5JR9C

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
185
structure length
185
Chain Sequence
MLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
molecule keywords NEQ131
total genus 82
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9C00
5JREA 3ZC0A 5JR9B 5JR9C 5JRCB 5JRCA 3ZC1A 5JR9A
chains in the Genus database with same CATH superfamily
2H89A 1XWMA 2DL1A 2L8KA 2PJQA 3K8PC 3N2OA 4YHJA 1YD8G 4I55E 2VURA 5DJQC 3ZJ2A 1XNQT 2VKJA 4B6XA 2MTQA 3AXJA 4H9OC 2XQ3A 2WZHA 5IHYA 3V5UA 3VKHA 4HWIB 3CQCB 4ISSA 3C50A 2AE9A 3B5MA 3EDUA 3P4SA 4QXBB 3ZCJA 2DNXA 2WP9A 4ZS3A 2FJDA 3IHRA 3LK3B 2XPKA 3ONJA 5HXEA 1J1JA 5HCMA 1UX5A 3KBUA 5CB4E 1OEDA 2C5IT 4ZI3C 3AEFA 2XQ5A 4A5XA 3AA0B 2E8IA 3NZPA 4LF9T 3L8RA 3OKQA 5AQNB 4KI0F 4PNIA 3EAMA 3EUHA 4U31A 1OEDB 1XMOT 4LMJA 3N9MA 2BDEA 4UV9B 3UFEA 4AKIA 4NIQA 3GN5A 1HG5A 3NVOA 2E5VA 3N5LA 3VRBA 3MK7C 3ZKRA 4AISA 5AQQB 5KMGP 3T1HT 1XMQT 4PFPA 4Z8XA 4PK5A 3W15B 1IBMT 2UXDT 1X9BA 5JH7E 1DU2A 3PUVF 3BK9A 5FMNA 3X1DA 4QH1A 5EK2A 5FXWA 3C4WA 4H9RC 4BAYB 4AQFC 2XTLA 2LSIA 4O2AE 5ABHA 3RPUA 3CMLA 1WYBA 1OXZA 3A5XA 3K3QC 3MZKB 4UEMA 5LG4A 2XHEB 4ILCA 3K3OA 3EABA 4KBMB 4B3MT 4JI7T 2WWUA 1ZOYA 4CXWA 1T72A 2X67A 4Z90A 5FVLA 4X1YE 5AFUL 2WU2A 2KINB 2KLQA 3E22E 3D0TA 4JLEA 5HWXA 5L2LA 4H9PC 1HS7A 4NXNT 4UV8B 2K48A 5IYZE 2NTXA 3UU6A 2R6GF 2FJAA 5J0ZA 3C51A 4DV6T 3OVUA 1HNZT 2W2UA 3EDVA 3LJCA 1JNRA 5JDLA 4ASKA 4LF6T 3RYHE 3KBTA 3QOFA 4PW8A 3EVYA 1MMNA 1HTJF 3ZMUB 5FL1A 5HEHA 4X1KE 2UUCT 5KXJA 4DUZT 2H88A 2D5UA 2W4XA 2QRXA 2SPCA 2W61A 4FJOA 1MMAA 4HFIA 2IC6A 4DBQA 5HXHA 2YDSA 3G06A 2UUAT 3H3AA 3K3NA 2LJLA 1GQEA 3FBZA 4ERRA 1T8BA 1BR0A 3CKDA 1T98A 3I0OA 3L39A 3AXJB 3I9YA 2BBHA 3HKCE 1YKHB 4ZI3D 1HX8A 2J47A 5HXCA 1YKEB 1FIOA 2KZ7B 2FUPA 3ANWB 4HN9A 4LF8T 2W67A 1UURA 2KXPB 1MNEA 4PJJA 3HR0A 3M3ZB 3PTRB 3AA6B 2QA7A 4AKRB 3NRXA 1WR0A 1VCTA 2V7LA 1U5PA 1IJ6A 1OEDC 5FXXA 3RIAA 4GYRA 3F31A 2YN6A 4TV8E 5AQPB 2WY2A 1G73A 2HN1A 4IIJE 5FY7A 2WS3A 5L3CB 4DV3T 2Q9QD 4L9IA 2BG9B 2AXDS 3WI3A 1YQ3A 2FJBA 3F57A 3GA8A 5LGTB 3CQXC 1D1BA 2QGSA 2V7IA 3RX6A 1FJGT 2FJEA 1XZYA 2CWYA 3C4XA 3M65A 3U3IA 4DV4T 2LT3A 4DR3T 3GWHA 2DLRA 5AQTB 4EOZB 2C5JA 4JI8T 2LSYA 3RYIE 2BKNA 2XAFB 3QB5K 2XASB 5HWYA 3FZKB 4JI2T 4JI3T 1N33T 2UXNB 4JUYA 4L5GA 4WZXA 3VR9A 2G0UA 2ODVA 3ZCIA 2X9XA 5JRCB 5AQRB 2OV9A 2CHNA 5L4EA 1W9RA 3PUZF 3AA7B 3HKBE 4I43B 5JREA 3AVSA 4UVBB 3DJBA 3ZLIA 3ESLA 4YJ3E 4HFHA 1NWMX 3N9QA 5GONE 5JVDE 5J2UE 4P1NA 1YXRA 5JDQA 2X51A 4IE7A 3RYCE 2MYSA 4AQGA 5JQGE 2EHOA 2K9AA 2CBJA 2VKOA 3CK6A 3RI5A 2VK9A 3FB2A 4WBNE 2NW8A 4QX7B 4HGAA 3ZN0B 3PU8A 3RRCA 5JTGA 3IF8B 3R6NA 2V7MA 3QUJA 1FMVA 2B76A 2VVSA 1YW0A 1Z0PA 2JRKA 4O4IE 4QH4A 4YT0A 2XQ4A 3AEGA 3JC6D 4ZI7E 4MBQA 4MHCA 1Y01A 4IE4A 4YFSA 3AE6A 4HFBA 5LJNA 4EZ4A 4DV7T 1IBKT 2CWOA 4ZZCA 1MNDA 2E9XB 3AA1B 2CXFA 5CA1E 3OPCA 4COFA 4X66T 4LFAT 2ACZA 1S94A 3MJXA 2XQ8A 5ABEA 3JADA 4NPPA 2XUEA 3N9NA 2CHOA 3E0ZA 4UF0A 1W09A 4YSYA 4A97A 3SRZA 4PK6A 4BJNA 4KHZF 3O1IA 4YY3T 4X65T 1D0YA 4IGUA 4U2YA 2D0UA 2YDRA 3I1AA 2WWVA 2KT9A 2LSGA 2Y8DA 3RIUA 5HEOA 5JDFA 2XAJB 4X1IE 2V7KA 5LB7B 3S4UA 4G63A 4U7IA 4MALA 5L4HA 2JIWA 2XM1A 5CJ5A 5LGUB 5LXTE 3AAEB 4LFBT 3ZJ1A 5CGMA 1EZ3A 4HWDA 1KK7A 1WCRA 1VOMA 4H9QC 4HE8A 3RKOA 5IWAT 2BG9A 4CXYA 3RC8A 3Q9DA 4EB6E 1IJ5A 3LDQB 3R84B 4UELA 5LHHB 3HA4A 3HKDE 4I0UA 3SS1A 2Q9QC 4CXXA 4O8SA 4DNDA 1UGOA 2XAQB 3AE7A 4UIGA 1FMWA 4YTMA 4H63H 2WDQA 2UXBT 2BG9C 1E2AA 4XZCA 5LA6E 2LSKA 3Q5WA 1N36T 5JDNA 2W63A 2JQQA 2VWAA 4EIWA 4TUYE 3N9LA 4IE0A 4C91A 3Q2MA 3RGLA 4ZS2A 3UU5A 4ZHQE 3J7Yq 2ZM6T 4CN4A 4DR6T 2C0SA 2DI4A 2LKGA 3ZMTB 2HPLA 4IE6A 2JPFA 4LMLA 3SFDA 5LG3A 4TNVA 5HYAA 4P0AA 2YKSA 3PUAA 2BKPA 5TAOA 3ZT7A 2EHOB 4JBWF 4JI5T 3KINB 3PE0A 3H37A 2DWKA 3CIRA 4HFVA 5M4YA 4UR9A 5C3JA 2VQFT 5LMUT 4B3RT 2CA5A 3VKGA 5FL0A 4EGWA 2M6BA 1KNZA 2LM9A 3VRAA 3ZSTA 5LP6E 4DV5T 4V1Av 2LHRA 4UVCB 2XZEA 4CN6A 3I0QA 5A1LA 2MBGA 3KV9A 4ISTA 2IDOB 4NXMT 4G2AA 1Z8UA 3LK2B 4HWHA 4ILAA 4K0UA 1QSDA 4AKGA 3AE3A 3BQKA 4U2ZA 2PG8A 3V5SA 3DP7A 1OWAA 1FEWA 3RC3A 1AJ3A 4P0BA 5AQMB 5C8YE 5ADXL 2Q9QA 4JEHB 1IZNB 4WW0A 2IC9A 3U78A 4IDZA 5ABFB 4JI6T 2Z6EA 2UXCT 3LBXA 4DO0A 4JV5T 3CPZA 2W66A 3TLWA 4B3ST 2EHOC 5LCYA 3IA3A 2IAKA 2ZM2A 1KEYA 