1QSDA

Rbl2p, beta-tubulin binding post-chaperonin cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
TQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKRLLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the post-chaperonin beta-tubulin binding cofactor Rbl2p
pubmed doi rcsb
molecule tags Chaperone
molecule keywords PROTEIN (BETA-TUBULIN BINDING POST-CHAPERONIN COFACTOR)
total genus 45
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02970 TBCA Tubulin binding cofactor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1qsdA00
1ZKEA 2XTLA 3N5LA 1LRZA 2MBGA 3CVRA 2IC9A 1IJ5A 3TKLB 2X9XA 3FXEB 2C5IT 2X9YA 1LVFA 4FI5A 4DNDA 2C5KT 1H7CA 2KWHA 2IC6A 2G0UA 2KWIB 3MXZA 3CKDA 4EYYR 4L0RA 4B6XA 1IJ6A 1Z0PA 4CQIA 1QSDA 3QK6A 3QUJA 3L3PA 3S4UA 3P7IA 2K48A 3FXDB 2C5JA 4J2CA 2CA5A 2X9WA
chains in the Genus database with same CATH superfamily
3PE0A 2LSJA 3JAEA 1XDOA 4E7ZA 2NW9A 3TLSA 2OV9A 4LF6T 2CLYB 2WY2A 3AA6B 3AXJA 2NW7A 3K3NA 3N9MA 3PUVF 3AAEB 4IHJE 4U2YA 5JTGA 2DHRA 2E9XC 2ODUA 4LF7T 2KMFA 2LSYA 3KINB 3ZJ2A 2CHNA 3LBXB 5EK2A 3RC3A 5LHGB 1M62A 1WRDA 2DNXA 3T1YT 3FB2A 1JNRA 3VU7H 2CLYC 2V5DA 2GK9A 4QH5A 4WNKA 1MMGA 2XQ4A 3C50A 2HHHT 4JI8T 1YKHB 2V7LA 3ZPOA 4CXXA 3Q5EA 1NWMX 2IIUA 3P8CD 3C4XA 1IAPA 4AKRB 2NW8A 5DQWA 3B57A 5GONE 4CI3B 4CZZB 2NTXA 1HFAA 3AEFA 5FVKA 2LLYA 3UU8A 3DJBA 4ILAA 5ABFB 3Q2MA 3TLTA 1XNRT 2JJ9A 4JEUB 2E5LT 3O1IA 3RH3A 4HFCA 3FZFB 3P4WA 5L3EB 4DV7T 3JADA 1KNRA 2NOXA 2ACZA 3U3IA 3IBPA 1LKXA 3K8PC 1E2AA 2MTQA 3RIAA 1LRZA 3ANWA 2RPAA 1IBLT 5HEOA 4QXCB 3ZKRA 1YD8G 2XASB 2KSRA 3J7Yq 3PJAJ 2ZM2A 5HEGA 1ZOYA 2CPTA 3DTOA 3QB5A 3KBTA 3ZT7A 4YSYA 2X9YA 3GN5A 4EEBA 4DV0T 4H9SE 3V5SA 2C5KT 3RYHE 2G0UA 4WBOA 2K3WA 4QKNA 2LM9A 4KI0F 3E22E 4AKHA 5LJMA 3ZMUB 3QNUA 5JH7E 2E9XD 4EXTA 4LMLA 3AEBA 4P09A 3JCFA 4PK4A 4A97A 2JQ9A 3E08A 1SUMB 2VL0A 3ZN0B 3Q5DA 1ZP0A 1R8IA 2D9DA 1XMOT 3HI2A 5AQVB 2M6BA 2QVAA 2BG9C 2LSKA 3ABVA 2W0GA 3A7MA 3BQIA 2IDOB 3L3PA 4J2CA 3JAFA 4L0RA 5TAOA 1IBMT 1MMAA 4HKAA 3EI0A 1CHUA 3RKOA 5LA6E 5LXTE 4UELA 1FIOA 5AQIB 2IMLA 2MYSA 4OHFA 4GKKT 3N9QA 5JDMA 2UUCT 1KNZA 2UXXB 3AE6A 4BJNA 4E7SA 5F8PA 3RQUA 1KEYA 2V6XA 3CMLA 2WWUA 3AEDA 2X68A 2V7KA 3C98B 3HKEE 3KDSE 4H9PC 2IW5B 3SFDA 2HN2A 5ABHA 4JI6T 2WU5A 2V5CA 3KVAA 2HPLA 3LK3B 5JR9B 4H63H 4NUUA 1MIVA 2H3RA 2VKDA 4LF4T 4KHZF 3AB3B 3AE3A 3ZSSA 2MPKA 4YJ2E 5LP6E 4XBFB 4O4IE 4TN7B 5HYAA 3PUAA 5L2LA 4IE7A 2YDSA 1HF8A 4IL9A 4X64T 2UU9T 3ETVA 3AE9A 4UVBB 4COFA 5L3BB 3X1DA 3N9OA 4TWHA 5JRCA 1US7B 3ETUA 3HA4A 4ERRA 4H9NC 2W2UA 2XTLA 5LMNT 4UVAB 4DV1T 4ZI2D 1SA0E 4YTMA 4OFZA 3IA3A 3ONJA 4UR9A 5DJQC 3ZN1B 2FJEA 4H9RC 5LBQB 2L9QA 2KNDA 4M1PA 4EOZB 2LOPA 2AXDS 3TKLB 3VRBA 4QH4A 2X9XA 3AA7B 3FHNA 2XAFB 4G63A 3TLWA 4AQFC 1WR0A 5L3FB 1YQ4A 3A8YC 3AVSA 3Q5WA 4KUMB 4DNDA 1HS7A 2ES0A 2E9XB 4O2AE 3UUMA 2RA1A 3CPZA 2DWGA 2YU1A 2OLTA 5LGTB 2JQQA 2VK9A 2PBIA 4BJMA 2HN1A 4ZXLA 4QXHB 4YTNA 2LSIA 1MNDA 2XM1A 1D0ZA 4U3CA 4UVCB 5FXWA 3W15B 4HFEA 3P7IA 5C2TA 2NTYA 2VVSA 1EZ3A 2JQKA 4AQYT 2V7MA 3HKBE 4HN9A 1E1HB 4P1NA 4Z91A 3UFEA 1T72A 5AQQB 3ANWB 2SPCA 4UEMA 1WLXA 2VKOA 2I59A 4OK0A 5M4YA 3AE5A 3JC6C 2X67A 1ZKEA 4HFIA 5A1LA 4DR2T 5L3DB 1UGOA 2FJAA 4HFDA 2BG9E 2YEVC 2LEHA 2V1DB 4X1IE 5EK3A 4YY3T 2XUEA 1N36T 3ONLC 5KXJA 5LB7B 4H9QC 2BS3A 2ZMAA 2MOZA 2CE7A 1M7KA 2A9UA 3IHRA 4IDNA 4DV3T 1B7TA 4JUYA 4JEHB 4EZ4A 3VHLA 3TLUA 3CKDA 4EZHA 2V7JA 3KFWX 3NBXX 3UULA 5J2TE 2XQ9A 5CJ5A 5C8YE 5HXHA 5FL1A 4NPPA 5DQVA 3ZEFB 2BVLA 3RX6A 2V6YA 4JLEA 4X65T 1MMNA 4GOUA 1L0VA 3UU4A 1U4QA 3OKQA 1D0XA 1OWAA 4YTPA 4O2BE 3FXDB 2XAGB 3FZKB 1FJGT 5LHHB 3MA9A 1KFYA 2JPFA 3D0TA 2WMNA 3N5LA 4N78D 3CVRA 3UT5E 4X66T 2VB6A 4KMCA 4ZZCA 4P0BA 5LCYA 2ZM8A 5AQMB 5JDQA 1WCRA 2BS2A 3RYCE 3I9YA 2V26A 3RC8A 4IT4A 1LVFA 3AEEA 4ZHQE 5HXRA 2A2FX 2N9DA 2BBHA 2WS3A 2YK0A 1D0YA 3ZSTA 4LFCT 2XHEB 2KWIB 3R84B 2FBWA 4H9OC 3I0OA 2UXBT 5L4EA 2X9HA 2WP9A 3FBZA 3ZJ1A 2CEAA 4GK0E 3HKDE 4IGUA 4AKLA 4AQFA 1T7SA 2BKOA 3UUXB 3O1HA 5JDHA 4LF9T 3FZMB 3PTRB 1XZYA 4QHOA 4WW0A 4PJLA 5ETWA 4YSZA 3AA1B 4B3TT 2HH7A 3UQ7A 1QUUA 3RLFF 4DV4T 4DBQA 4JI7T 4ZS3A 4EAHA 1YQ3A 3RYFE 2UXNB 2J4GA 1HNZT 5JRCB 3CIRA 3HR0A 2XZEA 3N9NA 2MBGA 2NP9A 4LMJA 4UXNB 4ASKA 3PU3A 5CA1E 3O9XA 2LE8A 3MJXA 3AEAA 3PUQA 4K0UA 3L09A 1UX4A 2LM2A 3LFMA 3OJAA 2CMRA 4JI5T 3SOLA 4U72A 5LG4A 2XY8B 3MXZA 