5L3FB 3ABVA 3VKGA 2LM9A 4U33A 2V7MA 4NUUA 4I4TE 3FXDB 3PUSA 3MACA 2FUPA 2CHOA 2D2SA 3QB5A 5FNVE 3NWIA 4B3TT 3C98B 4HGAA 2OLTA 5JVDE 5L3EB 2B76A 1OXZA 4JBWF 2K5BB 3DTOA 2I6HA 4EYYR 2PTFA 3N2OA 4F6RC 2XQ9A 3AAEB 4LFBT 3PTRB 3AECA 5FKYA 2ACZA 4JI4T 1SHZC 4AQFC 3ZC0A 4PW8A 1YW0A 4CN4A 1OWAA 3Q5DA 4XZCA 2WMNA 3Q5XA 2DHRA 4ZS3A 3M3ZB 2CA5A 3UFEA 3ZT5A 5AQNB 1D0YA 4LMKA 4ZS2A 1QLBA 2UUAT 2D9DA 4JI2T 3KBTA 4XAXB 1U4QA 3T8OA 5FXVA 3UQ7A 4COFA 5HEUA 3AE6A 3AVSA 3ZJ1A 4AQFA 3KV4A 1S35A 1US7B 4PFPA 2NTXA 1S94A 4ZI7E 1T7SA 2UU9T 4UELA 1MMGA 5FY0A 3JC6C 2K3WA 3JC6D 3N9OA 2MAWA 4ZZCA 2XZEA 4UV8B 2VQET 3KV9A 3AEBA 5M4YA 3E0ZA 3N5LA 4KUMB 4K0KT 4X62T 2OA5A 3PUYF 3QC9A 2NR4A 4UIGA 3FBLA 2OV9A 1ZEEA 1XNQT 5FXXA 1YQ3A 4JI0T 3FB2A 2BBJA 2C5KT 3P4SA 5FVKA 5JQGE 3D0TA 3KV6A 2WZHA 4OYKA 5FVLA 2BG9A 2X9HA 4DR2T 1M62A 3I9WA 2X67A 2NTYA 4LF5T 5JDMA 2X9XA 5IHYA 2SPCA 2VURA 3PUZF 4CN1A 2LHNA 3ZKRA 4GK5E 2JMKA 3C4ZA 3RRCA 2AE9A 5LOVE 3OVUA 2FJBA 2H7VC 5LCYA 1WR0A 4LMLA 1D1AA 3LBXB 4EZ4A 2J62A 1VOMA 3SFDA 5KMGP 3MK7C 4IDNA 1HG2A 4AISA 3DP7A 1ZOYA 4IDOA 4IIJE 4L0RA 4H9NC 3PU3A 4PAGA 1B7TA 3RI5A 5FY7A 1OEDC 2IMLA 3RYCE 1FMVA 2WMOA 2LM2A 3BQIA 3QK6A 4DR3T 3UU8A 3IEEA 4TX5A 1KFYA 5DJQC 2W66A 3SWHA 5L4EA 3FZLB 3ZMZB 4CXWA 4H63V 2KZ7B 4WYVA 4LMJA 2BVLA 4B6XA 4O8SA 1N36T 4U7YA 2JQ9A 2N1GA 4O4IE 3AE8A 3JAEA 4DNDA 5JR9C 1XMOT 1KK7A 2LEHA 4A97A 5LMUT 3CKDA 5HCMA 2D0UA 5ADXL 4ANJA 1ZV4X 4X1KE 3TLTA 4LF9T 3PUAA 4IDPA 4JEUB 2LSJA 1SA0E 2WSSV 2XPKA 3LK2B 5C8YE 3AXJA 2NWBA 5IYZE 4CI3B 5DABA 5AQLB 4IE4A 3ONXA 2AXDS 4WZXA 4YY3T 3UU5A 2Y48B 4TNVA 1V9DA 3KFWX 2YOEA 2H89A 3ZC1A 2WU2A 3CVRA 3AA1B 2BBHA 5JR9A 2BS2A 2P9BA 1HR0T 3RYIE 4N78D 2V7IA 1HFAA 2YU2A 4TNWA 4DMWA 3KBUA 2EHOC 2QA7A 2EHOD 4HWCA 4EEBA 5JDLA 3SOLA 3ANWB 4HKAA 4WW0A 4DVDA 4U2YA 5AFUL 5LA6E 1HF8A 2ZMAA 2BS3A 2WDQA 5AQMB 1YKEB 3LSVA 5CGMA 4QXHB 3AEAA 4V1Av 5EK3A 1J5WA 5J2UE 4GK0E 3ZMVB 2VB6A 4UVAB 3OBVE 3L3PA 4KHPT 4MHCA 4BJMA 4DV3T 1OEDB 4DBQA 2YDSA 3N9MA 4B3MT 2DLRA 3A5XA 2M6IA 2W67A 3N9NA 4TWDA 2NP9A 1HS7A 3VHLA 3LFMA 2CXDA 2EHOA 2ODUA 5ABGA 4AKGA 3E22E 4ZI3C 4U31A 4H63H 5LBMA 4YLHA 4IGUA 5HEGA 1W0AA 4HFBA 5L3BB 3K3OA 2KMFA 1LRZA 4CQIA 4HN9A 4U72A 4EXTA 5CA1E 5LMNT 4JI7T 3RX6A 3AEDA 2QGSA 4I50E 5AQKB 2E5VA 4DV1T 4JLEA 4UR9A 2MYSA 2V5CA 3ZCJA 3MA9A 3RQUA 2XSBA 4EYUA 2DCFA 5JRCA 5LG3A 2H88A 3AAIA 1N32T 2LKGA 5LB7B 2JMHA 4AI6A 3CPZA 1XZYA 3PV0F 2DI4A 2W4XA 1JNZA 3RYFE 2A3DA 5HWYA 3UUMA 1BR1A 1AJ3A 3N9LA 3K1SA 4LF6T 2JQQA 2LE8A 5FL1A 4H9RC 1XDOA 5L4HA 4UF0B 2RA1A 4KP3C 3CQGB 4QWNB 1IJ6A 3WI3A 