5AQSB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
113
structure length
113
Chain Sequence
LGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 44
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqsB00
1I6ZA 5AQSB 3A8YC 3FZMB 5AQIB 1T7SA 1HX1B 5AQHB 5AQNB 3M3ZB 4HWHA 5AQUB 5AQVB 5AQJB 4HWCA 3FZHB 5AQKB 5AQOB 5AQRB 5AQPB 1M7KA 1UK5A 5AQLB 1UGOA 4HWDA 3FZLB 5AQGB 5AQQB 5AQTB 4HWFA 4HWIB 2D9DA 3LDQB 5AQFB 3FZFB 3FZKB 1M62A 5AQMB
chains in the Genus database with same CATH superfamily
2N1GA 1QSDA 2LM9A 3ZPOA 1N33T 4B3MT 4YTMA 2XAGB 3AA6B 5F5WA 4X1KE 4MFRA 1W09A 4U74A 3LFMA 1KNZA 3LJCA 2JQ9A 4JI0T 2E9XD 4DV0T 2R6GF 3RYHE 1ZOYA 2JPFA 4GK5E 4PK5A 1YQ3A 3ZMVB 4UR9A 2LT3A 4H63V 5M4YA 5FMNA 5L3EB 4EB6E 5JDHA 4HFDA 4JV5T 2K3WA 3FZMB 2XAHB 2V7MA 2FJBA 1XWMA 3N9NA 2HPJA 3RYCE 3WI3A 5KMGP 3TKLB 2LHRA 2YDRA 4AKLA 1YW0A 4O4JE 3ANWB 3RQWA 1JNRA 2D9DA 4DUZT 4OFZA 2VASA 3OYXA 4U31A 4U72A 3KV4A 2KXPB 3VHLA 2CBIA 4PJJA 5CB4E 2H89A 3P4RA 2QA7A 3AEBA 2DLRA 3RI5A 3L3PA 3NVOA 3AA0B 2L9QA 2LE8A 2UU9T 3HA4A 4HE8A 2CXLA 4IL9A 5HWYA 1E1HB 5J2TE 1QUUA 2L3LA 5FXXA 4IGUA 3C64A 4LF8T 3RQUA 1CUNA 2Y6XA 3F31A 2Y8DA 4LF6T 3C50A 4G63A 2IW5B 2VK9A 4LFBT 5JDLA 4HWFA 5LHHB 2PBIA 4OYKA 2N2NA 3I9YA 1EZ3A 5LP6E 5HYAA 4DMWA 2WBLA 3TLTA 5LMNT 3RYIE 3EI0A 4JI7T 2J4GA 2C5JA 2H7VC 4AKIA 2CPTA 2XQ9A 4IE7A 4YTPA 2W66A 3VU7H 2EHOA 1NEKA 4WW0A 5HXCA 3ZSSA 3ZEFB 3LK42 5H6RB 4U7IA 3CWZB 4ISSA 2PFVA 5AQLB 4GK0E 3AEEA 4M1PA 4F8HA 3AXJA 4H9SE 1T8BA 3BQLA 2W62A 3O4XE 4GKJT 1HCIA 3O9XA 2WDVA 4H9PC 3AVRA 1UX5A 5FKYA 1VOMA 4JLEA 5J2UE 4X5TA 2VKDA 4QXCB 2XASB 4AIUA 5J0ZA 2J62A 4DV7T 2WM9A 2XQ3A 3UULA 3HR0A 2Q9QB 3AA7B 4X62T 1D0YA 4IE4A 5FP3A 4GKKT 4HFIA 2D0UA 3PTRB 5JDQA 4IDNA 5AQPB 5LGUB 1XDOA 3ZCIA 4JEUB 4DV1T 3ZCJA 3N9OA 3ETUA 3BK9A 2WWUA 2V7LA 3C4XA 3RIUA 2XQAA 4DBRA 2B1EA 3GWHA 4WBOA 3UU3A 3AE2A 1DU2A 1OWAA 1S94A 2XY8B 3CMLA 4J2CA 2XAFB 1SUMB 3DTOA 4N78D 3RGLA 5JRCA 1KF6A 1WFDA 2V7JA 2ZM8A 2Z6EA 5CA0E 1HR0T 2JQQA 3N5LA 3PUSA 4Z91A 4EEDA 2HH7A 4A5XA 3RHWA 2D0TA 3PU8A 2V1DB 3BQIA 2DNXA 3P4SA 1L0VA 3AEFA 4DV2T 1D0ZA 5JDMA 1M62A 4ASKA 2K24A 4X65T 3MA9A 4H9NC 3PV0F 2W67A 2WZHA 4BJMA 4AQYT 3SOLA 2FJDA 2WS3A 2IC9A 2X9HA 3P8CD 2E9XA 5LJNA 4CXWA 3MXZA 4H63H 4CI1B 3OYZA 3AE3A 5C2TA 5BMVE 3AE4A 4U2ZA 2LJLA 1W9RA 4YSYA 2ES0A 2CM0A 4GOUA 2QGSA 4PAGA 2YINA 2UUBT 1QLBA 1HS7A 1MNDA 5LHIB 2CWOA 5HEUA 2XPKA 5GONE 3C51A 3PJAA 1FMWA 1IZNB 3Q5EA 4DR3T 4LMKA 4LFAT 2BDEA 2ZM2A 3UUXB 2WP9A 2CLYB 2BBJA 3EAMA 5FL0A 5LBQB 3G06A 5FXVA 1SHZC 2UUAT 4TN7B 1XNQT 4DR4T 4LMLA 4DV6T 4X1YE 2LOSA 4UELA 2V6YA 1IJ5A 2BKNA 3HL6A 3P4QA 3SS1A 4IDOA 4H9OC 2M67A 4AQFA 5AQGB 2UXDT 4HFBA 4XAXB 3UU5A 5KXJA 3AE7A 5HWXA 3UU6A 5ADXL 3AAIA 1FIOA 1SA0E 3LG7A 1OEDA 2K48A 4B3RT 2OA5A 2A3DA 3N2GE 3K3QC 4HWDA 