2V7IA 3G06A 4PFOA 4U31A 4ZZBA 4X62T 3PUGA 1OEDC 4DBRA 2LJLA 2YKSA 3RIUC 4ANJA 1OXZA 2YINA 3CX7B 3KVBA 3VKHA 2C0SA 1QSDA 4JI2T 3O4XE 3S4UA 2W61A 3NVOA 1ZV4X 4HFVA 4JBWF 4ZI3D 4AKGA 2WDVA 1MIWA 4PK5A 2XQ5A 3RGLA 4DR7T 2XM2A 3NZQA 3CWZB 2YDRA 2N1GA 3ONXA 4MALA 3T8OA 2J1DG 4C90A 3C51A 4UIGA 2WZHA 4IDQA 1SHZC 1UURA 4O4LE 3VKGA 4KX6A 3LSVA 2ZLYA 5DABA 4TV8E 3TLVA 3VRAA 4F6RC 1UK5A 2F4VT 4UV9B 1NAFA 2LHRA 3K3QC 2RP4A 2H89A 3BQKA 3PURA 2KZ7B 4IDOA 4QXBB 4YHJA 4DO0A 1D1BA 4U7YA 5ADXL 1V9DA 4WBNE 3RKGA 1I6ZA 3DP7A 2V6YB 2DLRA 3NZPA 3P4SA 2R6GF 1YKEB 4X1YE 3ESLA 3QB5K 3GA8A 4LFBT 3AE4A 4I4TE 4TNVA 3A5XA 3CQCB 1HG5A 4TX5A 3PUWF 3O1JA 5HXEA 3M3ZB 1N33T 1VRBA 1SE7A 3EVYA 1MMDA 1J1JA 2W63A 5HAXA 5HCJA 2W62A 4ZI2C 4BA9A 2EHOC 3N9LA 2X9WA 1FEWA 3RHWA 4KP3C 3B5MA 3NWIA 4GYSA 2A3DA 2DL1A 2XQ3A 2ZM0A 2XQ6A 3L8RA 4CN1A 2XQ8A 4PW8A 5HWXA 4X20E 4NUVA 1T8BA 4YLHA 5EZYE 4MFRA 2M67A 3RF1A 2K5BB 3LDQB 3C4ZA 3OBVE 5ABFA 4FJOA 3ZT5A 5JDLA 4ILUA 5HXSA 5FY1A 1XNQT 2N2NA 3PDYA 5FXVA 1AJ3A 3EABA 2W67A 2L3LA 2ACXA 2WDRA 5HEHA 1KNPA 5LHIB 3SRZA 3EDVA 4PAGA 4DMVA 1LVKA 2KWHA 3LG7A 4GK5E 4EV6A 2A72A 4PJMA 2BBJA 4ZI7E 4JI4T 5AQSB 2LKHA 4U2ZA 3V5UA 3K3OA 4B6XA 1CUNA 1FMVA 5AQLB 3F57A 2LSGA 3QUJA 2WCAA 1DU2A 2CWOA 5BMVE 1NEKA 1W9RA 2K48A 4YXDA 1IBKT 2B1EA 2XAJB 4ZOLE 2UXCT 4BAYB 3GMIA 2CA5A 1MNEA 3EHZA 4B3MT 2WDQA 5IHYA 2JMKA 3RIUA 3CK6A 4MBQA 4NIQA 4HWFA 1VOMA 2DCFA 5AQFB 3ZMSB 2P9BA 4LFAT 1HG2A 5AQNB 5AQTB 3AE8A 4UV8B 3SWHA 3UUBA 4HWCA 4JI1T 5HCMA 2VL8A 5LGUB 4HWIB 5LBMA 4YHHT 1IJ5A 2CWYA 3H3AA 2XSAA 5LG3A 5AQHB 1I94T 5FYMA 3OVUA 2CXFA 1XMQT 5CFBA 3N2GE 2PJQA 3H37A 3N2KE 4FI5A 2BZBA 4IE4A 3PUSA 2EHOD 4CI2B 3IF8B 2WU2A 4IE6A 2XAQB 1YXRA 3EUHA 3HL6A 2PFVA 4I55E 4IDZA 4MLKA 3ZMVB 4ADZA 1N34T 4CI1B 2FJBA 4PJNA 2JRKA 4A98A 5JR9A 5LJNA 3VR9A 3ZC0A 3ZYMA 1BR0A 2FJDA 2QA7A 3H3MA 4PFPA 3C64A 5FMNA 2EHOA 5KMGP 4JV5T 1WR6A 5LOVE 1OEDB 2WSSV 2BVMA 2XPKA 3AE7A 4CXYA 4O8SA 2CXLA 4ZS2A 3ZMTB 5C3JA 5FKYA 4GIWA 4JI3T 3AAIA 3J9X1 2BKNA 4EB6E 2KT9A 4LF5T 1VCTA 2K24A 3QOFA 4ISTA 4EGWA 1HR0T 1UUSA 3LK42 4NXNT 3CX8B 4HTEA 3FXEB 2C5IT 2VKJA 2W4XA 4PNIA 2NWBA 5HWYA 2BG9A 2VKHA 1FMWA 1H7CA 2J62A 4L9IA 1KK7A 2D5UA 3ZYKA 5ABEA 5KDMC 5LNKA 4KBMB 4WYVA 4G2AA 4LMKA 4QX8B 2L8KA 3CQGB 4H63V 2XSBA 3RRWA 5LGNB 3WAJA 2ZM6T 4DUYT 1W0BA 3UQ4A 1Z8UA 4ILCA 1VCSA 4EYUA 2H7VC 2I6HA 1G8XA 4I43B 5FP3A 1YW0A 2LHNA 5AQRB 5L4HA 1KF6A 2C5JA 3GN5B 2VQFT 2BS4A 2KLQA 2X0HA 4TZ4C 3UU6A 4C91A 2BDEA 3CQXC 2DI4A 3BK9A 3MK7C 5AQPB 3RQWA 5CB4E 2VWAA 1HX1B 2JQHA 3UU5A 3BQLA 2LT3A 5J0ZA 2PTFA 5JDNA 2EHOB 2XQ7A 3P4RA 3OYXA 2H88A 2MAWA 4HWDA 2YOEA 2K9AA 5H6RB 5HEUA 4P0AA 2JMHA 2X51A 4Z90A 4QWNB 1MIYA 2QRXA 5FY0A 5L47A 3JC6D 4DV5T 3IEEA 4X1KE 4A5XA 2XJ7A 2IC6A 3LJCA 5AQOB 5HXCA 5J1GA 2CBIA 3EAMA 4ZI3C 4K0KT 2UUBT 5IUXA 2IHR1 3K1SA 4TNWA 1WYBA 2Y48B 1XWMA 4O4HE 4CQIA 1E7PA 2BKPA 1BR1A 3AVRA 2KINB 3CX6B 3QC9A 3QK6A 4U7IA 2D2SA 4XZCA 5JDFA 3UFGA 5IWAT 4CN6A 4Z8XA 2IAKA 2VQET 1OEDE 1X79A 4UF0B 4HE8A 2Q9QB 2YN6A 3R6NA 2KXPB 4TV9E 3ZT6A 5L3GB 3LBXA 3EDUA 5HEJA 5JREA 2J47A 2CBJA 2WB5A 4OX9T 5JQGE 3ZYLA 3GWHA 4HWHA 2M6IA 3M65A 2H7OA 2V8SV 3AXJB 3MACA 5KX5E 4OYKA 5FXZA 4IDPA 2QYWA 1X9BA 1HTJF 4IL4A 3UU3A 3NRXA 4ZEYA 1W09A 4HFBA 3I9WA 5J2UE 3PU8A 4A56A 5BR8T 3AAAB 4U74A 5E0OA 3WAKA 3KV5A 4IE5A 1IJ6A 4HFHA 2VVNA 2E2AA 3FZLB 3LK2B 3P4PA 2E9XA 1U5PA 2X0LB 3N2OA 3RYIE 4PK6A 2AE9A 2UXDT 1WYCA 3KV6A 4DR5T 5FNVE 3NKZA 2E5VA 2Y6XA 5IYZE 4U33A 1JNZA 2LKGA 1N32T 3AE1A 4HEAA 5F5WA 4CN4A 1HNWT 4DR4T 4IIJE 2Q9QA 3AECA 2W00A 3MZKB 4UF0A 4EIWA 4JI0T 1XDPA 5L3CB 2WAUA 4DIDB 2WBLA 2X66A 4DR3T 4DR6T 4Q25A 4HGAA 4AI6A 2E8IA 2D0UA 2HPJA 2WQYA 4PJJA 3UUNA 4AQGA 2Z6EA 3I1AA 3PUZF 4AKIA 2LRLA 5JVDE 1GQEA 4QH1A 4TWFA 4JYAT 2NR4A 3F2EA 2LRKA 5AQUB 1O3XA 5FY7A 4AXPA 2VASA 4DVDA 4B3ST 3FBLA 4DV2T 5AQJB 2B76A 3ZMZB 5AFUL 4YT0A 4IE0A 4YSXA 4YJ3E 4I0UA 2WMOA 1S35A 3FZHB 4WZXA 5FL0A 3OTOT 2OA5A 3ZCJA 1Y64B 5AQKB 4LF8T 3AEGA 2WWVA 2CCQA 2WM9A 5H6QB 3E0ZA 1W0AA 4IREA 3WI3A 5EK4A 3ZC1A 4GYRA 1HX8A 3T1HT 1D1AA 1UX5A 1WFDA 4F8HA 4TUYE 4DR1T 2ODVA 3I0QA 4DMWA 4NXMT 4B3RT 1J5WA 3UTKA 5JDGA 5FXXA 3RIFA 5AQGB 3PUXF 4DV6T 3Q9DA 1BR4A 4TWDA 3NRYA 3L39A 5ABGA 4AISA 5F3JA 1NENA 1QLBA 2XQYA 3AE2A 2X0YA 2BG9B 2W66A 2XQAA 3C4WA 2PG8A 3B13A 3PJAA 3P50A 1BR2A 2VURA 2FUPA 2Q9QD 3PV0F 3SS1A 1HCIA 2CRBA 4AIUA 1IZNB 2DWKA 4V1Av 5LMUT 4ISSA 5CGMA 4OYJA 4KHPT 4L5GA 3F31A 3RI5A 4EEDA 4GKJT 4QX7B 1Y01A 3RPUA 3SFEA 4DUZT 2CHOA 2UUAT 2D0TA 3MKDA 5CA0E 2LOSA 4CXWA 1OEDA 1S94A 5LYJE 3U78A 3AA0B 1D1CA 2IC9A 2Y8DA 3ZCIA 2Q9QC 1T98A 1ZHCA 1UCUA 5JR9C 3Q5XA 1G73A 4O4JE 3HKCE 2IUBA 2JIWA 2CXDA 2QGSA 2YDQA 3OYZA 4I50E 3VR8A 3RRCA 3ZLIA 3KV4A 4ILBA 1J5ET 3KBUA 3KV9A 4EYYR 4MHCA 2XAHB 2I0MA 2YU2A 4X5TA 4YFSA 4XAXB 1Z0PA 2CM0A 5FVLA 1HNXT 3P4QA 3N9PA 3OPCA 2WZIA 1ZEEA 3PUYF
