5JR9C

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
185
structure length
185
Chain Sequence
MLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
molecule keywords NEQ131
total genus 82
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9C00
5JR9B 5JRCA 5JR9A 3ZC1A 3ZC0A 5JRCB 5JREA 5JR9C
chains in the Genus database with same CATH superfamily
3B13A 4DV5T 2UXNB 4QH5A 1US7B 4HWIB 3ETUA 4IL9A 2OLTA 4UIGA 4A56A 3CQXC 4COFA 3CPZA 3N9QA 3EABA 3MKDA 1YXRA 4K0KT 4IDNA 3ZT6A 4DMWA 5FMNA 2L9QA 2ACZA 3ZYMA 5JVDE 2XASB 3AXJB 4JI1T 1KF6A 4QH4A 4CXXA 2MTQA 2F4VT 4DR6T 5FXWA 4HFVA 2ZMAA 3RHWA 4EOZB 2WWUA 1ZV4X 2LM2A 2MAWA 3B5MA 2X9WA 2IAKA 4JEUB 3OJAA 5FP3A 4F8HA 1WR6A 4KX6A 1QSDA 2ODUA 4MBQA 4DBRA 3ZN0B 4UVCB 4AQGA 5LMNT 2BBJA 2A2FX 1ZEEA 4FJOA 1EZ3A 2DNXA 3AA7B 3D0TA 4ILCA 3UQ4A 4EYYR 3ZN1B 5JDGA 4A97A 1QLBA 2B76A 4YSZA 3N9PA 2D5UA 4DR7T 1FIOA 5FYMA 4CN6A 4B3ST 5BMVE 2J4GA 3PUGA 5JR9A 2PJQA 4AKLA 2I0MA 3AE8A 3P4WA 3J9X1 4DO0A 2VL8A 4PJNA 4ZZBA 4GKKT 1MMNA 3QB5A 4U7IA 5M4YA 3F31A 4IE6A 3SOLA 4OYKA 2ACXA 3PURA 4ZI2D 2JQHA 2QVAA 1MNDA 2WDVA 2XM2A 4MLKA 5HXRA 3FBLA 4IL4A 2BZBA 3C4XA 3GA8A 2UXBT 4AKIA 4YY3T 3DP7A 3N9MA 4IE4A 2XM1A 4ILBA 4L5GA 4PAGA 5C8YE 4CI1B 5J0ZA 4AI6A 3ZYKA 3FZKB 4OYJA 2FJBA 3WAKA 3TLWA 4UVBB 3RIUC 3V5UA 4AQFA 3ZLIA 4Z90A 5HEGA 2LSKA 2XPKA 1HFAA 3O4XE 2IDOB 2LJLA 3P4PA 3FZFB 5LHHB 5LYJE 2JRKA 5LNKA 4L9IA 3F57A 2VKOA 3OKQA 5LXTE 2E8IA 3NVOA 4TX5A 2LHNA 4AIUA 5F8PA 3QNUA 2YDSA 2BS3A 2N2NA 1KEYA 4ILAA 5ABEA 5AQMB 2Y8DA 2JIWA 4DV6T 3Q5XA 2DWGA 5HWXA 2W61A 2BG9A 4U7YA 2LSYA 2RPAA 2V6YB 5FKYA 3RC8A 1D1BA 1D0YA 2LOSA 3KV4A 3UT5E 3WI3A 4AQYT 1DU2A 3MJXA 3C51A 2A72A 3FBZA 3X1DA 2DL1A 3BQLA 3NRXA 4QHOA 2ZM0A 4GK0E 5LHIB 3P8CD 3IHRA 4B3TT 5AQIB 2QYWA 2V26A 4NIQA 3RRCA 1UX4A 2BG9B 2QGSA 3IBPA 3L39A 4QXBB 5HCJA 1VOMA 5LG4A 1KNPA 3GWHA 5LOVE 4KBMB 1IBMT 5FXXA 3LSVA 2CXDA 2YKSA 1GQEA 1ZP0A 1M7KA 2K5BB 3N2OA 1NENA 3BQKA 3CX7B 4WBNE 2WMOA 3CQCB 3RYCE 1U4QA 4EEDA 2X9XA 1UX5A 1FMWA 2XQ6A 3AVRA 3AE5A 1JNRA 1HX1B 4ZI7E 3AAIA 4HFBA 4X1YE 4C91A 2CBJA 2IC9A 2DWKA 1D1CA 3CK6A 5JTGA 1XMQT 2ZM2A 5LB7B 2XQ8A 4EYUA 2BKPA 1HF8A 5ADXL 4ASKA 2XQAA 4MHCA 3P7IA 3A7MA 3AE7A 5AQVB 2JJ9A 3P4RA 3RLFF 3DJBA 4HKAA 4YSXA 3AE6A 3M65A 1T7SA 3N2KE 1E2AA 4KMCA 5HXSA 4I55E 2HN2A 2GK9A 4CQIA 2ZM8A 4YT0A 4X64T 4X66T 4HGAA 3AEEA 4DBQA 3CMLA 4HN9A 4H9SE 3NZQA 4ISTA 4GOUA 2BG9C 2IMLA 4OFZA 1UGOA 4A5XA 4CN4A 5LMUT 1SUMB 4O4JE 1W9RA 3EDUA 3TLTA 2D0TA 4QXCB 1MIWA 1JNZA 3M3ZB 4DV4T 1E1HB 1X79A 4HFIA 3VR8A 5A1LA 5FL1A 5HXEA 4O4HE 2WZHA 3Q5DA 3VR9A 5F3JA 1YD8G 4I43B 5CGMA 5KX5E 4X65T 5H6QB 3RIFA 2HPLA 5HXCA 5LP6E 5J2TE 5AQUB 3AE3A 5L4HA 3NRYA 1H7CA 3RGLA 2DLRA 2LRKA 2LE8A 4J2CA 3BQIA 4TN7B 4DIDB 4ZEYA 2I59A 2IIUA 2K24A 2FUPA 1U5PA 4P0BA 3RH3A 4JLEA 4DR5T 4GYSA 1M62A 3LK3B 4HFDA 2NR4A 4HWDA 2IW5B 2DCFA 4B3RT 4DNDA 3AAEB 2M6BA 3KV6A 4PK4A 4DR4T 5AQHB 1FEWA 1OXZA 5HEUA 2LSGA 3CX8B 3Q2MA 2ZM6T 3LK42 3UU3A 2LHRA 5FNVE 1G8XA 2C0SA 4OHFA 3L8RA 2VK9A 5KXJA 2VURA 3U78A 5HWYA 3KDSE 2MYSA 3H37A 4LMJA 4JI2T 1VCSA 2WDQA 1HNWT 2W00A 2X0LB 5TAOA 4YHHT 1Z0PA 3DTOA 2XAGB 2N9DA 2CWOA 3KBUA 3ONJA 1CHUA 3VRBA 4OX9T 2XQ9A 5L3FB 4DUZT 2CLYC 2ES0A 2QRXA 4GYRA 4O2BE 4U2ZA 1HR0T 4EIWA 1LRZA 3VRAA 4E7SA 4WBOA 5EK2A 1ZKEA 3HL6A 4O4LE 3W15B 1N32T 3C4WA 3ZC1A 4YFSA 4B6XA 4CN1A 4JYAT 4LF7T 3I0QA 2LKGA 1B7TA 3FXEB 2CM0A 4NUVA 4H9PC 3ZMTB 2H7OA 3HKEE 2XUEA 3KV9A 4KHPT 5CA0E 2V5CA 2JQKA 2XSBA 5IHYA 2FJDA 3UUMA 3ZC0A 1J5WA 3ZPOA 2WU2A 4K0UA 1IJ5A 5HEOA 3N9NA 1XDOA 3RYIE 4DVDA 3TLUA 1N33T 4I50E 5JDQA 4H9RC 2V6YA 3O9XA 2D0UA 3T1YT 2X68A 2OV9A 4NUUA 2V5DA 5AQRB 3RQWA 4JI4T 3SS1A 3MXZA 3IEEA 1XZYA 1HS7A 2CPTA 1SE7A 3AA0B 3JADA 2OA5A 3T1HT 1BR0A 3AE1A 5JRCA 2CBIA 4XZCA 3GMIA 5AQTB 5AQKB 3ZMSB 5LGUB 2VWAA 4M1PA 1XDPA 2X67A 4C90A 2A9UA 5CFBA 5HYAA 3JCFA 2VASA 3AA6B 3ZCJA 3ANWB 4Q25A 3VKGA 4U74A 4WYVA 5JDLA 2KLQA 3H3AA 3LBXA 3RYFE 5LCYA 5AQNB 3AEAA 2XHEB 4LFAT 1Y01A 1YKHB 5DQVA 3RX6A 2IUBA 2J1DG 3GN5B 3UUXB 1J5ET 3Q5EA 2DHRA 1LVKA 2V7MA 3UU5A 1D1AA 2KXPB 2X9HA 3EAMA 5FVLA 1LKXA 2FBWA 3JC6C 4IDQA 1UUSA 4Z91A 5L3BB 4CXYA 2C5IT 5FVKA 2CHOA 1OEDA 3I9YA 1HG5A 1XWMA 4KHZF 4Z8XA 5ABFB 4IDZA 1I6ZA 3ZJ2A 4L0RA 4YHJA 1WYBA 5JRCB 2VKDA 3ABVA 