1QSDA

Rbl2p, beta-tubulin binding post-chaperonin cofactor
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
102
structure length
102
Chain Sequence
TQLDIKVKALKRLTKEEGYYQQELKDQEAHVAKLKEDKSVDPYDLKKQEEVLDDTKRLLPTLYEKIREFKEDLEQFLKTYQGTEDVSDARSAITSAQELLDS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords PROTEIN (BETA-TUBULIN BINDING POST-CHAPERONIN COFACTOR)
publication title Crystal structure of the post-chaperonin beta-tubulin binding cofactor Rbl2p
pubmed doi rcsb
total genus 45
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02970 TBCA Tubulin binding cofactor A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1qsdA00
3QK6A 2C5JA 4J2CA 4CQIA 1IJ6A 2CA5A 1ZKEA 3FXDB 3QUJA 1IJ5A 2MBGA 2C5KT 2IC6A 4L0RA 2C5IT 3FXEB 3P7IA 1LVFA 2XTLA 2KWIB 4B6XA 2X9XA 3L3PA 1Z0PA 2X9WA 2K48A 3N5LA 2IC9A 2G0UA 3TKLB 3CVRA 4DNDA 2X9YA 3CKDA 4FI5A 4EYYR 1LRZA 1QSDA 3MXZA 2KWHA 3S4UA 1H7CA
chains in the Genus database with same CATH superfamily
2DLRA 5ABFA 3SS1A 3ZMTB 4JI6T 4ILCA 1XNQT 3AE8A 3RYHE 2BVMA 3KV9A 4IREA 3SFDA 2BS3A 3LK42 4H9OC 2XUEA 1XMOT 4A56A 1ZV4X 5CA0E 3A8YC 3PURA 4TZ4C 3AVSA 4EGWA 4DMWA 4BJNA 3AEDA 2YK0A 3SOLA 3HKDE 3OYZA 1D0YA 1I6ZA 3CX6B 2QA7A 2PJQA 5FXZA 5FY1A 3C50A 3GN5B 2ZM8A 4GKKT 5FVLA 4CQIA 3PUZF 3TLSA 4X64T 3SFEA 4HKAA 2N1GA 3O1JA 3ZYMA 4DBQA 5JDHA 3LK2B 3KBTA 2EHOD 4I4TE 3AE5A 3ZT5A 2HN2A 3TKLB 3MXZA 4ZS3A 4YJ3E 2QRXA 3RYIE 2V7MA 3OKQA 4H9SE 3RQWA 2WM9A 4JI7T 3DTOA 3HKBE 4ZI2D 4LFCT 4O4IE 1J5WA 3F57A 2LSKA 3E22E 1UURA 3RQUA 5DABA 1YKEB 3CKDA 2CXLA 2LSYA 3RLFF 3KV6A 2DI4A 3JC6C 4AXPA 1XDOA 2D9DA 4K0KT 2IHR1 3ZPOA 4G63A 1E2AA 4FJOA 1HCIA 2XM1A 4HWDA 3CVRA 3HA4A 2JQKA 2CLYC 3TLWA 4AI6A 3AEBA 3P4QA 2UXDT 4HFVA 4AQGA 5BR8T 4XZCA 2RP4A 4LMJA 2W0GA 2F4VT 1YW0A 3P7IA 2YDSA 5FY0A 4BJMA 1BR4A 4UF0A 2J4GA 2BG9A 3AB3B 1NEKA 3VRAA 4QXBB 3ZKRA 4IGUA 1BR2A 4U7IA 2KWIB 1CHUA 4P1NA 3T1YT 4I55E 2SPCA 1LRZA 1QSDA 2WU2A 5JVDE 3VKGA 5IYZE 5HXEA 4TNVA 2FJEA 2VKHA 2UU9T 5L3BB 3BQLA 4EZ4A 2C5IT 3HL6A 4X62T 5HEHA 3R84B 3R6NA 2K24A 2UUAT 4AISA 3FZHB 3GMIA 4Q25A 3GA8A 5C2TA 4MBQA 2LHRA 2J1DG 4DO0A 1IBMT 2A2FX 3ZJ1A 5LA6E 5JR9C 3ZSSA 3A5XA 1U4QA 4U2ZA 3AVRA 3VR9A 4U2YA 2QVAA 4AQFC 4AQYT 3ZEFB 4KUMB 2D0TA 3N2OA 3EABA 3FZMB 3CWZB 2MOZA 1HR0T 4QWNB 5FMNA 5FP3A 3RF1A 4XAXB 3UFEA 2D2SA 2V6YB 5J1GA 3ONJA 4YTNA 3PUYF 1ZOYA 2GK9A 4IHJE 4DV3T 5HEUA 1HG2A 2XAHB 3M65A 4QH4A 4X20E 4UIGA 4IE5A 4HTEA 4IE6A 3O9XA 4O2BE 1YKHB 3IF8B 2E9XB 3PUGA 1BR0A 3V5SA 4DR5T 1ZP0A 2ODUA 5ADXL 2XSAA 4U3CA 4X1KE 2ACZA 3CX7B 2VKDA 4C91A 5AQUB 1Z0PA 4TNWA 2NOXA 1R8IA 5L3FB 3KVAA 2LJLA 1MIWA 2E5LT 1OEDC 1KNZA 5EK3A 5LBMA 2WZHA 4ZI3D 4AKRB 2WSSV 3ZN0B 5HWXA 2LSJA 2MPKA 1VOMA 2FJDA 4IL9A 4UELA 2ES0A 2JPFA 3NBXX 3B13A 2CLYB 3IA3A 2YN6A 4YFSA 4JUYA 5FNVE 3ANWB 3UU4A 4PJJA 4YJ2E 2BKNA 1T7SA 5ABEA 1XMQT 1W0BA 2BG9E 3EI0A 2L9QA 2IIUA 2W66A 2XSBA 3DJBA 5DQWA 5AQQB 5JDGA 2WP9A 1XZYA 2W62A 5LG4A 4Z8XA 2IC6A 1MIYA 4OX9T 2LEHA 2LM9A 2M6BA 5GONE 3S4UA 4YT0A 3N9LA 3JADA 3LSVA 3BK9A 1HNZT 5JRCA 3N9QA 4LMKA 4QKNA 4NUVA 2Q9QB 3AA7B 1XNRT 2B1EA 2XQ6A 3ZYLA 3CMLA 3N9NA 2DHRA 1FIOA 3KV5A 3AA1B 2JJ9A 4CZZB 1KNRA 3ZSTA 3UTKA 3T1HT 4UV8B 2Y6XA 1FEWA 5LHHB 2IDOB 3NRXA 3NZPA 3AXJA 3RPUA 4A5XA 5AQVB 2X67A 1YQ4A 2DCFA 2WDRA 2YINA 2ZM6T 3PU8A 2VQET 3PUWF 4IDPA 5FY7A 3RIUC 2KT9A 3P4RA 3PJAJ 2FJBA 4UVBB 1ZEEA 4CXWA 1XWMA 5FVKA 2WB5A 4H63H 3ONLC 2VVNA 3AE7A 3CQGB 4O4LE 4UVCB 2KSRA 3K1SA 4H9PC 2VB6A 4DR4T 3ZMSB 2ZLYA 1NAFA 4PJLA 4ZZCA 3ZC0A 3WAKA 3RRCA 2XHEB 1OEDB 4C90A 4PK4A 3V5UA 5AQFB 5LMUT 2H7OA 2JQHA 3SRZA 1D0XA 4M1PA 3AEGA 4HEAA 5AFUL 4PFOA 4IDOA 1M62A 1VCSA 3EVYA 2VASA 5L3DB 1Z8UA 3LG7A 2EHOB 1QUUA 4CI2B 4DV1T 3MK7C 4YLHA 4L0RA 2XTLA 2HN1A 2WDVA 3KFWX 2BKPA 4ZI3C 1D1CA 2CEAA 1I94T 2JMHA 2E2AA 4H9NC 2VKJA 4WBOA 2V7JA 2JRKA 4ILAA 2BZBA 4DNDA 4DV2T 2V5CA 2LRLA 2ODVA 2LT3A 4E7SA 3IHRA 5KXJA 2XZEA 1FJGT 4PJNA 3B57A 5TAOA 1AJ3A 3D0TA 3C4ZA 4YSZA 2WMOA 4CI1B 3N2KE 2LLYA 3DP7A 4HWFA 2X0LB 4HE8A 1T8BA 4DUZT 3VR8A 4CN6A 3N2GE 1IBKT 4EIWA 3AAIA 2FUPA 2OV9A 3PDYA 3ZMZB 3FXEB 5LP6E 4B6XA 4JYAT 4KHPT 4PK5A 5AQSB 3OVUA 2E9XC 3ZC1A 4ANJA 1JNRA 3AE2A 4B3TT 1G8XA 3EAMA 3ZCJA 4KP3C 2MAWA 4H63V 4QX7B 5BMVE 5LG3A 2H3RA 5HXCA 3OTOT 3N5LA 5HXRA 2V7LA 3LDQB 4NXMT 4EZHA 4DUYT 2JMKA 2W63A 4NXNT 5JDMA 3Q5WA 4HWHA 3BQIA 1D1BA 3QNUA 4AKIA 1UX4A 5F8PA 