chains in the Genus database with same CATH topology
3PE0A 2LSJA 4E7ZA 2NW9A 2CLYB 3AA6B 3N9MA 3K3NA 2NW7A 4IHJE 3AAEB 2DHRA 2E9XC 2ODUA 2KMFA 2LSYA 3KINB 3ZJ2A 3LBXB 5EK2A 3RC3A 5LHGB 1WRDA 2DNXA 3FB2A 3VU7H 2CLYC 4WNKA 2GK9A 1MMGA 3C50A 1YKHB 2V7LA 3ZPOA 4CXXA 1NWMX 3P8CD 3C4XA 1IAPA 4AKRB 2NW8A 5DQWA 3B57A 5GONE 4CI3B 4CZZB 2NTXA 1HFAA 3DJBA 3Q2MA 2JJ9A 4JEUB 3O1IA 3RH3A 5L3EB 2NOXA 3U3IA 3IBPA 1LKXA 3K8PC 2MTQA 1LRZA 3ANWA 4QXCB 3J7Yq 1YD8G 2XASB 2ZM2A 3DTOA 3KBTA 2X9YA 3GN5A 4H9SE 3V5SA 2C5KT 3RYHE 2G0UA 4WBOA 4QKNA 2LM9A 4AKHA 3E22E 5LJMA 3ZMUB 5JH7E 2E9XD 4EXTA 4P09A 4PK4A 3E08A 3ZN0B 3HI2A 4J2CA 2LSKA 3L3PA 2W0GA 3BQIA 5TAOA 1MMAA 4HKAA 3RKOA 5LA6E 5LXTE 4UELA 1FIOA 2MYSA 4OHFA 3N9QA 5JDMA 1KNZA 2UXXB 4BJNA 4E7SA 5F8PA 3VHLA 3ZMVB 3CMLA 2WWUA 3HKEE 2X68A 2V7KA 3C98B 4H9PC 3KDSE 2IW5B 3KVAA 2HPLA 3LK3B 5JR9B 4H63H 4NUUA 1MIVA 2H3RA 2VKDA 3AB3B 4YJ2E 4XBFB 4O4IE 4TN7B 5HYAA 3PUAA 5L2LA 4IE7A 1HF8A 3ETVA 4UVBB 5L3BB 3N9OA 5JRCA 1US7B 3ETUA 3HA4A 4ERRA 4H9NC 2XTLA 4UVAB 4ZI2D 1SA0E 4OFZA 5DJQC 3ZN1B 4H9RC 5LBQB 4EOZB 2L9QA 2KNDA 4M1PA 2LOPA 3TKLB 2X9XA 3FHNA 3AA7B 2XAFB 4G63A 4AQFC 5L3FB 3AVSA 3Q5WA 4KUMB 4DNDA 1HS7A 2ES0A 2E9XB 4O2AE 3UUMA 2RA1A 3CPZA 2DWGA 2YU1A 5LGTB 5LP6E 2JQQA 2VK9A 2PBIA 4BJMA 4QXHB 2LSIA 1MNDA 1D0ZA 4UVCB 5FXWA 3W15B 3P7IA 2NTYA 1EZ3A 2V7MA 3HKBE 4HN9A 1E1HB 3UFEA 3ANWB 2SPCA 4UEMA 2VKOA 1WLXA 2I59A 4OK0A 5M4YA 3JC6C 2X67A 1ZKEA 5A1LA 1ZEEA 5L3DB 2YEVC 2LEHA 2V1DB 4X1IE 5EK3A 2XUEA 4H9QC 2ZMAA 2MOZA 2CE7A 3IHRA 1B7TA 4JEHB 4EZ4A 3CKDA 4EZHA 2V7JA 3KFWX 3NBXX 3UULA 5J2TE 5HXHA 5C8YE 3ZEFB 5DQVA 2BVLA 3RX6A 4JLEA 1MMNA 4GOUA 1U4QA 3OKQA 1D0XA 1OWAA 4O2BE 3FXDB 2XAGB 5LHHB 3MA9A 2JPFA 3D0TA 2WMNA 3N5LA 4N78D 3CVRA 3UT5E 2VB6A 4KMCA 4P0BA 5LCYA 2ZM8A 5JDQA 3RYCE 3I9YA 2V26A 3RC8A 1LVFA 4ZHQE 5HXRA 2A2FX 2N9DA 2YK0A 1D0YA 2XHEB 2KWIB 3R84B 4H9OC 3I0OA 2X9HA 3FBZA 3ZJ1A 2CEAA 4GK0E 3HKDE 4IGUA 4AKLA 4AQFA 3UUXB 5JDHA 3O1HA 3PTRB 4WW0A 4QHOA 4PJLA 5ETWA 3AA1B 2HH7A 1QUUA 4DBQA 4ZS3A 4EAHA 3RYFE 2UXNB 5JRCB 3HR0A 3N9NA 2MBGA 2NP9A 4UXNB 3O9XA 4ASKA 3PU3A 5CA1E 2LE8A 3MJXA 3PUQA 4K0UA 3L09A 1UX4A 3LFMA 3OJAA 2CMRA 3SOLA 4U72A 5LG4A 4PFOA 3MXZA 2V7IA 3PUGA 4DBRA 2LJLA 3VKHA 4ANJA 1OXZA 2YINA 3CX7B 3KVBA 2C0SA 1QSDA 3O4XE 3S4UA 2W61A 4AKGA 1ZV4X 4HFVA 4ZI3D 1MIWA 4PK5A 3NZQA 3CWZB 3ONXA 2N1GA 4MALA 3T8OA 2J1DG 4C90A 3C51A 4UIGA 1SHZC 4O4LE 3VKGA 5DABA 2ZLYA 4TV8E 4F6RC 4UV9B 1NAFA 2LHRA 3K3QC 2RP4A 3BQKA 3PURA 2KZ7B 4QXBB 4DO0A 4YHJA 1D1BA 5ADXL 1V9DA 4WBNE 3DP7A 2DLRA 3NZPA 1YKEB 4X1YE 3ESLA 3GA8A 4I4TE 3CQCB 3A5XA 1HG5A 4TX5A 3O1JA 5HXEA 1VRBA 3EVYA 1MMDA 2W63A 5HAXA 2W62A 4ZI2C 4BA9A 2EHOC 3N9LA 2X9WA 1FEWA 4KP3C 4GYSA 2A3DA 2ZM0A 4PW8A 5HWXA 4X20E 4NUVA 4YLHA 5EZYE 4MFRA 2M67A 2K5BB 3OBVE 3C4ZA 5JDLA 4FJOA 4ILUA 5HXSA 5FY1A 1AJ3A 2N2NA 3PDYA 5FXVA 2L3LA 2ACXA 5LHIB 3SRZA 3EDVA 4PAGA 4DMVA 1LVKA 2KWHA 3LG7A 4GK5E 4ZI7E 2A72A 4PJMA 3V5UA 3K3OA 4B6XA 1CUNA 1FMVA 3F57A 2LSGA 3QUJA 2CWOA 2K48A 2B1EA 2XAJB 4ZOLE 4BAYB 3GMIA 2CA5A 1MNEA 5IHYA 2JMKA 4MBQA 1VOMA 2DCFA 3ZMSB 2P9BA 1HG2A 4UV8B 3SWHA 2VL8A 5LGUB 5LBMA 1IJ5A 2CWYA 3H3AA 5FYMA 2CXFA 4P0AA 3N2GE 2PJQA 3H37A 3N2KE 4FI5A 2BZBA 4IE4A 3PUSA 2EHOD 4CI2B 3IF8B 4IE6A 2XAQB 3EUHA 3HL6A 4MLKA 2PFVA 4I55E 4IDZA 4ADZA 3ZC0A 4CI1B 4PJNA 2JRKA 5LJNA 5JR9A 1BR0A 3ZYMA 2QA7A 4PFPA 3C64A 5FMNA 2EHOA 5KMGP 1WR6A 5LOVE 2WSSV 2BVMA 4CXYA 4O8SA 2CXLA 4ZS2A 3ZMTB 4GIWA 3J9X1 4EB6E 2KT9A 2K24A 4ISTA 3LK42 3CX8B 4HTEA 3FXEB 2C5IT 2VKJA 4PNIA 2NWBA 5HWYA 2VKHA 1FMWA 1H7CA 3ZYKA 1KK7A 2D5UA 5LNKA 5KDMC 4KBMB 4G2AA 4QX8B 3RRWA 2L8KA 3CQGB 4H63V 5LGNB 3WAJA 4EYUA 2H7VC 5FP3A 1G8XA 4I43B 1YW0A 2LHNA 2C5JA 3GN5B 2KLQA 4TZ4C 4C91A 2BDEA 3CQXC 2DI4A 3BK9A 3MK7C 5CB4E 2VWAA 3BQLA 2LT3A 5JDNA 2EHOB 3OYXA 5H6RB 2K9AA 2JMHA 2X51A 4QWNB 1MIYA 5FY0A 3JC6D 