5AQSB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
LGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqsB00
3LDQB 1UK5A 5AQQB 5AQPB 5AQFB 5AQLB 3A8YC 5AQHB 5AQRB 1M62A 1UGOA 5AQVB 1M7KA 1HX1B 5AQMB 5AQGB 4HWFA 4HWIB 1T7SA 4HWHA 3M3ZB 3FZHB 5AQOB 3FZLB 2D9DA 1I6ZA 5AQJB 3FZMB 5AQNB 5AQSB 5AQTB 4HWCA 4HWDA 3FZFB 3FZKB 5AQIB 5AQKB 5AQUB
chains in the Genus database with same CATH superfamily
3CX8B 2WU5A 5BR8T 1ZKEA 3PV0F 4O4LE 1XMOT 3RQWA 2VKHA 3KVBA 3P4PA 2MAWA 2Z6EA 2N9DA 4H9QC 3ONLC 2YU2A 5L3EB 2OA5A 2M6IA 5JREA 5IUXA 4U74A 2ZM8A 3DTOA 1XNRT 1LKXA 4EV6A 2ODVA 3OYZA 2WQYA 1T72A 4LF5T 2D2SA 3A7MA 5L3BB 4Q25A 2FJEA 2WMNA 3UFEA 2HPLA 5H6QB 2KNDA 1HR0T 3AA6B 2LRLA 2XTLA 1XZYA 2KLQA 2V7KA 4H63V 5LHGB 3MJXA 3TKLB 2W0GA 5DJQC 5HWYA 3IHRA 5HXCA 5LHIB 5JDFA 4WNKA 5HCMA 5AQQB 3H3AA 3ZT5A 2E9XA 1D0XA 1VOMA 2WU2A 4I0UA 4XAXB 3RIUC 4HFIA 3VKHA 4HWHA 4P09A 5FXWA 4LFBT 3VKGA 5LBQB 1D0YA 3AEBA 2WP9A 5A1LA 3PUWF 4BJMA 3VHLA 1YW0A 3WAJA 2Q9QB 2YINA 4O2BE 2JQ9A 2LEHA 4ILAA 2DNXA 3FZHB 3RC3A 4QXCB 4JI1T 2V1DB 3RHWA 4HFVA 3RC8A 1D1AA 3PUSA 1UGOA 3IA3A 4AQYT 1OXZA 4X1YE 4ILCA 4JI3T 4YT0A 3L3PA 2KWIB 4HWCA 2GK9A 3ZC1A 2KINB 5HXSA 3O1IA 3SOLA 5HEGA 5L4EA 4MLKA 3NKZA 3PU8A 4X62T 3B5MA 3PTRB 5HYAA 3EUHA 4NPPA 5CFBA 1WLXA 1UX5A 5AQRB 2A3DA 5LHHB 4UR9A 1Y01A 4IREA 4DV4T 3AA1B 2OLTA 3UQ4A 1KEYA 3OVUA 2YDQA 3CPZA 4E7ZA 3D0TA 2Y6XA 5IHYA 1UCUA 2E2AA 1NWMX 4A97A 4ISTA 1YD8G 3UU3A 2PTFA 3KVAA 1OEDE 1W0AA 3ZC0A 2PG8A 5AQNB 2HPJA 5FP3A 4MALA 4DO0A 4IE5A 2XQAA 2WZHA 3H3MA 2X67A 3G06A 3VRAA 2LE8A 5CGMA 2LKHA 4Z8XA 5ABHA 3K3QC 2NR4A 2E5VA 4BAYB 3P4RA 4UF0B 1XWMA 1HCIA 4GYSA 2C5JA 2CXDA 3FHNA 2HN1A 2G0UA 2WM9A 2VL8A 4Z91A 4GYRA 3HKBE 2WY2A 2XQ5A 4CQIA 1W09A 2XQ7A 3ABVA 4GK5E 3HA4A 4TUYE 4LF6T 2C0SA 2LHRA 4YY3T 5CA0E 1YXRA 2H88A 4IDPA 3F2EA 3SFDA 3LK2B 3PJAJ 1W9RA 4QXBB 1V9DA 4YHHT 3Q5DA 4KHPT 3K1SA 3AE6A 2X9HA 1MMAA 1ZV4X 3NZPA 4DR3T 2YDSA 4JI4T 1LRZA 3AVSA 4GK0E 4DR2T 5JR9A 3GWHA 2XJ7A 2JIWA 2WZIA 2V6YA 4GKJT 3C4XA 2KZ7B 4H9PC 5AQHB 3T1YT 2D5UA 3GN5B 3AXJA 4JEUB 2WMOA 3ZYLA 5LG4A 4TN7B 2V7MA 1KF6A 3M3ZB 4B3ST 2Y48B 3S4UA 2VKJA 4EXTA 5JTGA 2JQHA 3CQGB 4YFSA 4BA9A 1M7KA 2XSAA 4WBNE 5KX5E 4MFRA 1D1CA 1LVFA 2VVNA 3MKDA 3SS1A 4O8SA 4PAGA 5LP6E 3I0OA 4JV5T 2EHOA 1IAPA 4HWDA 4MHCA 3N9QA 4IT4A 3UQ7A 4KI0F 2CXFA 4TNVA 1N32T 2CA5A 3EI0A 3PJAA 5HEJA 3LBXB 1N36T 2CCQA 2M6BA 4KBMB 1T7SA 5L47A 3AE4A 3CVRA 2XY8B 2XAFB 4DNDA 1N33T 1HF8A 2BBJA 3R6NA 1MNDA 1M62A 4H9OC 4IDQA 2VQET 4U7IA 2FJBA 2KWHA 3VU7H 4IDNA 5FYMA 1UUSA 3N9NA 4ZZCA 3QK6A 3PUVF 3RF1A 2BS2A 2LRKA 3QC9A 3L8RA 2VVSA 1ZP0A 5CJ5A 4QWNB 1NAFA 2SPCA 4UELA 5JRCA 4H9RC 2BG9C 4YLHA 2LM9A 4IE4A 5LYJE 2CHOA 5F3JA 3UU6A 3AECA 2CHNA 2CMRA 2X9YA 3JADA 5LA6E 2YDRA 3P4QA 4KUMB 2Q9QA 2LT3A 4U33A 