5AQSB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
LGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 44
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqsB00
1M62A 1UGOA 5AQNB 3FZLB 3A8YC 4HWFA 5AQPB 4HWCA 1HX1B 5AQTB 3FZHB 3FZFB 3M3ZB 5AQSB 5AQVB 5AQOB 5AQJB 1I6ZA 4HWIB 5AQFB 5AQGB 5AQKB 4HWDA 5AQQB 4HWHA 5AQIB 5AQUB 5AQHB 3FZKB 5AQRB 5AQLB 1UK5A 2D9DA 1M7KA 1T7SA 5AQMB 3FZMB 3LDQB
chains in the Genus database with same CATH superfamily
4MFRA 4IE0A 2HHHT 4PK4A 5TAOA 1UUSA 3KVBA 4X1KE 4GKKT 2P9BA 4ZI3D 4F6RC 3U78A 2RPAA 1OEDB 2D0TA 5DABA 3ZMVB 5LG3A 1T7SA 2LEHA 4AKIA 1HNXT 1W9RA 3PUXF 1MIVA 2LHNA 4FJOA 5LOVE 2BG9E 2HPLA 5HEOA 3C4XA 3AXJB 3JADA 5FMNA 5JR9A 4TWHA 3UU5A 3RGLA 2JRKA 3HR0A 1OWAA 4ILUA 4I55E 2XM2A 5ABFB 4AKGA 3CX7B 4GOUA 4IE6A 2M6BA 5H6RB 2K3WA 3PDYA 5AQSB 1N33T 1S35A 4U33A 2XAGB 4X20E 3ZLIA 2Y6XA 3TLWA 5AQLB 2LOSA 4AQFC 3N9LA 3VKHA 5KX5E 2V7IA 1IBMT 1UCUA 3FXDB 4U7IA 3AEBA 4HTEA 4K0UA 4PJNA 4LF7T 3R6NA 2K9AA 1YKEB 3AE4A 3AA1B 3KV6A 5L3DB 1MNEA 3C4WA 3LBXA 5AFUL 2WBLA 2YOEA 2UXCT 2YDQA 4PNIA 3RIUC 2MPKA 4HFVA 4AXPA 3AECA 3UU3A 1T98A 4ZI7E 3RHWA 5L2LA 2EHOA 3FHNA 3ZPOA 2UXBT 2LSGA 3OTOT 2XQAA 3L8RA 5J2UE 1MMDA 4YXDA 2J4GA 3F31A 3UUBA 4EB6E 1NEKA 3JC6D 3ANWB 4IDOA 3ZT7A 3A5XA 1W0BA 2KZ7B 3GA8A 1HG5A 2NTYA 2JQKA 3N9NA 4QX8B 2DWKA 2BS4A 3AA0B 4DUZT 4B6XA 5AQTB 2IAKA 2NTXA 2LRLA 4DV1T 3N9PA 3PUVF 3T8OA 5JR9B 4LF6T 4OYKA 2MTQA 4XBFB 3N9QA 2KSRA 3FZFB 1ZP0A 4X5TA 3QK6A 4LFAT 3RIUA 4TNVA 3ZJ1A 4BJMA 4HFCA 2CBIA 3VHLA 3GMIA 2JMHA 3K3OA 1HNWT 3H3AA 5FXZA 4AKRB 4UR9A 1JNRA 5ABHA 4ADZA 4BJNA 3QC9A 1IBLT 5L3CB 4A97A 4CXYA 3UTKA 4UXNB 4MBQA 3LBXB 5LYJE 4EEDA 4JBWF 4CQIA 2D0UA 3BQLA 4C91A 4CN4A 5F8PA 5DQVA 1HF8A 5HAXA 4PFPA 2EHOB 1KFYA 4P1NA 3AE5A 3SOLA 4EZ4A 1W09A 3ZJ2A 3N2OA 5ADXL 1UX5A 2CMRA 2BDEA 4HWDA 2JJ9A 4AQGA 2N2NA 4ZHQE 4U72A 4HN9A 4PFOA 3R84B 4TX5A 3RI5A 2BKOA 2DWGA 4L9IA 3ESLA 2V6YA 3RYHE 4I50E 3RH3A 3ONLC 5FY0A 2X9XA 4B3ST 4IL9A 4EGWA 4UVAB 5AQQB 3RLFF 4UELA 4ZZCA 4ZOLE 4ZS2A 4QKNA 3AB3B 5L3BB 1VRBA 2PG8A 5JDQA 3T1HT 1N32T 5JDLA 3O1JA 3LK3B 2UXNB 3A7MA 4GK0E 5F5WA 3RF1A 1MMNA 4YTPA 5LHHB 2BS2A 3PU8A 3PURA 3ETUA 2BZBA 1OEDC 4H9PC 5FXVA 1XMOT 5H6QB 4JI1T 1UK5A 4GIWA 5JDFA 3ZMUB 4H9SE 4ZXLA 2XQYA 4QXCB 3UULA 2E5VA 4WBNE 4OFZA 4JI0T 4B3TT 5HCMA 2WS3A 5JDHA 3SRZA 3ZN0B 3L3PA 3DTOA 4GK5E 5FL0A 4EOZB 1N34T 2LSIA 1KNPA 4OHFA 4DBRA 4H9RC 4TV9E 5LMNT 4A5XA 3C4ZA 4N78D 5IYZE 2UXDT 2X0HA 2V6YB 1SHZC 4P09A 2PTFA 4M1PA 5FXXA 2LOPA 2X66A 3ABVA 4CN1A 3AA7B 1E1HB 5AQHB 2KLQA 3AVRA 3FZKB 4QXBB 2LM2A 1R8IA 1B7TA 1XNQT 5HEJA 2GK9A 4EYYR 3Q2MA 3AEDA 4TWDA 4IIJE 2V6XA 1ZHCA 4YT0A 4X62T 1M62A 3LFMA 4ZZBA 3H37A 4EXTA 2ES0A 3RKOA 3VU7H 3TLTA 5J0ZA 3N9OA 3VKGA 2W4XA 2LM9A 3PUWF 5ABGA 4IE7A 3CQGB 2LKGA 2D5UA 