3UT5E 2YINA 5LOVE 3P4RA 2E9XC 4DR5T 3ZMSB 1H7CA 2LOSA 2WAUA 4GK0E 4EV6A 4YTNA 4AKLA 5HCJA 1JNZA 4ZXLA 1N32T 2I59A 3AEDA 1SA0E 3CWZB 1KNRA 2BVLA 2ES0A 2VB6A 2X66A 2XQAA 5HEUA 3TLUA 2JQ9A 2FBWA 4QWNB 2V5DA 4UXNB 3RLFF 3QC9A 2E2AA 5KX5E 2CPTA 4IDPA 4TV9E 5KDMC 1IAPA 1QUUA 2K3WA 5ETWA 4C90A 1D1CA 3BQLA 2X0HA 4PFOA 5LNKA 2CBIA 4GIWA 2P9BA 4LFCT 3HKEE 1SUMB 1KF6A 4EEDA 2WB5A 2XQYA 1L0VA 4IL9A 2X0LB 2L9QA 2KNDA 4MLKA 4QKNA 4XAXB 4FI5A 2HHHT 4IHJE 1V9DA 3MA9A 5JDMA 3OBVE 4ZZBA 2BS2A 4TNWA 4LF4T 5AQOB 1HNWT 2H3RA 3PUWF 2RPAA 2VL8A 5JR9B 4X20E 1ZV4X 2WDRA 4E7ZA 5BR8T 2I6HA 4TWFA 2LLYA 4JI1T 1I94T 2UU9T 1MIWA 4IDNA 2RA1A 4EXTA 5LGNB 1G8XA 1LVKA 2CCQA 2HH7A 3Q5XA 5JR9A 3ZYMA 1QLBA 2V8SV 2WDVA 4BA9A 2KSRA 5CA0E 2N9DA 4DR7T 5L3GB 2WM9A 2Y48B 2XSBA 4O4JE 3AAAB 3JAEA 4L0RA 3UU8A 2CM0A 2CMRA 2VKDA 2F4VT 2I0MA 2NWBA 2X9WA 2V26A 2IIUA 3ONLC 2ZM0A 5FXZA 2DCFA 4GYSA 3B13A 3RHWA 3ZN1B 3FXEB 4I50E 4U74A 3UQ4A 4H63V 3OJAA 4ILBA 1US7B 4KP3C 2CEAA 4QX8B 1NENA 2VL0A 2BS3A 4EYUA 4UVAB 2WMNA 1X79A 1NEKA 3ZMVB 3UUBA 4GKKT 4H9NC 4CI3B 3PJAA 3SOLA 3UU3A 3TLTA 4IREA 3ZT5A 5FY0A 2GK9A 2IUBA 4A56A 5IUXA 3P7IA 2E9XA 3ZEFB 5FVKA 5EK4A 2NP9A 4ZI2C 1XDOA 3PJAJ 4IT4A 5FXVA 2NW7A 4HKAA 4DIDB 4U3CA 4YSXA 2V1DB 1UUSA 4ZI2D 5JR9C 3IEEA 5LHIB 1SHZC 3P4QA 4PAGA 5EZYE 2IW5B 3KV6A 4JYAT 2E9XD 1WRDA 3Q5EA 4ANJA 3GN5B 3AE4A 5AQLB 2YEVC 2W62A 4ADZA 2XAGB 3LFMA 3LK42 3TLVA 5LBQB 3PUXF 4YHHT 2LOPA 5HEJA 1HX1B 3HL6A 5BMVE 4KX6A 5DQWA 4DMVA 3OTOT 1W0BA 2LM2A 4OHFA 1M62A 3EI0A 2ZMAA 2UUBT 1ZKEA 2V6YB 3RF1A 2WBLA 2K5BB 5H6RB 1T7SA 3AEAA 2IMLA 4QH5A 1J5WA 2PFVA 3L09A 2LEHA 4DR2T 3KV5A 1OEDE 4ZEYA 5JRCA 4OX9T 4DMWA 2M67A 4OYKA 4YSZA 3SFEA 3N2GE 2D0TA 2VKHA 1MMDA 1S35A 1SE7A 3DTOA 5EK3A 4O4HE 1ZP0A 1E7PA 3ABVA 2KWHA 4TX5A 3PURA 3SWHA 3KDSE 3NWIA 2YOEA 1J5ET 2DHRA 2J62A 3NZQA 4IE5A 4O2BE 4DR1T 1UX4A 4IL4A 4YLHA 3VHLA 4AQFA 5L3EB 5L3BB 1IBLT 4AKHA 2OLTA 2A3DA 5HXRA 4QXCB 2UXXB 3AE8A 2HPJA 4Q25A 4WBOA 4CI2B 2A9UA 3T1YT 2MOZA 3RIFA 2XQ7A 4CN1A 3P4PA 5AQGB 4DV1T 1M7KA 2JMKA 3PV0F 5FP3A 4A98A 3ZT6A 4EAHA 5L47A 3FZHB 5AQJB 3UULA 3ZYKA 5JDGA 2JQKA 4H9SE 3CX6B 5AQHB 4Z91A 4HWCA 5H6QB 3UUMA 3IBPA 3JCFA 2EHOD 3K1SA 3OYXA 4NUUA 2A72A 3O1JA 4GKJT 2Y6XA 5AQIB 2JMHA 4K0KT 4PJLA 2XSAA 3A7MA 3E08A 1D0ZA 3KV4A 3N2KE 4GOUA 5LBMA 3KVBA 5JDHA 2WMOA 1VCSA 5HEGA 2DWGA 1UK5A 2LE8A 1O3XA 2QVAA 3FZFB 1VRBA 3PUSA 4OFZA 5LYJE 4AXPA 4AIUA 4QHOA 1HR0T 4JI0T 2MPKA 3UU4A 5HAXA 4TN7B 2L3LA 1MIVA 3WAKA 5LJMA 3CX7B 4J2CA 2WZIA 4KUMB 3PUYF 5F5WA 3EHZA 4AI6A 4N78D 2KMFA 5LMNT 3LBXB 4YXDA 4TWDA 4ILUA 4X5TA 2X0YA 4PK4A 3ONXA 2IHR1 2YK0A 3Q5DA 3VU7H 4HEAA 3AAIA 3FHNA 4HWFA 2JJ9A 4F6RC 2CRBA 3VR8A 3ZYLA 5AQFB 5L3FB 1B7TA 3ZMZB 5HXSA 3C4ZA 3KVAA 4CI1B 3O9XA 3NBXX 4YTPA 1I6ZA 4LF5T 3ZC1A 2A2FX 2NW9A 4DVDA 3UQ7A 4U7YA 4U33A 1WFDA 4GK5E 5C2TA 3FBLA 3FZMB 4X64T 1BR2A 2V6XA 4KMCA 2H7VC 3JC6C 2PBIA 3I9WA 4PJNA 2YU2A 5AQUB 3AECA 2J1DG 1YQ4A 3T8OA 2VASA 4TWHA 2XQ6A 4HFCA 2LSJA 2ACXA 1WLXA 3A8YC 3B57A 1KNPA 3JAFA 4HTEA 4JEUB 4TZ4C 1ZEEA 2QYWA 2XY8B 3RYFE 2YDQA 3L3PA 3J9X1 2V7JA 4QXHB 1XNRT 2CLYC 1HF8A 2W0GA 2NTYA 2X68A 3ZC0A 2D2SA 3CVRA 4CQIA 2XQ9A 3NKZA 1UCUA 3AE1A 3QB5A 1CHUA 5FNVE 4LF7T 2M6IA 3TKLB 3ETVA 4X62T 3RKGA 4DV0T 2CXLA 3HI2A 4OYJA 1W0AA 2NR4A 4EEBA 3AB3B 2BVMA 3FXDB 2BBJA 3AE2A 5F3JA 1XDPA 3ETUA 1KFYA 2XAHB 3P8CD 2WSSV 3QK6A 4PJMA 3O1HA 4XBFB 2N1GA 2XJ7A 3N9PA 2LKHA 2BKOA 1WYCA 4I4TE 2C5KT 1HG2A 1D0XA 1BR1A 2LHNA 2OA5A 1MMGA 3KFWX 4IDQA 1R8IA 2ODUA 4HFEA 3LG7A 3P50A 4CZZB 2BZBA 5FY1A 2VVNA 3TLSA 4E7SA 3AEEA 1Y64B 3F2EA 4U72A 2B1EA 3GMIA 3LSVA 3CX8B 3FZLB 3RRWA 4EYYR 2N2NA 4IDOA 4YJ2E 3WAJA 1N34T 3ZPOA 4M1PA 2CLYB 1LRZA 2ZLYA 4NUVA 5J2TE 4DUYT 2NOXA 3MXZA 4B3TT 3PDYA 1CUNA 4KHPT 3BQIA 5ABGA 4WYVA 3PUQA 2KWIB 4F8HA 3H3MA 2K24A 4OK0A 5DQVA 5AQKB 3RIUC 4DBRA 4DV2T 4DR4T 3P4WA 2CXDA 1BR4A 5F8PA 3MACA 4LMKA 2H7OA 2WQYA 2LRLA 2X9HA 3PUGA 3RQWA 3UTKA 1LKXA 3RQUA 3MKDA 1LVFA 2WU5A 2W00A 1NAFA 2HN2A 1HNXT 1E1HB 3O4XE 3PU3A 3AVRA 4MFRA 2MAWA 2BS4A 1HFAA 2D9DA 2XM2A 2X9YA 2ZM8A 3NRYA 4HFDA 2E5LT 1ZHCA 2LRKA 5FYMA 2J4GA 2V6YA 5AQSB 4P09A 5L3DB 3OYZA 3C98B 3AE9A 5J1GA 3N9OA 3RH3A 4UF0B 3UFGA 2RP4A 5CFBA 4WNKA 3UUXB 5LHGB 4ZOLE 5FKYA 4EZHA 3CQGB 5E0OA 3UUNA 3C64A 2VQET 2PTFA 3ANWA 4O4LE 5AQVB 1D1AA 3AE5A 4BJMA 2JQHA 1HCIA 2Q9QB 3ZSSA 1WR6A 3QNUA 1MIYA 2BG9E 5ABFA 4AQYT 3AEBA 4JI4T 2CE7A 5DABA 2WCAA 2YU1A 1U4QA 2V5CA