3IEEA 4X1KE 2IC6A 3LJCA 5HXCA 5J1GA 4ZI3C 1WYBA 2Y48B 4O4HE 4CQIA 3CX6B 3QK6A 1BR1A 3AVRA 2KINB 4XZCA 3QC9A 5JDFA 2D2SA 4Z8XA 2IAKA 1X79A 4UF0B 4HE8A 2Q9QB 3R6NA 2KXPB 4TV9E 5L3GB 5JREA 3LBXA 3EDUA 5JQGE 3ZYLA 3GWHA 3M65A 2H7OA 3MACA 5KX5E 4OYKA 5FXZA 1HTJF 3NRXA 5J2UE 3I9WA 3PU8A 4A56A 3AAAB 4U74A 5E0OA 3WAKA 3KV5A 4IE5A 1IJ6A 3LK2B 2E9XA 1U5PA 2X0LB 3N2OA 3RYIE 4PK6A 1WYCA 3KV6A 5FNVE 2Y6XA 5IYZE 4HEAA 4IIJE 2Q9QA 4UF0A 2W00A 3MZKB 4EIWA 5L3CB 2WAUA 4AI6A 2WBLA 2X66A 4HGAA 2E8IA 2D0UA 2HPJA 4PJJA 3UUNA 4AQGA 4AKIA 2Z6EA 3I1AA 5JVDE 3F2EA 4AXPA 5FY7A 1O3XA 4DVDA 2VASA 3FBLA 3ZMZB 5AFUL 4IE0A 4YJ3E 2WMOA 1S35A 2OA5A 3ZCJA 1Y64B 2CCQA 2WM9A 5H6QB 3E0ZA 3WI3A 5EK4A 3ZC1A 4GYRA 1HX8A 1D1AA 1UX5A 4TUYE 2ODVA 3I0QA 4DMWA 3UTKA 5JDGA 5FXXA 3Q9DA 1BR4A 3NRYA 5F3JA 2XQYA 3C4WA 4JUYA 4L0RA 4L9IA 2PG8A 3B13A 1BR2A 2Q9QD 3SS1A 1HCIA 1IZNB 2DWKA 4V1Av 4ISSA 4OYJA 4L5GA 3F31A 4QX7B 3RPUA 2D0TA 3MKDA 5CA0E 2LOSA 4CXWA 1S94A 5LYJE 3U78A 3AA0B 1D1CA 2IC9A 2Y8DA 3ZCIA 2Q9QC 1T98A 1ZHCA 1UCUA 5JR9C 3Q5XA 1G73A 4O4JE 3HKCE 2CXDA 2QGSA 3OYZA 4I50E 3ZLIA 3RRCA 3KV4A 3KBUA 3KV9A 4EYYR 4MHCA 2XAHB 2YU2A 4YFSA 4XAXB 1Z0PA 2CM0A 3N9PA 3AAIA 5BMVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKE A;  2XTL A;  3N5L A;  1LRZ A;  2MBG A;  3CVR A;  2IC9 A;  1IJ5 A;  3TKL B;  2X9X A;  3FXE B;  2C5I T;  2X9Y A;  1LVF A;  4FI5 A;  4DND A;  2C5K T;  1H7C A;  2KWH A;  2IC6 A;  2G0U A;  2KWI B;  3MXZ A;  3CKD A;  4EYY R;  4L0R A;  4B6X A;  1IJ6 A;  1Z0P A;  4CQI A;  1QSD A;  3QK6 A;  3QUJ A;  3L3P A;  3S4U A;  3P7I A;  2K48 A;  3FXD B;  2C5J A;  4J2C A;  2CA5 A;  2X9W A; 
#chains in the Genus database with same CATH topology
 3PE0 A;  2LSJ A;  3JAE A;  1XDO A;  4E7Z A;  2NW9 A;  3TLS A;  2OV9 A;  4LF6 T;  2CLY B;  2WY2 A;  3AA6 B;  3AXJ A;  2NW7 A;  3K3N A;  3N9M A;  3PUV F;  3AAE B;  4IHJ E;  4U2Y A;  5JTG A;  2DHR A;  2E9X C;  2ODU A;  4LF7 T;  2KMF A;  2LSY A;  3KIN B;  3ZJ2 A;  2CHN A;  3LBX B;  5EK2 A;  3RC3 A;  5LHG B;  1M62 A;  1WRD A;  2DNX A;  3T1Y T;  3FB2 A;  1JNR A;  3VU7 H;  2CLY C;  2V5D A;  2GK9 A;  4QH5 A;  4WNK A;  1MMG A;  2XQ4 A;  3C50 A;  2HHH T;  4JI8 T;  1YKH B;  2V7L A;  3ZPO A;  4CXX A;  3Q5E A;  1NWM X;  2IIU A;  3P8C D;  3C4X A;  1IAP A;  4AKR B;  2NW8 A;  5DQW A;  3B57 A;  5GON E;  4CI3 B;  4CZZ B;  2NTX A;  1HFA A;  3AEF A;  5FVK A;  2LLY A;  3UU8 A;  3DJB A;  4ILA A;  5ABF B;  3Q2M A;  3TLT A;  1XNR T;  2JJ9 A;  4JEU B;  2E5L T;  3O1I A;  3RH3 A;  4HFC A;  3FZF B;  3P4W A;  5L3E B;  4DV7 T;  3JAD A;  1KNR A;  2NOX A;  2ACZ A;  3U3I A;  3IBP A;  1LKX A;  3K8P C;  1E2A A;  2MTQ A;  3RIA A;  1LRZ A;  3ANW A;  2RPA A;  1IBL T;  5HEO A;  4QXC B;  3ZKR A;  1YD8 G;  2XAS B;  2KSR A;  3J7Y q;  3PJA J;  2ZM2 A;  5HEG A;  1ZOY A;  2CPT A;  3DTO A;  3QB5 A;  3KBT A;  3ZT7 A;  4YSY A;  2X9Y A;  3GN5 A;  4EEB A;  4DV0 T;  4H9S E;  3V5S A;  2C5K T;  3RYH E;  2G0U A;  4WBO A;  2K3W A;  4QKN A;  2LM9 A;  4KI0 F;  3E22 E;  4AKH A;  5LJM A;  3ZMU B;  3QNU A;  5JH7 E;  2E9X D;  4EXT A;  4LML A;  3AEB A;  4P09 A;  3JCF A;  4PK4 A;  4A97 A;  2JQ9 A;  3E08 A;  1SUM B;  2VL0 A;  3ZN0 B;  3Q5D A;  1ZP0 A;  1R8I A;  2D9D A;  1XMO T;  3HI2 A;  5AQV B;  2M6B A;  2QVA A;  2BG9 C;  2LSK A;  3ABV A;  2W0G A;  3A7M A;  3BQI A;  2IDO B;  3L3P A;  4J2C A;  3JAF A;  4L0R A;  5TAO A;  1IBM T;  1MMA A;  4HKA A;  3EI0 A;  1CHU A;  3RKO A;  5LA6 E;  5LXT E;  4UEL A;  1FIO A;  5AQI B;  2IML A;  2MYS A;  4OHF A;  4GKK T;  3N9Q A;  5JDM A;  2UUC T;  1KNZ A;  2UXX B;  3AE6 A;  4BJN A;  4E7S A;  5F8P A;  3RQU A;  1KEY A;  2V6X A;  3CML A;  2WWU A;  3AED A;  2X68 A;  2V7K A;  3C98 B;  3HKE E;  3KDS E;  4H9P C;  2IW5 B;  3SFD A;  2HN2 A;  5ABH A;  4JI6 T;  2WU5 A;  2V5C A;  3KVA A;  2HPL A;  3LK3 B;  5JR9 B;  4H63 H;  4NUU A;  1MIV A;  2H3R A;  2VKD A;  4LF4 T;  4KHZ F;  3AB3 B;  3AE3 A;  3ZSS A;  2MPK A;  4YJ2 E;  5LP6 E;  4XBF B;  4O4I E;  4TN7 B;  5HYA A;  3PUA A;  5L2L A;  4IE7 A;  2YDS A;  1HF8 A;  4IL9 A;  4X64 T;  2UU9 T;  3ETV A;  3AE9 A;  4UVB B;  4COF A;  5L3B B;  3X1D A;  3N9O A;  4TWH A;  5JRC A;  1US7 B;  3ETU A;  3HA4 A;  4ERR A;  4H9N C;  2W2U A;  2XTL A;  5LMN T;  4UVA B;  4DV1 T;  4ZI2 D;  1SA0 E;  4YTM A;  4OFZ A;  3IA3 A;  3ONJ A;  4UR9 A;  5DJQ C;  3ZN1 B;  2FJE A;  4H9R C;  