4HGAA 1S94A 4QH4A 5A1LA 2SPCA 3CPZA 4F8HA 2JQ9A 5LXTE 5HEHA 4ERRA 5JR9C 2XQ9A 2ACZA 2PFVA 4I43B 1I94T 3N2GE 5FYMA 3E22E 3H3MA 4KI0F 2I6HA 3CKDA 4A56A 4NXMT 1WFDA 5AQJB 3C50A 2A3DA 3P7IA 5HXHA 2HH7A 3FB2A 5E0OA 5LB7B 3RYCE 2I59A 3P4QA 2XTLA 1E2AA 4YHJA 2W66A 2LRKA 3PJAJ 2ODUA 2CXLA 3IF8B 4QH1A 2KWHA 2RP4A 4O2BE 1VCTA 3SS1A 3PV0F 3O9XA 2VQET 1XMQT 3LG7A 2LSJA 5L47A 3ANWA 4AKLA 2N9DA 4P0AA 3RC8A 2JPFA 4U2YA 3SFDA 4CXXA 4JUYA 4AI6A 2OA5A 4LFCT 3Q5WA 4TZ4C 2CE7A 4BA9A 2XQ6A 5HEUA 3UUXB 4WZXA 4CI3B 5AQVB 2CWYA 4X1IE 5LJMA 4CXWA 4X1YE 4YHHT 2JQQA 5CA0E 3RQUA 4DMVA 4LMLA 4UV8B 3ZT5A 2EHOC 5L3EB 1OEDE 1V9DA 2XAHB 3CWZB 2CA5A 4EIWA 2F4VT 3HKCE 3KV4A 5AQKB 4IHJE 5BR8T 2UU9T 4NXNT 4HKAA 2CBJA 4X64T 5CJ5A 2ODVA 2V26A 3D0TA 2NP9A 2W67A 2MBGA 5L3GB 2A72A 2BBJA 4LMJA 2N1GA 2XQ3A 2LJLA 4U74A 1YKHB 2R6GF 4O4HE 3UQ4A 3KVAA 1HNZT 4ISSA 2IIUA 1HFAA 5EK4A 2W61A 4DVDA 2IMLA 3N9MA 3S4UA 3SWHA 3DP7A 3FBZA 2MYSA 5AQNB 2VQFT 2HN2A 4ZI3C 4JI6T 3NZPA 5AQPB 2V7MA 4HWCA 3OJAA 2E9XD 4IREA 3AEGA 2NW9A 2CHNA 3NRXA 2BKPA 3K3QC 2YU2A 3RRCA 3PUSA 2KT9A 5HCJA 2I0MA 4QWNB 4Z8XA 3F57A 3UUMA 4PK5A 2NW7A 2XQ8A 5JREA 1KNZA 4KMCA 4HFBA 4LFBT 2V7LA 3CK6A 4ILBA 3ZMSB 5L3FB 5LBQB 2KMFA 2VASA 5EK3A 2VVNA 1WR6A 3LJCA 4ZEYA 2DLRA 2X51A 2BVLA 5C2TA 3NKZA 4YSXA 3EAMA 3K3NA 4OYJA 3VR9A 5LCYA 2VKJA 4X65T 2UUCT 3AE7A 2KXPB 1O3XA 3Q5EA 2E2AA 4IDNA 4G63A 3RX6A 1KEYA 3WAKA 4LF9T 1DU2A 4E7ZA 3VRAA 2AE9A 3ZCIA 3ZYMA 3QNUA 4DR4T 4TV8E 4DMWA 1W0AA 4IDPA 3UU8A 4CI2B 4JEHB 3V5UA 5KXJA 3HKBE 3ZYKA 1BR0A 5KMGP 2XZEA 4DR5T 4JYAT 5FNVE 2A9UA 2E9XC 4DUYT 2Q9QD 1QUUA 1QSDA 2CEAA 3ZSTA 3PTRB 1HX1B 4DV4T 2D2SA 3JC6C 2VKDA 2XQ7A 3EI0A 5LG4A 5HWYA 4GYSA 4COFA 4JV5T 2ZM2A 4QH5A 2XAQB 5LMUT 3FZMB 3JAEA 1XDPA 5LJNA 1MMAA 4HFEA 3KV5A 3J7Yq 2XAFB 1FEWA 3NWIA 5JVDE 2XASB 3W15B 5CGMA 2WU2A 5LHIB 4ASKA 1L0VA 3BK9A 4ILAA 4UIGA 4OX9T 1IAPA 2C5IT 2BBHA 3I0OA 5JH7E 1WRDA 3X1DA 3EVYA 5FXWA 3HA4A 2WDVA 5JDGA 3T1YT 4DR1T 4KHZF 1LVKA 2H88A 3N2KE 3UQ7A 2W2UA 2XY8B 1UX4A 1BR4A 3NZQA 4JLEA 5BMVE 1VOMA 1YD8G 4JI3T 2IUBA 2V5DA 2E9XA 2LKHA 5LA6E 5KDMC 1MNDA 2VL0A 3CX6B 3G06A 2LSYA 2CM0A 5DJQC 4TWFA 2YDRA 3ZC1A 4WW0A 3Q9DA 2BG9C 4MALA 4DV6T 2CHOA 3RPUA 3CX8B 1IBKT 3ONJA 3HL6A 3PUYF 3PUAA 3QB5A 4Z91A 3FBLA 4PJMA 3KBTA 3KDSE 4FI5A 5HXEA 3QUJA 4O4LE 4IL4A 2DI4A 5FL1A 2B1EA 4MLKA 4ZI2D 2NWBA 3M3ZB 1SE7A 4HWIB 3C98B 4QXHB 2VB6A 1QLBA 4B3MT 4ISTA 2C5JA 2CXFA 4U2ZA 3DJBA 3CQCB 3P4PA 2X67A 3TKLB 2VURA 1LRZA 4AKHA 4U3CA 3SFEA 1E7PA 3NVOA 3K1SA 1U4QA 3IHRA 4DV2T 3U3IA 4AISA 2H7OA 3ZKRA 3EDVA 1YW0A 3P8CD 2CRBA 3E08A 4K0KT 2YINA 2BG9A 3IBPA 1ZEEA 5HWXA 2Y8DA 1CUNA 2XSBA 2QYWA 3AE2A 3QB5K 3ZT6A 4H63H 4YFSA 3RC3A 1Y01A 1YQ4A 4XZCA 5HXRA 4L5GA 3C64A 1WCRA 5LBMA 4DR7T 2NW8A 2E9XB 5FY1A 3UU4A 4PAGA 3I9YA 4DR3T 3K8PC 2X0YA 