3VRBA 2K9AA 2H7OA 1MIVA 2Q9QC 2EHOB 2XQ8A 1MNEA 5AQFB 2IDOB 3RPUA 3W15B 2LM2A 3PUVF 4AQGA 5AQHB 4ZI3D 2JQHA 1W0BA 4DR2T 4HWCA 1XMQT 3V5UA 4AI6A 4TWDA 3ZLIA 4H9RC 2CXDA 4KHZF 5L3FB 3AXJB 2HN2A 2HHHT 2RP4A 4X66T 2FUPA 4UIGA 4X20E 3RRWA 2WQYA 4IE5A 5JR9A 2LKHA 4ZI2D 4JEHB 4LMJA 3Q5WA 4ANJA 3WAKA 2YN6A 3QK6A 2XSAA 1D1AA 5CA1E 3ZN0B 3AVSA 2WCAA 4A98A 4DUYT 4JI1T 2UUCT 4EZ4A 3IA3A 3KV9A 2BG9A 5CJ5A 2MAWA 3A8YC 2Y48B 4DVDA 3FBZA 5H6QB 2ODUA 5IYZE 3KINB 2YU1A 2H88A 4YLHA 1V9DA 4PK6A 4GYRA 4U3CA 4P0AA 4QXHB 2WMOA 4ZS2A 3U3IA 2YKSA 2CBJA 2JIWA 2MBGA 3I0OA 4O8SA 4L0RA 1N34T 4YSXA 2WB5A 5IUXA 4DV5T 2BKOA 4LF9T 3IHRA 3LSVA 5FY1A 2I0MA 4UVAB 3PUGA 5JDGA 1YKEB 4ILCA 2VVNA 2NR4A 1MIYA 4HEAA 2W0GA 4JUYA 5LJMA 1UGOA 3ONXA 3SRZA 3PUQA 3Q5XA 3K8PC 3AB3B 2X0LB 2PJQA 1WR0A 2E5VA 2E9XB 4BA9A 1ZP0A 5AQSB 4L9IA 3OBVE 5CGMA 4Q25A 4MHCA 3AE9A 4OX9T 3ZT5A 2DWGA 2CLYC 1O3XA 2X9YA 2H3RA 1E2AA 2ZM0A 3FXEB 3AECA 2M6IA 5C8YE 2LRKA 2NW8A 1G73A 2LSJA 4OHFA 4JI3T 1HX1B 3FHNA 4TNVA 1VRBA 3N9QA 4UF0A 1D0XA 1LRZA 2C5IT 3LK3B 4HGAA 5ABFA 2JJ9A 2QRXA 5LMUT 3RRCA 3VKGA 4AKGA 3ZC1A 3MK7C 2KZ7B 5HCJA 2LSKA 3NRYA 2UXNB 1Y01A 2RPAA 5HEOA 3L8RA 4CXXA 4ZZBA 3B13A 5L3GB 3UT5E 2HN1A 1WR6A 1I6ZA 4L5GA 3KBUA 2V6YB 3RC3A 4Z8XA 2KNDA 4V1Av 2GK9A 3NRXA 3T1YT 2IC6A 4X1IE 3O1JA 5HCMA 4GIWA 2YU2A 3IBPA 4TUYE 1MIWA 3HKDE 4O4LE 3RKGA 1KEYA 2BS2A 5DJQC 5HEHA 2MOZA 2E2AA 4I50E 5L3CB 2OLTA 4QKNA 3NKZA 1S35A 4HWIB 4ZEYA 2XAJB 2XZEA 3VRAA 2X0HA 5J1GA 2BS3A 3ONJA 3QUJA 3AAAB 4WNKA 3D0TA 3LBXA 4EYYR 5AQOB 4TWFA 4MBQA 4KI0F 3RKOA 4YJ2E 5FVLA 1LVFA 3AE1A 2W61A 5EK2A 2UXXB 2X67A 1FMVA 2BZBA 1ZKEA 4YSZA 2V5DA 2W2UA 4PJNA 5JDFA 3QNUA 5AFUL 5FL1A 5L4HA 3OJAA 5AQRB 4U2YA 3N9MA 4OYJA 2XAQB 4XBFB 5LG4A 3L39A 4MLKA 3PUZF 4O4HE 2IMLA 5ETWA 2SPCA 3CQCB 3CKDA 4CN4A 1HTJF 4TZ4C 5JDNA 5L47A 3PE0A 2IAKA 1T72A 3QB5K 3JC6C 4IE0A 3DJBA 3CQGB 4F6RC 3EDVA 4H9QC 1IBKT 3PJAJ 5FXZA 3QB5A 3PUWF 4NXNT 4NUUA 4PFOA 1B7TA 5HXSA 2CEAA 1UK5A 3ESLA 4UEMA 3CK6A 4LF4T 5FY7A 3ZYKA 4UVBB 4ILBA 3KBTA 2YOEA 1MMAA 4UXNB 5AQJB 4PFPA 2ZLYA 4YY3T 4E7ZA 4YFSA 3EUHA 3ZMUB 2B76A 5EK4A 4YTNA 2LSGA 5IWAT 3ZT7A 4C91A 2NTXA 5LNKA 5E0OA 4NUVA 4CZZB 4QH4A 2MYSA 4JBWF 2PG8A 5A1LA 3K1SA 4IT4A 1G8XA 2XM2A 2VQET 2WDRA 2ZM6T 2CHOA 3R84B 3UTKA 4ZXLA 3N2OA 1U4QA 3ZMZB 3RIFA 4QHOA 4IDQA 2CE7A 3KDSE 4PJMA 3O1HA 3O1IA 2FJEA 2YDQA 5HXHA 3P4PA 2V26A 3EDUA 5FNVE 4EAHA 4HN9A 4DMVA 1XMOT 5AQIB 2DCFA 5JH7E 4UF0B 4QX8B 2YDSA 3QOFA 3S4UA 3EHZA 2FJAA 5FVKA 3TLWA 3SFDA 2P9BA 3EVYA 4UV8B 1UURA 3PUAA 4QWNB 3VKHA 1Z8UA 3EABA 2KWHA 3B57A 2N9DA 1GQEA 5JVDE 2AE9A 1T98A 1UX4A 3TLSA 3ZYMA 2X0YA 2MTQA 2DI4A 5JREA 1I94T 1X79A 1U5PA 1KFYA 4CI3B 3UUMA 3E0ZA 5F8PA 5L3BB 4K0UA 1IBLT 1FEWA 1WLXA 2VKHA 3HKBE 3KV6A 3DP7A 4EXTA 1KNRA 4IHJE 4HTEA 2LHNA 3B5MA 3A5XA 2BKPA 