2H3RA 3AB3B 3PUAA 3PUQA 2WMNA 3ZMUB 2C5KT 3PUXF 4GIWA 4HWHA 4ZI3D 5LJNA 3E0ZA 3PU8A 3AEGA 2AXDS 4EZ4A 2KWIB 2LKHA 2HN1A 5L2LA 3ANWA 4FI5A 1N34T 4CXWA 1WYCA 2UXXB 4UV9B 1O3XA 2RP4A 4LF9T 2YK0A 2L8KA 5KDMC 2WU5A 2CXLA 3LBXB 4MFRA 2CLYB 3N5LA 4TUYE 3ZSSA 3K8PC 3RIAA 1WCRA 4TWHA 4JI6T 3GN5A 4QH1A 1OEDE 4PNIA 2V7JA 1SA0E 2E9XA 2FJAA 2LM9A 1YQ4A 2LLYA 3E22E 3QB5K 4X1KE 3ZT5A 4ZZCA 5LGTB 1HG2A 3LFMA 1W0BA 4TV9E 3HKDE 2BVLA 3OPCA 3VHLA 4E7ZA 5C2TA 4EXTA 2WB5A 1LVFA 4PW8A 5CB4E 4B3MT 3RRWA 3UU6A 1HX8A 3N9OA 3AAAB 5H6RB 5CJ5A 4X20E 5AQSB 1OEDC 5JDFA 1FMVA 2I6HA 1G73A 2XZEA 4IDOA 4QX7B 3ZCIA 2E5LT 4JI7T 5L3EB 2H88A 4PJMA 3C50A 3RI5A 4QX8B 3P4QA 4TV8E 3A8YC 2XQYA 3NWIA 2KNDA 2KSRA 4UXNB 3V5SA 5L4EA 2KINB 2LRLA 4I4TE 4GK5E 2Z6EA 2XQ4A 3Q5WA 3ZKRA 3TLVA 5DQWA 5AQFB 2V7LA 4IIJE 1W09A 4TWDA 2WQYA 4DR2T 4DR3T 4ZS3A 3ZT7A 2IHR1 3UFGA 1MNEA 2NP9A 5HXHA 3OTOT 2ZLYA 4ZS2A 4BJMA 2MOZA 4PFPA 3FB2A 4YLHA 3KV5A 2FJEA 4BA9A 2W62A 4ZOLE 4AKRB 2E9XB 4JI5T 3SFEA 4UVAB 4LF6T 3U3IA 4LFCT 1S94A 2CWYA 4UELA 3UULA 1N36T 1D0ZA 1OWAA 4CI3B 2K3WA 1IJ6A 5J2UE 4H63H 2D9DA 2K48A 3LG7A 5AQJB 3RKOA 3LK2B 4I0UA 2H7VC 2YINA 1AJ3A 2SPCA 4HTEA 2NOXA 5J1GA 1WLXA 4LMKA 2Y6XA 2NW8A 2EHOD 4U31A 1NEKA 4EB6E 2KMFA 3UU8A 4JBWF 3FXDB 1MMDA 2AE9A 4LF8T 1OEDB 1R8IA 5ETWA 2E5VA 2WBLA 4F6RC 3K3OA 4IHJE 3JAFA 4H63V 3PE0A 2CXFA 4IREA 3PUSA 3R84B 1ZOYA 4BAYB 1CUNA 4ZI2C 2CCQA 3JAEA 3G06A 4DV7T 2KWHA 4U72A 2J47A 4UV8B 1J1JA 4EV6A 3NBXX 5JQGE 3VU7H 5ABGA 4KUMB 2MPKA 2XTLA 3UTKA 5JREA 3OBVE 1IAPA 3I9WA 4LF5T 2P9BA 1T98A 2WAUA 4IT4A 4MALA 3E08A 4WNKA 2BG9E 2XAFB 2E2AA 5EK4A 3RIUA 4AQFC 1MMAA 4DV2T 3B57A 2Q9QC 4P09A 2UUAT 4GKJT 2CHNA 4AKGA 3AECA 3AEBA 3EVYA 2NW7A 2R6GF 3HI2A 2BKOA 2V6XA 2VVSA 4HFEA 4IGUA 4UEMA 4HE8A 3IF8B 3P50A 1VRBA 5CA1E 3UFEA 4YXDA 1VCTA 2A3DA 2LEHA 3RC3A 4DR1T 3CQGB 2WCAA 2VL0A 5BR8T 1BR4A 2L3LA 4UF0B 4JI3T 4QWNB 5JDMA 2W63A 2WY2A 3T8OA 4BJNA 4XBFB 2YEVC 2CEAA 3PUVF 3K1SA 5HCMA 4WW0A 3N9LA 3ONLC 2YU1A 5FY0A 4ZXLA 5F5WA 5HEJA 4DMVA 1XNQT 3J7Yq 2PTFA 2V8SV 1MMGA 4EAHA 1BR2A 4JEHB 5AFUL 2Q9QA 3OYXA 3MACA 4LF4T 4UF0A 3RQUA 2VKJA 5LHGB 1MIYA 3OVUA 2WM9A 4HEAA 4PJJA 2XJ7A 5DABA 4H9QC 4AXPA 2NWBA 2W66A 4ANJA 1Z8UA 2LSIA 5FY7A 4YSYA 5ABFA 3S4UA 1UK5A 4PK6A 2YDRA 3QC9A 4DUYT 4PFOA 1HNZT 4DV0T 1HNXT 5LBMA 3KVBA 3RF1A 3ZEFB 4AKHA 2XQ3A 2Q9QB 3FHNA 4HFHA 3ZMVB 4KI0F 2MBGA 2HHHT 2LT3A 3EDVA 2BS2A 4U3CA 5HAXA 3PUYF 3C4ZA 1YQ3A 2E9XC 3PUWF 1BR1A 4XAXB 4N78D 2XQ5A 3O1HA 3JC6D 2HPJA 3O1IA 3OYZA 2B1EA 2LOPA 2M67A 4V1Av 4TWFA 5AQGB 3L3PA 3CWZB 2NTXA 3Q9DA 1SHZC 2BDEA 3L09A 4ZHQE 5IWAT 2X66A 2PBIA 2X51A 3EI0A 4CI2B 2XAJB 3HA4A 4PJLA 3AEDA 2JPFA 3SWHA 2V1DB 2W0GA 3CIRA 5JH7E 3KFWX 4IE5A 3LDQB 1ZHCA 2EHOB 5L3DB 5E0OA 3K3QC 3ZMZB 3RYHE 2C5JA 2UUBT 4P1NA 1KNZA 2XQ7A 3AEFA 4EGWA 5IUXA 4OK0A 3AE9A 2H89A 3HKBE 3I1AA 2V7KA 2VB6A 3PJAJ 4O2AE 4PK5A 2VQET 1FJGT 1KK7A 4O8SA 1NWMX 1IZNB 4X62T 4ILUA 3UU4A 4O4IE 4DV1T 4HWCA 2NW9A 4ADZA 3LJCA 2QA7A 2N1GA 2E9XD 5FXZA 3IA3A 5AQOB 2WS3A 3CVRA 2JQ9A 4YTPA 3NKZA 2X0YA 2XSAA 3H3MA 5HEHA 1HTJF 1I94T 2UXDT 2G0UA 1NAFA 2NTYA 4U2YA 4WZXA 5GONE 4IE0A 3EHZA 2X9YA 3SRZA 5JR9C 5LJMA 2YOEA 3AE2A 2W4XA 3UUNA 3MZKB 4AISA 2JQQA 2J62A 2XAHB 3FZMB 2UU9T 2ODVA 3K3NA 3FZHB 3A5XA 3MA9A 2CMRA 3MK7C 4G63A 3UUBA 3ETVA 4LMLA 4LFBT 3ZJ1A 2YDQA 5AQLB 3F2EA 2YU2A 3R6NA 4X1IE 3AXJA 3O1JA 4QXHB 3VKHA 5LA6E 1UURA 1YW0A 3KINB 1S35A 3PV0F 4TZ4C 5FXVA 5LBQB 4IE7A 3WAJA 1KFYA 2WP9A 4YJ3E 2YN6A 2Y48B 5IYZE 3RPUA 2D2SA 4IDPA 2VQFT 3ZYLA 3PDYA 4NXNT 2UUCT 1HCIA 2X0HA 1T8BA 4H9NC 3QUJA 4A98A 2BS4A 2CA5A 5C3JA 3PU3A 2VVNA 2HH7A 5FY1A 3FZLB 2Q9QD 5EK3A 3AE4A 3ZSTA 4EEBA 4YTNA 2UXCT 1XNRT 2VKHA 4CZZB 4ISSA 2K9AA 4NPPA 4JI8T 3C98B 2W2UA 2WDRA 2KZ7B 5L3CB 2WWVA 3C64A 3PJAA 2V7IA 3PTRB 2XY8B 4JUYA 5AQPB 2M6IA 2BBHA 5JR9B 2RA1A 3BK9A 1Y64B 1V9DA 4G2AA 5L47A 2JMKA 1KNRA 1YKEB 4HWFA 1UCUA 4U33A 2XAQB 3I0OA 4ZI3C 3HKCE 2BVMA 2IC6A 4QKNA 4TNVA 5DJQC 5KMGP 3HR0A 3P4SA 3TLSA 3RKGA 5L3GB 5AQQB 5FL0A 2DI4A 3TKLB 4YJ2E 1IBKT 4P0AA 1L0VA 3UQ7A 2EHOA 4EZHA 1IBLT 3CX6B 4JI0T 3ONXA 4DV3T 3CKDA 2W67A 5LG3A 4ERRA 1WR0A 2EHOC 2WZIA 3ESLA 1D0XA 3AA1B 3NZPA 3QOFA 2PFVA 3SFDA 3EUHA 5EZYE 5JDHA 1WRDA 4TNWA 3QK6A 3PUZF 3KBTA 1QUUA 3N2GE 1T72A 5LGNB 4NXMT 5JDNA 1W0AA 2WSSV 1E7PA 2BKNA 1X9BA 2CE7A 4UR9A 1WFDA 1XMOT 4KP3C 4JV5T 4HFCA 1MIVA 3AVSA 5ABHA 4H9OC 2PG8A 4YTMA 2JMHA 3KVAA 2LSJA 2CRBA 2KT9A 4X5TA