5LBQ B;  2L9Q A;  2KND A;  4M1P A;  4EOZ B;  2LOP A;  2AXD S;  3TKL B;  3VRB A;  4QH4 A;  2X9X A;  3AA7 B;  3FHN A;  2XAF B;  4G63 A;  3TLW A;  4AQF C;  1WR0 A;  5L3F B;  1YQ4 A;  3A8Y C;  3AVS A;  3Q5W A;  4KUM B;  4DND A;  1HS7 A;  2ES0 A;  2E9X B;  4O2A E;  3UUM A;  2RA1 A;  3CPZ A;  2DWG A;  2YU1 A;  2OLT A;  5LGT B;  2JQQ A;  2VK9 A;  2PBI A;  4BJM A;  2HN1 A;  4ZXL A;  4QXH B;  4YTN A;  2LSI A;  1MND A;  2XM1 A;  1D0Z A;  4U3C A;  4UVC B;  5FXW A;  3W15 B;  4HFE A;  3P7I A;  5C2T A;  2NTY A;  2VVS A;  1EZ3 A;  2JQK A;  4AQY T;  2V7M A;  3HKB E;  4HN9 A;  1E1H B;  4P1N A;  4Z91 A;  3UFE A;  1T72 A;  5AQQ B;  3ANW B;  2SPC A;  4UEM A;  1WLX A;  2VKO A;  2I59 A;  4OK0 A;  5M4Y A;  3AE5 A;  3JC6 C;  2X67 A;  1ZKE A;  4HFI A;  5A1L A;  4DR2 T;  5L3D B;  1UGO A;  2FJA A;  4HFD A;  2BG9 E;  2YEV C;  2LEH A;  2V1D B;  4X1I E;  5EK3 A;  4YY3 T;  2XUE A;  1N36 T;  3ONL C;  5KXJ A;  5LB7 B;  4H9Q C;  2BS3 A;  2ZMA A;  2MOZ A;  2CE7 A;  1M7K A;  2A9U A;  3IHR A;  4IDN A;  4DV3 T;  1B7T A;  4JUY A;  4JEH B;  4EZ4 A;  3VHL A;  3TLU A;  3CKD A;  4EZH A;  2V7J A;  3KFW X;  3NBX X;  3UUL A;  5J2T E;  2XQ9 A;  5CJ5 A;  5C8Y E;  5HXH A;  5FL1 A;  4NPP A;  5DQV A;  3ZEF B;  2BVL A;  3RX6 A;  2V6Y A;  4JLE A;  4X65 T;  1MMN A;  4GOU A;  1L0V A;  3UU4 A;  1U4Q A;  3OKQ A;  1D0X A;  1OWA A;  4YTP A;  4O2B E;  3FXD B;  2XAG B;  3FZK B;  1FJG T;  5LHH B;  3MA9 A;  1KFY A;  2JPF A;  3D0T A;  2WMN A;  3N5L A;  4N78 D;  3CVR A;  3UT5 E;  4X66 T;  2VB6 A;  4KMC A;  4ZZC A;  4P0B A;  5LCY A;  2ZM8 A;  5AQM B;  5JDQ A;  1WCR A;  2BS2 A;  3RYC E;  3I9Y A;  2V26 A;  3RC8 A;  4IT4 A;  1LVF A;  3AEE A;  4ZHQ E;  5HXR A;  2A2F X;  2N9D A;  2BBH A;  2WS3 A;  2YK0 A;  1D0Y A;  3ZST A;  4LFC T;  2XHE B;  2KWI B;  3R84 B;  2FBW A;  4H9O C;  3I0O A;  2UXB T;  5L4E A;  2X9H A;  2WP9 A;  3FBZ A;  3ZJ1 A;  2CEA A;  4GK0 E;  3HKD E;  4IGU A;  4AKL A;  4AQF A;  1T7S A;  2BKO A;  3UUX B;  3O1H A;  5JDH A;  4LF9 T;  3FZM B;  3PTR B;  1XZY A;  4QHO A;  4WW0 A;  4PJL A;  5ETW A;  4YSZ A;  3AA1 B;  4B3T T;  2HH7 A;  3UQ7 A;  1QUU A;  3RLF F;  4DV4 T;  4DBQ A;  4JI7 T;  4ZS3 A;  4EAH A;  1YQ3 A;  3RYF E;  2UXN B;  2J4G A;  1HNZ T;  5JRC B;  3CIR A;  3HR0 A;  2XZE A;  3N9N A;  2MBG A;  2NP9 A;  4LMJ A;  4UXN B;  4ASK A;  3PU3 A;  5CA1 E;  3O9X A;  2LE8 A;  3MJX A;  3AEA A;  3PUQ A;  4K0U A;  3L09 A;  1UX4 A;  2LM2 A;  3LFM A;  3OJA A;  2CMR A;  4JI5 T;  3SOL A;  4U72 A;  5LG4 A;  2XY8 B;  3MXZ A;  2V7I A;  3G06 A;  4PFO A;  4U31 A;  4ZZB A;  4X62 T;  3PUG A;  1OED C;  4DBR A;  2LJL A;  2YKS A;  3RIU C;  4ANJ A;  1OXZ A;  2YIN A;  3CX7 B;  3KVB A;  3VKH A;  2C0S A;  1QSD A;  4JI2 T;  3O4X E;  3S4U A;  2W61 A;  3NVO A;  1ZV4 X;  4HFV A;  4JBW F;  4ZI3 D;  4AKG A;  2WDV A;  1MIW A;  4PK5 A;  2XQ5 A;  3RGL A;  4DR7 T;  2XM2 A;  3NZQ A;  3CWZ B;  2YDR A;  2N1G A;  3ONX A;  4MAL A;  3T8O A;  2J1D G;  4C90 A;  3C51 A;  4UIG A;  2WZH A;  4IDQ A;  1SHZ C;  1UUR A;  4O4L E;  3VKG A;  4KX6 A;  3LSV A;  2ZLY A;  5DAB A;  4TV8 E;  3TLV A;  3VRA A;  4F6R C;  1UK5 A;  2F4V T;  4UV9 B;  1NAF A;  2LHR A;  3K3Q C;  2RP4 A;  2H89 A;  3BQK A;  3PUR A;  2KZ7 B;  4IDO A;  4QXB B;  4YHJ A;  4DO0 A;  1D1B A;  4U7Y A;  5ADX L;  1V9D A;  4WBN E;  3RKG A;  1I6Z A;  3DP7 A;  2V6Y B;  2DLR A;  3NZP A;  3P4S A;  2R6G F;  1YKE B;  4X1Y E;  3ESL A;  3QB5 K;  3GA8 A;  4LFB T;  3AE4 A;  4I4T E;  4TNV A;  3A5X A;  3CQC B;  1HG5 A;  4TX5 A;  3PUW F;  3O1J A;  5HXE A;  3M3Z B;  1N33 T;  1VRB A;  1SE7 A;  3EVY A;  1MMD A;  1J1J A;  2W63 A;  5HAX A;  5HCJ A;  2W62 A;  4ZI2 C;  4BA9 A;  2EHO C;  3N9L A;  2X9W A;  1FEW A;  3RHW A;  4KP3 C;  3B5M A;  3NWI A;  4GYS A;  2A3D A;  2DL1 A;  2XQ3 A;  2ZM0 A;  2XQ6 A;  3L8R A;  4CN1 A;  2XQ8 A;  4PW8 A;  5HWX A;  4X20 E;  4NUV A;  1T8B A;  4YLH A;  5EZY E;  4MFR A;  2M67 A;  3RF1 A;  2K5B B;  3LDQ B;  3C4Z A;  3OBV E;  5ABF A;  4FJO A;  3ZT5 A;  5JDL A;  4ILU A;  5HXS A;  5FY1 A;  1XNQ T;  2N2N A;  3PDY A;  5FXV A;  1AJ3 A;  3EAB A;  2W67 A;  2L3L A;  2ACX A;  2WDR A;  5HEH A;  1KNP A;  5LHI B;  3SRZ A;  3EDV A;  4PAG A;  4DMV A;  1LVK A;  2KWH A;  3LG7 A;  4GK5 E;  4EV6 A;  2A72 A;  4PJM A;  2BBJ A;  4ZI7 E;  4JI4 T;  5AQS B;  2LKH A;  4U2Z A;  3V5U A;  3K3O A;  4B6X A;  1CUN A;  1FMV A;  5AQL