4L5GA

Crystal structure of thermus thermophilus card
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords CarD
publication title Structure and function of CarD, an essential mycobacterial transcription factor.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 47
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l5gA02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l5gA01
2LQKA 4KBMB 2EYQA 4MFRA 4ILUA 4KMCA 2LT4A 2LT1A 4XAXB 2LT3A 4L5GA
chains in the Genus database with same CATH superfamily
4P5NA 1ZHIA 3ZYKA 3DB4A 1HJDA 4QVZA 1U8RA 1UB4A 2MAWA 5J3BA 3LX7A 1TUGB 5A0GA 3UU5A 1IREB 3SOLA 4J9FA 2JOYA 3ASKA 3A8HB 3P8CD 3ZJ1A 3SWHA 1QVPA 4RTUA 3HHTB 1N9RA 2W2UA 3I56Q 1PCXA 5IHNA 2X4WA 1NPPA 1R0BG 4CXYA 3M0PA 3VR8A 2I59A 2ZLYA 1PG5B 4IL9A 2RJDA 4PK5A 4A4FA 2NOXA 5GAOq 4M7DC 4WBNE 4HEAA 3M65A 1DU2A 2AIRB 1WHKA 4M78C 3S4UA 1VQ6T 4C0DB 3ER0A 4JBWF 1OZ3A 4LNPA 2E4HA 3QKJA 2ZM2A 2Z0WA 4M75G 2FPDA 4IGUA 3CBMA 3M4YA 4HT9A 2XU8A 3PUXF 3UU4A 1YWPA 4E7ZA 5AQJB 4DR5T 2RQWA 4IUUA 3JB9D 4EZ4A 2IMLA 1YJ9A 2EYXA 2QEXA 2XJ7A 1HG5A 3Q1JA 2FHDA 3EVYA 3N9OA 2V8IA 3H0FA 4XTVA 4IIMA 5GJVB 4ESRA 1M90C 2ZPEB 2C06A 4AG2C 3PUZF 3RHWA 2PU9B 2L3QA 3OA6A 1WJQA 2AKLA 1AZGB 5HEHA 1T0HA 2JXBA 3N9NA 2ED0A 3RKXA 2RJEA 4OVAA 3FBZA 4MZMA 3G71T 4UIGA 3H8ZA 2X9HA 2GCXA 3PU8A 4EB6E 2WDRA 3OYXA 5AQRB 4X1IE 1Q86U 4M75F 1ZHCA 2EYZA 1KF6A 4LXCA 3RYFE 4AQGA 2BKNA 2YUOA 1ZUKA 2VXEA 3QDFA 3CCVT 2A37A 4RG8A 3RLFF 1QQJA 1PRMC 2LJ0A 3I9WA 2KRMA 2RQRA 3FRNA 4C5EA 3UATA 3UU6A 3P4RA 4ZI7E 2LOSA 4BDYA 3I1AA 5L3CB 3RC3A 2D0UA 4PJMA 3CCEQ 3P8DA 2O88A 1BI0A 4BI8B 3SFEA 2JM8A 2MIOA 1YKEB 1Q81R 3E08A 5LJMA 3UF4A 3CXCS 2NTXA 2X9WA 2ZM0A 2PVOB 1UGPB 3NTHA 1TUDA 4N4IA 3UU3A 2JTFA 1OU8A 2ROTA 4X1VA 3OKQA 2X68A 1QVGS 3T1YT 1QMCA 4MDXA 5HXCA 2K9AA 4UXNB 1D0ZA 3V5SA 1MHNA 2YEVC 3QXEB 3A7MA 3NZPA 