5JR9C

Crystal structure of apo-nec3po
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
185
structure length
185
Chain Sequence
b'MLPNLDNLKEEYQKLEEKKQEIVDRSIRMSKLSKSLIYSMIREDYKSADKYKEELTNLAKTQIEELKKYPMFYSNGFIGLQEYVEALALYYYIKENRIPSKEELGVDTWVYLFGIGDIAGEILRKSSEELIKGNIEYAKKAKQDLESLYLDLLYIELKNFDLRRKLDYVSNIINKLIEFIIWKSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for single-stranded RNA recognition and cleavage by C3PO
pubmed doi rcsb
molecule keywords NEQ131
source organism Nanoarchaeum equitans (strain kin4-m)
molecule tags Dna binding protein
total genus 82
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01997 Translin Translin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2140 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5jr9C00
5JREA 5JR9A 5JRCA 5JR9B 5JRCB 3ZC0A 5JR9C 3ZC1A
chains in the Genus database with same CATH superfamily
2KZ7B 3E22E 3VKHA 3QK6A 4F6RC 5HCJA 5ABFA 5L47A 4O4LE 2K5BB 2IC6A 2WB5A 2DCFA 3HL6A 5JQGE 1HNZT 2JRKA 4DV4T 3IHRA 2XQ6A 1T72A 1HNXT 5JDHA 3N9NA 2FJEA 5H6QB 4TX5A 3P7IA 3O4XE 5LGTB 2W2UA 3O1JA 4X66T 4U7YA 4MALA 4IREA 2CBIA 2R6GF 1QLBA 3OVUA 2IW5B 2YDQA 2BBHA 2WY2A 2XHEB 4ZXLA 3ZSSA 2BG9E 2ZM0A 1XZYA 1WRDA 3AB3B 3CPZA 4U74A 5FMNA 3RYHE 1XNRT 2MTQA 4B3RT 3RKGA 1E7PA 2XQ8A 3ZN1B 3NKZA 2W00A 3RKOA 1X79A 5LHGB 3PUSA 2E2AA 3PUWF 4C91A 1E2AA 2XASB 4O2AE 1CHUA 3AA0B 4PJJA 1OEDC 3RRCA 4GK5E 2SPCA 3C50A 4ILCA 4AI6A 2H7VC 2WCAA 3B5MA 2RP4A 5FKYA 3TLTA 2X0HA 4H9SE 4HWFA 3AEGA 1VRBA 4OYJA 3F57A 4OFZA 1WR0A 1KFYA 3LFMA 2PJQA 4TN7B 3ZMZB 2HHHT 2F4VT 4JI6T 3MACA 2V6YA 2I0MA 3K3NA 1I6ZA 2CLYB 1NWMX 4CI2B 4AKLA 2C5IT 3I1AA 4IDQA 4UEMA 4NIQA 5KX5E 2XSBA 5LBMA 4YXDA 3UU4A 3BQIA 3FHNA 5JDNA 3H3MA 4U2ZA 1YD8G 2E5LT 2ZM2A 2XQYA 3ZKRA 3MKDA 4PAGA 4PFOA 1FIOA 3AAEB 3UUMA 4J2CA 4ANJA 3VHLA 2YU2A 3RYFE 4CN1A 1FJGT 1KNPA 1J5ET 2RA1A 1G8XA 5HXCA 5HWXA 2VKOA 3IA3A 1T7SA 3HKEE 5LJNA 2H88A 3RHWA 2LSKA 2HN2A 5ADXL 4DO0A 2VKHA 3VRAA 4WZXA 2JJ9A 2L9QA 2W0GA 5JR9B 4QXBB 2Y8DA 1OEDB 4ZZCA 2NW8A 4U3CA 2DLRA 1UX4A 2WBLA 3GN5A 3CX8B 3PE0A 4TV9E 1ZKEA 4UIGA 2WMNA 1FMWA 2PFVA 3PUZF 4OK0A 4JI3T 4B3TT 1HTJF 2VURA 2BVLA 3Q9DA 2N1GA 1L0VA 5HWYA 2WDRA 3UQ7A 4G63A 2I6HA 3ZMUB 4JYAT 4IDZA 5L3GB 2LRLA 5L3CB 2UU9T 4DVDA 5KMGP 3VRBA 4NXNT 4PJMA 2B76A 2EHOA 4A98A 2X9YA 4HWCA 1VCSA 2XZEA 3IF8B 2DNXA 4Z90A 3HKDE 2HPJA 2UXBT 4HFHA 2X9WA 3LJCA 3ZT6A 4PJNA 3I9YA 4EZHA 1US7B 2CA5A 4JI1T 4YT0A 3AAIA 4ZI3C 3PUAA 3UU8A 4QWNB 5FXVA 3ONLC 2XAHB 3KV4A 2UXCT 3SRZA 5HAXA 4DUZT 4ISTA 4TNVA 4U72A 1T8BA 4PK6A 1MMGA 2B1EA 3N9QA 2Q9QD 3RQUA 2LOPA 5LMNT 3SS1A 2V7KA 3PURA 1IJ6A 2VK9A 3H3AA 1N36T 4X64T 3N9LA 3T8OA 4A5XA 5ABGA 4N78D 1S94A 2LSIA 1DU2A 1EZ3A 3EVYA 4JV5T 4LFCT 1X9BA 2XY8B 2YN6A 4MLKA 3UU5A 2A9UA 4X20E 3OTOT 3C51A 1UK5A 4TWFA 4PNIA 1LKXA 5HEGA 2DWGA 4UVBB 2VL0A 4QX7B 2KINB 2E9XD 3CX6B 3Q5WA 4OHFA 1NAFA 2DI4A 4LMJA 4ZOLE 2QVAA 2CPTA 3EABA 1MIVA 2GK9A 3FBZA 3M3ZB 3AEDA 4UVAB 4NXMT 2XTLA 2LKGA 4WYVA 4U7IA 3CIRA 1ZV4X 3HKBE 4X1KE 4JI8T 2WZHA 4AKHA 2V1DB 3B13A 3KV9A 1KNRA 3ZMTB 2BBJA 2HPLA 5H6RB 2VVNA 2BS4A 3JCFA 3MA9A 2LT3A 2PTFA 1ZOYA 3NBXX 5ABFB 4EZ4A 3ZJ1A 1HF8A 4H9OC 5F5WA 3UU6A 3ANWA 3D0TA 4CXXA 1M7KA 4AKIA 2XAFB 3WAKA 2LSGA 1SA0E 3FZHB 2V26A 3P4RA 4HFDA 3WAJA 5AQLB 1HCIA 3J7Yq 3RYCE 3JC6C 5ABHA 5CGMA 2X9HA 3KFWX 1CUNA 3UUBA 3PTRB 2D5UA 4YTPA 4YTNA 3VKGA 4DNDA 2C5KT 3C98B 2NWBA 4H9NC 1WFDA 2FJBA 2MOZA 1KEYA 1XDOA 4YJ3E 2NW9A 1FEWA 3CWZB 3VR9A 4CQIA 3MJXA 3RX6A 3TLVA 3MXZA 3ETUA 5JDFA 3HKCE 2UXNB 3AE2A 2BDEA 4LF8T 1UCUA 5J2TE 2JQQA 2KWIB 3ZSTA 5HEHA 1WLXA 3HA4A 5FY0A 4DR3T 4DR6T 3V5UA 2V8SV 3CVRA 4HFEA 3AE7A 3FB2A 4IE4A 4EAHA 4QH4A 3IBPA 4QH5A 3ONJA 1D0XA 3ZT5A 3ESLA 2CLYC 5JRCA 1NENA 1G73A 3QOFA 2H89A 2K24A 2XAGB 5CB4E 4X62T 4ZI7E 4LFBT 2BKPA 2LE8A 4Z8XA 3AE8A 1BR4A 3B57A 5C2TA 2V6YB 3UU3A 2J47A 4AQFA 2QRXA 4FI5A 1XDPA 3LG7A 5IHYA 5IYZE 2Y6XA 4BJNA 4JI7T 2CRBA 2EHOC 2ODVA 3AE1A 2YKSA 2W4XA 3SWHA 2D0TA 1R8IA 1IJ5A 2NW7A 5IWAT 4A56A 3AEFA 5JREA 3NVOA 3VR8A 5JR9C 4OYKA 1HFAA 4K0KT 3A5XA 4WBOA 2KT9A 5AQUB 3AE4A 5AQQB 3CMLA 3E0ZA 1XMOT 4DR5T 4EV6A 4DR1T 2W66A 2Q9QA 1BR2A 5JH7E 3TLWA 4ASKA 2JQ9A 2VL8A 2BS3A 2WWVA 2XQ4A 3GN5B 3UUXB 4O4HE 3AVSA 3LK3B 4AKGA 2IDOB 3ZEFB 3C64A 3NWIA 2CXFA 5FXXA 2ZLYA 2QYWA 4XZCA 2HN1A 5HEOA 4ZI2C 