4EAHA 4CI1B 4EYUA 5AQFB 2XQ4A 3L39A 5IWAT 4IGUA 2J47A 2M67A 1IZNB 2VK9A 3P4SA 4TUYE 3P4RA 2W00A 3LSVA 4IT4A 4L0RA 1N36T 3RKGA 4CZZB 1M7KA 2FJAA 4XAXB 3KBUA 1HG2A 3AEFA 1SUMB 2CPTA 2UUBT 3JCFA 5ETWA 4WBOA 4H9NC 4YSZA 2WSSV 1WR0A 3FXEB 3B13A 2X9YA 2HPJA 1US7B 4O2AE 2FBWA 2H3RA 3P4WA 4PJLA 3FZLB 4KBMB 5CFBA 2VWAA 4DV3T 2LHRA 3UT5E 5EK2A 2OLTA 4P0BA 3VR8A 4LF4T 2JQHA 1NENA 3ZEFB 3EHZA 3KINB 2WY2A 4WYVA 2BG9B 5EZYE 3B57A 4LF8T 2B76A 2IC6A 1JNZA 5C8YE 4PJJA 3AE6A 2L9QA 1XNRT 2Q9QB 2D9DA 5HXCA 5ABEA 2JIWA 4B3RT 3KV9A 3AAIA 3CMLA 2FJDA 2IDOB 1KF6A 1J1JA 4NUVA 1LKXA 4TN7B 3TLSA 1KK7A 3LK42 3PE0A 4DNDA 1FMVA 2YDSA 1T8BA 3MXZA 2X9HA 3J9X1 3ZC0A 2CCQA 5JQGE 4MHCA 2J1DG 3UUNA 2L8KA 1OXZA 1ZKEA 1AJ3A 1BR1A 1I6ZA 5J1GA 1U5PA 5L4EA 1NAFA 1FJGT 3PUZF 4I0UA 4YLHA 1VCSA 4ILCA 3A8YC 3JAFA 1NWMX 2OV9A 3EUHA 3OPCA 4LMKA 4ANJA 1X79A 1WYBA 2H7VC 2ZM8A 5FVKA 2XJ7A 2X9WA 4NIQA 2E5LT 2WAUA 2WMOA 2YU1A 2VVSA 5AQIB 3ZCJA 4HE8A 4UV9B 3L09A 3PU3A 3MJXA 4AQYT 2IW5B 2VKOA 3PUQA 1HX8A 3O1HA 2VL8A 3HI2A 3E0ZA 4CN6A 3BQIA 4JI7T 1WYCA 2BVMA 4JI4T 2QGSA 2V7JA 1MIYA 1UGOA 1D0XA 5CA1E 2C5KT 3ZMZB 2WQYA 1FMWA 1UURA 5AQOB 4DR2T 4YSYA 2WDRA 3KFWX 1Z8UA 2Z6EA 1IJ5A 1GQEA 3UFEA 4UVBB 3HKEE 4IDQA 4AQFA 3O4XE 2WP9A 1CHUA 1YQ3A 5LP6E 5HYAA 3AE8A 4LF5T 5HEGA 2V7KA 1XWMA 2CWOA 2CLYB 1G8XA 3MK7C 2X68A 4QHOA 2WWUA 5AQUB 3ONXA 4YJ3E 2G0UA 3RYIE 5C3JA 1HR0T 2KWIB 2QA7A 2LLYA 2XSAA 5DQWA 4HWFA 4KP3C 2K48A 4HEAA 2WZHA 3I0QA 5HXSA 3MKDA 2JMKA 4H9QC 4U7YA 4A98A 2V1DB 2K5BB 4DIDB 2LSKA 4HWHA 1D1CA 2XHEB 4C90A 2WB5A 3AAEB 2IC9A 2WU5A 2YN6A 3CIRA 2DL1A 3MZKB 3MA9A 3IA3A 1LVFA 4H9OC 4HFDA 3RRWA 4I4TE 1XZYA 2DCFA 4GKJT 1KNRA 4JEUB 1X9BA 2YK0A 2H89A 4X66T 3NRYA 3B5MA 1HTJF 2Y48B 3QOFA 2NOXA 4BAYB 1D1BA 3OBVE 3MACA 2XPKA 3GN5A 2QVAA 5JRCA 2FJBA 3C51A 5FP3A 3P50A 2X0LB 5LHGB 4KHPT 3I9WA 3V5SA 5L4HA 5AQRB 1IJ6A 2HN1A 1HS7A 2E8IA 3OKQA 5FVLA 3WAJA 3FZHB 2UXXB 4U31A 4DO0A 3ZMTB 2WWVA 1ZV4X 5AQGB 4IDZA 2MAWA 3OYZA 4DBQA 5CB4E 5JDMA 2ZMAA 4O4JE 4KX6A 3AAAB 1J5ET 2W62A 3RYFE 1Z0PA 4EEBA 4JI8T 4O4IE 4YJ2E 3AA6B 4HFIA 1D0YA 1HCIA 2J62A 3TLUA 2XM1A 2YKSA 4NPPA 3ETVA 4UVCB 3ZSSA 1FIOA 3O1IA 3UFGA 4UF0A 2KINB 1XDOA 1MIWA 3N5LA 2Q9QC 3WI3A 4GYRA 3CQXC 3UU6A 2V5CA 3LK2B 2LT3A 2A2FX 1J5WA 3RIAA 4ZS3A 5JTGA 2VKHA 3I1AA 2IHR1 2DNXA 3BQKA 5IHYA 5J2TE 2ZM0A 3ZYLA 4IE5A 4JI5T 4IE4A 2DHRA 3GN5B 5M4YA 3AE1A 5JRCB 3M65A 3HKDE 3GWHA 2LE8A 2RA1A 4YY3T 5FY7A 3CVRA 4G2AA 5LGUB 2QRXA 2V8SV 1D0ZA 3OVUA 3EABA 4HFHA 2MOZA 4DV0T 1OEDA 2XQ5A 3RIFA 2L3LA 5JDNA 3PUGA 2W0GA 4DV5T 2Q9QA 3NBXX 1G73A 4JI2T 2WCAA 1MMGA 2K24A 3ZN1B 4WNKA 5F3JA 3AEAA 2NR4A 4DR6T 4EV6A 3AXJA 2CXDA 4AIUA 3Q5XA 1EZ3A 2W63A 3VRBA 2WZIA 2BS3A 2KNDA 3Q5DA 3RQWA 2FJEA 1WLXA 5ABFA 5GONE 1YXRA 4V1Av 2EHOD 2PBIA 4EZHA 2BKNA 4UF0B 4UEMA 2FUPA 5LGTB 3TLVA 2WDQA 5LGNB 1Y64B 4TNWA 2M6IA 1D1AA 4PK6A 2WM9A 4ZI2C 1T72A 4PW8A 2WMNA 2XUEA 2PJQA 2XAJB 3AEEA 5IUXA 2CLYC 4DV7T 3PJAA 4OK0A 3F2EA 2ZM6T 3OYXA 3AE3A 3EDUA 5LNKA 1BR2A 1H7CA 5FKYA 4E7SA 3IEEA 4J2CA 2AXDS 2ACXA 3LDQB 4H63V 4YTMA 1ZOYA 2C0SA 2ZLYA 3AVSA 4KUMB 4QX7B 1SA0E 3AE9A 4Z90A 4NUUA 2UUAT 4YTNA 4O8SA 4Q25A 5AQMB 2YEVC
