5JR9C

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
185
structure length
185
Chain Sequence
MLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords NEQ131
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
total genus 82
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9C00
5JR9B 5JREA 3ZC0A 5JRCA 5JR9C 3ZC1A 5JRCB 5JR9A
chains in the Genus database with same CATH superfamily
2MYSA 4TNWA 4ZOLE 1IBLT 1NENA 2W61A 4YXDA 3FB2A 5ADXL 4DV1T 3HKCE 3Q5XA 3QOFA 2MOZA 2XQYA 2RP4A 3CKDA 2V26A 5IWAT 3U78A 2ACZA 4BAYB 3N9LA 4OK0A 4ERRA 3I1AA 3QC9A 4U3CA 1V9DA 3UU5A 3HKDE 2YOEA 5FY0A 1IZNB 2XQ9A 2X9XA 2FUPA 2XSBA 1UUSA 4F6RC 2E9XD 1VRBA 3UFEA 1XNRT 2XAQB 5LGNB 3JC6D 4Z90A 2M6IA 1YKEB 2PFVA 5JDFA 4ZEYA 2LT3A 4PAGA 4ZS2A 4X1IE 4CQIA 2PJQA 4JI1T 2Z6EA 5FY1A 4ILAA 3VHLA 5IHYA 2LM2A 2LOSA 5LP6E 3LJCA 5JTGA 1FMWA 2R6GF 3VRBA 1GQEA 4XAXB 3ZCIA 3UT5E 2WWVA 1OXZA 3UU3A 4AKLA 3IEEA 1Y01A 1IJ6A 4UIGA 3PJAA 3RYHE 2JQ9A 3T8OA 3SFEA 3ZC1A 3EVYA 2V7KA 5L2LA 3C51A 1HG2A 3RHWA 3BQIA 3ONJA 2XQ4A 2V5DA 4QH1A 2YN6A 4ZI3D 4J2CA 4AXPA 2X0HA 2XQ5A 2B76A 4CI3B 3E0ZA 4EEDA 1MIVA 2L8KA 3ZYMA 4BJMA 3AEAA 2IMLA 5DABA 3KV5A 4IDOA 1AJ3A 3UU6A 3A8YC 2MPKA 2ODUA 5FMNA 3K1SA 2E9XB 5HEUA 3DTOA 3LBXB 3LFMA 3NKZA 3PU3A 4AIUA 1U4QA 3AE3A 3OTOT 4TV9E 4EOZB 3G06A 2H7VC 3ZYKA 5TAOA 2DI4A 3C98B 4UR9A 4JI2T 2WZHA 2UXCT 2YK0A 4DV5T 2E8IA 4JLEA 2JQHA 3H37A 5JR9B 4CI1B 5L4EA 2AE9A 2NR4A 4YSYA 2V6YB 4QWNB 4HTEA 5AQTB 4GKKT 2WB5A 4H9QC 5HEGA 4IE7A 2HPLA 3P8CD 3WAKA 4H9PC 2YDQA 3O4XE 3ETUA 1W09A 4JI5T 4ZZBA 4LF6T 3ESLA 1SHZC 2UUAT 3R84B 3ABVA 1IBMT 2YEVC 3AXJA 5JREA 2VQFT 4I0UA 3F2EA 2AXDS 5FVLA 5IUXA 4HWHA 2XUEA 4NXNT 3RYIE 3IF8B 4EXTA 4JI6T 4DV7T 4KHZF 3FXEB 5AQHB 4EZ4A 1B7TA 3ZKRA 3CWZB 3QB5K 3K3OA 2X9YA 3BQKA 4N78D 4P0BA 3AE2A 3PJAJ 3RH3A 3P4PA 5JDGA 3E08A 2KWIB 3RIUA 5IYZE 5C8YE 3M65A 1S94A 4DMWA 2N9DA 4DBRA 4ZS3A 5AQPB 3P4QA 2H3RA 1OEDA 1XMQT 2WSSV 2VL0A 2VKHA 4HFIA 3PUGA 2LLYA 3B13A 4ISSA 4K0UA 1FIOA 1HR0T 1WR6A 1YXRA 3GWHA 4ZZCA 1X9BA 2I0MA 2VL8A 3AE6A 3RC3A 3LDQB 1N33T 4TN7B 4DR5T 4EYYR 1FEWA 3SRZA 2OA5A 5FVKA 5DQWA 4QXHB 1T7SA 2LSJA 4JI7T 2H7OA 2LSKA 3TLSA 2LHNA 4CN6A 2DLRA 2XAFB 3EAMA 3PUZF 2V6XA 4EB6E 2XQAA 3KBUA 4ZI7E 2WWUA 3L39A 4OFZA 4L9IA 4DNDA 3KV6A 3C4XA 1NEKA 3JAFA 4JYAT 5HXHA 5A1LA 3VRAA 4IDNA 3ZSTA 2I59A 4Z91A 2JPFA 2XQ3A 3RYFE 1S35A 1D1CA 3MACA 4E7ZA 3O9XA 2VKOA 2B1EA 4PJLA 2KXPB 4JI3T 3B5MA 3CIRA 3N9OA 3MA9A 2KSRA 4MFRA 1DU2A 2VK9A 2F4VT 3PUXF 1JNZA 3SS1A 5AQIB 5HXSA 4GK0E 3UU4A 1BR2A 4AI6A 4UXNB 3NRXA 4ZHQE 1R8IA 2Y8DA 1WLXA 3VR9A 4DV0T 5ABGA 2LM9A 3O1IA 3SFDA 2VKJA 3PUWF 1MIWA 3VR8A 4EIWA 1LRZA 3F31A 1HFAA 1XZYA 3NBXX 2WY2A 2C5JA 4IDZA 2V7JA 2X51A 2J47A 4QX8B 2CLYB 5L47A 5LMUT 3AEBA 4LFAT 1HNWT 2NTXA 1HX1B 4TWDA 2JQQA 3R6NA 5HCMA 1BR4A 5FYMA 3UUBA 5LHHB 3FBLA 2WQYA 4TZ4C 2BKOA 5JH7E 2BG9E 2BS2A 2W00A 4EYUA 5HYAA 3M3ZB 4IREA 3P4RA 4DVDA 2CPTA 1IAPA 2WDVA 5AQJB 2V8SV 1O3XA 2D0TA 2YU2A 4YSXA 3CX8B 3HI2A 5FXVA 5AQSB 3ZYLA 4AISA 5CA0E 4AKRB 3ANWA 2WZIA 2J4GA 3QB5A 4PFOA 2WAUA 2CRBA 2ZLYA 1WCRA 3KINB 4ILBA 2E9XA 1I94T 3LBXA 4A98A 4QXCB 4CXYA 3J9X1 3VKGA 5HXEA 2UXNB 2JIWA 3Q5EA 5HXRA 2QVAA 4EAHA 3L8RA 4GKJT 3SOLA 2J1DG 1U5PA 4X65T 4X5TA 2H88A 3SWHA 4ILUA 4PNIA 2VVNA 2ES0A 3CPZA 3UULA 3TLVA 3ZT5A 3MZKB 2LHRA 1E7PA 4ZI2D 2BG9B 1ZKEA 3BK9A 4HFVA 2FJAA 3RIUC 2A72A 3I9WA 4HWIB 3ZJ2A 1BR0A 3LSVA 3FBZA 3PDYA 3T1YT 1VCSA 3PUYF 5AQOB 3TKLB 3ZT7A 1OEDC 5J2UE 2KNDA 2BS3A 5AQVB 4O2BE 4IE4A 5L3BB 4HFBA 2K24A 3O1HA 1MNDA 4NUVA 2CBJA 4ANJA 3W15B 3AEEA 5JVDE 4DO0A 5HEJA 3PURA 5LBQB 2LOPA 5KDMC 2NTYA 3HA4A 1M7KA 1CHUA 4ASKA 3H3AA 3OPCA 4AQYT 3BQLA 4A5XA 4EGWA 4I50E 3PU8A 4E7SA 5ABFB 3E22E 4P1NA 3KVBA 3PUVF 3CVRA 2CBIA 4O4LE 2PTFA 4LFBT 5HCJA 5GONE 2IAKA 5L4HA 2Q9QD 1UGOA 1Z8UA 3I0QA 4IHJE 5CFBA 4PK5A 4I55E 1KEYA 4CN1A 3KV4A 1M62A 3NZPA 3MKDA 3UU8A 1KNPA 4LFCT 5LJNA 2VB6A 2X0LB 2XZEA 4HFDA 2SPCA 2WCAA 2W0GA 4LF8T 2D0UA 5HEOA 2K9AA 4NIQA 1QUUA 2KMFA 3F57A 3AA0B 3ETVA 2XQ6A 2CEAA 3TLUA 4AQGA 3RPUA 2X0YA 5FP3A 4IDQA 2YKSA 4X20E 2RPAA 3RI5A 3PTRB 4HEAA 2WM9A 4TWFA 3C4WA 4H63H 2VQET 5H6QB 5CJ5A 3OKQA 4B3RT 5AQRB 3KV9A 1UX4A 4U2ZA 4NPPA 5CB4E 2JMHA 2X67A 2K48A 4WBOA 3HKEE 2W66A 1US7B 4MBQA 4CZZB 1HNZT 