1WRDA 5HXRA 2JMKA 5EK3A 3H37A 5AQQB 1WCRA 4O2BE 5L2LA 4DO0A 3OVUA 3GMIA 2UXBT 2YK0A 4HFHA 2DWKA 3UUNA 2BVMA 4ADZA 3SFEA 3LBXB 4KP3C 2NW9A 5LXTE 5DABA 3RLFF 1HNWT 4HFCA 2LEHA 1WYCA 2JQKA 3Q9DA 3N9LA 3AE6A 2A9UA 2Q9QA 4PW8A 4IDPA 4ZZCA 4EEBA 3ZC0A 2KWIB 5DQWA 3RIAA 4DNDA 4I0UA 4AKHA 3C98B 3KFWX 2CHNA 2ACXA 2JRKA 4PJLA 2DL1A 4B3TT 5KDMC 1Y64B 2E8IA 2W00A 5L3DB 1XDPA 2X9XA 1ZHCA 4EOZB 3P7IA 3PU3A 3CPZA 1US7B 4EIWA 5JRCB 3I9WA 3L09A 5AQTB 2WAUA 2VL8A 3RX6A 3LDQB 1N32T 2YEVC 4C90A 3ZJ2A 3P4WA 3ZSTA 4EV6A 3FZHB 2QYWA 4P0BA 3F57A 3AEDA 3JC6D 1HG2A 5BR8T 4LF7T 2HPLA 1HFAA 2NOXA 5EZYE 2NW7A 5AQMB 4LFCT 2VKJA 2XQ5A 3PUXF 3IEEA 4FI5A 5HAXA 3AAEB 4A97A 4HWHA 2WU2A 4O4IE 2VVSA 3JCFA 5HEGA 2CWYA 2OV9A 3JAFA 3BQKA 4HFEA 3AE8A 1VCSA 2X9WA 5IHYA 3R6NA 2CCQA 3H3MA 4Z90A 5AQVB 3A7MA 4K0KT 3VR9A 2VKOA 1KK7A 3TLUA 4DR5T 2VWAA 2CMRA 2V7IA 2L8KA 4U33A 4E7SA 1X9BA 2XJ7A 1JNZA 4JI6T 3CX6B 3GA8A 4TX5A 5JQGE 4EZHA 3CX8B 4UVCB 3CX7B 4CQIA 3C4ZA 3K3OA 2DHRA 4KBMB 4P1NA 2W63A 2C0SA 3RH3A 3AE5A 2EHOC 1IAPA 2CRBA 1HF8A 3UU8A 3I0QA 4G2AA 2PTFA 4NXMT 3UUBA 2VL0A 1J5WA 3HI2A 4ILAA 4KX6A 5LG3A 3CVRA 2ODVA 2RA1A 3T1HT 2JMHA 3NZQA 2XSBA 3X1DA 4XZCA 4ZI3C 1OEDB 3E22E 4TNWA 3SWHA 5F3JA 4QH1A 4DBQA 2VQFT 4DR7T 4IE6A 4AXPA 5FYMA 2K5BB 3PURA 2KLQA 3J7Yq 4YHHT 3TLVA 2IIUA 2UXCT 3ZJ1A 2Q9QD 2A72A 4ZI2C 2IHR1 3RIUC 2LRLA 3UU4A 4ZS3A 2LLYA 5AQUB 5JTGA 5LGNB 2CA5A 4PNIA 3UQ4A 5LA6E 4BAYB 5HEJA 4QX7B 4JI5T 4MALA 5JR9B 5LYJE 4ZHQE 4IDZA 1VCTA 1WYBA 1D1BA 2WU5A 3GN5A 1UUSA 4AKRB 1UCUA 4ILUA 4TWHA 3MZKB 3K3NA 4ZOLE 5LGTB 2BG9B 4TV9E 1BR4A 5LB7B 4BJNA 4ERRA 4DV3T 4ISTA 3HKCE 2MPKA 3T8OA 1CHUA 2C5KT 2XQ6A 1E7PA 1XNRT 2FBWA 3AA1B 3KV5A 2G0UA 1YKHB 4FJOA 4EYUA 4COFA 2E9XC 2IUBA 3P50A 3J9X1 3RYFE 5KX5E 3Q5DA 2V5CA 2F4VT 2NP9A 3KVAA 4KUMB 1NWMX 5DQVA 2QVAA 2I6HA 2J47A 4NIQA 2D5UA 2BS4A 1HG5A 2A2FX 5HXEA 4KMCA 3MACA 3ZMTB 4DR6T 3ZT6A 5ABHA 4IIJE 4JI8T 1R8IA 1LVKA 2WMNA 3VR8A 3NBXX 1YQ4A 3KVBA 1KNPA 4LF5T 2W4XA 3OPCA 2WSSV 3PUYF 3N9PA 4JYAT 1YD8G 2XM1A 5LHGB 5LOVE 2NTYA 3M3ZB 2AXDS 4YJ3E 3ZYLA 2CXFA 5CFBA 2V8SV 2BVLA 1YXRA 1BR0A 1BR1A 1OEDE 4YT0A 3ANWA 5L4EA 2X51A 1W0AA 4NPPA 2KINB 4O2AE 5AQKB 3M65A 3UQ7A 4IREA 5ABFB 2XQ7A 4AQFC 3F2EA 4EGWA 1J5ET 3FB2A 4DIDB 4CN6A 5ABGA 3V5SA 3FZKB 3WAJA 4DR1T 3ETVA 4WBNE 4QH5A 1J1JA 2KSRA 1OEDC 2I59A 1BR2A 3ABVA 4IL4A 2J1DG 4OK0A 2D2SA 4GYSA 2ACZA 2WWVA 4WZXA 4U7YA 3I1AA 2V6XA 4A56A 1IJ6A 3N2KE 2XQYA 4KHPT 1IBMT 5FY0A 2XHEB 1OXZA 2M6BA 4DV4T 4CN1A 3IF8B 1Z0PA 5C3JA 3MKDA 2EHOD 5ABEA 2NWBA 2E5LT 4CI2B 1MMGA 3LK2B 2XUEA 4JI4T 1MMDA 2BG9E 4I4TE 3ZMSB 5FXWA 3RF1A 4AISA 5JR9C 3JADA 4I43B 2X66A 4YXDA 3AEGA 5AQNB 1NAFA 2KMFA 1HX8A 3HKEE 3JAEA 1MMNA 1SE7A 2WDQA 5LBMA 1ZEEA 3OKQA 4JI2T 1ZV4X 3H3AA 2LSIA 3NZPA 2KT9A 2LSYA 4YHJA 4HKAA 3AEAA 2BG9C 4WYVA 2WZIA 4X64T 3U78A 3UFGA 4HFVA 1NENA 1AJ3A 2VURA 1HNZT 4TV8E 2VB6A 4UV9B 2ZMAA 3NWIA 3QC9A 1FJGT 2XTLA 1HNXT 3FZLB 2WY2A 1D1CA 1XZYA 3E08A 3RC8A 4I55E 2BBHA 1H7CA 1T7SA 5TAOA 3GN5B 2V7KA 3FBLA 3OTOT 5LCYA 3Q2MA 3FXDB 3C4WA 3UFEA 3MJXA 2LOPA 4B3ST 3CIRA 4B6XA 1LKXA 4CXYA 3PDYA 2X68A 3ZN1B 3ONLC 3CQXC 4P09A 4PK4A 1M7KA 2XQ4A 3ZKRA 4ZI7E 1N36T 4QXBB 3FZFB 2LKGA
