5JR9C

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
185
structure length
185
Chain Sequence
b'MLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 82
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9C00
5JR9C 5JREA 3ZC0A 5JRCB 5JRCA 3ZC1A 5JR9B 5JR9A
chains in the Genus database with same CATH superfamily
2V7LA 2XTLA 3UT5E 2WBLA 4QWNB 3ONLC 3ZMTB 3ZPOA 2Y8DA 4IGUA 1UX5A 4PJNA 5AQQB 4C91A 3Q5EA 2E8IA 2K24A 4V1Av 5L3CB 4DV1T 3VU7H 3K3QC 3W15B 3CMLA 4EIWA 2ACXA 4ZI7E 2BS4A 2UXDT 5AQGB 4DR5T 5FYMA 5LP6E 2ZM2A 2XAQB 2M67A 2F4VT 4UIGA 3KFWX 1S35A 4IREA 2V6YA 4DMVA 4X20E 3FZFB 2VVNA 3P4RA 3PUYF 4B3ST 2NW7A 1D0YA 2XY8B 1N34T 4JBWF 3RI5A 2WAUA 3ZEFB 4MLKA 3UU6A 3WI3A 2P9BA 3P4PA 2OA5A 1W0AA 3TLTA 4JV5T 4YY3T 1KEYA 2IUBA 2LM2A 3NWIA 3I9YA 5JH7E 4JEHB 5L3FB 2C5JA 3PU8A 2X9WA 2YINA 3N2KE 5LBMA 1OXZA 3A7MA 2CEAA 2L8KA 2KXPB 5BR8T 2CXLA 4NUVA 2PG8A 1N33T 4U3CA 3N9QA 5LCYA 2JQ9A 4X1YE 4Z91A 2XQ7A 4HFCA 3U3IA 5CA0E 4AXPA 1CUNA 4EAHA 2N1GA 5LG4A 1YXRA 3WAKA 4DV7T 1MNDA 3JCFA 3B13A 4LFAT 1MIYA 2G0UA 3T1HT 3HR0A 2WY2A 4DUYT 2VVSA 2BKOA 1HG2A 2B1EA 2CXDA 2V7KA 2DLRA 3ABVA 3LDQB 1W0BA 3ZSSA 2HPLA 5C3JA 3AE4A 2K48A 5L4EA 1VCTA 2N2NA 4YHJA 2IMLA 1W09A 4LF7T 1IJ6A 4HFDA 2NWBA 2V7JA 3UU4A 2CBJA 2FUPA 5DQVA 3AA6B 4HFIA 2VKHA 5FNVE 5AQUB 3AA0B 3AECA 4YTMA 5HXSA 4YJ3E 2A9UA 2EHOB 3UUBA 1BR4A 5EK4A 4TWDA 3ZSTA 1IBKT 4I43B 4XZCA 3AVSA 3C51A 3ZCIA 4OHFA 2UUCT 3ANWA 3SRZA 1BR2A 4DBQA 2MPKA 2X0HA 1I6ZA 3IF8B 3AEAA 4HFBA 2N9DA 3P50A 4IDQA 4X66T 2KWHA 5LHHB 3KBTA 5HXHA 4HFEA 4AISA 1KFYA 1XZYA 3M3ZB 3N9PA 1CHUA 1HX8A 2H89A 1D0ZA 4Z8XA 3C50A 5LOVE 5L4HA 3PUXF 3AAIA 1QLBA 3LG7A 3QOFA 4ZZBA 4X62T 3HKEE 2WMNA 4X5TA 3RYFE 4UEMA 5ABGA 1XMOT 3ZN1B 4IE4A 3NKZA 2LLYA 3LK3B 4WYVA 2W67A 3P4SA 3AEBA 4B6XA 4ILBA 5AQJB 2VL0A 4ILUA 5HEJA 3N5LA 3VRAA 2DL1A 3AXJA 1KNZA 5J1GA 4O8SA 1MMGA 2YKSA 1MMNA 4WW0A 2XQ8A 3N9LA 2HHHT 2LSIA 2X9XA 2IW5B 5C8YE 2C5KT 2CPTA 1US7B 4AKIA 1VOMA 4UV9B 3ESLA 5LMNT 4CXYA 3ZC1A 1N32T 2YK0A 5JDGA 2X0LB 3H37A 3HL6A 4ZS2A 1R8IA 3PDYA 3ZMSB 5FVLA 4H9RC 3QB5A 3PUWF 1LRZA 3EAMA 4ZI3D 4L9IA 2WZHA 5KDMC 5JDQA 3I0OA 1HS7A 4ADZA 3ZMVB 2CCQA 2LJLA 3JC6D 5LGNB 4JI1T 3FB2A 3RYCE 3QC9A 5ADXL 5FVKA 2A2FX 4LF9T 5AQLB 2E9XD 1UUSA 3ZT6A 4LFCT 1Y01A 5LGTB 2EHOD 3KV5A 1DU2A 3E08A 4FI5A 3RKOA 4U7YA 2XM1A 3CX7B 1OEDA 4JI0T 2NW9A 2XPKA 2JMHA 4WBOA 2CWOA 1T8BA 4I4TE 3GWHA 3PURA 1HR0T 2ZM8A 2W0GA 5LB7B 2VKOA 3HKDE 3OBVE 1GQEA 1QUUA 5DABA 2LSKA 5FL1A 1ZV4X 4E7ZA 5HEHA 4LMLA 4EYUA 2H88A 2VQFT 5DQWA 3O1HA 1WYBA 1SUMB 2XUEA 4DV6T 3LK42 4U33A 2XAJB 3RQUA 2W63A 3PU3A 5JDNA 4YTNA 4YSZA 5IYZE 4MHCA 2MYSA 2LSYA 3RIUC 5AQNB 2IIUA 2RPAA 2IC9A 4PNIA 2CRBA 4TUYE 4AKGA 1HF8A 2H3RA 2WQYA 4GK0E 3Q5WA 4AQFC 2X66A 1MMDA 1IBLT 3RRCA 3UQ4A 3BQIA 3C98B 1B7TA 4HWFA 1YQ4A 3J9X1 1D1AA 3VKGA 3FZKB 3EDVA 4JI5T 3L8RA 3AE5A 3ZLIA 2D2SA 1WCRA 3LK2B 1W9RA 4MALA 1SHZC 5AQOB 2WU2A 2WSSV 1HCIA 1I94T 2WDVA 4C90A 3LBXA 2MAWA 4WNKA 5HXEA 1KF6A 5AQIB 4A5XA 3CX6B 3KV9A 3PJAA 2FJEA 5LGUB 3MACA 2ZM0A 3KV6A 3ANWB 2NOXA 2NP9A 3OYXA 1G73A 1WRDA 2Y6XA 4EV6A 1KK7A 3VR8A 3O4XE 4OX9T 4CN4A 2CE7A 4DV0T 2K5BB 5JDFA 3ONXA 4HWDA 3KBUA 5CJ5A 3A8YC 3GMIA 4QX7B 4LMKA 4QH1A 4CI1B 5JVDE 2HN2A 3EVYA 4DV5T 1FMVA 3FZLB 2WCAA 4E7SA 3PUZF 2ODUA 2XQ9A 4LMJA 3ZJ1A 3GA8A 2X67A 4YXDA 2WMOA 2LRKA 3OPCA 1D1CA 4PFPA 5LJNA 3JAEA 1G8XA 5JRCA 5FXXA 4YSXA 3NZQA 2M6IA 3RYIE 3V5SA 2A72A 2XQYA 2ZMAA 4GYRA 4H9NC 3K8PC 2XAFB 3AXJB 4KHZF 2NTYA 2E5VA 4LFBT 5FY0A 4DV2T 2HH7A 2BS2A 2XJ7A 2E5LT 3K3NA 4TWFA 3NBXX 4A98A 4U2ZA 2Q9QD 5HCMA 2XAGB 3RIUA 2LRLA 3MKDA 1Y64B 3P7IA 4DVDA 5ABEA 4IL9A 5H6QB 2BBHA 4EEDA 1D0XA 1NWMX 2V7MA 4H9SE 4JEUB 3UUXB 3KVBA 2OV9A 4HTEA 4EOZB 4GKJT 3PJAJ 5AFUL 4AQFA 2C5IT 3UU3A 3KV4A 2X9HA 1JNRA 4KBMB 4QXHB 4JI7T 3OYZA 3PUAA 3O9XA 4IE6A 4PK4A 2PBIA 2CMRA 2JPFA 2KLQA 2V7IA 2LHNA 3U78A 2JRKA 4IL4A 3FHNA 2W2UA 3D0TA 3ZYLA 3N2GE 2SPCA 1L0VA 4O4LE 4H9QC 4EZ4A 2XASB 3FXDB 5LJMA 5LNKA 5C2TA 4YJ2E 4ZI2D 2KZ7B 3EI0A 5J2UE 1N36T 2XSBA 2YN6A 2DWKA 3FXEB 3PUQA 3MK7C 1XNRT 2ODVA 2YDSA 1OEDB 1FMWA 1ZKEA 4ZOLE 3H3MA 3C4XA 4J2CA 5KMGP 3L3PA 2PFVA 3I1AA 1OEDC 4UV8B 4I50E 1ZOYA 1HG5A 4X1IE 4F6RC 3IEEA 2JQKA 1OEDE 3BQKA 2QVAA 2LHRA 4F8HA 1XMQT 2XQ3A 3UUMA 