chains in the Genus database with same CATH topology
3B13A 2UXNB 1US7B 3ETUA 4UIGA 4A56A 3CQXC 3CPZA 3N9QA 3MKDA 4DMWA 5FMNA 2L9QA 3ZYMA 5JVDE 2XASB 4CXXA 2MTQA 5FXWA 4HFVA 2ZMAA 4EOZB 2WWUA 1ZV4X 2X9WA 2IAKA 4JEUB 3OJAA 5FP3A 1WR6A 4MBQA 1QSDA 2ODUA 4DBRA 3ZN0B 4UVCB 4AQGA 2A2FX 1ZEEA 4FJOA 1EZ3A 2DNXA 3AA7B 3D0TA 4EYYR 3ZN1B 5JDGA 3N9PA 2D5UA 1FIOA 5FYMA 5BMVE 3PUGA 5JR9A 2PJQA 4AKLA 4DO0A 3J9X1 2VL8A 4PJNA 1MMNA 5M4YA 3F31A 4IE6A 3SOLA 4OYKA 2ACXA 3PURA 4ZI2D 1MNDA 4MLKA 5HXRA 3FBLA 2BZBA 3C4XA 3GA8A 4AKIA 3DP7A 3N9MA 4IE4A 4L5GA 5C8YE 4CI1B 4PAGA 4AI6A 4OYJA 3WAKA 4UVBB 3V5UA 4AQFA 3ZLIA 2LSKA 1HFAA 3O4XE 2LJLA 5LHHB 5LYJE 2JRKA 5LNKA 4L9IA 3F57A 2VKOA 3OKQA 5LXTE 2E8IA 4TX5A 2LHNA 5F8PA 2N2NA 2Y8DA 3Q5XA 2DWGA 5HWXA 2W61A 2LSYA 3RC8A 1D1BA 1D0YA 2LOSA 3KV4A 3UT5E 3WI3A 3MJXA 3C51A 2A72A 3FBZA 3BQLA 3NRXA 4QHOA 2ZM0A 4GK0E 5LHIB 3P8CD 3IHRA 2V26A 3RRCA 1UX4A 2QGSA 3IBPA 5LG4A 4QXBB 1VOMA 3GWHA 5LOVE 4KBMB 5FXXA 2CXDA 2K5BB 3N2OA 3BQKA 3CX7B 4WBNE 2WMOA 3CQCB 3RYCE 1U4QA 2X9XA 1UX5A 1FMWA 3AVRA 4ZI7E 3AAIA 4C91A 4X1YE 2IC9A 2DWKA 1D1CA 2ZM2A 4EYUA 5ADXL 1HF8A 4ASKA 4MHCA 3P7IA 2JJ9A 3DJBA 4HKAA 3M65A 3N2KE 4KMCA 5HXSA 4I55E 2GK9A 4CQIA 2ZM8A 4HGAA 4DBQA 3CMLA 4HN9A 4H9SE 3NZQA 4ISTA 4GOUA 4OFZA 4O4JE 3EDUA 2D0TA 4QXCB 1MIWA 1E1HB 1X79A 5A1LA 5HXEA 4O4HE 5F3JA 1YD8G 4I43B 5KX5E 5H6QB 5J2TE 2HPLA 5HXCA 5LP6E 3NRYA 1H7CA 2DLRA 2LE8A 4J2CA 3BQIA 4TN7B 2I59A 2K24A 1U5PA 4P0BA 3RH3A 4JLEA 4GYSA 3LK3B 2IW5B 2DCFA 4DNDA 3AAEB 3KV6A 4PK4A 1FEWA 1OXZA 2LSGA 3CX8B 3Q2MA 3LK42 2LHRA 5FNVE 1G8XA 2C0SA 4OHFA 2VK9A 3U78A 5HWYA 3KDSE 2MYSA 3H37A 2W00A 2X0LB 5TAOA 1Z0PA 3DTOA 2XAGB 2N9DA 2CWOA 3KBUA 5L3FB 2CLYC 2ES0A 4GYRA 4O2BE 4EIWA 1LRZA 4E7SA 4WBOA 5EK2A 1ZKEA 3HL6A 4O4LE 3W15B 3C4WA 3ZC1A 4YFSA 4B6XA 3I0QA 3ZMTB 1B7TA 3FXEB 2CM0A 4NUVA 4H9PC 2H7OA 3HKEE 2XUEA 3KV9A 5CA0E 5IHYA 3UUMA 3ZPOA 4K0UA 1IJ5A 3N9NA 3RYIE 4DVDA 4I50E 4H9RC 3O9XA 2D0UA 2X68A 4NUUA 3SS1A 3MXZA 3IEEA 1HS7A 3AA0B 2OA5A 1BR0A 5JRCA 4XZCA 3ZMSB 3GMIA 5LGUB 2VWAA 4M1PA 2X67A 4C90A 5HYAA 2VASA 3AA6B 3ZCJA 3ANWB 3VKGA 4U74A 5JDLA 2KLQA 3H3AA 3LBXA 3RYFE 5LCYA 2XHEB 1YKHB 5DQVA 3RX6A 2J1DG 3GN5B 3UUXB 2DHRA 1LVKA 2V7MA 1D1AA 2KXPB 2X9HA 1LKXA 5L3BB 3JC6C 4CXYA 2C5IT 3I9YA 1HG5A 4Z8XA 4IDZA 3ZJ2A 4L0RA 4YHJA 1WYBA 5JRCB 2VKDA 3PUAA 2H3RA 3AB3B 3PUQA 3ZMUB 2WMNA 3ZYKA 2C5KT 4GIWA 5LJNA 4ZI3D 3E0ZA 3PU8A 4EZ4A 2KWIB 5L2LA 3ANWA 4FI5A 4CXWA 1WYCA 2UXXB 4UV9B 1O3XA 2RP4A 2YK0A 2L8KA 5KDMC 2CXLA 3LBXB 4MFRA 2CLYB 3N5LA 4TUYE 3K8PC 3GN5A 4PNIA 2V7JA 1SA0E 2E9XA 2LM9A 4X1KE 3E22E 5LGTB 1HG2A 3LFMA 4TV9E 3HKDE 2BVLA 3VHLA 4E7ZA 4EXTA 1LVFA 4PW8A 5CB4E 3RRWA 1HX8A 3N9OA 3AAAB 5H6RB 4X20E 5JDFA 1FMVA 1G73A 4QX7B 3ZCIA 5L3EB 4PJMA 3ZC0A 3C50A 4QX8B 3V5SA 4TV8E 4UXNB 2XQYA 2KNDA 2KINB 4I4TE 4GK5E 2Z6EA 3Q5WA 5DQWA 2V7LA 4IIJE 4ZS3A 1MNEA 2NP9A 5HXHA 2ZLYA 4ZS2A 4BJMA 2MOZA 4PFPA 3FB2A 4YLHA 3KV5A 4BA9A 2W62A 4ZOLE 2E9XB 4UVAB 3U3IA 1S94A 2CWYA 4UELA 3UULA 1D0ZA 1OWAA 4CI3B 1IJ6A 5J2UE 4H63H 2K48A 3LG7A 3LK2B 2H7VC 2YINA 1AJ3A 2SPCA 4HTEA 2NOXA 5J1GA 1WLXA 2Y6XA 2NW8A 2EHOD 4EB6E 2KMFA 3FXDB 1MMDA 5ETWA 4F6RC 2WBLA 3K3OA 4IHJE 4H63V 3PE0A 2CXFA 3R84B 3PUSA 4BAYB 1CUNA 4ZI2C 2CCQA 2KWHA 4U72A 4UV8B 3NBXX 5JQGE 3VU7H 4KUMB 2XTLA 3UTKA 5JREA 3OBVE 1IAPA 3I9WA 2P9BA 1T98A 2WAUA 4MALA 3E08A 4WNKA 2XAFB 5EK4A 4AQFC 1MMAA 3B57A 2Q9QC 4P09A 4AKGA 3EVYA 2NW7A 3HI2A 4UEMA 4IGUA 4AKRB 4HE8A 3IF8B 5CA1E 1VRBA 3UFEA 2A3DA 2LEHA 3RC3A 3CQGB 1BR4A 2L3LA 4UF0B 4QWNB 5JDMA 2W63A 3T8OA 4BJNA 4XBFB 2YEVC 2CEAA 5JDQA 4WW0A 3N9LA 2YU1A 5FY0A 4DMVA 3J7Yq 1MMGA 4EAHA 1BR2A 4JEHB 5AFUL 2Q9QA 3OYXA 3MACA 4UF0A 5LHGB 2VKJA 1MIYA 4HEAA 2WM9A 4PJJA 5DABA 4H9QC 4AXPA 2NWBA 4ANJA 5FY7A 2LSIA 3S4UA 4PK6A 3QC9A 4PFOA 5LBMA 3KVBA 3ZEFB 4AKHA 2Q9QB 3FHNA 3ZMVB 2MBGA 2LT3A 3EDVA 5HAXA 3C4ZA 2E9XC 1BR1A 4XAXB 4N78D 3O1HA 3JC6D 2HPJA 3O1IA 3OYZA 2B1EA 2LOPA 2M67A 4V1Av 3RKOA 5JDHA 3L3PA 3CWZB 2NTXA 3Q9DA 1SHZC 2BDEA 3L09A 4ZHQE 2X66A 2PBIA 2X51A 4CI2B 2XAJB 3HA4A 4PJLA 2JPFA 3SWHA 