3L8RA 3T8OA 4B3RT 4TV8E 4NUUA 3FBZA 3P4PA 4CXXA 4K0UA 1NENA 3RYFE 2WZIA 4ZHQE 2C5JA 2WY2A 3QUJA 5ABFB 2UXCT 2W2UA 1V9DA 3VRBA 2JIWA 2CBJA 4YY3T 2N2NA 4WW0A 3K8PC 2CRBA 2WWUA 2L3LA 3ONXA 3LBXB 2IUBA 2QGSA 5C8YE 2UUCT 5LOVE 3CK6A 5AQOB 1UGOA 4ZZBA 1WCRA 3AE3A 3Q5XA 4O4HE 4N78D 4I0UA 3ETUA 4JI0T 4DV4T 4KX6A 2DWGA 1YXRA 4JI2T 4EYUA 3J7Yq 3ETVA 2Q9QC 4OYKA 2XASB 2DWKA 4TWFA 2KMFA 2WBLA 1ZHCA 2XAFB 4WNKA 5F3JA 5HWYA 3N9MA 3AA6B 3EHZA 5FKYA 2CM0A 2I6HA 4UXNB 4NPPA 5IWAT 2LRKA 1KFYA 3FZLB 4O2AE 3FB2A 4ZI7E 2K3WA 2K9AA 2OA5A 1FMWA 2YOEA 4CI3B 1VCTA 3AECA 4AKHA 2OLTA 4QXCB 2XAGB 2MTQA 4AKGA 2B76A 3L39A 2PG8A 4PNIA 2VKOA 3FHNA 3BQKA 3I9YA 4B3MT 1SA0E 3OPCA 2KLQA 4YHJA 2ZM0A 3IEEA 4XBFB 4ADZA 2CA5A 2RA1A 5E0OA 2ACXA 5JTGA 4PK6A 1LKXA 3PUXF 3KVBA 5JR9A 1UUSA 2KWHA 2AXDS 2VURA 4GKJT 4YHHT 5H6QB 4UF0B 4AQFA 5FXVA 2BG9B 2BS2A 5L3EB 2LSGA 4LMLA 4LF9T 1HTJF 3AAEB 3AEEA 2CWOA 5H6RB 4DIDB 3C4XA 5ABHA 2V1DB 1KK7A 5HYAA 3PV0F 3CQXC 4TN7B 3TLUA 1BR1A 5LGNB 2EHOC 2N9DA 4JLEA 4IDNA 3OYXA 2NTXA 4GK5E 2QYWA 2UXXB 1WR0A 3HKCE 5HAXA 1W0AA 4ZI2C 2XQ5A 3MKDA 2CE7A 2X9XA 2L8KA 3PUVF 2A3DA 5LYJE 2P9BA 2XQ9A 4IE0A 1OEDA 5LMNT 4GYSA 2VWAA 3RC3A 5LXTE 2LHNA 1IJ5A 5J0ZA 3O4XE 1HNWT 2BBHA 2C5KT 3VKHA 2XJ7A 3PTRB 2CXFA 3UQ4A 5LJNA 4YSXA 2I0MA 3J9X1 2X9HA 2X51A 3UUMA 3RKGA 3AA0B 3I0QA 3FZKB 5JDLA 5CB4E 3UFGA 4X5TA 3Q2MA 5LNKA 2YU1A 4COFA 4TUYE 5AQNB 4HFIA 3MACA 1MNDA 2PBIA 3C98B 4G2AA 4HFBA 2X9YA 3QB5A 3H37A 3KV4A 4HFCA 1MIVA 3PUSA 2W67A 2X68A 2H88A 3JC6D 5AQHB 3UULA 3JAEA 5CA1E 2CBIA 3MJXA 2BDEA 3RX6A 3ZT6A 1MMNA 5IHYA 4IDZA 3NVOA 4FI5A 1YQ3A 4OHFA 1WYBA 2A72A 1WYCA 1HX8A 1SUMB 3UUBA 4P0BA 5M4YA 1MMAA 1WR6A 4JI4T 3K3OA 3PUQA 2G0UA 4P0AA 4AIUA 4MHCA 3JCFA 1L0VA 4A97A 2W61A 5LGUB 4HWCA 3KINB 2BKOA 3UQ7A 4HN9A 3GN5A 3KDSE 1B7TA 5L4HA 2KINB 2FBWA 4IE4A 2NW7A 2Y48B 4IE7A 2WCAA 3FBLA 4AKLA 4GYRA 5DJQC 3M3ZB 3LFMA 5HCMA 5LHGB 2LE8A 3CIRA 5AQRB 5IUXA 5JRCB 3RIUA 3CPZA 4X1IE 2FJAA 3UUXB 4EOZB 2VK9A 1HF8A 2Y8DA 5ETWA 1T98A 1X9BA 2XQYA 3UU5A 5L3CB 4CXYA 3O1IA 5F5WA 4X65T 1HG5A 2KZ7B 2WDQA 1IJ6A 1HX1B 5EZYE 1E7PA 3E08A 1GQEA 4ASKA 2XM2A 3RH3A 4GK0E 1OEDE 4QXHB 4O8SA 2WMNA 2V7IA 2LOPA 2HPJA 2LOSA 3AXJB 4UVAB 5AQKB 3C51A 1HFAA 3Q5DA 1T72A 2YDRA 4A98A 2UXBT 4DV6T 5FL1A 3L3PA 1KNPA 3WAJA 2DNXA 3JAFA 4MFRA 1FMVA 2V26A 3C4WA 3RRWA 2CPTA 1X79A 2XAQB 3Q9DA 1UCUA 4KBMB 4IIJE 3LBXA 5LBQB 5AQGB 3UU8A 3RI5A 5JDFA 4ZEYA 2IC9A 3EUHA 4U7YA 2KXPB 2ZMAA 4Z90A 5KMGP 3RHWA 2XQ8A 4YXDA 2V5DA 3LK3B 4YTMA 2MBGA 3ZMVB 2VL8A 1KF6A 1E1HB 5AQLB 3Q5EA 1UX5A 3UUNA 3EDVA 4DR2T 3LJCA 3N9PA 3VU7H 5AQMB 4IL4A 4H9RC 4I50E 4B3ST 3P4SA 4PW8A 5LCYA 1IAPA 2WQYA 2LM2A 5LJMA 4IT4A 2BG9C 3I0OA 4HFHA 1JNZA 5FYMA 2V6YA 3RIAA 5L4EA 5CFBA 3VHLA 1MMGA 1H7CA 1UK5A 4U72A 3U3IA 4DV0T 3AE4A 3ZLIA 1HNXT 1O3XA 4ISTA 2Z6EA 2JQ9A 4EXTA 2KNDA 5FL0A 3AE1A 3KBUA 2K5BB 3QC9A 5HCJA 2E9XA 2M6IA 1MMDA 4KMCA 4EAHA 2XQ4A 3A7MA 2HPLA 3N9OA 1ZKEA 1WLXA 3I9WA 1LVKA 1WRDA 4HFEA 4HWIB 3AEFA 4DR1T 1N34T 2NWBA 3ZYKA 3NKZA 1OWAA 4JV5T 5HXSA 1IBLT 2PFVA 4UV9B 4JEHB 4F8HA 2UUBT 5FXWA 4Z91A 2A9UA 2BS4A 1CUNA 4UEMA 2NW8A 2VL0A 1N33T 4EB6E 3ANWA 5J2TE 3PU3A 5KX5E 3HR0A 4OK0A 3F2EA 4MALA 4ILUA 3ZT7A 4L5GA 1S35A 5ABGA 3I1AA 1WFDA 4CN4A 3QK6A 4J2CA 3ZMUB 3PUAA 4O4JE 5EK2A 2VQFT 2XAJB 3C64A 2CMRA 2IW5B 3H3MA 5JQGE 1DU2A 1KEYA 2JQQA 4LF6T 5CJ5A 1MNEA 4EEDA 3NZQA 4JI3T 2Q9QA 2X66A 3HKEE 2NW9A 3HI2A 4UR9A 3SWHA 2XQ7A 4E7ZA 2WU5A 2IMLA 2YEVC 3RGLA 4OFZA 3AE9A 5FXXA 2K48A 2CWYA 4YSYA 3UU3A 2YU2A 4ZS2A 1OXZA 4YTPA 4DVDA 2LKGA 2CXDA 2CHNA 2D0UA 1G73A 2XY8B 2H89A 2WAUA 2YKSA 2XQAA 3U78A 4IDQA 4WBNE 3QOFA 3F31A 3FXDB 4TX5A 5AQJB 1N36T 4LF5T 5LHIB 4KI0F 1VRBA 5L47A 1M7KA 2NR4A 1Y64B 4U33A 3CQCB 1IZNB 1U5PA 2E8IA 2IAKA 4HFDA 4ZXLA 3RC8A 1XDPA 3AAAB 4KHZF 2E5VA 5LB7B 4WYVA 4LFAT 3P4WA 4BAYB 4DBRA 3MA9A 2C0SA 3QB5K 2J62A 4ILBA 3X1DA 1NWMX 4U74A 1LVFA 4GOUA 4TV9E 3NWIA 3IBPA 5AQPB 4TWHA 4EYYR 5LGTB 2CHOA 2RPAA 2M67A 2YDQA 2BBJA 1D1AA 4QH5A 1W09A 1W9RA 1J5ET 4PFPA 4ZOLE 4DR6T 3PE0A 4U31A 4BA9A 2BVLA 2I59A 2E9XD 3ESLA 3RYCE 1HS7A 4PJMA 5A1LA 3UT5E 4LF8T 4ISSA 1S94A 5JDNA 2EHOA 3OJAA 1EZ3A 2D5UA 5L2LA 4EEBA 2DL1A 3EDUA 2PTFA 4QH1A 1US7B 3WI3A 2ZM2A 4CN1A 2UXNB 4JI5T 3OBVE 5JR9B 3B5MA 2WWVA 4QX8B 2XPKA 2NTYA 3P8CD 5AQIB 5CGMA 2HHHT 4JEUB 1J1JA 2W00A 3ABVA 5HEGA 2LKHA 5JDQA 4ERRA 2R6GF 5HEOA 4L9IA 4F6RC 3UU6A 3AE6A 2CCQA 3K3QC 2X0YA 5HEJA 5DQVA 4EV6A 4TWDA 2VVSA 3RKOA 5AQTB 3AEAA 3ZCIA 4OYJA 3H3AA 5KDMC 2HH7A 1N32T 2LSIA 3W15B 1YD8G 3ZJ2A 5C3JA 1SHZC 4PAGA 3TLTA 1QLBA 4X66T 4WZXA 3TLVA 4DMVA 2W4XA 4DR7T 2Q9QD 4DV7T 3MZKB 2MYSA 5JH7E 2WS3A 3O1HA 4X1YE 4MLKA 3CX8B 5HXHA 1Y01A 4HGAA 4DR3T 2AE9A 2J47A 1SE7A 4LF4T 3L09A 3K3NA 5JREA 3PJAA 3GWHA 3E0ZA 1D0ZA 4DV5T 4JI8T 5EK4A 2XQ3A 3FZFB 4LFBT 4H9QC 4P09A 5L3GB 4NIQA 2X9WA 4JI1T 4JBWF 2NP9A 4V1Av 3ZN1B 4GIWA 2X0HA 2V8SV 2V6XA 3G06A 3NRYA 4LF7T 4QHOA 3P50A 2H7VC 2V7KA 4I43B 5J2UE 3RIFA
