3LDQB

Crystal structure of hsc70/bag1 in complex with small molecule inhibitor
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
111
structure length
111
Chain Sequence
GNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Heat shock cognate 71 kDa protein
publication title Adenosine-Derived Inhibitors of 78 kDa Glucose Regulated Protein (Grp78) ATPase: Insights into Isoform Selectivity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 46
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2010-01-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 3ldqB00
5AQNB 2D9DA 4HWHA 5AQOB 1UGOA 5AQVB 5AQKB 3FZLB 3FZKB 4HWFA 5AQHB 3A8YC 4HWIB 3M3ZB 1T7SA 5AQGB 5AQUB 4HWCA 5AQMB 4HWDA 1HX1B 1UK5A 5AQRB 5AQJB 5AQLB 5AQTB 3FZMB 1M62A 1M7KA 5AQFB 5AQPB 1I6ZA 5AQSB 5AQIB 5AQQB 3FZHB 3LDQB 3FZFB
chains in the Genus database with same CATH superfamily
4H63V 1AJ3A 1J1JA 3V5SA 1QLBA 3FZLB 2W66A 2Y8DA 3N2KE 5L3BB 2RPAA 4DR3T 2KWHA 4YJ3E 3SS1A 1WR0A 2KSRA 3ZCJA 5KXJA 2E2AA 5FXVA 2LEHA 4O4JE 4LF6T 1FMWA 3C98B 2BKPA 2LE8A 4IDZA 3RI5A 3NWIA 4JUYA 4IE0A 3CKDA 3N9PA 5FP3A 3AAAB 2H7OA 4K0UA 1IBLT 2VKJA 1GQEA 3RIUC 3RHWA 4EEBA 5LOVE 3MK7C 4AKGA 3ETVA 3VR9A 5AQFB 3N9LA 3RGLA 3QOFA 2IMLA 4QH5A 2KT9A 4JLEA 4PJNA 5L3DB 4UXNB 2LOSA 4B6XA 4FI5A 4JI8T 2V7IA 1N36T 5JQGE 5LHGB 4AKIA 2UUAT 2LOPA 4GYSA 1Y64B 4BAYB 4L0RA 5AQVB 3L39A 3LBXA 3MJXA 4O8SA 3B5MA 2JMKA 2PTFA 3AE3A 3EAMA 2NW7A 2AE9A 3ZMTB 2PFVA 2MOZA 3AA6B 4AKRB 5L4EA 1FJGT 2L3LA 1W0BA 3NZPA 1IAPA 4WZXA 2A3DA 4I55E 4YTMA 3ZT7A 4UEMA 5ABHA 4DV1T 4EYUA 4TX5A 1KFYA 2Q9QB 3T8OA 5E0OA 1XNQT 4U7YA 4U2ZA 3CQXC 4JI7T 4HWFA 2YEVC 4I0UA 1KNPA 3RRWA 2D5UA 1E2AA 4UF0B 5FNVE 3AB3B 4Z8XA 2LT3A 1VCSA 5LB7B 5EK3A 2JRKA 2M6BA 3K8PC 3EDUA 3PUQA 2WBLA 3OBVE 3FBLA 4WYVA 3RPUA 3P4QA 2IHR1 5CJ5A 1MMAA 1D1CA 5BR8T 4C91A 3QB5K 5L2LA 4X62T 4YSYA 5ABFA 4IT4A 3TLTA 2AXDS 3RC8A 4HEAA 1UUSA 4UV9B 5FXZA 5LNKA 2I0MA 2V6XA 3DTOA 3L8RA 2Z6EA 3KVAA 2LHRA 3NRXA 2N1GA 4GK0E 2WM9A 3NZQA 4MFRA 4CN1A 2ACXA 2W63A 4AKHA 1IBKT 3L3PA 4JEUB 4DV7T 2BG9E 4DVDA 3RX6A 4X1YE 2YU1A 2BS2A 3ABVA 2CRBA 2WMNA 3V5UA 2YOEA 3AECA 4TN7B 1Y01A 3J9X1 4XAXB 2DL1A 2UXXB 4PJLA 4EEDA 3PU3A 1Z8UA 4QXBB 4X65T 5LP6E 4PFOA 5LMNT 2E9XD 4YHHT 5C3JA 2VASA 3BQKA 2ZMAA 2D0TA 1N33T 5C2TA 2X9YA 2WY2A 4QX7B 5JRCB 2WP9A 1VRBA 4GIWA 5FXXA 3GWHA 3SRZA 4ISTA 4GK5E 2QVAA 5AQTB 2Y6XA 4QH1A 3ESLA 2NP9A 2JQKA 2XAJB 3RLFF 3ZSSA 3D0TA 3EDVA 4JI2T 4NIQA 2NWBA 1HCIA 4DR4T 1YQ3A 4A56A 1D1BA 2CPTA 3N2GE 2I6HA 2OA5A 2CMRA 1B7TA 4ZS2A 2QRXA 4LFAT 2OV9A 2CCQA 3LJCA 1UCUA 2BKOA 5CA1E 3OJAA 4JYAT 2X51A 4PAGA 3NKZA 4IGUA 3AVRA 5JDLA 1NAFA 3QNUA 2XAGB 3UU8A 3AE5A 1SHZC 4O2BE 3ZPOA 1XMOT 5LYJE 2YDQA 2A72A 5HXHA 3A5XA 2VVSA 3N9OA 1YQ4A 3RC3A 3HKBE 3I9YA 1JNZA 3PUSA 3T1HT 1Z0PA 5LBMA 5J0ZA 2KWIB 2LM9A 4OFZA 3CQGB 2XQAA 3UUXB 