2V1DB 2W0GA 5JH7E 3KFWX 4IE5A 1ZHCA 2EHOB 5L3DB 5E0OA 3K3QC 3ZMZB 3RYHE 2C5JA 1KNZA 4OK0A 3I1AA 3HKBE 4PK5A 2V7KA 2VB6A 4O2AE 1KK7A 4O8SA 1NWMX 1IZNB 4ILUA 4O4IE 2NW9A 4ADZA 3LJCA 2QA7A 2N1GA 2E9XD 5FXZA 3CVRA 1HTJF 2G0UA 1NAFA 2NTYA 5GONE 5JR9C 5LJMA 4IE0A 2X9YA 3SRZA 3UUNA 3MZKB 2JQQA 2XAHB 2ODVA 3K3NA 3A5XA 3MA9A 2CMRA 3MK7C 4G63A 3ETVA 3ZJ1A 3F2EA 2YU2A 3R6NA 4X1IE 3O1JA 4QXHB 3VKHA 5LA6E 3KINB 1YW0A 4TZ4C 1S35A 5FXVA 5LBQB 4IE7A 3WAJA 4YJ3E 2Y48B 5IYZE 3RPUA 2D2SA 3ZYLA 3PDYA 1HCIA 4H9NC 3QUJA 2CA5A 3PU3A 2HH7A 5FY1A 2Q9QD 5EK3A 2VKHA 4CZZB 4ISSA 2K9AA 3C98B 2KZ7B 5L3CB 3C64A 2V7IA 3PTRB 4JUYA 5JR9B 2RA1A 3BK9A 1Y64B 1V9DA 4G2AA 2JMKA 1YKEB 1UCUA 2XAQB 3I0OA 4ZI3C 3HKCE 2BVMA 2IC6A 4QKNA 5DJQC 5KMGP 3HR0A 5L3GB 2DI4A 3TKLB 4YJ2E 4P0AA 2EHOA 4EZHA 3CX6B 3ONXA 3CKDA 4ERRA 3ESLA 2EHOC 1D0XA 3AA1B 3NZPA 2PFVA 3EUHA 5EZYE 1WRDA 3QK6A 3KBTA 1QUUA 3N2GE 5LGNB 5JDNA 2WSSV 2CE7A 4KP3C 1MIVA 3AVSA 4H9OC 2PG8A 2JMHA 3KVAA 2LSJA 2KT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JR9 B;  5JRC A;  5JR9 A;  3ZC1 A;  3ZC0 A;  5JRC B;  5JRE A;  5JR9 C; 
#chains in the Genus database with same CATH topology
 3B13 A;  4DV5 T;  2UXN B;  4QH5 A;  1US7 B;  4HWI B;  3ETU A;  4IL9 A;  2OLT A;  4UIG A;  4A56 A;  3CQX C;  4COF A;  3CPZ A;  3N9Q A;  3EAB A;  3MKD A;  1YXR A;  4K0K T;  4IDN A;  3ZT6 A;  4DMW A;  5FMN A;  2L9Q A;  2ACZ A;  3ZYM A;  5JVD E;  2XAS B;  3AXJ B;  4JI1 T;  1KF6 A;  4QH4 A;  4CXX A;  2MTQ A;  2F4V T;  4DR6 T;  5FXW A;  4HFV A;  2ZMA A;  3RHW A;  4EOZ B;  2WWU A;  1ZV4 X;  2LM2 A;  2MAW A;  3B5M A;  2X9W A;  2IAK A;  4JEU B;  3OJA A;  5FP3 A;  4F8H A;  1WR6 A;  4KX6 A;  1QSD A;  2ODU A;  4MBQ A;  4DBR A;  3ZN0 B;  4UVC B;  4AQG A;  5LMN T;  2BBJ A;  2A2F X;  1ZEE A;  4FJO A;  1EZ3 A;  2DNX A;  3AA7 B;  3D0T A;  4ILC A;  3UQ4 A;  4EYY R;  3ZN1 B;  5JDG A;  4A97 A;  1QLB A;  2B76 A;  4YSZ A;  3N9P A;  2D5U A;  4DR7 T;  1FIO A;  5FYM A;  4CN6 A;  4B3S T;  5BMV E;  2J4G A;  3PUG A;  5JR9 A;  2PJQ A;  4AKL A;  2I0M A;  3AE8 A;  3P4W A;  3J9X 1;  4DO0 A;  2VL8 A;  4PJN A;  4ZZB A;  4GKK T;  1MMN A;  3QB5 A;  4U7I A;  5M4Y A;  3F31 A;  4IE6 A;  3SOL A;  4OYK A;  2ACX A;  3PUR A;  4ZI2 D;  2JQH A;  2QVA A;  1MND A;  2WDV A;  2XM2 A;  4MLK A;  5HXR A;  3FBL A;  4IL4 A;  2BZB A;  3C4X A;  3GA8 A;  2UXB T;  4AKI A;  4YY3 T;  3DP7 A;  3N9M A;  4IE4 A;  2XM1 A;  4ILB A;  4L5G A;  4PAG A;  5C8Y E;  4CI1 B;  5J0Z A;  4AI6 A;  3ZYK A;  3FZK B;  4OYJ A;  2FJB A;  3WAK A;  3TLW A;  4UVB B;  3RIU C;  3V5U A;  4AQF A;  3ZLI A;  4Z90 A;  5HEG A;  2LSK A;  2XPK A;  1HFA A;  3O4X E;  2IDO B;  2LJL A;  3P4P A;  3FZF B;  5LHH B;  5LYJ E;  2JRK A;  5LNK A;  4L9I A;  3F57 A;  2VKO A;  3OKQ A;  5LXT E;  2E8I A;  3NVO A;  4TX5 A;  2LHN A;  4AIU A;  5F8P A;  3QNU A;  2YDS A;  2BS3 A;  2N2N A;  1KEY A;  4ILA A;  5ABE A;  5AQM B;  2Y8D A;  2JIW A;  4DV6 T;  3Q5X A;  2DWG A;  5HWX A;  2W61 A;  2BG9 A;  4U7Y A;  2LSY A;  2RPA A;  2V6Y B;  5FKY A;  3RC8 A;  1D1B A;  1D0Y A;  2LOS A;  3KV4 A;  3UT5 E;  3WI3 A;  4AQY T;  1DU2 A;  3MJX A;  3C51 A;  2A72 A;  3FBZ A;  3X1D A;  2DL1 A;  3BQL A;  3NRX A;  4QHO A;  2ZM0 A;  4GK0 E;  5LHI B;  3P8C D;  3IHR A;  4B3T T;  5AQI B;  2QYW A;  2V26 A;  4NIQ A;  3RRC A;  1UX4 A;  2BG9 B;  2QGS A;  3IBP A;  3L39 A;  4QXB B;  5HCJ A;  1VOM A;  5LG4 A;  1KNP A;  3GWH A;  5LOV E;  4KBM B;  1IBM T;  5FXX A;  3LSV A;  2CXD A;  2YKS A;  1GQE A;  1ZP0 A;  1M7K A;  2K5B B;  3N2O A;  1NEN A;  3BQK A;  3CX7 B;  4WBN E;  2WMO A;  3CQC B;  3RYC E;  1U4Q A;  4EED A;  2X9X A;  1UX5 A;  1FMW A;  2XQ6 A;  3AVR A;  3AE5 A;  1JNR A;  1HX1 B;  4ZI7 E;  3AAI A;  4HFB A;  4X1Y E;  4C91 A;  2CBJ A;  2IC9 A;  2DWK A;  1D1C A;  3CK6 A;  5JTG A;  1XMQ T;  2ZM2 A;  5LB7 B;  2XQ8 A;  4EYU A;  2BKP A;  1HF8 A;  5ADX L;  4ASK A;  2XQA A;  4MHC A;  3P7I A;  3A7M A;  3AE7 A;  5AQV B;  2JJ9 A;  3P4R A;  3RLF F;  3DJB A;  4HKA A;  4YSX A;  3AE6 A;  3M65 A;  1T7S A;  3N2K E;  1E2A A;  4KMC A;  5HXS A;  4I55 E;  2HN2 A;  2GK9 A;  4CQI A;  2ZM8 A;  4YT0 A;  4X64 T;  4X66 T;  4HGA A;  3AEE A;  4DBQ A;  3CML A;  4HN9 A;  4H9S E;  3NZQ A;  4IST A;  4GOU A;  2BG9 C;  2IML A;  4OFZ A;  