chains in the Genus database with same CATH topology
1M62A 1UGOA 5AQNB 3FZLB 3A8YC 4HWFA 5AQPB 4HWCA 1HX1B 5AQTB 3FZHB 3FZFB 3M3ZB 5AQSB 5AQVB 5AQOB 5AQJB 1I6ZA 4HWIB 5AQFB 5AQGB 5AQKB 4HWDA 5AQQB 4HWHA 5AQIB 5AQUB 5AQHB 3FZKB 5AQRB 5AQLB 1UK5A 2D9DA 1M7KA 1T7SA 5AQMB 3FZMB 3LDQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M62 A;  1UGO A;  5AQN B;  3FZL B;  3A8Y C;  4HWF A;  5AQP B;  4HWC A;  1HX1 B;  5AQT B;  3FZH B;  3FZF B;  3M3Z B;  5AQS B;  5AQV B;  5AQO B;  5AQJ B;  1I6Z A;  4HWI B;  5AQF B;  5AQG B;  5AQK B;  4HWD A;  5AQQ B;  4HWH A;  5AQI B;  5AQU B;  5AQH B;  3FZK B;  5AQR B;  5AQL B;  1UK5 A;  2D9D A;  1M7K A;  1T7S A;  5AQM B;  3FZM B;  3LDQ B; 
#chains in the Genus database with same CATH topology
 4MFR A;  4IE0 A;  2HHH T;  4PK4 A;  5TAO A;  1UUS A;  3KVB A;  4X1K E;  4GKK T;  2P9B A;  4ZI3 D;  4F6R C;  3U78 A;  2RPA A;  1OED B;  2D0T A;  5DAB A;  3ZMV B;  5LG3 A;  1T7S A;  2LEH A;  4AKI A;  1HNX T;  1W9R A;  3PUX F;  1MIV A;  2LHN A;  4FJO A;  5LOV E;  2BG9 E;  2HPL A;  5HEO A;  3C4X A;  3AXJ B;  3JAD A;  5FMN A;  5JR9 A;  4TWH A;  3UU5 A;  3RGL A;  2JRK A;  3HR0 A;  1OWA A;  4ILU A;  4I55 E;  2XM2 A;  5ABF B;  4AKG A;  3CX7 B;  4GOU A;  4IE6 A;  2M6B A;  5H6R B;  2K3W A;  3PDY A;  5AQS B;  1N33 T;  1S35 A;  4U33 A;  2XAG B;  4X20 E;  3ZLI A;  2Y6X A;  3TLW A;  5AQL B;  2LOS A;  4AQF C;  3N9L A;  3VKH A;  5KX5 E;  2V7I A;  1IBM T;  1UCU A;  3FXD B;  4U7I A;  3AEB A;  4HTE A;  4K0U A;  4PJN A;  4LF7 T;  3R6N A;  2K9A A;  1YKE B;  3AE4 A;  3AA1 B;  3KV6 A;  5L3D B;  1MNE A;  3C4W A;  3LBX A;  5AFU L;  2WBL A;  2YOE A;  2UXC T;  2YDQ A;  4PNI A;  3RIU C;  2MPK A;  4HFV A;  4AXP A;  3AEC A;  3UU3 A;  1T98 A;  4ZI7 E;  3RHW A;  5L2L A;  2EHO A;  3FHN A;  3ZPO A;  2UXB T;  2LSG A;  3OTO T;  2XQA A;  3L8R A;  5J2U E;  1MMD A;  4YXD A;  2J4G A;  3F31 A;  3UUB A;  4EB6 E;  1NEK A;  3JC6 D;  3ANW B;  4IDO A;  3ZT7 A;  3A5X A;  1W0B A;  2KZ7 B;  3GA8 A;  1HG5 A;  2NTY A;  2JQK A;  3N9N A;  4QX8 B;  2DWK A;  2BS4 A;  3AA0 B;  4DUZ T;  4B6X A;  5AQT B;  2IAK A;  2NTX A;  2LRL A;  4DV1 T;  3N9P A;  3PUV F;  3T8O A;  5JR9 B;  4LF6 T;  4OYK A;  2MTQ A;  4XBF B;  3N9Q A;  2KSR A;  3FZF B;  1ZP0 A;  4X5T A;  3QK6 A;  4LFA T;  3RIU A;  4TNV A;  3ZJ1 A;  4BJM A;  4HFC A;  2CBI A;  3VHL A;  3GMI A;  2JMH A;  3K3O A;  1HNW T;  3H3A A;  5FXZ A;  4AKR B;  4UR9 A;  1JNR A;  5ABH A;  