4YTNA 3KFVA 2N2NA 3RC8A 5AQSB 4OB0B 2LX7A 2IHR1 3O9XA 3Q5EA 1RAEB 2X4YA 3M3ZB 4DV6T 5J0ZA 5ABEA 5LG3A 3WXMB 4RKUE 4XU3A 3CC2T 4IDQA 5EC7A 5C8YE 3JV3A 2X66A 2L9QA 3RUXA 2RQUA 1YQ4A 1AWXA 1Y01A 3F70A 4EOZB 1UURA 4CC7A 8ATCB 4F7UF 5GAN8 2A7YA 2K4YA 2ZPBB 4I50E 4BA9A 4KUMB 3V7CA 2K24A 2DLPA 1S72A 1E7PA 3FIFA 4UF0A 5GAN2 3A8GB 5GAOr 3H37A 2DBMA 2LLYA 1UTIA 2J06A 1HNZT 1TG0A 3E1SA 3R84B 3NFCA 2W61A 2JTEA 4OMMA 1TXQA 2WP9A 2M6BA 1XWMA 3SS1A 1WJRA 1Y7XA 3AVRA 2CM0A 2K3WA 1OEDB 2LJ3A 1I94T 5GANf 2XMFA 1SA0E 5LJ3d 3ETVA 1F1BB 4V2SA 3DB3A 4UEMA 2DNUA 3OPCA 2LQKA 4PKCC 2D5UA 3JB9J 4GOUA 2XQ8A 3QNUA 1OEDA 1L0VA 5HEOA 5JQGE 3C94A 4PFOA 2RH2A 3UULA 2FZGB 2F2XA 3JB9F 3QB5K 4LUEA 2Y4XA 1NE8A 3URGA 1TUCA 5LBMA 2PNIA 1KNPA 5AQFB 3CIRA 5FXXA 2NW9A 1AT1B 2ESWA 3CKDA 5KCHA 1KJWA 1Q95G 3TKLB 2HHHT 3EDUA 5KE3A 4OB3B 1GQEA 3DLMA 2L5QA 4A56A 1KSWA 2W66A 3HI2A 5JH7E 4DR7T 4BJMA 2C0OA 3SHWA 1UECA 2CXLA 5CFBA 5AQNB 2V6YB 1D1BA 2L8DA 2JIWA 2JPFA 4HCBA 5KXJA 3OS2A 1YBYA 1K73U 1Y64B 4KUDK 3BDLA 4JEUB 2V6YA 4ZI2C 2GFAA 2XY8B 1YP5A 4HKEA 4JI5T 5H6QB 4BACA 1M1KU 3E22E 3P50A 2DHRA 4KBMB 3I35A 1JO8A 2LCCA 3I9QA 1KNZA 1BI1A 2EPDA 4MHCA 5HXSA 2RJFA 3G4SA 1WHHA 3OYNA 2LM2A 3QK6A 3MHXA 2FRYA 3EABA 2DRKA 2FO0A 1JB0E 2LCLA 2QQAA 1KQSP 5JDMA 1ZBXA 2I2LA 2WMOA 2X51A 4FCYA 2RI2A 5L47A 1T3LA 2V8SV 2X9XA 2WDQA 3ZFJA 5EK2A 2C0IA 1G3SA 4C8QC 3CCUA 2LKGA 3CBOA 1B07A 2XASB 2KT1A 4J9EA 2VWAA 5LMNT 2M0YA 1PNJA 3H3MA 3L2QA 3NHNA 3REBB 1OI1A 3CPWS 2WDVA 4IE6A 1WXTA 4JRQA 4JV5T 5HEGA 5M4YA 4ZEYA 1VQ6Q 3ZMUB 2QK0A 4U74A 1HYOA 2NYSA 4O4LE 4HN9A 4DV0T 3CCLT 3OVUA 2ZZDA 4BB7A 4U2ZA 2A36A 5J39A 4TV9E 5CCAA 2Y48B 2QA7A 3K3QC 4CI1B 2ED1A 3JC6C 1W4SA 1Z0PA 2J6FA 2P0PA 3ZSSA 1HX8A 4PAGA 4YTPA 3V7SA 2A72A 2FVUA 1S35A 2QYWA 2EKOA 4LDWA 2XZEA 1WXBA 2SPCA 5C2TA 3FHNA 2JQQA 4M78G 3G71Q 4J6XA 3OBYA 1XNQT 2HN1A 