2LOPA 3O9XA 3FZKB 5ABEA 1BR2A 3UT5E 4YT0A 5ABHA 1YXRA 3RGLA 2IC6A 4HWFA 1N33T 4ZZBA 3AA0B 2B1EA 3P4RA 3X1DA 5AQRB 5FY1A 1T98A 5JDQA 1ZHCA 4I0UA 3RPUA 5FXZA 2JIWA 1WLXA 4MALA 2NW9A 2W00A 4G63A 4YHHT 4A56A 5KXJA 1CUNA 3JADA 1OEDE 3RC8A 1IBKT 3C4WA 3AVRA 2MTQA 2XUEA 2IDOB 4LFAT 1BR0A 4JEHB 2XQ8A 3U3IA 4O4LE 1WRDA 4ILBA 4C90A 2WAUA 3VR9A 2YN6A 4ZI2C 4ZI2D 2MBGA 2V7JA 4YXDA 2WU5A 5LHHB 1T8BA 1MNEA 3EUHA 3QOFA 1E2AA 3ZMUB 4DR7T 2L9QA 2KWHA 2Q9QB 2C5JA 3AE9A 4ZHQE 4QXCB 3T1HT 4IE5A 4IE6A 5JTGA 4JI3T 5LNKA 5AQSB 4QX7B 4Z8XA 3P8CD 3OKQA 3OYZA 5AQHB 1HX1B 1E1HB 3WAKA 4OYJA 3UUNA 3PUVF 2XAHB 4DBRA 4HWHA 5HXRA 3R84B 1MNDA 2BDEA 3HKCE 3N2KE 3UFGA 3U78A 3TLUA 3PUQA 2Z6EA 3UU4A 5CFBA 2JPFA 1MMDA 4WBNE 4O2BE 3GA8A 4CI2B 2BG9C 1W0BA 2VL8A 3RIUC 2YKSA 2A72A 1NENA 4OK0A 5LBQB 5HYAA 5AQGB 3OTOT 3K8PC 1J5ET 3VRAA 2XQ5A 4U2ZA 2FJEA 3GWHA 4Z90A 3ZJ2A 2M6BA 1T72A 4CXYA 3CX8B 3EDUA 1G73A 3O1IA 1HNZT 4DV4T 2XTLA 3VRBA 1UUSA 3NZPA 3M65A 4EOZB 4UEMA 1WFDA 3RIUA 5KDMC 4E7ZA 4IHJE 5J0ZA 3F57A 2X68A 4AKHA 1VRBA 4QH1A 4KMCA 4PFOA 2LRKA 1I6ZA 1YKHB 3BQKA 5EZYE 3UUXB 3ZMTB 5AQTB 5LYJE 3VU7H 1SE7A 2E2AA 5BR8T 3Q5WA 4B3RT 4DIDB 2KLQA 3P50A 3N9QA 5J2TE 4QH5A 4H9PC 4QX8B 3IBPA 3AE5A 4AQGA 4HFIA 4JI1T 4PK6A 4EIWA 4HWDA 4WBOA 2D0TA 4CZZB 2CHNA 3J7Yq 3O1JA 3G06A 3E08A 4BA9A 3LG7A 4ISSA 4TN7B 3C51A 4HFVA 4B3ST 3MKDA 2DWKA 1J1JA 5L3CB 4IL4A 2RPAA 2BG9B 4OX9T 4HWIB 4TUYE 5HEJA 2VKOA 1YD8G 5HXSA 2X9YA 2LOSA 1R8IA 3CWZB 4NXMT 4I43B 2DNXA 2IC9A 2BZBA 1KEYA 2ZM0A 2VKDA 3PJAJ 2UUCT 2LSIA 1VCTA 4G2AA 3JCFA 2XSAA 5ETWA 3PDYA 3C50A 2XAJB 2N9DA 4Z91A 4DO0A 4XBFB 1MIWA 4JUYA 2PG8A 2LHRA 2WB5A 5F5WA 5CA0E 3NVOA 3V5SA 2UXBT 2CEAA 2V26A 3RC3A 1FEWA 5FP3A 2G0UA 2XQYA 3QNUA 5FYMA 4UV9B 3I1AA 2XAGB 4WNKA 4ERRA 4LF8T 2BKPA 1X79A 2N2NA 2DL1A 1W09A 4LF4T 2LSGA 2V7KA 1NAFA 4J2CA 3I0OA 5AQVB 5HEHA 3W15B 3RQWA 3EVYA 3UTKA 2IUBA 4DV5T 4DR1T 4IDQA 3RLFF 4KBMB 4L9IA 2PBIA 3AXJB 4TWHA 4GOUA 1H7CA 1XWMA 2IW5B 4TZ4C 5LJMA 2MPKA 4IDZA 3ZSTA 3LK3B 3HKBE 3LK42 4YTNA 1CHUA 3BK9A 3LDQB 2E9XC 4EV6A 2E9XD 4PJJA 4EZHA 1GQEA 2QRXA 5JR9B 5CB4E 3EAMA 1YQ4A 4YJ2E 2WDVA 3CQCB 3Q5EA 2BG9E 3GN5A 5DQWA 3FBZA 4TV9E 2X51A 3PU8A 5GONE 1I94T 2CXFA 2CXLA 5HEOA 4HTEA 2CM0A 5LG4A 4GKKT 4EB6E 2LSKA 3AAAB 3L8RA 4X20E 2RP4A 3JAFA 4DV7T 2X0YA 2V6YA 5JDFA 4O4JE 1D1BA 4JI6T 4GKJT 3ZCIA 2ZM2A 4ADZA 3AE4A 5C2TA 5ABFA 1D0ZA 2VASA 3EDVA 1W9RA 4YFSA 2E9XA 3EI0A 4MBQA 2XASB 3IHRA 4H9OC 3ZYMA 2X9WA 4EAHA 3AEFA 3ESLA 2EHOB 2HH7A 2X66A 4YTMA 2K48A 4TV8E 1D1CA 4DUZT 2HPLA 3UU3A 4PJMA 1IZNB 5KX5E 3AE7A 1WYCA 1HNWT 