1Z0PA 3AE3A 4IGUA 1KF6A 5FY1A 4CN6A 2W61A 2IHR1 3AEAA 4B3MT 3NRXA 4I0UA 2PBIA 2WSSV 5BMVE 1ZHCA 3CKDA 1SUMB 3AAAB 3Q5XA 5AQPB 4EOZB 3RYIE 1VOMA 3UT5E 2WP9A 1W0AA 4EEBA 2X51A 4H9PC 3J9X1 3U78A 3NRYA 3FZKB 3RGLA 2EHOB 1XNQT 1MMNA 3TKLB 4KMCA 2H3RA 3ZC1A 2XAQB 1LRZA 4IDPA 2CXLA 2FBWA 4ZI3D 4O2BE 2BZBA 2IAKA 5LGUB 4AKRB 3L3PA 1D0YA 3W15B 2A72A 4EIWA 3AXJA 3SFEA 2XQ3A 4DMWA 3C4XA 4HFIA 3G06A 5F3JA 4QHOA 5HXRA 1IBLT 2LSJA 3HI2A 2W62A 2X66A 4BAYB 3L39A 2X0LB 1WYCA 4O4IE 3CX7B 5LHHB 4QXHB 4YHHT 4WW0A 5L2LA 2M67A 3ZYLA 4KBMB 2V6XA 2VB6A 4HTEA 5AQOB 4YSXA 4DV5T 4ERRA 4KHPT 3I0QA 3ZLIA 2NTYA 4TV8E 5AQSB 2JIWA 5AFUL 4L5GA 2XSAA 3RIUA 3N9PA 1HR0T 3A8YC 4YHJA 2WWUA 3BQLA 3QUJA 4JEUB 2XM1A 2VVSA 3V5SA 4HFVA 4X5TA 4IE0A 1HS7A 1WYBA 2IUBA 2BS2A 1IZNB 4HN9A 4GKJT 3UQ4A 3ZYMA 4JI5T 2VQET 4DMVA 2YEVC 4GKKT 2MYSA 2WM9A 5LMUT 3FZMB 4TUYE 3QB5K 2P9BA 3F31A 4FJOA 1GQEA 4GYSA 2KNDA 2W63A 5ABEA 1W09A 3DP7A 3UTKA 1XWMA 3C4ZA 3PUVF 1SHZC 4KX6A 2Z6EA 1MIWA 2ZMAA 4AQGA 4DV0T 3QC9A 5FVKA 1OEDE 1YW0A 2WZIA 5CA0E 2LM9A 1KK7A 4HFBA 3DJBA 2WMOA 1N33T 5GONE 4ILBA 3X1DA 4E7SA 5CA1E 2L3LA 3QB5A 3ANWB 3EDVA 4ZS3A 3OPCA 3PUGA 3PV0F 2A3DA 5J2UE 4O8SA 3R6NA 3R84B 5LYJE 2CEAA 3ONXA 5DABA 1QUUA 3OBVE 3JC6D 5FXWA 1E1HB 5JTGA 1UX5A 3CQCB 3U3IA 4P09A 3ZN0B 4YFSA 3PU8A 1QSDA 2CCQA 2MAWA 4U2YA 4B6XA 3RRWA 1YQ3A 2LHNA 2W67A 2NP9A 3LBXB 3OJAA 2PG8A 4F8HA 3T1HT 2CXDA 2V7IA 2CWOA 1OXZA 5AQKB 2YDSA 1YQ4A 3EDUA 2WQYA 2LSYA 3AE9A 5FXZA 3MZKB 2D9DA 4X1IE 2YU1A 3PU3A 4EYUA 3PJAA 2LRKA 5FNVE 4KP3C 2WU5A 3F2EA 4P1NA 1HX1B 2DL1A 2KWHA 5TAOA 3LK2B 2D0UA 2JMHA 2CM0A 4LFAT 2Q9QC 5DQVA 3JADA 5BR8T 3C4WA 4QH1A 4YLHA 2WDQA 4JI0T 1Z8UA 4MHCA 3CK6A 2N9DA 5L3FB 3BK9A 2QA7A 1NEKA 5HXHA 2NTXA 3OKQA 4V1Av 3NZPA 2HH7A 4HWDA 1HG5A 3RI5A 2V7LA 1LVFA 3LBXA 1YXRA 5JRCB 4I55E 5LG4A 2VWAA 4DR4T 4MFRA 1V9DA 3H37A 4PW8A 1SE7A 1M62A 1HG2A 5L3BB 2XM2A 1D1CA 2DHRA 2FUPA 5CJ5A 2J62A 4DR2T 5L4EA 4IDOA 2EHOD 2V7JA 4EB6E 5AQMB 4UXNB 5EZYE 3HR0A 2M6BA 4TZ4C 3ZMSB 4CN4A 3TLUA 4UV8B 3N5LA 5C8YE 2BVMA 5HYAA 2YOEA 3FXEB 3JAEA 3GA8A 5LA6E 3SFDA 2J4GA 2C5JA 3PUQA 2RPAA 2V5DA 3PUYF 4PK4A 5AQNB 2IC9A 4HGAA 5AQHB 4HFCA 2Q9QB 4HEAA 4L9IA 4L0RA 1HNWT 2H7OA 2CHNA 2QGSA 3RC8A 2OA5A 1UUSA 2OLTA 4C90A 3RC3A 1MIYA 4U33A 2ZM8A 5C3JA 2M6IA 5LXTE 1N32T 3RLFF 5DQWA 4ZI2D 2BG9A 3RQWA 4IDNA 3FZLB 2UXDT 3P4PA 3P50A 2X0YA 4AXPA 2BKNA 5AQJB 3TLSA 3RIUC 2LEHA 4WNKA 3M65A 5AQTB 5LNKA 3T1YT 3K3QC 4LF9T 1AJ3A 2E9XB 5EK2A 2IIUA 2ACXA 2VQFT 3PJAJ 2KLQA 2JQHA 2AE9A 4QKNA 1IAPA 2UUCT 2XAJB 2ACZA 4ZZBA 3KVBA 5AQVB 4EYYR 5LHIB 5HEJA 4GOUA 5HXSA 5E0OA 4LF6T 2IMLA 3QNUA 3ZJ2A 3FZFB 4Z91A 4H63H 1J1JA 3RIFA 4EEDA 2XQ5A 1LVKA 2E5VA 4PJLA 3AXJB 3GWHA 1IBMT 1WR6A 4EXTA 4NUUA 3PDYA 4ISSA 2JQKA 3ZT7A 3ETVA 2E8IA 2ZM6T 2LKHA 4JUYA 2V7MA 3FXDB 5HCMA 4BJMA 1W9RA 3OYXA 4X1YE 4DR7T 3L8RA 4A97A 3CQXC 3I0OA 2E9XA 2JMKA 3RH3A 2CMRA 1UGOA 3Q5EA 3GMIA 5LJMA 4AISA 2A2FX 2XUEA 4XBFB 2WU2A 4IE6A 5HEUA 4ZHQE 1U4QA 3EAMA 2WAUA 4U31A 5FY7A 2MBGA 2UXXB 4CI3B 2C0SA 4WBNE 2N2NA 4K0UA 4B3ST 2XJ7A 3DTOA 5J0ZA 5L4HA 5KDMC 3NZQA 4IE7A 3FBLA 4AQYT 4I50E 1D1BA 1YKEB 4GYRA 4DIDB 3KBUA 4KUMB 1J5WA 3AA7B 4G2AA 3ZCIA 4JEHB 4HWIB 4HKAA 1BR1A 3PUXF 1UURA 4PFPA 1XMQT 2J1DG 3UFGA 2WDVA 5F8PA 2X68A 3ZYKA 3KV5A 4M1PA 4JI4T 4ILUA 4DBRA 3AA1B 4UELA 5EK3A 1S35A 3UULA 1JNZA 4UF0B 3AA6B 5AQRB 5FL0A 4Q25A 5ETWA 2V5CA 3N9MA 4QXCB 4NPPA 4TWHA 5A1LA 2VKJA 2K3WA 2UUAT 1H7CA 3P4WA 5M4YA 5JDMA 4KI0F 1O3XA 2BKOA 2I59A 3AEEA 3ABVA 4ZEYA 3L09A 1FMVA 2CWYA 2AXDS 2ODUA 2D2SA 2CBJA 1I94T 3CQGB 3KDSE 5AQIB 5JR9A 2XQ9A 4ILAA 1OEDA 3S4UA 4I43B 4AIUA 2XQ7A 1ZP0A 2KXPB 4LF7T 4I4TE 3P4SA 4HE8A 2L8KA 5L3DB 1KNZA 4IE5A 4H63V 5J1GA 5CFBA 1BR0A 2ES0A 1MMAA 4KHZF 1B7TA 2X9XA 3KV6A 1ZEEA 3KINB 2K48A 4DV6T 2FJAA 1D0ZA 4DV1T 2OV9A 4UR9A 2MPKA 3RIAA 3N2OA 4UF0A 4X65T 2LHRA 3P4QA 4IL9A 3K8PC 3Q2MA 4H9QC 4TNWA 1T98A 2NOXA 5EK4A 5JDGA 2LLYA 5LOVE 3ZC0A 2LM2A 5JVDE 4HWHA 3O1IA 3OYZA 4OX9T 5HXEA 2BG9C 4DV2T 4IIJE 4TWDA 5DJQC 4LMKA 4EGWA 4AQFC 4H9RC 4UV9B 2KSRA 3N2KE 2K9AA 2X67A 4DBQA 1MNDA 2VASA 4LMLA 4GK0E 3EHZA 2G0UA 5AQGB 2XQAA 4YSZA 3JAFA 3KVAA 5JDQA 1YKHB 4BA9A 5LCYA 4P0BA 2LOSA 2FJDA 1Y64B 1D1AA 4ZS2A 3P8CD 3IEEA 3K3OA 5JDLA 4YTMA 4QX8B 5FVLA 2WS3A 4UVCB 5FL1A 1VCTA 3VU7H 4DUYT 4DV7T 3O1HA 2JPFA 3WI3A 5IUXA 4YY3T 4LF5T 4JBWF 4CZZB 3A7MA 5LGNB 3LDQB 2CE7A 4CI1B 5FYMA 3AEBA 4IL4A 3RPUA 4IT4A 3UFEA 2YK0A 4E7ZA 5KXJA 2YINA 2LJLA 4XAXB 3EI0A 4JI2T 2Y48B 2XPKA 4CXWA 1HX8A 3N2GE 3N9OA 5LP6E 2YDRA 3MK7C 1IBKT 3EUHA 2VKDA 3RF1A 4NUVA 1U5PA 1W0BA 4JLEA 3I9WA 1JNRA 3UUNA 3BQKA 3LK42 4IHJE 2E9XC 2BG9B 2NR4A 3KBTA 5AQFB 2UUBT 1WCRA 3LSVA 2KMFA 2DWKA 1OWAA 5FP3A 3AVRA 4COFA 3E08A 4P0AA 3AE5A 5LG3A 3Q5DA 5LBQB 4PK5A 2CHOA 4LF4T 1MMDA 4YJ2E 4ADZA 4CXYA 3SOLA 3ZPOA 5LB7B 1Y01A 4GIWA 4DV3T 3ZMVB 1N34T 4YSYA 3O9XA 3AECA 1MNEA 3ZCJA 4MBQA 3AE6A 4O4JE 3K1SA 5L3EB