chains in the Genus database with same CATH topology
1I6ZA 5AQSB 3A8YC 3FZMB 5AQIB 1T7SA 1HX1B 5AQHB 5AQNB 3M3ZB 4HWHA 5AQUB 5AQVB 5AQJB 4HWCA 3FZHB 5AQKB 5AQOB 5AQRB 5AQPB 1M7KA 1UK5A 5AQLB 1UGOA 4HWDA 3FZLB 5AQGB 5AQQB 5AQTB 4HWFA 4HWIB 2D9DA 3LDQB 5AQFB 3FZFB 3FZKB 1M62A 5AQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  5AQS B;  3A8Y C;  3FZM B;  5AQI B;  1T7S A;  1HX1 B;  5AQH B;  5AQN B;  3M3Z B;  4HWH A;  5AQU B;  5AQV B;  5AQJ B;  4HWC A;  3FZH B;  5AQK B;  5AQO B;  5AQR B;  5AQP B;  1M7K A;  1UK5 A;  5AQL B;  1UGO A;  4HWD A;  3FZL B;  5AQG B;  5AQQ B;  5AQT B;  4HWF A;  4HWI B;  2D9D A;  3LDQ B;  5AQF B;  3FZF B;  3FZK B;  1M62 A;  5AQM B; 
#chains in the Genus database with same CATH topology
 2N1G A;  1QSD A;  2LM9 A;  3ZPO A;  1N33 T;  4B3M T;  4YTM A;  2XAG B;  3AA6 B;  5F5W A;  4X1K E;  4MFR A;  1W09 A;  4U74 A;  3LFM A;  1KNZ A;  3LJC A;  2JQ9 A;  4JI0 T;  2E9X D;  4DV0 T;  2R6G F;  3RYH E;  1ZOY A;  2JPF A;  4GK5 E;  4PK5 A;  1YQ3 A;  3ZMV B;  4UR9 A;  2LT3 A;  4H63 V;  5M4Y A;  5FMN A;  5L3E B;  4EB6 E;  5JDH A;  4HFD A;  4JV5 T;  2K3W A;  3FZM B;  2XAH B;  2V7M A;  2FJB A;  1XWM A;  3N9N A;  2HPJ A;  3RYC E;  3WI3 A;  5KMG P;  3TKL B;  2LHR A;  2YDR A;  4AKL A;  1YW0 A;  4O4J E;  3ANW B;  3RQW A;  1JNR A;  2D9D A;  4DUZ T;  4OFZ A;  2VAS A;  3OYX A;  4U31 A;  4U72 A;  3KV4 A;  2KXP B;  3VHL A;  2CBI A;  4PJJ A;  5CB4 E;  2H89 A;  3P4R A;  2QA7 A;  3AEB A;  2DLR A;  3RI5 A;  3L3P A;  3NVO A;  3AA0 B;  2L9Q A;  2LE8 A;  2UU9 T;  3HA4 A;  4HE8 A;  2CXL A;  4IL9 A;  5HWY A;  1E1H B;  5J2T E;  1QUU A;  2L3L A;  5FXX A;  4IGU A;  3C64 A;  4LF8 T;  3RQU A;  1CUN A;  2Y6X A;  3F31 A;  2Y8D A;  4LF6 T;  3C50 A;  4G63 A;  2IW5 B;  2VK9 A;  4LFB T;  5JDL A;  4HWF A;  5LHH B;  2PBI A;  4OYK A;  2N2N A;  3I9Y A;  1EZ3 A;  5LP6 E;  5HYA A;  4DMW A;  2WBL A;  3TLT A;  5LMN T;  3RYI E;  3EI0 A;  4JI7 T;  2J4G A;  2C5J A;  2H7V C;  4AKI A;  2CPT A;  2XQ9 A;  4IE7 A;  4YTP A;  2W66 A;  3VU7 H;  2EHO A;  1NEK A;  4WW0 A;  5HXC A;  3ZSS A;  3ZEF B;  3LK4 2;  5H6R B;  4U7I A;  3CWZ B;  4ISS A;  2PFV A;  5AQL B;  4GK0 E;  3AEE A;  4M1P A;  4F8H A;  3AXJ A;  4H9S E;  1T8B A;  3BQL A;  2W62 A;  3O4X E;  4GKJ T;  1HCI A;  3O9X A;  2WDV A;  4H9P C;  3AVR A;  1UX5 A;  5FKY A;  1VOM A;  4JLE A;  5J2U E;  4X5T A;  2VKD A;  4QXC B;  2XAS B;  4AIU A;  5J0Z A;  