1UGO A;  4A5X A;  4CN4 A;  5LMU T;  1SUM B;  4O4J E;  1W9R A;  3EDU A;  3TLT A;  2D0T A;  4QXC B;  1MIW A;  1JNZ A;  3M3Z B;  4DV4 T;  1E1H B;  1X79 A;  4HFI A;  3VR8 A;  5A1L A;  5FL1 A;  5HXE A;  4O4H E;  2WZH A;  3Q5D A;  3VR9 A;  5F3J A;  1YD8 G;  4I43 B;  5CGM A;  5KX5 E;  4X65 T;  5H6Q B;  3RIF A;  2HPL A;  5HXC A;  5LP6 E;  5J2T E;  5AQU B;  3AE3 A;  5L4H A;  3NRY A;  1H7C A;  3RGL A;  2DLR A;  2LRK A;  2LE8 A;  4J2C A;  3BQI A;  4TN7 B;  4DID B;  4ZEY A;  2I59 A;  2IIU A;  2K24 A;  2FUP A;  1U5P A;  4P0B A;  3RH3 A;  4JLE A;  4DR5 T;  4GYS A;  1M62 A;  3LK3 B;  4HFD A;  2NR4 A;  4HWD A;  2IW5 B;  2DCF A;  4B3R T;  4DND A;  3AAE B;  2M6B A;  3KV6 A;  4PK4 A;  4DR4 T;  5AQH B;  1FEW A;  1OXZ A;  5HEU A;  2LSG A;  3CX8 B;  3Q2M A;  2ZM6 T;  3LK4 2;  3UU3 A;  2LHR A;  5FNV E;  1G8X A;  2C0S A;  4OHF A;  3L8R A;  2VK9 A;  5KXJ A;  2VUR A;  3U78 A;  5HWY A;  3KDS E;  2MYS A;  3H37 A;  4LMJ A;  4JI2 T;  1VCS A;  2WDQ A;  1HNW T;  2W00 A;  2X0L B;  5TAO A;  4YHH T;  1Z0P A;  3DTO A;  2XAG B;  2N9D A;  2CWO A;  3KBU A;  3ONJ A;  1CHU A;  3VRB A;  4OX9 T;  2XQ9 A;  5L3F B;  4DUZ T;  2CLY C;  2ES0 A;  2QRX A;  4GYR A;  4O2B E;  4U2Z A;  1HR0 T;  4EIW A;  1LRZ A;  3VRA A;  4E7S A;  4WBO A;  5EK2 A;  1ZKE A;  3HL6 A;  4O4L E;  3W15 B;  1N32 T;  3C4W A;  3ZC1 A;  4YFS A;  4B6X A;  4CN1 A;  4JYA T;  4LF7 T;  3I0Q A;  2LKG A;  1B7T A;  3FXE B;  2CM0 A;  4NUV A;  4H9P C;  3ZMT B;  2H7O A;  3HKE E;  2XUE A;  3KV9 A;  4KHP T;  5CA0 E;  2V5C A;  2JQK A;  2XSB A;  5IHY A;  2FJD A;  3UUM A;  3ZC0 A;  1J5W A;  3ZPO A;  2WU2 A;  4K0U A;  1IJ5 A;  5HEO A;  3N9N A;  1XDO A;  3RYI E;  4DVD A;  3TLU A;  1N33 T;  4I50 E;  5JDQ A;  4H9R C;  2V6Y A;  3O9X A;  2D0U A;  3T1Y T;  2X68 A;  2OV9 A;  4NUU A;  2V5D A;  5AQR B;  3RQW A;  4JI4 T;  3SS1 A;  3MXZ A;  3IEE A;  1XZY A;  1HS7 A;  2CPT A;  1SE7 A;  3AA0 B;  3JAD A;  2OA5 A;  3T1H T;  1BR0 A;  3AE1 A;  5JRC A;  2CBI A;  4XZC A;  3GMI A;  5AQT B;  5AQK B;  3ZMS B;  5LGU B;  2VWA A;  4M1P A;  1XDP A;  2X67 A;  4C90 A;  2A9U A;  5CFB A;  5HYA A;  3JCF A;  2VAS A;  3AA6 B;  3ZCJ A;  3ANW B;  4Q25 A;  3VKG A;  4U74 A;  4WYV A;  5JDL A;  2KLQ A;  3H3A A;  3LBX A;  3RYF E;  5LCY A;  5AQN B;  3AEA A;  2XHE B;  4LFA T;  1Y01 A;  1YKH B;  5DQV A;  3RX6 A;  2IUB A;  2J1D G;  3GN5 B;  3UUX B;  1J5E T;  3Q5E A;  2DHR A;  1LVK A;  2V7M A;  3UU5 A;  1D1A A;  2KXP B;  2X9H A;  3EAM A;  5FVL A;  1LKX A;  2FBW A;  3JC6 C;  4IDQ A;  1UUS A;  4Z91 A;  5L3B B;  4CXY A;  2C5I T;  5FVK A;  2CHO A;  1OED A;  3I9Y A;  1HG5 A;  1XWM A;  4KHZ F;  4Z8X A;  5ABF B;  4IDZ A;  1I6Z A;  3ZJ2 A;  4L0R A;  4YHJ A;  1WYB A;  5JRC B;  2VKD A;  3ABV A;  2H3R A;  3AB3 B;  3PUA A;  3PUQ A;  2WMN A;  3ZMU B;  2C5K T;  3PUX F;  4GIW A;  4HWH A;  4ZI3 D;  5LJN A;  3E0Z A;  3PU8 A;  3AEG A;  2AXD S;  4EZ4 A;  2KWI B;  2LKH A;  2HN1 A;  5L2L A;  3ANW A;  4FI5 A;  1N34 T;  4CXW A;  1WYC A;  2UXX B;  4UV9 B;  1O3X A;  2RP4 A;  4LF9 T;  2YK0 A;  2L8K A;  5KDM C;  2WU5 A;  2CXL A;  3LBX B;  4MFR A;  2CLY B;  3N5L A;  4TUY E;  3ZSS A;  3K8P C;  3RIA A;  1WCR A;  4TWH A;  4JI6 T;  3GN5 A;  4QH1 A;  1OED E;  4PNI A;  2V7J A;  1SA0 E;  2E9X A;  2FJA A;  2LM9 A;  1YQ4 A;  2LLY A;  3E22 E;  3QB5 K;  4X1K E;  3ZT5 A;  4ZZC A;  5LGT B;  1HG2 A;  3LFM A;  1W0B A;  4TV9 E;  3HKD E;  2BVL A;  3OPC A;  3VHL A;  4E7Z A;  5C2T A;  4EXT A;  2WB5 A;  1LVF A;  4PW8 A;  5CB4 E;  4B3M T;  3RRW A;  3UU6 A;  1HX8 A;  3N9O A;  3AAA B;  5H6R B;  5CJ5 A;  4X20 E;  5AQS B;  1OED C;  5JDF A;  1FMV A;  2I6H A;  1G73 A;  2XZE A;  4IDO A;  4QX7 B;  3ZCI A;  2E5L T;  4JI7 T;  5L3E B;  2H88 A;  4PJM A;  3C50 A;  3RI5 A;  4QX8 B;  3P4Q A;  4TV8 E;  3A8Y C;  2XQY A;  3NWI A;  2KND A;  2KSR A;  4UXN B;  3V5S A;  5L4E A;  2KIN B;  2LRL A;  4I4T E;  4GK5 E;  2Z6E A;  2XQ4 A;  3Q5W A;  3ZKR A;  3TLV A;  5DQW A;  5AQF B;  2V7L A;  4IIJ E;  1W09 A;  4TWD A;  2WQY A;  4DR2 T;  4DR3 T;  4ZS3 A;  3ZT7 A;  2IHR 1;  3UFG A;  1MNE A;  2NP9 A;  5HXH A;  3OTO T;  2ZLY A;  4ZS2 A;  4BJM A;  2MOZ A;  4PFP A;  3FB2 A;  4YLH A;  3KV5 A;  2FJE A;  4BA9 A;  2W62 A;  4ZOL E;  4AKR B;  2E9X B;  4JI5 T;  3SFE A;  4UVA B;  