chains in the Genus database with same CATH topology
1MIVA 2KZ7B 3E22E 3PDYA 2WWUA 2GK9A 3BQLA 4ISSA 3VKHA 3FBZA 3QK6A 3QUJA 4UVAB 4JEUB 4F6RC 3ETVA 2E8IA 4JUYA 2XTLA 3V5SA 2V7MA 4O4LE 4HFVA 3FXDB 2K5BB 1ZV4X 4BJMA 4IE0A 2IC6A 2DCFA 3HL6A 3HKBE 1HS7A 1WYBA 3OYXA 4X1YE 4X1KE 1IZNB 5JQGE 4HN9A 2JRKA 4AKHA 2V1DB 3B13A 3KV9A 3ZYMA 3CQXC 3IHRA 3ZMTB 3I0OA 2E9XA 2JMKA 3RH3A 2HPLA 4DMVA 5H6RB 2CMRA 5JDHA 2YEVC 2MYSA 2WM9A 3GMIA 3N9NA 3MA9A 4TUYE 5LJMA 2P9BA 3F31A 2A2FX 2LT3A 2XUEA 5H6QB 4FJOA 4XBFB 4IE6A 4TX5A 4GYSA 2KNDA 2W63A 4ZHQE 3P7IA 1U4QA 3NBXX 3DP7A 3O4XE 3UTKA 5LGTB 2WAUA 3C4ZA 3O1JA 4EZ4A 5FY7A 2MBGA 2UXXB 1HF8A 4MALA 3ZJ1A 4H9OC 4CI3B 2C0SA 4WBNE 1SHZC 2N2NA 4K0UA 3ANWA 2Z6EA 1MIWA 2ZMAA 3D0TA 4AQGA 3QC9A 4CXXA 3DTOA 4AKIA 5KDMC 3NZQA 1YW0A 2XAFB 4IE7A 3WAKA 3FBLA 2LSGA 2IW5B 1SA0E 4I50E 1D1BA 2V26A 1YKEB 4GYRA 2XHEB 2ZM0A 5CA0E 2LM9A 3CPZA 1WRDA 3AB3B 3WAJA 1KK7A 1HCIA 4U74A 3KBUA 4KUMB 3J7Yq 5FMNA 3RYHE 3RYCE 3DJBA 3JC6C 2X9HA 2MTQA 3AA7B 4G2AA 2WMOA 3ZN1B 3ZCIA 2W00A 5GONE 4JEHB 4E7SA 5CA1E 3RKOA 3KFWX 2L3LA 1X79A 5LHGB 4HKAA 1CUNA 3PTRB 1BR1A 3PUSA 2D5UA 3ANWB 3EDVA 3VKGA 4DNDA 4ZS3A 3PUGA 4PFPA 5J2UE 2A3DA 4C91A 2C5KT 4O8SA 2XASB 4O2AE 3R6NA 3C98B 2NWBA 4H9NC 3R84B 5LYJE 2CEAA 2J1DG 3AA0B 3ONXA 1QUUA 3OBVE 5DABA 3JC6D 5FXWA 2MOZA 1E1HB 1UX5A 3CQCB 4YJ3E 4PJJA 2NW9A 5F8PA 3U3IA 1FEWA 4P09A 3ZN0B 3CWZB 2X68A 4YFSA 3ZYKA 3PU8A 3RRCA 3KV5A 4GK5E 1QSDA 2CCQA 4CQIA 4B6XA 2SPCA 3C50A 4M1PA 3MJXA 3RRWA 2LHNA 3RX6A 2NP9A 3LBXB 3OJAA 4AI6A 2PG8A 3MXZA 4ILUA 3ETUA 5JDFA 2H7VC 4DBRA 3AA1B 2CXDA 3HKCE 2UXNB 2RP4A 2V7IA 4UELA 2CWOA 1OXZA 5EK3A 1S35A 2BDEA 3UULA 4H9SE 1UCUA 5J2TE 2JQQA 2KWIB 3EDUA 4UF0B 3AA6B 1VRBA 1WLXA 4OYJA 3HA4A 5ETWA 3N9MA 5FY0A 2LSYA 4QXCB 3F57A 5A1LA 4OFZA 2VKJA 5FXZA 3V5UA 3MZKB 3LFMA 1H7CA 2PJQA 4X1IE 5M4YA 2YU1A 3PU3A 4EYUA 5JDMA 4TN7B 3ZMZB 3CVRA 5FNVE 1O3XA 3MACA 2I59A 4KP3C 3FB2A 3L09A 1FMVA 3F2EA 3K3NA 2CWYA 2CLYB 1NWMX 2ODUA 4CI2B 4IE4A 4AKLA 4EAHA 2D2SA 2KWHA 2C5IT 3I1AA 5TAOA 3IBPA 4UEMA 3CQGB 3LK2B 5KX5E 5LBMA 2D0UA 1D0XA 2JMHA 2CM0A 3KDSE 3BQIA 3ESLA 3FHNA 2CLYC 5JR9A 2Q9QC 5DQVA 5JDNA 1G73A 3C4WA 1YD8G 4YLHA 5JRCA 2ZM2A 2XQYA 2K24A 4MHCA 3MKDA 2XAGB 2N9DA 4PAGA 4PFOA 5CB4E 3S4UA 5L3FB 3BK9A 1FIOA 2QA7A 3AAEB 5HXHA 4I43B 3UUMA 4J2CA 4ZI7E 2NTXA 3OKQA 4ANJA 2LE8A 4Z8XA 3VHLA 2YU2A 3RYFE 2RA1A 1G8XA 1BR4A 2KXPB 3B57A 4V1Av 5HXCA 3NZPA 5HWXA 2VKOA 4I4TE 4HE8A 3HKEE 5LJNA 2HH7A 2L8KA 1HG5A 4AQFA 5L3DB 1KNZA 4IE5A 4H63V 5J1GA 1BR0A 2LSKA 5ADXL 2V7LA 1LVFA 4FI5A 2ES0A 4DO0A 3LBXA 1MMAA 3LG7A 5IHYA 2VKHA 1B7TA 2X9XA 3KV6A 2JJ9A 5IYZE 2Y6XA 2L9QA 4BJNA 2W0GA 1ZEEA 2EHOC 2ODVA 5JR9B 5JRCB 3KINB 2Y8DA 4I55E 4QXBB 2VWAA 2K48A 2D0TA 3SWHA 5LG4A 1IJ5A 1D0ZA 2NW7A 2NW8A 4MFRA 4A56A 3N2OA 5JREA 1V9DA 4UF0A 2LHRA 2DLRA 3H37A 5JR9C 1UX4A 4PW8A 2WBLA 3GN5A 3CX8B 3K8PC 3PE0A 1ZKEA 3Q2MA 4H9QC 4TV9E 4UIGA 2WMNA 1HG2A 1FMWA 1T98A 2PFVA 4OYKA 5L3BB 1D1CA 2DHRA 1HFAA 3A5XA 2NOXA 4WBOA 4OK0A 5EK4A 5JDGA 5LOVE 2KT9A 3ZC0A 3CMLA 3E0ZA 5JVDE 2EHOD 2V7JA 4EB6E 3O1IA 3OYZA 1HTJF 5HXEA 4UXNB 4IIJE 5EZYE 3HR0A 2BVLA 2Q9QA 4TZ4C 3ZMSB 5DJQC 1BR2A 3Q9DA 4UV8B 3N5LA 5JH7E 2N1GA 5C8YE 4AQFC 4ASKA 4H9RC 4UV9B 2VL8A 5HWYA 2BVMA 3N2KE 5HYAA 2K9AA 2X67A 3FXEB 4G63A 4DBQA 1MNDA 2VASA 4GK0E 3GA8A 2G0UA 3ZMUB 3GN5B 4IDZA 5LA6E 3UUXB 3KVAA 4O4HE 5JDQA 1YKHB 5L3GB 3AVSA 4BA9A 3LK3B 5LCYA 4AKGA 5L3CB 4P0BA 2LOSA 3ZEFB 2C5JA 3PUQA 1Y64B 1D1AA 3C64A 4ZS2A 3P8CD 4DVDA 2CXFA 4PK4A 5FXXA 5KMGP 2IC9A 3IEEA 3K3OA 5JDLA 2ZLYA 4QX8B 4XZCA 4PJMA 4UVCB 4HGAA 2EHOA 4ZI2C 1Z0PA 2Q9QB 4HEAA 4L9IA 3VU7H 4L0RA 4IGUA 2X9YA 2H7OA 3IF8B 5FY1A 2W61A 2DNXA 3HKDE 3O1HA 2JPFA 3WI3A 2HPJA 3NRXA 2PBIA 4CZZB 2QGSA 