3KVAA 3VR8A 2QYWA 2VVNA 5L47A 4PJLA 3O1HA 5LP6E 4HE8A 2HN2A 1SUMB 2H7OA 2BKOA 5JDHA 3GMIA 2XAFB 3CX7B 4YHJA 1LKXA 1ZP0A 4CXXA 3ZPOA 5JRCB 2WQYA 4ISTA 2X0HA 3RH3A 3CK6A 3RF1A 3L39A 2UXXB 5HAXA 1FMWA 1DU2A 3ZYKA 1HNXT 3OPCA 5H6RB 3ZEFB 1LVKA 5HXHA 5FMNA 4U7IA 4KI0F 4IE7A 3B57A 4HFHA 4ASKA 3L09A 3TLSA 5F3JA 3AEGA 3PURA 1UCUA 5TAOA 3CQXC 3ZN0B 5EK4A 3WAJA 4PK5A 3NBXX 2VKJA 1IBLT 3HA4A 5LHIB 2VQFT 4QKNA 2YK0A 5LGTB 2XQ6A 3KDSE 3SFEA 2HPJA 3I9YA 3NRYA 5LHGB 2WWUA 3AE2A 3FZHB 2LSYA 1KNPA 2FJAA 3HKDE 2XQAA 2V5DA 4HEAA 3H37A 5HCJA 2V8SV 4I55E 1HG5A 2VL0A 3N2GE 1IAPA 3NKZA 4ILCA 5LGUB 3FZFB 3IF8B 2W2UA 5IWAT 4DUYT 3TLWA 4X1IE 5E0OA 4O2AE 4FI5A 2K24A 3B13A 4DV6T 4A98A 3ZMSB 1JNRA 1XNRT 2CPTA 2F4VT 2LRLA 3B5MA 4NUVA 3FXEB 3T1YT 5IUXA 3RRWA 2J4GA 2XM2A 4YSXA 3FHNA 1QUUA 2CMRA 1Y64B 3F2EA 5F8PA 3UU6A 4ZXLA 3P7IA 2CBIA 2XQ4A 2FBWA 4JI5T 1EZ3A 2VVSA 1MMNA 1MIVA 2A9UA 3OJAA 1U5PA 1QSDA 2YDRA 3LBXA 2C5IT 4KHZF 3CIRA 3P4PA 2KSRA 2K9AA 1G8XA 5H6QB 2J47A 2KINB 2M67A 4BJNA 4F8HA 3SRZA 4QXBB 5AQPB 3RIAA 5HXEA 3O4XE 3P4WA 1IBMT 4OFZA 3ONJA 1UX4A 2W62A 5L3DB 4A5XA 4NIQA 2ZM8A 3N9PA 4P0BA 1NWMX 3ZLIA 2XJ7A 5JDGA 3R6NA 3V5UA 2CBJA 4MLKA 4QH4A 3TLVA 1KF6A 2C0SA 2VWAA 5LXTE 4AXPA 1MMAA 4X64T 2QVAA 4DMVA 1XMQT 2XHEB 3F31A 4Q25A 4YSYA 4U74A 3AEEA 1UGOA 2LT3A 4OHFA 3LJCA 2IIUA 2PFVA 3CX6B 3UULA 4MFRA 5EK2A 4K0UA 5AQFB 4UVCB 4TWFA 2W0GA 2XAQB 5AQIB 2IAKA 4X66T 4HFDA 2Y6XA 1IJ5A 2W61A 3AA6B 2YU1A 3HI2A 3HL6A 3K3NA 3ZYLA 4JYAT 2YDQA 3H3AA 2Y8DA 4IL9A 4EGWA 2LLYA 3QUJA 4IT4A 3ONLC 4DV0T 3K3QC 2X0LB 5LJNA 4UXNB 2FJDA 2NOXA 4P1NA 3KINB 1LVFA 4H9SE 1VCSA 2WM9A 2WZIA 4P09A 4NXNT 1M7KA 5LGNB 3HKEE 4HFCA 1HCIA 3TKLB 3ANWA 2XQ3A 2CLYC 3MJXA 1FIOA 2WBLA 2JQKA 3MZKB 2WY2A 2CWOA 2VKHA 2HN1A 3DJBA 2KNDA 4PK4A 4DV2T 3MXZA 5BMVE 2PJQA 1HTJF 2J1DG 1OEDA 1N34T 4YJ3E 3EHZA 5AQQB 2BS4A
chains in the Genus database with same CATH topology
1I6ZA 4HWDA 5AQNB 3FZHB 3FZLB 5AQVB 5AQTB 5AQLB 1M62A 5AQMB 4HWIB 1M7KA 2D9DA 5AQHB 5AQRB 1HX1B 3FZMB 4HWCA 5AQGB 5AQFB 3FZKB 5AQUB 1UGOA 3FZFB 5AQIB 5AQOB 1T7SA 3LDQB 3M3ZB 1UK5A 5AQPB 5AQJB 5AQQB 3A8YC 5AQSB 5AQKB 4HWFA 4HWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  4HWD A;  5AQN B;  3FZH B;  3FZL B;  5AQV B;  5AQT B;  5AQL B;  1M62 A;  5AQM B;  4HWI B;  1M7K A;  2D9D A;  5AQH B;  5AQR B;  1HX1 B;  3FZM B;  4HWC A;  5AQG B;  5AQF B;  3FZK B;  5AQU B;  1UGO A;  3FZF B;  5AQI B;  5AQO B;  1T7S A;  3LDQ B;  3M3Z B;  1UK5 A;  5AQP B;  5AQJ B;  5AQQ B;  3A8Y C;  5AQS B;  5AQK B;  4HWF A;  4HWH A; 