chains in the Genus database with same CATH topology
2DLRA 4EAHA 3SS1A 2HPLA 3N9OA 3RPUA 3ZMTB 5H6QB 2X67A 1ZKEA 4UF0B 1WLXA 2DCFA 3RYHE 3I9WA 1LVKA 2BVMA 2YINA 4AQFA 1WRDA 5FXVA 3KV9A 3LK42 5L3EB 3PU8A 4H9OC 2XUEA 2LSGA 4A56A 5FY7A 1ZV4X 5CA0E 2KT9A 3PURA 1HTJF 3AAEB 4TZ4C 3AVSA 4DMWA 2CWOA 4BJNA 4UVBB 5H6RB 1ZEEA 4CXWA 2YK0A 3C4XA 2NWBA 3ZYKA 2V1DB 1OWAA 3SOLA 1KK7A 3HKDE 4H63H 3OYZA 5HYAA 1D0YA 5HXSA 3CQGB 4O4LE 2PFVA 3CX6B 4UV9B 3CQXC 4JEHB 4TN7B 1BR1A 2QA7A 2PJQA 4UVCB 2EHOC 5FXZA 2N9DA 5LGNB 4JLEA 5FXWA 5FY1A 3C50A 4H9PC 1CUNA 3GN5B 4UEMA 2NW8A 2ZM8A 2VB6A 3ZMSB 4EB6E 3OYXA 4CQIA 2ZLYA 3ANWA 1NAFA 2NTXA 4PJLA 3ZC0A 5J2TE 3PU3A 4GK5E 4HKAA 3WAKA 2UXXB 2N1GA 5KX5E 3HR0A 3O1JA 4OK0A 3F2EA 3HKCE 3RRCA 3ZYMA 4MALA 2XHEB 5HAXA 4DBQA 4ILUA 5JDHA 3LK2B 3KBTA 4C90A 4ZI2C 2EHOD 3MKDA 4PK4A 2CE7A 4L5GA 3V5UA 1S35A 2X9XA 2L8KA 4I4TE 3I1AA 2A3DA 2H7OA 5LYJE 2P9BA 3TKLB 3SRZA 4IE0A 3MXZA 4ZS3A 1D0XA 3QK6A 4J2CA 4GYSA 4M1PA 4YJ3E 3ZMUB 2VWAA 3RC3A 3PUAA 4O4JE 5EK2A 4HEAA 3RYIE 2LHNA 5AFUL 2XAJB 3C64A 5LXTE 1IJ5A 4PFOA 3O4XE 2V7MA 2C5KT 3OKQA 2CMRA 2IW5B 3VKHA 4H9SE 3EVYA 2VASA 2WM9A 3DTOA 5JQGE 3HKBE 4ZI2D 3PTRB 2JQQA 4O4IE 5L3DB 2CXFA 3F57A 2LSKA 3LG7A 3E22E 1MNEA 5LJNA 5DABA 1YKEB 3CKDA 2EHOB 2CXLA 2LSYA 3NZQA 1QUUA 4CI2B 3J9X1 2X9HA 3KV6A 3MK7C 2X51A 3UUMA 3AA0B 2DI4A 2Q9QA 3JC6C 3I0QA 4AXPA 2X66A 3HKEE 2NW9A 3HI2A 4YLHA 5JDLA 5CB4E 3SWHA 4L0RA 3Q2MA 4E7ZA 5LNKA 3ZPOA 2YEVC 2XTLA 4OFZA 2YU1A 4G63A 4FJOA 4TUYE 3MACA 5FXXA 1MNDA 1HCIA 2PBIA 2K48A 3C98B 3CVRA 4G2AA 2CWYA 3HA4A 3KFWX 2X9YA 2CLYC 3H37A 3KV4A 1MIVA 3PUSA 4AI6A 2X68A 3JC6D 3UULA 2YU2A 4ZS2A 4HFVA 4AQGA 4XZCA 1OXZA 4ZI3C 4DVDA 5CA1E 2CXDA 2RP4A 1D1CA 2W0GA 2CEAA 2JMHA 1YW0A 3MJXA 3P7IA 2BDEA 2D0UA 4H9NC 1G73A 3RX6A 2VKJA 4WBOA 2V7JA 2JRKA 5FY0A 2BZBA 4BJMA 4DNDA 2WAUA 1MMNA 1BR4A 4IDZA 4FI5A 5IHYA 4UF0A 4OHFA 2ODVA 1WYBA 2LT3A 4E7SA 3IHRA 3U78A 3AB3B 4WBNE 2A72A 1WYCA 3F31A 3FXDB 4PJNA 1HX8A 4TX5A 4QXBB 3B57A 5TAOA 5LHIB 1AJ3A 4IGUA 1BR2A 1VRBA 3C4ZA 3D0TA 2WMOA 4CI1B 2KWIB 1Y64B 3N2KE 4P0BA 5M4YA 1MMAA 1WR6A 4I55E 3CQCB 3DP7A 1IZNB 3K3OA 2G0UA 1U5PA 2E8IA 2SPCA 2X0LB 2IAKA 3PUQA 4P0AA 4MHCA 1LRZA 1QSDA 2W61A 3RC8A 3AAAB 4HE8A 5LGUB 3KINB 5JVDE 3VKGA 5IYZE 5HXEA 3N2GE 4BAYB 4DBRA 4EIWA 2VKHA 3AAIA 5L3BB 3BQLA 3MA9A 2C0SA 4HN9A 4EZ4A 2C5IT 3ZMZB 3PDYA 3HL6A 3FXEB 1NWMX 3GN5A 4U74A 3KDSE 3R84B 3R6NA 1LVFA 2K24A 5LP6E 4GOUA 4TV9E 3GMIA 4B6XA 3GA8A 1B7TA 4MBQA 2LHRA 3IBPA 2J1DG 2KINB 4DO0A 4PK5A 2A2FX 3ZJ1A 4IE4A 4EYYR 5LGTB 2NW7A 2E9XC 2Y48B 4IE7A 5LA6E 3ZC1A 4ANJA 5JR9C 3FBLA 4AKLA 2M67A 3A5XA 4GYRA 1U4QA 5DJQC 1G8XA 1D1AA 3AVRA 3ZCJA 3LFMA 5LHGB 4KP3C 4AQFC 4PFPA 2LE8A 4ZOLE 3ZEFB 4KUMB 2D0TA 4H63V 3PE0A 5JRCB 3N2OA 4QX7B 4BA9A 3CPZA 4X1IE 3CWZB 5BMVE 3UUXB 2MOZA 4EOZB 2VK9A 1HF8A 2H3RA 2Y8DA 5ETWA 5HXCA 1T98A 4QWNB 2BVLA 2I59A 3N5LA 5HXRA 5FMNA 2E9XD 2XQYA 2V7LA 4XAXB 5FP3A 5L3CB 3ESLA 3RYCE 3UFEA 4CXYA 2D2SA 3O1IA 4EZHA 1HG5A 2KZ7B 5J1GA 1IJ6A 2JMKA 2W63A 1HS7A 5JDMA 3Q5WA 4PJMA 5EZYE 3E08A 3BQIA 4ASKA 5A1LA 1D1BA 3UT5E 2GK9A 4IHJE 4ISSA 4AKIA 1S94A 5JDNA 1HG2A 1UX4A 2EHOA 2XAHB 5F8PA 3OJAA 3RH3A 4TV8E 4NUUA 1EZ3A 2D5UA 3M65A 4GK0E 3T8OA 5L2LA 4X20E 3FBZA 4UIGA 4CXXA 3EDUA 4K0UA 4QXHB 4IE5A 4HTEA 3RYFE 1US7B 4IE6A 3WI3A 4O2BE 3O9XA 1YKHB 2ZM2A 4O8SA 4ZHQE 2C5JA 2UXNB 2WMNA 2V7IA 3IF8B 3OBVE 2E9XB 3PUGA 1BR0A 5JR9B 2LOPA 2HPJA 3QUJA 3V5SA 2LOSA 2ODUA 4UVAB 5ADXL 3C51A 4QX8B 1V9DA 1HFAA 4X1KE 2NTYA 3P8CD 3CX7B 2N2NA 4WW0A 2VKDA 3K8PC 4C91A 2WWUA 2L3LA 3L3PA 1Z0PA 3ONXA 2NOXA 4JEUB 5L3FB 2DNXA 3LBXB 4MFRA 3WAJA 1FMVA 2V26A 3C4WA 3KVAA 2LJLA 2QGSA 3RRWA 1MIWA 5C8YE 2W00A 1X79A 2XAQB 3Q9DA 5LOVE 1KNZA 5EK3A 5LBMA 4ZI3D 4AKRB 2WSSV 1UCUA 4KBMB 5JDQA 4IIJE 3LBXA 4ERRA 5LBQB 3ZN0B 5HWXA 2LSJA 