3LDQB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords Heat shock cognate 71 kDa protein
publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3ldqB00
5AQRB 5AQQB 3FZHB 4HWDA 3LDQB 5AQKB 5AQUB 3FZKB 5AQVB 2D9DA 5AQSB 1M62A 1UK5A 1I6ZA 3FZFB 5AQIB 5AQNB 4HWFA 5AQGB 1HX1B 3FZMB 5AQPB 1T7SA 4HWCA 5AQLB 5AQJB 5AQMB 1M7KA 4HWIB 1UGOA 3FZLB 5AQOB 3A8YC 4HWHA 3M3ZB 5AQTB 5AQFB 5AQHB
chains in the Genus database with same CATH superfamily
4JEUB 2CLYB 2V5DA 3O1JA 1HG2A 5LHIB 2CCQA 4AKGA 2E9XA 3SWHA 4DR7T 2PJQA 4EZ4A 4X1YE 3RRWA 4U74A 4WBNE 3PUSA 3NKZA 4ANJA 5CA1E 2W2UA 5HEGA 4CN4A 2P9BA 4J2CA 4PFOA 2NR4A 4AISA 3EVYA 2LJLA 4UEMA 1SUMB 2BS4A 5AQPB 3ZLIA 2ODUA 4NUVA 5JR9C 2FBWA 1BR4A 2K3WA 5FNVE 2UUAT 2XQ8A 2UUBT 4OX9T 1KEYA 4L0RA 4P0BA 3OKQA 2L8KA 5ETWA 4DR6T 3JC6D 1HR0T 4FI5A 2V7JA 2VKHA 5HCMA 3AEAA 2ZLYA 3VRAA 2NW8A 3QUJA 3CX8B 1VRBA 4HEAA 4EOZB 5BMVE 5LGUB 2LSKA 4AQYT 5AQGB 2WZIA 4A56A 2CWOA 4PJLA 2RA1A 3B5MA 2JMKA 3SFEA 2DL1A 5FMNA 5CA0E 2SPCA 4HN9A 4EB6E 3PE0A 2WU5A 3ZT6A 1N36T 5HYAA 5L4EA 1L0VA 1SA0E 4LF6T 2HPLA 2R6GF 1E2AA 2DI4A 4GK5E 4DV3T 4HWDA 4O8SA 3Q5WA 5AFUL 2WWUA 2NTYA 4PAGA 3Q5DA 3OBVE 2DLRA 3MJXA 4AKRB 1JNRA 2A2FX 2ZM2A 4I55E 3ZMUB 5JR9B 1MIWA 3ZPOA 1HS7A 5LBQB 4QH5A 4JEHB 3ZCIA 1IJ5A 4ASKA 4UXNB 5LG4A 2WB5A 3OVUA 2MTQA 5JDFA 5JQGE 3HI2A 3LK2B 5LP6E 5AQUB 1T8BA 4IHJE 1SE7A 3AE6A 3A8YC 2H7VC 2CA5A 3M65A 5J1GA 3FBLA 4BJNA 2WM9A 3AE1A 3Q2MA 4DMWA 1IAPA 3PUQA 3UQ4A 4HWIB 1YW0A 2KT9A 2IDOB 2IW5B 5HXEA 1D0YA 5LHGB 2XQ7A 1I94T 2KXPB 4YHJA 2XAGB 5AQQB 2H3RA 1VCTA 3KBUA 5L3GB 3AAAB 5KX5E 1UURA 4GIWA 1LRZA 3CPZA 3UU4A 4X5TA 2IAKA 1UX4A 3RI5A 4UVAB 4ZI2C 1I6ZA 4ZOLE 2Q9QD 3IA3A 2CMRA 4I4TE 3LFMA 2XQAA 3O9XA 2WS3A 4GYRA 3ONLC 2QYWA 2NW9A 5L47A 1BR0A 3ANWB 4HFIA 3I9YA 2ZM8A 1WR0A 3RKGA 5LBMA 4P0AA 4YTNA 1E7PA 3RX6A 5IHYA 3C98B 4UF0B 1MMDA 3C64A 3MK7C 4H9NC 4CXWA 5CB4E 3FZHB 5TAOA 1OXZA 2KLQA 3PU8A 2LSIA 1UCUA 1XDOA 2KWIB 4YSXA 4H9PC 5ABFB 4JI7T 2RPAA 3I0QA 3VR8A 3E0ZA 2CEAA 2ZM6T 3FXDB 4KHPT 2X0YA 4DBRA 2CBJA 1G73A 1YQ3A 4X1KE 5GONE 1GQEA 1MMAA 5AQRB 3AEFA 4PJNA 4JI3T 1D1BA 3AB3B 4FJOA 4PW8A 4QXHB 3WI3A 2KMFA 3WAKA 3AE2A 3GMIA 3LSVA 4G63A 2CRBA 2M6BA 4DIDB 2W61A 4DUYT 3HKEE 4IIJE 2XM1A 1X79A 3GN5B 3JAEA 2XUEA 1N34T 4XZCA 3QB5A 4X64T 3KVAA 2WMNA 3KFWX 3K3OA 3UU5A 3QK6A 1WFDA 5FXZA 2DWGA 2QVAA 1U4QA 3EUHA 2X51A 3AVRA 1R8IA 4ILCA 2CHOA 5LB7B 4U7YA 2B1EA 3E22E 4DR4T 4MHCA 5KDMC 3KV6A 1WR6A 5AQOB 3Q9DA 4ZI3C 2F4VT 5JREA 4TNWA 2FUPA 2VL8A 5L3BB 2B76A 3AVSA 2NOXA 4EGWA 2VQFT 4BAYB 4QH1A 3FB2A 1WLXA 1W9RA 4ZS3A 4IE7A 2JIWA 3JCFA 2VWAA 3IF8B 4QXBB 4JI4T 3UFGA 3AA1B 5AQHB 4ADZA 5AQKB 5IWAT 5H6QB 4UV8B 3ZT7A 2CXDA 2LM9A 4CI1B 4YSZA 1QLBA 4NXNT 1ZV4X 2UU9T 2G0UA 3H3MA 3BQIA 3LK3B 1B7TA 1LKXA 3QB5K 4DR1T 1KNPA 3ZN0B 