3GMIA 2Q9QB 1HCIA 5LBMA 1T72A 3CQXC 1D1BA 2FJEA 2CA5A 3EUHA 4GK5E 1W0AA 3QNUA 3RC8A 4COFA 1ZOYA 3LK3B 1T98A 4YT0A 4GYSA 2BVMA 2XAJB 3NWIA 2WBLA 2KLQA 3EHZA 2DCFA 4YJ2E 5H6RB 2V7IA 4NXMT 2KT9A 5L3CB 2XASB 3FXDB 3AE5A 3K3QC 3ONXA 5FKYA 4A56A 3IA3A 4U7YA 2CWYA 5HWYA 1WR0A 2WS3A 2MBGA 3AAEB 4IE0A 4PW8A 4KI0F 2D9DA 4DV3T 1XNQT 5DJQC 2ZM0A 2P9BA 2XQ7A 3JC6C 2OV9A 3RKOA 3DJBA 1YQ3A 3P4WA 2UUCT 5HAXA 2KZ7B 5JDHA 1HF8A 3RX6A 4AQFA 3H3MA 1N36T 3IBPA 3WI3A 4L0RA 2IC9A 1L0VA 2Y48B 3AA7B 2A3DA 3L09A 3EDUA 4DBQA 2QA7A 4IT4A 3V5SA 1KFYA 4JUYA 1HX8A 3RKGA 4YSZA 2ACXA 3AEGA 5HXCA 2LKHA 3ONLC 1HG5A 5F3JA 5L3GB 4M1PA 3ZCJA 2EHOD 2ODVA 5AQGB 4ZI3C 2WP9A 4UV9B 4AKHA 2PG8A 4DR2T 1UURA 5LMNT 4HE8A 2V7MA 2DWGA 2UXBT 3A5XA 3RQWA 2XSAA 3N2OA 3X1DA 4P09A 5FXXA 4X64T 4QKNA 5F8PA 2IC6A 4DUYT 1CUNA 2WDQA 2BG9A 3RIFA 4X1KE 4EZHA 4YHJA 4DUZT 3S4UA 1UCUA 4PFPA 3UUXB 3RF1A 2OLTA 3RYCE 3JCFA 1NAFA 2BBJA 5J1GA 3AVSA 4UVAB 5FNVE 1XMOT 3AE7A 4LMKA 4FI5A 3OYZA 4NUUA 3AEDA 4Q25A 3CX6B 4ZXLA 2ZMAA 1FMVA 1J1JA 4I43B 3LG7A 5HWXA 2EHOB 2XPKA 1JNRA 4LMLA 4AKIA 2MAWA 4U74A 2K3WA 3C50A 4MHCA 1WFDA 2YDSA 5LCYA 2VURA 4G2AA 2QRXA 2XHEB 5LYJE 5LA6E 2LSYA 4DIDB 4YTMA 1HNXT 2CHOA 4TWHA 1MMGA 4IGUA 3LK2B 2CHNA 4ADZA 1D1AA 3C4ZA 4K0KT 5LG3A 2VASA 2NW9A 4X1YE 2XY8B 4QH4A 5C3JA 3TLWA 3N9NA 2M67A 4X62T 3N9QA 4IDPA 4JV5T 3UTKA 1E2AA 4UV8B 4CN4A 5AQLB 2LSIA 3VKHA 4LF4T 3PUSA 4X66T 3AE4A 2W67A 1ZP0A 4U72A 1G73A 2BKPA 5J0ZA 3NZQA 2FJBA 5ETWA 3ZMUB 2UXDT 4PK6A 2PBIA 3GA8A 3LK42 4DR7T 1OWAA 3ZMSB 2H89A 4LMJA 1OEDB 2BBHA 4WW0A 4DR1T 2IIUA 4DR6T 4PK4A 3MK7C 4UF0B 4JI8T 2W63A 4YFSA 2C5IT 1IBKT 4Z8XA 5BR8T 2ZM6T 2XJ7A 1YKHB 2JRKA 4H9NC 2M6BA 5JR9A 2CLYC 3UQ4A 2CWOA 2LEHA 4JEHB 2Q9QA 2V6YA 3IHRA 2YU1A 5JDMA 3PUQA 2CCQA 2LE8A 2A2FX 4PJJA 2L9QA 3AB3B 4AQFC 4CI2B 4HN9A 4CXWA 2D2SA 2CE7A 4IIJE 4GYRA 2UXXB 3A7MA 2NW7A 4LF9T 4U31A 4C90A 3VU7H 2C0SA 4MALA 4PJMA 4WZXA 2CMRA 3PE0A 3AECA 1I6ZA 4B3MT 2IHR1 4A97A 4GIWA 2X9HA 3D0TA 3HKBE 5LB7B 4YTNA 2HN1A 5EK3A 5F5WA 3ZEFB 1SUMB 1J5ET 2IUBA 4DV2T 5LHIB 1XDPA 2XM1A 1G8XA 3AE8A 3FZHB 3KFWX 2KINB 3N2GE 4WYVA 5JRCB 3OVUA 4I4TE 3P4SA 1D0XA 2NP9A 2JJ9A 3B57A 3RIAA 4EEBA 1X79A 1Z0PA 3EI0A 1QLBA 4H63V 5KMGP 4V1Av 2BG9C 3P7IA 3Q9DA 4IE5A 2DNXA 4QH5A 5L3EB 3N9PA 5EK4A 1LVFA 3UUMA 4QHOA 4UVBB 1XWMA 4TNVA 4KP3C 3HR0A 4YJ3E 2X9WA 2W2UA 4EV6A 4LF7T 3K8PC 3AAIA 4U33A 4OYJA 5M4YA 2G0UA 2LSGA 1W9RA 4U7IA 3AVRA 2WDRA 5FY7A 4XBFB 3Q5WA 5JDQA 5BMVE 5J2TE 3FZFB 4IE6A 4F8HA 1Y64B 2YINA 1HS7A 4KUMB 4PJNA 3ANWB 3T1HT 3OYXA 1N34T 4KHPT 3KBTA 2E5VA 1MMNA 4CXXA 2WMOA 3JAEA 4O4JE 4TX5A 3GN5B 3ZMVB 2XAGB 4WBNE 5KXJA 4B3TT 5EK2A 4UELA 3CK6A 3U3IA 1YW0A 4ZI2C 3AAAB 5FXZA 5KX5E 5E0OA 3OJAA 3ZMTB 3KDSE 2JMKA 4O4HE 3ZJ1A 2CXDA 1SE7A 1VCTA 4UVCB 2NWBA 3CX7B 3EDVA 1UK5A 2QGSA 2EHOA 4QXBB 2YDRA 2XTLA 1ZV4X 5L3DB 3I9YA 3NRYA 3KVAA 1KNRA 1D0ZA 4IL9A 2CXLA 2V5CA 1YQ4A 4HFEA 3N5LA 4U2YA 2BVLA 5LJMA 3AE9A 2E9XC 4B3ST 4FJOA 4ISTA 5AQNB 4OX9T 4XZCA 5AFUL 3UUNA 3RGLA 3JADA 3HL6A 1ZEEA 3UFGA 5ABEA 1YD8G 3RRWA 2LRKA 2XM2A 1VOMA 1MNEA 3FZLB 5JR9C 1ZHCA 4JEUB 3P50A 4UEMA 2VKDA 5L3FB 2Q9QC 2X68A 4IL4A 3CMLA 2FBWA 4KMCA 2IDOB 1QSDA 3ZLIA 2A9UA 3AA6B 5AQQB 5AQKB 4LF5T 3N2KE 2HPJA 2BKNA 3QUJA 5CA1E 5LHGB 4YY3T 2ZM2A 4HKAA 4G63A 3N9MA 4UF0A 4P0AA 2LJLA 2GK9A 1UX5A 2W4XA 5FL1A 3O1JA 2IW5B 4HWCA 3EABA 2V1DB 2WU5A 4HFHA 5AQUB 4HGAA 4O8SA 4HWFA 3V5UA 2RA1A 1LKXA 1FJGT 2E5LT 4HFCA 3ZN0B 4YHHT 2UUBT 3AE1A 2UU9T 3C64A 2X66A 3FZMB 3ZMZB 4B6XA 2QYWA 5HEHA 2HHHT 2WMNA 1W0BA 3DP7A 3ZT6A 1MMAA 4DR4T 4H9OC 2FJDA 3ZC0A 3Q2MA 2DWKA 5FXWA 2I6HA 3MJXA 1IJ5A 4C91A 2J62A 4JI4T 2KWHA 5ABHA 1N32T 2XAHB 4WNKA 4DMVA 5CGMA 1OEDE 2K5BB 3CQCB 1J5WA 2XQ8A 4YLHA 5JRCA 2HH7A 2Y6XA 4OHFA 4TV8E 2BZBA 1BR1A 4BA9A 5ABFA 5LGTB 4AKGA 4KBMB 4JI0T 2VWAA 2L3LA 5LXTE 4H9RC 3TLTA 1HTJF 3AXJB 5C2TA 3RRCA 4YTPA 3CQGB 2CXFA 2VVSA 1WYBA 2ZM8A 2NW8A 2N1GA 3OBVE 3WAJA 3K3NA 5LG4A 1MIYA 2HN2A 4GOUA 4QX7B 2N2NA 5AQFB 3J7Yq 2CM0A 2DL1A 3AEFA 3QK6A 3RQUA 3Q5DA 2LRLA 2DHRA 4DV6T 1EZ3A 3AA1B 5LOVE 1WRDA 3ZPOA 2MTQA 1MMDA 1XDOA 3I0OA 3NVOA 1T8BA 1D0YA 2JQKA 4DV4T 3ZSSA 2EHOC 2V7LA 1H7CA 4KX6A 1NWMX 4O2AE 1KF6A 3RLFF 5LGUB 1SA0E 4DR3T 1LVKA 3FHNA 4BJNA 4ILCA 4OYKA 4L5GA 3PUAA 5FL0A 3ZN1B 2WU2A 5DQVA 5AQMB 4HWDA 3UQ7A 4JBWF 2BS4A 4H9SE 5JQGE 2E2AA 3MXZA 2D5UA 3GN5A 4TUYE 4O4IE 1E1HB 3FZKB 1KNZA 2C5KT 2NOXA 1WYCA 5EZYE 4MLKA 2BDEA 5JDNA 1KK7A 2W62A 2LKGA 3PV0F 3L3PA 5LNKA 5JDLA