3Q5XA 4L9IA 4O4HE 4N78D 4F6RC 3ETUA 5JDFA 1VOMA 2IC9A 3EUHA 2KXPB 2ZMAA 2CCQA 3K3QC 4UELA 2ES0A 2JPFA 2DWGA 5KMGP 5DQVA 3NBXX 3B13A 3LK3B 3RKOA 4EYUA 2MBGA 3ETVA 2CLYB 3ZMVB 3J7Yq 2Q9QC 4OYKA 2XASB 4YFSA 2DWKA 4JUYA 5FNVE 3ANWB 3ZCIA 2KMFA 4OYJA 2WBLA 2VL8A 3H3AA 4PJJA 4YJ2E 5KDMC 1ZHCA 2XAFB 2HH7A 1E1HB 4WNKA 5F3JA 2LSIA 5HWYA 1UX5A 3UUNA 2L9QA 3N9MA 3W15B 1YD8G 3ZJ2A 3EDVA 1SHZC 3AA6B 3LJCA 4PAGA 2CM0A 3N9PA 3VU7H 3DJBA 5DQWA 4DMVA 4UXNB 5JDGA 4H9RC 2Q9QD 3MZKB 2W62A 5LG4A 4Z8XA 4I50E 2IC6A 2MYSA 5JH7E 3O1HA 3FB2A 4O2AE 1MIYA 4PW8A 4X1YE 2K9AA 4ZI7E 2OA5A 1FMWA 5LCYA 2LEHA 1IAPA 4MLKA 4CI3B 4AKHA 2LM9A 4QXCB 3CX8B 5HXHA 2XAGB 5GONE 3S4UA 2MTQA 4AKGA 3N9LA 4HGAA 5LJMA 3BK9A 5JRCA 3L09A 3K3NA 2PG8A 3N9QA 4PNIA 2VKOA 3I0OA 5JREA 3FHNA 3GWHA 3BQKA 3E0ZA 1D0ZA 3I9YA 4QKNA 5EK4A 1SA0E 4H9QC 5FYMA 4NUVA 2Q9QB 3AA7B 4P09A 2KLQA 4YHJA 5L3GB 2B1EA 2X9WA 2ZM0A 3ZYLA 3CMLA 3N9NA 3VHLA 1MMGA 1H7CA 2DHRA 3IEEA 4U72A 1FIOA 4XBFB 2NP9A 3U3IA 4ADZA 3KV5A 2CA5A 3ZLIA 4V1Av 3AA1B 2JJ9A 4CZZB 1O3XA 3ZN1B 3UTKA 4GIWA 2RA1A 4ISTA 2Z6EA 4UV8B 4EXTA 5E0OA 2Y6XA 3NRYA 2ACXA 1FEWA 2KNDA 5LHHB 3KBUA 4QHOA 4PK6A 1LKXA 3NRXA 2H7VC 2K5BB 3QC9A 2E9XA 3NZPA 3KVBA 5JR9A 2V7KA 1MMDA 2KWHA 4KMCA 4I43B 5J2UE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QK6 A;  2C5J A;  4J2C A;  4CQI A;  1IJ6 A;  2CA5 A;  1ZKE A;  3FXD B;  3QUJ A;  1IJ5 A;  2MBG A;  2C5K T;  2IC6 A;  4L0R A;  2C5I T;  3FXE B;  3P7I A;  1LVF A;  2XTL A;  2KWI B;  4B6X A;  2X9X A;  3L3P A;  1Z0P A;  2X9W A;  2K48 A;  3N5L A;  2IC9 A;  2G0U A;  3TKL B;  3CVR A;  4DND A;  2X9Y A;  3CKD A;  4FI5 A;  4EYY R;  1LRZ A;  1QSD A;  3MXZ A;  2KWH A;  3S4U A;  1H7C A; 
#chains in the Genus database with same CATH topology
 2DLR A;  5ABF A;  3SS1 A;  3ZMT B;  4JI6 T;  4ILC A;  1XNQ T;  3AE8 A;  3RYH E;  2BVM A;  3KV9 A;  4IRE A;  3SFD A;  2BS3 A;  3LK4 2;  4H9O C;  2XUE A;  1XMO T;  4A56 A;  1ZV4 X;  5CA0 E;  3A8Y C;  3PUR A;  4TZ4 C;  3AVS A;  4EGW A;  4DMW A;  4BJN A;  3AED A;  2YK0 A;  3SOL A;  3HKD E;  3OYZ A;  1D0Y A;  1I6Z A;  3CX6 B;  2QA7 A;  2PJQ A;  5FXZ A;  5FY1 A;  3C50 A;  3GN5 B;  2ZM8 A;  4GKK T;  5FVL A;  4CQI A;  3PUZ F;  3TLS A;  4X64 T;  3SFE A;  4HKA A;  2N1G A;  3O1J A;  3ZYM A;  4DBQ A;  5JDH A;  3LK2 B;  3KBT A;  2EHO D;  4I4T E;  3AE5 A;  3ZT5 A;  2HN2 A;  3TKL B;  3MXZ A;  4ZS3 A;  4YJ3 E;  2QRX A;  3RYI E;  2V7M A;  3OKQ A;  4H9S E;  3RQW A;  2WM9 A;  4JI7 T;  3DTO A;  3HKB E;  4ZI2 D;  4LFC T;  4O4I E;  1J5W A;  3F57 A;  2LSK A;  3E22 E;  1UUR A;  3RQU A;  5DAB A;  1YKE B;  3CKD A;  2CXL A;  2LSY A;  3RLF F;  3KV6 A;  2DI4 A;  3JC6 C;  4AXP A;  1XDO A;  2D9D A;  4K0K T;  2IHR 1;  3ZPO A;  4G63 A;  1E2A A;  4FJO A;  1HCI A;  2XM1 A;  4HWD A;  3CVR A;  3HA4 A;  2JQK A;  2CLY C;  3TLW A;  4AI6 A;  3AEB A;  3P4Q A;  2UXD T;  4HFV A;  4AQG A;  5BR8 T;  4XZC A;  2RP4 A;  4LMJ A;  2W0G A;  2F4V T;  1YW0 A;  3P7I A;  2YDS A;  5FY0 A;  4BJM A;  1BR4 A;  4UF0 A;  2J4G A;  2BG9 A;  3AB3 B;  1NEK A;  3VRA A;  4QXB B;  3ZKR A;  4IGU A;  1BR2 A;  4U7I A;  2KWI B;  1CHU A;  4P1N A;  3T1Y T;  4I55 E;  2SPC A;  1LRZ A;  1QSD A;  2WU2 A;  5JVD E;  3VKG A;  5IYZ E;  5HXE A;  4TNV A;  2FJE A;  2VKH A;  2UU9 T;  5L3B B;  3BQL A;  4EZ4 A;  2C5I T;  3HL6 A;  4X62 T;  5HEH A;  3R84 B;  3R6N A;  2K24 A;  2UUA T;  4AIS A;  3FZH B;  3GMI A;  4Q25 A;  3GA8 A;  5C2T A;  4MBQ A;  2LHR A;  2J1D G;  4DO0 A;  1IBM T;  2A2F X;  3ZJ1 A;  5LA6 E;  5JR9 C;  3ZSS A;  3A5X A;  1U4Q A;  4U2Z A;  3AVR A;  3VR9 A;  4U2Y A;  2QVA A;  4AQF C;  4AQY T;  3ZEF B;  4KUM B;  2D0T A;  3N2O A;  3EAB A;  3FZM B;  3CWZ B;  2MOZ A;  1HR0 T;  4QWN B;  5FMN A;  5FP3 A;  3RF1 A;  4XAX B;  3UFE A;  2D2S A;  2V6Y B;  5J1G A;  3ONJ A;  4YTN A;  3PUY F;  1ZOY A;  2GK9 A;  4IHJ E;  4DV3 T;  5HEU A;  1HG2 A;  2XAH B;  3M65 A;  4QH4 A;  4X20 E;  4UIG A;  4IE5 A;  4HTE A;  4IE6 A;  3O9X A;  4O2B E;  1YKH B;  3IF8 B;  2E9X B;  3PUG A;  1BR0 A;  3V5S A;  4DR5 T;  1ZP0 A;  2ODU A;  5ADX L;  2XSA A;  4U3C A;  4X1K E;  2ACZ A;  3CX7 B;  2VKD A;  4C91 A;  5AQU B;  1Z0P A;  4TNW A;  2NOX A;  1R8I A;  5L3F B;  3KVA A;  2LJL A;  1MIW A;  2E5L T;  1OED C;  1KNZ A;  5EK3 A;  5LBM A;  2WZH A;  4ZI3 D;  4AKR B;  2WSS V;  3ZN0 B;  5HWX A;  2LSJ A;  2MPK A;  1VOM A;  2FJD A;  4IL9 A;  