3TLTA 2JQHA 2XJ7A 3VU7H 5DQVA 2AXDS 1UK5A 4NUUA 2X0HA 2BZBA 4HWFA 2X67A 5AQMB 3RC3A 2WMOA 3V5UA 1FJGT 4IDPA 2MAWA 3E08A 3UU8A 2E5VA 2NW7A 1HTJF 3ZJ2A 1YKHB 3ABVA 2V7KA 2XASB 5BR8T 2YDSA 1VOMA 3IHRA 2D0UA 1U5PA 2JQ9A 2CPTA 1OEDE 3F31A 4UIGA 2PG8A 5DJQC 4LFCT 2V7MA 3B13A 1NEKA 2LOSA 5F8PA 4U7IA 1X9BA 1UGOA 5JH7E 2CWYA 5IYZE 3I9WA 3OPCA 3TLUA 4CZZB 1J5WA 1EZ3A 5ABHA 4ERRA 4ISTA 4QX8B 3CX6B 2LRKA 4OYKA 2DCFA 4LMLA 2JMHA 4YXDA 2WP9A 1ZEEA 4U33A 5FXVA 5FXWA 4A5XA 2J1DG 3RYIE 4MFRA 4GYSA 2KSRA 2W0GA 2XTLA 2H89A 2JJ9A 4XAXB 4EAHA 3FZMB 4EXTA 4WZXA 5J2UE 1OEDC 2C5JA 3N5LA 3C4ZA 1HNXT 1G8XA 3N9LA 4AI6A 5LXTE 2FJDA 2JQKA 4O4IE 4AQGA 3LBXA 2XAFB 2Q9QA 2LHRA 3LJCA 3UFEA 4O2BE 1XDPA 3P4PA 2X9HA 3ZMTB 2NWBA 3AA6B 3PUYF 3AE7A 3PJAA 4KP3C 3IEEA 2X0LB 3U3IA 3ZC1A 2VVSA 4L5GA 1BR1A 1T72A 2NTXA 3RHWA 2ACZA 3AXJB 5HXHA 4DV7T 3MXZA 2VVNA 3N2GE 2DHRA 4NIQA 1W09A 1IBLT 1S35A 1LVKA 4QWNB 5LMUT 5LMNT 2M67A 2VB6A 2LT3A 2BG9C 3VKHA 4HTEA 4HFHA 2W63A 3OYZA 2MYSA 3NBXX 3RIUC 2X68A 4BJMA 3LG7A 2UXCT 1HFAA 3MACA 3AE9A 2BS3A 3KBTA 4MALA 4AXPA 3ZMZB 5HAXA 4JI0T 1MMGA 1N32T 4CXXA 2EHOC 5L3EB 1HF8A 5LOVE 5HEUA 3ZC0A 2OLTA 4DV2T 1OEDB 2PFVA 5JRCA 3ZCJA 4HFBA 1NAFA 2XSBA 3JAFA 5JDHA 4H9QC 2AE9A 4ZEYA 2LRLA 4B3RT 4F6RC 3AAIA 4O2AE 5FY7A 2N9DA 3FZLB 4YLHA 4ZHQE 2DWKA 4DMVA 3CVRA 4O4LE 4A98A 3UU6A 1YXRA 2ZM0A 2C0SA 1KNZA 3A7MA 3AA0B 4I43B 3AEBA 4IDZA 4HFDA 4WW0A 3O1HA 4JI6T 3ZMSB 2VKOA 1E1HB 4IL4A 2XAHB 2V6YB 3UUXB 4ZI2D 4LMKA 3CQGB 1OWAA 2YDQA 3KINB 4QKNA 4IDOA 3T8OA 2CHNA 4QH4A 2BG9B 2KZ7B 2LKGA 5M4YA 4WYVA 3TLVA 5CFBA 2E9XC 4YFSA 2W66A 2Y48B 4Z90A 2V26A 1ZHCA 1IZNB 3BQKA 3CMLA 3N9PA 3IBPA 3OJAA 4Z8XA 4YT0A 2H7OA 2EHOB 4EEBA 1Z0PA 2YU2A 4AIUA 2K48A 2W4XA 4UVCB 4ZZBA 4GKKT 5EK4A 2C5KT 3PUZF 5C3JA 2IIUA 2LE8A 3Q5XA 3CWZB 2C5IT 4DUZT 4U2YA 2A9UA 5LJNA 3UTKA 1QUUA 1D1AA 2MOZA 4JI5T 5AQJB 3N9MA 4ILAA 4ZXLA 3K3NA 2XQ4A 3F57A 2XQ3A 4TUYE 2K5BB 1XZYA 4YY3T 3AE3A 5L4HA 5DQWA 2HH7A 1W0AA 5E0OA 1MMNA 1M7KA 2V7LA 2WDQA 2UUCT 2XQ9A 3CK6A 3ONJA 4P1NA 3F2EA 2XSAA 3PUGA 3KVBA 3B57A 3RC8A 4DV0T 2W67A 4A97A 3C4WA 3AEGA 3FBZA 5FY1A 4IREA 2E9XB 4B3ST 3MZKB 1UX5A 5AQVB 3RF1A 5J0ZA 1D1CA 1MNEA 3PUVF 4CQIA 4ZI3D 4OFZA 1HNWT 1YKEB 2D2SA 5JR9A 2XZEA 5LGTB 2V8SV 2XPKA 3RKOA 1VCSA 4ZS2A 4LF7T 4CXYA 4JUYA 4E7ZA 5H6RB 2UXBT 3AEDA 3C4XA 2Z6EA 4X1IE 3AAEB 1D0ZA 1FMVA 4HWHA 4EV6A 3DJBA 4UV9B 3R84B 4C91A 1WRDA 3T1HT 3P50A 2YKSA 2LEHA 4IL9A 2J62A 4LF8T 4UR9A 5AQTB 3QOFA 3C50A 3PTRB 5C2TA 3NRYA 1YD8G 3RQUA 4QHOA 1YQ4A 3SS1A 5HXCA 1M62A 4TX5A 5FXXA 3N9NA 4IE0A 5AQNB 5HXSA 4DV4T 3UU3A 5JDNA 4B6XA 4IDNA 3ZYKA 2LOPA 2X9WA 1Y64B 3K1SA 2ES0A 2QA7A 2CLYC 2WQYA 4BA9A 3PV0F 2RP4A 2GK9A 3FZFB 3PURA 3V5SA 3J9X1 4PJJA 4PFPA 2E5LT 2UXDT 1XMOT 3OYXA 4TWFA 3DP7A 2DNXA 3M3ZB 4EEDA 2X66A 3P4SA 3ETUA 