1T98A 4YT0A 5ABFB 3ZYMA 2WWUA 3E0ZA 2LSKA 2E5LT 2CM0A 4KI0F 1SUMB 2K9AA 2W61A 2WU2A 2V5CA 4DR7T 1UX5A 2XQ6A 3HKDE 4DV3T 4NPPA 2HPJA 2XAHB 3AEAA 4QX8B 5BMVE 1NENA 2CXLA 2F4VT 3UFEA 5CA0E 4MALA 2XQ8A 5ABGA 2ES0A 3ZN1B 3ZC0A 4H9OC 2V7KA 3DP7A 3K3QC 2DWKA 4ZS3A 1MNDA 4U33A 4H9PC 5JDFA 1HF8A 3ANWB 1IZNB 1O3XA 4I43B 3LDQB 3PV0F 4EYYR 4H9NC 1WYBA 5J1GA 3AVSA 2IW5B 5A1LA 3P50A 2X9WA 3RRCA 5HWXA 2ZM0A 2VVNA 4LF5T 4IE4A 4AQGA 4ILAA 3RYCE 3FZFB 4EOZB 4B3RT 1OWAA 4J2CA 2JIWA 4UELA 4X5TA 4G63A 2XM1A 5CGMA 4HKAA 2K24A 4UVAB 4L9IA 3CWZB 2YDSA 4AI6A 4IL9A 1LRZA 4DMVA 4GKKT 3A8YC 3F57A 3U78A 2LM2A 4UR9A 3HA4A 5LHHB 2QYWA 2NW8A 1N32T 4V1Av 2EHOB 4DR2T 3FB2A 1H7CA 3P7IA 2PJQA 2YDRA 2Q9QA 2KMFA 4C90A 4AKLA 4TWFA 2H3RA 4HFIA 3UUMA 3UU5A 3LK42 3PUYF 4OHFA 2NR4A 3MACA 4UF0A 3B13A 2NTYA 2B1EA 2D0UA 5AQOB 2LSGA 3T1YT 3ZLIA 5KX5E 2MAWA 5JDGA 2C5IT 1HNXT 4IDQA 2LKHA 5IUXA 2I59A 3H3AA 4PJMA 4I50E 5JDNA 2E5VA 4OYJA 3SOLA 3ZCIA 2C5KT 4K0KT 2L9QA 2BS3A 4PK4A 3UT5E 2KXPB 1WRDA 5ABEA 1VOMA 3BQLA 2VWAA 4HWCA 5HYAA 5FL0A 2V5DA 5FY0A 2XY8B 3C4ZA 3LFMA 2PG8A 4WBNE 3QUJA 3FHNA 3F2EA 2WQYA 2XM2A 4NXMT 3WAKA 4JI1T 3H3MA 3OKQA 2BBJA 3ZMVB 2M6IA 2MBGA 3LK2B 4HTEA 4B3MT 3IA3A 2CWOA 3NBXX 2VB6A 2W62A 1MMDA 3ZC1A 4JEHB 2LLYA 2DNXA 4P0AA 5FXWA 3JADA 2Y48B 5IYZE 5L3FB 1HNWT 3SFEA 3ETUA 5LJMA 2DCFA 2BKNA 4BA9A 2Q9QC 4QHOA 5LGTB 3ONXA 3UUNA 2KNDA 4LMKA 3EVYA 2V7JA 5AQGB 2UXNB 5AQUB 4IDOA 1X79A 5JRCA 1YKEB 3HI2A 5LBQB 2H88A 4UIGA 3CVRA 4HFEA 2JQQA 5FY7A 1R8IA 3AE6A 4O2AE 2KLQA 5JTGA 2FBWA 2ODVA 5JDMA 1MIVA 3O4XE 4KX6A 3CK6A 5GONE 5LGUB 4OX9T 4IDPA 2J62A 2X0YA 4UV8B 3O1HA 3PUVF 3AXJB 3KBTA 5L3EB 4P0BA 4LF8T 2M67A 5H6RB 3KDSE 2YKSA 2FJEA 4H63H 2XQ5A 3PE0A 5HEJA 1E1HB 2UUBT 5AQQB 3W15B 3AEFA 2CXFA 2PBIA 5FVLA 3NVOA 2VL8A 3JAEA 4H9RC 3GMIA 3MZKB 2VKOA 2CBIA 1QUUA 3PUAA 3P8CD 4JV5T 3N9QA 3KFWX 3AEGA 2XJ7A 2WU5A 1HFAA 1HR0T 1ZEEA 4N78D 2IAKA 2XUEA 3AE4A 3AAEB 3E22E 2XQ9A 4YTNA 1IJ5A 3VHLA 4HFVA 5L4HA 5EZYE 4Z91A 5LJNA 4WW0A 2LSIA 4HFDA 2CA5A 4X64T 3AA0B 3FZKB 3O1JA 3P4RA 5F8PA 3CPZA 3R6NA 2RP4A 4AQFA 4PFPA 4F8HA 4KMCA 2WDRA 3HL6A 4ISSA 2BZBA 1X9BA 3KV5A 3ANWA 5LG4A 3AA7B 2JQ9A 2DI4A 2XTLA 2V8SV 3Q5XA 4HWDA 3I0QA 2DWGA 4PK5A 1U5PA 4OYKA 3OPCA 3RIFA 1LVFA 2BG9B 4YFSA 4A97A 3VRBA 4LFCT 1HX8A 2WZIA 3JCFA 4CZZB 4U2YA 1I6ZA 3TLWA 4IE6A 2DLRA 4YSXA 2B76A 2VKDA 4ADZA 4DV4T 1ZKEA 4EGWA 1KF6A 5HCJA 2UXBT 2IC9A 4CI3B 1YXRA 4ILCA 4PK6A 4A98A 4ZEYA 1G73A 2WSSV 2CBJA 2BS4A 2D9DA 2V6YB 2EHOA 1D1AA 4DR1T 2HHHT 1CHUA 2ACZA 5AQHB 3ZEFB 5ADXL 3ZKRA 3Q9DA 5HWYA 2W00A 4QH4A 5AFUL 3F31A 1T8BA 2BVMA 4HE8A 3GN5B 5AQMB 1HTJF 2C5JA 4AQFC 3WI3A 4BJNA 3RQUA 3CX8B 2MYSA 1UURA 1IBMT 4G2AA 3VKGA 1WR6A 4U3CA 2X68A 3VU7H 2XPKA 5M4YA 4IHJE 2UU9T 4HGAA 3ZYLA 3MA9A 2UXDT 4X1KE 2JPFA 2LRKA 2W67A 4TNVA 3B57A 3Q5DA 4NXNT 2X9HA 3IBPA 5LGNB 3IHRA 4ZOLE 