4M1PA 2JMCA 4B3TT 3RKOA 4EDUA 2CSQA 3HKCE 5J2UE 4JLGA 1SSFA 1BU1A 1Q7YU 3RR6A 2JN0A 3CCVQ 2CDTA 4IE7A 1KD1C 2XAFB 1MMDA 1PSEA 2DIQA 1GFDA 4AIUA 3JCMe 3CCEA 3LWHA 5JDHA 4CXXA 1HCIA 3B5MA 3GN5B 3ZL7C 4Y91A 2HEQA 1JU5C 1BI2A 5HXHA 4EAHA 2PQWA 3W15B 2ZM6T 5GAMf 4M78F 5D7UA 5AQLB 1D0XA 3GN5A 4YJ2E 3VKHA 2XK0A 2LHRA 2OTLT 2X35A 1NJIC 4J6YA 4JS4A 4OB1B 3TREA 8AT1B 2P84A 4FSSA 3BDUA 4XTYA 5A2QE 1ZSZB 4QKNA 2GF7A 1PD0A 3E9GA 4KX6A 4LE9A 1N36T 4IIOA 3L3PA 2BZYA 2CGHA 5HY6A 2PJQA 5D6XA 5GMKh 2E5KA 1ZSZA 3VUZA 1WYXA 3TCJA 3FZKB 3PUYF 4MALA 4RTWA 3J81E 1JXOA 1LRZA 3P8BB 4O6JA 4M7AC 1WQWA 4E7JA 2RI5A 2VVNA 3CC2Q 5GAN7 2BBJA 1N8RR 2K57A 4UVCB 3CCSQ 5GANh 2H7OA 4AMCA 3PNWC 1B7TA 4LFCT 4E7HA 3WAJA 2FZKB 2JQKA 1WHLA 2PBIA 2ATCB 4DV7T 3LH5A 4QXHB 4ERRA 1WNLA 1A0NB 2IVWA 5CA1E 4MFRA 4QQ6A 4AG1C 2NWBA 3M58A 2K3XA 4JJCA 1QKXA 4JI2T 5LP6E 2IPOB 2KXCA 2YLCA 2HQXA 3UFGA 1UCUA 3EFSA 2RD1A 4R55A 1U06A 1WYBA 1T72A 1X43A 2RNAA 5IN1A 4EPCA 4YY3T 2V1QA 1WGSA 2ZPIB 2FJDA 2QGSA 1I6ZA 2PFVA 5LJ5f 1LJOA 4QKUA 4M7DE 1XMQT 4M75C 4WYVA 2FUPA 4J6WA 2XUEA 4V1Av 4QH4A 1PWTA 4M78E 2DLRA 2RHIA 2NWMA 2F1LA 2E8IA 2WCAA 3D0TA 2OAUA 5JR9B 2HPJA 3CPZA 1RI9A 2AK5A 5GMKm 1WFDA 4K0UA 2MYSA 3M4GA 1PSFA 2D1XA 3KV6A 4HA8A 4MBQA 3N2OA 4EIKA 5LHIB 2XQYA 4COFA 5JR9A 2KT9A 4FYYB 4P0BA 1IZ6A 2CE7A 4AQFC 2V7MA 4F8HA 2ZPFB 3RYIE 2K3YA 1NEBA 3I5RA 3OW2A 2XDBA 5JTGA 1ZP0A 3AE1A 2HD0A 4O5VA 4IDOA 2RQTA 4DOWA 2D2SA 1IJ6A 4GIWA 3UFEA 3NMZC 3CXCP 4HTEA 4A4KA 4X9CA 4M7AB 3KBTA 3VRZA 2KXDA 4PFZA 2J1DG 4AKRB 1ZX6A 4TNVA 2F2VA 2IIMA 1EIFA 4EYUA 4BE1A 2DNXA 3OYEA 3RIRA 4M7AA 1VQ7Q 5F8PA 3FLGA 3TVTA 2LRQA 2BS4A 1ZBJA 3KXTA 2ACXA 2DFUA 4TV8E 3NPFA 5LJ3j 5FXWA 4GKKT 1OEBA 1R8OB 1UE9A 5DY9A 4QHOA 2KRNA 3LBXB 3HFOA 2CSIA 1XNIA 4DMWA 2CUBA 1YW0A 3UA7A 3AAEB 4H9QC 4KUIA 3QUIA 4HVWA 4F16A 3CCRT 5JDLA 5FP3A 4XTWA 3LBXA 2DE0X 