1QSDA

Rbl2p, beta-tubulin binding post-chaperonin cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
TQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKRLLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (BETA-TUBULIN BINDING POST-CHAPERONIN COFACTOR)
publication title Crystal structure of the post-chaperonin beta-tubulin binding cofactor Rbl2p
pubmed doi rcsb
molecule tags Chaperone
total genus 45
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02970 TBCA Tubulin binding cofactor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1qsdA00
2C5JA 1H7CA 3QUJA 2KWHA 1LVFA 2C5KT 3TKLB 4L0RA 1IJ5A 1ZKEA 4DNDA 2IC6A 4EYYR 1IJ6A 3P7IA 4B6XA 3S4UA 2IC9A 2C5IT 3QK6A 2KWIB 3CKDA 3FXDB 2CA5A 2G0UA 2MBGA 2K48A 3N5LA 4FI5A 1Z0PA 4J2CA 2XTLA 3MXZA 2X9WA 3CVRA 3L3PA 2X9XA 3FXEB 1LRZA 2X9YA 4CQIA 1QSDA
chains in the Genus database with same CATH superfamily
5LB7B 3SS1A 1D0XA 1MMNA 2WDVA 3CX6B 3E08A 2V7KA 3SWHA 4IE7A 4YTNA 4CXYA 3FXEB 2NW9A 1XNQT 5M4YA 4OHFA 3N2GE 2P9BA 1SHZC 3N9NA 1IBMT 2E5VA 3PUZF 1ZKEA 1W0AA 4EZHA 1U4QA 4LMLA 3OVUA 2VL8A 3ZMUB 2LJLA 5AQRB 3CWZB 2WAUA 4Z90A 4WNKA 3RYHE 2ES0A 5FXXA 3HKBE 5JDFA 4MALA 4LFAT 2QGSA 1HS7A 5GONE 2XSBA 5CA0E 5EK3A 2HPJA 4HE8A 2LM9A 4B3TT 4HTEA 1MMGA 3BQKA 2IAKA 3AE8A 4TWFA 1FJGT 3T1YT 4JYAT 2XQYA 1BR4A 5JREA 3IF8B 2K9AA 5FXWA 3RF1A 3CQGB 2X0YA 3KBTA 5L3BB 3TLWA 2WU2A 3J9X1 3O4XE 4H63H 1OEDE 3IEEA 4AIUA 3ABVA 5IWAT 2WZHA 3RYCE 4JV5T 1XDOA 3C98B 4IREA 1D1CA 3AAIA 2EHOD 3N9LA 4UELA 3RQUA 5ABFB 3VR9A 3WI3A 4MFRA 3I9YA 4NUVA 3WAKA 4BJNA 3E22E 2L9QA 3KINB 3QB5A 4HFBA 4JI8T 5AQMB 2MAWA 4P0BA 1W0BA 3N9QA 3CQCB 3AEEA 3UUNA 4LF4T 4YXDA 2CM0A 2E5LT 5LXTE 3I9WA 2VKOA 4YFSA 2BG9A 3UUBA 2NTXA 2WMOA 2KZ7B 3Q5DA 4E7SA 3AE5A 5DJQC 4DMVA 4QH1A 3PURA 2D0UA 2K24A 4DV2T 4NIQA 4X62T 4XZCA 2WS3A 3ETUA 5FMNA 4QX7B 3K3NA 4HN9A 2YDSA 4DR2T 2MTQA 2VKJA 4AKGA 3VKGA 4WYVA 2PG8A 3PJAA 1MMAA 5JTGA 3OPCA 1J1JA 2QA7A 4DBRA 5C3JA 2W00A 2CPTA 3CQXC 3VRAA 2V7IA 2WP9A 4JI5T 3HR0A 2NW7A 2WSSV 2UUAT 2J4GA 2XQ3A 2UXDT 3ZT6A 2J47A 2PBIA 2BBHA 4U2YA 2D5UA 2X68A 3B57A 2E9XB 2IIUA 2NP9A 2XPKA 4PFOA 2A3DA 1YKHB 2VVSA 2W67A 4U7YA 2DWKA 1B7TA 2LSKA 3AEFA 4NXNT 5J2UE 3ONXA 3EHZA 5DQVA 3F31A 4AXPA 3CX8B 3K3QC 4U74A 3I0QA 5TAOA 5AQHB 5EK2A 3AEGA 2UXCT 2LKHA 4DV3T 2MYSA 3AA7B 1NENA 2XQ4A 3EUHA 2VQFT 2JMHA 4H9NC 2LE8A 4X20E 3VRBA 1XZYA 2G0UA 2N2NA 4BAYB 2V7MA 3RHWA 3NRXA 3RKGA 3RRCA 3UU3A 2Z6EA 2D2SA 1J5WA 3AB3B 5LCYA 5HEHA 3AE4A 4YJ2E 3ZYKA 1JNZA 2CA5A 5JRCA 3CX7B 4MBQA 3I0OA 2LEHA 2ZMAA 4OYJA 4TNVA 2ACXA 3ZT7A 2N1GA 3ANWB 1UX4A 2HH7A 3NKZA 2WBLA 2WMNA 5LBMA 2I59A 3U3IA 1E2AA 4FI5A 4TZ4C 3CIRA 4TN7B 5C8YE 4HFHA 4COFA 5FXVA 2LHNA 2W61A 3EDVA 3C4XA 4X66T 2BBJA 3NWIA 4CXWA 2HHHT 4DO0A 5LMUT 3OYXA 3BQLA 3SRZA 1FMVA 2YEVC 4I4TE 5HXCA 2VKDA 5JH7E 1HNWT 5JR9A 4EZ4A 3DP7A 4HEAA 1HNXT 2ODVA 5FYMA 2ZLYA 3O1HA 1WCRA 4ZXLA 2IUBA 2LSYA 1UCUA 2VL0A 4NPPA 1MIYA 2OA5A 3AE3A 5JDLA 1MMDA 1KF6A 2Y8DA 3RYFE 2YOEA 3JAEA 1XWMA 5AQGB 1UX5A 1T7SA 1KNRA 2UXNB 5AQIB 5JDNA 2BG9C 4ILBA 5ABHA 1D1AA 3KV6A 3ZLIA 2LSJA 3B5MA 1O3XA 3SFDA 2C5KT 4LF5T 4UVCB 5FL0A 4LF8T 1G73A 4UR9A 2DCFA 4F6RC 4TX5A 4E7ZA 2BG9E 2X9YA 5JVDE 3ZMTB 1FEWA 1LVFA 2I6HA 4TNWA 5AQSB 1YD8G 3BK9A 2BKNA 1N33T 3UUMA 2XQ8A 2BS4A 1IAPA 2F4VT 1XMQT 4EYUA 1Z0PA 2JRKA 5L3FB 5HWXA 4WW0A 5BR8T 4EGWA 4O8SA 5HEGA 3O1IA 4IE6A 2CRBA 2VKHA 4Q25A 3ZSTA 1N32T 3PDYA 1D0ZA 4JI6T 2NWBA 1NWMX 4G2AA 2UU9T 4CZZB 1M62A 2M6BA 5LHIB 3PE0A 1UGOA 4GYSA 4TUYE 3V5SA 1YKEB 3K1SA 2FJDA 1MIWA 2ACZA 3NRYA 4KI0F 2WZIA 4UF0A 4ZI2D 3J7Yq 4EIWA 3TLUA 5DQWA 2V26A 2YU1A 2HN2A 4PK6A 1HX8A 2LSGA 4AISA 3IHRA 3PUAA 4OX9T 5HEOA 2CHNA 3T1HT 3MKDA 3NZQA 1X9BA 1UK5A 1M7KA 4QH4A 1S35A 5LMNT 4KX6A 2VWAA 4KP3C 1WR6A 3JCFA 3AXJA 1BR0A 3UQ4A 2JJ9A 4YHJA 3A7MA 3PJAJ 5HXEA 3RIUA 5LG4A 4DR7T 5HXHA 2W62A 1T72A 5KXJA 3KVAA 2KLQA 5IHYA 4LFBT 2C5IT 3NBXX 3R6NA 2MBGA 5ADXL 5AQVB 5HAXA 3ZPOA 4JI0T 1VRBA 3UTKA 4Z8XA 5LJMA 5ETWA 1CUNA 3ZKRA 3AE7A 2J1DG 2B76A 1IJ6A 2IC9A 4L5GA 4O2BE 4I55E 5LNKA 2UUBT 1UURA 3JC6D 3P50A 4GIWA 2PFVA 4PFPA 2WB5A 3KDSE 2V6XA 4U3CA 3ETVA 2WCAA 3OJAA 4MHCA 2XQAA 4TWHA 2YN6A 2W2UA 1I6ZA 4IL4A 3AVRA 4HFDA 3VHLA 2XM2A 5JR9C 5LP6E 3H37A 2ZM2A 4ZS2A 2V5DA 2BVLA 3M3ZB 5L4HA 2VQET 4QX8B 4DR3T 1FMWA 1Z8UA 3FBLA 4MLKA 4HFVA 3ZT5A 3P4PA 3AVSA 5LHGB 3UFEA 4CN1A 