#chains in the Genus database with same CATH topology
 4GIW A;  2I59 A;  4ZOL E;  3A7M A;  4L5G A;  1Z8U A;  2UXN B;  4YTP A;  5JH7 E;  1BR4 A;  2L3L A;  3FZM B;  5J1G A;  5L2L A;  3S4U A;  3ZT6 A;  4FJO A;  3SS1 A;  1FJG T;  3QB5 K;  5AQO B;  4LFC T;  2CRB A;  2VK9 A;  5C3J A;  4M1P A;  2YEV C;  2MOZ A;  3IA3 A;  2NW7 A;  2DWG A;  2UXC T;  4DR4 T;  3RIF A;  2XM1 A;  3NRX A;  1NEK A;  5HWX A;  3H3M A;  4AIU A;  3AA7 B;  2CWY A;  1D0X A;  4JV5 T;  2ACX A;  4AKR B;  2D5U A;  2WWV A;  1WCR A;  2CCQ A;  2GK9 A;  3AE3 A;  4C91 A;  3HR0 A;  4DR6 T;  3PUG A;  4KX6 A;  5JRE A;  2KT9 A;  4BAY B;  4O4H E;  3AE1 A;  4GYS A;  3RKO A;  3ETU A;  4U3C A;  2KWI B;  2HHH T;  2YIN A;  2JJ9 A;  4QHO A;  1WR6 A;  4IRE A;  3RYH E;  2ZM6 T;  2E5L T;  1E7P A;  3KV5 A;  4ZI3 D;  5AQJ B;  1Z0P A;  2BVM A;  4UF0 A;  2CLY B;  3KVB A;  3RHW A;  4GYR A;  3Q9D A;  4AKL A;  3NZQ A;  2LKH A;  3P4Q A;  3PUX F;  2V7L A;  2ODV A;  3EAB A;  1MIY A;  3RKG A;  2XY8 B;  2WS3 A;  2I0M A;  3PE0 A;  4HFE A;  4UVB B;  1UX5 A;  5CJ5 A;  2JRK A;  4YSZ A;  3OYX A;  4DR5 T;  5DQV A;  2V1D B;  4X1Y E;  4JI8 T;  4LF7 T;  3ZSS A;  1X9B A;  3Q2M A;  3CML A;  4AQY T;  4ILU A;  3AB3 B;  4H9Q C;  2UUB T;  3VKH A;  2KXP B;  3BQL A;  4NPP A;  2IHR 1;  2Q9Q C;  2Q9Q D;  3I0Q A;  5FXW A;  2WP9 A;  3ZT7 A;  2WDR A;  3UUB A;  5L3G B;  1ZKE A;  3GN5 B;  1UK5 A;  3C64 A;  2JQH A;  4EED A;  2NW8 A;  1KNR A;  2E8I A;  2LJL A;  5JDN A;  3ZN1 B;  1WYB A;  4CN6 A;  1XDP A;  4CI1 B;  3PJA A;  3J9X 1;  2V6Y B;  2W63 A;  4PJN A;  2L8K A;  2H3R A;  4E7S A;  3UQ4 A;  2ZLY A;  1O3X A;  2V6X A;  2XQ7 A;  5ABF B;  4PNI A;  2Q9Q A;  2BKN A;  4X65 T;  5A1L A;  5FL0 A;  2UXD T;  4AKI A;  1HX8 A;  2E9X B;  4IE0 A;  3C4X A;  2A2F X;  2CE7 A;  2R6G F;  4ZEY A;  4ILA A;  1UUR A;  3ETV A;  5AQU B;  2ES0 A;  4X5T A;  4P0A A;  1L0V A;  3A8Y C;  1Y01 A;  5HXC A;  3PUW F;  2WCA A;  1KNZ A;  5L3F B;  3ABV A;  3VKG A;  2LM9 A;  4U33 A;  2V7M A;  4NUU A;  4I4T E;  3FXD B;  3PUS A;  3MAC A;  2FUP A;  2CHO A;  2D2S A;  3QB5 A;  5FNV E;  3NWI A;  4B3T T;  3C98 B;  4HGA A;  2OLT A;  5JVD E;  5L3E B;  2B76 A;  1OXZ A;  4JBW F;  2K5B B;  3DTO A;  2I6H A;  4EYY R;  2PTF A;  3N2O A;  4F6R C;  2XQ9 A;  3AAE B;  4LFB T;  3PTR B;  3AEC A;  5FKY A;  2ACZ A;  4JI4 T;  1SHZ C;  4AQF C;  3ZC0 A;  4PW8 A;  1YW0 A;  4CN4 A;  1OWA A;  3Q5D A;  4XZC A;  2WMN A;  3Q5X A;  2DHR A;  4ZS3 A;  3M3Z B;  2CA5 A;  3UFE A;  3ZT5 A;  5AQN B;  1D0Y A;  4LMK A;  4ZS2 A;  1QLB A;  2UUA T;  2D9D A;  4JI2 T;  3KBT A;  4XAX B;  1U4Q A;  3T8O A;  