2J62 A;  4DV7 T;  2WM9 A;  2XQ3 A;  3UUL A;  3HR0 A;  2Q9Q B;  3AA7 B;  4X62 T;  1D0Y A;  4IE4 A;  5FP3 A;  4GKK T;  4HFI A;  2D0U A;  3PTR B;  5JDQ A;  4IDN A;  5AQP B;  5LGU B;  1XDO A;  3ZCI A;  4JEU B;  4DV1 T;  3ZCJ A;  3N9O A;  3ETU A;  3BK9 A;  2WWU A;  2V7L A;  3C4X A;  3RIU A;  2XQA A;  4DBR A;  2B1E A;  3GWH A;  4WBO A;  3UU3 A;  3AE2 A;  1DU2 A;  1OWA A;  1S94 A;  2XY8 B;  3CML A;  4J2C A;  2XAF B;  1SUM B;  3DTO A;  4N78 D;  3RGL A;  5JRC A;  1KF6 A;  1WFD A;  2V7J A;  2ZM8 A;  2Z6E A;  5CA0 E;  1HR0 T;  2JQQ A;  3N5L A;  3PUS A;  4Z91 A;  4EED A;  2HH7 A;  4A5X A;  3RHW A;  2D0T A;  3PU8 A;  2V1D B;  3BQI A;  2DNX A;  3P4S A;  1L0V A;  3AEF A;  4DV2 T;  1D0Z A;  5JDM A;  1M62 A;  4ASK A;  2K24 A;  4X65 T;  3MA9 A;  4H9N C;  3PV0 F;  2W67 A;  2WZH A;  4BJM A;  4AQY T;  3SOL A;  2FJD A;  2WS3 A;  2IC9 A;  2X9H A;  3P8C D;  2E9X A;  5LJN A;  4CXW A;  3MXZ A;  4H63 H;  4CI1 B;  3OYZ A;  3AE3 A;  5C2T A;  5BMV E;  3AE4 A;  4U2Z A;  2LJL A;  1W9R A;  4YSY A;  2ES0 A;  2CM0 A;  4GOU A;  2QGS A;  4PAG A;  2YIN A;  2UUB T;  1QLB A;  1HS7 A;  1MND A;  5LHI B;  2CWO A;  5HEU A;  2XPK A;  5GON E;  3C51 A;  3PJA A;  1FMW A;  1IZN B;  3Q5E A;  4DR3 T;  4LMK A;  4LFA T;  2BDE A;  2ZM2 A;  3UUX B;  2WP9 A;  2CLY B;  2BBJ A;  3EAM A;  5FL0 A;  5LBQ B;  3G06 A;  5FXV A;  1SHZ C;  2UUA T;  4TN7 B;  1XNQ T;  4DR4 T;  4LML A;  4DV6 T;  4X1Y E;  2LOS A;  4UEL A;  2V6Y A;  1IJ5 A;  2BKN A;  3HL6 A;  3P4Q A;  3SS1 A;  4IDO A;  4H9O C;  2M67 A;  4AQF A;  5AQG B;  2UXD T;  4HFB A;  4XAX B;  3UU5 A;  5KXJ A;  3AE7 A;  5HWX A;  3UU6 A;  5ADX L;  3AAI A;  1FIO A;  1SA0 E;  3LG7 A;  1OED A;  2K48 A;  4B3R T;  2OA5 A;  2A3D A;  3N2G E;  3K3Q C;  4HWD A;  3VRB A;  2K9A A;  2H7O A;  1MIV A;  2Q9Q C;  2EHO B;  2XQ8 A;  1MNE A;  5AQF B;  2IDO B;  3RPU A;  3W15 B;  2LM2 A;  3PUV F;  4AQG A;  5AQH B;  4ZI3 D;  2JQH A;  1W0B A;  4DR2 T;  4HWC A;  1XMQ T;  3V5U A;  4AI6 A;  4TWD A;  3ZLI A;  4H9R C;  2CXD A;  4KHZ F;  5L3F B;  3AXJ B;  2HN2 A;  2HHH T;  2RP4 A;  4X66 T;  2FUP A;  4UIG A;  4X20 E;  3RRW A;  2WQY A;  4IE5 A;  5JR9 A;  2LKH A;  4ZI2 D;  4JEH B;  4LMJ A;  3Q5W A;  4ANJ A;  3WAK A;  2YN6 A;  3QK6 A;  2XSA A;  1D1A A;  5CA1 E;  3ZN0 B;  3AVS A;  2WCA A;  4A98 A;  4DUY T;  4JI1 T;  2UUC T;  4EZ4 A;  3IA3 A;  3KV9 A;  2BG9 A;  5CJ5 A;  2MAW A;  3A8Y C;  2Y48 B;  4DVD A;  3FBZ A;  5H6Q B;  2ODU A;  5IYZ E;  3KIN B;  2YU1 A;  2H88 A;  4YLH A;  1V9D A;  4PK6 A;  4GYR A;  4U3C A;  4P0A A;  4QXH B;  2WMO A;  4ZS2 A;  3U3I A;  2YKS A;  2CBJ A;  2JIW A;  2MBG A;  3I0O A;  4O8S A;  4L0R A;  1N34 T;  4YSX A;  2WB5 A;  5IUX A;  4DV5 T;  2BKO A;  4LF9 T;  3IHR A;  3LSV A;  5FY1 A;  2I0M A;  4UVA B;  3PUG A;  5JDG A;  1YKE B;  4ILC A;  2VVN