3ZSSA 2D0TA 2D5UA 5HWYA 4AQFA 2D9DA 3AEEA 3A5XA 3ANWA 3RYFE 3VHLA 5F5WA 2KWHA 4JI1T 2V1DB 3UUNA 2PBIA 4UF0A 2X9XA 3ZYLA 2L9QA 4Q25A 5LA6E 2BKNA 5AQLB 4V1Av 4IT4A 2WAUA 4H63V 5ABFA 3NRXA 4KHZF 3RYCE 1IJ6A 2KNDA 2VL0A 3GWHA 1SHZC 3N9QA 5EK2A 4MBQA 1D0XA 4NXMT 2K9AA 4TV8E 2XY8B 1XWMA 3TKLB 2LM2A 3P7IA 4XBFB 4E7SA 1UUSA 3UT5E 4YHHT 1Y01A 4QX7B 3FZKB 1FMWA 4YTMA 2I6HA 5A1LA 3GN5A 4CN1A 2N1GA 5KMGP 1W0BA 3MKDA 3RLFF 2LLYA 2VQET 4F8HA 2WWVA 3MA9A 4PNIA 3R6NA 4DR5T 5HXRA 2YOEA 1HG5A 2BG9E 2VK9A 2NP9A 4YSYA 1T98A 2LHNA 3L09A 3ZYMA 5ABEA 3CX7B 3GA8A 3HKCE 2HHHT 2YK0A 4H9OC 2YEVC 3ZKRA 5LG3A 3JADA 4AKIA 5AQSB 5LYJE 4H9SE 4OHFA 4B3TT 4KBMB 4I0UA 3SRZA 5HEHA 3I1AA 3WAJA 5CJ5A 1WCRA 4HE8A 2CM0A 3KV4A 3HKBE 4HFCA 1HNZT 3LDQB 3QNUA 2A3DA 4DV1T 3UUBA 4PK4A 5LGNB 2BDEA 3Q5EA 3CIRA 4DNDA 5JDLA 4TZ4C 1AJ3A 2V6XA 4TV9E 1DU2A 2L3LA 5IUXA 2LSJA 5EK3A 2EHOD 3JC6C 4KI0F 4X66T 3AE8A 1IBMT 3VKGA 3I0OA 5L2LA 4WNKA 4DV6T 4ILBA 3PUXF 3EAMA 3P8CD 5HWXA 3J7Yq 1MNDA 1XNRT 2E8IA 3NZPA 5J2TE 5C8YE 5L3FB 2FJAA 2LKHA 5FVLA 4GKJT 2J47A 4IE6A 2WZHA 3TLSA 5L3DB 3NVOA 4ZZCA 3L3PA 1QSDA 4TWHA 5JVDE 3BK9A 4HKAA 2Y6XA 4NPPA 2JRKA 2J4GA 4YJ2E 3UQ7A 4AKHA 2VASA 3RYHE 4KMCA 1Z8UA 3RRCA 3HL6A 2HN1A 2IMLA 2WDRA 3QC9A 4AQFC 1S94A 5HEJA 3FXEB 1N33T 2MBGA 3P4QA 3PUAA 3P4WA 1ZOYA 3EHZA 2OA5A 2E9XD 3CQCB 5F3JA 2VURA 2CXFA 2WSSV 1HX8A 1ZP0A 4GOUA 3O1IA 5LNKA 1CHUA 5JDQA 4IDQA 4DV5T 4DR3T 1BR2A 2YU1A 4TWDA 4DR2T 1J5ET 1T7SA 4H63H 4ISSA 1FEWA 3ESLA 1H7CA 4Z91A 3SFDA 5KXJA 4N78D 2Y8DA 4HFVA 2UXXB 2LSGA 4CI3B 5AQIB 2A72A 2XM2A 3KV9A 3ZMVB 2X9YA 3AECA 5CGMA 3EDVA 3O4XE 2BVLA 4MLKA 2N2NA 4C90A 1O3XA 3KV5A 5LHHB 2OV9A 4K0KT 3ETVA 1NWMX 2XQ6A 1XNQT 4IE5A 4COFA 4M1PA 2KINB 2WU2A 4YJ3E 4ZI7E 3BQLA 4CN6A 4ILUA 4JV5T 2M6IA 1JNZA 4K0UA 2W62A 3RPUA 4U3CA 4X65T 5FP3A 3PJAJ 4L9IA 4LFBT 4HFEA 3PU3A 2I0MA 4DBQA 3D0TA 5FL0A 5HCJA 3TLWA 1HX1B 3AE5A 3RIAA 3LK42 4LMJA 3EABA 3T1YT 4LF9T 4JLEA 2XQYA 2Q9QC 3AXJA 4EYYR 3X1DA 1MIYA 2K24A 3EI0A 3RIFA 3CKDA 3PUWF 3ZJ1A 4HGAA 2JQQA 1WYBA 3AA7B 1KK7A 4O4JE 4O4HE 3UULA 1XMQT 3N9OA 5ABGA 4X20E 5FKYA 4JBWF 4OK0A 2FJEA 2BVMA 2HN2A 4I50E 5EZYE 2XAQB 1FIOA 3SOLA 4AKLA 5LJMA 3NZQA 2VKDA 2XHEB 3RGLA 4WBOA 5DABA 2CE7A 4OYJA 2CXLA 4EIWA 2QGSA 2IUBA 4JI2T 5FY0A 5FYMA 1OEDA 2H88A 1HCIA 2WBLA 3KDSE 2VKJA 2W00A 2MPKA 4PJMA 3CQXC 2ZMAA 3AE4A 4IE4A 5AQFB 2ACXA 3OTOT 4LFAT 5HEOA 4EYUA 2BBHA 1KFYA 3L8RA 4TNVA 2XQ5A 3S4UA 4YTPA 5JDGA 4UVBB 2I59A 3H37A 2IC9A 3NWIA 3U78A 3UUMA 3LBXB 3HR0A 2Q9QB 2V6YA 4G2AA 4U2ZA 4KX6A 4GK0E 2BBJA 5FVKA 1ZKEA 3P4RA 4U31A 2BG9A 3ZEFB 3ONXA 1IBKT 4KUMB 4IGUA 4PK5A 2BKOA 2CBIA 4DO0A 1LVFA 4PK6A 3RIUA 3EDUA 4H9RC 3K8PC 2IC6A 2YDRA 2V5CA 4HWCA 4JI8T 2YN6A 3ZN1B 2HPJA 4LF5T 3HA4A 5ADXL 5JTGA 2WCAA 2QRXA 2EHOA 1NENA 3ZSTA 1MIVA 3W15B 5LCYA 5L3CB 3K3QC 3N2KE 2XAJB 3RH3A 4TN7B 2BS2A 3N2OA 5FL1A 2ODVA 4JYAT 4QXCB 4B3MT 2FJBA 2JPFA 3DTOA 2PTFA 3ZT5A 5JRCB 1J1JA 1KNRA 2YINA 2WDVA 1V9DA 3C51A 3HKDE 4CI2B 3FHNA 3PDYA 1US7B 2IHR1 3L39A 4X62T 5JDMA 2V7IA 4UELA 4LF4T 4U72A 2BKPA 1WYCA 4EZHA 1KF6A 4DVDA 3VR9A 2LSYA 2UXNB 3VRBA 2WY2A 3RQWA 4P09A 1CUNA 3G06A 3H3AA 2E2AA