3HKCE 3MK7C 1ZP0A 4QXBB 3N9MA 3M65A 4HWFA 1N34T 2V7JA 4QXCB 4JUYA 1ZEEA 2YDQA 4ZZBA 2E9XD 2W0GA 3IA3A 1W9RA 2CBJA 2VK9A 2LOPA 2IW5B 3Q5XA 1LRZA 2QRXA 3AECA 2EHOA 4AKHA 2FJAA 2N9DA 3TKLB 1WYBA 5HXRA 4EYYR 3I1AA 2FJBA 2XUEA 4O2AE 2H7OA 2WY2A 4U7IA 4J2CA 2BG9B 1R8IA 3ESLA 2X9WA 3QNUA 1ZHCA 3ZJ2A 2XQ6A 2B1EA 2XQ5A 3ZC0A 4GKKT 4YSYA 2Y6XA 4I0UA 2E8IA 1BR1A 1VCSA 4PAGA 1ZOYA 2V6YA 4ZZCA 4PJJA 3UU6A 4LFCT 1V9DA 3LBXA 3P4RA 2BDEA 1T98A 2K5BB 4G63A 2UUCT 2OV9A 3CK6A 2ZM8A 1U5PA 1EZ3A 2FUPA 4EOZB 3C4WA 4H9RC 5IUXA 3N2KE 4ZHQE 4DV6T 2BVMA 3ZYLA 3KV4A 4DNDA 4B6XA 4IL9A 4KUMB 3QK6A 2LSIA 4DV7T 4DMWA 4GKJT 2JMKA 3K8PC 2K48A 4ZI3C 3W15B 3ZCJA 4AI6A 5FY0A 2I0MA 3RIAA 5F5WA 5AQKB 2IDOB 5JDHA 3A5XA 4TV8E 4K0UA 3CMLA 4O4LE 3BQIA 4B3ST 3S4UA 4WBOA 2JQQA 3MXZA 2V1DB 4IHJE 4EAHA 4AQFA 4A56A 2KWHA 3UULA 4DUYT 2LT3A 4I43B 1AJ3A 4LF7T 4PJMA 4UVAB 1KFYA 5HCMA 2LRKA 3B13A 3Q9DA 4IT4A 2R6GF 3AA1B 5LOVE 2KSRA 4HWDA 3RIUC 3FHNA 2D0TA 3LSVA 4DUZT 2W66A 4U72A 4X5TA 2YU2A 1S94A 4YSXA 5HCJA 2M6IA 4X64T 3UQ7A 1DU2A 2AXDS 2WQYA 3CKDA 4U2ZA 5AQQB 3Q5WA 4UV9B 1VCTA 3UU4A 5AQOB 3ZMSB 3PUWF 1OEDA 4AQGA 5JRCB 4NXMT 3SOLA 2IHR1 3ZYMA 4YHHT 3RGLA 3UU8A 3AEBA 4ADZA 2Q9QD 3UU5A 1KEYA 3L3PA 2XQ9A 3ZMZB 5H6RB 5L3EB 2H3RA 4PW8A 2XASB 4EB6E 1IZNB 4DV0T 5FVKA 5H6QB 4CQIA 2H89A 4H63V 3HKDE 2WDQA 5JDMA 2CXLA 3OTOT 5AQJB 4KMCA 3RRWA 2BS3A 2IMLA 5L3GB 3RLFF 2C0SA 5JR9B 2VVNA 4JI2T 4DBQA 3KBUA 3RQWA 3AEAA 3RX6A 3G06A 4IIJE 5LGTB 4X1KE 4H9QC 3GN5A 3P4SA 4U31A 3RH3A 4ZI7E 2X0HA 4JLEA 2Q9QA 4PJNA 3R84B 5C2TA 5E0OA 3IBPA 3N9OA 2RA1A 2EHOC 2XHEB 2XAJB 4GK0E 4PK4A 3RI5A 3Q2MA 3KVBA 2YK0A 2JPFA 2VASA 4P09A 2V5CA 1XNRT 3MJXA 1US7B 2XTLA 2XAHB 4P0AA 4LF9T 5HEJA 4DR6T 2WM9A 2LLYA 3LJCA 1CHUA 4PJLA 5FY1A 3RYIE 2BZBA 3DTOA 3CPZA 3TLSA 4OFZA 4ASKA 3EI0A 3NZPA 3N5LA 4IDQA 3OYZA 1D1BA 3SFEA 2KT9A 4NUUA 2X0LB 4GYRA 1MNEA 1YW0A 5AFUL 2XY8B 1ZV4X 3TLTA 2CLYC 4EEDA 3P7IA 2BS2A 4DR5T 4TWDA 2CHOA 3EAMA 1OXZA 4CI2B 1W09A 4ILCA 3K3OA 4HWIB 1WYCA 3AE6A 4HKAA 4QXHB 4YTMA 2FJEA 2X67A 2XQ7A 4DV1T 2A2FX 2KWIB 4AQFC 5DABA 3N9PA 2RP4A 2W63A 2J62A 2CE7A 4DV5T 3Q5EA 1HG5A 4V1Av 2CWYA 2V7LA 4C91A 2X51A 3ZEFB 5L3CB 2LKGA 5ABGA 4UF0B 3V5UA 2ZM0A 2OLTA 4ZOLE 3KV9A 4JI1T 4CI3B 4HWHA 3QOFA 3ZJ1A 3ZMVB 4CI1B 1NAFA 3UFGA 2KINB 4DV4T 3PUVF 2D9DA 1WFDA 1QLBA 4O4JE 3HL6A 4IE5A 4HWCA 5EZYE 3HKEE 5AQPB 1HX1B 3PU3A 2H7VC 4KBMB 3T8OA 1XMOT 4QHOA 4KHPT 5LBQB 5JQGE 1HG2A 3AXJB 1N36T 2ZM6T 2NTYA 5IYZE 2UXBT 4LMJA 2DL1A 1OEDC 5FP3A 5LYJE 3DJBA 2XM1A 3AA6B 1QSDA 4JEUB 2CXFA 2YKSA 5ABFA 3GA8A 4HFIA 2DWGA 3QUJA 4ZEYA 3UUXB 4JI7T 3AE9A 2CEAA 3AAAB 2KNDA 3D0TA 2CCQA 4JI3T 4X65T 3KV5A 3L39A 4ERRA 3MACA 2RPAA 4UV8B 2VURA 4L0RA 3RKOA 3FZFB 4WZXA 2XJ7A 1VOMA 3ZN0B 2XAFB 3FZMB 2A9UA 2CXDA 4JEHB 3LK42 4M1PA 4O4IE 4DVDA 3ZC1A 4AQYT 1Y01A 5L47A 4JBWF 4CN4A 3ZCIA 1WLXA 5LGUB 2Q9QC 2X9XA 1GQEA 4OK0A 1SA0E 3F2EA 2ODUA 1JNRA 3PUYF 5CA1E 4GOUA 5F8PA 4YT0A 4HGAA 4YSZA 1T8BA 3NVOA 4B3MT 5AQUB 1KNZA 2C5JA 4A97A 3LK2B 5KMGP 3OBVE 5FXZA 3MA9A 4KHZF 4F8HA 3JAFA 4BJMA 3GWHA 2EHOB 2LOSA 3O1JA 1HNZT 2E9XA 3E0ZA 4DR4T 4IE4A 1E1HB 2KMFA 3AEDA 4AKIA 3QB5K 4EV6A 4UEMA 3MZKB 3AAEB 5FY7A 3AE1A 4H9SE 4YLHA 4GK5E 2SPCA 3L8RA 3P4QA 2HN1A 2XSAA 1WR0A 2JQKA 3PUXF 2V6YB 4ANJA 4X1YE 1KK7A 4O4HE 5LHHB 2NW8A 3ONJA 2KXPB 3LBXB 2UXXB 1NEKA 5HXSA 5KDMC 2K3WA 2JQ9A 2WWVA 4PK5A 2GK9A 3TLVA 1OWAA 2YDRA 3QC9A 2CWOA 1YQ3A 5FKYA 2LRLA 3OKQA 4WBNE 2XZEA 5LGNB 4IDPA 1H7CA 5A1LA 1E7PA 5HWYA 3ONLC 2CLYB 4FJOA 4U33A 1IBLT 2IC6A 2LHRA 3CVRA 3VU7H 4A98A 4QWNB 3RC3A 5JDQA 4CXXA 2YINA 3KFWX 4IDZA 4N78D 2XAQB 3C50A 1KNPA 2H88A 3EVYA 3ANWA 3FZHB 2X66A 1I94T 3LFMA 2DHRA 4ZI2C 2PTFA 2XAGB 4L9IA 2MOZA 2VB6A 3FZLB 3ZSSA 3P4WA 1BR2A 4HFEA 2E2AA 1L0VA 2W4XA 3P8CD 2DI4A 5AQNB 5FNVE 2DNXA 3LDQB 1J5ET 2V8SV 2HPLA 3X1DA 4H9OC 3RPUA 3PUQA 5L4EA 3HA4A 2X9HA 3RC8A 4AKLA 4XAXB 3U78A 4EXTA 4YJ3E 1XDPA 5J2TE 2NOXA 1UUSA 5KX5E 4K0KT 5CJ5A 2WDRA 3FB2A 3FZKB 2CBIA 4UXNB 3N2OA 4QKNA 5LJNA 4EEBA 3GMIA 3VR8A 2CMRA 4OYKA 4YY3T 4UIGA 1FIOA 3PUGA 2MPKA 2L8KA 1OEDB 1Y64B 1QUUA 1SE7A 3L09A 4Z91A 4IE0A 1LVKA 3H3MA 4ZS3A 5AQFB 4JI4T 3AA0B 4UVBB 3PU8A 4H9PC 3JADA 5FL1A 4ISSA 1MNDA 1G8XA 4CN6A 5L3DB 4QH5A 3C64A 3JC6C 3C4ZA 5HYAA 1HTJF 4YTPA 1X79A 3WAJA 1YXRA 5J1GA 1IJ5A 5BMVE 2QVAA 4I50E 4ILAA 3ZN1B 2L3LA 1HCIA 3PTRB 2QYWA 5EK4A 1HR0T 1MIVA 4P1NA 4LMKA 3F57A 3C51A 3FBZA 2PJQA 2WU5A 5JDGA 4LF6T 1LKXA 4ZI3D 3GN5B 5LA6E 3EABA 5CB4E 1HF8A 2BKPA 4IDOA 2Q9QB 4ISTA 1HFAA 4AKRB 2DLRA 2E9XC 4ILUA 1D0YA 3PV0F 2BKOA 4C90A 3VKHA 5J0ZA 4DR1T 5ABEA 4XBFB 2M67A 2A72A 2JIWA 5LG3A 3FXDB 3EDUA 4TV9E 1IBKT 2WWUA 3AE2A 5CGMA 4B3RT 4PNIA 4IDNA 3LK3B 4DIDB 5F3JA 2LM2A 3PUSA 2JQHA 4IGUA 5AQLB 3H3AA 4HFCA 5L2LA 3A8YC 3HI2A 2AE9A 1SUMB 3O9XA 2FBWA 1WRDA 3LG7A 3UT5E 2NR4A 3RIFA 2Y48B 5CFBA 4A5XA 1YQ4A 4BA9A 4X1IE 5FVLA 5HEUA 5AQTB