4XBFB 1NLOC 3A1PA 5FY0A 2PUKB 1KC8C 2I6HA 4PK6A 4TVRA 3H3AA 2LT1A 1VQ6A 1VYVA 4LFBT 2DKGA 2CP6A 2JVVA 1G83A 3GLXA 3HFNA 4JLEA 3ZCIA 3QYHB 1MGQA 4N0AC 1NYFA 1WDXA 5GAOp 4KP3C 2E5VA 4OK0A 1HXDA 2GTOA 2XKOC 2X0HA 1CKAA 2X0LB 1HSQA 3JCMd 4DEYA 3G06A 4A53A 1Z9QA 4DNDA 3KDSE 3MEUA 1GRIA 1RAGB 4NS5A 3DLLA 3CQXC 4AQFA 1Y07A 1N27A 4U3CA 3CQCB 3CCJT 3PDYA 1YIJT 4NXMT 4C8QG 3QWYA 4HKAA 2DTIA 4QX8B 5DABA 1M7KA 1K8AC 4CZZB 5LXTE 4QW2A 1NWMX 5A1LA 5GAMh 2C0SA 2MPKA 2LKHA 2DD4A 5LYJE 4ILCA 3HKBE 1KQSS 1C6VX 4R0KA 4LFAT 3RIAA 2LHNA 2LSJA 2GGRA 5GAN4 3O1HA 4A5XA 4Z89A 1N9SA 5FU6B 5HCJA 2XSBA 5HAXA 2RF0A 1ZQ1A 1G8XA 5CR2A 2O9VA 2DJZA 1Q81U 4LF9T 3PUWF 3C95A 3LW5E 2EQJA 2RHYA 3JRZA 2VWFA 3FZLB 4PFPA 4LN2A 2PVGB 4X1YE 1BBZA 5LJ5d 3A98A 4C8QF 2BS3A 2WBLA 5KYYB 3SD4A 1VQMT 1AJ3A 1Q82C 3PMTA 1H7CA 3OBVE 3GNFB 1SE7A 4IDPA 2DA9A 4ZN3A 2VL8A 3I0OA 5IXFA 2QA4Q 4QVCA 3ESLA 5KYYA 1T0JA 2OTLQ 4YSYA 3THKA 1TU0B 3VS0A 4HWHA 1UJ0A 2BE9B 1ZEEA 2CYZB 1HF8A 2HKQB 2XDPA 3F2EA 3B57A 3ONXA 3NGPA 5AT1B 1VQKT 1W2BP 2LTOA 3X1DA 5IXBA 3CC2A 1NEGA 4ZNXA 5LNKA 3K3NA 4IDNA 1RI0A 3EG2A 4C5HA 3EUHA 2W0GA 1X27A 2OX7A 1Q86C 3LGLA 3OTOT 3UUBA 2MWPA 4E6RA 2H89A 3PUAA 1AHJB 1FX7A 5LJ5h 2RK1A 4HFEA 1AVZC 1K9MC 3BFMA 3LK42 3ZLIA 2DO3A 2JZ2A 4EEBA 2VQET 2MF2A 3ABVA 1T98A 3HL6A 2KR3A 3ZMZB 1P92A 3KBGA 4BI4A 5FXZA 4CRIA 2OA5A 1X75C 1ZV4X 2Q9QC 2ZMAA 2LRKA 5L3BB 5IH2A 3M55A 3ZN1B 3VR9A 2DXCA 1SUMB 2LSYA 2X0YA 1MMGA 3FB2A 3HKDE 2VVSA 1SKUB 2BKPA 3UU8A 2A3LA 5GANj 2CUDA 2VB6A 2NW8A 4C8QE 3SFDA 5KX5E 4OGEA 2BS2A 1RUWA 3ZYMA 4M7AG 4B6XA 1E2AA 4TUYE 2HBWA 2QDLA 5IWAT 3RIFA 2AXDS 2GQIA 5IAYA 2CP3A 4AISA 3X20B 4IDZA 1UJYA 2I0NA 2X3XD 1U5PA 1BIAA 4PJJA 5LJ3f 4Z90A 4FU6A 3I5SA 1NENA 3OB9A 1U1SA 2DL7A 4QT7A 1YJNQ 2IC6A 4ZS3A 2RPNA 1SRMA 4HWIB 2KYMA 2O2OA 3PU3A 1RLPC 2M9UA 3F57A 3ULRB 4FL6A 3QIIA 3BW1A 1QLYA 