3RC8A 2OA5A 5LGNB 2WSSV 2CE7A 4C90A 2X9WA 4CI1B 5FYMA 5BMVE 1ZHCA 3RC3A 1MIYA 3CKDA 3LJCA 2ZM8A 3RPUA 4PJNA 3I9YA 4EZHA 3AAAB 1US7B 2CA5A 3UFEA 2YK0A 5LXTE 3Q5XA 4EOZB 3AAIA 5DQWA 4ZI3C 3RYIE 1VOMA 3PUAA 4QWNB 3UT5E 4ZI2D 5FXVA 4E7ZA 2XAHB 2X51A 4H9PC 3KV4A 2YINA 2LJLA 3J9X1 3SRZA 3U78A 4XAXB 3NRYA 5HAXA 4ISTA 4AXPA 2EHOB 4U72A 2Y48B 1MMNA 4PK6A 1HX8A 4CXWA 1MMGA 3N2GE 3TKLB 3N9OA 2B1EA 3N9QA 2Q9QD 5LP6E 2LOPA 4KMCA 2LEHA 4WNKA 2H3RA 3M65A 5LNKA 3MK7C 3ZC1A 3SS1A 3EUHA 2XAQB 3K3QC 1LRZA 2V7KA 3PURA 2VKDA 1AJ3A 2CXLA 4NUVA 1IJ6A 2E9XB 2VK9A 3H3AA 4ZI3D 5EK2A 4O2BE 1U5PA 4JLEA 2BZBA 2IAKA 2ACXA 3I9WA 3UUNA 5LGUB 3N9LA 2KLQA 4AKRB 3L3PA 3BQKA 3T8OA 1D0YA 3LK42 4QKNA 3W15B 1IAPA 2A72A 4IHJE 2E9XC 4N78D 4EIWA 2XAJB 3KBTA 4DMWA 3C4XA 1S94A 2LSIA 3KVBA 2KMFA 1EZ3A 2DWKA 1OWAA 3EVYA 5FP3A 4EYYR 5F3JA 4QHOA 5LHIB 5HXRA 2LSJA 3HI2A 2W62A 4GOUA 5HXSA 2X66A 3AVRA 3E08A 5E0OA 4BAYB 4P0AA 4MLKA 2X0LB 4X20E 1WYCA 5LBQB 3C51A 4PK5A 4O4IE 3CX7B 5LHHB 4QXHB 1MMDA 4YJ2E 4WW0A 4ADZA 4PNIA 1LKXA 3ZJ2A 2DWGA 3SOLA 3ZPOA 4UVBB 4CXYA 5L2LA 4QX7B 2M67A 2KINB 3ZYLA 4KBMB 2E9XD 3CX6B 4H63H 2VB6A 3Q5WA 4GIWA 4OHFA 4HTEA 3ZMVB 1LVKA 1NAFA 2DI4A 4PJLA 4ERRA 3O9XA 3I0QA 3ZLIA 2NTYA 3GWHA 1MNEA 4TV8E 4ZOLE 4MBQA 3ZCJA 5AFUL 1WR6A 4L5GA 4O4JE 3N9PA 4EXTA 5L3EB 4YHJA 4NUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JRE A;  5JR9 A;  5JRC A;  5JR9 B;  5JRC B;  3ZC0 A;  5JR9 C;  3ZC1 A; 
#chains in the Genus database with same CATH topology
 2KZ7 B;  3E22 E;  3VKH A;  3QK6 A;  4F6R C;  5HCJ A;  5ABF A;  5L47 A;  4O4L E;  2K5B B;  2IC6 A;  2WB5 A;  2DCF A;  3HL6 A;  5JQG E;  1HNZ T;  2JRK A;  4DV4 T;  3IHR A;  2XQ6 A;  1T72 A;  1HNX T;  5JDH A;  3N9N A;  2FJE A;  5H6Q B;  4TX5 A;  3P7I A;  3O4X E;  5LGT B;  2W2U A;  3O1J A;  4X66 T;  4U7Y A;  4MAL A;  4IRE A;  2CBI A;  2R6G F;  1QLB A;  3OVU A;  2IW5 B;  2YDQ A;  2BBH A;  2WY2 A;  2XHE B;  4ZXL A;  3ZSS A;  2BG9 E;  2ZM0 A;  1XZY A;  1WRD A;  3AB3 B;  3CPZ A;  4U74 A;  5FMN A;  3RYH E;  1XNR T;  2MTQ A;  4B3R T;  3RKG A;  1E7P A;  2XQ8 A;  3ZN1 B;  3NKZ A;  2W00 A;  3RKO A;  1X79 A;  5LHG B;  3PUS A;  2E2A A;  3PUW F;  4C91 A;  1E2A A;  2XAS B;  4O2A E;  1CHU A;  3AA0 B;  4PJJ A;  1OED C;  3RRC A;  4GK5 E;  2SPC A;  3C50 A;  4ILC A;  4AI6 A;  2H7V C;  2WCA A;  3B5M A;  2RP4 A;  5FKY A;  3TLT A;  2X0H A;  4H9S E;  4HWF A;  3AEG A;  1VRB A;  4OYJ A;  3F57 A;  4OFZ A;  1WR0 A;  1KFY A;  3LFM A;  2PJQ A;  4TN7 B;  3ZMZ B;  2HHH T;  2F4V T;  4JI6 T;  3MAC A;  2V6Y A;  2I0M A;  3K3N A;  1I6Z A;  2CLY B;  1NWM X;  4CI2 B;  4AKL A;  2C5I T;  3I1A A;  4IDQ A;  4UEM A;  4NIQ A;  5KX5 E;  2XSB A;  5LBM A;  4YXD A;  3UU4 A;  3BQI A;  3FHN A;  5JDN A;  3H3M A;  4U2Z A;  1YD8 G;  2E5L T;  2ZM2 A;  2XQY A;  3ZKR A;  3MKD A;  4PAG A;  4PFO A;  1FIO A;  3AAE B;  3UUM A;  4J2C A;  4ANJ A;  3VHL A;  2YU2 A;  3RYF E;  4CN1 A;  1FJG T;  1KNP A;  1J5E T;  2RA1 A;  1G8X A;  5HXC A;  5HWX A;  2VKO A;  3IA3 A;  1T7S A;  3HKE E;  5LJN A;  2H88 A;  3RHW A;  2LSK A;  2HN2 A;  5ADX L;  4DO0 A;  2VKH A;  3VRA A;  4WZX A;  2JJ9 A;  2L9Q A;  2W0G A;  5JR9 B;  4QXB B;  2Y8D A;  1OED B;  4ZZC A;  2NW8 A;  4U3C A;  2DLR A;  1UX4 A;  2WBL A;  3GN5 A;  3CX8 B;  3PE0 A;  4TV9 E;  1ZKE A;  4UIG A;  2WMN A;  1FMW A;  2PFV A;  3PUZ F;  4OK0 A;  4JI3 T;  4B3T T;  1HTJ F;  2VUR A;  2BVL A;  3Q9D A;  2N1G A;  1L0V A;  5HWY A;  2WDR A;  3UQ7 A;  4G63 A;  2I6H A;  3ZMU B;  4JYA T;  4IDZ A;  5L3G B;  2LRL A;  5L3C B;  2UU9 T;  4DVD A;  5KMG P;  3VRB A;  4NXN T;  4PJM A;  2B76 A;  2EHO A;  4A98 A;  2X9Y A;  4HWC A;  1VCS A;  2XZE A;  3IF8 B;  2DNX A;  4Z90 A;  3HKD E;  2HPJ A;  2UXB T;  4HFH A;  2X9W A;  3LJC A;  3ZT6 A;  4PJN A;  3I9Y A;  4EZH A;  1US7 B;  2CA5 A;  4JI1 T;  4YT0 A;  3AAI A;  4ZI3 C;  3PUA A;  3UU8 A;  4QWN B;  5FXV A;  3ONL C;  2XAH B;  3KV4 A;  2UXC T;  3SRZ A;  5HAX A;  4DUZ T;  4IST A;  4TNV A;  4U72 A;  1T8B A;  4PK6 A;  1MMG A;  2B1E A;  3N9Q A;  2Q9Q D;  3RQU A;  2LOP A;  5LMN T;  3SS1 A;  2V7K A;  3PUR A;  1IJ6 A;  2VK9 A;  3H3A A;  1N36 T;  4X64 T;  3N9L A;  3T8O A;  4A5X A;  5ABG A;  4N78 D;  1S94 A;  2LSI A;  1DU2 A;  1EZ3 A;  3EVY A;  4JV5 T;  4LFC T;  1X9B A;  2XY8 B;  2YN6 A;  4MLK A;  3UU5 A;  2A9U A;  4X20 