2CHOA 2DHRA 4ZHQE 2FJBA 4KP3C 1X9BA 4PAGA 4DR4T 2J1DG 4A56A 4CN1A 3PUSA 3VKHA 2QGSA 4H63V 2WP9A 4EGWA 4U72A 3EDUA 4EXTA 4G63A 4UF0A 3R84B 1XDPA 3OJAA 4M1PA 4GK5E 2BG9C 5JREA 2VURA 1KNPA 5KXJA 5JDMA 1MIVA 4IE5A 5FXWA 2CLYC 4EB6E 3UU8A 3K3OA 3KDSE 5CB4E 1UURA 2CBIA 4BAYB 3T1YT 3QNUA 5EK2A 1NAFA 4CI3B 4MBQA 4H63H 4O4JE 3L09A 1UCUA 5L3DB 5DJQC 4KX6A 3RPUA 3NRXA 1BR1A 3FBLA 2C0SA 1KNRA 3LBXB 2KMFA 4KHPT 5FP3A 4JI4T 4PJMA 1HX1B 2K3WA 5JR9C 4BJNA 1J5ET 1SA0E 2BVLA 1J5WA 3E0ZA 2JIWA 3ZN0B 3P4QA 5HWYA 3H3AA 3RQWA 1UGOA 2I59A 4AQGA 1YKEB 3P8CD 3RGLA 5CFBA 2J47A 4I55E 1ZHCA 1V9DA 4CN6A 2B76A 3KVAA 5F5WA 2VWAA 5AQRB 1VCSA 4QX8B 4QHOA 3RLFF 2IDOB 3F31A 3AEGA 2YU1A 4K0KT 4DO0A 2H7VC 4I0UA 3SOLA 3CQGB 1UK5A 2W62A 1IBMT 4AI6A 5JRCB 3GN5A 3ONJA 1ZEEA 3JADA 1JNZA 4ANJA 4CI2B 3RYHE 1WYCA 3SWHA 4GIWA 2E9XA 4IDOA 1T98A 2KWIB 2J62A 4LF4T 3Q9DA 2W4XA 4O2BE 3N2OA 3AE2A 4X65T 4Z90A 4CZZB 5IUXA 2MTQA 4DUZT 4X64T 2E2AA 4KUMB 3RRWA 2BG9A 4OFZA 2K9AA 3AB3B 2Z6EA 3IBPA 2JQQA 5LHGB 5EK3A 5J2TE 4JI2T 1E7PA 5LHIB 2WDQA 3I9WA 3VRBA 2V1DB 4UXNB 3RC8A 3VR9A 4X1KE 5AQHB 3IA3A 1VRBA 1NENA 1MMAA 2LT3A 4COFA 4B3RT 3O1JA 3FZHB 4K0UA 3SFDA 4OK0A 3AEDA 1YW0A 4O2AE 4UELA 4U31A 4IDZA 1M7KA 2MOZA 3C4ZA 4IT4A 4L0RA 5KX5E 2VKDA 5AQTB 3TLSA 5FKYA 1J1JA 4DR7T 3QUJA 2WDRA 4NIQA 5JR9A 3HA4A 5LXTE 2QYWA 3BK9A 1WFDA 2IAKA 2VASA 3AA1B 3CKDA 3CX8B 5HEUA 4JI8T 4TV9E 3I0QA 5LA6E 2W00A 5ABHA 1YQ3A 4HEAA 3SS1A 4QH5A 5A1LA 3CPZA 4P0AA 3FZMB 3ZC0A 1Z8UA 4CXXA 4QXCB 4DV3T 1SE7A 1NEKA 3LSVA 5AQVB 5ETWA 3AAEB 3HI2A 1MNEA 3J7Yq 2JQHA 4DR3T 3CK6A 4G2AA 5GONE 1LVKA 3JAFA 4UF0B 3AAAB 4ILCA 2UU9T 1U5PA 3RF1A 4A97A 2JJ9A 4IIJE 1ZP0A 4LF5T 4PFOA 2WWUA 3MJXA 4YTPA 5LMUT 5AQFB 3G06A 2DI4A 3SFEA 4KMCA 2CA5A 3O1IA 3B57A 3PUVF 1EZ3A 1HTJF 4TN7B 5CGMA 3NVOA 4JI6T 5CA1E 4DR6T 2I6HA 3LJCA 2J4GA 3M65A 5M4YA 4OYJA 1MIWA 1WR0A 5L3EB 4DBRA 4KI0F 2LOSA 4UVAB 2UXBT 3E22E 3PE0A 4HWCA 2R6GF 2QRXA 2ES0A 4U74A 3CIRA 3PUGA 4HE8A 3RIFA 3RH3A 4JYAT 4XBFB 3ZKRA 2YU2A 4CQIA 2LEHA 3EUHA 4EEBA 3ZT5A 3R6NA 3DP7A 2VL8A 2XHEB 4YT0A 2I0MA 5F3JA 3RC3A 3AVRA 4EZHA 4JLEA 1LKXA 2VB6A 4AIUA 4NXMT 4HFVA 3MZKB 2Q9QA 3AEFA 4TX5A 2LKGA 2DCFA 1LVFA 2BVMA 3RKGA 1XNQT 3UQ7A 4TWHA 3TLWA 4JI3T 3DTOA 2DNXA 4IHJE 3NRYA 1E1HB 2X51A 4L5GA 2LSGA 5FY7A 3RX6A 5AQMB 2UUAT 3AE3A 5BMVE 5ABFA 2XQAA 2JMKA 2YOEA 4FJOA 2PJQA 1AJ3A 2KNDA 2XQ5A 3GN5B 2W61A 2AE9A 1X79A 2OLTA 2X68A 2BS3A 4ZI3C 1H7CA 3UFEA 2CXFA 2V8SV 1FIOA 2D0TA 2V6XA 3NZPA 3UTKA 3WAJA 2D0UA 2FJAA 2X9YA 4NXNT 2KSRA 2LE8A 2RA1A 3JC6C 4GYSA 5J0ZA 2E9XB 2WM9A 4O4HE 4DV4T 4O4IE 2BBJA 4EYYR 3IHRA 4NUUA 4HN9A 4GOUA 2E9XC 2HPJA 4HKAA 3P4WA 3ZMUB 2EHOC 2XQ6A 4XAXB 5E0OA 4IDNA 2CM0A 3MXZA 4UR9A 4DR2T 2FBWA 5TAOA 2BG9B 4U2YA 3AE8A 2DWGA 3AA7B 2Y48B 4BA9A 2CLYB 5FMNA 3AE6A 3MA9A 4TZ4C 3ETUA 5HAXA 1Z0PA 3ZJ2A 3K1SA 2HN1A 5JQGE 3Q2MA 2BG9E 2CHNA 4P0BA 5JDHA 2MBGA 4ASKA 5HCJA 2KINB 3UULA 3S4UA 3TKLB 1D1BA 4U7IA 2D5UA 2IC6A 5HEOA 3VHLA 2BKNA 2YDQA 2UXXB 2WB5A 3L39A 1YKHB 3TLVA 4B3TT 1WLXA 1XDOA 5HXCA 2UXCT 3EABA 4GKKT 4AKHA 2ZM6T 4YLHA 1YD8G 1T72A 3HKBE 4YSYA 5JR9B 2V5DA 3N9NA 4NPPA 5AQKB 3F2EA 2NR4A 4ISSA 4IDPA 2L3LA 2YDRA 4UVBB 4YFSA 3X1DA 3BQLA 1HNWT 5FXVA 5AQSB 4MFRA 1O3XA 5AQPB 2V5CA 2QA7A 4AQYT 2LSJA 4DMWA 1IAPA 3UFGA 3ETVA 4IE0A 4TNWA 4Q25A 2WZIA 1HFAA 4WBNE 3AE7A 4WZXA 2X0YA 3A5XA 2WS3A 2FJDA 4HWIB 3CQXC 2UUBT 3B5MA 3PV0F 2XAHB 3QB5K 4ZEYA 3QK6A 4TNVA 4ZXLA 3F57A 4HGAA 5EZYE 3C64A 3OKQA 1IZNB 5HXRA 4DNDA 3AE1A 5LG3A 4ERRA 3PTRB 3V5UA 1S94A 1OWAA 4ZS3A 1WR6A 3CWZB 4N78D 2ACZA 1HNXT 4ILAA 2W66A 2A3DA 2V6YB 5IHYA 5FY1A 5JTGA 2BKPA 4H9OC 3AEEA 2BZBA 3T8OA 2KT9A 2D9DA 2EHOA 2XSAA 4PK5A 1T7SA 2L9QA 4LF8T 4PW8A 4CXWA 2BDEA 2V26A 2VKJA 3TLUA 2NTXA 2YEVC 3EHZA 5L2LA 4ISTA 1QSDA 3N9MA 3HKCE 1M62A 2PTFA 4QKNA 4JUYA 3Q5XA 5HEGA 5HWXA 2VK9A 2LOPA 4DIDB 3CVRA 2CWYA 5IWAT 4PK6A 5L47A 1UX4A 4HFHA 4IE7A 4H9PC 2XZEA 5H6RB 1BR0A 4YHHT 2M6BA 4PJJA 5FXZA 3KINB 2Q9QB 2LM9A 5F8PA 3LFMA 1FEWA 2XQ4A 5L3GB 2Q9QC 3C4WA 4TV8E 2NW8A 4LF6T 3RIAA 4ZZCA 1FJGT 4AKLA 3ZYMA 3UUNA 3ZCJA 3CQCB 3Q5DA 5LYJE 5JDLA 4DR1T 4B3MT 5ABFB 2RP4A 3OVUA 3UU5A 4HWHA 3OTOT 3N9OA 2ZLYA 1E2AA 3ZT7A 5LBQB 3ZMZB 2WWVA 2GK9A 3FBZA 2XM2A 4QXBB 5FL0A 4BJMA 4QH4A 3RHWA 1IJ5A 2LKHA 5HYAA 2UXNB 1U4QA 3DJBA 2WU5A 2IHR1 2VQET 2AXDS 4UVCB 3AE9A 3ZYKA 5L3BB 4ZI2C 4P1NA 4AKRB 2H7OA 1HNZT 4P09A 4PJLA 1XWMA 4OYKA