chains in the Genus database with same CATH topology
5AQRB 5AQQB 3FZHB 4HWDA 3LDQB 5AQKB 5AQUB 3FZKB 5AQVB 2D9DA 5AQSB 1M62A 1UK5A 1I6ZA 3FZFB 5AQIB 5AQNB 4HWFA 5AQGB 1HX1B 3FZMB 5AQPB 1T7SA 4HWCA 5AQLB 5AQJB 5AQMB 1M7KA 4HWIB 1UGOA 3FZLB 5AQOB 3A8YC 4HWHA 3M3ZB 5AQTB 5AQFB 5AQHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQR B;  5AQQ B;  3FZH B;  4HWD A;  3LDQ B;  5AQK B;  5AQU B;  3FZK B;  5AQV B;  2D9D A;  5AQS B;  1M62 A;  1UK5 A;  1I6Z A;  3FZF B;  5AQI B;  5AQN B;  4HWF A;  5AQG B;  1HX1 B;  3FZM B;  5AQP B;  1T7S A;  4HWC A;  5AQL B;  5AQJ B;  5AQM B;  1M7K A;  4HWI B;  1UGO A;  3FZL B;  5AQO B;  3A8Y C;  4HWH A;  3M3Z B;  5AQT B;  5AQF B;  5AQH B; 
#chains in the Genus database with same CATH topology
 4JEU B;  2CLY B;  2V5D A;  3O1J A;  1HG2 A;  5LHI B;  2CCQ A;  4AKG A;  2E9X A;  3SWH A;  4DR7 T;  2PJQ A;  4EZ4 A;  4X1Y E;  3RRW A;  4U74 A;  4WBN E;  3PUS A;  3NKZ A;  4ANJ A;  5CA1 E;  2W2U A;  5HEG A;  4CN4 A;  2P9B A;  4J2C A;  4PFO A;  2NR4 A;  4AIS A;  3EVY A;  2LJL A;  4UEM A;  1SUM B;  2BS4 A;  5AQP B;  3ZLI A;  2ODU A;  4NUV A;  5JR9 C;  2FBW A;  1BR4 A;  2K3W A;  5FNV E;  2UUA T;  2XQ8 A;  2UUB T;  4OX9 T;  1KEY A;  4L0R A;  4P0B A;  3OKQ A;  2L8K A;  5ETW A;  4DR6 T;  3JC6 D;  1HR0 T;  4FI5 A;  2V7J A;  2VKH A;  5HCM A;  3AEA A;  2ZLY A;  3VRA A;  2NW8 A;  3QUJ A;  3CX8 B;  1VRB A;  4HEA A;  4EOZ B;  5BMV E;  5LGU B;  2LSK A;  4AQY T;  5AQG B;  2WZI A;  4A56 A;  2CWO A;  4PJL A;  2RA1 A;  3B5M A;  2JMK A;  3SFE A;  2DL1 A;  5FMN A;  5CA0 E;  2SPC A;  4HN9 A;  4EB6 E;  3PE0 A;  2WU5 A;  3ZT6 A;  1N36 T;  5HYA A;  5L4E A;  1L0V A;  1SA0 E;  4LF6 T;  2HPL A;  2R6G F;  1E2A A;  2DI4 A;  4GK5 E;  4DV3 T;  4HWD A;  4O8S A;  3Q5W A;  5AFU L;  2WWU A;  2NTY A;  4PAG A;  3Q5D A;  3OBV E;  2DLR A;  3MJX A;  4AKR B;  1JNR A;  2A2F X;  2ZM2 A;  4I55 E;  3ZMU B;  5JR9 B;  1MIW A;  3ZPO A;  1HS7 A;  5LBQ B;  4QH5 A;  4JEH B;  3ZCI A;  1IJ5 A;  4ASK A;  4UXN B;  5LG4 A;  2WB5 A;  3OVU A;  2MTQ A;  5JDF A;  5JQG E;  3HI2 A;  3LK2 B;  5LP6 E;  5AQU B;  1T8B A;  4IHJ E;  1SE7 A;  3AE6 A;  3A8Y C;  2H7V C;  2CA5 A;  3M65 A;  5J1G A;  3FBL A;  4BJN A;  2WM9 A;  3AE1 A;  3Q2M A;  4DMW A;  1IAP A;  3PUQ A;  3UQ4 A;  4HWI B;  1YW0 A;  2KT9 A;  2IDO B;  2IW5 B;  5HXE A;  1D0Y A;  5LHG B;  2XQ7 A;  1I94 T;  2KXP B;  4YHJ A;  2XAG B;  5AQQ B;  2H3R A;  1VCT A;  3KBU A;  5L3G B;  3AAA