4ADZ A;  4BJN A;  3QC9 A;  1IBL T;  5L3C B;  4A97 A;  4CXY A;  3UTK A;  4UXN B;  4MBQ A;  3LBX B;  5LYJ E;  4EED A;  4JBW F;  4CQI A;  2D0U A;  3BQL A;  4C91 A;  4CN4 A;  5F8P A;  5DQV A;  1HF8 A;  5HAX A;  4PFP A;  2EHO B;  1KFY A;  4P1N A;  3AE5 A;  3SOL A;  4EZ4 A;  1W09 A;  3ZJ2 A;  3N2O A;  5ADX L;  1UX5 A;  2CMR A;  2BDE A;  4HWD A;  2JJ9 A;  4AQG A;  2N2N A;  4ZHQ E;  4U72 A;  4HN9 A;  4PFO A;  3R84 B;  4TX5 A;  3RI5 A;  2BKO A;  2DWG A;  4L9I A;  3ESL A;  2V6Y A;  3RYH E;  4I50 E;  3RH3 A;  3ONL C;  5FY0 A;  2X9X A;  4B3S T;  4IL9 A;  4EGW A;  4UVA B;  5AQQ B;  3RLF F;  4UEL A;  4ZZC A;  4ZOL E;  4ZS2 A;  4QKN A;  3AB3 B;  5L3B B;  1VRB A;  2PG8 A;  5JDQ A;  3T1H T;  1N32 T;  5JDL A;  3O1J A;  3LK3 B;  2UXN B;  3A7M A;  4GK0 E;  5F5W A;  3RF1 A;  1MMN A;  4YTP A;  5LHH B;  2BS2 A;  3PU8 A;  3PUR A;  3ETU A;  2BZB A;  1OED C;  4H9P C;  5FXV A;  1XMO T;  5H6Q B;  4JI1 T;  1UK5 A;  4GIW A;  5JDF A;  3ZMU B;  4H9S E;  4ZXL A;  2XQY A;  4QXC B;  3UUL A;  2E5V A;  4WBN E;  4OFZ A;  4JI0 T;  4B3T T;  5HCM A;  2WS3 A;  5JDH A;  3SRZ A;  3ZN0 B;  3L3P A;  3DTO A;  4GK5 E;  5FL0 A;  4EOZ B;  1N34 T;  2LSI A;  1KNP A;  4OHF A;  4DBR A;  4H9R C;  4TV9 E;  5LMN T;  4A5X A;  3C4Z A;  4N78 D;  5IYZ E;  2UXD T;  2X0H A;  2V6Y B;  1SHZ C;  4P09 A;  2PTF A;  4M1P A;  5FXX A;  2LOP A;  2X66 A;  3ABV A;  4CN1 A;  3AA7 B;  1E1H B;  5AQH B;  2KLQ A;  3AVR A;  3FZK B;  4QXB B;  2LM2 A;  1R8I A;  1B7T A;  1XNQ T;  5HEJ A;  2GK9 A;  4EYY R;  3Q2M A;  3AED A;  4TWD A;  4IIJ E;  2V6X A;  1ZHC A;  4YT0 A;  4X62 T;  1M62 A;  3LFM A;  4ZZB A;  3H37 A;  4EXT A;  2ES0 A;  3RKO A;  3VU7 H;  3TLT A;  5J0Z A;  3N9O A;  3VKG A;  2W4X A;  2LM9 A;  3PUW F;  5ABG A;  4IE7 A;  3CQG B;  2LKG A;  2D5U A;  4HGA A;  1S94 A;  4QH4 A;  5A1L A;  2SPC A;  3CPZ A;  4F8H A;  2JQ9 A;  5LXT E;  5HEH A;  4ERR A;  5JR9 C;  2XQ9 A;  2ACZ A;  2PFV A;  4I43 B;  1I94 T;  3N2G E;  5FYM A;  3E22 E;  3H3M A;  4KI0 F;  2I6H A;  3CKD A;  4A56 A;  4NXM T;  1WFD A;  5AQJ B;  3C50 A;  2A3D A;  3P7I A;  5HXH A;  2HH7 A;  3FB2 A;  5E0O A;  5LB7 B;  3RYC E;  2I59 A;  3P4Q A;  2XTL A;  1E2A A;  4YHJ A;  2W66 A;  2LRK A;  3PJA J;  2ODU A;  2CXL A;  3IF8 B;  4QH1 A;  2KWH A;  2RP4 A;  4O2B E;  1VCT A;  3SS1 A;  3PV0 F;  3O9X A;  2VQE T;  1XMQ T;  3LG7 A;  2LSJ A;  5L47 A;  3ANW A;  4AKL A;  2N9D A;  4P0A A;  3RC8 A;  2JPF A;  4U2Y A;  3SFD A;  4CXX A;  4JUY A;  4AI6 A;  2OA5 A;  4LFC T;  3Q5W A;  4TZ4 C;  2CE7 A;  4BA9 A;  2XQ6 A;  5HEU A;  3UUX B;  4WZX A;  4CI3 B;  5AQV B;  2CWY A;  4X1I E;  5LJM A;  4CXW A;  4X1Y E;  4YHH T;  2JQQ A;  5CA0 E;  3RQU A;  4DMV A;  4LML A;  4UV8 B;  3ZT5 A;  2EHO C;  5L3E B;  1OED E;  1V9D A;  2XAH B;  3CWZ B;  2CA5 A;  4EIW A;  2F4V T;  