2XHEB 4J2CA 3KV5A 3RYIE 3I9WA 1HX8A 1BR1A 2QVAA 4X1IE 4FI5A 4DMVA 2IAKA 3LDQB 4PK5A 5JDLA 4DUYT 4UXNB 1KNPA 4PFPA 4WW0A 3ZEFB 2XZEA 3FBZA 4O2AE 2BDEA 1OEDC 4AQFA 3J7Yq 2ES0A 3JAFA 1SHZC 4COFA 1XDPA 3CK6A 1WCRA 2WWUA 3OTOT 4L9IA 3JAEA 2XQ6A 4ADZA 3DJBA 2V7JA 2UUCT 3TLSA 2VKOA 4HFHA 5C2TA 4AKLA 4U3CA 3CQCB 1S94A 2LOSA 1UURA 3F57A 5HEHA 4YTPA 2YKSA 3R84B 2MTQA 5LNKA 1HFAA 3RLFF 3EAMA 3O1JA 2J4GA 3ZMUB 3WAKA 4YXDA 2XAJB 4CZZB 2WDRA 5AQGB 2CWOA 3ANWA 5C8YE 4QX7B 1MIWA 3RPUA 4DUZT 3BQKA 2IDOB 5AQKB 2L3LA 1UX4A 4V1Av 3AEAA 4DV1T 2BS4A 3IEEA 3F31A 2BBHA 2XAHB 4TWHA 3A5XA 4AXPA 3UU5A 4DV2T 2XAGB 4YSYA 3HKDE 2WSSV 3BK9A 5BMVE 3LK3B 4HTEA 2JJ9A 1XNQT 2KT9A 3NWIA 3AA0B 3ZMSB 2LSYA 4AQGA 1N34T 4YJ2E 5FXXA 1S35A 4L0RA 5FVKA 4CXWA 3RH3A 2WWVA 4B3RT 2VASA 5AQFB 4UF0A 3OYXA 5FVLA 3IF8B 2OV9A 2KXPB 3DP7A 2N1GA 4G63A 5DQVA 4AKRB 2Y8DA 3CIRA 5LMNT 5LJNA 3ZMTB 3BQIA 3QUJA 3UU4A 3N9PA 4JI0T 2J47A 3O4XE 3RIFA 1H7CA 4DMWA 2XQ9A 5L3CB 5LB7B 4PJNA 1MMDA 2MPKA 4HGAA 2UXCT 5KDMC 2X9XA 4YJ3E 4I43B 3N2GE 3OPCA 2R6GF 3ONXA 5HCJA 1IBKT 4H63H 4CI2B 3ZT7A 2J1DG 4AI6A 1D1BA 2W66A 4DV3T 4PW8A 3T1HT 3B57A 4TWFA 4B6XA 2ACXA 2C5IT 3GN5A 2NW9A 3I0QA 3OJAA 3M65A 2UXBT 4I55E 4CI3B 3LSVA 2K24A 2CBJA 3AVRA 1KNZA 2V8SV 2H3RA 1BR2A 5EK3A 1EZ3A 2X9WA 2JRKA 4B3TT 2CBIA 2VWAA 3PDYA 3ZKRA 1D0ZA 3EDUA 3PUGA 2LOPA 2HH7A 3FB2A 3RIAA 2NOXA 3ZCJA 4YTMA 4EIWA 5F8PA 3AE3A 2K9AA 4GKKT 5JDMA 2QRXA 4NUVA 3RIUA 2BG9B 2DWKA 3KFWX 3ZPOA 3LBXA 1E1HB 5J1GA 3TLTA 2D9DA 3VR9A 3QOFA 3HI2A 4DR4T 4LFCT 1XMQT 4LF7T 2H7OA 4ZHQE 2BVLA 3PURA 1ZHCA 2B76A 3UTKA 2D0TA 4OFZA 2UU9T 4PJMA 3CQXC 3H37A 1HS7A 2YN6A 3FBLA 1OEDB 3U3IA 4HFBA 1HX1B 5L3GB 4HKAA 5HEUA 1IJ6A 4ZS3A 1B7TA 2A9UA 1I6ZA 4YTNA 2KMFA 3EVYA 2DCFA 3CMLA 5AQIB 2ZLYA 2VURA 4IIJE 3NRXA 1W0BA 3KINB 4OYKA 2XQYA 2YEVC 4K0UA 3GA8A 3AE5A 4UVBB 4TWDA 2CEAA 2QYWA 4TZ4C 1Y64B 1G8XA 3HL6A 2W61A 3HKEE 3P4SA 3BQLA 5KMGP 2IW5B 1LVKA 3AAAB 1SUMB 4JEHB 5L2LA 5FY1A 5FL1A 1MNEA 4JI6T 4PJLA 4H9SE 4LMJA 3ZYKA 3SRZA 3KBTA 5LGNB 2J62A 1G73A 1VRBA 2KSRA 4A56A 3N9OA 4QX8B 2CXLA 3VRBA 1NENA 1HG5A 3C50A 3V5SA 4XZCA 2XUEA 3L39A 2W62A 1FMVA 3Q5WA 3Q5XA 3U78A 3RGLA 3VR8A 5J0ZA 4ZEYA 2MYSA 5HEOA 3AAIA 4YSXA 3E22E 4AISA 5ADXL 3UUXB 3K3OA 4HWIB 4X66T 1WRDA 2V5DA 4IHJE 3TLWA 4DR1T 3RI5A 4ISSA 1MMGA 5JH7E 4QHOA 4DR5T 4E7SA 1CUNA 2IUBA 4EEDA 4HFEA 5FNVE 5JQGE 4DV7T 3CKDA 3ZYMA 2V6XA 1VCSA 3AAEB 3PU3A 2ZM0A 2L9QA 3ETUA 4Z90A 5AFUL 3AE7A 2X51A 1KFYA 3TLVA 3AEEA 4HFDA 4CN1A 5IWAT 3PUZF 5JDHA 2XQ8A 4LMLA 2LSKA 2M67A 4ANJA 4KMCA 4G2AA 4ERRA 3UUBA 1WYCA 4O4HE 4U7YA 5LOVE 4QH4A 2YOEA 4CXYA 2B1EA 2H7VC 2UUAT 2XSBA 4LF9T 2NW7A 4U2YA 1O3XA 5EK2A 3Q9DA 4NXNT 5EK4A 2H89A 3HKCE 1HNZT 3JCFA 3AE9A 3FZKB 4DV5T 4JI5T 5ETWA 1YKHB 4X20E 2CM0A 2K3WA 1YQ4A 2W67A 2VQFT 4DIDB 