chains in the Genus database with same CATH topology
2V7LA 1ZV4X 4E7ZA 3DTOA 4EYUA 2XTLA 2DNXA 4MBQA 3UT5E 4IHJE 3NRYA 4H63H 4O4JE 1E1HB 2WBLA 4QWNB 2X51A 3L09A 3ZMTB 1UCUA 2Y8DA 5DQWA 3ZPOA 3O1HA 5L3DB 4L5GA 1WYBA 4IGUA 1UX5A 2LSGA 2XUEA 5DJQC 5FY7A 3RX6A 3LK42 4PJNA 2XAJB 3RPUA 3NRXA 1BR1A 2W63A 4C91A 3PU3A 5BMVE 5JDNA 2JMKA 3FBLA 2C0SA 5IYZE 3LBXB 2E8IA 2K24A 4FJOA 2KMFA 4MHCA 2MYSA 4V1Av 2LSYA 5L3CB 3VU7H 3K3QC 5FP3A 3W15B 2PJQA 3CMLA 1AJ3A 4EIWA 4PJMA 2KNDA 2ACXA 4ZI7E 3GN5B 2W61A 2IC9A 4PNIA 1X79A 4TUYE 4AKGA 2X68A 5FYMA 5JR9C 5LP6E 1HF8A 2H3RA 2ZM2A 2XAQB 2M67A 4BJNA 1SA0E 4GK0E 4ZI3C 1H7CA 3Q5WA 2BVLA 3UFEA 4UIGA 2CXFA 4AQFC 3E0ZA 3KFWX 1FIOA 1S35A 2D0TA 3ZN0B 2X66A 3NZPA 4DMVA 4X20E 5HWYA 3UTKA 1MMDA 3WAJA 2D0UA 3H3AA 2X9YA 2RA1A 2I59A 2LE8A 3JC6C 4GYSA 3RRCA 2E9XB 2NW7A 2WM9A 1D0YA 3BQIA 4AQGA 4O4HE 4O4IE 1YKEB 3P8CD 4EYYR 3IHRA 3C98B 4NUUA 1B7TA 4HN9A 4GOUA 2E9XC 2WAUA 3ZEFB 4MLKA 2HPJA 4HKAA 3WI3A 4I55E 1ZHCA 3ZMUB 2P9BA 3J9X1 1D1AA 1V9DA 2OA5A 3VKGA 2EHOC 3EDVA 3KVAA 4XAXB 5E0OA 2CM0A 3MXZA 2VWAA 3ZLIA 2D2SA 3LK2B 3I9YA 5TAOA 5JH7E 4QX8B 4JEHB 4MALA 4QHOA 5L3FB 2C5JA 1SHZC 3F31A 3PU8A 2WSSV 2DWGA 2X9WA 3AA7B 2YINA 3N2KE 1HCIA 1OXZA 2YU1A 5LBMA 2Y48B 2CEAA 2L8KA 4BA9A 4C90A 4DO0A 2CLYB 2KXPB 3LBXA 2CXLA 2H7VC 3SOLA 4NUVA 5FMNA 2PG8A 3CQGB 3MA9A 3N9QA 4WNKA 5LCYA 4TZ4C 3ETUA 5HAXA 1Z0PA 3ZJ2A 5HXEA 2W62A 4X1YE 4AI6A 5JQGE 5JRCB 3GN5A 3Q2MA 1ZEEA 4P0BA 5JDHA 3U3IA 5CA0E 2MBGA 4ASKA 4AXPA 2KINB 1CUNA 3CX6B 4ANJA 3KV9A 3UULA 3S4UA 3TKLB 2N1GA 4EAHA 5LG4A 3WAKA 5LGUB 1D1BA 3MACA 4CI2B 2ZM0A 2D5UA 2IC6A 1MNDA 3RYHE 3VHLA 1WYCA 3KV6A 3B13A 2UXXB 1MIYA 3SWHA 2G0UA 3ANWB 2NOXA 3HR0A 1YKHB 2NP9A 3OYXA 1G73A 1WRDA 2Y6XA 2E9XA 4GIWA 1HG2A 2B1EA 1WLXA 2CXDA 2V7KA 1T98A 5HXCA 2DLRA 1KK7A 3O4XE 2KWIB 2CE7A 2HPLA 4AKHA 2K5BB 5JDFA 3Q9DA 4O2BE 4YLHA 2K48A 3N2OA 1YD8G 3ONXA 3KBUA 3HKBE 5JR9B 2N2NA 4CZZB 3GMIA 4YHJA 2MTQA 4QX7B 3N9NA 1IJ6A 4KUMB 3RRWA 3F2EA 4CI1B 5JVDE 2NWBA 3EVYA 4ISSA 4OFZA 2V7JA 2K9AA 2L3LA 4UVBB 1FMVA 3AB3B 5DQVA 3AA6B 2Z6EA 3IBPA 4YFSA 2JQQA 5LHGB 4E7SA 3BQLA 5EK3A 5J2TE 2ODUA 2VKHA 5FXVA 5LHIB 5FNVE 3ZJ1A 3GA8A 4MFRA 2X67A 3I9WA 1O3XA 2V1DB 2WMOA 3AA0B 4UXNB 2QA7A 3RC8A 1D1CA 4PFPA 4X1KE 5LJNA 1G8XA 5JRCA 2LSJA 5FXXA 1VRBA 4DMWA 3NZQA 1IAPA 3RYIE 1MMAA 3ETVA 3V5SA 4YJ3E 5HXSA 2LT3A 2A72A 2XQYA 2EHOB 4IE0A 3O1JA 1BR4A 5EK4A 4K0UA 2ZMAA 4GYRA 4H9NC 3K8PC 1HFAA 2XAFB 4OK0A 4WBNE 2NTYA 4I43B 4XZCA 1YW0A 3AVSA 5FY0A 4O2AE 3C51A 4UELA 3ZCIA 2HH7A 3A5XA 4IDZA 4OHFA 3ANWA 3SRZA 1BR2A 3K3NA 4DBQA 3CQXC 3NBXX 2MOZA 2Q9QD 3C4ZA 3IF8B 2XAHB 2XAGB 4L0RA 5KX5E 2VKDA 2N9DA 3QK6A 3MKDA 3F57A 2KWHA 1Y64B 3P7IA 4HGAA 5EZYE 3C64A 4DVDA 3QUJA 3OKQA 5H6QB 5LHHB 1IZNB 3KBTA 5HXRA 4DNDA 5HXHA 5JR9A 1D0XA 1NWMX 2V7MA 4ERRA 3PTRB 4H9SE 4JEUB 3UUXB 3KVBA 3V5UA 3HA4A 4HTEA 1S94A 5LXTE 4EOZB 3BK9A 3N9PA 5AFUL 4AQFA 2C5IT 2IAKA 2VASA 1HX8A 3AA1B 3KV4A 1D0ZA 1OWAA 2X9HA 3CKDA 3CX8B 4Z8XA 4ZS3A 3C50A 4KBMB 5LOVE 1WR6A 3CWZB 4N78D 4QXHB 4TV9E 3I0QA 5LA6E 3OYZA 3AAIA 2A3DA 3PUAA 5IHYA 3LG7A 2W00A 3HKEE 2WMNA 3O9XA 4IE6A 5FY1A 4PK4A 4HEAA 2PBIA 2CMRA 3SS1A 2JPFA 2KLQA 3RYFE 5A1LA 4UEMA 4H9OC 2V7IA 3CPZA 3ZN1B 2LHNA 4IE4A 4P0AA 3LK3B 3U78A 2BZBA 2JRKA 3T8OA 2KT9A 3ZC0A 4CXXA 4B6XA 3FHNA 2EHOA 4QXCB 4ILUA 4PK5A 2L9QA 3N5LA 3D0TA 4PW8A 3ZYLA 3N2GE 2SPCA 4CXWA 2BDEA 4O4LE 2V26A 4H9QC 3AAEB 2VKJA 5ETWA 2NTXA 1KNZA 2YEVC 3HI2A 1MNEA 4EZ4A 5J1GA 5L2LA 3J7Yq 2XASB 4ISTA 4G2AA 1QSDA 3FXDB 5GONE 5LJMA 3N9MA 1LVKA 5LNKA 4O8SA 4YJ2E 4ZI2D 4UF0B 3HKCE 1MMGA 2KZ7B 3AAAB 5J2UE 1MMNA 1U5PA 4QKNA 4JUYA 3Q5XA 4WW0A 2JJ9A 4IIJE 2DWKA 5HWXA 2VK9A 2LOPA 3FXEB 3CVRA 3PUQA 3N9LA 4PFOA 3MK7C 2LSIA 2X9XA 2IW5B 2CWYA 2WWUA 5C8YE 2C5KT 2ODVA 4PK6A 1US7B 3MJXA 1FMWA 1ZKEA 1UX4A 1VOMA 4ZOLE 4UV9B 3C4XA 4IE7A 4AKIA 3ESLA 4CXYA 4H9PC 4J2CA 2DI4A 5KMGP 3L3PA 5H6RB 3ZC1A 2PFVA 1BR0A 2YK0A 3I1AA 4KMCA 2CA5A 3O1IA 5JDGA 3B57A 1EZ3A 1HTJF 2X0LB 4TN7B 3H37A 4PJJA 4UV8B 5FXZA 3HL6A 4ZS2A 5CA1E 4I50E 3KINB 2Q9QB 1HG5A 2LM9A 5F8PA 3LJCA 4X1IE 3M65A 4F6RC 5M4YA 3LFMA 