chains in the Genus database with same CATH topology
2OA5A 3SS1A 1D0XA 1MMNA 3LK42 4JEHB 4M1PA 4A56A 2KWHA 1MMDA 3UULA 4AQFA 5JDLA 2LT3A 4I43B 2Y8DA 3RYFE 3CX6B 4O4IE 4DVDA 1AJ3A 3ZC1A 3E08A 4PJMA 4UVAB 2V7KA 3SWHA 1UX5A 4IE7A 2UXNB 3ZCIA 5JDNA 1WLXA 3B13A 5LGUB 4CXYA 2Q9QC 3Q9DA 1D1AA 3KV6A 3ZLIA 2X9XA 3FXEB 2LSJA 3AA1B 2NW9A 5M4YA 4OHFA 5LOVE 3N2GE 4OK0A 1SA0E 2P9BA 1O3XA 1SHZC 3F2EA 3N9NA 2C5KT 4UVCB 2ODUA 1ZKEA 5CA1E 4EZHA 1U4QA 4GOUA 1G73A 5F8PA 3FHNA 2VL8A 3ZMUB 2LJLA 2DCFA 4F6RC 2D0TA 4TX5A 4HGAA 3CWZB 2WAUA 3RYHE 4WNKA 4E7ZA 2ES0A 2X9YA 4U72A 5JVDE 5FXXA 3HKBE 5JDFA 3ZMTB 2C5JA 4MALA 1KNZA 1FEWA 2YU2A 2QGSA 1S94A 1HS7A 5GONE 1LVFA 5CA0E 3LK2B 5KMGP 3OBVE 5EK3A 5FXZA 2HPJA 3MA9A 1YD8G 3BK9A 2LM9A 4HE8A 3UUMA 4BJMA 4HTEA 1IAPA 1MMGA 3BQKA 3CKDA 3GWHA 4EYUA 2IAKA 2EHOB 2LOSA 3O1JA 1Z0PA 2JRKA 3Q5WA 5L3FB 2E9XA 3E0ZA 4IE4A 4UV9B 4WW0A 5HWXA 1E1HB 2KMFA 4O8SA 4AKIA 3O1IA 3ZMSB 2XQYA 1BR4A 4IE6A 5JREA 3IF8B 4AQGA 2K9AA 5FXWA 4UEMA 3MZKB 5JRCB 3AAEB 3CQGB 5FY7A 3SOLA 4H9SE 2VKHA 3ZYMA 3KBTA 5L3BB 4YLHA 4GK5E 2SPCA 4ADZA 2Q9QD 3PDYA 3J9X1 3O4XE 1D0ZA 3L3PA 2NWBA 4H63H 1NWMX 3IEEA 3ZMZB 4G2AA 4ANJA 4X1YE 1KK7A 5H6RB 4O4HE 4CZZB 3RYCE 5LHHB 2NW8A 5L3EB 2KXPB 3LBXB 5LHIB 3C98B 2H3RA 3PE0A 4PW8A 2UXXB 2XASB 4EB6E 1D1CA 4GYSA 4TUYE 5HXSA 3AAIA 1IZNB 2EHOD 3N9LA 3V5SA 1YKEB 5KDMC 4PK5A 2GK9A 4UELA 3WI3A 1OWAA 4MFRA 3QC9A 1MIWA 3I9YA 3NRYA 2CWOA 4UF0A 4NUVA 5H6QB 3OKQA 4WBNE 4ZI2D 4CQIA 5LGNB 3J7Yq 4EIWA 3WAKA 5DQWA 4BJNA 1H7CA 2V26A 3E22E 2L9QA 2YU1A 3HKDE 4H63V 4PK6A 1HX8A 2LSGA 3IHRA 3PUAA 5JDMA 5A1LA 2CXLA 3KINB 5HWYA 2CLYB 4FJOA 4KMCA 2IC6A 3RRWA 4P0BA 3N9QA 3MKDA 2LHRA 3NZQA 5L3GB 2C0SA 5JR9B 3CQCB 4DBQA 3KBUA 3UUNA 3CVRA 3VU7H 3RX6A 4QWNB 2CM0A 3RC3A 1S35A 5LXTE 4IIJE 3I9WA 5LGTB 5JDQA 2VKOA 4X1KE 4YFSA 4H9QC 3GN5A 2VWAA 3RH3A 4KP3C 4ZI7E 2NTXA 2WMOA 4JLEA 2Q9QA 4PJNA 4CXXA 2KZ7B 1WR6A 2YINA 3R84B 4E7SA 5DJQC 3KFWX 5E0OA 4DMVA 3IBPA 3N9OA 4IDZA 3PURA 2D0UA 2K24A 2RA1A 4N78D 3C50A 2EHOC 2XAQB 2XHEB 1BR0A 2JJ9A 2XAJB 3ANWA 3EVYA 4YHJA 4GK0E 4XZCA 2X66A 4PK4A 3LFMA 3ETUA 5FMNA 5HXEA 2DHRA 4ZI2C 4QX7B 2XAGB 4L9IA 3Q2MA 2MOZA 3K3NA 2VB6A 5LG4A 4HN9A 5HXHA 1BR2A 2W62A 3KVBA 2YK0A 3KVAA 2MTQA 2JPFA 2VKJA 2VASA 4P09A 4AKGA 2KLQA 3P8CD 5IHYA 2DI4A 3VKGA 5FNVE 2DNXA 2C5IT 2PG8A 3NBXX 1MMAA 3R6NA 2MBGA 3MJXA 5ADXL 1US7B 2HPLA 2QA7A 4DBRA 2XTLA 4H9OC 5HAXA 3RPUA 2XAHB 3ZPOA 4P0AA 3PUQA 3HA4A 2WM9A 2X9HA 2W00A 3LJCA 1VRBA 3UTKA 3RC8A 4Z8XA 4AKLA 3CQXC 4PJLA 4XAXB 5FY1A 3U78A 4EXTA 5LJMA 5ETWA 4YJ3E 1CUNA 3RYIE 2BZBA 2J1DG 2V7IA 3DTOA 3HR0A 1IJ6A 2NOXA 5J2TE 3CPZA 2NW7A 2WSSV 2IC9A 4OFZA 4L5GA 4ASKA 4O2BE 4I55E 5LNKA 5KX5E 3JC6D 3NZPA 3N5LA 3FB2A 4GIWA 3OYZA 2PFVA 4PFPA 1D1BA 4UXNB 3N2OA 4QKNA 3KDSE 5LJNA 3GMIA 3ETVA 2PBIA 2KT9A 4NUUA 2CMRA 3OJAA 4OYKA 2D5UA 2X0LB 2X68A 4GYRA 1MNEA 1YW0A 4MHCA 5AFUL 3B57A 1ZV4X 2CLYC 4UIGA 1FIOA 2E9XB 3P7IA 3PUGA 2NP9A 3AVRA 3VHLA 2L8KA 5JR9C 4PFOA 5LP6E 2A3DA 1OXZA 3H37A 2ZM2A 1YKHB 4CI2B 4ZS2A 1Y64B 1QUUA 2BVLA 3L09A 4IE0A 1LVKA 4ZS3A 3K3OA 4QX8B 2DWKA 1B7TA 3AA0B 1FMWA 4UVBB 2LSKA 3FBLA 1WYCA 3PU8A 4H9PC 4HKAA 4MLKA 4QXHB 5J2UE 3ONXA 4HFVA 4ISSA 3AVSA 5DQVA 2X67A 3F31A 1MNDA 1G8XA 4AXPA 3CX8B 5LHGB 3UFEA 2A2FX 3K3QC 5L3DB 2KWIB 3HKCE 4AQFC 4U74A 3I0QA 3MK7C 5TAOA 5DABA 3C64A 3N9PA 3JC6C 3C4ZA 5HYAA 1HTJF 2RP4A 2W63A 5EK2A 2CE7A 4QXBB 3N9MA 3M65A 1X79A 2V7JA 4QXCB 4JUYA 1ZEEA 1HG5A 2MYSA 3AA7B 4V1Av 2CWYA 3WAJA 2V7LA 2E9XD 2X51A 4C91A 2W0GA 3EUHA 5J1GA 1IJ5A 2JMHA 3ZEFB 5BMVE 3V5UA 5L3CB 4UF0B 4I50E 4H9NC 3ZN1B 2ZM0A 2LE8A 2L3LA 1HCIA 3PTRB 4X20E 4ZOLE 5EK4A 2G0UA 3KV9A 2VK9A 2LOPA 4CI3B 2IW5B 3ZJ1A 2N2NA 3Q5XA 1LRZA 4BAYB 3ZMVB 2V7MA 1MIVA 2EHOA 3NRXA 3RRCA 4CI1B 4AKHA 2Z6EA 1NAFA 2N9DA 2D2SA 3TKLB 1WYBA 3AB3B 5HXRA 3F57A 2KINB 3C51A 4EYYR 5LCYA 3FBZA 2PJQA 5JDGA 