1E7PA 3NRYA 5LBMA 3MA9A 4JI2T 3EDVA 1HTJF 3UUNA 3ZSSA 3E08A 4EGWA 1XDOA 3FXDB 3CX6B 4CN4A 5ABFB 3FXEB 5CA1E 3AE8A 4EZ4A 3SWHA 2WB5A 4TX5A 2BS3A 4JYAT 2NP9A 2IMLA 4LMKA 2LM2A 2MOZA 2AE9A 2XAQB 1QUUA 4ZI7E 4P0BA 2BVMA 2V7IA 2NW8A 3GMIA 3EABA 1US7B 4EEBA 4OX9T 3N5LA 3K8PC 4IE7A 2E9XC 4YSZA 3LFMA 4ZS2A 4EYYR 4U2ZA 5L4HA 4X5TA 2W00A 2WDVA 2LKGA 2V26A 3TLUA 2JPFA 2LLYA 4ILBA 1U4QA 2V6YB 5KXJA 3LJCA 1IZNB 2WAUA 5AQLB 1T8BA 4IL9A 3KV4A 4CI1B 3AXJB 3RX6A 3ZCIA 2CLYC 5AQMB 4O4IE 3AEFA 2CRBA 3N9MA 4WYVA 4I50E 3P50A 4AKHA 2BKOA 3PUXF 5H6RB 2BG9A 3P4WA 3PE0A 5IYZE 5FXVA 3J9X1 4IDOA 3KV6A 3NVOA 4LFAT 4CN6A 2PFVA 3LK42 2W4XA 3NBXX 2EHOB 5JDNA 2FBWA 4AKGA 5AQUB 3T8OA 5FMNA 4IL4A 1ZEEA 2E5LT 4EOZB 1YKEB 5FY7A 1FIOA 1DU2A 5EZYE 1IBMT 4P0AA 2PBIA 3X1DA 4DR7T 3PUQA 4F8HA 4OHFA 1OEDA 1ZOYA 2I59A 2K5BB 2N2NA 2AXDS 3AEDA 2LSJA 2UUBT 3ZN1B 5C3JA 4C90A 3AEGA 1BR0A 1MMNA 5JRCB 2VB6A 3RRWA 3RKOA 2LJLA 5LJMA 1OWAA 3C4ZA 1NEKA 2DLRA 3I9YA 5CB4E 2W2UA 3I1AA 4DR6T 4X64T 2WCAA 4HE8A 2RPAA 4PNIA 2C5KT 3QB5A 4KHZF 1Z0PA 4EZHA 2UXDT 1J5WA 2X68A 5JDQA 4KP3C 2V7LA 3QB5K 1U5PA 1WYBA 1VCTA 4ZI3C 2E9XD 3UU8A 3ETVA 3ESLA 5FY0A 1WR0A 1WR6A 4ILUA 5LMUT 5HWXA 3CX7B 4U72A 4PJJA 3ZMZB 5J2UE 4DV6T 5GONE 1JNRA 4NUUA 3JC6C 5AQPB 5FL0A 3KV9A 2BG9E 1J1JA 3Q2MA 2NWBA 2UXXB 2CE7A 3L09A 2X0HA 5AQOB 3IBPA 4JI7T 4OK0A 2VK9A 1IJ5A 3ZMVB 2E8IA 3MK7C 2WBLA 5JVDE 2VKDA 1QLBA 2NTXA 4QH1A 2FJAA 3W15B 4TNWA 3ANWB 2MBGA 2CWYA 5HXEA 4ZXLA 3MZKB 2BKNA 2VL0A 5DQWA 1R8IA 3UULA 5JR9C 1AJ3A 4IE6A 5HXRA 5E0OA 4NIQA 3AE1A 2JQKA 4EAHA 3FZLB 3UUMA 2HN2A 2RP4A 2XASB 2CPTA 2FUPA 4EYUA 4KX6A 2IHR1 2IC9A 3P8CD 2DWGA 4UV9B 2A2FX 4O4JE 3K3NA 2X66A 2W63A 1Z8UA 4OYJA 3HR0A 2ACZA 4TV9E 2JMKA 3O1HA 3ZLIA 2EHOC 3AE2A 4B3MT 5LCYA 2E9XB 4F6RC 1J5ET 1HG2A 4HN9A 5J2TE 4GOUA 4P1NA 2WDQA 3E0ZA 5AQTB 2BZBA 4ZI3D 5L3FB 2CLYB 4MBQA 1FMWA 4AKIA 2X0YA 4C91A 2LSIA 5ABFA 1IBLT 2X0LB 1FJGT 1CHUA 5AQJB 1T98A 4PFOA 2DL1A 3N2OA 5LXTE 1UK5A 5HXHA 2BKPA 2FJDA 4M1PA 3JC6D 3N2KE 4JBWF 4IGUA 3QNUA 4L5GA 3O9XA 5LG3A 2ZM6T 1QSDA 2PJQA 4ZI2C 2ODUA 2NTYA 3MXZA 1I94T 4U31A 3C4WA 4WZXA 1MIYA 5JDGA 2HHHT 1KK7A 4UIGA 2XM1A 2YK0A 3LG7A 1E2AA 3AA7B 4K0KT 4EB6E 4BJNA 4LF4T 4N78D 2Q9QC 4A98A 1MIVA 5AQSB 4AIUA 5M4YA 4CXXA 4UV8B 3A8YC 5AQVB 2LHNA 2I6HA 2YU1A 3ZJ1A 4NXMT 2UXNB 4IDZA 2XPKA 2K48A 2P9BA 3EHZA 3UT5E 3ZT6A 1SE7A 4AQFC 5DABA 5TAOA 4UVCB 1GQEA 4DVDA 2QA7A 3OBVE 5LGUB 4XBFB 4HFCA 5ABEA 3B13A 2L8KA 3ZN0B 2XM2A 4TV8E 4JLEA 2V5CA 4ZOLE 4IE0A 4DBRA 2XQ3A 1X79A 2EHOD 3AB3B 3KDSE 4HWFA 3P7IA 4FJOA 2ZM2A 5F5WA 5LGTB 3WI3A 3FZMB 4UEMA 2QGSA 3OKQA 1BR4A 3RQUA 4QKNA 3MACA 1FEWA 2LSGA 5ABGA 4LF8T 1SA0E 4HEAA 3PUYF 3NZQA 4DV0T 2A72A 2IIUA 4DBQA 4QXHB 4X65T 4JUYA 3FZFB 1YQ3A 2XQ4A 1L0VA 3ZSTA 3C64A 4ASKA 1HNXT 3RYFE 1X9BA 5FXZA 3RYCE 3UFGA 4ZZBA 3Q5EA 4PK6A 2D0UA 2JMHA 3N9LA 3V5UA 1KNRA 3PUAA 2WS3A 4UVAB 4GIWA 5FKYA 4ZI2D 3SFEA 3RYHE 2F4VT 3ZJ2A 4YHJA 3C98B 5HAXA 2I0MA 5JR9B 4A5XA 4X1KE 2ZMAA 4WBOA 4JI8T 2Q9QD 4QH5A 3KBUA 2RA1A 1JNZA 3RRCA 3CWZB 5L3DB 2JQQA 1HNWT 1WFDA 3ONJA 3RKGA 4H9NC 4PK4A 2DI4A 2DHRA 2IC6A 4I4TE 3C51A