E;  3OTO T;  3C51 A;  1UK5 A;  4TWF A;  4PNI A;  1LKX A;  5HEG A;  2DWG A;  4UVB B;  2VL0 A;  4QX7 B;  2KIN B;  2E9X D;  3CX6 B;  3Q5W A;  4OHF A;  1NAF A;  2DI4 A;  4LMJ A;  4ZOL E;  2QVA A;  2CPT A;  3EAB A;  1MIV A;  2GK9 A;  3FBZ A;  3M3Z B;  3AED A;  4UVA B;  4NXM T;  2XTL A;  2LKG A;  4WYV A;  4U7I A;  3CIR A;  1ZV4 X;  3HKB E;  4X1K E;  4JI8 T;  2WZH A;  4AKH A;  2V1D B;  3B13 A;  3KV9 A;  1KNR A;  3ZMT B;  2BBJ A;  2HPL A;  5H6R B;  2VVN A;  2BS4 A;  3JCF A;  3MA9 A;  2LT3 A;  2PTF A;  1ZOY A;  3NBX X;  5ABF B;  4EZ4 A;  3ZJ1 A;  1HF8 A;  4H9O C;  5F5W A;  3UU6 A;  3ANW A;  3D0T A;  4CXX A;  1M7K A;  4AKI A;  2XAF B;  3WAK A;  2LSG A;  1SA0 E;  3FZH B;  2V26 A;  3P4R A;  4HFD A;  3WAJ A;  5AQL B;  1HCI A;  3J7Y q;  3RYC E;  3JC6 C;  5ABH A;  5CGM A;  2X9H A;  3KFW X;  1CUN A;  3UUB A;  3PTR B;  2D5U A;  4YTP A;  4YTN A;  3VKG A;  4DND A;  2C5K T;  3C98 B;  2NWB A;  4H9N C;  1WFD A;  2FJB A;  2MOZ A;  1KEY A;  1XDO A;  4YJ3 E;  2NW9 A;  1FEW A;  3CWZ B;  3VR9 A;  4CQI A;  3MJX A;  3RX6 A;  3TLV A;  3MXZ A;  3ETU A;  5JDF A;  3HKC E;  2UXN B;  3AE2 A;  2BDE A;  4LF8 T;  1UCU A;  5J2T E;  2JQQ A;  2KWI B;  3ZST A;  5HEH A;  1WLX A;  3HA4 A;  5FY0 A;  4DR3 T;  4DR6 T;  3V5U A;  2V8S V;  3CVR A;  4HFE A;  3AE7 A;  3FB2 A;  4IE4 A;  4EAH A;  4QH4 A;  3IBP A;  4QH5 A;  3ONJ A;  1D0X A;  3ZT5 A;  3ESL A;  2CLY C;  5JRC A;  1NEN A;  1G73 A;  3QOF A;  2H89 A;  2K24 A;  2XAG B;  5CB4 E;  4X62 T;  4ZI7 E;  4LFB T;  2BKP A;  2LE8 A;  4Z8X A;  3AE8 A;  1BR4 A;  3B57 A;  5C2T A;  2V6Y B;  3UU3 A;  2J47 A;  4AQF A;  2QRX A;  4FI5 A;  1XDP A;  3LG7 A;  5IHY A;  5IYZ E;  2Y6X A;  4BJN A;  4JI7 T;  2CRB A;  2EHO C;  2ODV A;  3AE1 A;  2YKS A;  2W4X A;  3SWH A;  2D0T A;  1R8I A;  1IJ5 A;  2NW7 A;  5IWA T;  4A56 A;  3AEF A;  5JRE A;  3NVO A;  3VR8 A;  5JR9 C;  4OYK A;  1HFA A;  4K0K T;  3A5X A;  4WBO A;  2KT9 A;  5AQU B;  3AE4 A;  5AQQ B;  3CML A;  3E0Z A;  1XMO T;  4DR5 T;  4EV6 A;  4DR1 T;  2W66 A;  2Q9Q A;  1BR2 A;  5JH7 E;  3TLW A;  4ASK A;  2JQ9 A;  2VL8 A;  2BS3 A;  2WWV A;  2XQ4 A;  3GN5 B;  3UUX B;  4O4H E;  3AVS A;  3LK3 B;  4AKG A;  2IDO B;  3ZEF B;  3C64 A;  3NWI A;  2CXF A;  5FXX A;  2ZLY A;  2QYW A;  4XZC A;  2HN1 A;  5HEO A;  4ZI2 C;  1Z0P A;  3AE3 A;  4IGU A;  1KF6 A;  5FY1 A;  4CN6 A;  2W61 A;  2IHR 1;  3AEA A;  4B3M T;  3NRX A;  4I0U A;  2PBI A;  2WSS V;  5BMV E;  1ZHC A;  3CKD A;  1SUM B;  3AAA B;  3Q5X A;  5AQP B;  4EOZ B;  3RYI E;  1VOM A;  3UT5 E;  2WP9 A;  1W0A A;  4EEB A;  2X51 A;  4H9P C;  3J9X 1;  3U78 A;  3NRY A;  3FZK B;  3RGL A;  2EHO B;  1XNQ T;  1MMN A;  3TKL B;  4KMC A;  2H3R A;  3ZC1 A;  2XAQ B;  1LRZ A;  4IDP A;  2CXL A;  2FBW A;  4ZI3 D;  4O2B E;  2BZB A;  2IAK A;  5LGU B;  4AKR B;  3L3P A;  1D0Y A;  3W15 B;  2A72 A;  4EIW A;  3AXJ A;  3SFE A;  2XQ3 A;  4DMW A;  3C4X A;  4HFI A;  3G06 A;  5F3J A;  4QHO A;  5HXR A;  1IBL T;  2LSJ A;  3HI2 A;  2W62 A;  2X66 A;  4BAY B;  3L39 A;  2X0L B;  1WYC A;  4O4I E;  3CX7 B;  5LHH B;  4QXH B;  4YHH T;  4WW0 A;  5L2L A;  2M67 A;  3ZYL A;  4KBM B;  2V6X A;  2VB6 A;  4HTE A;  5AQO B;  4YSX A;  4DV5 T;  4ERR A;  4KHP T;  3I0Q A;  3ZLI A;  2NTY A;  4TV8 E;  5AQS B;  2JIW A;  5AFU L;  4L5G A;  2XSA A;  3RIU A;  3N9P A;  1HR0 T;  3A8Y C;  4YHJ A;  2WWU A;  3BQL A;  3QUJ A;  4JEU B;  2XM1 A;  2VVS A;  3V5S A;  4HFV A;  4X5T A;  4IE0 A;  1HS7 A;  1WYB A;  2IUB A;  2BS2 A;  1IZN B;  4HN9 A;  4GKJ T;  3UQ4 A;  3ZYM A;  4JI5 T;  2VQE T;  4DMV A;  2YEV C;  4GKK T;  2MYS A;  2WM9 A;  5LMU T;  3FZM B;  4TUY E;  3QB5 K;  2P9B A;  3F31 A;  4FJO A;  1GQE A;  4GYS A;  2KND A;  2W63 A;  5ABE A;  1W09 A;  3DP7 A;  3UTK A;  1XWM A;  3C4Z A;  3PUV F;  1SHZ C;  4KX6 A;  2Z6E A;  1MIW A;  2ZMA A;  4AQG A;  4DV0 T;  3QC9 A;  5FVK A;  1OED E;  1YW0 A;  2WZI A;  5CA0 E;  2LM9 A;  1KK7 A;  4HFB A;  3DJB A;  2WMO A;  1N33 T;  5GON E;  4ILB A;  3X1D A;  4E7S A;  5CA1 E;  2L3L A;  3QB5 A;  3ANW B;  3EDV A;  4ZS3 A;  3OPC A;  3PUG A;  3PV0 F;  2A3D A;  5J2U E;  4O8S A;  3R6N A;  3R84 B;  5LYJ E;  2CEA A;  3ONX A;  5DAB A;  1QUU A;  3OBV E;  3JC6 D;  5FXW A;  1E1H B;  5JTG A;  1UX5 A;  3CQC B;  3U3I A;  4P09 A;  3ZN0 B;  4YFS A;  3PU8 A;  1QSD A;  2CCQ A;  2MAW A;  4U2Y A;  4B6X A;  3RRW