3I1AA 2XUEA 4O2AE 3ZYKA 4YJ2E 1LKXA 2H7OA 4ZI3D 3GN5B 2CA5A 5LA6E 4O4JE 5CB4E 5JRCA 1HF8A 3HL6A 4IE5A 3CX7B 4J2CA 5EZYE 4MBQA 3ESLA 2X9WA 3HKEE 2Q9QB 1ZHCA 4ISTA 3I0OA 2LEHA 2ZMAA 4OYJA 3ZJ2A 3PU3A 2H7VC 4KBMB 1HFAA 2B1EA 4AKRB 3T8OA 2ACXA 3ZC0A 4QHOA 2DLRA 2Y6XA 5LBQB 5JQGE 2N1GA 2E8IA 1BR1A 1HG2A 4PAGA 2E9XC 4ILUA 1D0YA 3ANWB 4C90A 3VKHA 1UX4A 2HH7A 2WBLA 4XBFB 2M67A 4PJJA 2WMNA 2NTYA 5LBMA 5IYZE 1V9DA 2A72A 2I59A 3LBXA 3U3IA 3FXDB 2BDEA 4FI5A 1T98A 5FP3A 3EDUA 2K5BB 4TV9E 5LYJE 4G63A 4TZ4C 4TN7B 5C8YE 3DJBA 2ZM8A 3AA6B 1QSDA 1U5PA 4JEUB 5FXVA 1EZ3A 2CXFA 2LHNA 3GA8A 2DWGA 2WWUA 3QUJA 4PNIA 4EOZB 2W61A 3LK3B 3EDVA 3UUXB 3C4WA 3C4XA 4H9RC 4CXWA 3N2KE 4DO0A 4ZHQE 5F3JA 2BVMA 3ZYLA 3KV4A 4DNDA 4B6XA 2CEAA 3PUSA 3OYXA 4IGUA 4KUMB 3BQLA 3QK6A 2LSIA 3SRZA 3AAAB 4DMWA 1FMVA 2YEVC 4I4TE 2JMKA 3K8PC 2K48A 4ZI3C 3W15B 5HXCA 3ZCJA 4AI6A 5FY0A 2KNDA 3D0TA 2CCQA 3KV5A 2VKDA 3H3AA 4ERRA 5JH7E 5L2LA 5JR9A 3MACA 4EZ4A 3DP7A 3HI2A 5JDHA 4HEAA 2ODVA 3A5XA 5FYMA 4UV8B 2ZLYA 4L0RA 3O9XA 3O1HA 3RKOA 4TV8E 4K0UA 3CMLA 4O4LE 3BQIA 3S4UA 2LSYA 1WRDA 3LG7A 4WBOA 1UCUA 3UT5E 1VOMA 2JQQA 3ZN0B 2Y48B 3MXZA 2V1DB 2XAFB 1MIYA 4IHJE 4EAHA 4BA9A 4X1IE 2CXDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5J A;  1H7C A;  3QUJ A;  2KWH A;  1LVF A;  2C5K T;  3TKL B;  4L0R A;  1IJ5 A;  1ZKE A;  4DND A;  2IC6 A;  4EYY R;  1IJ6 A;  3P7I A;  4B6X A;  3S4U A;  2IC9 A;  2C5I T;  3QK6 A;  2KWI B;  3CKD A;  3FXD B;  2CA5 A;  2G0U A;  2MBG A;  2K48 A;  3N5L A;  4FI5 A;  1Z0P A;  4J2C A;  2XTL A;  3MXZ A;  2X9W A;  3CVR A;  3L3P A;  2X9X A;  3FXE B;  1LRZ A;  2X9Y A;  4CQI A;  1QSD A; 
#chains in the Genus database with same CATH topology
 5LB7 B;  3SS1 A;  1D0X A;  1MMN A;  2WDV A;  3CX6 B;  3E08 A;  2V7K A;  3SWH A;  4IE7 A;  4YTN A;  4CXY A;  3FXE B;  2NW9 A;  1XNQ T;  5M4Y A;  4OHF A;  3N2G E;  2P9B A;  1SHZ C;  3N9N A;  1IBM T;  2E5V A;  3PUZ F;  1ZKE A;  1W0A A;  4EZH A;  1U4Q A;  4LML A;  3OVU A;  2VL8 A;  3ZMU B;  2LJL A;  5AQR B;  3CWZ B;  2WAU A;  4Z90 A;  4WNK A;  3RYH E;  2ES0 A;  5FXX A;  3HKB E;  5JDF A;  4MAL A;  4LFA T;  2QGS A;  1HS7 A;  5GON E;  2XSB A;  5CA0 E;  5EK3 A;  2HPJ A;  4HE8 A;  2LM9 A;  4B3T T;  4HTE A;  1MMG A;  3BQK A;  2IAK A;  3AE8 A;  4TWF A;  1FJG T;  3T1Y T;  4JYA T;  2XQY A;  1BR4 A;  5JRE A;  3IF8 B;  2K9A A;  5FXW A;  3RF1 A;  3CQG B;  2X0Y A;  3KBT A;  5L3B B;  3TLW A;  2WU2 A;  3J9X 1;  3O4X E;  4H63 H;  1OED E;  3IEE A;  4AIU A;  3ABV A;  5IWA T;  2WZH A;  3RYC E;  4JV5 T;  1XDO A;  3C98 B;  4IRE A;  1D1C A;  3AAI A;  2EHO D;  3N9L A;  4UEL A;  3RQU A;  5ABF B;  3VR9 A;  3WI3 A;  4MFR A;  3I9Y A;  4NUV A;  3WAK A;  4BJN A;  3E22 E;  2L9Q A;  3KIN B;  3QB5 A;  4HFB A;  4JI8 T;  5AQM B;  2MAW A;  4P0B A;  1W0B A;  3N9Q A;  3CQC B;  3AEE A;  3UUN A;  4LF4 T;  4YXD A;  2CM0 A;  2E5L T;  5LXT E;  3I9W A;  2VKO A;  4YFS A;  2BG9 A;  3UUB A;  2NTX A;  2WMO A;  2KZ7 B;  3Q5D A;  4E7S A;  3AE5 A;  5DJQ C;  4DMV A;  4QH1 A;  3PUR A;  2D0U A;  2K24 A;  4DV2 T;  4NIQ A;  4X62 T;  4XZC A;  2WS3 A;  3ETU A;  5FMN A;  4QX7 B;  3K3N A;  4HN9 A;  2YDS A;  4DR2 T;  2MTQ A;  2VKJ A;  4AKG A;  3VKG A;  4WYV A;  2PG8 A;  3PJA A;  1MMA A;  5JTG A;  3OPC A;  1J1J A;  2QA7 A;  4DBR A;  5C3J A;  2W00 A;  2CPT A;  3CQX C;  3VRA A;  2V7I A;  2WP9 A;  4JI5 T;  3HR0 A;  2NW7 A;  2WSS V;  2UUA T;  2J4G A;  2XQ3 A;  2UXD T;  3ZT6 A;  2J47 A;  2PBI A;  2BBH A;  4U2Y A;  2D5U A;  2X68 A;  3B57 A;  2E9X B;  2IIU A;  2NP9 A;  2XPK A;  4PFO A;  2A3D A;  1YKH B;  2VVS A;  2W67 A;  4U7Y A;  2DWK A;  1B7T A;  2LSK A;  3AEF A;  4NXN T;  5J2U E;  3ONX A;  3EHZ A;  5DQV A;  3F31 A;  4AXP A;  3CX8 B;  3K3Q C;  4U74 A;  3I0Q A;  5TAO A;  5AQH B;  5EK2 A;  3AEG A;  2UXC T;  2LKH A;  4DV3 T;  2MYS A;  3AA7 B;  1NEN A;  2XQ4 A;  3EUH A;  2VQF T;  2JMH A;  4H9N C;  2LE8 A;  4X20 E;  3VRB A;  1XZY A;  2G0U A;  2N2N A;  4BAY B;  2V7M A;  3RHW A;  3NRX A;  3RKG A;  3RRC A;  3UU3 A;  2Z6E A;  2D2S A;  1J5W A;  3AB3 B;  5LCY A;  5HEH A;  3AE4 A;  4YJ2 E;  3ZYK A;  1JNZ A;  2CA5 A;  5JRC A;  3CX7 B;  4MBQ A;  3I0O A;  2LEH A;  2ZMA A;  4OYJ A;  4TNV A;  2ACX A;  3ZT7 A;  2N1G A;  3ANW B;  1UX4 A;  2HH7 A;  3NKZ A;  2WBL A;  2WMN A;  5LBM A;  2I59 A;  3U3I A;  1E2A A;  4FI5 A;  4TZ4 C;  3CIR A;  4TN7 