3PDYA 4OYJA 1MIWA 1FEWA 5L3EB 4DBRA 3IEEA 2LOSA 4UVAB 5L3GB 3ZMSB 2Q9QC 3E22E 3BQKA 3PE0A 4H9RC 3C4WA 4TV8E 2NW8A 2LHRA 1LRZA 2ES0A 3UUMA 3ZYMA 4U74A 3UUNA 4AKLA 2DHRA 3ZCJA 4ZHQE 3PUGA 4KP3C 4ZI3D 4L9IA 3CQCB 5KDMC 4PAGA 5LYJE 5JDLA 2J1DG 4A56A 4HE8A 5JDQA 3I0OA 2RP4A 3RH3A 1HS7A 4XBFB 3PUSA 4ADZA 3ZMVB 2CCQA 2LJLA 3JC6D 3VKHA 2QGSA 5LGNB 3FB2A 4H63V 3RYCE 2YU2A 3QC9A 2LEHA 4U72A 4CQIA 3EDUA 5ADXL 4EXTA 2A2FX 3EUHA 3N9OA 4G63A 2ZLYA 4UF0A 3R6NA 3DP7A 2VL8A 2E9XD 5LBQB 2XHEB 3ZMZB 3R84B 2GK9A 3OJAA 3FBZA 5LGTB 4QXBB 2EHOD 3KV5A 4M1PA 5F3JA 4BJMA 4GK5E 3RC3A 1IJ5A 3AVRA 3E08A 4EZHA 4FI5A 5JREA 3RKOA 3CX7B 4JLEA 2NW9A 2JMHA 5JDMA 4WBOA 5HYAA 2CWOA 2UXNB 1MIVA 1LKXA 1U4QA 2VB6A 3DJBA 4IE5A 5FXWA 2CLYC 4EB6E 4HFVA 3K3OA 4I4TE 3KDSE 4UVCB 5CB4E 3GWHA 3PURA 3ZYKA 3MZKB 5L3BB 2Q9QA 2W0GA 2ZM8A 4TX5A 2VKOA 4ZI2C 4BAYB 2DCFA 3HKDE 1LVFA 3OBVE 2BVMA 4AKRB 2H7OA 1QUUA 4P09A 5EK2A 4PJLA 5DABA 2LSKA 4OYKA 1NAFA 4CI3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 C;  5JRE A;  3ZC0 A;  5JRC B;  5JRC A;  3ZC1 A;  5JR9 B;  5JR9 A; 
#chains in the Genus database with same CATH topology
 2V7L A;  2XTL A;  3UT5 E;  2WBL A;  4QWN B;  3ONL C;  3ZMT B;  3ZPO A;  2Y8D A;  4IGU A;  1UX5 A;  4PJN A;  5AQQ B;  4C91 A;  3Q5E A;  2E8I A;  2K24 A;  4V1A v;  5L3C B;  4DV1 T;  3VU7 H;  3K3Q C;  3W15 B;  3CML A;  4EIW A;  2ACX A;  4ZI7 E;  2BS4 A;  2UXD T;  5AQG B;  4DR5 T;  5FYM A;  5LP6 E;  2ZM2 A;  2XAQ B;  2M67 A;  2F4V T;  4UIG A;  3KFW X;  1S35 A;  4IRE A;  2V6Y A;  4DMV A;  4X20 E;  3FZF B;  2VVN A;  3P4R A;  3PUY F;  4B3S T;  2NW7 A;  1D0Y A;  2XY8 B;  1N34 T;  4JBW F;  3RI5 A;  2WAU A;  3ZEF B;  4MLK A;  3UU6 A;  3WI3 A;  2P9B A;  3P4P A;  2OA5 A;  1W0A A;  3TLT A;  4JV5 T;  4YY3 T;  1KEY A;  2IUB A;  2LM2 A;  3NWI A;  3I9Y A;  5JH7 E;  4JEH B;  5L3F B;  2C5J A;  3PU8 A;  2X9W A;  2YIN A;  3N2K E;  5LBM A;  1OXZ A;  3A7M A;  2CEA A;  2L8K A;  2KXP B;  5BR8 T;  2CXL A;  4NUV A;  2PG8 A;  1N33 T;  4U3C A;  3N9Q A;  5LCY A;  2JQ9 A;  4X1Y E;  4Z91 A;  2XQ7 A;  4HFC A;  3U3I A;  5CA0 E;  4AXP A;  1CUN A;  4EAH A;  2N1G A;  5LG4 A;  1YXR A;  3WAK A;  4DV7 T;  1MND A;  3JCF A;  3B13 A;  4LFA T;  1MIY A;  2G0U A;  3T1H T;  3HR0 A;  2WY2 A;  4DUY T;  2VVS A;  2BKO A;  1HG2 A;  2B1E A;  2CXD A;  2V7K A;  2DLR A;  3ABV A;  3LDQ B;  1W0B A;  3ZSS A;  2HPL A;  5C3J A;  3AE4 A;  2K48 A;  5L4E A;  1VCT A;  2N2N A;  4YHJ A;  2IML A;  1W09 A;  4LF7 T;  1IJ6 A;  4HFD A;  2NWB A;  2V7J A;  3UU4 A;  2CBJ A;  2FUP A;  5DQV A;  3AA6 B;  4HFI A;  2VKH A;  5FNV E;  5AQU B;  3AA0 B;  3AEC A;  4YTM A;  5HXS A;  4YJ3 E;  2A9U A;  2EHO B;  3UUB A;  1BR4 A;  5EK4 A;  4TWD A;  3ZST A;  1IBK T;  4I43 B;  4XZC A;  3AVS A;  3C51 A;  3ZCI A;  4OHF A;  2UUC T;  3ANW A;  3SRZ A;  1BR2 A;  4DBQ A;  2MPK A;  2X0H A;  1I6Z A;  3IF8 B;  3AEA A;  4HFB A;  2N9D A;  3P50 A;  4IDQ A;  4X66 T;  2KWH A;  5LHH B;  3KBT A;  5HXH A;  4HFE A;  4AIS A;  1KFY A;  1XZY A;  3M3Z B;  3N9P A;  1CHU A;  1HX8 A;  2H89 A;  1D0Z A;  4Z8X A;  3C50 A;  5LOV E;  5L4H A;  3PUX F;  3AAI A;  1QLB A;  3LG7 A;  3QOF A;  4ZZB A;  4X62 T;  3HKE E;  2WMN A;  4X5T A;  3RYF E;  4UEM A;  5ABG A;  1XMO T;  3ZN1 B;  4IE4 A;  3NKZ A;  2LLY A;  3LK3 B;  4WYV A;  2W67 A;  3P4S A;  3AEB A;  4B6X A;  4ILB A;  5AQJ B;  2VL0 A;  4ILU A;  5HEJ A;  3N5L A;  3VRA A;  2DL1 A;  3AXJ A;  1KNZ A;  5J1G A;  4O8S A;  1MMG A;  2YKS A;  1MMN A;  4WW0 A;  2XQ8 A;  3N9L A;  2HHH T;  2LSI A;  2X9X A;  2IW5 B;  5C8Y E;  2C5K T;  2CPT A;  1US7 B;  4AKI A;  1VOM A;  4UV9 B;  3ESL A;  5LMN T;  4CXY A;  3ZC1 A;  1N32 T;  2YK0 A;  5JDG A;  2X0L B;  3H37 A;  3HL6 A;  4ZS2 A;  1R8I A;  3PDY A;  3ZMS B;  5FVL A;  4H9R C;  3QB5 A;  3PUW F;  1LRZ A;  3EAM A;  4ZI3 D;  4L9I A;  2WZH A;  5KDM C;  5JDQ A;  3I0O A;  1HS7 A;  4ADZ A;  3ZMV B;  2CCQ A;  2LJL A;  3JC6 D;  5LGN B;  4JI1 T;  3FB2 A;  3RYC E;  3QC9 A;  5ADX L;  5FVK A;  2A2F X;  4LF9 T;  5AQL B;  2E9X D;  1UUS A;  3ZT6 A;  4LFC T;  1Y01 A;  5LGT B;  2EHO D;  3KV5 A;  1DU2 A;  3E08 A;  4FI5 A;  3RKO A;  4U7Y A;  2XM1 A;  3CX7 B;  1OED A;  4JI0 T;  2NW9 A;  2XPK A;  2JMH A;  4WBO A;  2CWO A;  1T8B A;  4I4T E;  