A;  2NR4 A;  1MIY A;  4HEA A;  2W0G A;  4JUY A;  5LJM A;  1UGO A;  3ONX A;  3SRZ A;  3PUQ A;  3Q5X A;  3K8P C;  3AB3 B;  2X0L B;  2PJQ A;  1WR0 A;  2E5V A;  2E9X B;  4BA9 A;  1ZP0 A;  5AQS B;  4L9I A;  3OBV E;  5CGM A;  4Q25 A;  4MHC A;  3AE9 A;  4OX9 T;  3ZT5 A;  2DWG A;  2CLY C;  1O3X A;  2X9Y A;  2H3R A;  1E2A A;  2ZM0 A;  3FXE B;  3AEC A;  2M6I A;  5C8Y E;  2LRK A;  2NW8 A;  1G73 A;  2LSJ A;  4OHF A;  4JI3 T;  1HX1 B;  3FHN A;  4TNV A;  1VRB A;  3N9Q A;  4UF0 A;  1D0X A;  1LRZ A;  2C5I T;  3LK3 B;  4HGA A;  5ABF A;  2JJ9 A;  2QRX A;  5LMU T;  3RRC A;  3VKG A;  4AKG A;  3ZC1 A;  3MK7 C;  2KZ7 B;  5HCJ A;  2LSK A;  3NRY A;  2UXN B;  1Y01 A;  2RPA A;  5HEO A;  3L8R A;  4CXX A;  4ZZB A;  3B13 A;  5L3G B;  3UT5 E;  2HN1 A;  1WR6 A;  1I6Z A;  4L5G A;  3KBU A;  2V6Y B;  3RC3 A;  4Z8X A;  2KND A;  4V1A v;  2GK9 A;  3NRX A;  3T1Y T;  2IC6 A;  4X1I E;  3O1J A;  5HCM A;  4GIW A;  2YU2 A;  3IBP A;  4TUY E;  1MIW A;  3HKD E;  4O4L E;  3RKG A;  1KEY A;  2BS2 A;  5DJQ C;  5HEH A;  2MOZ A;  2E2A A;  4I50 E;  5L3C B;  2OLT A;  4QKN A;  3NKZ A;  1S35 A;  4HWI B;  4ZEY A;  2XAJ B;  2XZE A;  3VRA A;  2X0H A;  5J1G A;  2BS3 A;  3ONJ A;  3QUJ A;  3AAA B;  4WNK A;  3D0T A;  3LBX A;  4EYY R;  5AQO B;  4TWF A;  4MBQ A;  4KI0 F;  3RKO A;  4YJ2 E;  5FVL A;  1LVF A;  3AE1 A;  2W61 A;  5EK2 A;  2UXX B;  2X67 A;  1FMV A;  2BZB A;  1ZKE A;  4YSZ A;  2V5D A;  2W2U A;  4PJN A;  5JDF A;  3QNU A;  5AFU L;  5FL1 A;  5L4H A;  3OJA A;  5AQR B;  4U2Y A;  3N9M A;  4OYJ A;  2XAQ B;  4XBF B;  5LG4 A;  3L39 A;  4MLK A;  3PUZ F;  4O4H E;  2IML A;  5ETW A;  2SPC A;  3CQC B;  3CKD A;  4CN4 A;  1HTJ F;  4TZ4 C;  5JDN A;  5L47 A;  3PE0 A;  2IAK A;  1T72 A;  3QB5 K;  3JC6 C;  4IE0 A;  3DJB A;  3CQG B;  4F6R C;  3EDV A;  4H9Q C;  1IBK T;  3PJA J;  5FXZ A;  3QB5 A;  3PUW F;  4NXN T;  4NUU A;  4PFO A;  1B7T A;  5HXS A;  2CEA A;  1UK5 A;  3ESL A;  4UEM A;  3CK6 A;  4LF4 T;  5FY7 A;  3ZYK A;  4UVB B;  4ILB A;  3KBT A;  2YOE A;  1MMA A;  4UXN B;  5AQJ B;  4PFP A;  2ZLY A;  4YY3 T;  4E7Z A;  4YFS A;  3EUH A;  3ZMU B;  2B76 A;  5EK4 A;  4YTN A;  2LSG A;  5IWA T;  3ZT7 A;  4C91 A;  2NTX A;  5LNK A;  5E0O A;  4NUV A;  4CZZ B;  4QH4 A;  2MYS A;  4JBW F;  2PG8 A;  5A1L A;  3K1S A;  4IT4 A;  1G8X A;  2XM2 A;  2VQE T;  2WDR A;  2ZM6 T;  2CHO A;  3R84 B;  3UTK A;  4ZXL A;  3N2O A;  1U4Q A;  3ZMZ B;  3RIF A;  4QHO A;  4IDQ A;  2CE7 A;  3KDS E;  4PJM A;  3O1H A;  3O1I A;  2FJE A;  2YDQ A;  5HXH A;  3P4P A;  2V26 A;  3EDU A;  5FNV E;  4EAH A;  4HN9 A;  4DMV A;  1XMO T;  5AQI B;  2DCF A;  5JH7 E;  4UF0 B;  4QX8 B;  2YDS A;  3QOF A;  3S4U A;  3EHZ A;  2FJA A;  5FVK A;  3TLW A;  3SFD A;  2P9B A;  3EVY A;  4UV8 B;  1UUR A;  3PUA A;  4QWN B;  3VKH A;  1Z8U A;  3EAB A;  2KWH A;  3B57 