2LKGA 4JI0T 5FKYA 5LCYA 5JH7E 2MPKA 2CE7A 4IE5A 5J2TE 1BR2A 4JBWF 5LHIB 1J5WA 3QB5A 1QSDA 1IJ6A 4CXYA 4LF4T 5HEGA 2QGSA 2A2FX 2XQ3A 4NUUA 3ZN0B 4AQYT 1FIOA 4A5XA 4ZZCA 4YSZA 5DQVA 2XSAA 2WB5A 3SFDA 4GOUA 4DUZT 2V1DB 4P1NA 3RKGA 3UFGA 1N34T 2EHOC 1OEDE 2P9BA 5AQSB 2KZ7B 2XASB 3IF8B 1D0YA 1T72A 2LSYA 1XMQT 4COFA 4DR5T 2H89A 3U3IA 4TZ4C 4UVCB 5HXCA 2VURA 4U7IA 3UTKA 4DR6T 1HX1B 4JI6T 3HR0A 1FMVA 3UU4A 4CXWA 5FYMA 3TLSA 3AAIA 2E9XB 3AEEA 3PTRB 1XZYA 1MIYA 4CQIA 1G8XA 5JR9B 1KEYA 2NW9A 4IIJE 4EZ4A 3P4WA 1OEDB 4ZXLA 3JC6C 3LG7A 4EXTA 2HN1A 5AQRB 1E7PA 2WWVA 2R6GF 3RKOA 1XDOA 4HFCA 2Q9QD 4TV9E 3K3OA 4HFBA 5C8YE 2OLTA 3DJBA 3N9MA 3BK9A 2JQHA 4U72A 3AXJA 5HXSA 3SWHA 4ZI3C 2ZLYA 3UQ4A 2V26A 3OVUA 2NTXA 3CX6B 5FL1A 4QXHB 4UVBB 2LJLA 3VRAA 2VK9A 2X0HA 2J1DG 3CQCB 3AE7A 1EZ3A 2SPCA 3Q5EA 2CLYB 4EAHA 1M62A 2K5BB 2JMHA 3P4PA 4CN6A 3JAFA 1J5ET 3ZMSB 1JNRA 3ZMZB 4AIUA 5CB4E 2WAUA 3PJAJ 2XHEB 3C4XA 2FJDA 1S94A 4HFHA 5FVKA 3KINB 2VQFT 5HAXA 4KUMB 3CMLA 4YHJA 5H6QB 4BJMA 4LMJA 3A7MA 5ETWA 1ZHCA 4QWNB 3KVBA 3Q2MA 4XZCA 3AE8A 4LMLA 3R84B 2VKHA 2IIUA 3H37A 4KBMB 4ANJA 4OK0A 5F5WA 1CUNA 3ZJ2A 4E7ZA 1BR0A 4H9QC 2W0GA 4ZHQE 3AEBA 5L3GB 4GKJT 2K3WA 4U31A 4X66T 4TWHA 3AA1B 4WBOA 4CI1B 2X9XA 2ZM8A 3C4WA 4HWIB 2BG9A 3PUZF 2LSJA 5HEHA 3CIRA 4PW8A 4ZI2D 3O9XA 1M7KA 4TV8E 4YLHA 4DMWA 3FXEB 1MIWA 3K1SA 2YU2A 1XNRT 4HWHA 4X1IE 2XQYA 5HXRA 3TLVA 2BBHA 3EHZA 1T7SA 3KV6A 1NWMX 3O1IA 3HKEE 4YY3T 1W09A 4TUYE 2VQET 1WYCA 1LKXA 4LFBT 4H9SE 3G06A 1UGOA 3PUXF 4YTPA 3EABA 5IHYA 4PNIA 5JDQA 3M3ZB 2V6YA 3Q5WA 4TWDA 4M1PA 3ZT5A 5L3CB 3ZYKA 2YINA 2WMOA 1U4QA 2X67A 2FJAA 1WLXA 2XAQB 4DBQA 1UK5A 1I94T 3GN5A 2KINB 3PURA 1KK7A 4KHZF 3RF1A 2WCAA 4EIWA 2RA1A 3RYHE 1SA0E 4I4TE 3ZMUB 1ZV4X 2X0LB 2D2SA 3VR8A 4JI5T 5HEUA 2LHNA 1HS7A 4MBQA 5AQPB 5DABA 2YK0A 3BQIA 4Q25A 2XQ4A 1ZOYA 3KV9A 2BG9C 2WS3A 4CXXA 4LF7T 2WZHA 4Z90A 5FY1A 1YW0A 4O4HE 1OXZA 5KDMC 4ZI2C 3PDYA 2DHRA 1WCRA 3TLUA 3UQ7A 3ZT6A 2XSBA 5HXEA 2ZM6T 5AQKB 4EB6E 5JVDE 2UUCT 1BR1A 3J7Yq 2UXCT 2WDQA 4JI4T 4NUVA 1BR4A 3FXDB 4DUYT 1D0ZA 3N5LA 3ZJ1A 3LSVA 4DO0A 5LG3A 2X66A 5F3JA 4KP3C 3S4UA 2XZEA 2HN2A 2W2UA 2BDEA 3I9WA 3LK3B 1NEKA 3CX7B 1KNRA 4EV6A 4B3ST 2MTQA 3OYZA 3LBXB 2N9DA 2FJBA 5LXTE 3EUHA 2E9XA 3VKHA 3QC9A 5HEOA 4E7SA 1MMNA 5JR9A 3UU3A 2CEAA 3N2OA 3FBZA 4DIDB 5EK4A 2C0SA 5AQLB 1OEDA 2EHOD 2XQ7A 3FZMB 3C50A 2VL0A 5EK2A 4ASKA 1LVKA 3E08A 4PJJA 4O4IE 5JREA 4ZI7E 2IDOB 2IUBA 3X1DA 2BVLA 3PUGA 3ZSTA 2NOXA 3OTOT 3QK6A 3MXZA 3HKCE 3TKLB 4ZZBA 3ONJA 3C64A 2H7VC 3JC6D 3WAJA 1XWMA 3MKDA 3RQWA 2A9UA 5DQWA 3KV4A 3PU8A 2J47A 4AISA 3IEEA 2FUPA 4AXPA 2CWYA 5FMNA 1FEWA 2JJ9A 2N2NA 4LF9T 5TAOA 3C51A 4QKNA 4ZI3D 5AQJB 4FJOA 4DBRA 3OYXA 3UULA 2QA7A 4IREA 5DJQC 2LRLA 1DU2A 4CI2B 1XDPA 2XAFB 3KBUA 3AE1A 4WNKA 2CHNA 5HCMA 2J4GA 3RIAA 4EZHA 5CFBA 2K48A 2YN6A 3K3NA 4XBFB 3I1AA 