chains in the Genus database with same CATH topology
4YHJA 3K8PC 5DJQC 2L8KA 2PJQA 3N2OA 1YD8G 4I55E 3ZJ2A 2VKJA 4B6XA 2MTQA 4H9OC 5IHYA 3V5UA 3VKHA 3CQCB 4ISSA 3C50A 3EDUA 4QXBB 3ZCJA 2DNXA 4ZS3A 3IHRA 3LK3B 5HXEA 1UX5A 3KBUA 5CB4E 2C5IT 4ZI3C 3AA0B 2E8IA 3NZPA 3OKQA 4PNIA 3EUHA 3N9MA 2BDEA 4UV9B 3UFEA 4AKIA 3GN5A 1HG5A 5KMGP 3N5LA 3MK7C 4PFPA 4Z8XA 4PK5A 3W15B 5JH7E 3BK9A 5FMNA 5EK2A 5FXWA 3C4WA 4H9RC 4BAYB 4AQFC 2XTLA 2LSIA 4O2AE 3RPUA 3CMLA 1WYBA 1OXZA 3A5XA 3K3QC 3MZKB 4UEMA 5LG4A 2XHEB 3K3OA 4KBMB 2WWUA 4CXWA 5AFUL 4P0AA 2X67A 4X1YE 5HWXA 2KINB 2KLQA 3E22E 3D0TA 4JLEA 5L2LA 4H9PC 1HS7A 4UV8B 2K48A 5IYZE 2NTXA 3C51A 3EDVA 3LJCA 5JDLA 4ASKA 3RYHE 3KBTA 4PW8A 3ZMUB 3EVYA 1MMNA 1HTJF 4X1KE 2D5UA 2SPCA 4FJOA 2W61A 1MMAA 2IC6A 4DBQA 5HXHA 3H3AA 3K3NA 2LJLA 3FBZA 4ERRA 1BR0A 3CKDA 1T98A 3I0OA 3I9YA 3HKCE 1YKHB 4ZI3D 1HX8A 5HXCA 1YKEB 1FIOA 2KZ7B 3ANWB 4HN9A 2KXPB 1MNEA 4PJJA 3HR0A 4AKRB 3PTRB 3AA6B 2QA7A 3NRXA 2V7LA 1U5PA 1IJ6A 5FXXA 4GYRA 3F31A 4TV8E 5L3EB 5L3CB 5L3BB 1G73A 5LJMA 4IIJE 5FY7A 2Q9QD 4L9IA 3WI3A 3F57A 3GA8A 5LGTB 3CQXC 1D1BA 2QGSA 2V7IA 3RX6A 3M65A 2CWYA 3C4XA 3U3IA 2LT3A 3GWHA 2DLRA 4EOZB 2C5JA 2LSYA 3RYIE 2XAFB 5HWYA 2XASB 2UXNB 4JUYA 4L5GA 3ZCIA 5JRCB 2G0UA 2ODVA 2X9XA 3AA7B 3HKBE 4I43B 5JREA 3AVSA 4UVBB 3DJBA 3ZLIA 3ESLA 4YJ3E 1NWMX 3N9QA 5GONE 5JVDE 5J2UE 5JDQA 2X51A 4IE7A 3RYCE 2MYSA 4AQGA 5JQGE 2EHOA 2K9AA 2VKOA 4WBNE 2VK9A 3FB2A 2NW8A 4QX7B 4HGAA 3ZN0B 3PU8A 3RRCA 3IF8B 3R6NA 2V7MA 3QUJA 1FMVA 1YW0A 1Z0PA 2JRKA 4O4IE 3JC6D 4ZI7E 4MBQA 4MHCA 4IE4A 4YFSA 5LJNA 4EZ4A 2CWOA 1MNDA 2E9XB 3AA1B 2CXFA 5CA1E 1S94A 3MJXA 2XUEA 3N9NA 4UF0A 3E0ZA 3SRZA 4PK6A 4BJNA 3O1IA 1D0YA 4IGUA 2D0UA 3I1AA 2KT9A 2LSGA 2Y8DA 5JDFA 2XAJB 4X1IE 2V7KA 3S4UA 4G63A 4MALA 5LXTE 5LGUB 3AAEB 3ZJ1A 1EZ3A 1KK7A 3RKOA 1VOMA 4H9QC 4HE8A 3RC8A 4CXYA 3Q9DA 4EB6E 1IJ5A 3R84B 4UELA 5LHHB 3HA4A 3HKDE 3SS1A 2Q9QC 4CXXA 4O8SA 4DNDA 2XAQB 4UIGA 1FMWA 4H63H 5LA6E 4XZCA 2LSKA 3Q5WA 5JDNA 2W63A 2JQQA 2VWAA 4EIWA 4TUYE 3N9LA 4IE0A 4C91A 3Q2MA 4ZHQE 4ZS2A 3J7Yq 2C0SA 2DI4A 3ZMTB 2HPLA 4IE6A 2JPFA 5HYAA 3PUAA 5TAOA 2EHOB 3KINB 3PE0A 3H37A 2DWKA 4HFVA 5M4YA 2CA5A 3VKGA 1KNZA 2LM9A 5LP6E 4V1Av 2LHRA 4UVCB 3I0QA 5A1LA 2MBGA 3KV9A 4ISTA 4G2AA 3LK2B 4K0UA 1QSDA 3BQKA 2PG8A 3V5SA 3DP7A 1OWAA 1FEWA 3RC3A 1AJ3A 4P0BA 5C8YE 5ADXL 2Q9QA 4JEHB 1IZNB 4WW0A 2IC9A 3U78A 4IDZA 2Z6EA 3LBXA 4DO0A 3CPZA 2EHOC 5LCYA 2IAKA 2ZM2A 3UT5E 2YINA 5LOVE 2E9XC 3ZMSB 1H7CA 2LOSA 2WAUA 4GK0E 4AKLA 2I59A 1SA0E 3CWZB 2BVLA 2ES0A 2VB6A 2X66A 4QWNB 4UXNB 3QC9A 5KX5E 4TV9E 5KDMC 1IAPA 1QUUA 5ETWA 4C90A 1D1CA 3BQLA 4PFOA 5LNKA 4GIWA 2P9BA 3HKEE 2XQYA 2X0LB 2L9QA 2KNDA 4MLKA 4QKNA 4XAXB 4FI5A 4IHJE 1V9DA 3MA9A 5JDMA 3OBVE 2H3RA 2VL8A 5JR9B 4X20E 1ZV4X 4E7ZA 1MIWA 2RA1A 4EXTA 5LGNB 1G8XA 1LVKA 2CCQA 2HH7A 3Q5XA 5JR9A 3ZYMA 4BA9A 5CA0E 2N9DA 5L3GB 2WM9A 2Y48B 4O4JE 3AAAB 4L0RA 2CM0A 2CMRA 2VKDA 2X9WA 2NWBA 2V26A 2ZM0A 5FXZA 2DCFA 4GYSA 3B13A 3ZN1B 3FXEB 4I50E 4U74A 4H63V 3OJAA 1US7B 4KP3C 2CEAA 4QX8B 4EYUA 4UVAB 2WMNA 1X79A 3ZMVB 4H9NC 4CI3B 3SOLA 5FY0A 2GK9A 4A56A 3P7IA 2E9XA 3ZEFB 5EK4A 2NP9A 4ZI2C 5FXVA 2NW7A 4HKAA 2V1DB 4ZI2D 5JR9C 5LHIB 3IEEA 1SHZC 4PAGA 5EZYE 2IW5B 3KV6A 2E9XD 1WRDA 4ANJA 3GN5B 2YEVC 2W62A 4ADZA 2XAGB 3LFMA 3LK42 5LBQB 2LOPA 3HL6A 5BMVE 4DMVA 5DQWA 4OHFA 2ZMAA 1ZKEA 2WBLA 2K5BB 5H6RB 2PFVA 3L09A 2LEHA 3KV5A 5JRCA 4DMWA 2M67A 4OYKA 3N2GE 2D0TA 2VKHA 1MMDA 1S35A 3DTOA 5EK3A 4O4HE 2KWHA 4TX5A 3PURA 3SWHA 3KDSE 2DHRA 3NZQA 4O2BE 4IE5A 1UX4A 4YLHA 3VHLA 4AQFA 4AKHA 2A3DA 5HXRA 4QXCB 2UXXB 2HPJA 4WBOA 4CI2B 2MOZA 2JMKA 4EAHA 5FP3A 3UULA 5JDGA 3ZYKA 4H9SE 3CX6B 3UUMA 5H6QB 3IBPA 2EHOD 3OYXA 4NUUA 2A72A 3O1JA 2Y6XA 2JMHA 4PJLA 3KV4A 3E08A 1D0ZA 3N2KE 4GOUA 5LBMA 3KVBA 5JDHA 2WMOA 2DWGA 2LE8A 1O3XA 5LYJE 3PUSA 1VRBA 4OFZA 4AXPA 4QHOA 5HAXA 4TN7B 2L3LA 1MIVA 3WAKA 3CX7B 4J2CA 4KUMB 4AI6A 4N78D 2KMFA 3LBXB 4ILUA 4PK4A 3ONXA 2YK0A 3VU7H 4HEAA 3AAIA 3FHNA 2JJ9A 4F6RC 3ZYLA 5L3FB 1B7TA 3ZMZB 5HXSA 3C4ZA 3KVAA 4CI1B 3O9XA 3NBXX 3ZC1A 2A2FX 4DVDA 