A;  1YQ3 A;  2LHN A;  2W67 A;  2NP9 A;  3LBX B;  3OJA A;  2PG8 A;  4F8H A;  3T1H T;  2CXD A;  2V7I A;  2CWO A;  1OXZ A;  5AQK B;  2YDS A;  1YQ4 A;  3EDU A;  2WQY A;  2LSY A;  3AE9 A;  5FXZ A;  3MZK B;  2D9D A;  4X1I E;  2YU1 A;  3PU3 A;  4EYU A;  3PJA A;  2LRK A;  5FNV E;  4KP3 C;  2WU5 A;  3F2E A;  4P1N A;  1HX1 B;  2DL1 A;  2KWH A;  5TAO A;  3LK2 B;  2D0U A;  2JMH A;  2CM0 A;  4LFA T;  2Q9Q C;  5DQV A;  3JAD A;  5BR8 T;  3C4W A;  4QH1 A;  4YLH A;  2WDQ A;  4JI0 T;  1Z8U A;  4MHC A;  3CK6 A;  2N9D A;  5L3F B;  3BK9 A;  2QA7 A;  1NEK A;  5HXH A;  2NTX A;  3OKQ A;  4V1A v;  3NZP A;  2HH7 A;  4HWD A;  1HG5 A;  3RI5 A;  2V7L A;  1LVF A;  3LBX A;  1YXR A;  5JRC B;  4I55 E;  5LG4 A;  2VWA A;  4DR4 T;  4MFR A;  1V9D A;  3H37 A;  4PW8 A;  1SE7 A;  1M62 A;  1HG2 A;  5L3B B;  2XM2 A;  1D1C A;  2DHR A;  2FUP A;  5CJ5 A;  2J62 A;  4DR2 T;  5L4E A;  4IDO A;  2EHO D;  2V7J A;  4EB6 E;  5AQM B;  4UXN B;  5EZY E;  3HR0 A;  2M6B A;  4TZ4 C;  3ZMS B;  4CN4 A;  3TLU A;  4UV8 B;  3N5L A;  5C8Y E;  2BVM A;  5HYA A;  2YOE A;  3FXE B;  3JAE A;  3GA8 A;  5LA6 E;  3SFD A;  2J4G A;  2C5J A;  3PUQ A;  2RPA A;  2V5D A;  3PUY F;  4PK4 A;  5AQN B;  2IC9 A;  4HGA A;  5AQH B;  4HFC A;  2Q9Q B;  4HEA A;  4L9I A;  4L0R A;  1HNW T;  2H7O A;  2CHN A;  2QGS A;  3RC8 A;  2OA5 A;  1UUS A;  2OLT A;  4C90 A;  3RC3 A;  1MIY A;  4U33 A;  2ZM8 A;  5C3J A;  2M6I A;  5LXT E;  1N32 T;  3RLF F;  5DQW A;  4ZI2 D;  2BG9 A;  3RQW A;  4IDN A;  3FZL B;  2UXD T;  3P4P A;  3P50 A;  2X0Y A;  4AXP A;  2BKN A;  5AQJ B;  3TLS A;  3RIU C;  2LEH A;  4WNK A;  3M65 A;  5AQT B;  5LNK A;  3T1Y T;  3K3Q C;  4LF9 T;  1AJ3 A;  2E9X B;  5EK2 A;  2IIU A;  2ACX A;  2VQF T;  3PJA J;  2KLQ A;  2JQH A;  2AE9 A;  4QKN A;  1IAP A;  2UUC T;  2XAJ B;  2ACZ A;  4ZZB A;  3KVB A;  5AQV B;  4EYY R;  5LHI B;  5HEJ A;  4GOU A;  5HXS A;  5E0O A;  4LF6 T;  2IML A;  3QNU A;  3ZJ2 A;  3FZF B;  4Z91 A;  4H63 H;  1J1J A;  3RIF A;  4EED A;  2XQ5 A;  1LVK A;  2E5V A;  4PJL A;  3AXJ B;  3GWH A;  1IBM T;  1WR6 A;  4EXT A;  4NUU A;  3PDY A;  4ISS A;  2JQK A;  3ZT7 A;  3ETV A;  2E8I A;  2ZM6 T;  2LKH A;  4JUY A;  2V7M A;  3FXD B;  5HCM A;  4BJM A;  1W9R A;  3OYX A;  4X1Y E;  4DR7 T;  3L8R A;  4A97 A;  3CQX C;  3I0O A;  2E9X A;  2JMK A;  3RH3 A;  2CMR A;  1UGO A;  3Q5E A;  3GMI A;  5LJM A;  4AIS A;  2A2F X;  2XUE A;  4XBF B;  2WU2 A;  4IE6 A;  5HEU A;  4ZHQ E;  1U4Q A;  3EAM A;  2WAU A;  4U31 A;  5FY7 A;  2MBG A;  2UXX B;  4CI3 B;  2C0S A;  4WBN E;  2N2N A;  4K0U A;  4B3S T;  2XJ7 A;  3DTO A;  5J0Z A;  5L4H A;  5KDM C;  3NZQ A;  4IE7 A;  3FBL A;  4AQY T;  4I50 E;  1D1B A;  1YKE B;  4GYR A;  4DID B;  3KBU A;  4KUM B;  1J5W A;  3AA7 B;  4G2A A;  3ZCI A;  4JEH B;  4HWI B;  4HKA A;  1BR1 A;  3PUX F;  1UUR A;  4PFP A;  1XMQ T;  2J1D G;  3UFG A;  2WDV A;  5F8P A;  2X68 A;  3ZYK A;  3KV5 A;  4M1P A;  4JI4 T;  4ILU A;  4DBR A;  3AA1 B;  4UEL A;  5EK3 A;  1S35 A;  3UUL A;  1JNZ A;  4UF0 B;  3AA6 B;  5AQR B;  5FL0 A;  4Q25 A;  5ETW A;  2V5C A;  3N9M A;  4QXC B;  4NPP A;  4TWH A;  5A1L A;  2VKJ A;  2K3W A;  2UUA T;  1H7C A;  3P4W A;  5M4Y A;  5JDM A;  4KI0 F;  1O3X A;  2BKO A;  2I59 A;  3AEE A;  3ABV A;  4ZEY A;  3L09 A;  1FMV A;  2CWY A;  2AXD S;  2ODU A;  2D2S A;  2CBJ A;  1I94 T;  3CQG B;  3KDS E;  5AQI B;  5JR9 A;  2XQ9 A;  4ILA A;  1OED A;  3S4U A;  4I43 B;  4AIU A;  2XQ7 A;  1ZP0 A;  2KXP B;  4LF7 T;  4I4T E;  3P4S A;  4HE8 A;  2L8K A;  5L3D B;  1KNZ A;  4IE5 A;  4H63 V;  5J1G A;  5CFB A;  1BR0 A;  2ES0 A;  1MMA A;  4KHZ F;  1B7T A;  2X9X A;  3KV6 A;  1ZEE A;  3KIN B;  2K48 A;  4DV6 T;  2FJA A;  1D0Z A;  4DV1 T;  2OV9 A;  4UR9 A;  2MPK A;  3RIA A;  3N2O A;  4UF0 A;  4X65 T;  2LHR A;  3P4Q A;  4IL9 A;  3K8P C;  3Q2M A;  4H9Q C;  4TNW A;  1T98 A;  2NOX A;  5EK4 A;  5JDG A;  2LLY A;  5LOV E;  3ZC0 A;  2LM2 A;  5JVD E;  4HWH A;  3O1I A;  3OYZ A;  4OX9 T;  5HXE A;  2BG9 C;  4DV2 T;  4IIJ E;  4TWD A;  5DJQ C;  4LMK A;  4EGW A;  4AQF C;  4H9R C;  4UV9 B;  2KSR A;  3N2K E;  2K9A A;  2X67 A;  4DBQ A;  1MND A;  2VAS A;  4LML A;  4GK0 E;  3EHZ A;  2G0U A;  5AQG B;  2XQA A;  4YSZ A;  3JAF A;  3KVA A;  5JDQ A;  1YKH B;  4BA9 A;  5LCY A;  4P0B A;  2LOS A;  2FJD A;  1Y64 B;  1D1A A;  4ZS2 A;  3P8C D;  3IEE A;  3K3O A;  5JDL