chains in the Genus database with same CATH topology
3NRXA 3IBPA 3WI3A 3Q5WA 5JDQA 5BMVE 5J2TE 4ZHQE 2MYSA 4L0RA 2IC9A 2Y48B 2Y8DA 3AA7B 4ZOLE 2A3DA 1WLXA 3L09A 4IE6A 1Y64B 2YINA 3EDUA 2W61A 1HS7A 4DBQA 2QA7A 2LM9A 3V5SA 4JUYA 4KUMB 3O1IA 4PJNA 3ANWB 3FB2A 5ADXL 3HKCE 3OYXA 1HX8A 3Q5XA 2VKJA 1MIWA 2MOZA 3KBTA 2ACXA 1MMNA 2XQYA 2RP4A 5HXCA 3CKDA 2V26A 4CXXA 4EIWA 1LRZA 2WMOA 3F31A 1HFAA 3NBXX 1HG5A 5F3JA 2C5JA 5L3GB 4IDZA 2V7JA 4M1PA 4O4JE 3ZCJA 2X51A 4TX5A 4QX8B 3GN5B 3ZMVB 2EHOD 2CLYB 2XAGB 4WBNE 3U78A 4BAYB 3N9LA 2ODVA 4OK0A 4ERRA 3I1AA 2NTXA 3QC9A 5EK2A 1V9DA 4ZI3C 4UELA 4UV9B 4AKHA 2JQQA 2PG8A 3U3IA 3HKDE 1YW0A 4ZI2C 5FY0A 3AAAB 3R6NA 1IZNB 1BR4A 5FXZA 4HE8A 5FYMA 5KX5E 2V7MA 2DWGA 3A5XA 5E0OA 2X9XA 3OJAA 3FBLA 4TZ4C 5LHHB 5JH7E 3ZMTB 3KDSE 4F6RC 2JMKA 2E9XD 2W00A 4O4HE 3ZJ1A 4EYUA 5HYAA 2CXDA 3N2OA 4UVCB 4P09A 5FXXA 1VRBA 4DVDA 2NWBA 3UFEA 3CX7B 3EDVA 1IAPA 2XAQB 2QGSA 5LGNB 4QKNA 5F8PA 3JC6D 1YKEB 2EHOA 2PFVA 4QXBB 5JDFA 2IC6A 1O3XA 2D0TA 2LT3A 2XTLA 2YU2A 4PAGA 1ZV4X 5L3DB 3I9YA 3NRYA 3KVAA 1CUNA 3CX8B 3HI2A 5FXVA 4ZS2A 3ZYLA 4X1IE 4CQIA 1D0ZA 5CA0E 2PJQA 2Z6EA 4AKRB 3ANWA 4X1KE 5FY1A 3VHLA 4EZHA 2CXLA 5IHYA 4YHJA 2LOSA 3S4UA 5LP6E 1UCUA 3LJCA 4PFOA 4PFPA 3N5LA 3UUXB 2WAUA 1FMWA 2ZLYA 3RYCE 2BVLA 4CXWA 5LJMA 3KINB 2E9XC 4XAXB 2E9XA 3UT5E 3ZCIA 1NAFA 3LBXA 4QXCB 4CXYA 5J1GA 1OXZA 4FJOA 3J9X1 4ISTA 3AVSA 3VKGA 4AKLA 4XZCA 3IEEA 5AFUL 4UVAB 5FNVE 3UUNA 3HL6A 1IJ6A 4UIGA 5HXEA 3RYHE 1ZEEA 2UXNB 3T8OA 4FI5A 5HXRA 1YD8G 3RRWA 3OYZA 3ZC1A 4NUUA 3EVYA 1VOMA 1MNEA 4EAHA 2V7KA 5L2LA 3C51A 5JR9C 1ZHCA 2J1DG 4JEUB 3SOLA 1U5PA 1HG2A 3BQIA 4UEMA 3CX6B 2VKDA 3SWHA 5L3FB 4ILUA 4PNIA 2ZMAA 1FMVA 4I43B 3LG7A 5HWXA 2ES0A 2EHOB 3CPZA 4ZI3D 4J2CA 4AXPA 3UULA 2Q9QC 4XBFB 3MZKB 2LHRA 2X68A 4AKIA 4ZI2D 1ZKEA 4U74A 4CI3B 3C50A 3CMLA 3E0ZA 4MHCA 1MIVA 2L8KA 3BK9A 3ZYMA 4KMCA 4HFVA 4BJMA 5DABA 5LCYA 1QSDA 2A72A 4G2AA 3I9WA 3KV5A 1AJ3A 2XHEB 3ZJ2A 3ZLIA 5LYJE 3AA6B 5LA6E 1BR0A 3FBZA 2LSYA 3PDYA 2ODUA 5FMNA 2E9XB 3DTOA 3LBXB 3N2KE 2HPJA 3LFMA 1MMGA 3PU3A 4IGUA 3QUJA 3LK2B 5CA1E 3TKLB 5LHGB 5J2UE 2KNDA 1U4QA 2ZM2A 4HKAA 4TV9E 4EOZB 4ADZA 2H7VC 4G63A 3ZYKA 3N9MA 4O2BE 5TAOA 2DI4A 3C98B 4UF0A 1D1AA 3C4ZA 4IE4A 2YK0A 5L3BB 2K24A 2VASA 2NW9A 2E8IA 3O1HA 1MNDA 4NUVA 4X1YE 4JLEA 3N9NA 2M67A 3H37A 5JR9B 4ANJA 3N9QA 4CI1B 5FY7A 3W15B 4P0AA 3UTKA 2LJLA 2GK9A 5JVDE 4DO0A 4UV8B 1UX5A 3PURA 3O1JA 5LBQB 2IW5B 2LOPA 2V1DB 5KDMC 2LSIA 2NTYA 4QWNB 3VKHA 3HA4A 4HTEA 3PUSA 4HGAA 4O8SA 4ASKA 3H3AA 4U72A 1G73A 4H9QC 3BQLA 3V5UA 2RA1A 4IE7A 2HPLA 3P8CD 4I50E 3PU8A 3NZQA 3WAKA 4E7SA 4H9PC 5ETWA 3ZMUB 1LKXA 3E22E 4PK6A 3O4XE 2PBIA 3GA8A 3LK42 1OWAA 3KVBA 3ETUA 3ZN0B 3ZMSB 3CVRA 4O4LE 3ESLA 5GONE 4WW0A 2IAKA 2Q9QD 1SHZC 3C64A 3R84B 2X66A 4PK4A 3ZMZB 2YEVC 3MK7C 4B6XA 3I0QA 4IHJE 4UF0B 5JREA 2W63A 4YFSA 4PK5A 4I55E 2C5IT 3F2EA 3KV4A 4Z8XA 2WMNA 3DP7A 3MKDA 3NZPA 1MMAA 1YKHB 5LJNA 2VB6A 2X0LB 4H9OC 2JRKA 3ZC0A 2XUEA 4H9NC 3RYIE 3Q2MA 2DWKA 5FXWA 5JR9A 2SPCA 3IF8B 4EXTA 3MJXA 2CLYC 1IJ5A 2W0GA 4C91A 2D0UA 2CWOA 2K9AA 2LEHA 1QUUA 2KMFA 3F57A 3FXEB 3AA0B 2KWHA 3ETVA 4JEHB 4EZ4A 2Q9QA 2XAHB 3IHRA 2YU1A 2CEAA 5JDMA 1B7TA 4WNKA 3PUQA 4DMVA 4AQGA 3RPUA 3CWZB 2CCQA 3K3OA 2LE8A 2A2FX 2X9YA 5FP3A 3BQKA 4N78D 4P0BA 4PJJA 2K5BB 3RH3A 3CQCB 2L9QA 3AB3B 4YLHA 4AQFC 4CI2B 5JRCA 4HN9A 2D2SA 4X20E 2CE7A 2HH7A 2Y6XA 3E08A 4GYRA 4IIJE 2KWIB 2UXXB 5JDGA 4OHFA 5IYZE 3PTRB 5C8YE 4TV8E 2BZBA 1S94A 3M65A 1BR1A 4DMWA 4HEAA 2NW7A 4BA9A 2WM9A 2N9DA 4C90A 5LGTB 3VU7H 4DBRA 4AKGA 2C0SA 3C4WA 4H63H 4MALA 4KBMB 4ZS3A 2VWAA 4PJMA 2L3LA 5H6QB 2H3RA 5LXTE 4H9RC 2CMRA 1HTJF 3PE0A 2WSSV 2VKHA 3RRCA 3CQGB 2CXFA 3OKQA 3PUGA 4GIWA 1WYBA 2ZM8A 3B13A 2NW8A 4ISSA 2N1GA 2X9HA 3D0TA 3HKBE 4K0UA 1FIOA 3KV9A 1WR6A 3OBVE 3WAJA 1UX4A 3K3NA 5LG4A 1MIYA 5CB4E 2JMHA 2X67A 2K48A 3GWHA 4GOUA 4WBOA 3HKEE 4QX7B 5EK3A 2N2NA 3ZEFB 1US7B 2VL8A 4MBQA 4CZZB 3RC3A 4TN7B 3J7Yq 4EYYR 1FEWA 2CM0A 3GMIA 5LHIB 2Q9QB 3SRZA 3QK6A 1HCIA 1G8XA 2OA5A 3KFWX 5DQWA 5LBMA 2KINB 4QXHB 