4LF6 T;  3U3I A;  4LFC T;  1S94 A;  2CWY A;  4UEL A;  3UUL A;  1N36 T;  1D0Z A;  1OWA A;  4CI3 B;  2K3W A;  1IJ6 A;  5J2U E;  4H63 H;  2D9D A;  2K48 A;  3LG7 A;  5AQJ B;  3RKO A;  3LK2 B;  4I0U A;  2H7V C;  2YIN A;  1AJ3 A;  2SPC A;  4HTE A;  2NOX A;  5J1G A;  1WLX A;  4LMK A;  2Y6X A;  2NW8 A;  2EHO D;  4U31 A;  1NEK A;  4EB6 E;  2KMF A;  3UU8 A;  4JBW F;  3FXD B;  1MMD A;  2AE9 A;  4LF8 T;  1OED B;  1R8I A;  5ETW A;  2E5V A;  2WBL A;  4F6R C;  3K3O A;  4IHJ E;  3JAF A;  4H63 V;  3PE0 A;  2CXF A;  4IRE A;  3PUS A;  3R84 B;  1ZOY A;  4BAY B;  1CUN A;  4ZI2 C;  2CCQ A;  3JAE A;  3G06 A;  4DV7 T;  2KWH A;  4U72 A;  2J47 A;  4UV8 B;  1J1J A;  4EV6 A;  3NBX X;  5JQG E;  3VU7 H;  5ABG A;  4KUM B;  2MPK A;  2XTL A;  3UTK A;  5JRE A;  3OBV E;  1IAP A;  3I9W A;  4LF5 T;  2P9B A;  1T98 A;  2WAU A;  4IT4 A;  4MAL A;  3E08 A;  4WNK A;  2BG9 E;  2XAF B;  2E2A A;  5EK4 A;  3RIU A;  4AQF C;  1MMA A;  4DV2 T;  3B57 A;  2Q9Q C;  4P09 A;  2UUA T;  4GKJ T;  2CHN A;  4AKG A;  3AEC A;  3AEB A;  3EVY A;  2NW7 A;  2R6G F;  3HI2 A;  2BKO A;  2V6X A;  2VVS A;  4HFE A;  4IGU A;  4UEM A;  4HE8 A;  3IF8 B;  3P50 A;  1VRB A;  5CA1 E;  3UFE A;  4YXD A;  1VCT A;  2A3D A;  2LEH A;  3RC3 A;  4DR1 T;  3CQG B;  2WCA A;  2VL0 A;  5BR8 T;  1BR4 A;  2L3L A;  4UF0 B;  4JI3 T;  4QWN B;  5JDM A;  2W63 A;  2WY2 A;  3T8O A;  4BJN A;  4XBF B;  2YEV C;  2CEA A;  3PUV F;  3K1S A;  5HCM A;  4WW0 A;  3N9L A;  3ONL C;  2YU1 A;  5FY0 A;  4ZXL A;  5F5W A;  5HEJ A;  4DMV A;  1XNQ T;  3J7Y q;  2PTF A;  2V8S V;  1MMG A;  4EAH A;  1BR2 A;  4JEH B;  5AFU L;  2Q9Q A;  3OYX A;  3MAC A;  4LF4 T;  4UF0 A;  3RQU A;  2VKJ A;  5LHG B;  1MIY A;  3OVU A;  2WM9 A;  4HEA A;  4PJJ A;  2XJ7 A;  5DAB A;  4H9Q C;  4AXP A;  2NWB A;  2W66 A;  4ANJ A;  1Z8U A;  2LSI A;  5FY7 A;  4YSY A;  5ABF A;  3S4U A;  1UK5 A;  4PK6 A;  2YDR A;  3QC9 A;  4DUY T;  4PFO A;  1HNZ T;  4DV0 T;  1HNX T;  5LBM A;  3KVB A;  3RF1 A;  3ZEF B;  4AKH A;  2XQ3 A;  2Q9Q B;  3FHN A;  4HFH A;  3ZMV B;  4KI0 F;  2MBG A;  2HHH T;  2LT3 A;  3EDV A;  2BS2 A;  4U3C A;  5HAX A;  3PUY F;  3C4Z A;  1YQ3 A;  2E9X C;  3PUW F;  1BR1 A;  4XAX B;  4N78 D;  2XQ5 A;  3O1H A;  3JC6 D;  2HPJ A;  3O1I A;  3OYZ A;  2B1E A;  2LOP A;  2M67 A;  4V1A v;  4TWF A;  5AQG B;  3L3P A;  3CWZ B;  2NTX A;  3Q9D A;  1SHZ C;  2BDE A;  3L09 A;  4ZHQ E;  5IWA T;  2X66 A;  2PBI A;  2X51 A;  3EI0 A;  4CI2 B;  2XAJ B;  3HA4 A;  4PJL A;  3AED A;  2JPF A;  3SWH A;  2V1D B;  2W0G A;  3CIR A;  5JH7 E;  3KFW X;  4IE5 A;  3LDQ B;  1ZHC A;  2EHO B;  5L3D B;  5E0O A;  3K3Q C;  3ZMZ B;  3RYH E;  2C5J A;  2UUB T;  4P1N A;  1KNZ A;  2XQ7 A;  3AEF A;  4EGW A;  5IUX A;  4OK0 A;  3AE9 A;  2H89 A;  3HKB E;  3I1A A;  2V7K A;  2VB6 A;  3PJA J;  4O2A E;  4PK5 A;  2VQE T;  1FJG T;  1KK7 A;  4O8S A;  1NWM X;  1IZN B;  4X62 T;  4ILU A;  3UU4 A;  4O4I E;  4DV1 T;  4HWC A;  2NW9 A;  4ADZ A;  3LJC A;  2QA7 A;  2N1G A;  2E9X D;  5FXZ A;  3IA3 A;  5AQO B;  2WS3 A;  3CVR A;  2JQ9 A;  4YTP A;  3NKZ A;  2X0Y A;  2XSA A;  3H3M A;  5HEH A;  1HTJ F;  1I94 T;  2UXD T;  2G0U A;  1NAF A;  2NTY A;  4U2Y A;  4WZX A;  5GON E;  4IE0 A;  3EHZ A;  2X9Y A;  3SRZ A;  5JR9 C;  5LJM A;  2YOE A;  3AE2 A;  2W4X A;  3UUN A;  3MZK B;  4AIS A;  2JQQ A;  2J62 A;  2XAH B;  3FZM B;  2UU9 T;  2ODV A;  3K3N A;  3FZH B;  3A5X A;  3MA9 A;  2CMR A;  3MK7 C;  4G63 A;  3UUB A;  3ETV A;  4LML A;  4LFB T;  3ZJ1 A;  2YDQ A;  5AQL B;  3F2E A;  2YU2 A;  3R6N A;  4X1I E;  3AXJ A;  3O1J A;  4QXH B;  3VKH A;  5LA6 E;  1UUR A;  1YW0 A;  3KIN B;  1S35 A;  3PV0 F;  4TZ4 C;  5FXV A;  5LBQ B;  4IE7 A;  3WAJ A;  1KFY A;  2WP9 A;  4YJ3 E;  2YN6 A;  2Y48 B;  5IYZ E;  3RPU A;  2D2S A;  4IDP A;  2VQF T;  3ZYL A;  3PDY A;  4NXN T;  2UUC T;  1HCI A;  2X0H A;  1T8B A;  4H9N C;  3QUJ A;  4A98 A;  2BS4 A;  2CA5 A;  5C3J A;  3PU3 A;  2VVN A;  2HH7 A;  5FY1 A;  3FZL B;  2Q9Q D;  5EK3 A;  3AE4 A;  3ZST A;  4EEB A;  4YTN A;  2UXC T;  1XNR T;  2VKH A;  4CZZ B;  4ISS A;  2K9A A;  4NPP A;  4JI8 T;  3C98 B;  2W2U A;  2WDR A;  2KZ7 B;  5L3C B;  2WWV A;  3C64 A;  3PJA A;  2V7I A;  3PTR B;  2XY8 B;  4JUY A;  5AQP B;  2M6I A;  2BBH A;  5JR9 B;  2RA1 A;  3BK9 A;  1Y64 B;  1V9D A;  