2C5KT 2FB7A 3VS7A 3VV0A 2L3LA 4LDUA 4RTVA 4ELZC 3OYZA 4ATOA 1QWFA 2KEAA 1VQPT 1KG1A 3RYHE 4M7AF 2V5DA 3PV0F 2W00A 3EH1A 3HA4A 1UGQB 1QCNA 3HPWA 3TQ7P 4EMGA 4L9IA 1VQLQ 4YSXA 2J7IA 1VQ8T 2DX1A 2PVDB 2QYZA 4OB2B 2RA1A 1KQ2A 2CKKA 4GKJT 5GMKl 3WI3A 4AFZC 5LOVE 3ZC1A 2OTJQ 3E0ZA 3NBXX 2MMPA 3M54A 3DP7A 1EX4A 1QUUA 2BE7D 1VIFA 2DCFA 1JJ2P 3BK9A 3G7ZA 2XQ4A 2Q9QB 4AKIA 1IRXA 4J9CA 2RN8A 2KXPB 4E47A 4PW8A 2OV9A 4DBQA 1ZOYA 4KI0F 2B86A 3CQGB 1V76A 5HEJA 2CMRA 4N4GA 1QVGA 5AQMB 5KCOA 2Q9QA 5JDQA 3CCQA 1WXUA 2F2WA 2CS7A 4M77B 3I55T 1ARKA 2K3BA 3CPFA 1JBMA 2B8AA 3TLWA 1OEDC 3N9LA 3VYHB 4ZGEB 5GANg 2XQ6A 3CCRQ 2LRLA 5J26A 4M77A 2L3SA 3AHUA 2E6ZA 4JI3T 1X79A 3SRZA 2J6OA 1UGSB 1KK7A 3L8RA 3TLSA 3AECA 3AXJB 2WSFE 3PTAA 2UUCT 2DYIA 3AT1B 3HKSA 1D1AA 3AEAA 1XQHA 3CCLA 1VQ4T 1VQ9T 5KYXB 4J9BA 4H9SE 3RMQA 4C5IA 2Y4YA 3HP9A 1PHTA 2RO0A 5I2SA 3AXJA 1YCYA 1UUSA 4JRKA 2KVQG 4F7UG 5KYNA 2BZBA 3O8VA 5LGTB 4JYAT 1J5WA 2VKOA 4RTYA 5KYXA 3LSVA 4X65T 1FWZA 3RESA 1M1KC 2FJEA 4QQDA 4ZXLA 2E12A 5L4EA 2R57A 5FXVA 5L3DB 4AKHA 3CCJQ 1OX9A 2M02A 2J47A 1YIJQ 1QCFA 4X1KE 2LC4A 3IA3A 4XQ3A 2HH7A 4NL3A 3CCST 3EHQA 3KUFA 2K9GA 3ZEFB 5FRMA 2VC8A 2CZ6B 2FEIA 2X9YA 5GMKe 3OYIA 3RKGA 3TLVA 3UA6A 3PE0A 4HXJA 3CCMT 1FXXA 2Q9QD 1NYGA 4M75E 1MIYA 4PJOB 2PTKA 2UUBT 2XQAA 2L3RA 2A08A 2V8JA 1RAIB 3GA8A 3N2GE 3RPUA 1FJGT 2K7AA 3CMEA 1ZA2B 2XIDA 3GNGA 2E1HA 4GBQA 3JB9G 3L2VA 2Y8DA 2BBHA 4J9HA 4PJOA 4M77D 1H92A 1OULA 5A0DA 3PT9A 2KDSA 3MJXA 3GBQA 5GAMj 4B6MA 4H9PC 3OQ5A 1XZYA 3UDCA 3MEVA 3S3NA 2WAUA 1VQMQ 3ZN0B 2OTLA 2BVLA 3J7AF 4DV3T 2QASA 4ZS2A 2YUNA 1R0CB 1C0MA 2YK0A 3M0TA 4OMPA 3QG1A 4PJLA 3JAME 5KH6A 2DL3A 2DXUA 3A5ZB 3INZA 2LCSA 2EKHA 4HFHA 4U33A 1N8RU 1FMVA 3MKDA 1M90U 4A63B 3G6ET 5GAOm 2XAHB 1VQKQ 2LQ8A 4GY5A 4JDSA 4OX9T 3RDVA 3VS6A 3O1JA 1X01A 4DBHA 5LMUT 2KBTA 2LQNA 5CJ5A 3OYLA 2EHOB 