2DHRA 3CQXC 3N2GE 1D1BA 2CA5A 5JRCB 3EUHA 2LSJA 4GK5E 1EZ3A 3AA1B 5LOVE 1WRDA 2H7OA 2LSKA 3RC8A 2LHNA 4I4TE 1D0XA 2NP9A 2DLRA 2XAFB 2JJ9A 3B57A 3ZPOA 3LK3B 1T98A 2MTQA 4GYSA 1MMDA 2BVMA 2XAJB 3I0OA 4EB6E 1D0YA 2WBLA 2KLQA 3KBUA 2DCFA 4ZI7E 4YJ2E 1X79A 2EHOC 5H6RB 2WWUA 2V7IA 1Z0PA 1H7CA 2KT9A 2V7LA 4OFZA 4L9IA 4H63V 4DNDA 3KV6A 5KMGP 5L3CB 4V1Av 1NWMX 2XASB 3FXDB 3P7IA 4O2AE 3K3QC 3C4XA 3Q9DA 3ONXA 4IE5A 2DNXA 4A56A 5LGUB 1SA0E 5L3EB 2CWYA 5HXHA 5A1LA 3N9PA 5HWYA 1LVKA 3FHNA 4BJNA 4OYKA 2I59A 5EK4A 2MBGA 2JPFA 1LVFA 3AAEB 3PUAA 4L5GA 3RYFE 1S35A 3UUMA 1D1CA 3MACA 3ZN1B 5DQVA 4IE0A 4PW8A 4QHOA 4UVBB 4E7ZA 3O9XA 4H9SE 2VKOA 5JQGE 2B1EA 3MXZA 4KP3C 4PJLA 2KXPB 3HR0A 4YJ3E 2X9WA 2D5UA 5DJQC 3GN5A 4TUYE 2ZM0A 4O4IE 2P9BA 3N9OA 1E1HB 3MA9A 3K8PC 4MFRA 1KNZA 2C5KT 2VK9A 3AAIA 4OYJA 2NOXA 3JC6C 1WYCA 3RKOA 3DJBA 5EZYE 5M4YA 2G0UA 3SS1A 4MLKA 5HXSA 4GK0E 2LSGA 2BDEA 5JDNA 1KK7A 2W62A 2KZ7B 5HAXA 5JDHA 1HF8A 3AVRA 3RX6A 4AQFA 1BR2A 3L3PA 5LNKA 4AI6A 4UXNB 5JDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 B;  5JRE A;  3ZC0 A;  5JRC A;  5JR9 C;  3ZC1 A;  5JRC B;  5JR9 A; 
#chains in the Genus database with same CATH topology
 2MYS A;  4TNW A;  4ZOL E;  1IBL T;  1NEN A;  2W61 A;  4YXD A;  3FB2 A;  5ADX L;  4DV1 T;  3HKC E;  3Q5X A;  3QOF A;  2MOZ A;  2XQY A;  2RP4 A;  3CKD A;  2V26 A;  5IWA T;  3U78 A;  2ACZ A;  4BAY B;  3N9L A;  4OK0 A;  4ERR A;  3I1A A;  3QC9 A;  4U3C A;  1V9D A;  3UU5 A;  3HKD E;  2YOE A;  5FY0 A;  1IZN B;  2XQ9 A;  2X9X A;  2FUP A;  2XSB A;  1UUS A;  4F6R C;  2E9X D;  1VRB A;  3UFE A;  1XNR T;  2XAQ B;  5LGN B;  3JC6 D;  4Z90 A;  2M6I A;  1YKE B;  2PFV A;  5JDF A;  4ZEY A;  2LT3 A;  4PAG A;  4ZS2 A;  4X1I E;  4CQI A;  2PJQ A;  4JI1 T;  2Z6E A;  5FY1 A;  4ILA A;  3VHL A;  5IHY A;  2LM2 A;  2LOS A;  5LP6 E;  3LJC A;  5JTG A;  1FMW A;  2R6G F;  3VRB A;  1GQE A;  4XAX B;  3ZCI A;  3UT5 E;  2WWV A;  1OXZ A;  3UU3 A;  4AKL A;  3IEE A;  1Y01 A;  1IJ6 A;  4UIG A;  3PJA A;  3RYH E;  2JQ9 A;  3T8O A;  3SFE A;  3ZC1 A;  3EVY A;  2V7K A;  5L2L A;  3C51 A;  1HG2 A;  3RHW A;  3BQI A;  3ONJ A;  2XQ4 A;  2V5D A;  4QH1 A;  2YN6 A;  4ZI3 D;  4J2C A;  4AXP A;  2X0H A;  2XQ5 A;  2B76 A;  4CI3 B;  3E0Z A;  4EED A;  1MIV A;  2L8K A;  3ZYM A;  4BJM A;  3AEA A;  2IML A;  5DAB A;  3KV5 A;  4IDO A;  1AJ3 A;  3UU6 A;  3A8Y C;  2MPK A;  2ODU A;  5FMN A;  3K1S A;  2E9X B;  5HEU A;  3DTO A;  3LBX B;  3LFM A;  3NKZ A;  3PU3 A;  4AIU A;  1U4Q A;  3AE3 A;  3OTO T;  4TV9 E;  4EOZ B;  3G06 A;  2H7V C;  3ZYK A;  5TAO A;  2DI4 A;  3C98 B;  4UR9 A;  4JI2 T;  2WZH A;  2UXC T;  2YK0 A;  4DV5 T;  2E8I A;  4JLE A;  2JQH A;  3H37 A;  5JR9 B;  4CI1 B;  5L4E A;  2AE9 A;  2NR4 A;  4YSY A;  2V6Y B;  4QWN B;  4HTE A;  5AQT B;  4GKK T;  2WB5 A;  4H9Q C;  5HEG A;  4IE7 A;  2HPL A;  3P8C D;  3WAK A;  4H9P C;  2YDQ A;  3O4X E;  3ETU A;  1W09 A;  4JI5 T;  4ZZB A;  4LF6 T;  3ESL A;  1SHZ C;  2UUA T;  3R84 B;  3ABV A;  1IBM T;  2YEV C;  3AXJ A;  5JRE A;  2VQF T;  4I0U A;  3F2E A;  2AXD S;  5FVL A;  5IUX A;  4HWH A;  2XUE A;  4NXN T;  3RYI E;  3IF8 B;  4EXT A;  4JI6 T;  4DV7 T;  4KHZ F;  3FXE B;  5AQH B;  4EZ4 A;  1B7T A;  3ZKR A;  3CWZ B;  3QB5 K;  3K3O A;  2X9Y A;  3BQK A;  4N78 D;  4P0B A;  3AE2 A;  3PJA J;  3RH3 A;  3P4P A;  5JDG A;  3E08 A;  2KWI B;  3RIU A;  5IYZ E;  5C8Y E;  3M65 A;  1S94 A;  4DMW A;  2N9D A;  4DBR A;  4ZS3 A;  5AQP B;  3P4Q A;  2H3R A;  1OED A;  1XMQ T;  2WSS V;  2VL0 A;  2VKH A;  4HFI A;  3PUG A;  2LLY A;  3B13 A;  4ISS A;  4K0U A;  1FIO A;  1HR0 T;  1WR6 A;  1YXR A;  3GWH A;  4ZZC A;  1X9B A;  2I0M A;  2VL8 A;  3AE6 A;  3RC3 A;  3LDQ B;  1N33 T;  4TN7 B;  4DR5 T;  4EYY R;  1FEW A;  3SRZ A;  2OA5 A;  5FVK A;  5DQW A;  4QXH B;  1T7S A;  2LSJ A;  4JI7 T;  2H7O A;  2LSK A;  3TLS A;  2LHN A;  4CN6 A;  2DLR A;  2XAF B;  3EAM A;  3PUZ F;  2V6X A;  4EB6 E;  2XQA A;  3KBU A;  4ZI7 E;  2WWU A;  3L39 A;  4OFZ A;  4L9I A;  4DND A;  3KV6 A;  3C4X A;  1NEK A;  3JAF A;  4JYA T;  5HXH A;  5A1L A;  3VRA A;  4IDN A;  3ZST A;  2I59 A;  4Z91 A;  2JPF A;  2XQ3 A;  3RYF E;  1S35 A;  1D1C A;  3MAC A;  4E7Z A;  3O9X A;  2VKO A;  2B1E A;  4PJL A;  2KXP B;  4JI3 T;  3B5M A;  3CIR A;  3N9O A;  