4GK5E 3FBLA 1BR2A 4KMCA 2H7VC 3JC6C 2PBIA 3I9WA 4PJNA 2YU2A 2J1DG 3T8OA 2VASA 2LSJA 2ACXA 1WLXA 3B57A 4JEUB 4TZ4C 2NW9A 4HTEA 1ZEEA 3RYFE 3L3PA 3J9X1 2V7JA 4QXHB 2CLYC 1HF8A 2W0GA 2NTYA 2X68A 3ZC0A 2D2SA 3CVRA 4CQIA 1UCUA 5FNVE 3TKLB 3ETVA 2CXLA 3HI2A 4OYJA 3AB3B 2BVMA 3FXDB 5F3JA 3ETUA 2XAHB 4PJMA 3P8CD 2WSSV 3QK6A 3O1HA 4XBFB 2N1GA 3N9PA 1WYCA 4I4TE 2C5KT 1HG2A 1D0XA 1BR1A 2LHNA 2OA5A 1MMGA 3KFWX 2ODUA 3LG7A 4CZZB 2BZBA 5FY1A 4E7SA 1Y64B 3F2EA 4U72A 2B1EA 3GMIA 3RRWA 3CX8B 4EYYR 4YJ2E 4AKGA 2N2NA 3WAJA 3ZPOA 4M1PA 2CLYB 1LRZA 2ZLYA 4NUVA 5J2TE 2NOXA 3MXZA 3PDYA 1CUNA 3BQIA 3PUQA 2KWIB 4DBRA 2K24A 4OK0A 5DQVA 2CXDA 1BR4A 5F8PA 3MACA 2H7OA 2X9HA 3PUGA 3UTKA 1LKXA 3MKDA 1LVFA 2W00A 1NAFA 1E1HB 3O4XE 3PU3A 3AVRA 4MFRA 2ZM8A 1HFAA 3NRYA 2X9YA 1ZHCA 5FYMA 4P09A 5L3DB 3OYZA 3C98B 5J1GA 3N9OA 3RH3A 4UF0B 2RP4A 4WNKA 3UUXB 5LHGB 4ZOLE 4EZHA 3CQGB 5E0OA 3UUNA 3C64A 4O4LE 3ANWA 1D1AA 4BJMA 1HCIA 2Q9QB 1WR6A 1MIYA 2CE7A 5DABA 2YU1A 1U4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRE A;  3ZC0 A;  5JR9 B;  5JR9 C;  5JRC B;  5JRC A;  3ZC1 A;  5JR9 A; 
#chains in the Genus database with same CATH topology
 2H89 A;  1XWM A;  2DL1 A;  2L8K A;  2PJQ A;  3K8P C;  3N2O A;  4YHJ A;  1YD8 G;  4I55 E;  2VUR A;  5DJQ C;  3ZJ2 A;  1XNQ T;  2VKJ A;  4B6X A;  2MTQ A;  3AXJ A;  4H9O C;  2XQ3 A;  2WZH A;  5IHY A;  3V5U A;  3VKH A;  4HWI B;  3CQC B;  4ISS A;  3C50 A;  2AE9 A;  3B5M A;  3EDU A;  3P4S A;  4QXB B;  3ZCJ A;  2DNX A;  2WP9 A;  4ZS3 A;  2FJD A;  3IHR A;  3LK3 B;  2XPK A;  3ONJ A;  5HXE A;  1J1J A;  5HCM A;  1UX5 A;  3KBU A;  5CB4 E;  1OED A;  2C5I T;  4ZI3 C;  3AEF A;  2XQ5 A;  4A5X A;  3AA0 B;  2E8I A;  3NZP A;  4LF9 T;  3L8R A;  3OKQ A;  5AQN B;  4KI0 F;  4PNI A;  3EAM A;  3EUH A;  4U31 A;  1OED B;  1XMO T;  4LMJ A;  3N9M A;  2BDE A;  4UV9 B;  3UFE A;  4AKI A;  4NIQ A;  3GN5 A;  1HG5 A;  3NVO A;  2E5V A;  3N5L A;  3VRB A;  3MK7 C;  3ZKR A;  4AIS A;  5AQQ B;  5KMG P;  3T1H T;  1XMQ T;  4PFP A;  4Z8X A;  4PK5 A;  3W15 B;  1IBM T;  2UXD T;  1X9B A;  5JH7 E;  1DU2 A;  3PUV F;  3BK9 A;  5FMN A;  3X1D A;  4QH1 A;  5EK2 A;  5FXW A;  3C4W A;  4H9R C;  4BAY B;  4AQF C;  2XTL A;  2LSI A;  4O2A E;  5ABH A;  3RPU A;  3CML A;  1WYB A;  1OXZ A;  3A5X A;  3K3Q C;  3MZK B;  4UEM A;  5LG4 A;  2XHE B;  4ILC A;  3K3O A;  3EAB A;  4KBM B;  4B3M T;  4JI7 T;  2WWU A;  1ZOY A;  4CXW A;  1T72 A;  2X67 A;  4Z90 A;  5FVL A;  4X1Y E;  5AFU L;  2WU2 A;  2KIN B;  2KLQ A;  3E22 E;  3D0T A;  4JLE A;  5HWX A;  5L2L A;  4H9P C;  1HS7 A;  4NXN T;  4UV8 B;  2K48 A;  5IYZ E;  2NTX A;  3UU6 A;  2R6G F;  2FJA A;  5J0Z A;  3C51 A;  4DV6 T;  3OVU A;  1HNZ T;  2W2U A;  3EDV A;  3LJC A;  1JNR A;  5JDL A;  4ASK A;  4LF6 T;  3RYH E;  3KBT A;  3QOF A;  4PW8 A;  3EVY A;  1MMN A;  1HTJ F;  3ZMU B;  5FL1 A;  5HEH A;  4X1K E;  2UUC T;  5KXJ A;  4DUZ T;  2H88 A;  2D5U A;  2W4X A;  2QRX A;  2SPC A;  2W61 A;  4FJO A;  1MMA A;  4HFI A;  2IC6 A;  4DBQ A;  5HXH A;  2YDS A;  3G06 A;  2UUA T;  3H3A A;  3K3N A;  2LJL A;  1GQE A;  3FBZ A;  4ERR A;  1T8B A;  1BR0 A;  3CKD A;  1T98 A;  3I0O A;  3L39 A;  3AXJ B;  3I9Y A;  2BBH A;  3HKC E;  1YKH B;  4ZI3 D;  1HX8 A;  2J47 A;  5HXC A;  1YKE B;  1FIO A;  2KZ7 B;  2FUP A;  3ANW B;  4HN9 A;  4LF8 T;  2W67 A;  1UUR A;  2KXP B;  1MNE A;  4PJJ A;  3HR0 A;  3M3Z B;  3PTR B;  3AA6 B;  2QA7 A;  4AKR B;  3NRX A;  1WR0 A;  1VCT A;  2V7L A;  1U5P A;  1IJ6 A;  1OED C;  5FXX A;  3RIA A;  4GYR A;  3F31 A;  2YN6 A;  4TV8 E;  5AQP B;  2WY2 A;  1G73 A;  2HN1 A;  4IIJ E;  5FY7 A;  2WS3 A;  5L3C B;  4DV3 T;  2Q9Q D;  4L9I A;  2BG9 B;  2AXD S;  3WI3 A;  1YQ3 A;  2FJB A;  3F57 A;  3GA8 A;  5LGT B;  3CQX C;  1D1B A;  2QGS A;  2V7I A;  3RX6 A;  1FJG T;  2FJE A;  1XZY A;  2CWY A;  3C4X A;  3M65 A;  3U3I A;  4DV4 T;  2LT3 A;  4DR3 T;  3GWH A;  2DLR A;  5AQT B;  4EOZ B;  2C5J A;  4JI8 T;  2LSY A;  3RYI E;  2BKN A;  2XAF B;  3QB5 K;  2XAS B;  5HWY A;  3FZK B;  4JI2 T;  4JI3 T;  1N33 T;  2UXN B;  4JUY A;  4L5G A;  4WZX A;  3VR9 A;  2G0U A;  2ODV A;  3ZCI A;  2X9X A;  5JRC B;  5AQR B;  2OV9 A;  2CHN A;  5L4E A;  1W9R A;  3PUZ F;  3AA7 B;  3HKB E;  4I43 B;  5JRE A;  3AVS A;  4UVB B;  3DJB A;  3ZLI A;  