1MMGA 4B3TT 3RH3A 2W4XA 2V7MA 3RYIE 4KHPT 4DV0T 2E9XC 5AQIB 4DV6T 4YJ2E 1V9DA 4GYRA 5JR9C 5L47A 3UU6A 4MLKA 1OEDC 4HN9A 2GK9A 1HNZT 3PJAA 2IC6A 4YXDA 2HPLA 2CXDA 3ONLC 4JI3T 5J2UE 3EI0A 2ODUA 1KNZA 4O4LE 1W0AA 3UUBA 4U74A 4DV5T 3AEDA 4ILBA 2E8IA 5AQNB 4QXCB 1UX4A 1SE7A 1S35A 3I0OA 1YD8G 1MNEA 3N9NA 1HG5A 4F6RC 4TNWA 3L09A 3RIUA 1US7B 1HG2A 1VCTA 2CLYC 4IE7A 4L5GA 3GA8A 4ILUA 3AE9A 1ZP0A 3RYFE 5IWAT 2G0UA 5LMUT 1W9RA 3PUWF 3AE2A 4CN4A 5LA6E 2V7LA 5KMGP 2HH7A 1WFDA 3M65A 3FZHB 2CHOA 1D0XA 4IDNA 4DV2T 2ZM2A 2L8KA 3P4SA 1YKHB 4IL4A 4MHCA 4ERRA 4P09A 4X20E 3NRYA 2WDVA 5JDHA 1L0VA 4DNDA
chains in the Genus database with same CATH topology
5AQNB 2D9DA 4HWHA 5AQOB 1UGOA 5AQVB 5AQKB 3FZLB 3FZKB 4HWFA 5AQHB 3A8YC 4HWIB 3M3ZB 1T7SA 5AQGB 5AQUB 4HWCA 5AQMB 4HWDA 1HX1B 1UK5A 5AQRB 5AQJB 5AQLB 5AQTB 3FZMB 1M62A 1M7KA 5AQFB 5AQPB 1I6ZA 5AQSB 5AQIB 5AQQB 3FZHB 3LDQB 3FZFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQN B;  2D9D A;  4HWH A;  5AQO B;  1UGO A;  5AQV B;  5AQK B;  3FZL B;  3FZK B;  4HWF A;  5AQH B;  3A8Y C;  4HWI B;  3M3Z B;  1T7S A;  5AQG B;  5AQU B;  4HWC A;  5AQM B;  4HWD A;  1HX1 B;  1UK5 A;  5AQR B;  5AQJ B;  5AQL B;  5AQT B;  3FZM B;  1M62 A;  1M7K A;  5AQF B;  5AQP B;  1I6Z A;  5AQS B;  5AQI B;  5AQQ B;  3FZH B;  3LDQ B;  3FZF B; 
#chains in the Genus database with same CATH topology
 4H63 V;  1AJ3 A;  1J1J A;  3V5S A;  1QLB A;  3FZL B;  2W66 A;  2Y8D A;  3N2K E;  5L3B B;  2RPA A;  4DR3 T;  2KWH A;  4YJ3 E;  3SS1 A;  1WR0 A;  2KSR A;  3ZCJ A;  5KXJ A;  2E2A A;  5FXV A;  2LEH A;  4O4J E;  4LF6 T;  1FMW A;  3C98 B;  2BKP A;  2LE8 A;  4IDZ A;  3RI5 A;  3NWI A;  4JUY A;  4IE0 A;  3CKD A;  3N9P A;  5FP3 A;  3AAA B;  2H7O A;  4K0U A;  1IBL T;  2VKJ A;  1GQE A;  3RIU C;  3RHW A;  4EEB A;  5LOV E;  3MK7 C;  4AKG A;  3ETV A;  3VR9 A;  5AQF B;  3N9L A;  3RGL A;  3QOF A;  2IML A;  4QH5 A;  2KT9 A;  4JLE A;  4PJN A;  5L3D B;  4UXN B;  2LOS A;  4B6X A;  4FI5 A;  4JI8 T;  2V7I A;  1N36 T;  5JQG E;  5LHG B;  4AKI A;  2UUA T;  2LOP A;  4GYS A;  1Y64 B;  4BAY B;  4L0R A;  5AQV B;  3L39 A;  3LBX A;  3MJX A;  4O8S A;  3B5M A;  2JMK A;  2PTF A;  3AE3 A;  3EAM A;  2NW7 A;  2AE9 A;  3ZMT B;  2PFV A;  2MOZ A;  3AA6 B;  4AKR B;  5L4E A;  1FJG T;  2L3L A;  1W0B A;  3NZP A;  1IAP A;  4WZX A;  2A3D A;  4I55 E;  4YTM A;  3ZT7 A;  4UEM A;  5ABH A;  4DV1 T;  4EYU A;  4TX5 A;  1KFY A;  2Q9Q B;  3T8O A;  5E0O A;  1XNQ T;  4U7Y A;  4U2Z A;  3CQX C;  4JI7 T;  4HWF A;  2YEV C;  4I0U A;  1KNP A;  3RRW A;  2D5U A;  1E2A A;  4UF0 B;  5FNV E;  3AB3 B;  4Z8X A;  2LT3 A;  1VCS A;  5LB7 B;  5EK3 A;  2JRK A;  2M6B A;  3K8P C;  3EDU A;  3PUQ A;  2WBL A;  3OBV E;  3FBL A;  4WYV A;  3RPU A;  3P4Q A;  2IHR 1;  5CJ5 A;  1MMA A;  1D1C A;  5BR8 T;  4C91 A;  3QB5 K;  5L2L A;  4X62 T;  4YSY A;  5ABF