B;  3F57 A;  2LSG A;  3QUJ A;  2WCA A;  1DU2 A;  2CWO A;  5BMV E;  1NEK A;  1W9R A;  2K48 A;  4YXD A;  1IBK T;  2B1E A;  2XAJ B;  4ZOL E;  2UXC T;  4BAY B;  3GMI A;  2CA5 A;  1MNE A;  3EHZ A;  4B3M T;  2WDQ A;  5IHY A;  2JMK A;  3RIU A;  3CK6 A;  4MBQ A;  4NIQ A;  4HWF A;  1VOM A;  2DCF A;  5AQF B;  3ZMS B;  2P9B A;  4LFA T;  1HG2 A;  5AQN B;  5AQT B;  3AE8 A;  4UV8 B;  3SWH A;  3UUB A;  4HWC A;  4JI1 T;  5HCM A;  2VL8 A;  5LGU B;  4HWI B;  5LBM A;  4YHH T;  1IJ5 A;  2CWY A;  3H3A A;  2XSA A;  5LG3 A;  5AQH B;  1I94 T;  5FYM A;  3OVU A;  2CXF A;  1XMQ T;  5CFB A;  3N2G E;  2PJQ A;  3H37 A;  3N2K E;  4FI5 A;  2BZB A;  4IE4 A;  3PUS A;  2EHO D;  4CI2 B;  3IF8 B;  2WU2 A;  4IE6 A;  2XAQ B;  1YXR A;  3EUH A;  3HL6 A;  2PFV A;  4I55 E;  4IDZ A;  4MLK A;  3ZMV B;  4ADZ A;  1N34 T;  4CI1 B;  2FJB A;  4PJN A;  2JRK A;  4A98 A;  5JR9 A;  5LJN A;  3VR9 A;  3ZC0 A;  3ZYM A;  1BR0 A;  2FJD A;  2QA7 A;  3H3M A;  4PFP A;  3C64 A;  5FMN A;  2EHO A;  5KMG P;  4JV5 T;  1WR6 A;  5LOV E;  1OED B;  2WSS V;  2BVM A;  2XPK A;  3AE7 A;  4CXY A;  4O8S A;  2CXL A;  4ZS2 A;  3ZMT B;  5C3J A;  5FKY A;  4GIW A;  4JI3 T;  3AAI A;  3J9X 1;  2BKN A;  4EB6 E;  2KT9 A;  4LF5 T;  1VCT A;  2K24 A;  3QOF A;  4IST A;  4EGW A;  1HR0 T;  1UUS A;  3LK4 2;  4NXN T;  3CX8 B;  4HTE A;  3FXE B;  2C5I T;  2VKJ A;  2W4X A;  4PNI A;  2NWB A;  5HWY A;  2BG9 A;  2VKH A;  1FMW A;  1H7C A;  2J62 A;  4L9I A;  1KK7 A;  2D5U A;  3ZYK A;  5ABE A;  5KDM C;  5LNK A;  4KBM B;  4WYV A;  4G2A A;  4LMK A;  4QX8 B;  2L8K A;  3CQG B;  4H63 V;  2XSB A;  3RRW A;  5LGN B;  3WAJ A;  2ZM6 T;  4DUY T;  1W0B A;  3UQ4 A;  1Z8U A;  4ILC A;  1VCS A;  4EYU A;  2H7V C;  2I6H A;  1G8X A;  4I43 B;  5FP3 A;  1YW0 A;  2LHN A;  5AQR B;  5L4H A;  1KF6 A;  2C5J A;  3GN5 B;  2VQF T;  2BS4 A;  2KLQ A;  2X0H A;  4TZ4 C;  3UU6 A;  4C91 A;  2BDE A;  3CQX C;  2DI4 A;  3BK9 A;  3MK7 C;  5AQP B;  3RQW A;  5CB4 E;  2VWA A;  1HX1 B;  2JQH A;  3UU5 A;  3BQL A;  2LT3 A;  5J0Z A;  2PTF A;  5JDN A;  2EHO B;  2XQ7 A;  3P4R A;  3OYX A;  2H88 A;  2MAW A;  4HWD A;  2YOE A;  2K9A A;  5H6R B;  5HEU A;  4P0A A;  2JMH A;  2X51 A;  4Z90 A;  4QWN B;  1MIY A;  2QRX A;  5FY0 A;  5L47 A;  3JC6 D;  4DV5 T;  3IEE A;  4X1K E;  4A5X A;  2XJ7 A;  2IC6 A;  3LJC A;  5AQO B;  5HXC A;  5J1G A;  2CBI A;  3EAM A;  4ZI3 C;  4K0K T;  2UUB T;  5IUX A;  2IHR 1;  3K1S A;  4TNW A;  1WYB A;  2Y48 B;  1XWM A;  4O4H E;  4CQI A;  1E7P A;  2BKP A;  1BR1 A;  3AVR A;  2KIN B;  3CX6 B;  3QC9 A;  3QK6 A;  4U7I A;  2D2S A;  4XZC A;  5JDF A;  3UFG A;  5IWA T;  4CN6 A;  4Z8X A;  2IAK A;  2VQE T;  1OED E;  1X79 A;  4UF0 B;  4HE8 A;  2Q9Q B;  2YN6 A;  3R6N A;  2KXP B;  4TV9 E;  3ZT6 A;  5L3G B;  3LBX A;  3EDU A;  5HEJ A;  5JRE A;  2J47 A;  2CBJ A;  2WB5 A;  4OX9 T;  5JQG E;  3ZYL A;  3GWH A;  4HWH A;  2M6I A;  3M65 A;  2H7O A;  2V8S V;  3AXJ B;  3MAC A;  5KX5 E;  4OYK A;  5FXZ A;  4IDP A;  2QYW A;  1X9B A;  1HTJ F;  4IL4 A;  3UU3 A;  3NRX A;  4ZEY A;  1W09 A;  4HFB A;  3I9W A;  5J2U E;  3PU8 A;  4A56 A;  5BR8 T;  3AAA B;  4U74 A;  5E0O A;  3WAK A;  3KV5 A;  4IE5 A;  1IJ6 A;  4HFH A;  2VVN A;  2E2A A;  3FZL B;  3LK2 B;  3P4P A;  2E9X A;  1U5P A;  2X0L B;  3N2O A;  3RYI E;  4PK6 A;  2AE9 A;  2UXD T;  1WYC A;  3KV6 A;  4DR5 T;  5FNV E;  3NKZ A;  2E5V A;  2Y6X A;  5IYZ E;  4U33 A;  1JNZ A;  2LKG A;  1N32 T;  3AE1 A;  4HEA A;  5F5W A;  4CN4 A;  1HNW T;  4DR4 T;  4IIJ E;  2Q9Q A;  3AEC A;  2W00 A;  3MZK B;  4UF0 A;  4EIW A;  4JI0 T;  1XDP A;  5L3C B;  2WAU A;  4DID B;  2WBL A;  2X66 A;  4DR3 T;  4DR6 T;  4Q25 A;  4HGA A;  4AI6 A;  2E8I A;  2D0U A;  2HPJ A;  2WQY A;  4PJJ A;  3UUN A;  4AQG A;  2Z6E A;  3I1A A;  3PUZ F;  4AKI A;  2LRL A;  5JVD E;  1GQE A;  4QH1 A;  4TWF A;  4JYA T;  2NR4 A;  3F2E A;  2LRK A;  5AQU B;  1O3X A;  5FY7 A;  4AXP A;  2VAS A;  4DVD A;  4B3S T;  3FBL A;  4DV2 T;  5AQJ B;  2B76 A;  3ZMZ B;  5AFU L;  4YT0 A;  4IE0 A;  4YSX A;  4YJ3 E;  4I0U A;  2WMO A;  1S35 A;  3FZH B;  4WZX A;  5FL0 A;  3OTO T;  2OA5 A;  3ZCJ A;  1Y64 B;  5AQK B;  4LF8 T;  3AEG A;  2WWV A;  2CCQ A;  2WM9 A;  5H6Q B;  3E0Z A;  1W0A A;  4IRE A;  3WI3 A;  5EK4 A;  3ZC1 A;  4GYR A;  1HX8 A;  3T1H T;  1D1A A;  1UX5 A;  1WFD A;  4F8H A;  4TUY E;  4DR1 T;  2ODV A;  3I0Q A;  4DMW A;  4NXM T;  4B3R T;  1J5W