B;  5C8Y E;  4HFH A;  4COF A;  5FXV A;  2LHN A;  2W61 A;  3EDV A;  3C4X A;  4X66 T;  2BBJ A;  3NWI A;  4CXW A;  2HHH T;  4DO0 A;  5LMU T;  3OYX A;  3BQL A;  3SRZ A;  1FMV A;  2YEV C;  4I4T E;  5HXC A;  2VKD A;  5JH7 E;  1HNW T;  5JR9 A;  4EZ4 A;  3DP7 A;  4HEA A;  1HNX T;  2ODV A;  5FYM A;  2ZLY A;  3O1H A;  1WCR A;  4ZXL A;  2IUB A;  2LSY A;  1UCU A;  2VL0 A;  4NPP A;  1MIY A;  2OA5 A;  3AE3 A;  5JDL A;  1MMD A;  1KF6 A;  2Y8D A;  3RYF E;  2YOE A;  3JAE A;  1XWM A;  5AQG B;  1UX5 A;  1T7S A;  1KNR A;  2UXN B;  5AQI B;  5JDN A;  2BG9 C;  4ILB A;  5ABH A;  1D1A A;  3KV6 A;  3ZLI A;  2LSJ A;  3B5M A;  1O3X A;  3SFD A;  2C5K T;  4LF5 T;  4UVC B;  5FL0 A;  4LF8 T;  1G73 A;  4UR9 A;  2DCF A;  4F6R C;  4TX5 A;  4E7Z A;  2BG9 E;  2X9Y A;  5JVD E;  3ZMT B;  1FEW A;  1LVF A;  2I6H A;  4TNW A;  5AQS B;  1YD8 G;  3BK9 A;  2BKN A;  1N33 T;  3UUM A;  2XQ8 A;  2BS4 A;  1IAP A;  2F4V T;  1XMQ T;  4EYU A;  1Z0P A;  2JRK A;  5L3F B;  5HWX A;  4WW0 A;  5BR8 T;  4EGW A;  4O8S A;  5HEG A;  3O1I A;  4IE6 A;  2CRB A;  2VKH A;  4Q25 A;  3ZST A;  1N32 T;  3PDY A;  1D0Z A;  4JI6 T;  2NWB A;  1NWM X;  4G2A A;  2UU9 T;  4CZZ B;  1M62 A;  2M6B A;  5LHI B;  3PE0 A;  1UGO A;  4GYS A;  4TUY E;  3V5S A;  1YKE B;  3K1S A;  2FJD A;  1MIW A;  2ACZ A;  3NRY A;  4KI0 F;  2WZI A;  4UF0 A;  4ZI2 D;  3J7Y q;  4EIW A;  3TLU A;  5DQW A;  2V26 A;  2YU1 A;  2HN2 A;  4PK6 A;  1HX8 A;  2LSG A;  4AIS A;  3IHR A;  3PUA A;  4OX9 T;  5HEO A;  2CHN A;  3T1H T;  3MKD A;  3NZQ A;  1X9B A;  1UK5 A;  1M7K A;  4QH4 A;  1S35 A;  5LMN T;  4KX6 A;  2VWA A;  4KP3 C;  1WR6 A;  3JCF A;  3AXJ A;  1BR0 A;  3UQ4 A;  2JJ9 A;  4YHJ A;  3A7M A;  3PJA J;  5HXE A;  3RIU A;  5LG4 A;  4DR7 T;  5HXH A;  2W62 A;  1T72 A;  5KXJ A;  3KVA A;  2KLQ A;  5IHY A;  4LFB T;  2C5I T;  3NBX X;  3R6N A;  2MBG A;  5ADX L;  5AQV B;  5HAX A;  3ZPO A;  4JI0 T;  1VRB A;  3UTK A;  4Z8X A;  5LJM A;  5ETW A;  1CUN A;  3ZKR A;  3AE7 A;  2J1D G;  2B76 A;  1IJ6 A;  2IC9 A;  4L5G A;  4O2B E;  4I55 E;  5LNK A;  2UUB T;  1UUR A;  3JC6 D;  3P50 A;  4GIW A;  2PFV A;  4PFP A;  2WB5 A;  3KDS E;  2V6X A;  4U3C A;  3ETV A;  2WCA A;  3OJA A;  4MHC A;  2XQA A;  4TWH A;  2YN6 A;  2W2U A;  1I6Z A;  4IL4 A;  3AVR A;  4HFD A;  3VHL A;  2XM2 A;  5JR9 C;  5LP6 E;  3H37 A;  2ZM2 A;  4ZS2 A;  2V5D A;  2BVL A;  3M3Z B;  5L4H A;  2VQE T;  4QX8 B;  4DR3 T;  1FMW A;  1Z8U A;  3FBL A;  4MLK A;  4HFV A;  3ZT5 A;  3P4P A;  3AVS A;  5LHG B;  3UFE A;  4CN1 A;  3HKC E;  3MK7 C;  1ZP0 A;  4QXB B;  3N9M A;  3M65 A;  4HWF A;  1N34 T;  2V7J A;  4QXC B;  4JUY A;  1ZEE A;  2YDQ A;  4ZZB A;  2E9X D;  2W0G A;  3IA3 A;  1W9R A;  2CBJ A;  2VK9 A;  2LOP A;  2IW5 B;  3Q5X A;  1LRZ A;  2QRX A;  3AEC A;  2EHO A;  4AKH A;  2FJA A;  2N9D A;  3TKL B;  1WYB A;  5HXR A;  4EYY R;  3I1A A;  2FJB A;  2XUE A;  4O2A E;  2H7O A;  2WY2 A;  4U7I A;  4J2C A;  2BG9 B;  1R8I A;  3ESL A;  2X9W A;  3QNU A;  1ZHC A;  3ZJ2 A;  2XQ6 A;  2B1E A;  2XQ5 A;  3ZC0 A;  4GKK T;  4YSY A;  2Y6X A;  4I0U A;  2E8I A;  1BR1 A;  1VCS A;  4PAG A;  1ZOY A;  2V6Y A;  4ZZC A;  4PJJ A;  3UU6 A;  4LFC T;  1V9D A;  3LBX A;  3P4R A;  2BDE A;  1T98 A;  2K5B B;  4G63 A;  2UUC T;  2OV9 A;  3CK6 A;  2ZM8 A;  1U5P A;  1EZ3 A;  2FUP A;  4EOZ B;  3C4W A;  4H9R C;  5IUX A;  3N2K E;  4ZHQ E;  4DV6 T;  2BVM A;  3ZYL A;  3KV4 A;  4DND A;  4B6X A;  4IL9 A;  4KUM B;  3QK6 A;  2LSI A;  4DV7 T;  4DMW A;  4GKJ T;  2JMK A;  3K8P C;  2K48 A;  4ZI3 C;  3W15 B;  3ZCJ A;  4AI6 A;  5FY0 A;  2I0M A;  3RIA A;  5F5W A;  5AQK B;  2IDO B;  5JDH A;  3A5X A;  4TV8 E;  4K0U A;  3CML A;  4O4L E;  3BQI A;  4B3S T;  3S4U A;  4WBO A;  2JQQ A;  3MXZ A;  2V1D B;  4IHJ E;  4EAH A;  4AQF A;  4A56 A;  2KWH A;  3UUL A;  4DUY T;  2LT3 A;  4I43 B;  1AJ3 A;  4LF7 T;  4PJM A;  4UVA B;  1KFY A;  5HCM A;  2LRK A;  3B13 A;  3Q9D A;  4IT4 A;  2R6G F;  3AA1 B;  5LOV E;  2KSR A;  4HWD A;  3RIU C;  3FHN A;  2D0T A;  3LSV A;  4DUZ T;  2W66 A;  4U72 A;  4X5T A;  2YU2 A;  1S94 A;  4YSX A;  5HCJ A;  2M6I A;  4X64 T;  3UQ7 A;  1DU2 A;  2AXD S;  2WQY A;  3CKD A;  4U2Z A;  5AQQ B;  3Q5W A;  4UV9 B;  1VCT A;  3UU4 A;  5AQO B;  3ZMS B;  3PUW F;  1OED A;  4AQG A;  5JRC B;  4NXM T;  3SOL A;  2IHR 1;  3ZYM A;  4YHH T;  3RGL A;  3UU8 A;  3AEB A;  4ADZ A;  2Q9Q D;  3UU5 A;  1KEY A;  3L3P A;  