5FXV A;  3UQ7 A;  4COF A;  5HEU A;  3AE6 A;  3AVS A;  3ZJ1 A;  4AQF A;  3KV4 A;  1S35 A;  1US7 B;  4PFP A;  2NTX A;  1S94 A;  4ZI7 E;  1T7S A;  2UU9 T;  4UEL A;  1MMG A;  5FY0 A;  3JC6 C;  2K3W A;  3JC6 D;  3N9O A;  2MAW A;  4ZZC A;  2XZE A;  4UV8 B;  2VQE T;  3KV9 A;  3AEB A;  5M4Y A;  3E0Z A;  3N5L A;  4KUM B;  4K0K T;  4X62 T;  2OA5 A;  3PUY F;  3QC9 A;  2NR4 A;  4UIG A;  3FBL A;  2OV9 A;  1ZEE A;  1XNQ T;  5FXX A;  1YQ3 A;  4JI0 T;  3FB2 A;  2BBJ A;  2C5K T;  3P4S A;  5FVK A;  5JQG E;  3D0T A;  3KV6 A;  2WZH A;  4OYK A;  5FVL A;  2BG9 A;  2X9H A;  4DR2 T;  1M62 A;  3I9W A;  2X67 A;  2NTY A;  4LF5 T;  5JDM A;  2X9X A;  5IHY A;  2SPC A;  2VUR A;  3PUZ F;  4CN1 A;  2LHN A;  3ZKR A;  4GK5 E;  2JMK A;  3C4Z A;  3RRC A;  2AE9 A;  5LOV E;  3OVU A;  2FJB A;  2H7V C;  5LCY A;  1WR0 A;  4LML A;  1D1A A;  3LBX B;  4EZ4 A;  2J62 A;  1VOM A;  3SFD A;  5KMG P;  3MK7 C;  4IDN A;  1HG2 A;  4AIS A;  3DP7 A;  1ZOY A;  4IDO A;  4IIJ E;  4L0R A;  4H9N C;  3PU3 A;  4PAG A;  1B7T A;  3RI5 A;  5FY7 A;  1OED C;  2IML A;  3RYC E;  1FMV A;  2WMO A;  2LM2 A;  3BQI A;  3QK6 A;  4DR3 T;  3UU8 A;  3IEE A;  4TX5 A;  1KFY A;  5DJQ C;  2W66 A;  3SWH A;  5L4E A;  3FZL B;  3ZMZ B;  4CXW A;  4H63 V;  2KZ7 B;  4WYV A;  4LMJ A;  2BVL A;  4B6X A;  4O8S A;  1N36 T;  4U7Y A;  2JQ9 A;  2N1G A;  4O4I E;  3AE8 A;  3JAE A;  4DND A;  5JR9 C;  1XMO T;  1KK7 A;  2LEH A;  4A97 A;  5LMU T;  3CKD A;  5HCM A;  2D0U A;  5ADX L;  4ANJ A;  1ZV4 X;  4X1K E;  3TLT A;  4LF9 T;  3PUA A;  4IDP A;  4JEU B;  2LSJ A;  1SA0 E;  2WSS V;  2XPK A;  3LK2 B;  5C8Y E;  3AXJ A;  2NWB A;  5IYZ E;  4CI3 B;  5DAB A;  5AQL B;  4IE4 A;  3ONX A;  2AXD S;  4WZX A;  4YY3 T;  3UU5 A;  2Y48 B;  4TNV A;  1V9D A;  3KFW X;  2YOE A;  2H89 A;  3ZC1 A;  2WU2 A;  3CVR A;  3AA1 B;  2BBH A;  5JR9 A;  2BS2 A;  2P9B A;  1HR0 T;  3RYI E;  4N78 D;  2V7I A;  1HFA A;  2YU2 A;  4TNW A;  4DMW A;  3KBU A;  2EHO C;  2QA7 A;  2EHO D;  4HWC A;  4EEB A;  5JDL A;  3SOL A;  3ANW B;  4HKA A;  4WW0 A;  4DVD A;  4U2Y A;  5AFU L;  5LA6 E;  1HF8 A;  2ZMA A;  2BS3 A;  2WDQ A;  5AQM B;  1YKE B;  3LSV A;  5CGM A;  4QXH B;  3AEA A;  4V1A v;  5EK3 A;  1J5W A;  5J2U E;  4GK0 E;  3ZMV B;  2VB6 A;  4UVA B;  3OBV E;  3L3P A;  4KHP T;  4MHC A;  4BJM A;  4DV3 T;  1OED B;  4DBQ A;  2YDS A;  3N9M A;  4B3M T;  2DLR A;  3A5X A;  2M6I A;  2W67 A;  3N9N A;  4TWD A;  2NP9 A;  1HS7 A;  3VHL A;  3LFM A;  2CXD A;  2EHO A;  2ODU A;  5ABG A;  4AKG A;  3E22 E;  4ZI3 C;  4U31 A;  4H63 H;  5LBM A;  4YLH A;  4IGU A;  5HEG A;  1W0A A;  