3MA9 A;  2KSR A;  4MFR A;  1DU2 A;  2VK9 A;  2F4V T;  3PUX F;  1JNZ A;  3SS1 A;  5AQI B;  5HXS A;  4GK0 E;  3UU4 A;  1BR2 A;  4AI6 A;  4UXN B;  3NRX A;  4ZHQ E;  1R8I A;  2Y8D A;  1WLX A;  3VR9 A;  4DV0 T;  5ABG A;  2LM9 A;  3O1I A;  3SFD A;  2VKJ A;  3PUW F;  1MIW A;  3VR8 A;  4EIW A;  1LRZ A;  3F31 A;  1HFA A;  1XZY A;  3NBX X;  2WY2 A;  2C5J A;  4IDZ A;  2V7J A;  2X51 A;  2J47 A;  4QX8 B;  2CLY B;  5L47 A;  5LMU T;  3AEB A;  4LFA T;  1HNW T;  2NTX A;  1HX1 B;  4TWD A;  2JQQ A;  3R6N A;  5HCM A;  1BR4 A;  5FYM A;  3UUB A;  5LHH B;  3FBL A;  2WQY A;  4TZ4 C;  2BKO A;  5JH7 E;  2BG9 E;  2BS2 A;  2W00 A;  4EYU A;  5HYA A;  3M3Z B;  4IRE A;  3P4R A;  4DVD A;  2CPT A;  1IAP A;  2WDV A;  5AQJ B;  2V8S V;  1O3X A;  2D0T A;  2YU2 A;  4YSX A;  3CX8 B;  3HI2 A;  5FXV A;  5AQS B;  3ZYL A;  4AIS A;  5CA0 E;  4AKR B;  3ANW A;  2WZI A;  2J4G A;  3QB5 A;  4PFO A;  2WAU A;  2CRB A;  2ZLY A;  1WCR A;  3KIN B;  4ILB A;  2E9X A;  1I94 T;  3LBX A;  4A98 A;  4QXC B;  4CXY A;  3J9X 1;  3VKG A;  5HXE A;  2UXN B;  2JIW A;  3Q5E A;  5HXR A;  2QVA A;  4EAH A;  3L8R A;  4GKJ T;  3SOL A;  2J1D G;  1U5P A;  4X65 T;  4X5T A;  2H88 A;  3SWH A;  4ILU A;  4PNI A;  2VVN A;  2ES0 A;  3CPZ A;  3UUL A;  3TLV A;  3ZT5 A;  3MZK B;  2LHR A;  1E7P A;  4ZI2 D;  2BG9 B;  1ZKE A;  3BK9 A;  4HFV A;  2FJA A;  3RIU C;  2A72 A;  3I9W A;  4HWI B;  3ZJ2 A;  1BR0 A;  3LSV A;  3FBZ A;  3PDY A;  3T1Y T;  1VCS A;  3PUY F;  5AQO B;  3TKL B;  3ZT7 A;  1OED C;  5J2U E;  2KND A;  2BS3 A;  5AQV B;  4O2B E;  4IE4 A;  5L3B B;  4HFB A;  2K24 A;  3O1H A;  1MND A;  4NUV A;  2CBJ A;  4ANJ A;  3W15 B;  3AEE A;  5JVD E;  4DO0 A;  5HEJ A;  3PUR A;  5LBQ B;  2LOP A;  5KDM C;  2NTY A;  3HA4 A;  1M7K A;  1CHU A;  4ASK A;  3H3A A;  3OPC A;  4AQY T;  3BQL A;  4A5X A;  4EGW A;  4I50 E;  3PU8 A;  4E7S A;  5ABF B;  3E22 E;  4P1N A;  3KVB A;  3PUV F;  3CVR A;  2CBI A;  4O4L E;  2PTF A;  4LFB T;  5HCJ A;  5GON E;  2IAK A;  5L4H A;  2Q9Q D;  1UGO A;  1Z8U A;  3I0Q A;  4IHJ E;  5CFB A;  4PK5 A;  4I55 E;  1KEY A;  4CN1 A;  3KV4 A;  1M62 A;  3NZP A;  3MKD A;  3UU8 A;  1KNP A;  4LFC T;  5LJN A;  2VB6 A;  2X0L B;  2XZE A;  4HFD A;  2SPC A;  2WCA A;  2W0G A;  4LF8 T;  2D0U A;  5HEO A;  2K9A A;  4NIQ A;  1QUU A;  2KMF A;  3F57 A;  3AA0 B;  3ETV A;  2XQ6 A;  2CEA A;  3TLU A;  4AQG A;  3RPU A;  2X0Y A;  5FP3 A;  4IDQ A;  2YKS A;  4X20 E;  2RPA A;  3RI5 A;  3PTR B;  4HEA A;  2WM9 A;  4TWF A;  3C4W A;  4H63 H;  2VQE T;  5H6Q B;  5CJ5 A;  3OKQ A;  4B3R T;  5AQR B;  3KV9 A;  1UX4 A;  4U2Z A;  4NPP A;  5CB4 E;  2JMH A;  2X67 A;  2K48 A;  4WBO A;  3HKE E;  2W66 A;  1US7 B;  4MBQ A;  4CZZ B;  1HNZ T;  3GMI A;  2Q9Q B;  1HCI A;  5LBM A;  1T72 A;  3CQX C;  1D1B A;  2FJE A;  2CA5 A;  3EUH A;  4GK5 E;  1W0A A;  3QNU A;  3RC8 A;  4COF A;  1ZOY A;  3LK3 B;  1T98 A;  4YT0 A;  4GYS A;  2BVM A;  2XAJ B;  3NWI A;  2WBL A;  2KLQ A;  3EHZ A;  2DCF A;  4YJ2 E;  5H6R B;  2V7I A;  4NXM T;  2KT9 A;  5L3C B;  2XAS B;  3FXD B;  3AE5 A;  3K3Q C;  3ONX A;  5FKY A;  4A56 A;  3IA3 A;  4U7Y A;  2CWY A;  5HWY A;  1WR0 A;  2WS3 A;  2MBG A;  3AAE B;  4IE0 A;  4PW8 A;  4KI0 F;  2D9D A;  4DV3 T;  1XNQ T;  5DJQ C;  2ZM0 A;  2P9B A;  2XQ7 A;  3JC6 C;  2OV9 A;  3RKO A;  3DJB A;  1YQ3 A;  3P4W A;  2UUC T;  5HAX A;  2KZ7 B;  5JDH A;  1HF8 A;  3RX6 A;  4AQF A;  3H3M A;  1N36 T;  3IBP A;  3WI3 A;  4L0R A;  2IC9 A;  1L0V A;  2Y48 B;  3AA7 B;  2A3D A;  3L09 A;  3EDU A;  4DBQ A;  2QA7 A;  4IT4 A;  3V5S A;  1KFY A;  4JUY A;  1HX8 A;  3RKG A;  4YSZ A;  2ACX A;  3AEG A;  5HXC A;  2LKH A;  3ONL C;  1HG5 A;  5F3J A;  5L3G B;  4M1P A;  3ZCJ A;  2EHO D;  2ODV A;  5AQG B;  4ZI3 C;  2WP9 A;  4UV9 B;  4AKH A;  2PG8 A;  4DR2 T;  1UUR A;  5LMN T;  4HE8 A;  2V7M A;  2DWG A;  2UXB T;  3A5X A;  3RQW A;  2XSA A;  3N2O A;  3X1D A;  4P09 A;  5FXX A;  4X64 T;  4QKN A;  5F8P A;  2IC6 A;  4DUY T;  1CUN A;  2WDQ A;  2BG9 A;  3RIF A;  4X1K E;  4EZH A;  4YHJ A;  4DUZ T;  3S4U A;  1UCU A;  4PFP A;  3UUX B;  3RF1 A;  2OLT A;  3RYC E;  3JCF A;  1NAF A;  2BBJ A;  5J1G A;  3AVS A;  4UVA B;  5FNV E;  1XMO T;  3AE7 A;  4LMK A;  4FI5 A;  3OYZ A;  4NUU A;  3AED A;  4Q25 A;  3CX6 B;  4ZXL A;  2ZMA A;  1FMV A;  1J1J