A;  4IT4 A;  3TLT A;  2AXD S;  3RC8 A;  4HEA A;  1UUS A;  4UV9 B;  5FXZ A;  5LNK A;  2I0M A;  2V6X A;  3DTO A;  3L8R A;  2Z6E A;  3KVA A;  2LHR A;  3NRX A;  2N1G A;  4GK0 E;  2WM9 A;  3NZQ A;  4MFR A;  4CN1 A;  2ACX A;  2W63 A;  4AKH A;  1IBK T;  3L3P A;  4JEU B;  4DV7 T;  2BG9 E;  4DVD A;  3RX6 A;  4X1Y E;  2YU1 A;  2BS2 A;  3ABV A;  2CRB A;  2WMN A;  3V5U A;  2YOE A;  3AEC A;  4TN7 B;  1Y01 A;  3J9X 1;  4XAX B;  2DL1 A;  2UXX B;  4PJL A;  4EED A;  3PU3 A;  1Z8U A;  4QXB B;  4X65 T;  5LP6 E;  4PFO A;  5LMN T;  2E9X D;  4YHH T;  5C3J A;  2VAS A;  3BQK A;  2ZMA A;  2D0T A;  1N33 T;  5C2T A;  2X9Y A;  2WY2 A;  4QX7 B;  5JRC B;  2WP9 A;  1VRB A;  4GIW A;  5FXX A;  3GWH A;  3SRZ A;  4IST A;  4GK5 E;  2QVA A;  5AQT B;  2Y6X A;  4QH1 A;  3ESL A;  2NP9 A;  2JQK A;  2XAJ B;  3RLF F;  3ZSS A;  3D0T A;  3EDV A;  4JI2 T;  4NIQ A;  2NWB A;  1HCI A;  4DR4 T;  1YQ3 A;  4A56 A;  1D1B A;  2CPT A;  3N2G E;  2I6H A;  2OA5 A;  2CMR A;  1B7T A;  4ZS2 A;  2QRX A;  4LFA T;  2OV9 A;  2CCQ A;  3LJC A;  1UCU A;  2BKO A;  5CA1 E;  3OJA A;  4JYA T;  2X51 A;  4PAG A;  3NKZ A;  4IGU A;  3AVR A;  5JDL A;  1NAF A;  3QNU A;  2XAG B;  3UU8 A;  3AE5 A;  1SHZ C;  4O2B E;  3ZPO A;  1XMO T;  5LYJ E;  2YDQ A;  2A72 A;  5HXH A;  3A5X A;  2VVS A;  3N9O A;  1YQ4 A;  3RC3 A;  3HKB E;  3I9Y A;  1JNZ A;  3PUS A;  3T1H T;  1Z0P A;  5LBM A;  5J0Z A;  2KWI B;  2LM9 A;  4OFZ A;  3CQG B;  2XQA A;  3UUX B;  1T98 A;  4YT0 A;  5ABF B;  3ZYM A;  2WWU A;  3E0Z A;  2LSK A;  2E5L T;  2CM0 A;  4KI0 F;  1SUM B;  2K9A A;  2W61 A;  2WU2 A;  2V5C A;  4DR7 T;  1UX5 A;  2XQ6 A;  3HKD E;  4DV3 T;  4NPP A;  2HPJ A;  2XAH B;  3AEA A;  4QX8 B;  5BMV E;  1NEN A;  2CXL A;  2F4V T;  3UFE A;  5CA0 E;  4MAL A;  2XQ8 A;  5ABG A;  2ES0 A;  3ZN1 B;  3ZC0 A;  4H9O C;  2V7K A;  3DP7 A;  3K3Q C;  2DWK A;  4ZS3 A;  1MND A;  4U33 A;  4H9P C;  5JDF A;  1HF8 A;  3ANW B;  1IZN B;  1O3X A;  4I43 B;  3LDQ B;  3PV0 F;  4EYY R;  4H9N C;  1WYB A;  5J1G A;  3AVS A;  2IW5 B;  5A1L A;  3P50 A;  2X9W A;  3RRC A;  5HWX A;  2ZM0 A;  2VVN A;  4LF5 T;  4IE4 A;  4AQG A;  4ILA A;  3RYC E;  3FZF B;  4EOZ B;  4B3R T;  1OWA A;  4J2C A;  2JIW A;  4UEL A;  4X5T A;  4G63 A;  2XM1 A;  5CGM A;  4HKA A;  2K24 A;  4UVA B;  4L9I A;  3CWZ B;  2YDS A;  4AI6 A;  4IL9 A;  1LRZ A;  4DMV A;  4GKK T;  3A8Y C;  3F57 A;  3U78 A;  2LM2 A;  4UR9 A;  3HA4 A;  5LHH B;  2QYW A;  2NW8 A;  1N32 T;  4V1A v;  2EHO B;  4DR2 T;  3FB2 A;  1H7C A;  3P7I A;  2PJQ A;  2YDR A;  2Q9Q A;  2KMF A;  4C90 A;  4AKL A;  4TWF A;  2H3R A;  4HFI A;  3UUM A;  3UU5 A;  3LK4 2;  3PUY F;  4OHF A;  2NR4 A;  3MAC A;  4UF0 A;  3B13 A;  2NTY A;  2B1E A;  2D0U A;  5AQO B;  2LSG A;  3T1Y T;  3ZLI A;  5KX5 E;  2MAW A;  5JDG A;  2C5I T;  1HNX T;  4IDQ A;  2LKH A;  5IUX A;  2I59 A;  3H3A A;  4PJM A;  4I50 E;  5JDN