3ESL A;  4YJ3 E;  4HFH A;  1NWM X;  3N9Q A;  5GON E;  5JVD E;  5J2U E;  4P1N A;  1YXR A;  5JDQ A;  2X51 A;  4IE7 A;  3RYC E;  2MYS A;  4AQG A;  5JQG E;  2EHO A;  2K9A A;  2CBJ A;  2VKO A;  3CK6 A;  3RI5 A;  2VK9 A;  3FB2 A;  4WBN E;  2NW8 A;  4QX7 B;  4HGA A;  3ZN0 B;  3PU8 A;  3RRC A;  5JTG A;  3IF8 B;  3R6N A;  2V7M A;  3QUJ A;  1FMV A;  2B76 A;  2VVS A;  1YW0 A;  1Z0P A;  2JRK A;  4O4I E;  4QH4 A;  4YT0 A;  2XQ4 A;  3AEG A;  3JC6 D;  4ZI7 E;  4MBQ A;  4MHC A;  1Y01 A;  4IE4 A;  4YFS A;  3AE6 A;  4HFB A;  5LJN A;  4EZ4 A;  4DV7 T;  1IBK T;  2CWO A;  4ZZC A;  1MND A;  2E9X B;  3AA1 B;  2CXF A;  5CA1 E;  3OPC A;  4COF A;  4X66 T;  4LFA T;  2ACZ A;  1S94 A;  3MJX A;  2XQ8 A;  5ABE A;  3JAD A;  4NPP A;  2XUE A;  3N9N A;  2CHO A;  3E0Z A;  4UF0 A;  1W09 A;  4YSY A;  4A97 A;  3SRZ A;  4PK6 A;  4BJN A;  4KHZ F;  3O1I A;  4YY3 T;  4X65 T;  1D0Y A;  4IGU A;  4U2Y A;  2D0U A;  2YDR A;  3I1A A;  2WWV A;  2KT9 A;  2LSG A;  2Y8D A;  3RIU A;  5HEO A;  5JDF A;  2XAJ B;  4X1I E;  2V7K A;  5LB7 B;  3S4U A;  4G63 A;  4U7I A;  4MAL A;  5L4H A;  2JIW A;  2XM1 A;  5CJ5 A;  5LGU B;  5LXT E;  3AAE B;  4LFB T;  3ZJ1 A;  5CGM A;  1EZ3 A;  4HWD A;  1KK7 A;  1WCR A;  1VOM A;  4H9Q C;  4HE8 A;  3RKO A;  5IWA T;  2BG9 A;  4CXY A;  3RC8 A;  3Q9D A;  4EB6 E;  1IJ5 A;  3LDQ B;  3R84 B;  4UEL A;  5LHH B;  3HA4 A;  3HKD E;  4I0U A;  3SS1 A;  2Q9Q C;  4CXX A;  4O8S A;  4DND A;  1UGO A;  2XAQ B;  3AE7 A;  4UIG A;  1FMW A;  4YTM A;  4H63 H;  2WDQ A;  2UXB T;  2BG9 C;  1E2A A;  4XZC A;  5LA6 E;  2LSK A;  3Q5W A;  1N36 T;  5JDN A;  2W63 A;  2JQQ A;  2VWA A;  4EIW A;  4TUY E;  3N9L A;  4IE0 A;  4C91 A;  3Q2M A;  3RGL A;  4ZS2 A;  3UU5 A;  4ZHQ E;  3J7Y q;  2ZM6 T;  4CN4 A;  4DR6 T;  2C0S A;  2DI4 A;  2LKG A;  3ZMT B;  2HPL A;  4IE6 A;  2JPF A;  4LML A;  3SFD A;  5LG3 A;  4TNV A;  5HYA A;  4P0A A;  2YKS A;  3PUA A;  2BKP A;  5TAO A;  3ZT7 A;  2EHO B;  4JBW F;  4JI5 T;  3KIN B;  3PE0 A;  3H37 A;  2DWK A;  3CIR A;  4HFV A;  5M4Y A;  4UR9 A;  5C3J A;  2VQF T;  5LMU T;  4B3R T;  2CA5 A;  3VKG A;  5FL0 A;  4EGW A;  2M6B A;  1KNZ A;  2LM9 A;  3VRA A;  3ZST A;  5LP6 E;  4DV5 T;  4V1A v;  2LHR A;  4UVC B;  2XZE A;  4CN6 A;  3I0Q A;  5A1L A;  2MBG A;  3KV9 A;  4IST A;  2IDO B;  4NXM T;  4G2A A;  1Z8U A;  3LK2 B;  4HWH A;  4ILA A;  4K0U A;  1QSD A;  4AKG A;  3AE3 A;  3BQK A;  4U2Z A;  2PG8 A;  3V5S A;  3DP7 A;  1OWA A;  1FEW A;  3RC3 A;  1AJ3 A;  4P0B A;  5AQM B;  5C8Y E;  5ADX L;  2Q9Q A;  4JEH B;  1IZN B;  4WW0 A;  2IC9 A;  3U78 A;  4IDZ A;  5ABF B;  4JI6 T;  2Z6E A;  2UXC T;  3LBX A;  4DO0 A;  4JV5 T;  3CPZ A;  2W66 A;  3TLW A;  4B3S T;  2EHO C;  5LCY A;  3IA3 A;  2IAK A;  2ZM2 A;  1KEY A;  3UT5 E;  2YIN A;  5LOV E;  3P4R A;  2E9X C;  4DR5 T;  3ZMS B;  1H7C A;  2LOS A;  2WAU A;  4GK0 E;  4EV6 A;  4YTN A;  4AKL A;  5HCJ A;  1JNZ A;  4ZXL A;  1N32 T;  2I59 A;  3AED A;  1SA0 E;  3CWZ B;  1KNR A;  2BVL A;  2ES0 A;  2VB6 A;  2X66 A;  2XQA A;  5HEU A;  3TLU A;  2JQ9 A;  2FBW A;  4QWN B;  2V5D A;  4UXN B;  3RLF F;  3QC9 A;  2E2A A;  5KX5 E;  2CPT A;  4IDP A;  4TV9 E;  5KDM C;  1IAP A;  1QUU A;  2K3W A;  5ETW A;  4C90 A;  1D1C A;  3BQL A;  2X0H A;  4PFO A;  5LNK A;  2CBI A;  4GIW A;  2P9B A;  4LFC T;  3HKE E;  1SUM B;  1KF6 A;  4EED A;  2WB5 A;  2XQY A;  1L0V A;  4IL9 A;  2X0L B;  2L9Q A;  2KND A;  4MLK A;  4QKN A;  4XAX B;  4FI5 A;  2HHH T;  4IHJ E;  1V9D A;  3MA9 A;  5JDM A;  3OBV E;  4ZZB A;  2BS2 A;  4TNW A;  4LF4 T;  5AQO B;  1HNW T;  2H3R A;  3PUW F;  2RPA A;  2VL8 A;  5JR9 B;  4X20 E;  1ZV4 X;  2WDR A;  4E7Z A;  5BR8 T;  2I6H A;  4TWF A;  2LLY A;  4JI1 T;  1I94 T;  2UU9 T;  1MIW A;  4IDN A;  2RA1 A;  4EXT A;  5LGN B;  1G8X A;  1LVK A;  2CCQ A;  2HH7 A;  3Q5X A;  5JR9 A;  3ZYM A;  1QLB A;  2V8S V;  2WDV A;  4BA9 A;  2KSR A;  5CA0 E;  2N9D A;  4DR7 T;  5L3G B;  2WM9 A;  2Y48 B;  2XSB A;  4O4J E;  3AAA B;  3JAE A;  4L0R A;  3UU8 A;  2CM0 A;  2CMR A;  2VKD A;  2F4V T;  2I0M A;  2NWB A;  2X9W A;  2V26 A;  2IIU A;  3ONL C;  2ZM0 A;  5FXZ A;  2DCF A;  4GYS A;  3B13 A;  3RHW A;  3ZN1 B;  3FXE B;  4I50 E;  4U74 A;  3UQ4 A;  4H63 V;  3OJA A;  4ILB A;  1US7 B;  4KP3 C;  2CEA A;  4QX8 B;  1NEN A;  2VL0 A;  