chains in the Genus database with same CATH topology
3LDQB 1UK5A 5AQQB 5AQPB 5AQFB 5AQLB 3A8YC 5AQHB 5AQRB 1M62A 1UGOA 5AQVB 1M7KA 1HX1B 5AQMB 5AQGB 4HWFA 4HWIB 1T7SA 4HWHA 3M3ZB 3FZHB 5AQOB 3FZLB 2D9DA 1I6ZA 5AQJB 3FZMB 5AQNB 5AQSB 5AQTB 4HWCA 4HWDA 3FZFB 3FZKB 5AQIB 5AQKB 5AQUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LDQ B;  1UK5 A;  5AQQ B;  5AQP B;  5AQF B;  5AQL B;  3A8Y C;  5AQH B;  5AQR B;  1M62 A;  1UGO A;  5AQV B;  1M7K A;  1HX1 B;  5AQM B;  5AQG B;  4HWF A;  4HWI B;  1T7S A;  4HWH A;  3M3Z B;  3FZH B;  5AQO B;  3FZL B;  2D9D A;  1I6Z A;  5AQJ B;  3FZM B;  5AQN B;  5AQS B;  5AQT B;  4HWC A;  4HWD A;  3FZF B;  3FZK B;  5AQI B;  5AQK B;  5AQU B; 
#chains in the Genus database with same CATH topology
 3CX8 B;  2WU5 A;  5BR8 T;  1ZKE A;  3PV0 F;  4O4L E;  1XMO T;  3RQW A;  2VKH A;  3KVB A;  3P4P A;  2MAW A;  2Z6E A;  2N9D A;  4H9Q C;  3ONL C;  2YU2 A;  5L3E B;  2OA5 A;  2M6I A;  5JRE A;  5IUX A;  4U74 A;  2ZM8 A;  3DTO A;  1XNR T;  1LKX A;  4EV6 A;  2ODV A;  3OYZ A;  2WQY A;  1T72 A;  4LF5 T;  2D2S A;  3A7M A;  5L3B B;  4Q25 A;  2FJE A;  2WMN A;  3UFE A;  2HPL A;  5H6Q B;  2KND A;  1HR0 T;  3AA6 B;  2LRL A;  2XTL A;  1XZY A;  2KLQ A;  2V7K A;  4H63 V;  5LHG B;  3MJX A;  3TKL B;  2W0G A;  5DJQ C;  5HWY A;  3IHR A;  5HXC A;  5LHI B;  5JDF A;  4WNK A;  5HCM A;  5AQQ B;  3H3A A;  3ZT5 A;  2E9X A;  1D0X A;  1VOM A;  2WU2 A;  4I0U A;  4XAX B;  3RIU C;  4HFI A;  3VKH A;  4HWH A;  4P09 A;  5FXW A;  4LFB T;  3VKG A;  5LBQ B;  1D0Y A;  3AEB A;  2WP9 A;  5A1L A;  3PUW F;  4BJM A;  3VHL A;  1YW0 A;  3WAJ A;  2Q9Q B;  2YIN A;  4O2B E;  2JQ9 A;  2LEH A;  4ILA A;  2DNX A;  3FZH B;  3RC3 A;  4QXC B;  4JI1 T;  2V1D B;  3RHW A;  4HFV A;  3RC8 A;  1D1A A;  3PUS A;  1UGO A;  3IA3 A;  4AQY T;  1OXZ A;  4X1Y E;  4ILC A;  4JI3 T;  4YT0 A;  3L3P A;  2KWI B;  4HWC A;  2GK9 A;  3ZC1 A;  2KIN B;  5HXS A;  3O1I A;  3SOL A;  5HEG A;  5L4E A;  4MLK A;  3NKZ A;  3PU8 A;  4X62 T;  3B5M A;  3PTR B;  5HYA A;  3EUH A;  4NPP A;  5CFB A;  1WLX A;  1UX5 A;  5AQR B;  2A3D A;  5LHH B;  4UR9 A;  1Y01 A;  4IRE A;  4DV4 T;  3AA1 B;  2OLT A;  3UQ4 A;  1KEY A;  3OVU A;  2YDQ A;  3CPZ A;  4E7Z A;  3D0T A;  2Y6X A;  5IHY A;  1UCU A;  2E2A A;  1NWM X;  4A97 A;  4IST A;  1YD8 G;  3UU3 A;  2PTF A;  3KVA A;  1OED E;  1W0A A;  3ZC0 A;  2PG8 A;  5AQN B;  2HPJ A;  5FP3 A;  4MAL A;  4DO0 A;  4IE5 A;  2XQA A;  2WZH A;  3H3M A;  2X67 A;  3G06 A;  