A;  4YTM A;  4QX8 B;  5FVL A;  2WS3 A;  4UVC B;  5FL1 A;  1VCT A;  3VU7 H;  4DUY T;  4DV7 T;  3O1H A;  2JPF A;  3WI3 A;  5IUX A;  4YY3 T;  4LF5 T;  4JBW F;  4CZZ B;  3A7M A;  5LGN B;  3LDQ B;  2CE7 A;  4CI1 B;  5FYM A;  3AEB A;  4IL4 A;  3RPU A;  4IT4 A;  3UFE A;  2YK0 A;  4E7Z A;  5KXJ A;  2YIN A;  2LJL A;  4XAX B;  3EI0 A;  4JI2 T;  2Y48 B;  2XPK A;  4CXW A;  1HX8 A;  3N2G E;  3N9O A;  5LP6 E;  2YDR A;  3MK7 C;  1IBK T;  3EUH A;  2VKD A;  3RF1 A;  4NUV A;  1U5P A;  1W0B A;  4JLE A;  3I9W A;  1JNR A;  3UUN A;  3BQK A;  3LK4 2;  4IHJ E;  2E9X C;  2BG9 B;  2NR4 A;  3KBT A;  5AQF B;  2UUB T;  1WCR A;  3LSV A;  2KMF A;  2DWK A;  1OWA A;  5FP3 A;  3AVR A;  4COF A;  3E08 A;  4P0A A;  3AE5 A;  5LG3 A;  3Q5D A;  5LBQ B;  4PK5 A;  2CHO A;  4LF4 T;  1MMD A;  4YJ2 E;  4ADZ A;  4CXY A;  3SOL A;  3ZPO A;  5LB7 B;  1Y01 A;  4GIW A;  4DV3 T;  3ZMV B;  1N34 T;  4YSY A;  3O9X A;  3AEC A;  1MNE A;  3ZCJ A;  4MBQ A;  3AE6 A;  4O4J E;  3K1S A;  5L3E B; 
#chains in the Genus database with same CATH homology
 1MIV A;  2KZ7 B;  3E22 E;  3PDY A;  2WWU A;  2GK9 A;  3BQL A;  4ISS A;  3VKH A;  3FBZ A;  3QK6 A;  3QUJ A;  4UVA B;  4JEU B;  4F6R C;  3ETV A;  2E8I A;  4JUY A;  2XTL A;  3V5S A;  2V7M A;  4O4L E;  4HFV A;  3FXD B;  2K5B B;  1ZV4 X;  4BJM A;  4IE0 A;  2IC6 A;  2DCF A;  3HL6 A;  3HKB E;  1HS7 A;  1WYB A;  3OYX A;  4X1Y E;  4X1K E;  1IZN B;  5JQG E;  4HN9 A;  2JRK A;  4AKH A;  2V1D B;  3B13 A;  3KV9 A;  3ZYM A;  3CQX C;  3IHR A;  3ZMT B;  3I0O A;  2E9X A;  2JMK A;  3RH3 A;  2HPL A;  4DMV A;  5H6R B;  2CMR A;  5JDH A;  2YEV C;  2MYS A;  2WM9 A;  3GMI A;  3N9N A;  3MA9 A;  4TUY E;  5LJM A;  2P9B A;  3F31 A;  2A2F X;  2LT3 A;  2XUE A;  5H6Q B;  4FJO A;  4XBF B;  4IE6 A;  4TX5 A;  4GYS A;  2KND A;  2W63 A;  4ZHQ E;  3P7I A;  1U4Q A;  3NBX X;  3DP7 A;  3O4X E;  3UTK A;  5LGT B;  2WAU A;  3C4Z A;  3O1J A;  4EZ4 A;  5FY7 A;  2MBG A;  2UXX B;  1HF8 A;  4MAL A;  3ZJ1 A;  4H9O C;  4CI3 B;  2C0S A;  4WBN E;  1SHZ C;  2N2N A;  4K0U A;  3ANW A;  2Z6E A;  1MIW A;  2ZMA A;  3D0T A;  4AQG A;  3QC9 A;  4CXX A;  3DTO A;  4AKI A;  5KDM C;  3NZQ A;  1YW0 A;  2XAF B;  4IE7 A;  3WAK A;  3FBL A;  2LSG A;  2IW5 B;  1SA0 E;  4I50 E;  1D1B A;  2V26 A;  1YKE B;  4GYR A;  2XHE B;  2ZM0 A;  5CA0 E;  2LM9 A;  3CPZ A;  1WRD A;  3AB3 B;  3WAJ A;  1KK7 A;  1HCI A;  4U74 A;  3KBU A;  4KUM B;  3J7Y q;  5FMN A;  3RYH E;  3RYC E;  3DJB A;  3JC6 C;  2X9H A;  2MTQ A;  3AA7 B;  4G2A A;  2WMO A;  3ZN1 B;  3ZCI A;  2W00 A;  5GON E;  4JEH B;  4E7S A;  5CA1 E;  3RKO A;  3KFW X;  2L3L A;  1X79 A;  5LHG B;  4HKA A;  1CUN A;  3PTR B;  1BR1 A;  3PUS A;  2D5U A;  3ANW B;  3EDV A;  3VKG A;  4DND A;  4ZS3 A;  3PUG A;  4PFP A;  5J2U E;  2A3D A;  4C91 A;  2C5K T;  4O8S A;  2XAS B;  4O2A E;  3R6N A;  3C98 B;  2NWB A;  4H9N C;  3R84 B;  5LYJ E;  2CEA A;  2J1D G;  3AA0 B;  3ONX A;  1QUU A;  3OBV E;  5DAB A;  3JC6 D;  5FXW A;  2MOZ A;  1E1H B;  1UX5 A;  3CQC B;  4YJ3 E;  4PJJ A;  2NW9 A;  5F8P A;  3U3I A;  1FEW A;  4P09 A;  3ZN0 B;  3CWZ B;  2X68 A;  4YFS A;  3ZYK A;  3PU8 A;  3RRC A;  3KV5 A;  4GK5 E;  1QSD A;  2CCQ A;  4CQI A;  4B6X A;  2SPC A;  3C50 A;  4M1P A;  3MJX A;  3RRW A;  2LHN A;  3RX6 A;  2NP9 A;  3LBX B;  3OJA A;  4AI6 A;  2PG8 A;  3MXZ A;  4ILU A;  3ETU A;  5JDF A;  2H7V C;  4DBR A;  3AA1 B;  2CXD A;  3HKC E;  2UXN B;  2RP4 A;  2V7I A;  4UEL A;  2CWO A;  1OXZ A;  5EK3 A;  1S35 A;  2BDE A;  3UUL A;  4H9S E;  1UCU A;  5J2T E;  2JQQ A;  2KWI B;  3EDU A;  4UF0 B;  3AA6 B;  1VRB A;  1WLX A;  4OYJ A;  3HA4 A;  5ETW A;  3N9M A;  5FY0 A;  2LSY A;  4QXC B;  3F57 A;  5A1L A;  4OFZ A;  2VKJ A;  5FXZ A;  3V5U A;  3MZK B;  3LFM A;  1H7C A;  2PJQ A;  4X1I E;  5M4Y A;  2YU1 A;  3PU3 A;  4EYU A;  5JDM A;  4TN7 B;  3ZMZ B;  3CVR A;  5FNV E;  1O3X A;  3MAC A;  2I59 A;  4KP3 C;  3FB2 A;  3L09 A;  1FMV A;  3F2E A;  3K3N A;  2CWY A;  2CLY B;  1NWM X;  2ODU A;  4CI2 B;  4IE4 A;  4AKL A;  4EAH A;  2D2S A;  2KWH A;  2C5I T;  3I1A A;  5TAO A;  3IBP A;  4UEM A;  3CQG B;  3LK2 B;  5KX5 E;  5LBM A;  2D0U A;  1D0X A;  2JMH A;  2CM0 A;  3KDS E;  3BQI A;  3ESL A;  3FHN A;  2CLY C;  5JR9 A;  2Q9Q C;  5DQV A;  5JDN A;  1G73 A;  3C4W A;  1YD8 G;  4YLH A;  5JRC A;  2ZM2 A;  2XQY A;  2K24 A;  4MHC A;  3MKD