2XQ9 A;  3ZMZ B;  5H6R B;  5L3E B;  2H3R A;  4PW8 A;  2XAS B;  4EB6 E;  1IZN B;  4DV0 T;  5FVK A;  5H6Q B;  4CQI A;  2H89 A;  4H63 V;  3HKD E;  2WDQ A;  5JDM A;  2CXL A;  3OTO T;  5AQJ B;  4KMC A;  3RRW A;  2BS3 A;  2IML A;  5L3G B;  3RLF F;  2C0S A;  5JR9 B;  2VVN A;  4JI2 T;  4DBQ A;  3KBU A;  3RQW A;  3AEA A;  3RX6 A;  3G06 A;  4IIJ E;  5LGT B;  4X1K E;  4H9Q C;  3GN5 A;  3P4S A;  4U31 A;  3RH3 A;  4ZI7 E;  2X0H A;  4JLE A;  2Q9Q A;  4PJN A;  3R84 B;  5C2T A;  5E0O A;  3IBP A;  3N9O A;  2RA1 A;  2EHO C;  2XHE B;  2XAJ B;  4GK0 E;  4PK4 A;  3RI5 A;  3Q2M A;  3KVB A;  2YK0 A;  2JPF A;  2VAS A;  4P09 A;  2V5C A;  1XNR T;  3MJX A;  1US7 B;  2XTL A;  2XAH B;  4P0A A;  4LF9 T;  5HEJ A;  4DR6 T;  2WM9 A;  2LLY A;  3LJC A;  1CHU A;  4PJL A;  5FY1 A;  3RYI E;  2BZB A;  3DTO A;  3CPZ A;  3TLS A;  4OFZ A;  4ASK A;  3EI0 A;  3NZP A;  3N5L A;  4IDQ A;  3OYZ A;  1D1B A;  3SFE A;  2KT9 A;  4NUU A;  2X0L B;  4GYR A;  1MNE A;  1YW0 A;  5AFU L;  2XY8 B;  1ZV4 X;  3TLT A;  2CLY C;  4EED A;  3P7I A;  2BS2 A;  4DR5 T;  4TWD A;  2CHO A;  3EAM A;  1OXZ A;  4CI2 B;  1W09 A;  4ILC A;  3K3O A;  4HWI B;  1WYC A;  3AE6 A;  4HKA A;  4QXH B;  4YTM A;  2FJE A;  2X67 A;  2XQ7 A;  4DV1 T;  2A2F X;  2KWI B;  4AQF C;  5DAB A;  3N9P A;  2RP4 A;  2W63 A;  2J62 A;  2CE7 A;  4DV5 T;  3Q5E A;  1HG5 A;  4V1A v;  2CWY A;  2V7L A;  4C91 A;  2X51 A;  3ZEF B;  5L3C B;  2LKG A;  5ABG A;  4UF0 B;  3V5U A;  2ZM0 A;  2OLT A;  4ZOL E;  3KV9 A;  4JI1 T;  4CI3 B;  4HWH A;  3QOF A;  3ZJ1 A;  3ZMV B;  4CI1 B;  1NAF A;  3UFG A;  2KIN B;  4DV4 T;  3PUV F;  2D9D A;  1WFD A;  1QLB A;  4O4J E;  3HL6 A;  4IE5 A;  4HWC A;  5EZY E;  3HKE E;  5AQP B;  1HX1 B;  3PU3 A;  2H7V C;  4KBM B;  3T8O A;  1XMO T;  4QHO A;  4KHP T;  5LBQ B;  5JQG E;  1HG2 A;  3AXJ B;  1N36 T;  2ZM6 T;  2NTY A;  5IYZ E;  2UXB T;  4LMJ A;  2DL1 A;  1OED C;  5FP3 A;  5LYJ E;  3DJB A;  2XM1 A;  3AA6 B;  1QSD A;  4JEU B;  2CXF A;  2YKS A;  5ABF A;  3GA8 A;  4HFI A;  2DWG A;  3QUJ A;  4ZEY A;  3UUX B;  4JI7 T;  3AE9 A;  2CEA A;  3AAA B;  2KND A;  3D0T A;  2CCQ A;  4JI3 T;  4X65 T;  3KV5 A;  3L39 A;  4ERR A;  3MAC A;  2RPA A;  4UV8 B;  2VUR A;  4L0R A;  3RKO A;  3FZF B;  4WZX A;  2XJ7 A;  1VOM A;  3ZN0 B;  2XAF B;  3FZM B;  2A9U A;  2CXD A;  4JEH B;  3LK4 2;  4M1P A;  4O4I E;  4DVD A;  3ZC1 A;  4AQY T;  1Y01 A;  5L47 A;  4JBW F;  4CN4 A;  3ZCI A;  1WLX A;  5LGU B;  2Q9Q C;  2X9X A;  1GQE A;  4OK0 A;  1SA0 E;  3F2E A;  2ODU A;  1JNR A;  3PUY F;  5CA1 E;  4GOU A;  5F8P A;  4YT0 A;  4HGA A;  4YSZ A;  1T8B A;  3NVO A;  4B3M T;  5AQU B;  1KNZ A;  2C5J A;  4A97 A;  3LK2 B;  5KMG P;  3OBV E;  5FXZ A;  3MA9 A;  4KHZ F;  4F8H A;  3JAF A;  4BJM A;  3GWH A;  2EHO B;  2LOS A;  3O1J A;  1HNZ T;  2E9X A;  3E0Z A;  4DR4 T;  4IE4 A;  1E1H B;  2KMF A;  3AED A;  4AKI A;  3QB5 K;  4EV6 A;  4UEM A;  3MZK B;  3AAE B;  5FY7 A;  3AE1 A;  4H9S E;  4YLH A;  4GK5 E;  2SPC A;  3L8R A;  3P4Q A;  2HN1 A;  2XSA A;  1WR0 A;  2JQK A;  3PUX F;  2V6Y B;  4ANJ A;  4X1Y E;  1KK7 A;  4O4H E;  5LHH B;  2NW8 A;  3ONJ A;  2KXP B;  3LBX B;  2UXX B;  1NEK A;  5HXS A;  5KDM C;  2K3W A;  2JQ9 A;  2WWV A;  4PK5 A;  2GK9 A;  3TLV A;  1OWA A;  2YDR A;  3QC9 A;  2CWO A;  1YQ3 A;  5FKY A;  2LRL A;  3OKQ A;  4WBN E;  2XZE A;  5LGN B;  4IDP A;  1H7C A;  5A1L A;  1E7P A;  5HWY A;  3ONL C;  2CLY B;  4FJO A;  4U33 A;  1IBL T;  2IC6 A;  2LHR A;  3CVR A;  3VU7 H;  4A98 A;  4QWN B;  3RC3 A;  5JDQ A;  4CXX A;  2YIN A;  3KFW X;  4IDZ A;  4N78 D;  2XAQ B;  3C50 A;  1KNP A;  2H88 A;  3EVY A;  3ANW A;  3FZH B;  2X66 A;  1I94 T;  3LFM A;  2DHR A;  4ZI2 C;  2PTF A;  2XAG B;  4L9I A;  2MOZ A;  2VB6 A;  3FZL B;  3ZSS A;  3P4W A;  1BR2 A;  4HFE A;  2E2A A;  1L0V A;  2W4X A;  3P8C D;  2DI4 A;  5AQN B;  5FNV E;  2DNX A;  3LDQ B;  1J5E T;  2V8S V;  2HPL A;  3X1D A;  4H9O C;  3RPU A;  3PUQ A;  5L4E A;  3HA4 A;  2X9H A;  3RC8 A;  4AKL A;  4XAX B;  3U78 A;  4EXT A;  4YJ3 E;  1XDP A;  5J2T E;  2NOX A;  1UUS A;  5KX5 E;  4K0K T;  5CJ5 A;  2WDR A;  3FB2 A;  3FZK B;  2CBI A;  4UXN B;  3N2O A;  4QKN A;  5LJN A;  4EEB A;  3GMI A;  3VR8 A;  2CMR A;  4OYK A;  4YY3 T;  4UIG A;  1FIO A;  3PUG A;  2MPK A;  2L8K A;  1OED B;  1Y64 B;  1QUU A;  1SE7 A;  3L09 A;  4Z91 A;  4IE0 A;  1LVK A;  3H3M A;  4ZS3 A;  5AQF B;  4JI4 T;  