2BS3 A;  4EYU A;  4UVA B;  2WMN A;  1X79 A;  1NEK A;  3ZMV B;  3UUB A;  4GKK T;  4H9N C;  4CI3 B;  3PJA A;  3SOL A;  3UU3 A;  3TLT A;  4IRE A;  3ZT5 A;  5FY0 A;  2GK9 A;  2IUB A;  4A56 A;  5IUX A;  3P7I A;  2E9X A;  3ZEF B;  5FVK A;  5EK4 A;  2NP9 A;  4ZI2 C;  1XDO A;  3PJA J;  4IT4 A;  5FXV A;  2NW7 A;  4HKA A;  4DID B;  4U3C A;  4YSX A;  2V1D B;  1UUS A;  4ZI2 D;  5JR9 C;  3IEE A;  5LHI B;  1SHZ C;  3P4Q A;  4PAG A;  5EZY E;  2IW5 B;  3KV6 A;  4JYA T;  2E9X D;  1WRD A;  3Q5E A;  4ANJ A;  3GN5 B;  3AE4 A;  5AQL B;  2YEV C;  2W62 A;  4ADZ A;  2XAG B;  3LFM A;  3LK4 2;  3TLV A;  5LBQ B;  3PUX F;  4YHH T;  2LOP A;  5HEJ A;  1HX1 B;  3HL6 A;  5BMV E;  4KX6 A;  5DQW A;  4DMV A;  3OTO T;  1W0B A;  2LM2 A;  4OHF A;  1M62 A;  3EI0 A;  2ZMA A;  2UUB T;  1ZKE A;  2V6Y B;  3RF1 A;  2WBL A;  2K5B B;  5H6R B;  1T7S A;  3AEA A;  2IML A;  4QH5 A;  1J5W A;  2PFV A;  3L09 A;  2LEH A;  4DR2 T;  3KV5 A;  1OED E;  4ZEY A;  5JRC A;  4OX9 T;  4DMW A;  2M67 A;  4OYK A;  4YSZ A;  3SFE A;  3N2G E;  2D0T A;  2VKH A;  1MMD A;  1S35 A;  1SE7 A;  3DTO A;  5EK3 A;  4O4H E;  1ZP0 A;  1E7P A;  3ABV A;  2KWH A;  4TX5 A;  3PUR A;  3SWH A;  3KDS E;  3NWI A;  2YOE A;  1J5E T;  2DHR A;  2J62 A;  3NZQ A;  4IE5 A;  4O2B E;  4DR1 T;  1UX4 A;  4IL4 A;  4YLH A;  3VHL A;  4AQF A;  5L3E B;  5L3B B;  1IBL T;  4AKH A;  2OLT A;  2A3D A;  5HXR A;  4QXC B;  2UXX B;  3AE8 A;  2HPJ A;  4Q25 A;  4WBO A;  4CI2 B;  2A9U A;  3T1Y T;  2MOZ A;  3RIF A;  2XQ7 A;  4CN1 A;  3P4P A;  5AQG B;  4DV1 T;  1M7K A;  2JMK A;  3PV0 F;  5FP3 A;  4A98 A;  3ZT6 A;  4EAH A;  5L47 A;  3FZH B;  5AQJ B;  3UUL A;  3ZYK A;  5JDG A;  2JQK A;  4H9S E;  3CX6 B;  5AQH B;  4Z91 A;  4HWC A;  5H6Q B;  3UUM A;  3IBP A;  3JCF A;  2EHO D;  3K1S A;  3OYX A;  4NUU A;  2A72 A;  3O1J A;  4GKJ T;  2Y6X A;  5AQI B;  2JMH A;  4K0K T;  4PJL A;  2XSA A;  3A7M A;  3E08 A;  1D0Z A;  3KV4 A;  3N2K E;  4GOU A;  5LBM A;  3KVB A;  5JDH A;  2WMO A;  1VCS A;  5HEG A;  2DWG A;  1UK5 A;  2LE8 A;  1O3X A;  2QVA A;  3FZF B;  1VRB A;  3PUS A;  4OFZ A;  5LYJ E;  4AXP A;  4AIU A;  4QHO A;  1HR0 T;  4JI0 T;  2MPK A;  3UU4 A;  5HAX A;  4TN7 B;  2L3L A;  1MIV A;  3WAK A;  5LJM A;  3CX7 B;  4J2C A;  2WZI A;  4KUM B;  3PUY F;  5F5W A;  3EHZ A;  4AI6 A;  4N78 D;  2KMF A;  5LMN T;  3LBX B;  4YXD A;  4TWD A;  4ILU A;  4X5T A;  2X0Y A;  4PK4 A;  3ONX A;  2IHR 1;  2YK0 A;  3Q5D A;  3VU7 H;  4HEA A;  3AAI A;  3FHN A;  4HWF A;  2JJ9 A;  4F6R C;  2CRB A;  3VR8 A;  3ZYL A;  5AQF B;  5L3F B;  1B7T A;  3ZMZ B;  5HXS A;  3C4Z A;  3KVA A;  4CI1 B;  3O9X A;  3NBX X;  4YTP A;  1I6Z A;  4LF5 T;  3ZC1 A;  2A2F X;  2NW9 A;  4DVD A;  3UQ7 A;  4U7Y A;  4U33 A;  1WFD A;  4GK5 E;  5C2T A;  3FBL A;  3FZM B;  4X64 T;  1BR2 A;  2V6X A;  4KMC A;  2H7V C;  3JC6 C;  2PBI A;  3I9W A;  4PJN A;  2YU2 A;  5AQU B;  3AEC A;  2J1D G;  1YQ4 A;  3T8O A;  2VAS A;  4TWH A;  2XQ6 A;  4HFC A;  2LSJ A;  2ACX A;  1WLX A;  3A8Y C;  3B57 A;  1KNP A;  3JAF A;  4HTE A;  4JEU B;  4TZ4 C;  1ZEE A;  2QYW A;  2XY8 B;  3RYF E;  2YDQ A;  3L3P A;  3J9X 1;  2V7J A;  4QXH B;  1XNR T;  2CLY C;  1HF8 A;  2W0G A;  2NTY A;  2X68 A;  3ZC0 A;  2D2S A;  3CVR A;  4CQI A;  2XQ9 A;  3NKZ A;  1UCU A;  3AE1 A;  3QB5 A;  1CHU A;  5FNV E;  4LF7 T;  2M6I A;  3TKL B;  3ETV A;  4X62 T;  3RKG A;  4DV0 T;  2CXL A;  3HI2 A;  4OYJ A;  1W0A A;  2NR4 A;  4EEB A;  3AB3 B;  2BVM A;  3FXD B;  2BBJ A;  3AE2 A;  5F3J A;  1XDP A;  3ETU A;  1KFY A;  2XAH B;  3P8C D;  2WSS V;  3QK6 A;  4PJM A;  3O1H A;  4XBF B;  2N1G A;  2XJ7 A;  3N9P A;  2LKH A;  2BKO A;  1WYC A;  4I4T E;  2C5K T;  1HG2 A;  1D0X A;  1BR1 A;  2LHN A;  2OA5 A;  1MMG A;  3KFW X;  4IDQ A;  1R8I A;  2ODU A;  4HFE A;  3LG7 A;  3P50 A;  4CZZ B;  2BZB A;  5FY1 A;  2VVN A;  3TLS A;  4E7S A;  3AEE A;  1Y64 B;  3F2E A;  4U72 A;  2B1E A;  3GMI A;  3LSV A;  3CX8 B;  3FZL B;  3RRW A;  4EYY R;  2N2N A;  4IDO A;  4YJ2 E;  3WAJ A;  1N34 T;  3ZPO A;  4M1P A;  2CLY B;  1LRZ A;  2ZLY A;  4NUV A;  5J2T E;  4DUY T;  2NOX A;  3MXZ A;  4B3T T;  3PDY A;  1CUN A;  4KHP T;  3BQI A;  5ABG A;  4WYV A;  3PUQ A;  2KWI B;  4F8H A;  3H3M A;  2K24 A;  4OK0 A;  5DQV A;  5AQK B;  3RIU C;  4DBR A;  4DV2 T;  4DR4 T;  