A;  4I43 B;  3LG7 A;  5HWX A;  2EHO B;  2XPK A;  1JNR A;  4LML A;  4AKI A;  2MAW A;  4U74 A;  2K3W A;  3C50 A;  4MHC A;  1WFD A;  2YDS A;  5LCY A;  2VUR A;  4G2A A;  2QRX A;  2XHE B;  5LYJ E;  5LA6 E;  2LSY A;  4DID B;  4YTM A;  1HNX T;  2CHO A;  4TWH A;  1MMG A;  4IGU A;  3LK2 B;  2CHN A;  4ADZ A;  1D1A A;  3C4Z A;  4K0K T;  5LG3 A;  2VAS A;  2NW9 A;  4X1Y E;  2XY8 B;  4QH4 A;  5C3J A;  3TLW A;  3N9N A;  2M67 A;  4X62 T;  3N9Q A;  4IDP A;  4JV5 T;  3UTK A;  1E2A A;  4UV8 B;  4CN4 A;  5AQL B;  2LSI A;  3VKH A;  4LF4 T;  3PUS A;  4X66 T;  3AE4 A;  2W67 A;  1ZP0 A;  4U72 A;  1G73 A;  2BKP A;  5J0Z A;  3NZQ A;  2FJB A;  5ETW A;  3ZMU B;  2UXD T;  4PK6 A;  2PBI A;  3GA8 A;  3LK4 2;  4DR7 T;  1OWA A;  3ZMS B;  2H89 A;  4LMJ A;  1OED B;  2BBH A;  4WW0 A;  4DR1 T;  2IIU A;  4DR6 T;  4PK4 A;  3MK7 C;  4UF0 B;  4JI8 T;  2W63 A;  4YFS A;  2C5I T;  1IBK T;  4Z8X A;  5BR8 T;  2ZM6 T;  2XJ7 A;  1YKH B;  2JRK A;  4H9N C;  2M6B A;  5JR9 A;  2CLY C;  3UQ4 A;  2CWO A;  2LEH A;  4JEH B;  2Q9Q A;  2V6Y A;  3IHR A;  2YU1 A;  5JDM A;  3PUQ A;  2CCQ A;  2LE8 A;  2A2F X;  4PJJ A;  2L9Q A;  3AB3 B;  4AQF C;  4CI2 B;  4HN9 A;  4CXW A;  2D2S A;  2CE7 A;  4IIJ E;  4GYR A;  2UXX B;  3A7M A;  2NW7 A;  4LF9 T;  4U31 A;  4C90 A;  3VU7 H;  2C0S A;  4MAL A;  4PJM A;  4WZX A;  2CMR A;  3PE0 A;  3AEC A;  1I6Z A;  4B3M T;  2IHR 1;  4A97 A;  4GIW A;  2X9H A;  3D0T A;  3HKB E;  5LB7 B;  4YTN A;  2HN1 A;  5EK3 A;  5F5W A;  3ZEF B;  1SUM B;  1J5E T;  2IUB A;  4DV2 T;  5LHI B;  1XDP A;  2XM1 A;  1G8X A;  3AE8 A;  3FZH B;  3KFW X;  2KIN B;  3N2G E;  4WYV A;  5JRC B;  3OVU A;  4I4T E;  3P4S A;  1D0X A;  2NP9 A;  2JJ9 A;  3B57 A;  3RIA A;  4EEB A;  1X79 A;  1Z0P A;  3EI0 A;  1QLB A;  4H63 V;  5KMG P;  4V1A v;  2BG9 C;  3P7I A;  3Q9D A;  4IE5 A;  2DNX A;  4QH5 A;  5L3E B;  3N9P A;  5EK4 A;  1LVF A;  3UUM A;  4QHO A;  4UVB B;  1XWM A;  4TNV A;  4KP3 C;  3HR0 A;  4YJ3 E;  2X9W A;  2W2U A;  4EV6 A;  4LF7 T;  3K8P C;  3AAI A;  4U33 A;  4OYJ A;  5M4Y A;  2G0U A;  2LSG A;  1W9R A;  4U7I A;  3AVR A;  2WDR A;  5FY7 A;  4XBF B;  3Q5W A;  5JDQ A;  5BMV E;  5J2T E;  3FZF B;  4IE6 A;  4F8H A;  1Y64 B;  2YIN A;  1HS7 A;  4KUM B;  4PJN A;  3ANW B;  3T1H T;  3OYX A;  1N34 T;  4KHP T;  3KBT A;  2E5V A;  1MMN A;  4CXX A;  2WMO A;  3JAE A;  4O4J E;  4TX5 A;  3GN5 B;  3ZMV B;  2XAG B;  4WBN E;  5KXJ A;  4B3T T;  5EK2 A;  4UEL A;  3CK6 A;  3U3I A;  1YW0 A;  4ZI2 C;  3AAA B;  5FXZ A;  5KX5 E;  5E0O A;  3OJA A;  3ZMT B;  3KDS E;  2JMK A;  4O4H E;  3ZJ1 A;  2CXD A;  1SE7 A;  1VCT A;  4UVC B;  2NWB A;  3CX7 B;  3EDV A;  1UK5 A;  2QGS A;  2EHO A;  4QXB B;  2YDR A;  2XTL A;  1ZV4 X;  5L3D B;  3I9Y A;  3NRY A;  3KVA A;  1KNR A;  1D0Z A;  4IL9 A;  2CXL A;  2V5C A;  1YQ4 A;  4HFE A;  3N5L A;  4U2Y A;  2BVL A;  5LJM A;  3AE9 A;  2E9X C;  4B3S T;  4FJO A;  4IST A;  5AQN B;  4OX9 T;  4XZC A;  5AFU L;  3UUN A;  3RGL A;  3JAD A;  3HL6 A;  1ZEE A;  3UFG A;  5ABE A;  1YD8 G;  3RRW A;  2LRK A;  2XM2 A;  1VOM A;  1MNE A;  3FZL B;  5JR9 C;  1ZHC A;  4JEU B;  3P50 A;  4UEM A;  2VKD A;  5L3F B;  2Q9Q C;  2X68 A;  4IL4 A;  3CML A;  2FBW A;  4KMC A;  2IDO B;  1QSD A;  3ZLI A;  2A9U A;  3AA6 B;  5AQQ B;  5AQK B;  4LF5 T;  3N2K E;  2HPJ A;  2BKN A;  3QUJ A;  5CA1 E;  5LHG B;  4YY3 T;  2ZM2 A;  4HKA A;  4G63 A;  3N9M A;  4UF0 A;  4P0A A;  2LJL A;  2GK9 A;  1UX5 A;  2W4X A;  5FL1 A;  3O1J A;  2IW5 B;  4HWC A;  3EAB A;  2V1D B;  2WU5 A;  4HFH A;  5AQU B;  4HGA A;  4O8S A;  4HWF A;  3V5U A;  2RA1 A;  1LKX A;  1FJG T;  2E5L T;  4HFC A;  3ZN0 B;  4YHH T;  2UUB T;  3AE1 A;  2UU9 T;  3C64 A;  2X66 A;  3FZM B;  3ZMZ B;  4B6X A;  2QYW A;  5HEH A;  2HHH T;  2WMN A;  1W0B A;  3DP7 A;  3ZT6 A;  1MMA A;  4DR4 T;  4H9O C;  2FJD A;  3ZC0 A;  3Q2M A;  2DWK A;  5FXW A;  2I6H A;  3MJX A;  1IJ5 A;  4C91 A;  2J62 A;  4JI4 T;  2KWH A;  5ABH A;  1N32 T;  2XAH B;  4WNK A;  4DMV A;  5CGM A;  1OED E;  2K5B B;  3CQC B;  1J5W A;  2XQ8 A;  4YLH A;  5JRC A;  2HH7 A;  2Y6X A;  4OHF A;  4TV8 E;  2BZB A;  1BR1 A;  4BA9 A;  5ABF A;  5LGT B;  4AKG A;  4KBM B;  4JI0 T;  2VWA A;  2L3L A;  5LXT E;  4H9R C;  3TLT A;  1HTJ F;  3AXJ B;  5C2T A;  3RRC A;  4YTP A;  3CQG B;  2CXF A;  