3GWH A;  3PUR A;  1HR0 T;  2ZM8 A;  2W0G A;  5LB7 B;  2VKO A;  3HKD E;  3OBV E;  1GQE A;  1QUU A;  5DAB A;  2LSK A;  5FL1 A;  1ZV4 X;  4E7Z A;  5HEH A;  4LML A;  4EYU A;  2H88 A;  2VQF T;  5DQW A;  3O1H A;  1WYB A;  1SUM B;  2XUE A;  4DV6 T;  3LK4 2;  4U33 A;  2XAJ B;  3RQU A;  2W63 A;  3PU3 A;  5JDN A;  4YTN A;  4YSZ A;  5IYZ E;  4MHC A;  2MYS A;  2LSY A;  3RIU C;  5AQN B;  2IIU A;  2RPA A;  2IC9 A;  4PNI A;  2CRB A;  4TUY E;  4AKG A;  1HF8 A;  2H3R A;  2WQY A;  4GK0 E;  3Q5W A;  4AQF C;  2X66 A;  1MMD A;  1IBL T;  3RRC A;  3UQ4 A;  3BQI A;  3C98 B;  1B7T A;  4HWF A;  1YQ4 A;  3J9X 1;  1D1A A;  3VKG A;  3FZK B;  3EDV A;  4JI5 T;  3L8R A;  3AE5 A;  3ZLI A;  2D2S A;  1WCR A;  3LK2 B;  1W9R A;  4MAL A;  1SHZ C;  5AQO B;  2WU2 A;  2WSS V;  1HCI A;  1I94 T;  2WDV A;  4C90 A;  3LBX A;  2MAW A;  4WNK A;  5HXE A;  1KF6 A;  5AQI B;  4A5X A;  3CX6 B;  3KV9 A;  3PJA A;  2FJE A;  5LGU B;  3MAC A;  2ZM0 A;  3KV6 A;  3ANW B;  2NOX A;  2NP9 A;  3OYX A;  1G73 A;  1WRD A;  2Y6X A;  4EV6 A;  1KK7 A;  3VR8 A;  3O4X E;  4OX9 T;  4CN4 A;  2CE7 A;  4DV0 T;  2K5B B;  5JDF A;  3ONX A;  4HWD A;  3KBU A;  5CJ5 A;  3A8Y C;  3GMI A;  4QX7 B;  4LMK A;  4QH1 A;  4CI1 B;  5JVD E;  2HN2 A;  3EVY A;  4DV5 T;  1FMV A;  3FZL B;  2WCA A;  4E7S A;  3PUZ F;  2ODU A;  2XQ9 A;  4LMJ A;  3ZJ1 A;  3GA8 A;  2X67 A;  4YXD A;  2WMO A;  2LRK A;  3OPC A;  1D1C A;  4PFP A;  5LJN A;  3JAE A;  1G8X A;  5JRC A;  5FXX A;  4YSX A;  3NZQ A;  2M6I A;  3RYI E;  3V5S A;  2A72 A;  2XQY A;  2ZMA A;  4GYR A;  4H9N C;  3K8P C;  2XAF B;  3AXJ B;  4KHZ F;  2NTY A;  2E5V A;  4LFB T;  5FY0 A;  4DV2 T;  2HH7 A;  2BS2 A;  2XJ7 A;  2E5L T;  3K3N A;  4TWF A;  3NBX X;  4A98 A;  4U2Z A;  2Q9Q D;  5HCM A;  2XAG B;  3RIU A;  2LRL A;  3MKD A;  1Y64 B;  3P7I A;  4DVD A;  5ABE A;  4IL9 A;  5H6Q B;  2BBH A;  4EED A;  1D0X A;  1NWM X;  2V7M A;  4H9S E;  4JEU B;  3UUX B;  3KVB A;  2OV9 A;  4HTE A;  4EOZ B;  4GKJ T;  3PJA J;  5AFU L;  4AQF A;  2C5I T;  3UU3 A;  3KV4 A;  2X9H A;  1JNR A;  4KBM B;  4QXH B;  4JI7 T;  3OYZ A;  3PUA A;  3O9X A;  4IE6 A;  4PK4 A;  2PBI A;  2CMR A;  2JPF A;  2KLQ A;  2V7I A;  2LHN A;  3U78 A;  2JRK A;  4IL4 A;  3FHN A;  2W2U A;  3D0T A;  3ZYL A;  3N2G E;  2SPC A;  1L0V A;  4O4L E;  4H9Q C;  4EZ4 A;  2XAS B;  3FXD B;  5LJM A;  5LNK A;  5C2T A;  4YJ2 E;  4ZI2 D;  2KZ7 B;  3EI0 A;  5J2U E;  1N36 T;  2XSB A;  2YN6 A;  2DWK A;  3FXE B;  3PUQ A;  3MK7 C;  1XNR T;  2ODV A;  2YDS A;  1OED B;  1FMW A;  1ZKE A;  4ZOL E;  3H3M A;  3C4X A;  4J2C A;  5KMG P;  3L3P A;  2PFV A;  3I1A A;  1OED C;  4UV8 B;  4I50 E;  1ZOY A;  1HG5 A;  4X1I E;  4F6R C;  3IEE A;  2JQK A;  1OED E;  3BQK A;  2QVA A;  2LHR A;  4F8H A;  1XMQ T;  2XQ3 A;  3UUM A;  2CHO A;  2DHR A;  4ZHQ E;  2FJB A;  4KP3 C;  1X9B A;  4PAG A;  4DR4 T;  2J1D G;  4A56 A;  4CN1 A;  3PUS A;  3VKH A;  2QGS A;  4H63 V;  2WP9 A;  4EGW A;  4U72 A;  3EDU A;  4EXT A;  4G63 A;  4UF0 A;  3R84 B;  1XDP A;  3OJA A;  4M1P A;  4GK5 E;  2BG9 C;  5JRE A;  2VUR A;  1KNP A;  5KXJ A;  5JDM A;  1MIV A;  4IE5 A;  5FXW A;  2CLY C;  4EB6 E;  3UU8 A;  3K3O A;  3KDS E;  5CB4 E;  1UUR A;  2CBI A;  4BAY B;  3T1Y T;  3QNU A;  5EK2 A;  1NAF A;  4CI3 B;  4MBQ A;  4H63 H;  4O4J E;  3L09 A;  1UCU A;  5L3D B;  5DJQ C;  4KX6 A;  3RPU A;  3NRX A;  1BR1 A;  3FBL A;  2C0S A;  1KNR A;  3LBX B;  2KMF A;  4KHP T;  5FP3 A;  4JI4 T;  4PJM A;  1HX1 B;  2K3W A;  5JR9 C;  4BJN A;  1J5E T;  1SA0 E;  2BVL A;  1J5W A;  3E0Z A;  2JIW A;  3ZN0 B;  3P4Q A;  5HWY A;  3H3A A;  3RQW A;  1UGO A;  2I59 A;  4AQG A;  1YKE B;  3P8C D;  3RGL A;  5CFB A;  2J47 A;  4I55 E;  1ZHC A;  1V9D A;  4CN6 A;  2B76 A;  3KVA A;  5F5W A;  2VWA A;  5AQR B;  1VCS A;  4QX8 B;  4QHO A;  3RLF F;  2IDO B;  3F31 A;  3AEG A;  2YU1 A;  4K0K T;  4DO0 A;  2H7V C;  4I0U A;  3SOL A;  3CQG B;  1UK5 A;  2W62 A;  1IBM T;  4AI6 A;  5JRC B;  3GN5 A;  3ONJ A;  1ZEE A;  3JAD A;  1JNZ A;  4ANJ A;  4CI2 B;  3RYH E;  1WYC A;  3SWH A;  4GIW A;  2E9X A;  4IDO A;  1T98 A;  2KWI B;  2J62 A;  4LF4 T;  3Q9D A;  2W4X A;  4O2B E;  3N2O A;  3AE2 A;  4X65 T;  4Z90 A;  4CZZ B;  5IUX A;  2MTQ A;  4DUZ T;  4X64 T;  2E2A A;  4KUM B;  3RRW A;  2BG9 A;  4OFZ A;  2K9A