B;  5KX5 E;  1UUR A;  4GIW A;  1LRZ A;  3CPZ A;  3UU4 A;  4X5T A;  2IAK A;  1UX4 A;  3RI5 A;  4UVA B;  4ZI2 C;  1I6Z A;  4ZOL E;  2Q9Q D;  3IA3 A;  2CMR A;  4I4T E;  3LFM A;  2XQA A;  3O9X A;  2WS3 A;  4GYR A;  3ONL C;  2QYW A;  2NW9 A;  5L47 A;  1BR0 A;  3ANW B;  4HFI A;  3I9Y A;  2ZM8 A;  1WR0 A;  3RKG A;  5LBM A;  4P0A A;  4YTN A;  1E7P A;  3RX6 A;  5IHY A;  3C98 B;  4UF0 B;  1MMD A;  3C64 A;  3MK7 C;  4H9N C;  4CXW A;  5CB4 E;  3FZH B;  5TAO A;  1OXZ A;  2KLQ A;  3PU8 A;  2LSI A;  1UCU A;  1XDO A;  2KWI B;  4YSX A;  4H9P C;  5ABF B;  4JI7 T;  2RPA A;  3I0Q A;  3VR8 A;  3E0Z A;  2CEA A;  2ZM6 T;  3FXD B;  4KHP T;  2X0Y A;  4DBR A;  2CBJ A;  1G73 A;  1YQ3 A;  4X1K E;  5GON E;  1GQE A;  1MMA A;  5AQR B;  3AEF A;  4PJN A;  4JI3 T;  1D1B A;  3AB3 B;  4FJO A;  4PW8 A;  4QXH B;  3WI3 A;  2KMF A;  3WAK A;  3AE2 A;  3GMI A;  3LSV A;  4G63 A;  2CRB A;  2M6B A;  4DID B;  2W61 A;  4DUY T;  3HKE E;  4IIJ E;  2XM1 A;  1X79 A;  3GN5 B;  3JAE A;  2XUE A;  1N34 T;  4XZC A;  3QB5 A;  4X64 T;  3KVA A;  2WMN A;  3KFW X;  3K3O A;  3UU5 A;  3QK6 A;  1WFD A;  5FXZ A;  2DWG A;  2QVA A;  1U4Q A;  3EUH A;  2X51 A;  3AVR A;  1R8I A;  4ILC A;  2CHO A;  5LB7 B;  4U7Y A;  2B1E A;  3E22 E;  4DR4 T;  4MHC A;  5KDM C;  3KV6 A;  1WR6 A;  5AQO B;  3Q9D A;  4ZI3 C;  2F4V T;  5JRE A;  4TNW A;  2FUP A;  2VL8 A;  5L3B B;  2B76 A;  3AVS A;  2NOX A;  4EGW A;  2VQF T;  4BAY B;  4QH1 A;  3FB2 A;  1WLX A;  1W9R A;  4ZS3 A;  4IE7 A;  2JIW A;  3JCF A;  2VWA A;  3IF8 B;  4QXB B;  4JI4 T;  3UFG A;  3AA1 B;  5AQH B;  4ADZ A;  5AQK B;  5IWA T;  5H6Q B;  4UV8 B;  3ZT7 A;  2CXD A;  2LM9 A;  4CI1 B;  4YSZ A;  1QLB A;  4NXN T;  1ZV4 X;  2UU9 T;  2G0U A;  3H3M A;  3BQI A;  3LK3 B;  1B7T A;  1LKX A;  3QB5 K;  4DR1 T;  1KNP A;  3ZN0 B;  3TLT A;  2JQH A;  2XJ7 A;  3VU7 H;  5DQV A;  2AXD S;  1UK5 A;  4NUU A;  2X0H A;  2BZB A;  4HWF A;  2X67 A;  5AQM B;  3RC3 A;  2WMO A;  3V5U A;  1FJG T;  4IDP A;  2MAW A;  3E08 A;  3UU8 A;  2E5V A;  2NW7 A;  1HTJ F;  3ZJ2 A;  1YKH B;  3ABV A;  2V7K A;  2XAS B;  5BR8 T;  2YDS A;  1VOM A;  3IHR A;  2D0U A;  1U5P A;  2JQ9 A;  2CPT A;  1OED E;  3F31 A;  4UIG A;  2PG8 A;  5DJQ C;  4LFC T;  2V7M A;  3B13 A;  1NEK A;  2LOS A;  5F8P A;  4U7I A;  1X9B A;  1UGO A;  5JH7 E;  2CWY A;  5IYZ E;  3I9W A;  3OPC A;  3TLU A;  4CZZ B;  1J5W A;  1EZ3 A;  5ABH A;  4ERR A;  4IST A;  4QX8 B;  3CX6 B;  2LRK A;  4OYK A;  2DCF A;  4LML A;  2JMH A;  4YXD A;  2WP9 A;  1ZEE A;  4U33 A;  5FXV A;  5FXW A;  4A5X A;  2J1D G;  3RYI E;  4MFR A;  4GYS A;  2KSR A;  2W0G A;  2XTL A;  2H89 A;  2JJ9 A;  4XAX B;  4EAH A;  3FZM B;  4EXT A;  4WZX A;  5J2U E;  1OED C;  2C5J A;  3N5L A;  3C4Z A;  1HNX T;  1G8X A;  3N9L A;  4AI6 A;  5LXT E;  2FJD A;  2JQK A;  4O4I E;  4AQG