3AA0 B;  4UVB B;  3PU8 A;  4H9P C;  3JAD A;  5FL1 A;  4ISS A;  1MND A;  1G8X A;  4CN6 A;  5L3D B;  4QH5 A;  3C64 A;  3JC6 C;  3C4Z A;  5HYA A;  1HTJ F;  4YTP A;  1X79 A;  3WAJ A;  1YXR A;  5J1G A;  1IJ5 A;  5BMV E;  2QVA A;  4I50 E;  4ILA A;  3ZN1 B;  2L3L A;  1HCI A;  3PTR B;  2QYW A;  5EK4 A;  1HR0 T;  1MIV A;  4P1N A;  4LMK A;  3F57 A;  3C51 A;  3FBZ A;  2PJQ A;  2WU5 A;  5JDG A;  4LF6 T;  1LKX A;  4ZI3 D;  3GN5 B;  5LA6 E;  3EAB A;  5CB4 E;  1HF8 A;  2BKP A;  4IDO A;  2Q9Q B;  4IST A;  1HFA A;  4AKR B;  2DLR A;  2E9X C;  4ILU A;  1D0Y A;  3PV0 F;  2BKO A;  4C90 A;  3VKH A;  5J0Z A;  4DR1 T;  5ABE A;  4XBF B;  2M67 A;  2A72 A;  2JIW A;  5LG3 A;  3FXD B;  3EDU A;  4TV9 E;  1IBK T;  2WWU A;  3AE2 A;  5CGM A;  4B3R T;  4PNI A;  4IDN A;  3LK3 B;  4DID B;  5F3J A;  2LM2 A;  3PUS A;  2JQH A;  4IGU A;  5AQL B;  3H3A A;  4HFC A;  5L2L A;  3A8Y C;  3HI2 A;  2AE9 A;  1SUM B;  3O9X A;  2FBW A;  1WRD A;  3LG7 A;  3UT5 E;  2NR4 A;  3RIF A;  2Y48 B;  5CFB A;  4A5X A;  1YQ4 A;  4BA9 A;  4X1I E;  5FVL A;  5HEU A;  5AQT B; 
#chains in the Genus database with same CATH homology
 2OA5 A;  3SS1 A;  1D0X A;  1MMN A;  3LK4 2;  4JEH B;  4M1P A;  4A56 A;  2KWH A;  1MMD A;  3UUL A;  4AQF A;  5JDL A;  2LT3 A;  4I43 B;  2Y8D A;  3RYF E;  3CX6 B;  4O4I E;  4DVD A;  1AJ3 A;  3ZC1 A;  3E08 A;  4PJM A;  4UVA B;  2V7K A;  3SWH A;  1UX5 A;  4IE7 A;  2UXN B;  3ZCI A;  5JDN A;  1WLX A;  3B13 A;  5LGU B;  4CXY A;  2Q9Q C;  3Q9D A;  1D1A A;  3KV6 A;  3ZLI A;  2X9X A;  3FXE B;  2LSJ A;  3AA1 B;  2NW9 A;  5M4Y A;  4OHF A;  5LOV E;  3N2G E;  4OK0 A;  1SA0 E;  2P9B A;  1O3X A;  1SHZ C;  3F2E A;  3N9N A;  2C5K T;  4UVC B;  2ODU A;  1ZKE A;  5CA1 E;  4EZH A;  1U4Q A;  4GOU A;  1G73 A;  5F8P A;  3FHN A;  2VL8 A;  3ZMU B;  2LJL A;  2DCF A;  4F6R C;  2D0T A;  4TX5 A;  4HGA A;  3CWZ B;  2WAU A;  3RYH E;  4WNK A;  4E7Z A;  2ES0 A;  2X9Y A;  4U72 A;  5JVD E;  5FXX A;  3HKB E;  5JDF A;  3ZMT B;  2C5J A;  4MAL A;  1KNZ A;  1FEW A;  2YU2 A;  2QGS A;  1S94 A;  1HS7 A;  5GON E;  1LVF A;  5CA0 E;  3LK2 B;  5KMG P;  3OBV E;  5EK3 A;  5FXZ A;  2HPJ A;  3MA9 A;  1YD8 G;  3BK9 A;  2LM9 A;  4HE8 A;  3UUM A;  4BJM A;  4HTE A;  1IAP A;  1MMG A;  3BQK A;  3CKD A;  3GWH A;  4EYU A;  2IAK A;  2EHO B;  2LOS A;  3O1J A;  1Z0P A;  2JRK A;  3Q5W A;  5L3F B;  2E9X A;  3E0Z A;  4IE4 A;  4UV9 B;  4WW0 A;  5HWX A;  1E1H B;  2KMF A;  4O8S A;  4AKI A;  3O1I A;  3ZMS B;  2XQY A;  1BR4 A;  4IE6 A;  5JRE A;  3IF8 B;  4AQG A;  2K9A A;  5FXW A;  4UEM A;  3MZK B;  5JRC B;  3AAE B;  3CQG B;  5FY7 A;  3SOL A;  4H9S E;  2VKH A;  3ZYM A;  3KBT A;  5L3B B;  4YLH A;  4GK5 E;  2SPC A;  4ADZ A;  2Q9Q D;  3PDY A;  3J9X 1;  3O4X E;  1D0Z A;  3L3P A;  2NWB A;  4H63 H;  1NWM X;  3IEE A;  3ZMZ B;  4G2A A;  4ANJ A;  4X1Y E;  1KK7 A;  5H6R B;  4O4H E;  4CZZ B;  3RYC E;  5LHH B;  2NW8 A;  5L3E B;  2KXP B;  3LBX B;  5LHI B;  3C98 B;  2H3R A;  3PE0 A;  4PW8 A;  2UXX B;  2XAS B;  4EB6 E;  1D1C A;  4GYS A;  4TUY E;  5HXS A;  3AAI A;  1IZN B;  2EHO D;  3N9L A;  3V5S A;  1YKE B;  5KDM C;  4PK5 A;  2GK9 A;  4UEL A;  3WI3 A;  1OWA A;  4MFR A;  3QC9 A;  1MIW A;  3I9Y A;  3NRY A;  2CWO A;  4UF0 A;  4NUV A;  5H6Q B;  3OKQ A;  4WBN E;  4ZI2 D;  4CQI A;  5LGN B;  3J7Y q;  4EIW A;  3WAK A;  5DQW A;  4BJN A;  1H7C A;  2V26 A;  3E22 E;  2L9Q A;  2YU1 A;  3HKD E;  4H63 V;  4PK6 A;  1HX8 A;  2LSG A;  3IHR A;  3PUA A;  5JDM A;  5A1L A;  2CXL A;  3KIN B;  5HWY A;  2CLY B;  4FJO A;  4KMC A;  2IC6 A;  3RRW A;  4P0B A;  3N9Q A;  3MKD A;  2LHR A;  3NZQ A;  5L3G B;  2C0S A;  5JR9 B;  3CQC B;  4DBQ A;  3KBU A;  3UUN A;  3CVR A;  3VU7 H;  3RX6 A;  4QWN B;  2CM0 A;  3RC3 A;  1S35 A;  5LXT E;  4IIJ E;  3I9W A;  5LGT B;  5JDQ A;  2VKO A;  4X1K E;  4YFS A;  4H9Q C;  3GN5 A;  2VWA A;  3RH3 A;  4KP3 C;  4ZI7 E;  2NTX A;  2WMO A;  4JLE A;  2Q9Q A;  4PJN A;  4CXX A;  2KZ7 B;  1WR6 A;  2YIN A;  3R84 B;  4E7S A;  5DJQ C;  3KFW X;  5E0O A;  4DMV A;  3IBP A;  3N9O A;  4IDZ A;  3PUR A;  2D0U A;  2K24 A;  2RA1 A;  4N78 D;  3C50 A;  2EHO C;  2XAQ B;  2XHE B;  1BR0 A;  2JJ9 A;  2XAJ B;  3ANW A;  3EVY A;  4YHJ A;  4GK0 E;  4XZC A;  2X66 A;  4PK4 A;  3LFM A;  3ETU A;  5FMN A;  5HXE A;  2DHR A;  4ZI2 C;  4QX7 B;  2XAG B;  4L9I A;  3Q2M A;  2MOZ A;  3K3N A;  2VB6 A;  5LG4 A;  4HN9 A;  5HXH