A;  2E5V A;  4OYJ A;  3SOL A;  3ZCI A;  2C5K T;  4K0K T;  2L9Q A;  2BS3 A;  4PK4 A;  3UT5 E;  2KXP B;  1WRD A;  5ABE A;  1VOM A;  3BQL A;  2VWA A;  4HWC A;  5HYA A;  5FL0 A;  2V5D A;  5FY0 A;  2XY8 B;  3C4Z A;  3LFM A;  2PG8 A;  4WBN E;  3QUJ A;  3FHN A;  3F2E A;  2WQY A;  2XM2 A;  4NXM T;  3WAK A;  4JI1 T;  3H3M A;  3OKQ A;  2BBJ A;  3ZMV B;  2M6I A;  2MBG A;  3LK2 B;  4HTE A;  4B3M T;  3IA3 A;  2CWO A;  3NBX X;  2VB6 A;  2W62 A;  1MMD A;  3ZC1 A;  4JEH B;  2LLY A;  2DNX A;  4P0A A;  5FXW A;  3JAD A;  2Y48 B;  5IYZ E;  5L3F B;  1HNW T;  3SFE A;  3ETU A;  5LJM A;  2DCF A;  2BKN A;  4BA9 A;  2Q9Q C;  4QHO A;  5LGT B;  3ONX A;  3UUN A;  2KND A;  4LMK A;  3EVY A;  2V7J A;  5AQG B;  2UXN B;  5AQU B;  4IDO A;  1X79 A;  5JRC A;  1YKE B;  3HI2 A;  5LBQ B;  2H88 A;  4UIG A;  3CVR A;  4HFE A;  2JQQ A;  5FY7 A;  1R8I A;  3AE6 A;  4O2A E;  2KLQ A;  5JTG A;  2FBW A;  2ODV A;  5JDM A;  1MIV A;  3O4X E;  4KX6 A;  3CK6 A;  5GON E;  5LGU B;  4OX9 T;  4IDP A;  2J62 A;  2X0Y A;  4UV8 B;  3O1H A;  3PUV F;  3AXJ B;  3KBT A;  5L3E B;  4P0B A;  4LF8 T;  2M67 A;  5H6R B;  3KDS E;  2YKS A;  2FJE A;  4H63 H;  2XQ5 A;  3PE0 A;  5HEJ A;  1E1H B;  2UUB T;  5AQQ B;  3W15 B;  3AEF A;  2CXF A;  2PBI A;  5FVL A;  3NVO A;  2VL8 A;  3JAE A;  4H9R C;  3GMI A;  3MZK B;  2VKO A;  2CBI A;  1QUU A;  3PUA A;  3P8C D;  4JV5 T;  3N9Q A;  3KFW X;  3AEG A;  2XJ7 A;  2WU5 A;  1HFA A;  1HR0 T;  1ZEE A;  4N78 D;  2IAK A;  2XUE A;  3AE4 A;  3AAE B;  3E22 E;  2XQ9 A;  4YTN A;  1IJ5 A;  3VHL A;  4HFV A;  5L4H A;  5EZY E;  4Z91 A;  5LJN A;  4WW0 A;  2LSI A;  4HFD A;  2CA5 A;  4X64 T;  3AA0 B;  3FZK B;  3O1J A;  3P4R A;  5F8P A;  3CPZ A;  3R6N A;  2RP4 A;  4AQF A;  4PFP A;  4F8H A;  4KMC A;  2WDR A;  3HL6 A;  4ISS A;  2BZB A;  1X9B A;  3KV5 A;  3ANW A;  5LG4 A;  3AA7 B;  2JQ9 A;  2DI4 A;  2XTL A;  2V8S V;  3Q5X A;  4HWD A;  3I0Q A;  2DWG A;  4PK5 A;  1U5P A;  4OYK A;  3OPC A;  3RIF A;  1LVF A;  2BG9 B;  4YFS A;  4A97 A;  3VRB A;  4LFC T;  1HX8 A;  2WZI A;  3JCF A;  4CZZ B;  4U2Y A;  1I6Z A;  3TLW A;  4IE6 A;  2DLR A;  4YSX A;  2B76 A;  2VKD A;  4ADZ A;  4DV4 T;  1ZKE A;  4EGW A;  1KF6 A;  5HCJ A;  2UXB T;  2IC9 A;  4CI3 B;  1YXR A;  4ILC A;  4PK6 A;  4A98 A;  4ZEY A;  1G73 A;  2WSS V;  2CBJ A;  2BS4 A;  2D9D A;  2V6Y B;  2EHO A;  1D1A A;  4DR1 T;  2HHH T;  1CHU A;  2ACZ A;  5AQH B;  3ZEF B;  5ADX L;  3ZKR A;  3Q9D A;  5HWY A;  2W00 A;  4QH4 A;  5AFU L;  3F31 A;  1T8B A;  2BVM A;  4HE8 A;  3GN5 B;  5AQM B;  1HTJ F;  2C5J A;  4AQF C;  3WI3 A;  4BJN A;  3RQU A;  3CX8 B;  2MYS A;  1UUR A;  1IBM T;  4G2A A;  3VKG A;  1WR6 A;  4U3C A;  2X68 A;  3VU7 H;  2XPK A;  5M4Y A;  4IHJ E;  2UU9 T;  4HGA A;  3ZYL A;  3MA9 A;  2UXD T;  4X1K E;  2JPF A;  2LRK A;  2W67 A;  4TNV A;  3B57 A;  3Q5D A;  4NXN T;  2X9H A;  3IBP A;  