A;  3LBX A;  2XAF B;  2Q9Q A;  2LHR A;  3LJC A;  3UFE A;  4O2B E;  1XDP A;  3P4P A;  2X9H A;  3ZMT B;  2NWB A;  3AA6 B;  3PUY F;  3AE7 A;  3PJA A;  4KP3 C;  3IEE A;  2X0L B;  3U3I A;  3ZC1 A;  2VVS A;  4L5G A;  1BR1 A;  1T72 A;  2NTX A;  3RHW A;  2ACZ A;  3AXJ B;  5HXH A;  4DV7 T;  3MXZ A;  2VVN A;  3N2G E;  2DHR A;  4NIQ A;  1W09 A;  1IBL T;  1S35 A;  1LVK A;  4QWN B;  5LMU T;  5LMN T;  2M67 A;  2VB6 A;  2LT3 A;  2BG9 C;  3VKH A;  4HTE A;  4HFH A;  2W63 A;  3OYZ A;  2MYS A;  3NBX X;  3RIU C;  2X68 A;  4BJM A;  3LG7 A;  2UXC T;  1HFA A;  3MAC A;  3AE9 A;  2BS3 A;  3KBT A;  4MAL A;  4AXP A;  3ZMZ B;  5HAX A;  4JI0 T;  1MMG A;  1N32 T;  4CXX A;  2EHO C;  5L3E B;  1HF8 A;  5LOV E;  5HEU A;  3ZC0 A;  2OLT A;  4DV2 T;  1OED B;  2PFV A;  5JRC A;  3ZCJ A;  4HFB A;  1NAF A;  2XSB A;  3JAF A;  5JDH A;  4H9Q C;  2AE9 A;  4ZEY A;  2LRL A;  4B3R T;  4F6R C;  3AAI A;  4O2A E;  5FY7 A;  2N9D A;  3FZL B;  4YLH A;  4ZHQ E;  2DWK A;  4DMV A;  3CVR A;  4O4L E;  4A98 A;  3UU6 A;  1YXR A;  2ZM0 A;  2C0S A;  1KNZ A;  3A7M A;  3AA0 B;  4I43 B;  3AEB A;  4IDZ A;  4HFD A;  4WW0 A;  3O1H A;  4JI6 T;  3ZMS B;  2VKO A;  1E1H B;  4IL4 A;  2XAH B;  2V6Y B;  3UUX B;  4ZI2 D;  4LMK A;  3CQG B;  1OWA A;  2YDQ A;  3KIN B;  4QKN A;  4IDO A;  3T8O A;  2CHN A;  4QH4 A;  2BG9 B;  2KZ7 B;  2LKG A;  5M4Y A;  4WYV A;  3TLV A;  5CFB A;  2E9X C;  4YFS A;  2W66 A;  2Y48 B;  4Z90 A;  2V26 A;  1ZHC A;  1IZN B;  3BQK A;  3CML A;  3N9P A;  3IBP A;  3OJA A;  4Z8X A;  4YT0 A;  2H7O A;  2EHO B;  4EEB A;  1Z0P A;  2YU2 A;  4AIU A;  2K48 A;  2W4X A;  4UVC B;  4ZZB A;  4GKK T;  5EK4 A;  2C5K T;  3PUZ F;  5C3J A;  2IIU A;  2LE8 A;  3Q5X A;  3CWZ B;  2C5I T;  4DUZ T;  4U2Y A;  2A9U A;  5LJN A;  3UTK A;  1QUU A;  1D1A A;  2MOZ A;  4JI5 T;  5AQJ B;  3N9M A;  4ILA A;  4ZXL A;  3K3N A;  2XQ4 A;  3F57 A;  2XQ3 A;  4TUY E;  2K5B B;  1XZY A;  4YY3 T;  3AE3 A;  5L4H A;  5DQW A;  2HH7 A;  1W0A A;  5E0O A;  1MMN A;  1M7K A;  2V7L A;  2WDQ A;  2UUC T;  2XQ9 A;  3CK6 A;  3ONJ A;  4P1N A;  3F2E A;  2XSA A;  3PUG A;  3KVB A;  3B57 A;  3RC8 A;  4DV0 T;  2W67 A;  4A97 A;  3C4W A;  3AEG A;  3FBZ A;  5FY1 A;  4IRE A;  2E9X B;  4B3S T;  3MZK B;  1UX5 A;  5AQV B;  3RF1 A;  5J0Z A;  1D1C A;  1MNE A;  3PUV F;  4CQI A;  4ZI3 D;  4OFZ A;  1HNW T;  1YKE B;  2D2S A;  5JR9 A;  2XZE A;  5LGT B;  2V8S V;  2XPK A;  3RKO A;  1VCS A;  4ZS2 A;  4LF7 T;  4CXY A;  4JUY A;  4E7Z A;  5H6R B;  2UXB T;  3AED A;  3C4X A;  2Z6E A;  4X1I E;  3AAE B;  1D0Z A;  1FMV A;  4HWH A;  4EV6 A;  3DJB A;  4UV9 B;  3R84 B;  4C91 A;  1WRD A;  3T1H T;  3P50 A;  2YKS A;  2LEH A;  4IL9 A;  2J62 A;  4LF8 T;  4UR9 A;  5AQT B;  3QOF A;  3C50 A;  3PTR B;  5C2T A;  3NRY A;  1YD8 G;  3RQU A;  4QHO A;  1YQ4 A;  3SS1 A;  5HXC