3VRA A;  2LE8 A;  5CGM A;  2LKH A;  4Z8X A;  5ABH A;  3K3Q C;  2NR4 A;  2E5V A;  4BAY B;  3P4R A;  4UF0 B;  1XWM A;  1HCI A;  4GYS A;  2C5J A;  2CXD A;  3FHN A;  2HN1 A;  2G0U A;  2WM9 A;  2VL8 A;  4Z91 A;  4GYR A;  3HKB E;  2WY2 A;  2XQ5 A;  4CQI A;  1W09 A;  2XQ7 A;  3ABV A;  4GK5 E;  3HA4 A;  4TUY E;  4LF6 T;  2C0S A;  2LHR A;  4YY3 T;  5CA0 E;  1YXR A;  2H88 A;  4IDP A;  3F2E A;  3SFD A;  3LK2 B;  3PJA J;  1W9R A;  4QXB B;  1V9D A;  4YHH T;  3Q5D A;  4KHP T;  3K1S A;  3AE6 A;  2X9H A;  1MMA A;  1ZV4 X;  3NZP A;  4DR3 T;  2YDS A;  4JI4 T;  1LRZ A;  3AVS A;  4GK0 E;  4DR2 T;  5JR9 A;  3GWH A;  2XJ7 A;  2JIW A;  2WZI A;  2V6Y A;  4GKJ T;  3C4X A;  2KZ7 B;  4H9P C;  5AQH B;  3T1Y T;  2D5U A;  3GN5 B;  3AXJ A;  4JEU B;  2WMO A;  3ZYL A;  5LG4 A;  4TN7 B;  2V7M A;  1KF6 A;  3M3Z B;  4B3S T;  2Y48 B;  3S4U A;  2VKJ A;  4EXT A;  5JTG A;  2JQH A;  3CQG B;  4YFS A;  4BA9 A;  1M7K A;  2XSA A;  4WBN E;  5KX5 E;  4MFR A;  1D1C A;  1LVF A;  2VVN A;  3MKD A;  3SS1 A;  4O8S A;  4PAG A;  5LP6 E;  3I0O A;  4JV5 T;  2EHO A;  1IAP A;  4HWD A;  4MHC A;  3N9Q A;  4IT4 A;  3UQ7 A;  4KI0 F;  2CXF A;  4TNV A;  1N32 T;  2CA5 A;  3EI0 A;  3PJA A;  5HEJ A;  3LBX B;  1N36 T;  2CCQ A;  2M6B A;  4KBM B;  1T7S A;  5L47 A;  3AE4 A;  3CVR A;  2XY8 B;  2XAF B;  4DND A;  1N33 T;  1HF8 A;  2BBJ A;  3R6N A;  1MND A;  1M62 A;  4H9O C;  4IDQ A;  2VQE T;  4U7I A;  2FJB A;  2KWH A;  3VU7 H;  4IDN A;  5FYM A;  1UUS A;  3N9N A;  4ZZC A;  3QK6 A;  3PUV F;  3RF1 A;  2BS2 A;  2LRK A;  3QC9 A;  3L8R A;  2VVS A;  1ZP0 A;  5CJ5 A;  4QWN B;  1NAF A;  2SPC A;  4UEL A;  5JRC A;  4H9R C;  2BG9 C;  4YLH A;  2LM9 A;  4IE4 A;  5LYJ E;  2CHO A;  5F3J A;  3UU6 A;  3AEC A;  2CHN A;  2CMR A;  2X9Y A;  3JAD A;  5LA6 E;  2YDR A;  3P4Q A;  4KUM B;  2Q9Q A;  2LT3 A;  4U33 A;  2XHE B;  4J2C A;  3KV5 A;  3RYI E;  3I9W A;  1HX8 A;  1BR1 A;  2QVA A;  4X1I E;  4FI5 A;  4DMV A;  2IAK A;  3LDQ B;  4PK5 A;  5JDL A;  4DUY T;  4UXN B;  1KNP A;  4PFP A;  4WW0 A;  3ZEF B;  2XZE A;  3FBZ A;  4O2A E;  2BDE A;  1OED C;  4AQF A;  3J7Y q;  2ES0 A;  3JAF A;  1SHZ C;  4COF A;  1XDP A;  3CK6 A;  1WCR A;  2WWU A;  3OTO T;  4L9I A;  3JAE A;  2XQ6 A;  4ADZ A;  3DJB A;  2V7J A;  2UUC T;  3TLS A;  2VKO A;  4HFH A;  5C2T A;  4AKL A;  4U3C A;  3CQC B;  1S94 A;  2LOS A;  1UUR A;  3F57 A;  5HEH A;  4YTP A;  2YKS A;  3R84 B;  2MTQ A;  5LNK A;  1HFA A;  3RLF F;  3EAM A;  3O1J A;  2J4G A;  3ZMU B;  3WAK A;  4YXD A;  2XAJ B;  4CZZ B;  2WDR A;  5AQG B;  2CWO A;  3ANW A;  5C8Y E;  4QX7 B;  1MIW A;  3RPU A;  4DUZ T;  3BQK A;  2IDO B;  5AQK B;  2L3L A;  1UX4 A;  4V1A v;  3AEA A;  4DV1 T;  2BS4 A;  3IEE A;  3F31 A;  2BBH A;  2XAH B;  4TWH A;  3A5X A;  4AXP A;  3UU5 A;  4DV2 T;  2XAG B;  4YSY A;  3HKD