4HFB A;  5L3B B;  3K3O A;  2KMF A;  1LRZ A;  4CQI A;  4HN9 A;  4U72 A;  4EXT A;  5CA1 E;  5LMN T;  4JI7 T;  3RX6 A;  3AED A;  2QGS A;  4I50 E;  5AQK B;  2E5V A;  4DV1 T;  4JLE A;  4UR9 A;  2MYS A;  2V5C A;  3ZCJ A;  3MA9 A;  3RQU A;  2XSB A;  4EYU A;  2DCF A;  5JRC A;  5LG3 A;  2H88 A;  3AAI A;  1N32 T;  2LKG A;  5LB7 B;  2JMH A;  4AI6 A;  3CPZ A;  1XZY A;  3PV0 F;  2DI4 A;  2W4X A;  1JNZ A;  3RYF E;  2A3D A;  5HWY A;  3UUM A;  1BR1 A;  1AJ3 A;  3N9L A;  3K1S A;  4LF6 T;  2JQQ A;  2LE8 A;  5FL1 A;  4H9R C;  1XDO A;  5L4H A;  4UF0 B;  2RA1 A;  4KP3 C;  3CQG B;  4QWN B;  1IJ6 A;  3WI3 A;  2LOP A;  3O9X A;  3FZK B;  5ABE A;  1BR2 A;  3UT5 E;  4YT0 A;  5ABH A;  1YXR A;  3RGL A;  2IC6 A;  4HWF A;  1N33 T;  4ZZB A;  3AA0 B;  2B1E A;  3P4R A;  3X1D A;  5AQR B;  5FY1 A;  1T98 A;  5JDQ A;  1ZHC A;  4I0U A;  3RPU A;  5FXZ A;  2JIW A;  1WLX A;  4MAL A;  2NW9 A;  2W00 A;  4G63 A;  4YHH T;  4A56 A;  5KXJ A;  1CUN A;  3JAD A;  1OED E;  3RC8 A;  1IBK T;  3C4W A;  3AVR A;  2MTQ A;  2XUE A;  2IDO B;  4LFA T;  1BR0 A;  4JEH B;  2XQ8 A;  3U3I A;  4O4L E;  1WRD A;  4ILB A;  4C90 A;  2WAU A;  3VR9 A;  2YN6 A;  4ZI2 C;  4ZI2 D;  2MBG A;  2V7J A;  4YXD A;  2WU5 A;  5LHH B;  1T8B A;  1MNE A;  3EUH A;  3QOF A;  1E2A A;  3ZMU B;  4DR7 T;  2L9Q A;  2KWH A;  2Q9Q B;  2C5J A;  3AE9 A;  4ZHQ E;  4QXC B;  3T1H T;  4IE5 A;  4IE6 A;  5JTG A;  4JI3 T;  5LNK A;  5AQS B;  4QX7 B;  4Z8X A;  3P8C D;  3OKQ A;  3OYZ A;  5AQH B;  1HX1 B;  1E1H B;  3WAK A;  4OYJ A;  3UUN A;  3PUV F;  2XAH B;  4DBR A;  4HWH A;  5HXR A;  3R84 B;  1MND A;  2BDE A;  3HKC E;  3N2K E;  3UFG A;  3U78 A;  3TLU A;  3PUQ A;  2Z6E A;  3UU4 A;  5CFB A;  2JPF A;  1MMD A;  4WBN E;  4O2B E;  3GA8 A;  4CI2 B;  2BG9 C;  1W0B A;  2VL8 A;  3RIU C;  2YKS A;  2A72 A;  1NEN A;  4OK0 A;  5LBQ B;  5HYA A;  5AQG B;  3OTO T;  3K8P C;  1J5E T;  3VRA A;  2XQ5 A;  4U2Z A;  2FJE A;  3GWH A;  4Z90 A;  3ZJ2 A;  2M6B A;  1T72 A;  4CXY A;  3CX8 B;  3EDU A;  1G73 A;  3O1I A;  1HNZ T;  4DV4 T;  2XTL A;  3VRB A;  1UUS A;  3NZP A;  3M65 A;  4EOZ B;  4UEM A;  1WFD A;  3RIU A;  5KDM C;  4E7Z A;  4IHJ E;  5J0Z A;  3F57 A;  2X68 A;  4AKH A;  1VRB A;  4QH1 A;  4KMC A;  4PFO A;  2LRK A;  1I6Z A;  1YKH B;  3BQK A;  5EZY E;  3UUX B;  3ZMT B;  5AQT B;  5LYJ E;  3VU7 H;  1SE7 A;  2E2A A;  5BR8 T;  3Q5W A;  4B3R T;  4DID B;  2KLQ A;  3P50 A;  3N9Q A;  5J2T E;  4QH5 A;  4H9P C;  4QX8 B;  3IBP A;  3AE5 A;  4AQG A;  4HFI A;  4JI1 T;  4PK6 A;  4EIW A;  4HWD A;  4WBO A;  2D0T A;  4CZZ B;  2CHN A;  3J7Y q;  3O1J A;  