3P4W A;  2CXD A;  1BR4 A;  5F8P A;  3MAC A;  4LMK A;  2H7O A;  2WQY A;  2LRL A;  2X9H A;  3PUG A;  3RQW A;  3UTK A;  1LKX A;  3RQU A;  3MKD A;  1LVF A;  2WU5 A;  2W00 A;  1NAF A;  2HN2 A;  1HNX T;  1E1H B;  3O4X E;  3PU3 A;  3AVR A;  4MFR A;  2MAW A;  2BS4 A;  1HFA A;  2D9D A;  2XM2 A;  2X9Y A;  2ZM8 A;  3NRY A;  4HFD A;  2E5L T;  1ZHC A;  2LRK A;  5FYM A;  2J4G A;  2V6Y A;  5AQS B;  4P09 A;  5L3D B;  3OYZ A;  3C98 B;  3AE9 A;  5J1G A;  3N9O A;  3RH3 A;  4UF0 B;  3UFG A;  2RP4 A;  5CFB A;  4WNK A;  3UUX B;  5LHG B;  4ZOL E;  5FKY A;  4EZH A;  3CQG B;  5E0O A;  3UUN A;  3C64 A;  2VQE T;  2PTF A;  3ANW A;  4O4L E;  5AQV B;  1D1A A;  3AE5 A;  4BJM A;  2JQH A;  1HCI A;  2Q9Q B;  3ZSS A;  1WR6 A;  3QNU A;  1MIY A;  2BG9 E;  5ABF A;  4AQY T;  3AEB A;  4JI4 T;  2CE7 A;  5DAB A;  2WCA A;  2YU1 A;  1U4Q A;  2V5C A; 
#chains in the Genus database with same CATH homology
 4YHJ A;  3K8P C;  5DJQ C;  2L8K A;  2PJQ A;  3N2O A;  1YD8 G;  4I55 E;  3ZJ2 A;  2VKJ A;  4B6X A;  2MTQ A;  4H9O C;  5IHY A;  3V5U A;  3VKH A;  3CQC B;  4ISS A;  3C50 A;  3EDU A;  4QXB B;  3ZCJ A;  2DNX A;  4ZS3 A;  3IHR A;  3LK3 B;  5HXE A;  1UX5 A;  3KBU A;  5CB4 E;  2C5I T;  4ZI3 C;  3AA0 B;  2E8I A;  3NZP A;  3OKQ A;  4PNI A;  3EUH A;  3N9M A;  2BDE A;  4UV9 B;  3UFE A;  4AKI A;  3GN5 A;  1HG5 A;  5KMG P;  3N5L A;  3MK7 C;  4PFP A;  4Z8X A;  4PK5 A;  3W15 B;  5JH7 E;  3BK9 A;  5FMN A;  5EK2 A;  5FXW A;  3C4W A;  4H9R C;  4BAY B;  4AQF C;  2XTL A;  2LSI A;  4O2A E;  3RPU A;  3CML A;  1WYB A;  1OXZ A;  3A5X A;  3K3Q C;  3MZK B;  4UEM A;  5LG4 A;  2XHE B;  3K3O A;  4KBM B;  2WWU A;  4CXW A;  5AFU L;  4P0A A;  2X67 A;  4X1Y E;  5HWX A;  2KIN B;  2KLQ A;  3E22 E;  3D0T A;  4JLE A;  5L2L A;  4H9P C;  1HS7 A;  4UV8 B;  2K48 A;  5IYZ E;  2NTX A;  3C51 A;  3EDV A;  3LJC A;  5JDL A;  4ASK A;  3RYH E;  3KBT A;  4PW8 A;  3ZMU B;  3EVY A;  1MMN A;  1HTJ F;  4X1K E;  2D5U A;  2SPC A;  4FJO A;  2W61 A;  1MMA A;  2IC6 A;  4DBQ A;  5HXH A;  3H3A A;  3K3N A;  2LJL A;  3FBZ A;  4ERR A;  1BR0 A;  3CKD A;  1T98 A;  3I0O A;  3I9Y A;  3HKC E;  1YKH B;  4ZI3 D;  1HX8 A;  5HXC A;  1YKE B;  1FIO A;  2KZ7 B;  3ANW B;  4HN9 A;  2KXP B;  1MNE A;  4PJJ A;  3HR0 A;  4AKR B;  3PTR B;  3AA6 B;  2QA7 A;  3NRX A;  2V7L A;  1U5P A;  1IJ6 A;  5FXX A;  4GYR A;  3F31 A;  4TV8 E;  5L3E B;  5L3C B;  5L3B B;  1G73 A;  5LJM A;  4IIJ E;  5FY7 A;  2Q9Q D;  4L9I A;  3WI3 A;  3F57 A;  3GA8 A;  5LGT B;  3CQX C;  1D1B A;  2QGS A;  2V7I A;  3RX6 A;  3M65 A;  2CWY A;  3C4X A;  3U3I A;  2LT3 A;  3GWH A;  2DLR A;  4EOZ B;  2C5J A;  2LSY A;  3RYI E;  2XAF B;  5HWY A;  2XAS B;  2UXN B;  4JUY A;  4L5G A;  3ZCI A;  5JRC B;  2G0U A;  2ODV A;  2X9X A;  3AA7 B;  3HKB E;  4I43 B;  5JRE A;  3AVS A;  4UVB B;  3DJB A;  3ZLI A;  3ESL A;  4YJ3 E;  1NWM X;  3N9Q A;  5GON E;  5JVD E;  5J2U E;  5JDQ A;  2X51 A;  4IE7 A;  3RYC E;  2MYS A;  4AQG A;  5JQG E;  2EHO A;  2K9A A;  2VKO A;  4WBN E;  2VK9 A;  3FB2 A;  2NW8 A;  4QX7 B;  4HGA A;  3ZN0 B;  3PU8 A;  3RRC A;  3IF8 B;  3R6N A;  2V7M A;  3QUJ A;  1FMV A;  1YW0 A;  1Z0P A;  2JRK A;  4O4I E;  3JC6 D;  4ZI7 E;  4MBQ A;  4MHC A;  4IE4 A;  4YFS A;  5LJN A;  4EZ4 A;  2CWO A;  1MND A;  2E9X B;  3AA1 B;  2CXF A;  5CA1 E;  1S94 A;  3MJX A;  2XUE A;  3N9N A;  4UF0 A;  3E0Z A;  3SRZ A;  4PK6 A;  4BJN A;  3O1I A;  1D0Y A;  4IGU A;  2D0U A;  3I1A A;  2KT9 A;  2LSG A;  2Y8D A;  5JDF A;  2XAJ B;  4X1I E;  2V7K A;  3S4U A;  4G63 A;  4MAL A;  5LXT E;  5LGU B;  3AAE B;  3ZJ1 A;  1EZ3 A;  1KK7 A;  3RKO A;  1VOM A;  4H9Q C;  4HE8 A;  3RC8 A;  4CXY A;  3Q9D A;  4EB6 E;  1IJ5 A;  3R84 B;  4UEL A;  5LHH B;  3HA4 A;  3HKD E;  3SS1 A;  2Q9Q C;  4CXX A;  4O8S A;  4DND A;  2XAQ B;  4UIG A;  1FMW A;  4H63 H;  5LA6 E;  4XZC A;  2LSK A;  3Q5W A;  5JDN A;  2W63 A;  2JQQ A;  2VWA A;  4EIW A;  4TUY E;  3N9L A;  4IE0 A;  4C91 A;  3Q2M A;  4ZHQ E;  4ZS2 A;  3J7Y q;  2C0S A;  2DI4 A;  3ZMT B;  2HPL A;  4IE6 A;  2JPF A;  5HYA A;  3PUA A;  5TAO A;  2EHO B;  3KIN B;  3PE0 A;  3H37 A;  2DWK A;  4HFV A;  5M4Y A;  2CA5 A;  3VKG A;  1KNZ A;  2LM9 A;  5LP6 E;  4V1A v;  2LHR A;  4UVC B;  3I0Q A;  5A1L A;  2MBG A;  3KV9 A;  4IST A;  4G2A A;  3LK2 