A;  3UTK A;  5JDG A;  5FXX A;  3RIF A;  5AQG B;  3PUX F;  4DV6 T;  3Q9D A;  1BR4 A;  4TWD A;  3NRY A;  3L39 A;  5ABG A;  4AIS A;  5F3J A;  1NEN A;  1QLB A;  2XQY A;  3AE2 A;  2X0Y A;  2BG9 B;  2W66 A;  2XQA A;  3C4W A;  2PG8 A;  3B13 A;  3PJA A;  3P50 A;  1BR2 A;  2VUR A;  2FUP A;  2Q9Q D;  3PV0 F;  3SS1 A;  1HCI A;  2CRB A;  4AIU A;  1IZN B;  2DWK A;  4V1A v;  5LMU T;  4ISS A;  5CGM A;  4OYJ A;  4KHP T;  4L5G A;  3F31 A;  3RI5 A;  4EED A;  4GKJ T;  4QX7 B;  1Y01 A;  3RPU A;  3SFE A;  4DUZ T;  2CHO A;  2UUA T;  2D0T A;  3MKD A;  5CA0 E;  2LOS A;  4CXW A;  1OED A;  1S94 A;  5LYJ E;  3U78 A;  3AA0 B;  1D1C A;  2IC9 A;  2Y8D A;  3ZCI A;  2Q9Q C;  1T98 A;  1ZHC A;  1UCU A;  5JR9 C;  3Q5X A;  1G73 A;  4O4J E;  3HKC E;  2IUB A;  2JIW A;  2CXD A;  2QGS A;  2YDQ A;  3OYZ A;  4I50 E;  3VR8 A;  3RRC A;  3ZLI A;  3KV4 A;  4ILB A;  1J5E T;  3KBU A;  3KV9 A;  4EYY R;  4MHC A;  2XAH B;  2I0M A;  2YU2 A;  4X5T A;  4YFS A;  4XAX B;  1Z0P A;  2CM0 A;  5FVL A;  1HNX T;  3P4Q A;  3N9P A;  3OPC A;  2WZI A;  1ZEE A;  3PUY F; 
#chains in the Genus database with same CATH homology
 3PE0 A;  2LSJ A;  4E7Z A;  2NW9 A;  2CLY B;  3AA6 B;  3N9M A;  3K3N A;  2NW7 A;  4IHJ E;  3AAE B;  2DHR A;  2E9X C;  2ODU A;  2KMF A;  2LSY A;  3KIN B;  3ZJ2 A;  3LBX B;  5EK2 A;  3RC3 A;  5LHG B;  1WRD A;  2DNX A;  3FB2 A;  3VU7 H;  2CLY C;  4WNK A;  2GK9 A;  1MMG A;  3C50 A;  1YKH B;  2V7L A;  3ZPO A;  4CXX A;  1NWM X;  3P8C D;  3C4X A;  1IAP A;  4AKR B;  2NW8 A;  5DQW A;  3B57 A;  5GON E;  4CI3 B;  4CZZ B;  2NTX A;  1HFA A;  3DJB A;  3Q2M A;  2JJ9 A;  4JEU B;  3O1I A;  3RH3 A;  5L3E B;  2NOX A;  3U3I A;  3IBP A;  1LKX A;  3K8P C;  2MTQ A;  1LRZ A;  3ANW A;  4QXC B;  3J7Y q;  1YD8 G;  2XAS B;  2ZM2 A;  3DTO A;  3KBT A;  2X9Y A;  3GN5 A;  4H9S E;  3V5S A;  2C5K T;  3RYH E;  2G0U A;  4WBO A;  4QKN A;  2LM9 A;  4AKH A;  3E22 E;  5LJM A;  3ZMU B;  5JH7 E;  2E9X D;  4EXT A;  4P09 A;  4PK4 A;  3E08 A;  3ZN0 B;  3HI2 A;  4J2C A;  2LSK A;  3L3P A;  2W0G A;  3BQI A;  5TAO A;  1MMA A;  4HKA A;  3RKO A;  5LA6 E;  5LXT E;  4UEL A;  1FIO A;  2MYS A;  4OHF A;  3N9Q A;  5JDM A;  1KNZ A;  2UXX B;  4BJN A;  4E7S A;  5F8P A;  3VHL A;  3ZMV B;  3CML A;  2WWU A;  3HKE E;  2X68 A;  2V7K A;  3C98 B;  4H9P C;  3KDS E;  2IW5 B;  3KVA A;  2HPL A;  3LK3 B;  5JR9 B;  4H63 H;  4NUU A;  1MIV A;  2H3R A;  2VKD A;  3AB3 B;  4YJ2 E;  4XBF B;  4O4I E;  4TN7 B;  5HYA A;  3PUA A;  5L2L A;  4IE7 A;  1HF8 A;  3ETV A;  4UVB B;  5L3B B;  3N9O A;  5JRC A;  1US7 B;  3ETU A;  3HA4 A;  4ERR A;  4H9N C;  2XTL A;  4UVA B;  4ZI2 D;  1SA0 E;  4OFZ A;  5DJQ C;  3ZN1 B;  4H9R C;  5LBQ B;  4EOZ B;  2L9Q A;  2KND A;  4M1P A;  2LOP A;  3TKL B;  2X9X A;  3FHN A;  3AA7 B;  2XAF B;  4G63 A;  4AQF C;  5L3F B;  3AVS A;  3Q5W A;  4KUM B;  4DND A;  1HS7 A;  2ES0 A;  2E9X B;  4O2A E;  3UUM A;  2RA1 A;  3CPZ A;  2DWG A;  2YU1 A;  5LGT B;  5LP6 E;  2JQQ A;  2VK9 A;  2PBI A;  4BJM A;  4QXH B;  2LSI A;  1MND A;  1D0Z A;  4UVC B;  5FXW A;  3W15 B;  3P7I A;  2NTY A;  1EZ3 A;  2V7M A;  3HKB E;  4HN9 A;  1E1H B;  3UFE A;  3ANW B;  2SPC A;  4UEM A;  2VKO A;  1WLX A;  2I59 A;  4OK0 A;  5M4Y A;  3JC6 C;  2X67 A;  1ZKE A;  5A1L A;  1ZEE A;  5L3D B;  2YEV C;  2LEH A;  2V1D B;  4X1I E;  5EK3 A;  2XUE A;  4H9Q C;  2ZMA A;  2MOZ A;  2CE7 A;  3IHR A;  1B7T A;  4JEH B;  4EZ4 A;  3CKD A;  4EZH A;  2V7J A;  3KFW X;  3NBX X;  3UUL A;  5J2T E;  5HXH A;  5C8Y E;  3ZEF B;  5DQV A;  2BVL A;  3RX6 A;  4JLE A;  1MMN A;  4GOU A;  1U4Q A;  3OKQ A;  1D0X A;  1OWA A;  4O2B E;  3FXD B;  2XAG B;  5LHH B;  3MA9 A;  2JPF A;  3D0T A;  2WMN A;  3N5L A;  4N78 D;  3CVR A;  3UT5 E;  2VB6 A;  4KMC A;  4P0B A;  5LCY A;  2ZM8 A;  5JDQ A;  3RYC E;  3I9Y A;  2V26 A;  3RC8 A;  1LVF A;  4ZHQ E;  5HXR A;  2A2F X;  2N9D A;  2YK0 A;  1D0Y A;  2XHE B;  2KWI B;  3R84 B;  4H9O C;  3I0O A;  2X9H A;  3FBZ A;  3ZJ1 A;  2CEA A;  4GK0 E;  3HKD E;  4IGU A;  4AKL A;  4AQF A;  3UUX B;  5JDH A;  3O1H A;  3PTR B;  4WW0 A;  4QHO A;  4PJL A;  5ETW A;  3AA1 B;  2HH7 A;  1QUU A;  4DBQ A;  4ZS3 A;  4EAH A;  3RYF E;  2UXN B;  5JRC B;  3HR0 A;  3N9N A;  2MBG A;  2NP9 A;  4UXN B;  3O9X A;  4ASK A;  3PU3 A;  5CA1 E;  2LE8 A;  3MJX A;  3PUQ A;  4K0U A;  3L09 A;  1UX4 A;  3LFM A;  3OJA A;  2CMR A;  3SOL A;  4U72 A;  5LG4 