3HKC E;  3KV4 A;  5AQK B;  4IHJ E;  5BR8 T;  2UU9 T;  4NXN T;  4HKA A;  2CBJ A;  4X64 T;  5CJ5 A;  2ODV A;  2V26 A;  3D0T A;  2NP9 A;  2W67 A;  2MBG A;  5L3G B;  2A72 A;  2BBJ A;  4LMJ A;  2N1G A;  2XQ3 A;  2LJL A;  4U74 A;  1YKH B;  2R6G F;  4O4H E;  3UQ4 A;  3KVA A;  1HNZ T;  4ISS A;  2IIU A;  1HFA A;  5EK4 A;  2W61 A;  4DVD A;  2IML A;  3N9M A;  3S4U A;  3SWH A;  3DP7 A;  3FBZ A;  2MYS A;  5AQN B;  2VQF T;  2HN2 A;  4ZI3 C;  4JI6 T;  3NZP A;  5AQP B;  2V7M A;  4HWC A;  3OJA A;  2E9X D;  4IRE A;  3AEG A;  2NW9 A;  2CHN A;  3NRX A;  2BKP A;  3K3Q C;  2YU2 A;  3RRC A;  3PUS A;  2KT9 A;  5HCJ A;  2I0M A;  4QWN B;  4Z8X A;  3F57 A;  3UUM A;  4PK5 A;  2NW7 A;  2XQ8 A;  5JRE A;  1KNZ A;  4KMC A;  4HFB A;  4LFB T;  2V7L A;  3CK6 A;  4ILB A;  3ZMS B;  5L3F B;  5LBQ B;  2KMF A;  2VAS A;  5EK3 A;  2VVN A;  1WR6 A;  3LJC A;  4ZEY A;  2DLR A;  2X51 A;  2BVL A;  5C2T A;  3NKZ A;  4YSX A;  3EAM A;  3K3N A;  4OYJ A;  3VR9 A;  5LCY A;  2VKJ A;  4X65 T;  2UUC T;  3AE7 A;  2KXP B;  1O3X A;  3Q5E A;  2E2A A;  4IDN A;  4G63 A;  3RX6 A;  1KEY A;  3WAK A;  4LF9 T;  1DU2 A;  4E7Z A;  3VRA A;  2AE9 A;  3ZCI A;  3ZYM A;  3QNU A;  4DR4 T;  4TV8 E;  4DMW A;  1W0A A;  4IDP A;  3UU8 A;  4CI2 B;  4JEH B;  3V5U A;  5KXJ A;  3HKB E;  3ZYK A;  1BR0 A;  5KMG P;  2XZE A;  4DR5 T;  4JYA T;  5FNV E;  2A9U A;  2E9X C;  4DUY T;  2Q9Q D;  1QUU A;  1QSD A;  2CEA A;  3ZST A;  3PTR B;  1HX1 B;  4DV4 T;  2D2S A;  3JC6 C;  2VKD A;  2XQ7 A;  3EI0 A;  5LG4 A;  5HWY A;  4GYS A;  4COF A;  4JV5 T;  2ZM2 A;  4QH5 A;  2XAQ B;  5LMU T;  3FZM B;  3JAE A;  1XDP A;  5LJN A;  1MMA A;  4HFE A;  3KV5 A;  3J7Y q;  2XAF B;  1FEW A;  3NWI A;  5JVD E;  2XAS B;  3W15 B;  5CGM A;  2WU2 A;  5LHI B;  4ASK A;  1L0V A;  3BK9 A;  4ILA A;  4UIG A;  4OX9 T;  1IAP A;  2C5I T;  2BBH A;  3I0O A;  5JH7 E;  1WRD A;  3X1D A;  3EVY A;  5FXW A;  3HA4 A;  2WDV A;  5JDG A;  3T1Y T;  4DR1 T;  4KHZ F;  1LVK A;  2H88 A;  3N2K E;  3UQ7 A;  2W2U A;  2XY8 B;  1UX4 A;  1BR4 A;  3NZQ A;  4JLE A;  5BMV E;  1VOM A;  1YD8 G;  4JI3 T;  2IUB A;  2V5D A;  2E9X A;  2LKH A;  5LA6 E;  5KDM C;  1MND A;  2VL0 A;  3CX6 B;  3G06 A;  2LSY A;  2CM0 A;  5DJQ C;  4TWF A;  2YDR A;  3ZC1 A;  4WW0 A;  3Q9D A;  2BG9 C;  4MAL A;  4DV6 T;  2CHO A;  3RPU A;  3CX8 B;  1IBK T;  3ONJ A;  3HL6 A;  3PUY F;  3PUA A;  3QB5 A;  4Z91 A;  3FBL A;  4PJM A;  3KBT A;  3KDS E;  4FI5 A;  5HXE A;  3QUJ A;  4O4L E;  4IL4 A;  2DI4 A;  5FL1 A;  2B1E A;  4MLK A;  4ZI2 D;  2NWB A;  3M3Z B;  1SE7 A;  4HWI B;  3C98 B;  4QXH B;  2VB6 A;  1QLB A;  4B3M T;  4IST A;  2C5J A;  2CXF A;  4U2Z A;  3DJB A;  3CQC B;  3P4P A;  2X67 A;  3TKL B;  2VUR A;  1LRZ A;  4AKH A;  4U3C A;  3SFE A;  1E7P A;  3NVO A;  3K1S A;  1U4Q A;  3IHR A;  4DV2 T;  3U3I A;  4AIS