E;  2WSS V;  3BK9 A;  5BMV E;  3LK3 B;  4HTE A;  2JJ9 A;  1XNQ T;  2KT9 A;  3NWI A;  3AA0 B;  3ZMS B;  2LSY A;  4AQG A;  1N34 T;  4YJ2 E;  5FXX A;  1S35 A;  4L0R A;  5FVK A;  4CXW A;  3RH3 A;  2WWV A;  4B3R T;  2VAS A;  5AQF B;  4UF0 A;  3OYX A;  5FVL A;  3IF8 B;  2OV9 A;  2KXP B;  3DP7 A;  2N1G A;  4G63 A;  5DQV A;  4AKR B;  2Y8D A;  3CIR A;  5LMN T;  5LJN A;  3ZMT B;  3BQI A;  3QUJ A;  3UU4 A;  3N9P A;  4JI0 T;  2J47 A;  3O4X E;  3RIF A;  1H7C A;  4DMW A;  2XQ9 A;  5L3C B;  5LB7 B;  4PJN A;  1MMD A;  2MPK A;  4HGA A;  2UXC T;  5KDM C;  2X9X A;  4YJ3 E;  4I43 B;  3N2G E;  3OPC A;  2R6G F;  3ONX A;  5HCJ A;  1IBK T;  4H63 H;  4CI2 B;  3ZT7 A;  2J1D G;  4AI6 A;  1D1B A;  2W66 A;  4DV3 T;  4PW8 A;  3T1H T;  3B57 A;  4TWF A;  4B6X A;  2ACX A;  2C5I T;  3GN5 A;  2NW9 A;  3I0Q A;  3OJA A;  3M65 A;  2UXB T;  4I55 E;  4CI3 B;  3LSV A;  2K24 A;  2CBJ A;  3AVR A;  1KNZ A;  2V8S V;  2H3R A;  1BR2 A;  5EK3 A;  1EZ3 A;  2X9W A;  2JRK A;  4B3T T;  2CBI A;  2VWA A;  3PDY A;  3ZKR A;  1D0Z A;  3EDU A;  3PUG A;  2LOP A;  2HH7 A;  3FB2 A;  3RIA A;  2NOX A;  3ZCJ A;  4YTM A;  4EIW A;  5F8P A;  3AE3 A;  2K9A A;  4GKK T;  5JDM A;  2QRX A;  4NUV A;  3RIU A;  2BG9 B;  2DWK A;  3KFW X;  3ZPO A;  3LBX A;  1E1H B;  5J1G A;  3TLT A;  2D9D A;  3VR9 A;  3QOF A;  3HI2 A;  4DR4 T;  4LFC T;  1XMQ T;  4LF7 T;  2H7O A;  4ZHQ E;  2BVL A;  3PUR A;  1ZHC A;  2B76 A;  3UTK A;  2D0T A;  4OFZ A;  2UU9 T;  4PJM A;  3CQX C;  3H37 A;  1HS7 A;  2YN6 A;  3FBL A;  1OED B;  3U3I A;  4HFB A;  1HX1 B;  5L3G B;  4HKA A;  5HEU A;  1IJ6 A;  4ZS3 A;  1B7T A;  2A9U A;  1I6Z A;  4YTN A;  2KMF A;  3EVY A;  2DCF A;  3CML A;  5AQI B;  2ZLY A;  2VUR A;  4IIJ E;  3NRX A;  1W0B A;  3KIN B;  4OYK A;  2XQY A;  2YEV C;  4K0U A;  3GA8 A;  3AE5 A;  4UVB B;  4TWD A;  2CEA A;  2QYW A;  4TZ4 C;  1Y64 B;  1G8X A;  3HL6 A;  2W61 A;  3HKE E;  3P4S A;  3BQL A;  5KMG P;  2IW5 B;  1LVK A;  3AAA B;  1SUM B;  4JEH B;  5L2L A;  5FY1 A;  5FL1 A;  1MNE A;  4JI6 T;  4PJL A;  4H9S E;  4LMJ A;  3ZYK A;  3SRZ A;  3KBT A;  5LGN B;  2J62 A;  1G73 A;  1VRB A;  2KSR A;  4A56 A;  3N9O A;  4QX8 B;  2CXL A;  3VRB A;  1NEN A;  1HG5 A;  3C50 A;  3V5S A;  4XZC A;  2XUE A;  3L39 A;  2W62 A;  1FMV A;  3Q5W A;  3Q5X A;  3U78 A;  3RGL A;  3VR8 A;  5J0Z A;  4ZEY A;  2MYS A;  5HEO A;  3AAI A;  4YSX A;  3E22 E;  4AIS A;  5ADX L;  3UUX B;  3K3O A;  4HWI B;  4X66 T;  1WRD A;  2V5D A;  4IHJ E;  3TLW A;  4DR1 T;  3RI5 A;  4ISS A;  1MMG A;  5JH7 E;  4QHO A;  4DR5 T;  4E7S A;  1CUN A;  2IUB A;  4EED A;  4HFE A;  5FNV E;  5JQG E;  4DV7 T;  3CKD A;  3ZYM A;  2V6X A;  1VCS A;  3AAE B;  3PU3 A;  2ZM0 A;  2L9Q A;  3ETU A;  4Z90 A;  5AFU L;  3AE7 A;  2X51 A;  1KFY A;  3TLV A;  3AEE A;  4HFD A;  4CN1 A;  5IWA T;  