B;  4K0U A;  1QSD A;  3BQK A;  2PG8 A;  3V5S A;  3DP7 A;  1OWA A;  1FEW A;  3RC3 A;  1AJ3 A;  4P0B A;  5C8Y E;  5ADX L;  2Q9Q A;  4JEH B;  1IZN B;  4WW0 A;  2IC9 A;  3U78 A;  4IDZ A;  2Z6E A;  3LBX A;  4DO0 A;  3CPZ A;  2EHO C;  5LCY A;  2IAK A;  2ZM2 A;  3UT5 E;  2YIN A;  5LOV E;  2E9X C;  3ZMS B;  1H7C A;  2LOS A;  2WAU A;  4GK0 E;  4AKL A;  2I59 A;  1SA0 E;  3CWZ B;  2BVL A;  2ES0 A;  2VB6 A;  2X66 A;  4QWN B;  4UXN B;  3QC9 A;  5KX5 E;  4TV9 E;  5KDM C;  1IAP A;  1QUU A;  5ETW A;  4C90 A;  1D1C A;  3BQL A;  4PFO A;  5LNK A;  4GIW A;  2P9B A;  3HKE E;  2XQY A;  2X0L B;  2L9Q A;  2KND A;  4MLK A;  4QKN A;  4XAX B;  4FI5 A;  4IHJ E;  1V9D A;  3MA9 A;  5JDM A;  3OBV E;  2H3R A;  2VL8 A;  5JR9 B;  4X20 E;  1ZV4 X;  4E7Z A;  1MIW A;  2RA1 A;  4EXT A;  5LGN B;  1G8X A;  1LVK A;  2CCQ A;  2HH7 A;  3Q5X A;  5JR9 A;  3ZYM A;  4BA9 A;  5CA0 E;  2N9D A;  5L3G B;  2WM9 A;  2Y48 B;  4O4J E;  3AAA B;  4L0R A;  2CM0 A;  2CMR A;  2VKD A;  2X9W A;  2NWB A;  2V26 A;  2ZM0 A;  5FXZ A;  2DCF A;  4GYS A;  3B13 A;  3ZN1 B;  3FXE B;  4I50 E;  4U74 A;  4H63 V;  3OJA A;  1US7 B;  4KP3 C;  2CEA A;  4QX8 B;  4EYU A;  4UVA B;  2WMN A;  1X79 A;  3ZMV B;  4H9N C;  4CI3 B;  3SOL A;  5FY0 A;  2GK9 A;  4A56 A;  3P7I A;  2E9X A;  3ZEF B;  5EK4 A;  2NP9 A;  4ZI2 C;  5FXV A;  2NW7 A;  4HKA A;  2V1D B;  4ZI2 D;  5JR9 C;  5LHI B;  3IEE A;  1SHZ C;  4PAG A;  5EZY E;  2IW5 B;  3KV6 A;  2E9X D;  1WRD A;  4ANJ A;  3GN5 B;  2YEV C;  2W62 A;  4ADZ A;  2XAG B;  3LFM A;  3LK4 2;  5LBQ B;  2LOP A;  3HL6 A;  5BMV E;  4DMV A;  5DQW A;  4OHF A;  2ZMA A;  1ZKE A;  2WBL A;  2K5B B;  5H6R B;  2PFV A;  3L09 A;  2LEH A;  3KV5 A;  5JRC A;  4DMW A;  2M67 A;  4OYK A;  3N2G E;  2D0T A;  2VKH A;  1MMD A;  1S35 A;  3DTO A;  5EK3 A;  4O4H E;  2KWH A;  4TX5 A;  3PUR A;  3SWH A;  3KDS E;  2DHR A;  3NZQ A;  4O2B E;  4IE5 A;  1UX4 A;  4YLH A;  3VHL A;  4AQF A;  4AKH A;  2A3D A;  5HXR A;  4QXC B;  2UXX B;  2HPJ A;  4WBO A;  4CI2 B;  2MOZ A;  2JMK A;  4EAH A;  5FP3 A;  3UUL A;  5JDG A;  3ZYK A;  4H9S E;  3CX6 B;  3UUM A;  5H6Q B;  3IBP A;  2EHO D;  3OYX A;  4NUU A;  2A72 A;  3O1J A;  2Y6X A;  2JMH A;  4PJL A;  3KV4 A;  3E08 A;  1D0Z A;  3N2K E;  4GOU A;  5LBM A;  3KVB A;  5JDH A;  2WMO A;  2DWG A;  2LE8 A;  1O3X A;  5LYJ E;  3PUS A;  1VRB A;  4OFZ A;  4AXP A;  4QHO A;  5HAX A;  4TN7 B;  2L3L A;  1MIV A;  3WAK A;  3CX7 B;  4J2C A;  4KUM B;  4AI6 A;  4N78 D;  2KMF A;  3LBX B;  4ILU A;  4PK4 A;  3ONX A;  2YK0 A;  3VU7 H;  4HEA A;  3AAI A;  3FHN A;  2JJ9 A;  4F6R C;  3ZYL A;  5L3F B;  1B7T A;  3ZMZ B;  5HXS A;  3C4Z A;  3KVA A;  4CI1 B;  3O9X A;  3NBX X;  3ZC1 A;  2A2F X;  4DVD A;  4GK5 E;  3FBL A;  1BR2 A;  4KMC A;  2H7V C;  3JC6 C;  2PBI A;  3I9W A;  4PJN A;  2YU2 A;  2J1D G;  3T8O A;  2VAS A;  2LSJ A;  2ACX A;  1WLX A;  3B57 A;  4JEU B;  4TZ4 C;  2NW9 A;  4HTE A;  1ZEE A;  3RYF E;  3L3P A;  3J9X 1;  2V7J A;  4QXH B;  2CLY C;  1HF8 A;  2W0G A;  2NTY A;  2X68 A;  3ZC0 A;  2D2S A;  3CVR A;  4CQI A;  1UCU A;  5FNV E;  3TKL B;  3ETV A;  2CXL A;  3HI2 A;  4OYJ A;  3AB3 B;  2BVM A;  3FXD B;  5F3J A;  3ETU A;  2XAH B;  4PJM A;  3P8C D;  2WSS V;  3QK6 A;  3O1H A;  4XBF B;  2N1G A;  3N9P A;  1WYC A;  4I4T E;  2C5K T;  1HG2 A;  1D0X A;  1BR1 A;  2LHN A;  2OA5 A;  1MMG A;  3KFW X;  2ODU A;  3LG7 A;  4CZZ B;  2BZB A;  5FY1 A;  4E7S A;  1Y64 B;  3F2E A;  4U72 A;  2B1E A;  3GMI A;  3RRW A;  3CX8 B;  4EYY R;  4YJ2 E;  4AKG A;  2N2N A;  3WAJ A;  3ZPO A;  4M1P A;  2CLY B;  1LRZ A;  2ZLY A;  4NUV A;  5J2T E;  2NOX A;  3MXZ A;  3PDY A;  1CUN A;  3BQI A;  3PUQ A;  2KWI B;  4DBR A;  2K24 A;  4OK0 A;  5DQV A;  2CXD A;  1BR4 A;  5F8P A;  3MAC A;  2H7O A;  2X9H A;  3PUG A;  3UTK A;  1LKX A;  3MKD A;  1LVF A;  2W00 A;  1NAF A;  1E1H B;  3O4X E;  3PU3 A;  3AVR A;  4MFR A;  2ZM8 A;  1HFA A;  3NRY A;  2X9Y A;  1ZHC A;  5FYM A;  4P09 A;  5L3D B;  3OYZ A;  3C98 B;  5J1G A;  3N9O A;  3RH3 A;  4UF0 B;  2RP4 A;  4WNK A;  3UUX B;  5LHG B;  4ZOL E;  4EZH A;  3CQG B;  5E0O A;  3UUN A;  3C64 A;  4O4L E;  3ANW A;  1D1A A;  4BJM A;  1HCI A;  2Q9Q B;  1WR6 A;  1MIY A;  2CE7 A;  5DAB A;  2YU1 A;  1U4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...