2VVS A;  1WYB A;  2ZM8 A;  2NW8 A;  2N1G A;  3OBV E;  3WAJ A;  3K3N A;  5LG4 A;  1MIY A;  2HN2 A;  4GOU A;  4QX7 B;  2N2N A;  5AQF B;  3J7Y q;  2CM0 A;  2DL1 A;  3AEF A;  3QK6 A;  3RQU A;  3Q5D A;  2LRL A;  2DHR A;  4DV6 T;  1EZ3 A;  3AA1 B;  5LOV E;  1WRD A;  3ZPO A;  2MTQ A;  1MMD A;  1XDO A;  3I0O A;  3NVO A;  1T8B A;  1D0Y A;  2JQK A;  4DV4 T;  3ZSS A;  2EHO C;  2V7L A;  1H7C A;  4KX6 A;  1NWM X;  4O2A E;  1KF6 A;  3RLF F;  5LGU B;  1SA0 E;  4DR3 T;  1LVK A;  3FHN A;  4BJN A;  4ILC A;  4OYK A;  4L5G A;  3PUA A;  5FL0 A;  3ZN1 B;  2WU2 A;  5DQV A;  5AQM B;  4HWD A;  3UQ7 A;  4JBW F;  2BS4 A;  4H9S E;  5JQG E;  2E2A A;  3MXZ A;  2D5U A;  3GN5 A;  4TUY E;  4O4I E;  1E1H B;  3FZK B;  1KNZ A;  2C5K T;  2NOX A;  1WYC A;  5EZY E;  4MLK A;  2BDE A;  5JDN A;  1KK7 A;  2W62 A;  2LKG A;  3PV0 F;  3L3P A;  5LNK A;  5JDL A; 
#chains in the Genus database with same CATH homology
 3NRX A;  3IBP A;  3WI3 A;  3Q5W A;  5JDQ A;  5BMV E;  5J2T E;  4ZHQ E;  2MYS A;  4L0R A;  2IC9 A;  2Y48 B;  2Y8D A;  3AA7 B;  4ZOL E;  2A3D A;  1WLX A;  3L09 A;  4IE6 A;  1Y64 B;  2YIN A;  3EDU A;  2W61 A;  1HS7 A;  4DBQ A;  2QA7 A;  2LM9 A;  3V5S A;  4JUY A;  4KUM B;  3O1I A;  4PJN A;  3ANW B;  3FB2 A;  5ADX L;  3HKC E;  3OYX A;  1HX8 A;  3Q5X A;  2VKJ A;  1MIW A;  2MOZ A;  3KBT A;  2ACX A;  1MMN A;  2XQY A;  2RP4 A;  5HXC A;  3CKD A;  2V26 A;  4CXX A;  4EIW A;  1LRZ A;  2WMO A;  3F31 A;  1HFA A;  3NBX X;  1HG5 A;  5F3J A;  2C5J A;  5L3G B;  4IDZ A;  2V7J A;  4M1P A;  4O4J E;  3ZCJ A;  2X51 A;  4TX5 A;  4QX8 B;  3GN5 B;  3ZMV B;  2EHO D;  2CLY B;  2XAG B;  4WBN E;  3U78 A;  4BAY B;  3N9L A;  2ODV A;  4OK0 A;  4ERR A;  3I1A A;  2NTX A;  3QC9 A;  5EK2 A;  1V9D A;  4ZI3 C;  4UEL A;  4UV9 B;  4AKH A;  2JQQ A;  2PG8 A;  3U3I A;  3HKD E;  1YW0 A;  4ZI2 C;  5FY0 A;  3AAA B;  3R6N A;  1IZN B;  1BR4 A;  5FXZ A;  4HE8 A;  5FYM A;  5KX5 E;  2V7M A;  2DWG A;  3A5X A;  5E0O A;  2X9X A;  3OJA A;  3FBL A;  4TZ4 C;  5LHH B;  5JH7 E;  3ZMT B;  3KDS E;  4F6R C;  2JMK A;  2E9X D;  2W00 A;  4O4H E;  3ZJ1 A;  4EYU A;  5HYA A;  2CXD A;  3N2O A;  4UVC B;  4P09 A;  5FXX A;  1VRB A;  4DVD A;  2NWB A;  3UFE A;  3CX7 B;  3EDV A;  1IAP A;  2XAQ B;  2QGS A;  5LGN B;  4QKN A;  5F8P A;  3JC6 D;  1YKE B;  2EHO A;  2PFV A;  4QXB B;  5JDF A;  2IC6 A;  1O3X A;  2D0T A;  2LT3 A;  2XTL A;  2YU2 A;  4PAG A;  1ZV4 X;  5L3D B;  3I9Y A;  3NRY A;  3KVA A;  1CUN A;  3CX8 B;  3HI2 A;  5FXV A;  4ZS2 A;  3ZYL A;  4X1I E;  4CQI A;  1D0Z A;  5CA0 E;  2PJQ A;  2Z6E A;  4AKR B;  3ANW A;  4X1K E;  5FY1 A;  3VHL A;  4EZH A;  2CXL A;  5IHY A;  4YHJ A;  2LOS A;  3S4U A;  5LP6 E;  1UCU A;  3LJC A;  4PFO A;  4PFP A;  3N5L A;  3UUX B;  2WAU A;  1FMW A;  2ZLY A;  3RYC E;  2BVL A;  4CXW A;  5LJM A;  3KIN B;  2E9X C;  4XAX B;  2E9X A;  3UT5 E;  3ZCI A;  1NAF A;  3LBX A;  4QXC B;  4CXY A;  5J1G A;  1OXZ A;  4FJO A;  3J9X 1;  4IST A;  3AVS A;  3VKG A;  4AKL A;  4XZC A;  3IEE A;  5AFU L;  4UVA B;  5FNV E;  3UUN A;  3HL6 A;  1IJ6 A;  4UIG A;  5HXE A;  3RYH E;  1ZEE A;  2UXN B;  3T8O A;  4FI5 A;  5HXR A;  1YD8 G;  3RRW A;  3OYZ A;  3ZC1 A;  4NUU A;  3EVY A;  1VOM A;  1MNE A;  4EAH A;  2V7K A;  5L2L A;  3C51 A;  5JR9 C;  1ZHC A;  2J1D G;  4JEU B;  3SOL A;  1U5P A;  1HG2 A;  3BQI A;  4UEM A;  3CX6 B;  2VKD A;  3SWH A;  5L3F B;  4ILU A;  4PNI A;  2ZMA A;  1FMV A;  4I43 B;  3LG7 A;  5HWX A;  2ES0 A;  2EHO B;  3CPZ A;  4ZI3 D;  4J2C A;  4AXP A;  3UUL A;  2Q9Q C;  4XBF B;  3MZK B;  2LHR A;  2X68 A;  4AKI A;  4ZI2 D;  1ZKE A;  4U74 A;  4CI3 B;  3C50 A;  3CML A;  3E0Z A;  4MHC A;  1MIV A;  2L8K A;  3BK9 A;  3ZYM A;  4KMC A;  4HFV A;  4BJM A;  5DAB A;  5LCY A;  1QSD A;  2A72 A;  4G2A A;  3I9W A;  3KV5 A;  1AJ3 A;  2XHE B;  3ZJ2 A;  3ZLI A;  5LYJ E;  3AA6 B;  5LA6 E;  1BR0 A;  3FBZ A;  2LSY A;  3PDY A;  2ODU A;  5FMN A;  2E9X B;  3DTO A;  3LBX B;  3N2K E;  2HPJ A;  3LFM A;  1MMG A;  3PU3 A;  4IGU A;  3QUJ A;  3LK2 B;  5CA1 E;  3TKL B;  5LHG B;  5J2U E;  2KND A;  1U4Q A;  2ZM2 A;  4HKA A;  4TV9 E;  4EOZ B;  4ADZ A;  2H7V C;  4G63 A;  3ZYK A;  3N9M A;  4O2B E;  5TAO A;  2DI4 A;  3C98 B;  4UF0 A;  1D1A A;  3C4Z A;  4IE4 A;  2YK0 A;  5L3B B;  2K24 A;  2VAS A;  