3PUZ F;  5JDH A;  2XQ8 A;  4LML A;  2LSK A;  2M67 A;  4ANJ A;  4KMC A;  4G2A A;  4ERR A;  3UUB A;  1WYC A;  4O4H E;  4U7Y A;  5LOV E;  4QH4 A;  2YOE A;  4CXY A;  2B1E A;  2H7V C;  2UUA T;  2XSB A;  4LF9 T;  2NW7 A;  4U2Y A;  1O3X A;  5EK2 A;  3Q9D A;  4NXN T;  5EK4 A;  2H89 A;  3HKC E;  1HNZ T;  3JCF A;  3AE9 A;  3FZK B;  4DV5 T;  4JI5 T;  5ETW A;  1YKH B;  4X20 E;  2CM0 A;  2K3W A;  1YQ4 A;  2W67 A;  2VQF T;  4DID B;  1E7P A;  3NRY A;  5LBM A;  3MA9 A;  4JI2 T;  3EDV A;  1HTJ F;  3UUN A;  3ZSS A;  3E08 A;  4EGW A;  1XDO A;  3FXD B;  3CX6 B;  4CN4 A;  5ABF B;  3FXE B;  5CA1 E;  3AE8 A;  4EZ4 A;  3SWH A;  2WB5 A;  4TX5 A;  2BS3 A;  4JYA T;  2NP9 A;  2IML A;  4LMK A;  2LM2 A;  2MOZ A;  2AE9 A;  2XAQ B;  1QUU A;  4ZI7 E;  4P0B A;  2BVM A;  2V7I A;  2NW8 A;  3GMI A;  3EAB A;  1US7 B;  4EEB A;  4OX9 T;  3N5L A;  3K8P C;  4IE7 A;  2E9X C;  4YSZ A;  3LFM A;  4ZS2 A;  4EYY R;  4U2Z A;  5L4H A;  4X5T A;  2W00 A;  2WDV A;  2LKG A;  2V26 A;  3TLU A;  2JPF A;  2LLY A;  4ILB A;  1U4Q A;  2V6Y B;  5KXJ A;  3LJC A;  1IZN B;  2WAU A;  5AQL B;  1T8B A;  4IL9 A;  3KV4 A;  4CI1 B;  3AXJ B;  3RX6 A;  3ZCI A;  2CLY C;  5AQM B;  4O4I E;  3AEF A;  2CRB A;  3N9M A;  4WYV A;  4I50 E;  3P50 A;  4AKH A;  2BKO A;  3PUX F;  5H6R B;  2BG9 A;  3P4W A;  3PE0 A;  5IYZ E;  5FXV A;  3J9X 1;  4IDO A;  3KV6 A;  3NVO A;  4LFA T;  4CN6 A;  2PFV A;  3LK4 2;  2W4X A;  3NBX X;  2EHO B;  5JDN A;  2FBW A;  4AKG A;  5AQU B;  3T8O A;  5FMN A;  4IL4 A;  1ZEE A;  2E5L T;  4EOZ B;  1YKE B;  5FY7 A;  1FIO A;  1DU2 A;  5EZY E;  1IBM T;  4P0A A;  2PBI A;  3X1D A;  4DR7 T;  3PUQ A;  4F8H A;  4OHF A;  1OED A;  1ZOY A;  2I59 A;  2K5B B;  2N2N A;  2AXD S;  3AED A;  2LSJ A;  2UUB T;  3ZN1 B;  5C3J A;  4C90 A;  3AEG A;  1BR0 A;  1MMN A;  5JRC B;  2VB6 A;  3RRW A;  3RKO A;  2LJL A;  5LJM A;  1OWA A;  3C4Z A;  1NEK A;  2DLR A;  3I9Y A;  5CB4 E;  2W2U A;  3I1A A;  4DR6 T;  4X64 T;  2WCA A;  4HE8 A;  2RPA A;  4PNI A;  2C5K T;  3QB5 A;  4KHZ F;  1Z0P A;  4EZH A;  2UXD T;  1J5W A;  2X68 A;  5JDQ A;  4KP3 C;  2V7L A;  3QB5 K;  1U5P A;  1WYB A;  1VCT A;  4ZI3 C;  2E9X D;  3UU8 A;  3ETV A;  3ESL A;  5FY0 A;  1WR0 A;  1WR6 A;  4ILU A;  5LMU T;  5HWX A;  3CX7 B;  4U72 A;  4PJJ A;  3ZMZ B;  5J2U E;  4DV6 T;  5GON E;  1JNR A;  4NUU A;  3JC6 C;  5AQP B;  5FL0 A;  3KV9 A;  2BG9 E;  1J1J A;  3Q2M A;  2NWB A;  2UXX B;  2CE7 A;  3L09 A;  2X0H A;  5AQO B;  3IBP A;  4JI7 T;  4OK0 A;  2VK9 A;  1IJ5 A;  3ZMV B;  2E8I A;  3MK7 C;  2WBL A;  5JVD E;  2VKD A;  1QLB A;  2NTX A;  4QH1 A;  2FJA A;  3W15 B;  4TNW A;  3ANW B;  2MBG A;  2CWY A;  5HXE A;  4ZXL A;  3MZK B;  2BKN A;  2VL0 A;  5DQW A;  1R8I A;  3UUL A;  5JR9 C;  1AJ3 A;  4IE6 A;  5HXR A;  5E0O A;  4NIQ A;  3AE1 A;  2JQK A;  4EAH