A;  1M62 A;  4TX5 A;  5FXX A;  3N9N A;  4IE0 A;  5AQN B;  5HXS A;  4DV4 T;  3UU3 A;  5JDN A;  4B6X A;  4IDN A;  3ZYK A;  2LOP A;  2X9W A;  1Y64 B;  3K1S A;  2ES0 A;  2QA7 A;  2CLY C;  2WQY A;  4BA9 A;  3PV0 F;  2RP4 A;  2GK9 A;  3FZF B;  3PUR A;  3V5S A;  3J9X 1;  4PJJ A;  4PFP A;  2E5L T;  2UXD T;  1XMO T;  3OYX A;  4TWF A;  3DP7 A;  2DNX A;  3M3Z B;  4EED A;  2X66 A;  3P4S A;  3ETU A;  3ZSS A;  2D0T A;  2D5U A;  5HWY A;  4AQF A;  2D9D A;  3AEE A;  3A5X A;  3ANW A;  3RYF E;  3VHL A;  5F5W A;  2KWH A;  4JI1 T;  2V1D B;  3UUN A;  2PBI A;  4UF0 A;  2X9X A;  3ZYL A;  2L9Q A;  4Q25 A;  5LA6 E;  2BKN A;  5AQL B;  4V1A v;  4IT4 A;  2WAU A;  4H63 V;  5ABF A;  3NRX A;  4KHZ F;  3RYC E;  1IJ6 A;  2KND A;  2VL0 A;  3GWH A;  1SHZ C;  3N9Q A;  5EK2 A;  4MBQ A;  1D0X A;  4NXM T;  2K9A A;  4TV8 E;  2XY8 B;  1XWM A;  3TKL B;  2LM2 A;  3P7I A;  4XBF B;  4E7S A;  1UUS A;  3UT5 E;  4YHH T;  1Y01 A;  4QX7 B;  3FZK B;  1FMW A;  4YTM A;  2I6H A;  5A1L A;  3GN5 A;  4CN1 A;  2N1G A;  5KMG P;  1W0B A;  3MKD A;  3RLF F;  2LLY A;  2VQE T;  4F8H A;  2WWV A;  3MA9 A;  4PNI A;  3R6N A;  4DR5 T;  5HXR A;  2YOE A;  1HG5 A;  2BG9 E;  2VK9 A;  2NP9 A;  4YSY A;  1T98 A;  2LHN A;  3L09 A;  3ZYM A;  5ABE A;  3CX7 B;  3GA8 A;  3HKC E;  2HHH T;  2YK0 A;  4H9O C;  2YEV C;  3ZKR A;  5LG3 A;  3JAD A;  4AKI A;  5AQS B;  5LYJ E;  4H9S E;  4OHF A;  4B3T T;  4KBM B;  4I0U A;  3SRZ A;  5HEH A;  3I1A A;  3WAJ A;  5CJ5 A;  1WCR A;  4HE8 A;  2CM0 A;  3KV4 A;  3HKB E;  4HFC A;  1HNZ T;  3LDQ B;  3QNU A;  2A3D A;  4DV1 T;  3UUB A;  4PK4 A;  5LGN B;  2BDE A;  3Q5E A;  3CIR A;  4DND A;  5JDL A;  4TZ4 C;  1AJ3 A;  2V6X A;  4TV9 E;  1DU2 A;  2L3L A;  5IUX A;  2LSJ A;  5EK3 A;  2EHO D;  3JC6 C;  4KI0 F;  4X66 T;  3AE8 A;  1IBM T;  3VKG A;  3I0O A;  5L2L A;  4WNK A;  4DV6 T;  4ILB A;  3PUX F;  3EAM A;  3P8C D;  5HWX A;  3J7Y q;  1MND A;  1XNR T;  2E8I A;  3NZP A;  5J2T E;  5C8Y E;  5L3F B;  2FJA A;  2LKH A;  5FVL A;  4GKJ T;  2J47 A;  4IE6 A;  2WZH A;  3TLS A;  5L3D B;  3NVO A;  4ZZC A;  3L3P A;  1QSD A;  4TWH A;  5JVD E;  3BK9 A;  4HKA A;  2Y6X A;  4NPP A;  2JRK A;  2J4G A;  4YJ2 E;  3UQ7 A;  4AKH A;  2VAS A;  3RYH E;  4KMC A;  1Z8U A;  3RRC A;  3HL6 A;  2HN1 A;  2IML A;  2WDR A;  3QC9 A;  4AQF C;  1S94 A;  5HEJ A;  3FXE B;  1N33 T;  2MBG A;  3P4Q A;  3PUA A;  3P4W A;  1ZOY A;  3EHZ A;  2OA5 A;  2E9X D;  3CQC B;  5F3J A;  2VUR A;  2CXF A;  2WSS V;  1HX8 A;  1ZP0 A;  4GOU A;  3O1I A;  5LNK A;  1CHU A;  5JDQ A;  4IDQ A;  4DV5 T;  4DR3 T;  1BR2 A;  2YU1 A;  4TWD A;  4DR2 T;  1J5E T;  1T7S A;  4H63 H;  4ISS A;  1FEW A;  3ESL A;  1H7C A;  4Z91 A;  3SFD A;  5KXJ A;  4N78 D;  2Y8D A;  4HFV A;  2UXX B;  2LSG A;  4CI3 B;  5AQI B;  2A72 A;  2XM2 A;  3KV9 A;  3ZMV B;  2X9Y