A;  2N9D A;  1GQE A;  5JVD E;  2AE9 A;  1T98 A;  1UX4 A;  3TLS A;  3ZYM A;  2X0Y A;  2MTQ A;  2DI4 A;  5JRE A;  1I94 T;  1X79 A;  1U5P A;  1KFY A;  4CI3 B;  3UUM A;  3E0Z A;  5F8P A;  5L3B B;  4K0U A;  1IBL T;  1FEW A;  1WLX A;  2VKH A;  3HKB E;  3KV6 A;  3DP7 A;  4EXT A;  1KNR A;  4IHJ E;  4HTE A;  2LHN A;  3B5M A;  3A5X A;  2BKP A;  1WRD A;  5HXR A;  2JMK A;  5EK3 A;  3H37 A;  5AQQ B;  1WCR A;  4O2B E;  5L2L A;  4DO0 A;  3OVU A;  3GMI A;  2UXB T;  2YK0 A;  4HFH A;  2DWK A;  3UUN A;  2BVM A;  4ADZ A;  3SFE A;  3LBX B;  4KP3 C;  2NW9 A;  5LXT E;  5DAB A;  3RLF F;  1HNW T;  4HFC A;  2LEH A;  1WYC A;  2JQK A;  3Q9D A;  3N9L A;  3AE6 A;  2A9U A;  2Q9Q A;  4PW8 A;  4IDP A;  4ZZC A;  4EEB A;  3ZC0 A;  2KWI B;  5DQW A;  3RIA A;  4DND A;  4I0U A;  4AKH A;  3C98 B;  3KFW X;  2CHN A;  2ACX A;  2JRK A;  4PJL A;  2DL1 A;  4B3T T;  5KDM C;  1Y64 B;  2E8I A;  2W00 A;  5L3D B;  1XDP A;  2X9X A;  1ZHC A;  4EOZ B;  3P7I A;  3PU3 A;  3CPZ A;  1US7 B;  4EIW A;  5JRC B;  3I9W A;  3L09 A;  5AQT B;  2WAU A;  2VL8 A;  3RX6 A;  3LDQ B;  1N32 T;  2YEV C;  4C90 A;  3ZJ2 A;  3P4W A;  3ZST A;  4EV6 A;  3FZH B;  2QYW A;  4P0B A;  3F57 A;  3AED A;  3JC6 D;  1HG2 A;  5BR8 T;  4LF7 T;  2HPL A;  1HFA A;  2NOX A;  5EZY E;  2NW7 A;  5AQM B;  4LFC T;  2VKJ A;  2XQ5 A;  3PUX F;  3IEE A;  4FI5 A;  5HAX A;  3AAE B;  4A97 A;  4HWH A;  2WU2 A;  4O4I E;  2VVS A;  3JCF A;  5HEG A;  2CWY A;  2OV9 A;  3JAF A;  3BQK A;  4HFE A;  3AE8 A;  1VCS A;  2X9W A;  5IHY A;  3R6N A;  2CCQ A;  3H3M A;  4Z90 A;  5AQV B;  3A7M A;  4K0K T;  3VR9 A;  2VKO A;  1KK7 A;  3TLU A;  4DR5 T;  2VWA A;  2CMR A;  2V7I A;  2L8K A;  4U33 A;  4E7S A;  1X9B A;  2XJ7 A;  1JNZ A;  4JI6 T;  3CX6 B;  3GA8 A;  4TX5 A;  5JQG E;  4EZH A;  3CX8 B;  4UVC B;  3CX7 B;  4CQI A;  3C4Z A;  3K3O A;  2DHR A;  4KBM B;  4P1N A;  2W63 A;  2C0S A;  3RH3 A;  3AE5 A;  2EHO C;  1IAP A;  2CRB A;  1HF8 A;  3UU8 A;  3I0Q A;  4G2A A;  2PTF A;  4NXM T;  3UUB A;  2VL0 A;  1J5W A;  3HI2 A;  4ILA A;  4KX6 A;  5LG3 A;  3CVR A;  2ODV A;  2RA1 A;  3T1H T;  2JMH A;  3NZQ A;  2XSB A;  3X1D A;  4XZC A;  4ZI3 C;  1OED B;  3E22 E;  4TNW A;  3SWH A;  5F3J A;  4QH1 A;  4DBQ A;  2VQF T;  4DR7 T;  4IE6 A;  4AXP A;  5FYM A;  2K5B B;  3PUR A;  2KLQ A;  3J7Y q;  4YHH T;  3TLV A;  2IIU A;  2UXC T;  3ZJ1 A;  2Q9Q D;  2A72 A;  4ZI2 C;  2IHR 1;  3RIU C;  2LRL A;  3UU4 A;  4ZS3 A;  2LLY A;  5AQU B;  5JTG A;  5LGN B;  2CA5 A;  4PNI A;  3UQ4 A;  5LA6 E;  4BAY B;  5HEJ A;  4QX7 B;  4JI5 T;  4MAL A;  5JR9 B;  5LYJ E;  4ZHQ E;  4IDZ A;  1VCT A;  1WYB A;  1D1B A;  2WU5 A;  3GN5 A;  1UUS A;  4AKR B;  1UCU A;  4ILU A;  4TWH A;  3MZK B;  3K3N A;  4ZOL E;  5LGT B;  2BG9 B;  4TV9 E;  1BR4 A;  5LB7 B;  4BJN A;  4ERR A;  4DV3 T;  4IST A;  3HKC E;  