A;  1BR2 A;  2W62 A;  3KVB A;  2YK0 A;  3KVA A;  2MTQ A;  2JPF A;  2VKJ A;  2VAS A;  4P09 A;  4AKG A;  2KLQ A;  3P8C D;  5IHY A;  2DI4 A;  3VKG A;  5FNV E;  2DNX A;  2C5I T;  2PG8 A;  3NBX X;  1MMA A;  3R6N A;  2MBG A;  3MJX A;  5ADX L;  1US7 B;  2HPL A;  2QA7 A;  4DBR A;  2XTL A;  4H9O C;  5HAX A;  3RPU A;  2XAH B;  3ZPO A;  4P0A A;  3PUQ A;  3HA4 A;  2WM9 A;  2X9H A;  2W00 A;  3LJC A;  1VRB A;  3UTK A;  3RC8 A;  4Z8X A;  4AKL A;  3CQX C;  4PJL A;  4XAX B;  5FY1 A;  3U78 A;  4EXT A;  5LJM A;  5ETW A;  4YJ3 E;  1CUN A;  3RYI E;  2BZB A;  2J1D G;  2V7I A;  3DTO A;  3HR0 A;  1IJ6 A;  2NOX A;  5J2T E;  3CPZ A;  2NW7 A;  2WSS V;  2IC9 A;  4OFZ A;  4L5G A;  4ASK A;  4O2B E;  4I55 E;  5LNK A;  5KX5 E;  3JC6 D;  3NZP A;  3N5L A;  3FB2 A;  4GIW A;  3OYZ A;  2PFV A;  4PFP A;  1D1B A;  4UXN B;  3N2O A;  4QKN A;  3KDS E;  5LJN A;  3GMI A;  3ETV A;  2PBI A;  2KT9 A;  4NUU A;  2CMR A;  3OJA A;  4OYK A;  2D5U A;  2X0L B;  2X68 A;  4GYR A;  1MNE A;  1YW0 A;  4MHC A;  5AFU L;  3B57 A;  1ZV4 X;  2CLY C;  4UIG A;  1FIO A;  2E9X B;  3P7I A;  3PUG A;  2NP9 A;  3AVR A;  3VHL A;  2L8K A;  5JR9 C;  4PFO A;  5LP6 E;  2A3D A;  1OXZ A;  3H37 A;  2ZM2 A;  1YKH B;  4CI2 B;  4ZS2 A;  1Y64 B;  1QUU A;  2BVL A;  3L09 A;  4IE0 A;  1LVK A;  4ZS3 A;  3K3O A;  4QX8 B;  2DWK A;  1B7T A;  3AA0 B;  1FMW A;  4UVB B;  2LSK A;  3FBL A;  1WYC A;  3PU8 A;  4H9P C;  4HKA A;  4MLK A;  4QXH B;  5J2U E;  3ONX A;  4HFV A;  4ISS A;  3AVS A;  5DQV A;  2X67 A;  3F31 A;  1MND A;  1G8X A;  4AXP A;  3CX8 B;  5LHG B;  3UFE A;  2A2F X;  3K3Q C;  5L3D B;  2KWI B;  3HKC E;  4AQF C;  4U74 A;  3I0Q A;  3MK7 C;  5TAO A;  5DAB A;  3C64 A;  3N9P A;  3JC6 C;  3C4Z A;  5HYA A;  1HTJ F;  2RP4 A;  2W63 A;  5EK2 A;  2CE7 A;  4QXB B;  3N9M A;  3M65 A;  1X79 A;  2V7J A;  4QXC B;  4JUY A;  1ZEE A;  1HG5 A;  2MYS A;  3AA7 B;  4V1A v;  2CWY A;  3WAJ A;  2V7L A;  2E9X D;  2X51 A;  4C91 A;  2W0G A;  3EUH A;  5J1G A;  1IJ5 A;  2JMH A;  3ZEF B;  5BMV E;  3V5U A;  5L3C B;  4UF0 B;  4I50 E;  4H9N C;  3ZN1 B;  2ZM0 A;  2LE8 A;  2L3L A;  1HCI A;  3PTR B;  4X20 E;  4ZOL E;  5EK4 A;  2G0U A;  3KV9 A;  2VK9 A;  2LOP A;  4CI3 B;  2IW5 B;  3ZJ1 A;  2N2N A;  3Q5X A;  1LRZ A;  4BAY B;  3ZMV B;  2V7M A;  1MIV A;  2EHO A;  3NRX A;  3RRC A;  4CI1 B;  4AKH A;  2Z6E A;  1NAF A;  2N9D A;  2D2S A;  3TKL B;  1WYB A;  3AB3 B;  5HXR A;  3F57 A;  2KIN B;  3C51 A;  4EYY R;  5LCY A;  3FBZ A;  2PJQ A;  5JDG A;  3I1A A;  2XUE A;  4O2A E;  3ZYK A;  4YJ2 E;  1LKX A;  2H7O A;  4ZI3 D;  3GN5 B;  2CA5 A;  5LA6 E;  4O4J E;  5CB4 E;  5JRC A;  1HF8 A;  3HL6 A;  4IE5 A;  3CX7 B;  4J2C A;  5EZY E;  4MBQ A;  3ESL A;  2X9W A;  3HKE E;  2Q9Q B;  1ZHC A;  4IST A;  3I0O A;  2LEH A;  2ZMA A;  4OYJ A;  3ZJ2 A;  3PU3 A;  2H7V C;  4KBM B;  1HFA A;  2B1E A;  4AKR B;  3T8O A;  2ACX A;  3ZC0 A;  4QHO A;  2DLR A;  2Y6X A;  5LBQ B;  5JQG E;  2N1G A;  2E8I A;  1BR1 A;  1HG2 A;  4PAG A;  2E9X C;  4ILU A;  1D0Y A;  3ANW B;  4C90 A;  3VKH A;  1UX4 A;  2HH7 A;  2WBL A;  4XBF B;  2M67 A;  4PJJ A;  2WMN A;  2NTY A;  5LBM A;  5IYZ E;  1V9D A;  2A72 A;  2I59 A;  3LBX A;  3U3I A;  3FXD B;  2BDE A;  4FI5 A;  1T98 A;  5FP3 A;  3EDU A;  2K5B B;  4TV9 E;  5LYJ E;  4G63 A;  4TZ4 C;  4TN7 B;  5C8Y E;  3DJB A;  2ZM8 A;  3AA6 B;  1QSD A;  1U5P A;  4JEU B;  5FXV A;  1EZ3 A;  2CXF A;  2LHN A;  3GA8 A;  2DWG A;  2WWU A;  3QUJ A;  4PNI A;  4EOZ B;  2W61 A;  3LK3 B;  3EDV A;  3UUX B;  3C4W A;  3C4X A;  4H9R C;  4CXW A;  3N2K E;  4DO0 A;  4ZHQ E;  5F3J A;  2BVM A;  3ZYL A;  3KV4 A;  4DND A;  4B6X A;  2CEA A;  3PUS A;  3OYX A;  4IGU A;  4KUM B;  3BQL A;  3QK6 A;  2LSI A;  3SRZ A;  3AAA B;  4DMW A;  1FMV A;  2YEV C;  4I4T E;  2JMK A;  3K8P C;  2K48 A;  4ZI3 C;  3W15 B;  5HXC A;  3ZCJ A;  4AI6 A;  5FY0 A;  2KND A;  3D0T A;  2CCQ A;  3KV5 A;  2VKD A;  3H3A A;  4ERR A;  5JH7 E;  5L2L A;  5JR9 A;  3MAC A;  4EZ4 A;  3DP7 A;  3HI2 A;  5JDH A;  4HEA A;  2ODV A;  3A5X A;  5FYM A;  4UV8 B;  2ZLY A;  4L0R A;  3O9X A;  3O1H A;  3RKO A;  4TV8 E;  4K0U A;  3CML A;  4O4L E;  3BQI A;  3S4U A;  2LSY A;  1WRD A;  3LG7 A;  4WBO A;  1UCU A;  3UT5 E;  1VOM A;  2JQQ A;  3ZN0 B;  2Y48 B;  3MXZ A;  2V1D B;  2XAF B;  1MIY A;  4IHJ E;  4EAH A;  4BA9 A;  4X1I E;  2CXD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...