A;  4PFO A;  3MXZ A;  2V7I A;  3PUG A;  4DBR A;  2LJL A;  3VKH A;  4ANJ A;  1OXZ A;  2YIN A;  3CX7 B;  3KVB A;  2C0S A;  1QSD A;  3O4X E;  3S4U A;  2W61 A;  4AKG A;  1ZV4 X;  4HFV A;  4ZI3 D;  1MIW A;  4PK5 A;  3NZQ A;  3CWZ B;  3ONX A;  2N1G A;  4MAL A;  3T8O A;  2J1D G;  4C90 A;  3C51 A;  4UIG A;  1SHZ C;  4O4L E;  3VKG A;  5DAB A;  2ZLY A;  4TV8 E;  4F6R C;  4UV9 B;  1NAF A;  2LHR A;  3K3Q C;  2RP4 A;  3BQK A;  3PUR A;  2KZ7 B;  4QXB B;  4DO0 A;  4YHJ A;  1D1B A;  5ADX L;  1V9D A;  4WBN E;  3DP7 A;  2DLR A;  3NZP A;  1YKE B;  4X1Y E;  3ESL A;  3GA8 A;  4I4T E;  3CQC B;  3A5X A;  1HG5 A;  4TX5 A;  3O1J A;  5HXE A;  1VRB A;  3EVY A;  1MMD A;  2W63 A;  5HAX A;  2W62 A;  4ZI2 C;  4BA9 A;  2EHO C;  3N9L A;  2X9W A;  1FEW A;  4KP3 C;  4GYS A;  2A3D A;  2ZM0 A;  4PW8 A;  5HWX A;  4X20 E;  4NUV A;  4YLH A;  5EZY E;  4MFR A;  2M67 A;  2K5B B;  3OBV E;  3C4Z A;  5JDL A;  4FJO A;  4ILU A;  5HXS A;  5FY1 A;  1AJ3 A;  2N2N A;  3PDY A;  5FXV A;  2L3L A;  2ACX A;  5LHI B;  3SRZ A;  3EDV A;  4PAG A;  4DMV A;  1LVK A;  2KWH A;  3LG7 A;  4GK5 E;  4ZI7 E;  2A72 A;  4PJM A;  3V5U A;  3K3O A;  4B6X A;  1CUN A;  1FMV A;  3F57 A;  2LSG A;  3QUJ A;  2CWO A;  2K48 A;  2B1E A;  2XAJ B;  4ZOL E;  4BAY B;  3GMI A;  2CA5 A;  1MNE A;  5IHY A;  2JMK A;  4MBQ A;  1VOM A;  2DCF A;  3ZMS B;  2P9B A;  1HG2 A;  4UV8 B;  3SWH A;  2VL8 A;  5LGU B;  5LBM A;  1IJ5 A;  2CWY A;  3H3A A;  5FYM A;  2CXF A;  4P0A A;  3N2G E;  2PJQ A;  3H37 A;  3N2K E;  4FI5 A;  2BZB A;  4IE4 A;  3PUS A;  2EHO D;  4CI2 B;  3IF8 B;  4IE6 A;  2XAQ B;  3EUH A;  3HL6 A;  4MLK A;  2PFV A;  4I55 E;  4IDZ A;  4ADZ A;  3ZC0 A;  4CI1 B;  4PJN A;  2JRK A;  5LJN A;  5JR9 A;  1BR0 A;  3ZYM A;  2QA7 A;  4PFP A;  3C64 A;  5FMN A;  2EHO A;  5KMG P;  1WR6 A;  5LOV E;  2WSS V;  2BVM A;  4CXY A;  4O8S A;  2CXL A;  4ZS2 A;  3ZMT B;  4GIW A;  3J9X 1;  4EB6 E;  2KT9 A;  2K24 A;  4IST A;  3LK4 2;  3CX8 B;  4HTE A;  3FXE B;  2C5I T;  2VKJ A;  4PNI A;  2NWB A;  5HWY A;  2VKH A;  1FMW A;  1H7C A;  3ZYK A;  1KK7 A;  2D5U A;  5LNK A;  5KDM C;  4KBM B;  4G2A A;  4QX8 B;  3RRW A;  2L8K A;  3CQG B;  4H63 V;  5LGN B;  3WAJ A;  4EYU A;  2H7V C;  5FP3 A;  1G8X A;  4I43 B;  1YW0 A;  2LHN A;  2C5J A;  3GN5 B;  2KLQ A;  4TZ4 C;  4C91 A;  2BDE A;  3CQX C;  2DI4 A;  3BK9 A;  3MK7 C;  5CB4 E;  2VWA A;  3BQL A;  2LT3 A;  5JDN A;  2EHO B;  3OYX A;  5H6R B;  2K9A A;  2JMH A;  2X51 A;  4QWN B;  1MIY A;  5FY0 A;  3JC6 D;  3IEE A;  4X1K E;  2IC6 A;  3LJC A;  5HXC A;  5J1G A;  4ZI3 C;  1WYB A;  2Y48 B;  4O4H E;  4CQI A;  3CX6 B;  3QK6 A;  1BR1 A;  3AVR A;  2KIN B;  4XZC A;  3QC9 A;  5JDF A;  2D2S A;  4Z8X A;  2IAK A;  1X79 A;  4UF0 B;  4HE8 A;  2Q9Q B;  3R6N A;  2KXP B;  4TV9 E;  5L3G B;  5JRE A;  3LBX A;  3EDU A;  5JQG E;  3ZYL A;  3GWH A;  3M65 A;  2H7O A;  3MAC A;  5KX5 E;  4OYK A;  5FXZ A;  1HTJ F;  3NRX A;  5J2U E;  3I9W A;  3PU8 A;  4A56 A;  3AAA B;  4U74 A;  5E0O A;  3WAK A;  3KV5 A;  4IE5 A;  1IJ6 A;  3LK2 B;  2E9X A;  1U5P A;  2X0L B;  3N2O A;  3RYI E;  4PK6 A;  1WYC A;  3KV6 A;  5FNV E;  2Y6X A;  5IYZ E;  4HEA A;  4IIJ E;  2Q9Q A;  4UF0 A;  2W00 A;  3MZK B;  4EIW A;  5L3C B;  2WAU A;  4AI6 A;  2WBL A;  2X66 A;  4HGA A;  2E8I A;  2D0U A;  2HPJ A;  4PJJ A;  3UUN A;  4AQG A;  4AKI A;  2Z6E A;  3I1A A;  5JVD E;  3F2E A;  4AXP A;  5FY7 A;  1O3X A;  4DVD A;  2VAS A;  3FBL A;  3ZMZ B;  5AFU L;  4IE0 A;  4YJ3 E;  2WMO A;  1S35 A;  2OA5 A;  3ZCJ A;  1Y64 B;  2CCQ A;  2WM9 A;  5H6Q B;  3E0Z A;  3WI3 A;  5EK4 A;  3ZC1 A;  4GYR A;  1HX8 A;  1D1A A;  1UX5 A;  4TUY E;  2ODV A;  3I0Q A;  4DMW A;  3UTK A;  5JDG A;  5FXX A;  3Q9D A;  1BR4 A;  3NRY A;  5F3J A;  2XQY A;  3C4W A;  4JUY A;  4L0R A;  4L9I A;  2PG8 A;  3B13 A;  1BR2 A;  2Q9Q D;  3SS1 A;  1HCI A;  1IZN B;  2DWK A;  4V1A v;  4ISS A;  4OYJ A;  4L5G A;  3F31 A;  4QX7 B;  3RPU A;  2D0T A;  3MKD A;  5CA0 E;  2LOS A;  4CXW A;  1S94 A;  5LYJ E;  3U78 A;  3AA0 B;  1D1C A;  2IC9 A;  2Y8D A;  3ZCI A;  2Q9Q C;  1T98 A;  1ZHC A;  1UCU A;  5JR9 C;  3Q5X A;  1G73 A;  4O4J E;  3HKC E;  2CXD A;  2QGS A;  3OYZ A;  4I50 E;  3ZLI A;  3RRC A;  3KV4 A;  3KBU A;  3KV9 A;  4EYY R;  4MHC A;  2XAH B;  2YU2 A;  4YFS A;  4XAX B;  1Z0P A;  2CM0 A;  3N9P A;  3AAI A;  5BMV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...