4UEL A;  2ES0 A;  2JPF A;  3NBX X;  3B13 A;  2CLY B;  3IA3 A;  2YN6 A;  4YFS A;  4JUY A;  5FNV E;  3ANW B;  3UU4 A;  4PJJ A;  4YJ2 E;  2BKN A;  1T7S A;  5ABE A;  1XMQ T;  1W0B A;  2BG9 E;  3EI0 A;  2L9Q A;  2IIU A;  2W66 A;  2XSB A;  3DJB A;  5DQW A;  5AQQ B;  5JDG A;  2WP9 A;  1XZY A;  2W62 A;  5LG4 A;  4Z8X A;  2IC6 A;  1MIY A;  4OX9 T;  2LEH A;  2LM9 A;  2M6B A;  5GON E;  3S4U A;  4YT0 A;  3N9L A;  3JAD A;  3LSV A;  3BK9 A;  1HNZ T;  5JRC A;  3N9Q A;  4LMK A;  4QKN A;  4NUV A;  2Q9Q B;  3AA7 B;  1XNR T;  2B1E A;  2XQ6 A;  3ZYL A;  3CML A;  3N9N A;  2DHR A;  1FIO A;  3KV5 A;  3AA1 B;  2JJ9 A;  4CZZ B;  1KNR A;  3ZST A;  3UTK A;  3T1H T;  4UV8 B;  2Y6X A;  1FEW A;  5LHH B;  2IDO B;  3NRX A;  3NZP A;  3AXJ A;  3RPU A;  4A5X A;  5AQV B;  2X67 A;  1YQ4 A;  2DCF A;  2WDR A;  2YIN A;  2ZM6 T;  3PU8 A;  2VQE T;  3PUW F;  4IDP A;  5FY7 A;  3RIU C;  2KT9 A;  3P4R A;  3PJA J;  2FJB A;  4UVB B;  1ZEE A;  4CXW A;  1XWM A;  5FVK A;  2WB5 A;  4H63 H;  3ONL C;  2VVN A;  3AE7 A;  3CQG B;  4O4L E;  4UVC B;  2KSR A;  3K1S A;  4H9P C;  2VB6 A;  4DR4 T;  3ZMS B;  2ZLY A;  1NAF A;  4PJL A;  4ZZC A;  3ZC0 A;  3WAK A;  3RRC A;  2XHE B;  1OED B;  4C90 A;  4PK4 A;  3V5U A;  5AQF B;  5LMU T;  2H7O A;  2JQH A;  3SRZ A;  1D0X A;  4M1P A;  3AEG A;  4HEA A;  5AFU L;  4PFO A;  4IDO A;  1M62 A;  1VCS A;  3EVY A;  2VAS A;  5L3D B;  1Z8U A;  3LG7 A;  2EHO B;  1QUU A;  4CI2 B;  4DV1 T;  3MK7 C;  4YLH A;  4L0R A;  2XTL A;  2HN1 A;  2WDV A;  3KFW X;  2BKP A;  4ZI3 C;  1D1C A;  2CEA A;  1I94 T;  2JMH A;  2E2A A;  4H9N C;  2VKJ A;  4WBO A;  2V7J A;  2JRK A;  4ILA A;  2BZB A;  4DND A;  4DV2 T;  2V5C A;  2LRL A;  2ODV A;  2LT3 A;  4E7S A;  3IHR A;  5KXJ A;  2XZE A;  1FJG T;  4PJN A;  3B57 A;  5TAO A;  1AJ3 A;  3D0T A;  3C4Z A;  4YSZ A;  2WMO A;  4CI1 B;  3N2K E;  2LLY A;  3DP7 A;  4HWF A;  2X0L B;  4HE8 A;  1T8B A;  4DUZ T;  3VR8 A;  4CN6 A;  3N2G E;  1IBK T;  4EIW A;  3AAI A;  2FUP A;  2OV9 A;  3PDY A;  3ZMZ B;  3FXE B;  5LP6 E;  4B6X A;  4JYA T;  4KHP T;  4PK5 A;  5AQS B;  3OVU A;  2E9X C;  3ZC1 A;  4ANJ A;  1JNR A;  3AE2 A;  4B3T T;  1G8X A;  3EAM A;  3ZCJ A;  4KP3 C;  2MAW A;  4H63 V;  4QX7 B;  5BMV E;  5LG3 A;  2H3R A;  5HXC A;  3OTO T;  3N5L A;  5HXR A;  2V7L A;  3LDQ B;  4NXM T;  4EZH A;  4DUY T;  2JMK A;  2W63 A;  4NXN T;  5JDM A;  3Q5W A;  4HWH A;  3BQI A;  1D1B A;  3QNU A;  4AKI A;  1UX4 A;  5F8P A;  3L8R A;  3T8O A;  4B3R T;  4TV8 E;  4NUU A;  3FBZ A;  3P4P A;  4CXX A;  4K0U A;  1NEN A;  3RYF E;  2WZI A;  4ZHQ E;  2C5J A;  2WY2 A;  3QUJ A;  5ABF B;  2UXC T;  2W2U A;  1V9D A;  3VRB A;  2JIW A;  2CBJ A;  4YY3 T;  2N2N A;  4WW0 A;  3K8P C;  2CRB A;  2WWU A;  2L3L A;  3ONX A;  3LBX B;  2IUB A;  2QGS A;  5C8Y E;  2UUC T;  5LOV E;  3CK6 A;  5AQO B;  1UGO A;  4ZZB A;  1WCR A;  3AE3 A;  3Q5X A;  4O4H E;  4N78 D;  4I0U A;  3ETU A;  4JI0 T;  4DV4 T;  4KX6 A;  2DWG A;  1YXR A;  4JI2 T;  4EYU A;  3J7Y q;  3ETV A;  2Q9Q C;  4OYK A;  2XAS B;  2DWK A;  4TWF A;  2KMF A;  2WBL A;  1ZHC A;  2XAF B;  4WNK A;  5F3J A;  5HWY A;  3N9M A;  3AA6 B;  3EHZ A;  5FKY A;  2CM0 A;  2I6H A;  4UXN B;  4NPP A;  5IWA T;  2LRK A;  1KFY A;  3FZL B;  4O2A E;  3FB2 A;  4ZI7 E;  2K3W A;  2K9A A;  2OA5 A;  1FMW A;  2YOE A;  4CI3 B;  1VCT A;  3AEC A;  4AKH A;  2OLT A;  4QXC B;  2XAG B;  2MTQ A;  4AKG A;  2B76 A;  3L39 A;  2PG8 A;  4PNI A;  2VKO A;  3FHN A;  3BQK A;  3I9Y A;  4B3M T;  1SA0 E;  3OPC A;  2KLQ A;  4YHJ A;  2ZM0 A;  3IEE A;  4XBF B;  4ADZ A;  2CA5 A;  2RA1 A;  5E0O A;  2ACX A;  5JTG A;  4PK6 A;  1LKX A;  3PUX F;  3KVB A;  5JR9 A;  1UUS A;  2KWH A;  2AXD S;  2VUR A;  4GKJ T;  4YHH T;  5H6Q B;  4UF0 B;  4AQF A;  5FXV A;  2BG9 B;  2BS2 A;  5L3E B;  2LSG A;  4LML A;  4LF9 T;  1HTJ F;  3AAE B;  3AEE A;  2CWO A;  5H6R B;  4DID B;  3C4X A;  5ABH A;  2V1D B;  1KK7 A;  5HYA A;  3PV0 F;  3CQX C;  4TN7 B;  3TLU A;  1BR1 A;  5LGN B;  2EHO C;  2N9D A;  4JLE A;  4IDN A;  3OYX A;  2NTX A;  4GK5 E;  2QYW A;  2UXX B;  1WR0 A;  3HKC E;  5HAX A;  1W0A A;  4ZI2 C;  2XQ5 A;  3MKD A;  2CE7 A;  2X9X A;  2L8K A;  3PUV F;  2A3D A;  5LYJ E;  2P9B A;  2XQ9 A;  4IE0 A;  1OED A;  5LMN T;  4GYS A;  2VWA A;  3RC3 A;  5LXT E;  2LHN A;  1IJ5 A;  5J0Z A;  3O4X E;  1HNW T;  2BBH A;  2C5K T;  3VKH A;  2XJ7 A;  3PTR B;  2CXF A;  3UQ4 A;  5LJN A;  4YSX