5LGN B;  3IHR A;  4ZOL E;  2LKG A;  4JI0 T;  5FKY A;  5LCY A;  5JH7 E;  2MPK A;  2CE7 A;  4IE5 A;  5J2T E;  1BR2 A;  4JBW F;  5LHI B;  1J5W A;  3QB5 A;  1QSD A;  1IJ6 A;  4CXY A;  4LF4 T;  5HEG A;  2QGS A;  2A2F X;  2XQ3 A;  4NUU A;  3ZN0 B;  4AQY T;  1FIO A;  4A5X A;  4ZZC A;  4YSZ A;  5DQV A;  2XSA A;  2WB5 A;  3SFD A;  4GOU A;  4DUZ T;  2V1D B;  4P1N A;  3RKG A;  3UFG A;  1N34 T;  2EHO C;  1OED E;  2P9B A;  5AQS B;  2KZ7 B;  2XAS B;  3IF8 B;  1D0Y A;  1T72 A;  2LSY A;  1XMQ T;  4COF A;  4DR5 T;  2H89 A;  3U3I A;  4TZ4 C;  4UVC B;  5HXC A;  2VUR A;  4U7I A;  3UTK A;  4DR6 T;  1HX1 B;  4JI6 T;  3HR0 A;  1FMV A;  3UU4 A;  4CXW A;  5FYM A;  3TLS A;  3AAI A;  2E9X B;  3AEE A;  3PTR B;  1XZY A;  1MIY A;  4CQI A;  1G8X A;  5JR9 B;  1KEY A;  2NW9 A;  4IIJ E;  4EZ4 A;  3P4W A;  1OED B;  4ZXL A;  3JC6 C;  3LG7 A;  4EXT A;  2HN1 A;  5AQR B;  1E7P A;  2WWV A;  2R6G F;  3RKO A;  1XDO A;  4HFC A;  2Q9Q D;  4TV9 E;  3K3O A;  4HFB A;  5C8Y E;  2OLT A;  3DJB A;  3N9M A;  3BK9 A;  2JQH A;  4U72 A;  3AXJ A;  5HXS A;  3SWH A;  4ZI3 C;  2ZLY A;  3UQ4 A;  2V26 A;  3OVU A;  2NTX A;  3CX6 B;  5FL1 A;  4QXH B;  4UVB B;  2LJL A;  3VRA A;  2VK9 A;  2X0H A;  2J1D G;  3CQC B;  3AE7 A;  1EZ3 A;  2SPC A;  3Q5E A;  2CLY B;  4EAH A;  1M62 A;  2K5B B;  2JMH A;  3P4P A;  4CN6 A;  3JAF A;  1J5E T;  3ZMS B;  1JNR A;  3ZMZ B;  4AIU A;  5CB4 E;  2WAU A;  3PJA J;  2XHE B;  3C4X A;  2FJD A;  1S94 A;  4HFH A;  5FVK A;  3KIN B;  2VQF T;  5HAX A;  4KUM B;  3CML A;  4YHJ A;  5H6Q B;  4BJM A;  4LMJ A;  3A7M A;  5ETW A;  1ZHC A;  4QWN B;  3KVB A;  3Q2M A;  4XZC A;  3AE8 A;  4LML A;  3R84 B;  2VKH A;  2IIU A;  3H37 A;  4KBM B;  4ANJ A;  4OK0 A;  5F5W A;  1CUN A;  3ZJ2 A;  4E7Z A;  1BR0 A;  4H9Q C;  2W0G A;  4ZHQ E;  3AEB A;  5L3G B;  4GKJ T;  2K3W A;  4U31 A;  4X66 T;  4TWH A;  3AA1 B;  4WBO A;  4CI1 B;  2X9X A;  2ZM8 A;  3C4W A;  4HWI B;  2BG9 A;  3PUZ F;  2LSJ A;  5HEH A;  3CIR A;  4PW8 A;  4ZI2 D;  3O9X A;  1M7K A;  4TV8 E;  4YLH A;  4DMW A;  3FXE B;  1MIW A;  3K1S A;  2YU2 A;  1XNR T;  4HWH A;  4X1I E;  2XQY A;  5HXR A;  3TLV A;  2BBH A;  3EHZ A;  1T7S A;  3KV6 A;  1NWM X;  3O1I A;  3HKE E;  4YY3 T;  1W09 A;  4TUY E;  2VQE T;  1WYC A;  1LKX A;  4LFB T;  4H9S E;  3G06 A;  1UGO A;  3PUX F;  4YTP A;  3EAB A;  5IHY A;  4PNI A;  5JDQ A;  3M3Z B;  2V6Y A;  3Q5W A;  4TWD A;  4M1P A;  3ZT5 A;  5L3C B;  3ZYK A;  2YIN A;  2WMO A;  1U4Q A;  2X67 A;  2FJA A;  1WLX A;  2XAQ B;  4DBQ A;  1UK5 A;  1I94 T;  3GN5 A;  2KIN B;  3PUR A;  1KK7 A;  4KHZ F;  3RF1 A;  2WCA A;  4EIW A;  2RA1 A;  3RYH E;  1SA0 E;  4I4T E;  3ZMU B;  1ZV4 X;  2X0L B;  2D2S A;  3VR8 A;  4JI5 T;  5HEU A;  2LHN A;  1HS7 A;  4MBQ A;  5AQP B;  5DAB A;  2YK0 A;  3BQI A;  4Q25 A;  2XQ4 A;  1ZOY A;  3KV9 A;  2BG9 C;  2WS3 A;  4CXX A;  4LF7 T;  2WZH A;  