A;  3FZL B;  3UUM A;  2HN2 A;  2RP4 A;  2XAS B;  2CPT A;  2FUP A;  4EYU A;  4KX6 A;  2IHR 1;  2IC9 A;  3P8C D;  2DWG A;  4UV9 B;  2A2F X;  4O4J E;  3K3N A;  2X66 A;  2W63 A;  1Z8U A;  4OYJ A;  3HR0 A;  2ACZ A;  4TV9 E;  2JMK A;  3O1H A;  3ZLI A;  2EHO C;  3AE2 A;  4B3M T;  5LCY A;  2E9X B;  4F6R C;  1J5E T;  1HG2 A;  4HN9 A;  5J2T E;  4GOU A;  4P1N A;  2WDQ A;  3E0Z A;  5AQT B;  2BZB A;  4ZI3 D;  5L3F B;  2CLY B;  4MBQ A;  1FMW A;  4AKI A;  2X0Y A;  4C91 A;  2LSI A;  5ABF A;  1IBL T;  2X0L B;  1FJG T;  1CHU A;  5AQJ B;  1T98 A;  4PFO A;  2DL1 A;  3N2O A;  5LXT E;  1UK5 A;  5HXH A;  2BKP A;  2FJD A;  4M1P A;  3JC6 D;  3N2K E;  4JBW F;  4IGU A;  3QNU A;  4L5G A;  3O9X A;  5LG3 A;  2ZM6 T;  1QSD A;  2PJQ A;  4ZI2 C;  2ODU A;  2NTY A;  3MXZ A;  1I94 T;  4U31 A;  3C4W A;  4WZX A;  1MIY A;  5JDG A;  2HHH T;  1KK7 A;  4UIG A;  2XM1 A;  2YK0 A;  3LG7 A;  1E2A A;  3AA7 B;  4K0K T;  4EB6 E;  4BJN A;  4LF4 T;  4N78 D;  2Q9Q C;  4A98 A;  1MIV A;  5AQS B;  4AIU A;  5M4Y A;  4CXX A;  4UV8 B;  3A8Y C;  5AQV B;  2LHN A;  2I6H A;  2YU1 A;  3ZJ1 A;  4NXM T;  2UXN B;  4IDZ A;  2XPK A;  2K48 A;  2P9B A;  3EHZ A;  3UT5 E;  3ZT6 A;  1SE7 A;  4AQF C;  5DAB A;  5TAO A;  4UVC B;  1GQE A;  4DVD A;  2QA7 A;  3OBV E;  5LGU B;  4XBF B;  4HFC A;  5ABE A;  3B13 A;  2L8K A;  3ZN0 B;  2XM2 A;  4TV8 E;  4JLE A;  2V5C A;  4ZOL E;  4IE0 A;  4DBR A;  2XQ3 A;  1X79 A;  2EHO D;  3AB3 B;  3KDS E;  4HWF A;  3P7I A;  4FJO A;  2ZM2 A;  5F5W A;  5LGT B;  3WI3 A;  3FZM B;  4UEM A;  2QGS A;  3OKQ A;  1BR4 A;  3RQU A;  4QKN A;  3MAC A;  1FEW A;  2LSG A;  5ABG A;  4LF8 T;  1SA0 E;  4HEA A;  3PUY F;  3NZQ A;  4DV0 T;  2A72 A;  2IIU A;  4DBQ A;  4QXH B;  4X65 T;  4JUY A;  3FZF B;  1YQ3 A;  2XQ4 A;  1L0V A;  3ZST A;  3C64 A;  4ASK A;  1HNX T;  3RYF E;  1X9B A;  5FXZ A;  3RYC E;  3UFG A;  4ZZB A;  3Q5E A;  4PK6 A;  2D0U A;  2JMH A;  3N9L A;  3V5U A;  1KNR A;  3PUA A;  2WS3 A;  4UVA B;  4GIW A;  5FKY A;  4ZI2 D;  3SFE A;  3RYH E;  2F4V T;  3ZJ2 A;  4YHJ A;  3C98 B;  5HAX A;  2I0M A;  5JR9 B;  4A5X A;  4X1K E;  2ZMA A;  4WBO A;  4JI8 T;  2Q9Q D;  4QH5 A;  3KBU A;  2RA1 A;  1JNZ A;  3RRC A;  3CWZ B;  5L3D B;  2JQQ A;  1HNW T;  1WFD A;  3ONJ A;  3RKG A;  4H9N C;  4PK4 A;  2DI4 A;  2DHR A;  2IC6 A;  4I4T E;  3C51 A; 
#chains in the Genus database with same CATH homology
 3LDQ B;  1UK5 A;  5AQQ B;  5AQP B;  5AQF B;  5AQL B;  3A8Y C;  5AQH B;  5AQR B;  1M62 A;  1UGO A;  5AQV B;  1M7K A;  1HX1 B;  5AQM B;  5AQG B;  4HWF A;  4HWI B;  1T7S A;  4HWH A;  3M3Z B;  3FZH B;  5AQO B;  3FZL B;  2D9D A;  1I6Z A;  5AQJ B;  3FZM B;  5AQN B;  5AQS B;  5AQT B;  4HWC A;  4HWD A;  3FZF B;  3FZK B;  5AQI B;  5AQK B;  5AQU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...