A;  2I0M A;  3J9X 1;  2X9H A;  2X51 A;  3UUM A;  3RKG A;  3AA0 B;  3I0Q A;  3FZK B;  5JDL A;  5CB4 E;  3UFG A;  4X5T A;  3Q2M A;  5LNK A;  2YU1 A;  4COF A;  4TUY E;  5AQN B;  4HFI A;  3MAC A;  1MND A;  2PBI A;  3C98 B;  4G2A A;  4HFB A;  2X9Y A;  3QB5 A;  3H37 A;  3KV4 A;  4HFC A;  1MIV A;  3PUS A;  2W67 A;  2X68 A;  2H88 A;  3JC6 D;  5AQH B;  3UUL A;  3JAE A;  5CA1 E;  2CBI A;  3MJX A;  2BDE A;  3RX6 A;  3ZT6 A;  1MMN A;  5IHY A;  4IDZ A;  3NVO A;  4FI5 A;  1YQ3 A;  4OHF A;  1WYB A;  2A72 A;  1WYC A;  1HX8 A;  1SUM B;  3UUB A;  4P0B A;  5M4Y A;  1MMA A;  1WR6 A;  4JI4 T;  3K3O A;  3PUQ A;  2G0U A;  4P0A A;  4AIU A;  4MHC A;  3JCF A;  1L0V A;  4A97 A;  2W61 A;  5LGU B;  4HWC A;  3KIN B;  2BKO A;  3UQ7 A;  4HN9 A;  3GN5 A;  3KDS E;  1B7T A;  5L4H A;  2KIN B;  2FBW A;  4IE4 A;  2NW7 A;  2Y48 B;  4IE7 A;  2WCA A;  3FBL A;  4AKL A;  4GYR A;  5DJQ C;  3M3Z B;  3LFM A;  5HCM A;  5LHG B;  2LE8 A;  3CIR A;  5AQR B;  5IUX A;  5JRC B;  3RIU A;  3CPZ A;  4X1I E;  2FJA A;  3UUX B;  4EOZ B;  2VK9 A;  1HF8 A;  2Y8D A;  5ETW A;  1T98 A;  1X9B A;  2XQY A;  3UU5 A;  5L3C B;  4CXY A;  3O1I A;  5F5W A;  4X65 T;  1HG5 A;  2KZ7 B;  2WDQ A;  1IJ6 A;  1HX1 B;  5EZY E;  1E7P A;  3E08 A;  1GQE A;  4ASK A;  2XM2 A;  3RH3 A;  4GK0 E;  1OED E;  4QXH B;  4O8S A;  2WMN A;  2V7I A;  2LOP A;  2HPJ A;  2LOS A;  3AXJ B;  4UVA B;  5AQK B;  3C51 A;  1HFA A;  3Q5D A;  1T72 A;  2YDR A;  4A98 A;  2UXB T;  4DV6 T;  5FL1 A;  3L3P A;  1KNP A;  3WAJ A;  2DNX A;  3JAF A;  4MFR A;  1FMV A;  2V26 A;  3C4W A;  3RRW A;  2CPT A;  1X79 A;  2XAQ B;  3Q9D A;  1UCU A;  4KBM B;  4IIJ E;  3LBX A;  5LBQ B;  5AQG B;  3UU8 A;  3RI5 A;  5JDF A;  4ZEY A;  2IC9 A;  3EUH A;  4U7Y A;  2KXP B;  2ZMA A;  4Z90 A;  5KMG P;  3RHW A;  2XQ8 A;  4YXD A;  2V5D A;  3LK3 B;  4YTM A;  2MBG A;  3ZMV B;  2VL8 A;  1KF6 A;  1E1H B;  5AQL B;  3Q5E A;  1UX5 A;  3UUN A;  3EDV A;  4DR2 T;  3LJC A;  3N9P A;  3VU7 H;  5AQM B;  4IL4 A;  4H9R C;  4I50 E;  4B3S T;  3P4S A;  4PW8 A;  5LCY A;  1IAP A;  2WQY A;  2LM2 A;  5LJM A;  4IT4 A;  2BG9 C;  3I0O A;  4HFH A;  1JNZ A;  5FYM A;  2V6Y A;  3RIA A;  5L4E A;  5CFB A;  3VHL A;  1MMG A;  1H7C A;  1UK5 A;  4U72 A;  3U3I A;  4DV0 T;  3AE4 A;  3ZLI A;  1HNX T;  1O3X A;  4IST A;  2Z6E A;  2JQ9 A;  4EXT A;  2KND A;  5FL0 A;  3AE1 A;  3KBU A;  2K5B B;  3QC9 A;  5HCJ A;  2E9X A;  2M6I A;  1MMD A;  4KMC A;  4EAH A;  2XQ4 A;  3A7M A;  2HPL A;  3N9O A;  1ZKE A;  1WLX A;  3I9W A;  1LVK A;  1WRD A;  4HFE A;  4HWI B;  3AEF A;  4DR1 T;  1N34 T;  2NWB A;  3ZYK A;  3NKZ A;  1OWA A;  4JV5 T;  5HXS A;  1IBL T;  2PFV A;  4UV9 B;  4JEH B;  4F8H A;  2UUB T;  5FXW A;  4Z91 A;  2A9U A;  2BS4 A;  1CUN A;  4UEM A;  2NW8 A;  2VL0 A;  1N33 T;  4EB6 E;  3ANW A;  5J2T E;  3PU3 A;  5KX5 E;  3HR0 A;  4OK0 A;  3F2E A;  4MAL A;  4ILU A;  3ZT7 A;  4L5G A;  1S35 A;  5ABG A;  3I1A A;  1WFD A;  4CN4 A;  3QK6 A;  4J2C A;  3ZMU B;  3PUA A;  4O4J E;  5EK2 A;  2VQF T;  2XAJ B;  3C64 A;  2CMR A;  2IW5 B;  3H3M A;  5JQG E;  1DU2 A;  1KEY A;  2JQQ A;  4LF6 T;  5CJ5 A;  1MNE A;  4EED A;  3NZQ A;  4JI3 T;  2Q9Q A;  2X66 A;  3HKE E;  2NW9 A;  3HI2 A;  4UR9 A;  3SWH A;  2XQ7 A;  4E7Z A;  2WU5 A;  2IML A;  2YEV C;  3RGL A;  4OFZ A;  3AE9 A;  5FXX A;  2K48 A;  2CWY A;  4YSY A;  3UU3 A;  2YU2 A;  4ZS2 A;  1OXZ A;  4YTP A;  4DVD A;  2LKG A;  2CXD A;  2CHN A;  2D0U A;  1G73 A;  2XY8 B;  2H89 A;  2WAU A;  2YKS A;  2XQA A;  3U78 A;  4IDQ A;  4WBN E;  3QOF A;  3F31 A;  3FXD B;  4TX5 A;  5AQJ B;  1N36 T;  4LF5 T;  5LHI B;  4KI0 F;  1VRB A;  5L47 A;  1M7K A;  2NR4 A;  1Y64 B;  4U33 A;  3CQC B;  1IZN B;  1U5P A;  2E8I A;  2IAK A;  4HFD A;  4ZXL A;  3RC8 A;  1XDP A;  3AAA B;  4KHZ F;  2E5V A;  5LB7 B;  4WYV A;  4LFA T;  3P4W A;  4BAY B;  4DBR A;  3MA9 A;  2C0S A;  3QB5 K;  2J62 A;  4ILB A;  3X1D A;  1NWM X;  4U74 A;  1LVF A;  4GOU A;  4TV9 E;  3NWI A;  3IBP A;  5AQP B;  4TWH A;  4EYY R;  5LGT B;  2CHO A;  2RPA A;  2M67 A;  2YDQ A;  2BBJ A;  1D1A A;  4QH5 A;  1W09 A;  1W9R A;  1J5E T;  4PFP A;  4ZOL E;  4DR6 T;  3PE0 A;  4U31 A;  4BA9 A;  2BVL A;  2I59 A;  2E9X D;  3ESL A;  3RYC E;  1HS7 A;  4PJM A;  5A1L A;  3UT5 E;  4LF8 T;  4ISS A;  1S94 A;  5JDN A;  2EHO A;  3OJA A;  1EZ3 A;  2D5U A;  5L2L A;  4EEB A;  2DL1 A;  3EDU A;  2PTF A;  4QH1 A;  1US7 B;  3WI3 A;  