4G2A A;  5L47 A;  2JMK A;  1KNR A;  1YKE B;  4HWF A;  1UCU A;  4U33 A;  2XAQ B;  3I0O A;  4ZI3 C;  3HKC E;  2BVM A;  2IC6 A;  4QKN A;  4TNV A;  5DJQ C;  5KMG P;  3HR0 A;  3P4S A;  3TLS A;  3RKG A;  5L3G B;  5AQQ B;  5FL0 A;  2DI4 A;  3TKL B;  4YJ2 E;  1IBK T;  4P0A A;  1L0V A;  3UQ7 A;  2EHO A;  4EZH A;  1IBL T;  3CX6 B;  4JI0 T;  3ONX A;  4DV3 T;  3CKD A;  2W67 A;  5LG3 A;  4ERR A;  1WR0 A;  2EHO C;  2WZI A;  3ESL A;  1D0X A;  3AA1 B;  3NZP A;  3QOF A;  2PFV A;  3SFD A;  3EUH A;  5EZY E;  5JDH A;  1WRD A;  4TNW A;  3QK6 A;  3PUZ F;  3KBT A;  1QUU A;  3N2G E;  1T72 A;  5LGN B;  4NXM T;  5JDN A;  1W0A A;  2WSS V;  1E7P A;  2BKN A;  1X9B A;  2CE7 A;  4UR9 A;  1WFD A;  1XMO T;  4KP3 C;  4JV5 T;  4HFC A;  1MIV A;  3AVS A;  5ABH A;  4H9O C;  2PG8 A;  4YTM A;  2JMH A;  3KVA A;  2LSJ A;  2CRB A;  2KT9 A;  4X5T A; 
#chains in the Genus database with same CATH homology
 3B13 A;  2UXN B;  1US7 B;  3ETU A;  4UIG A;  4A56 A;  3CQX C;  3CPZ A;  3N9Q A;  3MKD A;  4DMW A;  5FMN A;  2L9Q A;  3ZYM A;  5JVD E;  2XAS B;  4CXX A;  2MTQ A;  5FXW A;  4HFV A;  2ZMA A;  4EOZ B;  2WWU A;  1ZV4 X;  2X9W A;  2IAK A;  4JEU B;  3OJA A;  5FP3 A;  1WR6 A;  4MBQ A;  1QSD A;  2ODU A;  4DBR A;  3ZN0 B;  4UVC B;  4AQG A;  2A2F X;  1ZEE A;  4FJO A;  1EZ3 A;  2DNX A;  3AA7 B;  3D0T A;  4EYY R;  3ZN1 B;  5JDG A;  3N9P A;  2D5U A;  1FIO A;  5FYM A;  5BMV E;  3PUG A;  5JR9 A;  2PJQ A;  4AKL A;  4DO0 A;  3J9X 1;  2VL8 A;  4PJN A;  1MMN A;  5M4Y A;  3F31 A;  4IE6 A;  3SOL A;  4OYK A;  2ACX A;  3PUR A;  4ZI2 D;  1MND A;  4MLK A;  5HXR A;  3FBL A;  2BZB A;  3C4X A;  3GA8 A;  4AKI A;  3DP7 A;  3N9M A;  4IE4 A;  4L5G A;  5C8Y E;  4CI1 B;  4PAG A;  4AI6 A;  4OYJ A;  3WAK A;  4UVB B;  3V5U A;  4AQF A;  3ZLI A;  2LSK A;  1HFA A;  3O4X E;  2LJL A;  5LHH B;  5LYJ E;  2JRK A;  5LNK A;  4L9I A;  3F57 A;  2VKO A;  3OKQ A;  5LXT E;  2E8I A;  4TX5 A;  2LHN A;  5F8P A;  2N2N A;  2Y8D A;  3Q5X A;  2DWG A;  5HWX A;  2W61 A;  2LSY A;  3RC8 A;  1D1B A;  1D0Y A;  2LOS A;  3KV4 A;  3UT5 E;  3WI3 A;  3MJX A;  3C51 A;  2A72 A;  3FBZ A;  3BQL A;  3NRX A;  4QHO A;  2ZM0 A;  4GK0 E;  5LHI B;  3P8C D;  3IHR A;  2V26 A;  3RRC A;  1UX4 A;  2QGS A;  3IBP A;  5LG4 A;  4QXB B;  1VOM A;  3GWH A;  5LOV E;  4KBM B;  5FXX A;  2CXD A;  2K5B B;  3N2O A;  3BQK A;  3CX7 B;  4WBN E;  2WMO A;  3CQC B;  3RYC E;  1U4Q A;  2X9X A;  1UX5 A;  1FMW A;  3AVR A;  4ZI7 E;  3AAI A;  4C91 A;  4X1Y E;  2IC9 A;  2DWK A;  1D1C A;  2ZM2 A;  4EYU A;  5ADX L;  1HF8 A;  4ASK A;  4MHC A;  3P7I A;  2JJ9 A;  3DJB A;  4HKA A;  3M65 A;  3N2K E;  4KMC A;  5HXS A;  4I55 E;  2GK9 A;  4CQI A;  2ZM8 A;  4HGA A;  4DBQ A;  3CML A;  4HN9 A;  4H9S E;  3NZQ A;  4IST A;  4GOU A;  4OFZ A;  4O4J E;  3EDU A;  2D0T A;  4QXC B;  1MIW A;  1E1H B;  1X79 A;  5A1L A;  5HXE A;  4O4H E;  5F3J A;  1YD8 G;  4I43 B;  5KX5 E;  5H6Q B;  5J2T E;  2HPL A;  5HXC A;  5LP6 E;  3NRY A;  1H7C A;  2DLR A;  2LE8 A;  4J2C A;  3BQI A;  4TN7 B;  2I59 A;  2K24 A;  1U5P A;  4P0B A;  3RH3 A;  4JLE A;  4GYS A;  3LK3 B;  2IW5 B;  2DCF A;  4DND A;  3AAE B;  3KV6 A;  4PK4 A;  1FEW A;  1OXZ A;  2LSG A;  3CX8 B;  3Q2M A;  3LK4 2;  2LHR A;  5FNV E;  1G8X A;  2C0S A;  4OHF A;  2VK9 A;  3U78 A;  5HWY A;  3KDS E;  2MYS A;  3H37 A;  2W00 A;  2X0L B;  5TAO A;  1Z0P A;  3DTO A;  2XAG B;  2N9D A;  2CWO A;  3KBU A;  5L3F B;  2CLY C;  2ES0 A;  4GYR A;  4O2B E;  4EIW A;  1LRZ A;  4E7S A;  4WBO A;  5EK2 A;  1ZKE A;  3HL6 A;  4O4L E;  3W15 B;  3C4W A;  3ZC1 A;  4YFS A;  4B6X A;  3I0Q A;  3ZMT B;  1B7T A;  3FXE B;  2CM0 A;  4NUV A;  4H9P C;  2H7O A;  3HKE E;  2XUE A;  3KV9 A;  5CA0 E;  5IHY A;  3UUM A;  3ZPO A;  4K0U A;  1IJ5 A;  3N9N A;  3RYI E;  4DVD A;  4I50 E;  4H9R C;  3O9X A;  2D0U A;  2X68 A;  4NUU A;  3SS1 A;  3MXZ A;  3IEE A;  1HS7 A;  3AA0 B;  2OA5 A;  1BR0 A;  5JRC A;  4XZC A;  3ZMS B;  3GMI A;  5LGU B;  2VWA A;  4M1P A;  2X67 A;  4C90 A;  5HYA A;  2VAS A;  3AA6 B;  3ZCJ A;  3ANW B;  3VKG A;  4U74 A;  5JDL A;  2KLQ A;  3H3A A;  3LBX A;  3RYF E;  5LCY A;  2XHE B;  1YKH B;  5DQV A;  3RX6 A;  2J1D G;  3GN5 B;  3UUX B;  2DHR A;  1LVK A;  2V7M A;  1D1A A;  2KXP B;  2X9H A;  1LKX A;  5L3B B;  3JC6 C;  4CXY