2WY2A 2UU9T 2JRKA 1R77A 2KSSA 1BK2A 1LVFA 5M9OA 2YU2A 1QWEA 3ME9A 4U7YA 3JADA 5L8RE 1MMNA 4OMNA 5LJ3h 5GONE 5TAOA 4A54A 4F7UE 2RM4A 2FZCB 4ILAA 2QQRA 2WWUA 3J9X1 1BCOA 3KV4A 4PJOD 1VQ7T 3AE3A 3FEOA 2XM1A 4UV8B 4AKGA 4RCCA 3REAB 2K6DA 5LJ5j 4C92D 2DVJA 3VS3A 3AE2A 3CPWA 3CC4T 3HRUA 5E0OA 2V1RA 2FRWA 1LNXA 4YT0A 2PTFA 4EGWA 2DL5A 1WJSA 2J6KA 2R58A 3I56A 3CMAT 3H0HA 3ZT7A 1O9SA 3VU3C 5GAN5 4ZZBA 1YJ9T 1HNXT 4CC2A 1VQOQ 1N5ZA 3MPUB 3E2UA 3AA7B 4IUQA 1AWWA 1W2BS 2HN2A 2F4VT 4KGXB 1Q82R 3RQUA 4H63H 1K1ZA 3LYIA 5C0MA 1VQNQ 4LF6T 1QP3A 4B3RT 2NP9A 3B13A 1Z8UA 1BYMA 2YUQA 3U3IA 2RK2A 3WAKA 5LHHB 4MZPA 3JCMb 5L2LA 2QXFA 3R6OA 3HKEE 4Z91A 2KGTA 3NRYA 1ZSZC 2D9DA 3OSSC 1K4US 1B3QA 4NUUA 2JQ9A 5AQPB 4FM4B 3V5UA 4A4EA 1VQPQ 3ONJA 3GMIA 3FBLA 1I4K1 1X6GA 2M0OA 5FWCA 1W9RA 2EHOD 5FROA 2XSAA 2VKJA 1VQ8Q 3UUMA 2KYBA 1OOTA 3NTKA 1V29B 2CH4W 3C4SA 5GMKi 2OJ2A 1M62A 5DLQE 2E9XB 3O5ZA 2LT3A 4IE5A 1K9MR 2BUDA 3AE8A 2K79A 4LF4T 2JNGA 4FT2A 4I43B 5FLXE 2CP7A 4DA4A 2KK4A 3M57A 4LD9K 2CBJA 3AEEA 2E9XA 5L3FB 5JVDE 1WYCA 2YRCA 3PMIA 5F5WA 1ACMB 4Q5WA 1I5LA 1Y57A 2JS0A 2YDQA 3AE7A 2EBPA 2P0QA 3IQLA 4C0GA 1TS9A 3M0SA 1IGUA 4AKLA 2ZM8A 2F5KA 2D6FA 3CCRA 4EIWA 6AT1B 1YXRA 1Y96B 1RL2A 3N5BB 3I55Q 2LM9A 3ZEHA 3FDRA 2UXCT 4OYJA 4F6RC 3AEGA 5AQIB 1Y96A 3U23A 4X64T 2C0TA 2J62A 5JR9C 4YFSA 2RP4A 2QA4T 4JJBA 2DEQA 4HE8A 1UK5A 5J1GA 4QVDA 5CVIA 4X34A 3P4SA 1QCOA 3RI5A 3T8OA 1BB9A 2JMHA 5LA6E 1O75A 4QH5A 3L09A 2ZPHB 4TWHA 1VQ4Q 1VQ9Q 4WNKA 2XTLA 4QQGA 3HRSA 1S72T 4EZHA 2E41A 4A97A 2ODVA 1V9DA 3CCJA 1QVFP 2MTQA 3RF1A 1YIJA 3RH3A 3JCMf 4WF2A 2DXTA 1JJ2S 2BIVA 3AA0B 2HQHA 2ACZA 4X5TA 1AD5A 1WFWA 2KROA 4L59A 4EMHA 3C12A 4RCBA 2E3HA 3UUNA 4C5GA 2E9XD 2QG9B 2L8KA 1N33T 2P9BA 2C5JA 3FXEB 1M90R 2CWYA 3OY9A 2HQEA 3NZQA 1I5OB 3I0QA 2XDDA 3BQIA 1SPKA 5D6YA 1YN8A 1PD1A 3M0QA 3CCMQ 1PM3A 3PUQA 5HCKA 