A;  2H7O A;  3ZKR A;  3EDV A;  1YW0 A;  3P8C D;  2CRB A;  3E08 A;  4K0K T;  2YIN A;  2BG9 A;  3IBP A;  1ZEE A;  5HWX A;  2Y8D A;  1CUN A;  2XSB A;  2QYW A;  3AE2 A;  3QB5 K;  3ZT6 A;  4H63 H;  4YFS A;  3RC3 A;  1Y01 A;  1YQ4 A;  4XZC A;  5HXR A;  4L5G A;  3C64 A;  1WCR A;  5LBM A;  4DR7 T;  2NW8 A;  2E9X B;  5FY1 A;  3UU4 A;  4PAG A;  3I9Y A;  4DR3 T;  3K8P C;  2X0Y A;  4EAH A;  4CI1 B;  4EYU A;  5AQF B;  2XQ4 A;  3L39 A;  5IWA T;  4IGU A;  2J47 A;  2M67 A;  1IZN B;  2VK9 A;  3P4S A;  4TUY E;  3P4R A;  2W00 A;  3LSV A;  4IT4 A;  4L0R A;  1N36 T;  3RKG A;  4CZZ B;  1M7K A;  2FJA A;  4XAX B;  3KBU A;  1HG2 A;  3AEF A;  1SUM B;  2CPT A;  2UUB T;  3JCF A;  5ETW A;  4WBO A;  4H9N C;  4YSZ A;  2WSS V;  1WR0 A;  3FXE B;  3B13 A;  2X9Y A;  2HPJ A;  1US7 B;  4O2A E;  2FBW A;  2H3R A;  3P4W A;  4PJL A;  3FZL B;  4KBM B;  5CFB A;  2VWA A;  4DV3 T;  2LHR A;  3UT5 E;  5EK2 A;  2OLT A;  4P0B A;  3VR8 A;  4LF4 T;  2JQH A;  1NEN A;  3ZEF B;  3EHZ A;  3KIN B;  2WY2 A;  4WYV A;  2BG9 B;  5EZY E;  3B57 A;  4LF8 T;  2B76 A;  2IC6 A;  1JNZ A;  5C8Y E;  4PJJ A;  3AE6 A;  2L9Q A;  1XNR T;  2Q9Q B;  2D9D A;  5HXC A;  5ABE A;  2JIW A;  4B3R T;  3KV9 A;  3AAI A;  3CML A;  2FJD A;  2IDO B;  1KF6 A;  1J1J A;  4NUV A;  1LKX A;  4TN7 B;  3TLS A;  1KK7 A;  3LK4 2;  3PE0 A;  4DND A;  1FMV A;  2YDS A;  1T8B A;  3MXZ A;  2X9H A;  3J9X 1;  3ZC0 A;  2CCQ A;  5JQG E;  4MHC A;  2J1D G;  3UUN A;  2L8K A;  1OXZ A;  1ZKE A;  1AJ3 A;  1BR1 A;  1I6Z A;  5J1G A;  1U5P A;  5L4E A;  1NAF A;  1FJG T;  3PUZ F;  4I0U A;  4YLH A;  1VCS A;  4ILC A;  3A8Y C;  3JAF A;  1NWM X;  2OV9 A;  3EUH A;  3OPC A;  4LMK A;  4ANJ A;  1X79 A;  1WYB A;  2H7V C;  2ZM8 A;  5FVK A;  2XJ7 A;  2X9W A;  4NIQ A;  2E5L T;  2WAU A;  2WMO A;  2YU1 A;  2VVS A;  5AQI B;  3ZCJ A;  4HE8 A;  4UV9 B;  3L09 A;  3PU3 A;  3MJX A;  4AQY T;  2IW5 B;  2VKO A;  3PUQ A;  1HX8 A;  3O1H A;  2VL8 A;  3HI2 A;  3E0Z A;  4CN6 A;  3BQI A;  4JI7 T;  1WYC A;  2BVM A;  4JI4 T;  2QGS A;  2V7J A;  1MIY A;  1UGO A;  1D0X A;  5CA1 E;  2C5K T;  3ZMZ B;  2WQY A;  1FMW A;  1UUR A;  5AQO B;  4DR2 T;  4YSY A;  2WDR A;  3KFW X;  1Z8U A;  2Z6E A;  1IJ5 A;  1GQE A;  3UFE A;  4UVB B;  3HKE E;  4IDQ A;  4AQF A;  3O4X E;  2WP9 A;  1CHU A;  1YQ3 A;  5LP6 E;  5HYA A;  3AE8 A;  4LF5 T;  5HEG A;  2V7K A;  1XWM A;  2CWO A;  2CLY B;  1G8X A;  3MK7 C;  2X68 A;  4QHO A;  2WWU A;  5AQU B;  3ONX A;  4YJ3 E;  2G0U A;  3RYI E;  5C3J A;  1HR0 T;  2KWI B;  2QA7 A;  2LLY A;  2XSA A;  5DQW A;  4HWF A;  4KP3 C;  2K48 A;  4HEA A;  2WZH A;  3I0Q A;  5HXS A;  3MKD A;  2JMK A;  4H9Q C;  4U7Y A;  4A98 A;  2V1D B;  2K5B B;  4DID B;  2LSK A;  4HWH A;  1D1C A;  2XHE B;  4C90 A;  2WB5 A;  3AAE B;  2IC9 A;  2WU5 A;  2YN6 A;  3CIR A;  2DL1 A;  3MZK