4Z90 A;  5FY1 A;  1YW0 A;  4O4H E;  1OXZ A;  5KDM C;  4ZI2 C;  3PDY A;  2DHR A;  1WCR A;  3TLU A;  3UQ7 A;  3ZT6 A;  2XSB A;  5HXE A;  2ZM6 T;  5AQK B;  4EB6 E;  5JVD E;  2UUC T;  1BR1 A;  3J7Y q;  2UXC T;  2WDQ A;  4JI4 T;  4NUV A;  1BR4 A;  3FXD B;  4DUY T;  1D0Z A;  3N5L A;  3ZJ1 A;  3LSV A;  4DO0 A;  5LG3 A;  2X66 A;  5F3J A;  4KP3 C;  3S4U A;  2XZE A;  2HN2 A;  2W2U A;  2BDE A;  3I9W A;  3LK3 B;  1NEK A;  3CX7 B;  1KNR A;  4EV6 A;  4B3S T;  2MTQ A;  3OYZ A;  3LBX B;  2N9D A;  2FJB A;  5LXT E;  3EUH A;  2E9X A;  3VKH A;  3QC9 A;  5HEO A;  4E7S A;  1MMN A;  5JR9 A;  3UU3 A;  2CEA A;  3N2O A;  3FBZ A;  4DID B;  5EK4 A;  2C0S A;  5AQL B;  1OED A;  2EHO D;  2XQ7 A;  3FZM B;  3C50 A;  2VL0 A;  5EK2 A;  4ASK A;  1LVK A;  3E08 A;  4PJJ A;  4O4I E;  5JRE A;  4ZI7 E;  2IDO B;  2IUB A;  3X1D A;  2BVL A;  3PUG A;  3ZST A;  2NOX A;  3OTO T;  3QK6 A;  3MXZ A;  3HKC E;  3TKL B;  4ZZB A;  3ONJ A;  3C64 A;  2H7V C;  3JC6 D;  3WAJ A;  1XWM A;  3MKD A;  3RQW A;  2A9U A;  5DQW A;  3KV4 A;  3PU8 A;  2J47 A;  4AIS A;  3IEE A;  2FUP A;  4AXP A;  2CWY A;  5FMN A;  1FEW A;  2JJ9 A;  2N2N A;  4LF9 T;  5TAO A;  3C51 A;  4QKN A;  4ZI3 D;  5AQJ B;  4FJO A;  4DBR A;  3OYX A;  3UUL A;  2QA7 A;  4IRE A;  5DJQ C;  2LRL A;  1DU2 A;  4CI2 B;  1XDP A;  2XAF B;  3KBU A;  3AE1 A;  4WNK A;  2CHN A;  5HCM A;  2J4G A;  3RIA A;  4EZH A;  5CFB A;  2K48 A;  2YN6 A;  3K3N A;  4XBF B;  3I1A A;  1MMG A;  4B3T T;  3RH3 A;  2W4X A;  2V7M A;  3RYI E;  4KHP T;  4DV0 T;  2E9X C;  5AQI B;  4DV6 T;  4YJ2 E;  1V9D A;  4GYR A;  5JR9 C;  5L47 A;  3UU6 A;  4MLK A;  1OED C;  4HN9 A;  2GK9 A;  1HNZ T;  3PJA A;  2IC6 A;  4YXD A;  2HPL A;  2CXD A;  3ONL C;  4JI3 T;  5J2U E;  3EI0 A;  2ODU A;  1KNZ A;  4O4L E;  1W0A A;  3UUB A;  4U74 A;  4DV5 T;  3AED A;  4ILB A;  2E8I A;  5AQN B;  4QXC B;  1UX4 A;  1SE7 A;  1S35 A;  3I0O A;  1YD8 G;  1MNE A;  3N9N A;  1HG5 A;  4F6R C;  4TNW A;  3L09 A;  3RIU A;  1US7 B;  1HG2 A;  1VCT A;  2CLY C;  4IE7 A;  4L5G A;  3GA8 A;  4ILU A;  3AE9 A;  1ZP0 A;  3RYF E;  5IWA T;  2G0U A;  5LMU T;  1W9R A;  3PUW F;  3AE2 A;  4CN4 A;  5LA6 E;  2V7L A;  5KMG P;  2HH7 A;  1WFD A;  3M65 A;  3FZH B;  2CHO A;  1D0X A;  4IDN A;  4DV2 T;  2ZM2 A;  2L8K A;  3P4S A;  1YKH B;  4IL4 A;  4MHC A;  4ERR A;  4P09 A;  4X20 E;  3NRY A;  2WDV A;  5JDH A;  1L0V A;  4DND A; 
#chains in the Genus database with same CATH homology
 5AQN B;  2D9D A;  4HWH A;  5AQO B;  1UGO A;  5AQV B;  5AQK B;  3FZL B;  3FZK B;  4HWF A;  5AQH B;  3A8Y C;  4HWI B;  3M3Z B;  1T7S A;  5AQG B;  5AQU B;  4HWC A;  5AQM B;  4HWD A;  1HX1 B;  1UK5 A;  5AQR B;  5AQJ B;  5AQL B;  5AQT B;  3FZM B;  1M62 A;  1M7K A;  5AQF B;  5AQP B;  1I6Z A;  5AQS B;  5AQI B;  5AQQ B;  3FZH B;  3LDQ B;  3FZF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...