2MPK A;  3T8O A;  1CHU A;  2C5K T;  2XQ6 A;  1E7P A;  1XNR T;  2FBW A;  3AA1 B;  3KV5 A;  2G0U A;  1YKH B;  4FJO A;  4EYU A;  4COF A;  2E9X C;  2IUB A;  3P50 A;  3J9X 1;  3RYF E;  5KX5 E;  3Q5D A;  2V5C A;  2F4V T;  2NP9 A;  3KVA A;  4KUM B;  1NWM X;  5DQV A;  2QVA A;  2I6H A;  2J47 A;  4NIQ A;  2D5U A;  2BS4 A;  1HG5 A;  2A2F X;  5HXE A;  4KMC A;  3MAC A;  3ZMT B;  4DR6 T;  3ZT6 A;  5ABH A;  4IIJ E;  4JI8 T;  1R8I A;  1LVK A;  2WMN A;  3VR8 A;  3NBX X;  1YQ4 A;  3KVB A;  1KNP A;  4LF5 T;  2W4X A;  3OPC A;  2WSS V;  3PUY F;  3N9P A;  4JYA T;  1YD8 G;  2XM1 A;  5LHG B;  5LOV E;  2NTY A;  3M3Z B;  2AXD S;  4YJ3 E;  3ZYL A;  2CXF A;  5CFB A;  2V8S V;  2BVL A;  1YXR A;  1BR0 A;  1BR1 A;  1OED E;  4YT0 A;  3ANW A;  5L4E A;  2X51 A;  1W0A A;  4NPP A;  2KIN B;  4O2A E;  5AQK B;  3M65 A;  3UQ7 A;  4IRE A;  5ABF B;  2XQ7 A;  4AQF C;  3F2E A;  4EGW A;  1J5E T;  3FB2 A;  4DID B;  4CN6 A;  5ABG A;  3V5S A;  3FZK B;  3WAJ A;  4DR1 T;  3ETV A;  4WBN E;  4QH5 A;  1J1J A;  2KSR A;  1OED C;  2I59 A;  1BR2 A;  3ABV A;  4IL4 A;  2J1D G;  4OK0 A;  2D2S A;  4GYS A;  2ACZ A;  2WWV A;  4WZX A;  4U7Y A;  3I1A A;  2V6X A;  4A56 A;  1IJ6 A;  3N2K E;  2XQY A;  4KHP T;  1IBM T;  5FY0 A;  2XHE B;  1OXZ A;  2M6B A;  4DV4 T;  4CN1 A;  3IF8 B;  1Z0P A;  5C3J A;  3MKD A;  2EHO D;  5ABE A;  2NWB A;  2E5L T;  4CI2 B;  1MMG A;  3LK2 B;  2XUE A;  4JI4 T;  1MMD A;  2BG9 E;  4I4T E;  3ZMS B;  5FXW A;  3RF1 A;  4AIS A;  5JR9 C;  3JAD A;  4I43 B;  2X66 A;  4YXD A;  3AEG A;  5AQN B;  1NAF A;  2KMF A;  1HX8 A;  3HKE E;  3JAE A;  1MMN A;  1SE7 A;  2WDQ A;  5LBM A;  1ZEE A;  3OKQ A;  4JI2 T;  1ZV4 X;  3H3A A;  2LSI A;  3NZP A;  2KT9 A;  2LSY A;  4YHJ A;  4HKA A;  3AEA A;  2BG9 C;  4WYV A;  2WZI A;  4X64 T;  3U78 A;  3UFG A;  4HFV A;  1NEN A;  1AJ3 A;  2VUR A;  1HNZ T;  4TV8 E;  2VB6 A;  4UV9 B;  2ZMA A;  3NWI A;  3QC9 A;  1FJG T;  2XTL A;  1HNX T;  3FZL B;  2WY2 A;  1D1C A;  1XZY A;  3E08 A;  3RC8 A;  4I55 E;  2BBH A;  1H7C A;  1T7S A;  5TAO A;  3GN5 B;  2V7K A;  3FBL A;  3OTO T;  5LCY A;  3Q2M A;  3FXD B;  3C4W A;  3UFE A;  3MJX A;  2LOP A;  4B3S T;  3CIR A;  4B6X A;  1LKX A;  4CXY A;  3PDY A;  2X68 A;  3ZN1 B;  3ONL C;  3CQX C;  4P09 A;  4PK4 A;  1M7K A;  2XQ4 A;  3ZKR A;  4ZI7 E;  1N36 T;  4QXB B;  3FZF B;  2LKG A; 
#chains in the Genus database with same CATH homology
 1I6Z A;  5AQS B;  3A8Y C;  3FZM B;  5AQI B;  1T7S A;  1HX1 B;  5AQH B;  5AQN B;  3M3Z B;  4HWH A;  5AQU B;  5AQV B;  5AQJ B;  4HWC A;  3FZH B;  5AQK B;  5AQO B;  5AQR B;  5AQP B;  1M7K A;  1UK5 A;  5AQL B;  1UGO A;  4HWD A;  3FZL B;  5AQG B;  5AQQ B;  5AQT B;  4HWF A;  4HWI B;  2D9D A;  3LDQ B;  5AQF B;  3FZF B;  3FZK B;  1M62 A;  5AQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...