B;  3MA9 A;  3IA3 A;  1LVF A;  4H9O C;  4HFD A;  3RRW A;  4I4T E;  1XZY A;  2DCF A;  4GKJ T;  1KNR A;  4JEU B;  1X9B A;  2YK0 A;  2H89 A;  4X66 T;  3NRY A;  3B5M A;  1HTJ F;  2Y48 B;  3QOF A;  2NOX A;  4BAY B;  1D1B A;  3OBV E;  3MAC A;  2XPK A;  3GN5 A;  2QVA A;  5JRC A;  2FJB A;  3C51 A;  5FP3 A;  3P50 A;  2X0L B;  5LHG B;  4KHP T;  3I9W A;  3V5S A;  5L4H A;  5AQR B;  1IJ6 A;  2HN1 A;  1HS7 A;  2E8I A;  3OKQ A;  5FVL A;  3WAJ A;  3FZH B;  2UXX B;  4U31 A;  4DO0 A;  3ZMT B;  2WWV A;  1ZV4 X;  5AQG B;  4IDZ A;  2MAW A;  3OYZ A;  4DBQ A;  5CB4 E;  5JDM A;  2ZMA A;  4O4J E;  4KX6 A;  3AAA B;  1J5E T;  2W62 A;  3RYF E;  1Z0P A;  4EEB A;  4JI8 T;  4O4I E;  4YJ2 E;  3AA6 B;  4HFI A;  1D0Y A;  1HCI A;  2J62 A;  3TLU A;  2XM1 A;  2YKS A;  4NPP A;  3ETV A;  4UVC B;  3ZSS A;  1FIO A;  3O1I A;  3UFG A;  4UF0 A;  2KIN B;  1XDO A;  1MIW A;  3N5L A;  2Q9Q C;  3WI3 A;  4GYR A;  3CQX C;  3UU6 A;  2V5C A;  3LK2 B;  2LT3 A;  2A2F X;  1J5W A;  3RIA A;  4ZS3 A;  5JTG A;  2VKH A;  3I1A A;  2IHR 1;  2DNX A;  3BQK A;  5IHY A;  5J2T E;  2ZM0 A;  3ZYL A;  4IE5 A;  4JI5 T;  4IE4 A;  2DHR A;  3GN5 B;  5M4Y A;  3AE1 A;  5JRC B;  3M65 A;  3HKD E;  3GWH A;  2LE8 A;  2RA1 A;  4YY3 T;  5FY7 A;  3CVR A;  4G2A A;  5LGU B;  2QRX A;  2V8S V;  1D0Z A;  3OVU A;  3EAB A;  4HFH A;  2MOZ A;  4DV0 T;  1OED A;  2XQ5 A;  3RIF A;  2L3L A;  5JDN A;  3PUG A;  2W0G A;  4DV5 T;  2Q9Q A;  3NBX X;  1G73 A;  4JI2 T;  2WCA A;  1MMG A;  2K24 A;  3ZN1 B;  4WNK A;  5F3J A;  3AEA A;  2NR4 A;  4DR6 T;  4EV6 A;  3AXJ A;  2CXD A;  4AIU A;  3Q5X A;  1EZ3 A;  2W63 A;  3VRB A;  2WZI A;  2BS3 A;  2KND A;  3Q5D A;  3RQW A;  2FJE A;  1WLX A;  5ABF A;  5GON E;  1YXR A;  4V1A v;  2EHO D;  2PBI A;  4EZH A;  2BKN A;  4UF0 B;  4UEM A;  2FUP A;  5LGT B;  3TLV A;  2WDQ A;  5LGN B;  1Y64 B;  4TNW A;  2M6I A;  1D1A A;  4PK6 A;  2WM9 A;  4ZI2 C;  1T72 A;  4PW8 A;  2WMN A;  2XUE A;  2PJQ A;  2XAJ B;  3AEE A;  5IUX A;  2CLY C;  4DV7 T;  3PJA A;  4OK0 A;  3F2E A;  2ZM6 T;  3OYX A;  3AE3 A;  3EDU A;  5LNK A;  1BR2 A;  1H7C A;  5FKY A;  4E7S A;  3IEE A;  4J2C A;  2AXD S;  2ACX A;  3LDQ B;  4H63 V;  4YTM A;  1ZOY A;  2C0S A;  2ZLY A;  3AVS A;  4KUM B;  4QX7 B;  1SA0 E;  3AE9 A;  4Z90 A;  4NUU A;  2UUA T;  4YTN A;  4O8S A;  4Q25 A;  5AQM B;  2YEV C; 
#chains in the Genus database with same CATH homology
 1M62 A;  1UGO A;  5AQN B;  3FZL B;  3A8Y C;  4HWF A;  5AQP B;  4HWC A;  1HX1 B;  5AQT B;  3FZH B;  3FZF B;  3M3Z B;  5AQS B;  5AQV B;  5AQO B;  5AQJ B;  1I6Z A;  4HWI B;  5AQF B;  5AQG B;  5AQK B;  4HWD A;  5AQQ B;  4HWH A;  5AQI B;  5AQU B;  5AQH B;  3FZK B;  5AQR B;  5AQL B;  1UK5 A;  2D9D A;  1M7K A;  1T7S A;  5AQM B;  3FZM B;  3LDQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...