A;  2C5I T;  3I9Y A;  1HG5 A;  4Z8X A;  4IDZ A;  3ZJ2 A;  4L0R A;  4YHJ A;  1WYB A;  5JRC B;  2VKD A;  3PUA A;  2H3R A;  3AB3 B;  3PUQ A;  3ZMU B;  2WMN A;  3ZYK A;  2C5K T;  4GIW A;  5LJN A;  4ZI3 D;  3E0Z A;  3PU8 A;  4EZ4 A;  2KWI B;  5L2L A;  3ANW A;  4FI5 A;  4CXW A;  1WYC A;  2UXX B;  4UV9 B;  1O3X A;  2RP4 A;  2YK0 A;  2L8K A;  5KDM C;  2CXL A;  3LBX B;  4MFR A;  2CLY B;  3N5L A;  4TUY E;  3K8P C;  3GN5 A;  4PNI A;  2V7J A;  1SA0 E;  2E9X A;  2LM9 A;  4X1K E;  3E22 E;  5LGT B;  1HG2 A;  3LFM A;  4TV9 E;  3HKD E;  2BVL A;  3VHL A;  4E7Z A;  4EXT A;  1LVF A;  4PW8 A;  5CB4 E;  3RRW A;  1HX8 A;  3N9O A;  3AAA B;  5H6R B;  4X20 E;  5JDF A;  1FMV A;  1G73 A;  4QX7 B;  3ZCI A;  5L3E B;  4PJM A;  3ZC0 A;  3C50 A;  4QX8 B;  3V5S A;  4TV8 E;  4UXN B;  2XQY A;  2KND A;  2KIN B;  4I4T E;  4GK5 E;  2Z6E A;  3Q5W A;  5DQW A;  2V7L A;  4IIJ E;  4ZS3 A;  1MNE A;  2NP9 A;  5HXH A;  2ZLY A;  4ZS2 A;  4BJM A;  2MOZ A;  4PFP A;  3FB2 A;  4YLH A;  3KV5 A;  4BA9 A;  2W62 A;  4ZOL E;  2E9X B;  4UVA B;  3U3I A;  1S94 A;  2CWY A;  4UEL A;  3UUL A;  1D0Z A;  1OWA A;  4CI3 B;  1IJ6 A;  5J2U E;  4H63 H;  2K48 A;  3LG7 A;  3LK2 B;  2H7V C;  2YIN A;  1AJ3 A;  2SPC A;  4HTE A;  2NOX A;  5J1G A;  1WLX A;  2Y6X A;  2NW8 A;  2EHO D;  4EB6 E;  2KMF A;  3FXD B;  1MMD A;  5ETW A;  4F6R C;  2WBL A;  3K3O A;  4IHJ E;  4H63 V;  3PE0 A;  2CXF A;  3R84 B;  3PUS A;  4BAY B;  1CUN A;  4ZI2 C;  2CCQ A;  2KWH A;  4U72 A;  4UV8 B;  3NBX X;  5JQG E;  3VU7 H;  4KUM B;  2XTL A;  3UTK A;  5JRE A;  3OBV E;  1IAP A;  3I9W A;  2P9B A;  1T98 A;  2WAU A;  4MAL A;  3E08 A;  4WNK A;  2XAF B;  5EK4 A;  4AQF C;  1MMA A;  3B57 A;  2Q9Q C;  4P09 A;  4AKG A;  3EVY A;  2NW7 A;  3HI2 A;  4UEM A;  4IGU A;  4AKR B;  4HE8 A;  3IF8 B;  5CA1 E;  1VRB A;  3UFE A;  2A3D A;  2LEH A;  3RC3 A;  3CQG B;  1BR4 A;  2L3L A;  4UF0 B;  4QWN B;  5JDM A;  2W63 A;  3T8O A;  4BJN A;  4XBF B;  2YEV C;  2CEA A;  5JDQ A;  4WW0 A;  3N9L A;  2YU1 A;  5FY0 A;  4DMV A;  3J7Y q;  1MMG A;  4EAH A;  1BR2 A;  4JEH B;  5AFU L;  2Q9Q A;  3OYX A;  3MAC A;  4UF0 A;  5LHG B;  2VKJ A;  1MIY A;  4HEA A;  2WM9 A;  4PJJ A;  5DAB A;  4H9Q C;  4AXP A;  2NWB A;  4ANJ A;  5FY7 A;  2LSI A;  3S4U A;  4PK6 A;  3QC9 A;  4PFO A;  5LBM A;  3KVB A;  3ZEF B;  4AKH A;  2Q9Q B;  3FHN A;  3ZMV B;  2MBG A;  2LT3 A;  3EDV A;  5HAX A;  3C4Z A;  2E9X C;  1BR1 A;  4XAX B;  4N78 D;  3O1H A;  3JC6 D;  2HPJ A;  3O1I A;  3OYZ A;  2B1E A;  2LOP A;  2M67 A;  4V1A v;  3RKO A;  5JDH A;  3L3P A;  3CWZ B;  2NTX A;  3Q9D A;  1SHZ C;  2BDE A;  3L09 A;  4ZHQ E;  2X66 A;  2PBI A;  2X51 A;  4CI2 B;  2XAJ B;  3HA4 A;  4PJL A;  2JPF A;  3SWH A;  2V1D B;  2W0G A;  5JH7 E;  3KFW X;  4IE5 A;  1ZHC A;  2EHO B;  5L3D B;  5E0O A;  3K3Q C;  3ZMZ B;  3RYH E;  2C5J A;  1KNZ A;  4OK0 A;  3I1A A;  3HKB E;  4PK5 A;  2V7K A;  2VB6 A;  4O2A E;  1KK7 A;  4O8S A;  1NWM X;  1IZN B;  4ILU A;  4O4I E;  2NW9 A;  4ADZ A;  3LJC A;  2QA7 A;  2N1G A;  2E9X D;  5FXZ A;  3CVR A;  1HTJ F;  2G0U A;  1NAF A;  2NTY A;  5GON E;  5JR9 C;  5LJM A;  4IE0 A;  2X9Y A;  3SRZ A;  3UUN A;  3MZK B;  2JQQ A;  2XAH B;  2ODV A;  3K3N A;  3A5X A;  3MA9 A;  2CMR A;  3MK7 C;  4G63 A;  3ETV A;  3ZJ1 A;  3F2E A;  2YU2 A;  3R6N A;  4X1I E;  3O1J A;  4QXH B;  3VKH A;  5LA6 E;  3KIN B;  1YW0 A;  4TZ4 C;  1S35 A;  5FXV A;  5LBQ B;  4IE7 A;  3WAJ A;  4YJ3 E;  2Y48 B;  5IYZ E;  3RPU A;  2D2S A;  3ZYL A;  3PDY A;  1HCI A;  4H9N C;  3QUJ A;  2CA5 A;  3PU3 A;  2HH7 A;  5FY1 A;  2Q9Q D;  5EK3 A;  2VKH A;  4CZZ B;  4ISS A;  2K9A A;  3C98 B;  2KZ7 B;  5L3C B;  3C64 A;  2V7I A;  3PTR B;  4JUY A;  5JR9 B;  2RA1 A;  3BK9 A;  1Y64 B;  1V9D A;  4G2A A;  2JMK A;  1YKE B;  1UCU A;  2XAQ B;  3I0O A;  4ZI3 C;  3HKC E;  2BVM A;  2IC6 A;  4QKN A;  5DJQ C;  5KMG P;  3HR0 A;  5L3G B;  2DI4 A;  3TKL B;  4YJ2 E;  4P0A A;  2EHO A;  4EZH A;  3CX6 B;  3ONX A;  3CKD A;  4ERR A;  3ESL A;  2EHO C;  1D0X A;  3AA1 B;  3NZP A;  2PFV A;  3EUH A;  5EZY E;  1WRD A;  3QK6 A;  3KBT A;  1QUU A;  3N2G E;  5LGN B;  5JDN A;  2WSS V;  2CE7 A;  4KP3 C;  1MIV A;  3AVS A;  4H9O C;  2PG8 A;  2JMH A;  3KVA A;  2LSJ A;  2KT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...