1D1CA 1WHJA 2KMFA 2KWHA 1W1FA 2GFUA 1U1TA 2MK5A 1YI2T 2CZ1B 4AFSC 3FC3A 5CO7A 1VQMA 5LHGB 3OSVA 4RTZA 4N4HA 4EV6A 1YD8G 2W62A 1OZ2A 5HXRA 1KEYA 2EQMA 5FWBA 3TSWA 1MNDA 3EGXB 4LDXA 5KYWB 3QDRB 1ZSGA 3ZT5A 2LNHB 3QC9A 1PKTA 5GAN6 3J7Yq 1LVKA 2KNDA 1NZ9A 4FI5A 2MOXA 1E7OA 1DJ7B 1M5Q1 1M3BA 3VS5A 3AA1B 2QRXA 2KMTA 4PNIA 5CAIA 2L0AA 4YTMA 4I55E 1VQKA 1WLXA 2UXXB 1RLQC 4IL4A 3RRWA 1YJNT 1RAHB 1NBEB 4F14A 4YTLA 5EK4A 1G3YA 2QDYB 4JUYA 1AEYA 3CX8B 2HCKA 1OXZA 4KMCA 3G6EQ 3JAEA 2HL5C 4ISSA 4HFIA 1U5SA 5HKCA 4MZTA 4HGAA 4WTOB 2V8KA 3ZC0A 1ABQA 3PIOA 2EJ9A 4CI0C 1YHQT 3G4ST 2X67A 1VQLT 3M53A 5FL1A 4DVDA 3EG3A 4PLLA 3GF5A 3TSZA 1H641 2D8HA 4Z8AA 2R6GF 3GWHA 1M2VB 4UV9B 1W70A 1IBLT 1OQKA 1UHFA 2AT1B 5IHYA 3CMLA 5GAN3 3X26B 3GIBA 2LZ6B 4CI3B 2DJQA 4PNOA 2OTJT 3PTRB 3AB3B 4FJOA 3VUBA 1CHUA 5DQVA 5DQWA 1M2VA 2IC9A 1KQ1A 2AHJB 5GAOl 2JW4A 1OEDE 3HR0A 1HTJF 4O4HE 5ETWA 4FW2A 5L3GB 2KE9A 1X2KA 3EGUA 4U7IA 5FU6C 3L42A 4XU1A 3HSBA 1BCMA 2MOZA 1XDPA 3FZMB 3CC4Q 1M9SA 1EZZB 2K5LA 2GBQA 4JI7T 1QKWA 4HCCA 2VQFT 4I4TE 3CMAQ 3NWIA 2CXDA 1HR0T 4QWNB 2ODUA 1YJ9Q 1WQ7A 4TX5A 4NIQA 2CHOA 1TWBA 3VU7H 1YWOA 2YUPA 4XTXA 3DJBA 4FYVB 4XTUA 5AYFA 4IE0A 1I07A 4O4JE 2FL7A 5JDGA 4YHJA 1UX5A 2YWWA 3VKIA 2LSKA 1VQPA 2UXDT 3S6WA 2B1EA 4E7IA 1KHIA 4GK0E 2D0NA 4L0RA 4AT1B 4H9OC 1V1CA 2EGCA 2QI2A 4NPPA 3L39A 2ABLA 3ZJ2A 1KQSA 3LDQB 2OLTA 5C3JA 4CN1A 2W67A 3CBPA 4MDWA 1VQ8A 1D0YA 4RUGA 4J9DA 3LK2B 4UVBB 3WVDB 4DV2T 2EQUA 1FIOA 3RIUA 2C5IT 2E65A 1MV3A 4H63V 2O4XB 3D7SB 5HEUA 4JS5A 5CB4E 4J2CA 4ZI3C 1IXDA 1Y0MA 2F69A 3P8HA 4OMFB 4BE2A 3L2ZA 2P4RA 4IKFA 2MBGA 5HWXA 3EDVA 3M0UA 1NLPC 3V7RA 3MACA 1GL5A 3PGGA 3X28B 2O4XA 4OF1A 3G71A 4B9XA 1OPLA 1UFFA 1GXIE 5AQUB 1WRDA 1IAPA 3BY7A 2E5LT 3CK6A 2D8JA 4J5YA 2KINB 1HX1B 2K5FA 2KLQA 1IHWA 2HPLA 4MLKA 4ELYC 3CCVA 3I55A 4HFVA 5AQKB 4RG2A 3ZT6A 2BZXA 