A;  2XAG B;  2N9D A;  4PAG A;  4PFO A;  5CB4 E;  3S4U A;  5L3F B;  3BK9 A;  1FIO A;  2QA7 A;  3AAE B;  5HXH A;  4I43 B;  3UUM A;  4J2C A;  4ZI7 E;  2NTX A;  3OKQ A;  4ANJ A;  2LE8 A;  4Z8X A;  3VHL A;  2YU2 A;  3RYF E;  2RA1 A;  1G8X A;  1BR4 A;  2KXP B;  3B57 A;  4V1A v;  5HXC A;  3NZP A;  5HWX A;  2VKO A;  4I4T E;  4HE8 A;  3HKE E;  5LJN A;  2HH7 A;  2L8K A;  1HG5 A;  4AQF A;  5L3D B;  1KNZ A;  4IE5 A;  4H63 V;  5J1G A;  1BR0 A;  2LSK A;  5ADX L;  2V7L A;  1LVF A;  4FI5 A;  2ES0 A;  4DO0 A;  3LBX A;  1MMA A;  3LG7 A;  5IHY A;  2VKH A;  1B7T A;  2X9X A;  3KV6 A;  2JJ9 A;  5IYZ E;  2Y6X A;  2L9Q A;  4BJN A;  2W0G A;  1ZEE A;  2EHO C;  2ODV A;  5JR9 B;  5JRC B;  3KIN B;  2Y8D A;  4I55 E;  4QXB B;  2VWA A;  2K48 A;  2D0T A;  3SWH A;  5LG4 A;  1IJ5 A;  1D0Z A;  2NW7 A;  2NW8 A;  4MFR A;  4A56 A;  3N2O A;  5JRE A;  1V9D A;  4UF0 A;  2LHR A;  2DLR A;  3H37 A;  5JR9 C;  1UX4 A;  4PW8 A;  2WBL A;  3GN5 A;  3CX8 B;  3K8P C;  3PE0 A;  1ZKE A;  3Q2M A;  4H9Q C;  4TV9 E;  4UIG A;  2WMN A;  1HG2 A;  1FMW A;  1T98 A;  2PFV A;  4OYK A;  5L3B B;  1D1C A;  2DHR A;  1HFA A;  3A5X A;  2NOX A;  4WBO A;  4OK0 A;  5EK4 A;  5JDG A;  5LOV E;  2KT9 A;  3ZC0 A;  3CML A;  3E0Z A;  5JVD E;  2EHO D;  2V7J A;  4EB6 E;  3O1I A;  3OYZ A;  1HTJ F;  5HXE A;  4UXN B;  4IIJ E;  5EZY E;  3HR0 A;  2BVL A;  2Q9Q A;  4TZ4 C;  3ZMS B;  5DJQ C;  1BR2 A;  3Q9D A;  4UV8 B;  3N5L A;  5JH7 E;  2N1G A;  5C8Y E;  4AQF C;  4ASK A;  4H9R C;  4UV9 B;  2VL8 A;  5HWY A;  2BVM A;  3N2K E;  5HYA A;  2K9A A;  2X67 A;  3FXE B;  4G63 A;  4DBQ A;  1MND A;  2VAS A;  4GK0 E;  3GA8 A;  2G0U A;  3ZMU B;  3GN5 B;  4IDZ A;  5LA6 E;  3UUX B;  3KVA A;  4O4H E;  5JDQ A;  1YKH B;  5L3G B;  3AVS A;  4BA9 A;  3LK3 B;  5LCY A;  4AKG A;  5L3C B;  4P0B A;  2LOS A;  3ZEF B;  2C5J A;  3PUQ A;  1Y64 B;  1D1A A;  3C64 A;  4ZS2 A;  3P8C D;  4DVD A;  2CXF A;  4PK4 A;  5FXX A;  5KMG P;  2IC9 A;  3IEE A;  3K3O A;  5JDL A;  2ZLY A;  4QX8 B;  4XZC A;  4PJM A;  4UVC B;  4HGA A;  2EHO A;  4ZI2 C;  1Z0P A;  2Q9Q B;  4HEA A;  4L9I A;  3VU7 H;  4L0R A;  4IGU A;  2X9Y A;  2H7O A;  3IF8 B;  5FY1 A;  2W61 A;  2DNX A;  3HKD E;  3O1H A;  2JPF A;  3WI3 A;  2HPJ A;  3NRX A;  2PBI A;  4CZZ B;  2QGS A;  3RC8 A;  2OA5 A;  5LGN B;  2WSS V;  2CE7 A;  4C90 A;  2X9W A;  4CI1 B;  5FYM A;  5BMV E;  1ZHC A;  3RC3 A;  1MIY A;  3CKD A;  3LJC A;  2ZM8 A;  3RPU A;  4PJN A;  3I9Y A;  4EZH A;  3AAA B;  1US7 B;  2CA5 A;  3UFE A;  2YK0 A;  5LXT E;  3Q5X A;  4EOZ B;  3AAI A;  5DQW A;  4ZI3 C;  3RYI E;  1VOM A;  3PUA A;  4QWN B;  3UT5 E;  4ZI2 D;  5FXV A;  4E7Z A;  2XAH B;  2X51 A;  4H9P C;  3KV4 A;  2YIN A;  2LJL A;  3J9X 1;  3SRZ A;  3U78 A;  4XAX B;  3NRY A;  5HAX A;  4IST A;  4AXP A;  2EHO B;  4U72 A;  2Y48 B;  1MMN A;  4PK6 A;  1HX8 A;  4CXW A;  1MMG A;  3N2G E;  3TKL B;  3N9O A;  2B1E A;  3N9Q A;  2Q9Q D;  5LP6 E;  2LOP A;  4KMC A;  2LEH A;  4WNK A;  2H3R A;  3M65 A;  5LNK A;  3MK7 C;  3ZC1 A;  3SS1 A;  3EUH A;  2XAQ B;  3K3Q C;  1LRZ A;  2V7K A;  3PUR A;  2VKD A;  1AJ3 A;  2CXL A;  4NUV A;  1IJ6 A;  2E9X B;  2VK9 A;  3H3A A;  4ZI3 D;  5EK2 A;  4O2B E;  1U5P A;  4JLE A;  2BZB A;  2IAK A;  2ACX A;  3I9W A;  3UUN A;  5LGU B;  3N9L A;  2KLQ A;  4AKR B;  3L3P A;  3BQK A;  3T8O A;  1D0Y A;  3LK4 2;  4QKN A;  3W15 B;  1IAP A;  2A72 A;  4IHJ E;  2E9X C;  4N78 D;  4EIW A;  2XAJ B;  3KBT A;  4DMW A;  3C4X A;  1S94 A;  2LSI A;  3KVB A;  2KMF A;  1EZ3 A;  2DWK A;  1OWA A;  3EVY A;  5FP3 A;  4EYY R;  5F3J A;  4QHO A;  5LHI B;  5HXR A;  2LSJ A;  3HI2 A;  2W62 A;  4GOU A;  5HXS A;  2X66 A;  3AVR A;  3E08 A;  5E0O A;  4BAY B;  4P0A A;  4MLK A;  2X0L B;  4X20 E;  1WYC A;  5LBQ B;  3C51 A;  4PK5 A;  4O4I E;  3CX7 B;  5LHH B;  4QXH B;  1MMD A;  4YJ2 E;  4WW0 A;  4ADZ A;  4PNI A;  1LKX A;  3ZJ2 A;  2DWG A;  3SOL A;  3ZPO A;  4UVB B;  4CXY A;  5L2L A;  4QX7 B;  2M67 A;  2KIN B;  3ZYL A;  4KBM B;  2E9X D;  3CX6 B;  4H63 H;  2VB6 A;  3Q5W A;  4GIW A;  4OHF A;  4HTE A;  3ZMV B;  1LVK A;  1NAF A;  2DI4 A;  4PJL A;  4ERR A;  3O9X A;  3I0Q A;  3ZLI A;  2NTY A;  3GWH A;  1MNE A;  4TV8 E;  4ZOL E;  4MBQ A;  3ZCJ A;  5AFU L;  1WR6 A;  4L5G A;  4O4J E;  3N9P A;  4EXT A;  5L3E B;  4YHJ A;  4NUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...