A;  3AB3 B;  2Z6E A;  3IBP A;  2JQQ A;  5LHG B;  5EK3 A;  5J2T E;  4JI2 T;  1E7P A;  5LHI B;  2WDQ A;  3I9W A;  3VRB A;  2V1D B;  4UXN B;  3RC8 A;  3VR9 A;  4X1K E;  5AQH B;  3IA3 A;  1VRB A;  1NEN A;  1MMA A;  2LT3 A;  4COF A;  4B3R T;  3O1J A;  3FZH B;  4K0U A;  3SFD A;  4OK0 A;  3AED A;  1YW0 A;  4O2A E;  4UEL A;  4U31 A;  4IDZ A;  1M7K A;  2MOZ A;  3C4Z A;  4IT4 A;  4L0R A;  5KX5 E;  2VKD A;  5AQT B;  3TLS A;  5FKY A;  1J1J A;  4DR7 T;  3QUJ A;  2WDR A;  4NIQ A;  5JR9 A;  3HA4 A;  5LXT E;  2QYW A;  3BK9 A;  1WFD A;  2IAK A;  2VAS A;  3AA1 B;  3CKD A;  3CX8 B;  5HEU A;  4JI8 T;  4TV9 E;  3I0Q A;  5LA6 E;  2W00 A;  5ABH A;  1YQ3 A;  4HEA A;  3SS1 A;  4QH5 A;  5A1L A;  3CPZ A;  4P0A A;  3FZM B;  3ZC0 A;  1Z8U A;  4CXX A;  4QXC B;  4DV3 T;  1SE7 A;  1NEK A;  3LSV A;  5AQV B;  5ETW A;  3AAE B;  3HI2 A;  1MNE A;  3J7Y q;  2JQH A;  4DR3 T;  3CK6 A;  4G2A A;  5GON E;  1LVK A;  3JAF A;  4UF0 B;  3AAA B;  4ILC A;  2UU9 T;  1U5P A;  3RF1 A;  4A97 A;  2JJ9 A;  4IIJ E;  1ZP0 A;  4LF5 T;  4PFO A;  2WWU A;  3MJX A;  4YTP A;  5LMU T;  5AQF B;  3G06 A;  2DI4 A;  3SFE A;  4KMC A;  2CA5 A;  3O1I A;  3B57 A;  3PUV F;  1EZ3 A;  1HTJ F;  4TN7 B;  5CGM A;  3NVO A;  4JI6 T;  5CA1 E;  4DR6 T;  2I6H A;  3LJC A;  2J4G A;  3M65 A;  5M4Y A;  4OYJ A;  1MIW A;  1WR0 A;  5L3E B;  4DBR A;  4KI0 F;  2LOS A;  4UVA B;  2UXB T;  3E22 E;  3PE0 A;  4HWC A;  2R6G F;  2QRX A;  2ES0 A;  4U74 A;  3CIR A;  3PUG A;  4HE8 A;  3RIF A;  3RH3 A;  4JYA T;  4XBF B;  3ZKR A;  2YU2 A;  4CQI A;  2LEH A;  3EUH A;  4EEB A;  3ZT5 A;  3R6N A;  3DP7 A;  2VL8 A;  2XHE B;  4YT0 A;  2I0M A;  5F3J A;  3RC3 A;  3AVR A;  4EZH A;  4JLE A;  1LKX A;  2VB6 A;  4AIU A;  4NXM T;  4HFV A;  3MZK B;  2Q9Q A;  3AEF A;  4TX5 A;  2LKG A;  2DCF A;  1LVF A;  2BVM A;  3RKG A;  1XNQ T;  3UQ7 A;  4TWH A;  3TLW A;  4JI3 T;  3DTO A;  2DNX A;  4IHJ E;  3NRY A;  1E1H B;  2X51 A;  4L5G A;  2LSG A;  5FY7 A;  3RX6 A;  5AQM B;  2UUA T;  3AE3 A;  5BMV E;  5ABF A;  2XQA A;  2JMK A;  2YOE A;  4FJO A;  2PJQ A;  1AJ3 A;  2KND A;  2XQ5 A;  3GN5 B;  2W61 A;  2AE9 A;  1X79 A;  2OLT A;  2X68 A;  2BS3 A;  4ZI3 C;  1H7C A;  3UFE A;  2CXF A;  2V8S V;  1FIO A;  2D0T A;  2V6X A;  3NZP A;  3UTK A;  3WAJ A;  2D0U A;  2FJA A;  2X9Y A;  4NXN T;  2KSR A;  2LE8 A;  2RA1 A;  3JC6 C;  4GYS A;  5J0Z A;  2E9X B;  2WM9 A;  4O4H E;  4DV4 T;  4O4I E;  2BBJ A;  4EYY R;  3IHR A;  4NUU A;  4HN9 A;  4GOU A;  2E9X C;  2HPJ A;  4HKA A;  3P4W A;  3ZMU B;  2EHO C;  2XQ6 A;  4XAX B;  5E0O A;  4IDN A;  2CM0 A;  3MXZ A;  4UR9 A;  4DR2 T;  2FBW A;  5TAO A;  2BG9 B;  4U2Y A;  3AE8 A;  2DWG A;  3AA7 B;  2Y48 B;  4BA9 A;  2CLY B;  5FMN A;  3AE6 A;  3MA9 A;  4TZ4 C;  3ETU A;  5HAX A;  1Z0P A;  3ZJ2 A;  3K1S A;  2HN1 A;  5JQG E;  3Q2M A;  2BG9 E;  2CHN A;  4P0B A;  5JDH A;  2MBG A;  4ASK A;  5HCJ A;  2KIN B;  3UUL A;  3S4U A;  3TKL B;  1D1B A;  4U7I A;  2D5U A;  2IC6 A;  5HEO A;  3VHL A;  2BKN A;  2YDQ A;  2UXX B;  2WB5 A;  3L39 A;  1YKH B;  3TLV A;  4B3T T;  1WLX A;  1XDO A;  5HXC A;  2UXC T;  3EAB A;  4GKK T;  4AKH A;  2ZM6 T;  4YLH A;  1YD8 G;  1T72 A;  3HKB E;  4YSY A;  5JR9 B;  2V5D A;  3N9N A;  4NPP A;  5AQK B;  3F2E A;  2NR4 A;  4ISS A;  4IDP A;  2L3L A;  2YDR A;  4UVB B;  4YFS A;  3X1D A;  3BQL A;  1HNW T;  5FXV A;  5AQS B;  4MFR A;  1O3X A;  5AQP B;  2V5C A;  2QA7 A;  4AQY T;  2LSJ A;  4DMW A;  1IAP A;  3UFG A;  3ETV A;  4IE0 A;  4TNW A;  4Q25 A;  2WZI A;  1HFA A;  4WBN E;  3AE7 A;  4WZX A;  2X0Y A;  3A5X A;  2WS3 A;  2FJD A;  4HWI B;  3CQX C;  2UUB T;  3B5M A;  3PV0 F;  2XAH B;  3QB5 K;  4ZEY A;  3QK6 A;  4TNV A;  4ZXL A;  3F57 A;  4HGA A;  5EZY E;  3C64 A;  3OKQ A;  1IZN B;  5HXR A;  4DND A;  3AE1 A;  5LG3 A;  4ERR A;  3PTR B;  3V5U A;  1S94 A;  1OWA A;  4ZS3 A;  1WR6 A;  3CWZ B;  4N78 D;  2ACZ A;  1HNX T;  4ILA A;  2W66 A;  2A3D A;  2V6Y B;  5IHY A;  5FY1 A;  5JTG A;  2BKP A;  4H9O C;  3AEE A;  2BZB A;  3T8O A;  2KT9 A;  2D9D A;  2EHO A;  2XSA A;  4PK5 A;  1T7S A;  2L9Q A;  4LF8 T;  4PW8 A;  4CXW A;  2BDE A;  2V26 A;  2VKJ A;  3TLU A;  2NTX A;  2YEV C;  3EHZ A;  5L2L A;  4IST A;  1QSD A;  3N9M A;  3HKC E;  1M62 A;  2PTF A;  4QKN A;  4JUY A;  3Q5X A;  5HEG A;  