3G06 A;  3E08 A;  4BA9 A;  3LG7 A;  4ISS A;  4TN7 B;  3C51 A;  4HFV A;  4B3S T;  3MKD A;  2DWK A;  1J1J A;  5L3C B;  4IL4 A;  2RPA A;  2BG9 B;  4OX9 T;  4HWI B;  4TUY E;  5HEJ A;  2VKO A;  1YD8 G;  5HXS A;  2X9Y A;  2LOS A;  1R8I A;  3CWZ B;  4NXM T;  4I43 B;  2DNX A;  2IC9 A;  2BZB A;  1KEY A;  2ZM0 A;  2VKD A;  3PJA J;  2UUC T;  2LSI A;  1VCT A;  4G2A A;  3JCF A;  2XSA A;  5ETW A;  3PDY A;  3C50 A;  2XAJ B;  2N9D A;  4Z91 A;  4DO0 A;  4XBF B;  1MIW A;  4JUY A;  2PG8 A;  2LHR A;  2WB5 A;  5F5W A;  5CA0 E;  3NVO A;  3V5S A;  2UXB T;  2CEA A;  2V26 A;  3RC3 A;  1FEW A;  5FP3 A;  2G0U A;  2XQY A;  3QNU A;  5FYM A;  4UV9 B;  3I1A A;  2XAG B;  4WNK A;  4ERR A;  4LF8 T;  2BKP A;  1X79 A;  2N2N A;  2DL1 A;  1W09 A;  4LF4 T;  2LSG A;  2V7K A;  1NAF A;  4J2C A;  3I0O A;  5AQV B;  5HEH A;  3W15 B;  3RQW A;  3EVY A;  3UTK A;  2IUB A;  4DV5 T;  4DR1 T;  4IDQ A;  3RLF F;  4KBM B;  4L9I A;  2PBI A;  3AXJ B;  4TWH A;  4GOU A;  1H7C A;  1XWM A;  2IW5 B;  4TZ4 C;  5LJM A;  2MPK A;  4IDZ A;  3ZST A;  3LK3 B;  3HKB E;  3LK4 2;  4YTN A;  1CHU A;  3BK9 A;  3LDQ B;  2E9X C;  4EV6 A;  2E9X D;  4PJJ A;  4EZH A;  1GQE A;  2QRX A;  5JR9 B;  5CB4 E;  3EAM A;  1YQ4 A;  4YJ2 E;  2WDV A;  3CQC B;  3Q5E A;  2BG9 E;  3GN5 A;  5DQW A;  3FBZ A;  4TV9 E;  2X51 A;  3PU8 A;  5GON E;  1I94 T;  2CXF A;  2CXL A;  5HEO A;  4HTE A;  2CM0 A;  5LG4 A;  4GKK T;  4EB6 E;  2LSK A;  3AAA B;  3L8R A;  4X20 E;  2RP4 A;  3JAF A;  4DV7 T;  2X0Y A;  2V6Y A;  5JDF A;  4O4J E;  1D1B A;  4JI6 T;  4GKJ T;  3ZCI A;  2ZM2 A;  4ADZ A;  3AE4 A;  5C2T A;  5ABF A;  1D0Z A;  2VAS A;  3EDV A;  1W9R A;  4YFS A;  2E9X A;  3EI0 A;  4MBQ A;  2XAS B;  3IHR A;  4H9O C;  3ZYM A;  2X9W A;  4EAH A;  3AEF A;  3ESL A;  2EHO B;  2HH7 A;  2X66 A;  4YTM A;  2K48 A;  4TV8 E;  1D1C A;  4DUZ T;  2HPL A;  3UU3 A;  4PJM A;  1IZN B;  5KX5 E;  3AE7 A;  1WYC A;  1HNW T;  3KVA A;  3VR8 A;  2QYW A;  2VVN A;  5L47 A;  4PJL A;  3O1H A;  5LP6 E;  4HE8 A;  2HN2 A;  1SUM B;  2H7O A;  2BKO A;  5JDH A;  3GMI A;  2XAF B;  3CX7 B;  4YHJ A;  1LKX A;  1ZP0 A;  4CXX A;  3ZPO A;  5JRC B;  2WQY A;  4IST A;  2X0H A;  3RH3 A;  3CK6 A;  3RF1 A;  3L39 A;  2UXX B;  5HAX A;  1FMW A;  1DU2 A;  3ZYK A;  1HNX T;  3OPC A;  5H6R B;  3ZEF B;  1LVK A;  5HXH A;  5FMN A;  4U7I A;  4KI0 F;  4IE7 A;  3B57 A;  4HFH A;  4ASK A;  3L09 A;  3TLS A;  5F3J A;  3AEG A;  3PUR A;  1UCU A;  5TAO A;  3CQX C;  3ZN0 B;  5EK4 A;  3WAJ A;  4PK5 A;  3NBX X;  2VKJ A;  1IBL T;  3HA4 A;  5LHI B;  2VQF T;  4QKN A;  2YK0 A;  5LGT B;  2XQ6 A;  