2NW9 A;  2E8I A;  3O1H A;  1MND A;  4NUV A;  4X1Y E;  4JLE A;  3N9N A;  2M67 A;  3H37 A;  5JR9 B;  4ANJ A;  3N9Q A;  4CI1 B;  5FY7 A;  3W15 B;  4P0A A;  3UTK A;  2LJL A;  2GK9 A;  5JVD E;  4DO0 A;  4UV8 B;  1UX5 A;  3PUR A;  3O1J A;  5LBQ B;  2IW5 B;  2LOP A;  2V1D B;  5KDM C;  2LSI A;  2NTY A;  4QWN B;  3VKH A;  3HA4 A;  4HTE A;  3PUS A;  4HGA A;  4O8S A;  4ASK A;  3H3A A;  4U72 A;  1G73 A;  4H9Q C;  3BQL A;  3V5U A;  2RA1 A;  4IE7 A;  2HPL A;  3P8C D;  4I50 E;  3PU8 A;  3NZQ A;  3WAK A;  4E7S A;  4H9P C;  5ETW A;  3ZMU B;  1LKX A;  3E22 E;  4PK6 A;  3O4X E;  2PBI A;  3GA8 A;  3LK4 2;  1OWA A;  3KVB A;  3ETU A;  3ZN0 B;  3ZMS B;  3CVR A;  4O4L E;  3ESL A;  5GON E;  4WW0 A;  2IAK A;  2Q9Q D;  1SHZ C;  3C64 A;  3R84 B;  2X66 A;  4PK4 A;  3ZMZ B;  2YEV C;  3MK7 C;  4B6X A;  3I0Q A;  4IHJ E;  4UF0 B;  5JRE A;  2W63 A;  4YFS A;  4PK5 A;  4I55 E;  2C5I T;  3F2E A;  3KV4 A;  4Z8X A;  2WMN A;  3DP7 A;  3MKD A;  3NZP A;  1MMA A;  1YKH B;  5LJN A;  2VB6 A;  2X0L B;  4H9O C;  2JRK A;  3ZC0 A;  2XUE A;  4H9N C;  3RYI E;  3Q2M A;  2DWK A;  5FXW A;  5JR9 A;  2SPC A;  3IF8 B;  4EXT A;  3MJX A;  2CLY C;  1IJ5 A;  2W0G A;  4C91 A;  2D0U A;  2CWO A;  2K9A A;  2LEH A;  1QUU A;  2KMF A;  3F57 A;  3FXE B;  3AA0 B;  2KWH A;  3ETV A;  4JEH B;  4EZ4 A;  2Q9Q A;  2XAH B;  3IHR A;  2YU1 A;  2CEA A;  5JDM A;  1B7T A;  4WNK A;  3PUQ A;  4DMV A;  4AQG A;  3RPU A;  3CWZ B;  2CCQ A;  3K3O A;  2LE8 A;  2A2F X;  2X9Y A;  5FP3 A;  3BQK A;  4N78 D;  4P0B A;  4PJJ A;  2K5B B;  3RH3 A;  3CQC B;  2L9Q A;  3AB3 B;  4YLH A;  4AQF C;  4CI2 B;  5JRC A;  4HN9 A;  2D2S A;  4X20 E;  2CE7 A;  2HH7 A;  2Y6X A;  3E08 A;  4GYR A;  4IIJ E;  2KWI B;  2UXX B;  5JDG A;  4OHF A;  5IYZ E;  3PTR B;  5C8Y E;  4TV8 E;  2BZB A;  1S94 A;  3M65 A;  1BR1 A;  4DMW A;  4HEA A;  2NW7 A;  4BA9 A;  2WM9 A;  2N9D A;  4C90 A;  5LGT B;  3VU7 H;  4DBR A;  4AKG A;  2C0S A;  3C4W A;  4H63 H;  4MAL A;  4KBM B;  4ZS3 A;  2VWA A;  4PJM A;  2L3L A;  5H6Q B;  2H3R A;  5LXT E;  4H9R C;  2CMR A;  1HTJ F;  3PE0 A;  2WSS V;  2VKH A;  3RRC A;  3CQG B;  2CXF A;  3OKQ A;  3PUG A;  4GIW A;  1WYB A;  2ZM8 A;  3B13 A;  2NW8 A;  4ISS A;  2N1G A;  2X9H A;  3D0T A;  3HKB E;  4K0U A;  1FIO A;  3KV9 A;  1WR6 A;  3OBV E;  3WAJ A;  1UX4 A;  3K3N A;  5LG4 A;  1MIY A;  5CB4 E;  2JMH A;  2X67 A;  2K48 A;  3GWH A;  4GOU A;  4WBO A;  3HKE E;  4QX7 B;  5EK3 A;  2N2N A;  3ZEF B;  1US7 B;  2VL8 A;  4MBQ A;  4CZZ B;  3RC3 A;  4TN7 B;  3J7Y q;  4EYY R;  1FEW A;  2CM0 A;  3GMI A;  5LHI B;  2Q9Q B;  3SRZ A;  3QK6 A;  1HCI A;  1G8X A;  2OA5 A;  3KFW X;  5DQW A;  5LBM A;  2KIN B;  4QXH B;  2DHR A;  3CQX C;  3N2G E;  1D1B A;  2CA5 A;  5JRC B;  3EUH A;  2LSJ A;  4GK5 E;  1EZ3 A;  3AA1 B;  5LOV E;  1WRD A;  2H7O A;  2LSK A;  3RC8 A;  2LHN A;  4I4T E;  1D0X A;  2NP9 A;  2DLR A;  2XAF B;  2JJ9 A;  3B57 A;  3ZPO A;  3LK3 B;  1T98 A;  2MTQ A;  4GYS A;  1MMD A;  2BVM A;  2XAJ B;  3I0O A;  4EB6 E;  1D0Y A;  2WBL A;  2KLQ A;  3KBU A;  2DCF A;  4ZI7 E;  4YJ2 E;  1X79 A;  2EHO C;  5H6R B;  2WWU A;  2V7I A;  1Z0P A;  1H7C A;  2KT9 A;  2V7L A;  4OFZ A;  4L9I A;  4H63 V;  4DND A;  3KV6 A;  5KMG P;  5L3C B;  4V1A v;  1NWM X;  2XAS B;  3FXD B;  3P7I A;  4O2A E;  3K3Q C;  3C4X A;  3Q9D A;  3ONX A;  4IE5 A;  2DNX A;  4A56 A;  5LGU B;  1SA0 E;  5L3E B;  2CWY A;  5HXH A;  5A1L A;  3N9P A;  5HWY A;  1LVK A;  3FHN A;  4BJN A;  4OYK A;  2I59 A;  5EK4 A;  2MBG A;  2JPF A;  1LVF A;  3AAE B;  3PUA A;  4L5G A;  3RYF E;  1S35 A;  3UUM A;  1D1C A;  3MAC A;  3ZN1 B;  5DQV A;  4IE0 A;  4PW8 A;  4QHO A;  4UVB B;  4E7Z A;  3O9X A;  4H9S E;  2VKO A;  5JQG E;  2B1E A;  3MXZ A;  4KP3 C;  4PJL A;  2KXP B;  3HR0 A;  4YJ3 E;  2X9W A;  2D5U A;  5DJQ C;  3GN5 A;  4TUY E;  2ZM0 A;  4O4I E;  2P9B A;  3N9O A;  1E1H B;  3MA9 A;  3K8P C;  4MFR A;  1KNZ A;  2C5K T;  2VK9 A;  3AAI A;  4OYJ A;  2NOX A;  3JC6 C;  1WYC A;  3RKO A;  3DJB A;  5EZY E;  5M4Y A;  2G0U A;  3SS1 A;  4MLK A;  5HXS A;  4GK0 E;  2LSG A;  2BDE A;  5JDN A;  1KK7 A;  2W62 A;  2KZ7 B;  5HAX A;  5JDH A;  1HF8 A;  3AVR A;  3RX6 A;  4AQF A;  1BR2 A;  3L3P A;  5LNK A;  4AI6 A;  4UXN B;  5JDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...