5HWX A;  2VK9 A;  2LOP A;  4DID B;  3CVR A;  2CWY A;  5IWA T;  4PK6 A;  5L47 A;  1UX4 A;  4HFH A;  4IE7 A;  4H9P C;  2XZE A;  5H6R B;  1BR0 A;  4YHH T;  2M6B A;  4PJJ A;  5FXZ A;  3KIN B;  2Q9Q B;  2LM9 A;  5F8P A;  3LFM A;  1FEW A;  2XQ4 A;  5L3G B;  2Q9Q C;  3C4W A;  4TV8 E;  2NW8 A;  4LF6 T;  3RIA A;  4ZZC A;  1FJG T;  4AKL A;  3ZYM A;  3UUN A;  3ZCJ A;  3CQC B;  3Q5D A;  5LYJ E;  5JDL A;  4DR1 T;  4B3M T;  5ABF B;  2RP4 A;  3OVU A;  3UU5 A;  4HWH A;  3OTO T;  3N9O A;  2ZLY A;  1E2A A;  3ZT7 A;  5LBQ B;  3ZMZ B;  2WWV A;  2GK9 A;  3FBZ A;  2XM2 A;  4QXB B;  5FL0 A;  4BJM A;  4QH4 A;  3RHW A;  1IJ5 A;  2LKH A;  5HYA A;  2UXN B;  1U4Q A;  3DJB A;  2WU5 A;  2IHR 1;  2VQE T;  2AXD S;  4UVC B;  3AE9 A;  3ZYK A;  5L3B B;  4ZI2 C;  4P1N A;  4AKR B;  2H7O A;  1HNZ T;  4P09 A;  4PJL A;  1XWM A;  4OYK A; 
#chains in the Genus database with same CATH homology
 2V7L A;  1ZV4 X;  4E7Z A;  3DTO A;  4EYU A;  2XTL A;  2DNX A;  4MBQ A;  3UT5 E;  4IHJ E;  3NRY A;  4H63 H;  4O4J E;  1E1H B;  2WBL A;  4QWN B;  2X51 A;  3L09 A;  3ZMT B;  1UCU A;  2Y8D A;  5DQW A;  3ZPO A;  3O1H A;  5L3D B;  4L5G A;  1WYB A;  4IGU A;  1UX5 A;  2LSG A;  2XUE A;  5DJQ C;  5FY7 A;  3RX6 A;  3LK4 2;  4PJN A;  2XAJ B;  3RPU A;  3NRX A;  1BR1 A;  2W63 A;  4C91 A;  3PU3 A;  5BMV E;  5JDN A;  2JMK A;  3FBL A;  2C0S A;  5IYZ E;  3LBX B;  2E8I A;  2K24 A;  4FJO A;  2KMF A;  4MHC A;  2MYS A;  4V1A v;  2LSY A;  5L3C B;  3VU7 H;  3K3Q C;  5FP3 A;  3W15 B;  2PJQ A;  3CML A;  1AJ3 A;  4EIW A;  4PJM A;  2KND A;  2ACX A;  4ZI7 E;  3GN5 B;  2W61 A;  2IC9 A;  4PNI A;  1X79 A;  4TUY E;  4AKG A;  2X68 A;  5FYM A;  5JR9 C;  5LP6 E;  1HF8 A;  2H3R A;  2ZM2 A;  2XAQ B;  2M67 A;  4BJN A;  1SA0 E;  4GK0 E;  4ZI3 C;  1H7C A;  3Q5W A;  2BVL A;  3UFE A;  4UIG A;  2CXF A;  4AQF C;  3E0Z A;  3KFW X;  1FIO A;  1S35 A;  2D0T A;  3ZN0 B;  2X66 A;  3NZP A;  4DMV A;  4X20 E;  5HWY A;  3UTK A;  1MMD A;  3WAJ A;  2D0U A;  3H3A A;  2X9Y A;  2RA1 A;  2I59 A;  2LE8 A;  3JC6 C;  4GYS A;  3RRC A;  2E9X B;  2NW7 A;  2WM9 A;  1D0Y A;  3BQI A;  4AQG A;  4O4H E;  4O4I E;  1YKE B;  3P8C D;  4EYY R;  3IHR A;  3C98 B;  4NUU A;  1B7T A;  4HN9 A;  4GOU A;  2E9X C;  2WAU A;  3ZEF B;  4MLK A;  2HPJ A;  4HKA A;  3WI3 A;  4I55 E;  1ZHC A;  3ZMU B;  2P9B A;  3J9X 1;  1D1A A;  1V9D A;  2OA5 A;  3VKG A;  2EHO C;  3EDV A;  3KVA A;  4XAX B;  5E0O A;  2CM0 A;  3MXZ A;  2VWA A;  3ZLI A;  2D2S A;  3LK2 B;  3I9Y A;  5TAO A;  5JH7 E;  4QX8 B;  4JEH B;  4MAL A;  4QHO A;  5L3F B;  2C5J A;  1SHZ C;  3F31 A;  3PU8 A;  2WSS V;  2DWG A;  2X9W A;  3AA7 B;  2YIN A;  3N2K E;  1HCI A;  1OXZ A;  2YU1 A;  5LBM A;  2Y48 B;  2CEA A;  2L8K A;  4BA9 A;  4C90 A;  4DO0 A;  2CLY B;  2KXP B;  3LBX A;  2CXL A;  2H7V C;  3SOL A;  4NUV A;  5FMN A;  2PG8 A;  3CQG B;  3MA9 A;  3N9Q A;  4WNK A;  5LCY A;  4TZ4 C;  3ETU A;  5HAX A;  1Z0P A;  3ZJ2 A;  5HXE A;  2W62 A;  4X1Y E;  4AI6 A;  5JQG E;  5JRC B;  3GN5 A;  3Q2M A;  1ZEE A;  4P0B A;  5JDH A;  3U3I A;  5CA0 E;  2MBG A;  4ASK A;  4AXP A;  2KIN B;  1CUN A;  3CX6 B;  4ANJ A;  3KV9 A;  3UUL A;  3S4U A;  3TKL B;  2N1G A;  4EAH A;  5LG4 A;  3WAK A;  5LGU B;  1D1B A;  3MAC A;  4CI2 B;  2ZM0 A;  2D5U A;  2IC6 A;  1MND A;  3RYH E;  3VHL A;  1WYC A;  3KV6 A;  3B13 A;  2UXX B;  1MIY A;  3SWH A;  2G0U A;  3ANW B;  2NOX A;  3HR0 A;  1YKH B;  2NP9 A;  3OYX A;  1G73 A;  1WRD A;  2Y6X A;  2E9X A;  4GIW A;  1HG2 A;  2B1E A;  1WLX A;  2CXD A;  2V7K A;  1T98 A;  5HXC A;  2DLR A;  1KK7 A;  3O4X E;  2KWI B;  2CE7 A;  2HPL A;  4AKH A;  2K5B B;  5JDF A;  3Q9D A;  4O2B E;  4YLH A;  2K48 A;  3N2O A;  1YD8 G;  3ONX A;  3KBU A;  3HKB E;  5JR9 B;  2N2N A;  4CZZ B;  3GMI A;  4YHJ A;  2MTQ A;  4QX7 B;  3N9N A;  1IJ6 A;  4KUM B;  3RRW A;  3F2E A;  4CI1 B;  5JVD E;  2NWB A;  3EVY A;  4ISS A;  4OFZ A;  2V7J A;  2K9A A;  2L3L A;  4UVB B;  1FMV A;  3AB3 B;  5DQV A;  3AA6 B;  2Z6E A;  3IBP A;  4YFS A;  2JQQ A;  5LHG B;  4E7S A;  3BQL A;  5EK3 A;  5J2T E;  2ODU A;  2VKH A;  5FXV A;  5LHI B;  5FNV E;  3ZJ1 A;  3GA8 A;  4MFR A;  2X67 A;  3I9W A;  1O3X A;  2V1D B;  2WMO A;  3AA0 B;  4UXN B;  2QA7 A;  3RC8 A;  1D1C A;  4PFP A;  4X1K E;  5LJN A;  1G8X A;  