3KDS E;  3SFE A;  2HPJ A;  3I9Y A;  3NRY A;  5LHG B;  2WWU A;  3AE2 A;  3FZH B;  2LSY A;  1KNP A;  2FJA A;  3HKD E;  2XQA A;  2V5D A;  4HEA A;  3H37 A;  5HCJ A;  2V8S V;  4I55 E;  1HG5 A;  2VL0 A;  3N2G E;  1IAP A;  3NKZ A;  4ILC A;  5LGU B;  3FZF B;  3IF8 B;  2W2U A;  5IWA T;  4DUY T;  3TLW A;  4X1I E;  5E0O A;  4O2A E;  4FI5 A;  2K24 A;  3B13 A;  4DV6 T;  4A98 A;  3ZMS B;  1JNR A;  1XNR T;  2CPT A;  2F4V T;  2LRL A;  3B5M A;  4NUV A;  3FXE B;  3T1Y T;  5IUX A;  3RRW A;  2J4G A;  2XM2 A;  4YSX A;  3FHN A;  1QUU A;  2CMR A;  1Y64 B;  3F2E A;  5F8P A;  3UU6 A;  4ZXL A;  3P7I A;  2CBI A;  2XQ4 A;  2FBW A;  4JI5 T;  1EZ3 A;  2VVS A;  1MMN A;  1MIV A;  2A9U A;  3OJA A;  1U5P A;  1QSD A;  2YDR A;  3LBX A;  2C5I T;  4KHZ F;  3CIR A;  3P4P A;  2KSR A;  2K9A A;  1G8X A;  5H6Q B;  2J47 A;  2KIN B;  2M67 A;  4BJN A;  4F8H A;  3SRZ A;  4QXB B;  5AQP B;  3RIA A;  5HXE A;  3O4X E;  3P4W A;  1IBM T;  4OFZ A;  3ONJ A;  1UX4 A;  2W62 A;  5L3D B;  4A5X A;  4NIQ A;  2ZM8 A;  3N9P A;  4P0B A;  1NWM X;  3ZLI A;  2XJ7 A;  5JDG A;  3R6N A;  3V5U A;  2CBJ A;  4MLK A;  4QH4 A;  3TLV A;  1KF6 A;  2C0S A;  2VWA A;  5LXT E;  4AXP A;  1MMA A;  4X64 T;  2QVA A;  4DMV A;  1XMQ T;  2XHE B;  3F31 A;  4Q25 A;  4YSY A;  4U74 A;  3AEE A;  1UGO A;  2LT3 A;  4OHF A;  3LJC A;  2IIU A;  2PFV A;  3CX6 B;  3UUL A;  4MFR A;  5EK2 A;  4K0U A;  5AQF B;  4UVC B;  4TWF A;  2W0G A;  2XAQ B;  5AQI B;  2IAK A;  4X66 T;  4HFD A;  2Y6X A;  1IJ5 A;  2W61 A;  3AA6 B;  2YU1 A;  3HI2 A;  3HL6 A;  3K3N A;  3ZYL A;  4JYA T;  2YDQ A;  3H3A A;  2Y8D A;  4IL9 A;  4EGW A;  2LLY A;  3QUJ A;  4IT4 A;  3ONL C;  4DV0 T;  3K3Q C;  2X0L B;  5LJN A;  4UXN B;  2FJD A;  2NOX A;  4P1N A;  3KIN B;  1LVF A;  4H9S E;  1VCS A;  2WM9 A;  2WZI A;  4P09 A;  4NXN T;  1M7K A;  5LGN B;  3HKE E;  4HFC A;  1HCI A;  3TKL B;  3ANW A;  2XQ3 A;  2CLY C;  3MJX A;  1FIO A;  2WBL A;  2JQK A;  3MZK B;  2WY2 A;  2CWO A;  2VKH A;  2HN1 A;  3DJB A;  2KND A;  4PK4 A;  4DV2 T;  3MXZ A;  5BMV E;  2PJQ A;  1HTJ F;  2J1D G;  1OED A;  1N34 T;  4YJ3 E;  3EHZ A;  5AQQ B;  2BS4 A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  4HWD A;  5AQN B;  3FZH B;  3FZL B;  5AQV B;  5AQT B;  5AQL B;  1M62 A;  5AQM B;  4HWI B;  1M7K A;  2D9D A;  5AQH B;  5AQR B;  1HX1 B;  3FZM B;  4HWC A;  5AQG B;  5AQF B;  3FZK B;  5AQU B;  1UGO A;  3FZF B;  5AQI B;  5AQO B;  1T7S A;  3LDQ B;  3M3Z B;  1UK5 A;  5AQP B;  5AQJ B;  5AQQ B;  3A8Y C;  5AQS B;  5AQK B;  4HWF A;  4HWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...