A;  3AEC A;  5CGM A;  3EDV A;  3O4X E;  2BVL A;  4MLK A;  2N2N A;  4C90 A;  1O3X A;  3KV5 A;  5LHH B;  2OV9 A;  4K0K T;  3ETV A;  1NWM X;  2XQ6 A;  1XNQ T;  4IE5 A;  4COF A;  4M1P A;  2KIN B;  2WU2 A;  4YJ3 E;  4ZI7 E;  3BQL A;  4CN6 A;  4ILU A;  4JV5 T;  2M6I A;  1JNZ A;  4K0U A;  2W62 A;  3RPU A;  4U3C A;  4X65 T;  5FP3 A;  3PJA J;  4L9I A;  4LFB T;  4HFE A;  3PU3 A;  2I0M A;  4DBQ A;  3D0T A;  5FL0 A;  5HCJ A;  3TLW A;  1HX1 B;  3AE5 A;  3RIA A;  3LK4 2;  4LMJ A;  3EAB A;  3T1Y T;  4LF9 T;  4JLE A;  2XQY A;  2Q9Q C;  3AXJ A;  4EYY R;  3X1D A;  1MIY A;  2K24 A;  3EI0 A;  3RIF A;  3CKD A;  3PUW F;  3ZJ1 A;  4HGA A;  2JQQ A;  1WYB A;  3AA7 B;  1KK7 A;  4O4J E;  4O4H E;  3UUL A;  1XMQ T;  3N9O A;  5ABG A;  4X20 E;  5FKY A;  4JBW F;  4OK0 A;  2FJE A;  2BVM A;  2HN2 A;  4I50 E;  5EZY E;  2XAQ B;  1FIO A;  3SOL A;  4AKL A;  5LJM A;  3NZQ A;  2VKD A;  2XHE B;  3RGL A;  4WBO A;  5DAB A;  2CE7 A;  4OYJ A;  2CXL A;  4EIW A;  2QGS A;  2IUB A;  4JI2 T;  5FY0 A;  5FYM A;  1OED A;  2H88 A;  1HCI A;  2WBL A;  3KDS E;  2VKJ A;  2W00 A;  2MPK A;  4PJM A;  3CQX C;  2ZMA A;  3AE4 A;  4IE4 A;  5AQF B;  2ACX A;  3OTO T;  4LFA T;  5HEO A;  4EYU A;  2BBH A;  1KFY A;  3L8R A;  4TNV A;  2XQ5 A;  3S4U A;  4YTP A;  5JDG A;  4UVB B;  2I59 A;  3H37 A;  2IC9 A;  3NWI A;  3U78 A;  3UUM A;  3LBX B;  3HR0 A;  2Q9Q B;  2V6Y A;  4G2A A;  4U2Z A;  4KX6 A;  4GK0 E;  2BBJ A;  5FVK A;  1ZKE A;  3P4R A;  4U31 A;  2BG9 A;  3ZEF B;  3ONX A;  1IBK T;  4KUM B;  4IGU A;  4PK5 A;  2BKO A;  2CBI A;  4DO0 A;  1LVF A;  4PK6 A;  3RIU A;  3EDU A;  4H9R C;  3K8P C;  2IC6 A;  2YDR A;  2V5C A;  4HWC A;  4JI8 T;  2YN6 A;  3ZN1 B;  2HPJ A;  4LF5 T;  3HA4 A;  5ADX L;  5JTG A;  2WCA A;  2QRX A;  2EHO A;  1NEN A;  3ZST A;  1MIV A;  3W15 B;  5LCY A;  5L3C B;  3K3Q C;  3N2K E;  2XAJ B;  3RH3 A;  4TN7 B;  2BS2 A;  3N2O A;  5FL1 A;  2ODV A;  4JYA T;  4QXC B;  4B3M T;  2FJB A;  2JPF A;  3DTO A;  2PTF A;  3ZT5 A;  5JRC B;  1J1J A;  1KNR A;  2YIN A;  2WDV A;  1V9D A;  3C51 A;  3HKD E;  4CI2 B;  3FHN A;  3PDY A;  1US7 B;  2IHR 1;  3L39 A;  4X62 T;  5JDM A;  2V7I A;  4UEL A;  4LF4 T;  4U72 A;  2BKP A;  1WYC A;  4EZH A;  1KF6 A;  4DVD A;  3VR9 A;  2LSY A;  2UXN B;  3VRB A;  2WY2 A;  3RQW A;  4P09 A;  1CUN A;  3G06 A;  3H3A A;  2E2A A; 
#chains in the Genus database with same CATH homology
 5AQR B;  5AQQ B;  3FZH B;  4HWD A;  3LDQ B;  5AQK B;  5AQU B;  3FZK B;  5AQV B;  2D9D A;  5AQS B;  1M62 A;  1UK5 A;  1I6Z A;  3FZF B;  5AQI B;  5AQN B;  4HWF A;  5AQG B;  1HX1 B;  3FZM B;  5AQP B;  1T7S A;  4HWC A;  5AQL B;  5AQJ B;  5AQM B;  1M7K A;  4HWI B;  1UGO A;  3FZL B;  5AQO B;  3A8Y C;  4HWH A;  3M3Z B;  5AQT B;  5AQF B;  5AQH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...