5JRC A;  2LSJ A;  5FXX A;  1VRB A;  4DMW A;  3NZQ A;  1IAP A;  3RYI E;  1MMA A;  3ETV A;  3V5S A;  4YJ3 E;  5HXS A;  2LT3 A;  2A72 A;  2XQY A;  2EHO B;  4IE0 A;  3O1J A;  1BR4 A;  5EK4 A;  4K0U A;  2ZMA A;  4GYR A;  4H9N C;  3K8P C;  1HFA A;  2XAF B;  4OK0 A;  4WBN E;  2NTY A;  4I43 B;  4XZC A;  1YW0 A;  3AVS A;  5FY0 A;  4O2A E;  3C51 A;  4UEL A;  3ZCI A;  2HH7 A;  3A5X A;  4IDZ A;  4OHF A;  3ANW A;  3SRZ A;  1BR2 A;  3K3N A;  4DBQ A;  3CQX C;  3NBX X;  2MOZ A;  2Q9Q D;  3C4Z A;  3IF8 B;  2XAH B;  2XAG B;  4L0R A;  5KX5 E;  2VKD A;  2N9D A;  3QK6 A;  3MKD A;  3F57 A;  2KWH A;  1Y64 B;  3P7I A;  4HGA A;  5EZY E;  3C64 A;  4DVD A;  3QUJ A;  3OKQ A;  5H6Q B;  5LHH B;  1IZN B;  3KBT A;  5HXR A;  4DND A;  5HXH A;  5JR9 A;  1D0X A;  1NWM X;  2V7M A;  4ERR A;  3PTR B;  4H9S E;  4JEU B;  3UUX B;  3KVB A;  3V5U A;  3HA4 A;  4HTE A;  1S94 A;  5LXT E;  4EOZ B;  3BK9 A;  3N9P A;  5AFU L;  4AQF A;  2C5I T;  2IAK A;  2VAS A;  1HX8 A;  3AA1 B;  3KV4 A;  1D0Z A;  1OWA A;  2X9H A;  3CKD A;  3CX8 B;  4Z8X A;  4ZS3 A;  3C50 A;  4KBM B;  5LOV E;  1WR6 A;  3CWZ B;  4N78 D;  4QXH B;  4TV9 E;  3I0Q A;  5LA6 E;  3OYZ A;  3AAI A;  2A3D A;  3PUA A;  5IHY A;  3LG7 A;  2W00 A;  3HKE E;  2WMN A;  3O9X A;  4IE6 A;  5FY1 A;  4PK4 A;  4HEA A;  2PBI A;  2CMR A;  3SS1 A;  2JPF A;  2KLQ A;  3RYF E;  5A1L A;  4UEM A;  4H9O C;  2V7I A;  3CPZ A;  3ZN1 B;  2LHN A;  4IE4 A;  4P0A A;  3LK3 B;  3U78 A;  2BZB A;  2JRK A;  3T8O A;  2KT9 A;  3ZC0 A;  4CXX A;  4B6X A;  3FHN A;  2EHO A;  4QXC B;  4ILU A;  4PK5 A;  2L9Q A;  3N5L A;  3D0T A;  4PW8 A;  3ZYL A;  3N2G E;  2SPC A;  4CXW A;  2BDE A;  4O4L E;  2V26 A;  4H9Q C;  3AAE B;  2VKJ A;  5ETW A;  2NTX A;  1KNZ A;  2YEV C;  3HI2 A;  1MNE A;  4EZ4 A;  5J1G A;  5L2L A;  3J7Y q;  2XAS B;  4IST A;  4G2A A;  1QSD A;  3FXD B;  5GON E;  5LJM A;  3N9M A;  1LVK A;  5LNK A;  4O8S A;  4YJ2 E;  4ZI2 D;  4UF0 B;  3HKC E;  1MMG A;  2KZ7 B;  3AAA B;  5J2U E;  1MMN A;  1U5P A;  4QKN A;  4JUY A;  3Q5X A;  4WW0 A;  2JJ9 A;  4IIJ E;  2DWK A;  5HWX A;  2VK9 A;  2LOP A;  3FXE B;  3CVR A;  3PUQ A;  3N9L A;  4PFO A;  3MK7 C;  2LSI A;  2X9X A;  2IW5 B;  2CWY A;  2WWU A;  5C8Y E;  2C5K T;  2ODV A;  4PK6 A;  1US7 B;  3MJX A;  1FMW A;  1ZKE A;  1UX4 A;  1VOM A;  4ZOL E;  4UV9 B;  3C4X A;  4IE7 A;  4AKI A;  3ESL A;  4CXY A;  4H9P C;  4J2C A;  2DI4 A;  5KMG P;  3L3P A;  5H6R B;  3ZC1 A;  2PFV A;  1BR0 A;  2YK0 A;  3I1A A;  4KMC A;  2CA5 A;  3O1I A;  5JDG A;  3B57 A;  1EZ3 A;  1HTJ F;  2X0L B;  4TN7 B;  3H37 A;  4PJJ A;  4UV8 B;  5FXZ A;  3HL6 A;  4ZS2 A;  5CA1 E;  4I50 E;  3KIN B;  2Q9Q B;  1HG5 A;  2LM9 A;  5F8P A;  3LJC A;  4X1I E;  3M65 A;  4F6R C;  5M4Y A;  3LFM A;  3PDY A;  4OYJ A;  1MIW A;  1FEW A;  5L3E B;  4DBR A;  3IEE A;  2LOS A;  4UVA B;  5L3G B;  3ZMS B;  2Q9Q C;  3E22 E;  3BQK A;  3PE0 A;  4H9R C;  3C4W A;  4TV8 E;  2NW8 A;  2LHR A;  1LRZ A;  2ES0 A;  3UUM A;  3ZYM A;  4U74 A;  3UUN A;  4AKL A;  2DHR A;  3ZCJ A;  4ZHQ E;  3PUG A;  4KP3 C;  4ZI3 D;  4L9I A;  3CQC B;  5KDM C;  4PAG A;  5LYJ E;  5JDL A;  2J1D G;  4A56 A;  4HE8 A;  5JDQ A;  3I0O A;  2RP4 A;  3RH3 A;  1HS7 A;  4XBF B;  3PUS A;  4ADZ A;  3ZMV B;  2CCQ A;  2LJL A;  3JC6 D;  3VKH A;  2QGS A;  5LGN B;  3FB2 A;  4H63 V;  3RYC E;  2YU2 A;  3QC9 A;  2LEH A;  4U72 A;  4CQI A;  3EDU A;  5ADX L;  4EXT A;  2A2F X;  3EUH A;  3N9O A;  4G63 A;  2ZLY A;  4UF0 A;  3R6N A;  3DP7 A;  2VL8 A;  2E9X D;  5LBQ B;  2XHE B;  3ZMZ B;  3R84 B;  2GK9 A;  3OJA A;  3FBZ A;  5LGT B;  4QXB B;  2EHO D;  3KV5 A;  4M1P A;  5F3J A;  4BJM A;  4GK5 E;  3RC3 A;  1IJ5 A;  3AVR A;  3E08 A;  4EZH A;  4FI5 A;  5JRE A;  3RKO A;  3CX7 B;  4JLE A;  2NW9 A;  2JMH A;  5JDM A;  4WBO A;  5HYA A;  2CWO A;  2UXN B;  1MIV A;  1LKX A;  1U4Q A;  2VB6 A;  3DJB A;  4IE5 A;  5FXW A;  2CLY C;  4EB6 E;  4HFV A;  3K3O A;  4I4T E;  3KDS E;  4UVC B;  5CB4 E;  3GWH A;  3PUR A;  3ZYK A;  3MZK B;  5L3B B;  2Q9Q A;  2W0G A;  2ZM8 A;  4TX5 A;  2VKO A;  4ZI2 C;  4BAY B;  2DCF A;  3HKD E;  1LVF A;  3OBV E;  2BVM A;  4AKR B;  2H7O A;  1QUU A;  4P09 A;  5EK2 A;  4PJL A;  5DAB A;  2LSK A;  4OYK A;  1NAF A;  4CI3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...