2ZM2 A;  4CN1 A;  2UXN B;  4JI5 T;  3OBV E;  5JR9 B;  3B5M A;  2WWV A;  4QX8 B;  2XPK A;  2NTY A;  3P8C D;  5AQI B;  5CGM A;  2HHH T;  4JEU B;  1J1J A;  2W00 A;  3ABV A;  5HEG A;  2LKH A;  5JDQ A;  4ERR A;  2R6G F;  5HEO A;  4L9I A;  4F6R C;  3UU6 A;  3AE6 A;  2CCQ A;  3K3Q C;  2X0Y A;  5HEJ A;  5DQV A;  4EV6 A;  4TWD A;  2VVS A;  3RKO A;  5AQT B;  3AEA A;  3ZCI A;  4OYJ A;  3H3A A;  5KDM C;  2HH7 A;  1N32 T;  2LSI A;  3W15 B;  1YD8 G;  3ZJ2 A;  5C3J A;  1SHZ C;  4PAG A;  3TLT A;  1QLB A;  4X66 T;  4WZX A;  3TLV A;  4DMV A;  2W4X A;  4DR7 T;  2Q9Q D;  4DV7 T;  3MZK B;  2MYS A;  5JH7 E;  2WS3 A;  3O1H A;  4X1Y E;  4MLK A;  3CX8 B;  5HXH A;  1Y01 A;  4HGA A;  4DR3 T;  2AE9 A;  2J47 A;  1SE7 A;  4LF4 T;  3L09 A;  3K3N A;  5JRE A;  3PJA A;  3GWH A;  3E0Z A;  1D0Z A;  4DV5 T;  4JI8 T;  5EK4 A;  2XQ3 A;  3FZF B;  4LFB T;  4H9Q C;  4P09 A;  5L3G B;  4NIQ A;  2X9W A;  4JI1 T;  4JBW F;  2NP9 A;  4V1A v;  3ZN1 B;  4GIW A;  2X0H A;  2V8S V;  2V6X A;  3G06 A;  3NRY A;  4LF7 T;  4QHO A;  3P50 A;  2H7V C;  2V7K A;  4I43 B;  5J2U E;  3RIF A; 
#chains in the Genus database with same CATH homology
 2DLR A;  4EAH A;  3SS1 A;  2HPL A;  3N9O A;  3RPU A;  3ZMT B;  5H6Q B;  2X67 A;  1ZKE A;  4UF0 B;  1WLX A;  2DCF A;  3RYH E;  3I9W A;  1LVK A;  2BVM A;  2YIN A;  4AQF A;  1WRD A;  5FXV A;  3KV9 A;  3LK4 2;  5L3E B;  3PU8 A;  4H9O C;  2XUE A;  2LSG A;  4A56 A;  5FY7 A;  1ZV4 X;  5CA0 E;  2KT9 A;  3PUR A;  1HTJ F;  3AAE B;  4TZ4 C;  3AVS A;  4DMW A;  2CWO A;  4BJN A;  4UVB B;  5H6R B;  1ZEE A;  4CXW A;  2YK0 A;  3C4X A;  2NWB A;  3ZYK A;  2V1D B;  1OWA A;  3SOL A;  1KK7 A;  3HKD E;  4H63 H;  3OYZ A;  5HYA A;  1D0Y A;  5HXS A;  3CQG B;  4O4L E;  2PFV A;  3CX6 B;  4UV9 B;  3CQX C;  4JEH B;  4TN7 B;  1BR1 A;  2QA7 A;  2PJQ A;  4UVC B;  2EHO C;  5FXZ A;  2N9D A;  5LGN B;  4JLE A;  5FXW A;  5FY1 A;  3C50 A;  4H9P C;  1CUN A;  3GN5 B;  4UEM A;  2NW8 A;  2ZM8 A;  2VB6 A;  3ZMS B;  4EB6 E;  3OYX A;  4CQI A;  2ZLY A;  3ANW A;  1NAF A;  2NTX A;  4PJL A;  3ZC0 A;  5J2T E;  3PU3 A;  4GK5 E;  4HKA A;  3WAK A;  2UXX B;  2N1G A;  5KX5 E;  3HR0 A;  3O1J A;  4OK0 A;  3F2E A;  3HKC E;  3RRC A;  3ZYM A;  4MAL A;  2XHE B;  5HAX A;  4DBQ A;  4ILU A;  5JDH A;  3LK2 B;  3KBT A;  4C90 A;  4ZI2 C;  2EHO D;  3MKD A;  4PK4 A;  2CE7 A;  4L5G A;  3V5U A;  1S35 A;  2X9X A;  2L8K A;  4I4T E;  3I1A A;  2A3D A;  2H7O A;  5LYJ E;  2P9B A;  3TKL B;  3SRZ A;  4IE0 A;  3MXZ A;  4ZS3 A;  1D0X A;  3QK6 A;  4J2C A;  4GYS A;  4M1P A;  4YJ3 E;  3ZMU B;  2VWA A;  3RC3 A;  3PUA A;  4O4J E;  5EK2 A;  4HEA A;  3RYI E;  2LHN A;  5AFU L;  2XAJ B;  3C64 A;  5LXT E;  1IJ5 A;  4PFO A;  3O4X E;  2V7M A;  2C5K T;  3OKQ A;  2CMR A;  2IW5 B;  3VKH A;  4H9S E;  3EVY A;  2VAS A;  2WM9 A;  3DTO A;  5JQG E;  3HKB E;  4ZI2 D;  3PTR B;  2JQQ A;  4O4I E;  5L3D B;  2CXF A;  3F57 A;  2LSK A;  3LG7 A;  3E22 E;  1MNE A;  5LJN A;  5DAB A;  1YKE B;  3CKD A;  2EHO B;  2CXL A;  2LSY A;  3NZQ A;  1QUU A;  4CI2 B;  3J9X 1;  2X9H A;  3KV6 A;  3MK7 C;  2X51 A;  3UUM A;  3AA0 B;  2DI4 A;  2Q9Q A;  3JC6 C;  3I0Q A;  4AXP A;  2X66 A;  3HKE E;  2NW9 A;  3HI2 A;  4YLH A;  5JDL A;  5CB4 E;  3SWH A;  4L0R A;  3Q2M A;  4E7Z A;  5LNK A;  3ZPO A;  2YEV C;  2XTL A;  4OFZ A;  2YU1 A;  4G63 A;  4FJO A;  4TUY E;  3MAC A;  5FXX A;  1MND A;  1HCI A;  2PBI A;  2K48 A;  3C98 B;  3CVR A;  4G2A A;  2CWY A;  3HA4 A;  3KFW X;  2X9Y A;  2CLY C;  3H37 A;  3KV4 A;  1MIV A;  3PUS A;  4AI6 A;  2X68 A;  3JC6 D;  3UUL A;  2YU2 A;  4ZS2 A;  4HFV A;  4AQG A;  4XZC A;  1OXZ A;  4ZI3 C;  4DVD A;  5CA1 E;  2CXD A;  2RP4 A;  1D1C A;  2W0G A;  2CEA A;  2JMH A;  1YW0 A;  3MJX A;  3P7I A;  2BDE A;  2D0U A;  4H9N C;  1G73 A;  3RX6 A;  2VKJ A;  4WBO A;  2V7J A;  2JRK A;  5FY0 A;  2BZB A;  4BJM A;  4DND A;  2WAU A;  1MMN A;  1BR4 A;  4IDZ A;  4FI5 A;  5IHY A;  4UF0 A;  4OHF A;  2ODV A;  1WYB A;  2LT3 A;  4E7S A;  3IHR A;  3U78 A;  3AB3 B;  4WBN E;  2A72 A;  1WYC A;  3F31 A;  3FXD B;  4PJN A;  1HX8 A;  4TX5 A;  4QXB B;  3B57 A;  5TAO A;  5LHI B;  1AJ3 A;  4IGU A;  1BR2 A;  1VRB A;  3C4Z A;  3D0T A;  2WMO A;  4CI1 B;  2KWI B;  1Y64 B;  3N2K E;  4P0B A;  5M4Y A;  1MMA A;  1WR6 A;  4I55 E;  3CQC B;  3DP7 A;  1IZN B;  3K3O A;  2G0U A;  1U5P A;  2E8I A;  2SPC A;  2X0L B;  2IAK A;  3PUQ A;  4P0A A;  4MHC A;  1LRZ A;  1QSD A;  2W61 A;  3RC8 A;  3AAA B;  4HE8 A;  5LGU B;  3KIN B;  5JVD E;  3VKG A;  5IYZ E;  5HXE A;  3N2G E;  4BAY B;  4DBR A;  4EIW A;  2VKH A;  3AAI A;  5L3B B;  3BQL A;  3MA9 A;  2C0S A;  4HN9 A;  4EZ4 A;  2C5I T;  3ZMZ B;  3PDY A;  3HL6 A;  3FXE B;  1NWM X;  3GN5 A;  4U74 A;  3KDS E;  3R84 B;  3R6N A;  1LVF A;  2K24 A;  5LP6 E;  4GOU A;  4TV9 E;  3GMI A;  4B6X A;  3GA8 A;  1B7T A;  4MBQ A;  2LHR A;  3IBP A;  2J1D G;  2KIN B;  4DO0 A;  4PK5 A;  2A2F X;  3ZJ1 A;  4IE4 A;  4EYY R;  5LGT B;  2NW7 A;  2E9X C;  2Y48 B;  4IE7 A;  5LA6 E;  3ZC1 A;  4ANJ A;  5JR9 C;  3FBL A;  4AKL A;  2M67 A;  3A5X A;  4GYR A;  1U4Q A;  5DJQ C;  1G8X A;  1D1A A;  3AVR A;  3ZCJ A;  3LFM A;  5LHG B;  4KP3 C;  4AQF C;  4PFP A;  2LE8 A;  4ZOL E;  3ZEF B;  4KUM B;  2D0T A;  4H63 V;  3PE0 A;  5JRC B;  3N2O A;  4QX7 B;  4BA9 A;  3CPZ A;  4X1I E;  3CWZ B;  5BMV E;  3UUX B;  2MOZ A;  4EOZ B;  2VK9 A;  1HF8 A;  2H3R A;  2Y8D A;  5ETW A;  5HXC A;  1T98 A;  4QWN B;  2BVL A;  2I59 A;  3N5L A;  5HXR A;  5FMN A;  2E9X D;  2XQY A;  2V7L A;  4XAX B;  5FP3 A;  5L3C B;  3ESL A;  3RYC E;  3UFE A;  4CXY A;  2D2S A;  3O1I A;  4EZH A;  1HG5 A;  2KZ7 B;  5J1G A;  1IJ6 A;  2JMK A;  2W63 A;  1HS7 A;  5JDM A;  3Q5W A;  4PJM A;  5EZY E;  3E08 A;  3BQI A;  4ASK A;  5A1L A;  1D1B A;  3UT5 E;  2GK9 A;  4IHJ E;  4ISS A;  4AKI A;  1S94 A;  5JDN A;  1HG2 A;  1UX4 A;  2EHO A;  2XAH B;  5F8P A;  3OJA A;  3RH3 A;  4TV8 E;  4NUU A;  1EZ3 A;  2D5U A;  3M65 A;  4GK0 E;  3T8O A;  5L2L A;  4X20 E;  3FBZ A;  4UIG A;  4CXX A;  3EDU A;  4K0U A;  4QXH B;  4IE5 A;  4HTE A;  3RYF E;  1US7 B;  4IE6 A;  3WI3 A;  4O2B E;  3O9X A;  1YKH B;  2ZM2 A;  4O8S A;  4ZHQ E;  2C5J A;  2UXN B;  2WMN A;  2V7I A;  3IF8 B;  3OBV E;  2E9X B;  3PUG A;  1BR0 A;  5JR9 B;  2LOP A;  2HPJ A;  3QUJ A;  3V5S A;  2LOS A;  2ODU A;  4UVA B;  5ADX L;  3C51 A;  4QX8 B;  1V9D A;  1HFA A;  4X1K E;  2NTY A;  3P8C D;  3CX7 B;  2N2N A;  4WW0 A;  2VKD A;  3K8P C;  4C91 A;  2WWU A;  2L3L A;  3L3P A;  1Z0P A;  3ONX A;  2NOX A;  4JEU B;  5L3F B;  2DNX A;  3LBX B;  4MFR A;  3WAJ A;  1FMV A;  2V26 A;  3C4W A;  3KVA A;  2LJL A;  2QGS A;  3RRW A;  1MIW A;  5C8Y E;  2W00 A;  1X79 A;  2XAQ B;  3Q9D A;  5LOV E;  1KNZ A;  5EK3 A;  5LBM A;  4ZI3 D;  4AKR B;  2WSS V;  1UCU A;  4KBM B;  5JDQ A;  4IIJ E;  3LBX A;  4ERR A;  5LBQ B;  3ZN0 B;  5HWX A;  2LSJ A;  3Q5X A;  4L9I A;  4O4H E;  4N78 D;  4F6R C;  3ETU A;  5JDF A;  1VOM A;  2IC9 A;  3EUH A;  2KXP B;  2ZMA A;  2CCQ A;  3K3Q C;  4UEL A;  2ES0 A;  2JPF A;  2DWG A;  5KMG P;  5DQV A;  3NBX X;  3B13 A;  3LK3 B;  3RKO A;  4EYU A;  2MBG A;  3ETV A;  2CLY B;  3ZMV B;  3J7Y q;  2Q9Q C;  4OYK A;  2XAS B;  4YFS A;  2DWK A;  4JUY A;  5FNV E;  3ANW B;  3ZCI A;  2KMF A;  4OYJ A;  2WBL A;  2VL8 A;  3H3A A;  4PJJ A;  4YJ2 E;  5KDM C;  1ZHC A;  2XAF B;  2HH7 A;  1E1H B;  4WNK A;  5F3J A;  2LSI A;  5HWY A;  1UX5 A;  3UUN A;  2L9Q A;  3N9M A;  3W15 B;  1YD8 G;  3ZJ2 A;  3EDV A;  1SHZ C;  3AA6 B;  3LJC A;  4PAG A;  2CM0 A;  3N9P A;  3VU7 H;  3DJB A;  5DQW A;  4DMV A;  4UXN B;  5JDG A;  4H9R C;  2Q9Q D;  3MZK B;  2W62 A;  5LG4 A;  4Z8X A;  4I50 E;  2IC6 A;  2MYS A;  5JH7 E;  3O1H A;  3FB2 A;  4O2A E;  1MIY A;  4PW8 A;  4X1Y E;  2K9A A;  4ZI7 E;  2OA5 A;  1FMW A;  5LCY A;  2LEH A;  1IAP A;  4MLK A;  4CI3 B;  4AKH A;  2LM9 A;  4QXC B;  3CX8 B;  5HXH A;  2XAG B;  5GON E;  3S4U A;  2MTQ A;  4AKG A;  3N9L A;  4HGA A;  5LJM A;  3BK9 A;  5JRC A;  3L09 A;  3K3N A;  2PG8 A;  3N9Q A;  4PNI A;  2VKO A;  3I0O A;  5JRE A;  3FHN A;  3GWH A;  3BQK A;  3E0Z A;  1D0Z A;  3I9Y A;  4QKN A;  5EK4 A;  1SA0 E;  4H9Q C;  5FYM A;  4NUV A;  2Q9Q B;  3AA7 B;  4P09 A;  2KLQ A;  4YHJ A;  5L3G B;  2B1E A;  2X9W A;  2ZM0 A;  3ZYL A;  3CML A;  3N9N A;  3VHL A;  1MMG A;  1H7C A;  2DHR A;  3IEE A;  4U72 A;  1FIO A;  4XBF B;  2NP9 A;  3U3I A;  4ADZ A;  3KV5 A;  2CA5 A;  3ZLI A;  4V1A v;  3AA1 B;  2JJ9 A;  4CZZ B;  1O3X A;  3ZN1 B;  3UTK A;  4GIW A;  2RA1 A;  4IST A;  2Z6E A;  4UV8 B;  4EXT A;  5E0O A;  2Y6X A;  3NRY A;  2ACX A;  1FEW A;  2KND A;  5LHH B;  3KBU A;  4QHO A;  4PK6 A;  1LKX A;  3NRX A;  2H7V C;  2K5B B;  3QC9 A;  2E9X A;  3NZP A;  3KVB A;  5JR9 A;  2V7K A;  1MMD A;  2KWH A;  4KMC A;  4I43 B;  5J2U E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...