3RKWA 2N1GA 3O1IA 5DJQC 2LSIA 3OYKA 2O01E 1GBQA 4KULA 1M1GA 1RAAB 2LE8A 4KHZF 4LUDA 2KI7A 5FU7B 2CZ7B 4O2BE 4BAYB 1HD3A 1K0XA 4UR9A 1QW1A 2CRBA 3META 3C98B 3JCMh 4K11A 2BKOA 3OYHA 2X3WD 2FG0A 3GPLA 4O2AE 1B34B 5LJ3g 1NAFA 2IAKA 4C91A 3OYFA 1Y71A 1G3TA 1VQ9A 3ZMVB 4JJNK 2VXFA 2DD5A 3QB5A 2L2PA 1M1FA 3IBPA 3KVBA 1JXMA 3C51A 3PVQA 2RJCA 1B34A 2P0KA 4BI3A 3EGDB 4FSXA 1IZNB 3OYGA 1J5ET 2QVAA 4IUVA 2V7JA 5AQOB 4ZHQE 1S72Q 4GYRA 1W09A 4GYSA 2HKNA 2I0MA 2O31A 4HCZA 1WA7A 3JCMX 5LL6S 3EGDA 1RAFB 3MEAA 3ONLC 1KFYA 3KBUA 1G3WA 3ZPOA 5FW9A 4BY6B 3OYDA 2PG8A 1YITT 2A28A 3CCSA 2EQKA 3ANWB 5CQYA 2RPAA 3VHLA 2WM9A 3UT5E 2EJFA 5IHIA 5I11A 4JI0T 4DUYT 3VRYA 4RMOA 2FJBA 4Q25A 3ANWA 2CWOA 5CK9A 3OS1A 3SWNB 1CSKA 3UPUA 5LBQB 4EXTA 3CEYA 1K0SA 3LH0A 2YN6A 3SWNA 3RBBB 4F04B 1EFNA 2ROLA 1YI2Q 3OS0A 3QJ6A 1YJWT 2M1HA 4M77C 1G2BA 4E2FB 4F17A 1JNRA 2A2FX 3KINB 4ANJA 4RTXA 1WZOA 5LJ3e 1KD1R 1O3XA 5FKYA 1I8FA 2DAQA 2YRVA 2BDEA 2XPKA 4OYKA 1VQOT 3N2KE 4U2YA 1M2OA 2NW7A 2Y90A 2GTJA 2LMJA 4ME7A 1AOJA 3QO3A 1QVFS 3CX6B 4XK8E 4XU2A 1VQNT 2IDOB 4KHPT 3OYYA 3CWZB 3OYCA 4CC3A 1I81A 1LPLA 2EWNA 4IUPA 2WU2A 2LT4A 3PVLA 1HFAA 5BR8T 4IURA 1M30A 1NJIR 4Z02A 4D8DA 4E7LA 2G3RA 4GK5E 3JSCA 4IT4A 2IIUA 3FJ5A 1KFZA 3SFMA 2XAGB 2H3RA 1H8KA 2VASA 5FRNA 4JRPA 2NUPB 1K8AU 3S3MA 1C1AA 2LNVA 2CLYB 1BKBA 2DL8A 2DTOA 4A4GA 3Q5XA 2LJLA 1BIBA 4JRIA 3SB2A 4HWCA 1YHQQ 2ECZA 3AE6A 1E1HB 5HK3A 4DIDB 3G4SQ 3JCMW 2OAWA 2NUPA 4KRTA 4ZI3D 5ECAA 3QWXX 1J1JA 2DILA 3OYMA 3S3OA 3MA9A 1VQ7A 2HSPA 2NR4A 3L2WA 1W6XA 3M0RA 5JREA 5LCYA 1N32T 3CCUQ 1GCPA 3CC4A 4PJOC 3PIPA 2KSRA 3AEFA 4ASKA 1FMKA 3GOXA 2BZ8A 4DV5T 5CKBA 1Q82U 1GCQA 4C92C 3ETUA 3Q2MA 2PZ1A 3CMAA 3U78A 1SHGA 1WX6A 2JJ9A 4PL6A 4ZGJB 3CXCA 3JCMP 3VS1A 3FXDB 5ABFB 1H3ZA 2FPFA 2DMOA 1N8RC 2L3PA 3DTOA 2E6NA 2PUOB 3NVOA 2KAFA 3UTKA 5ABFA 2VKHA 3C4ZA 2H3EB 4HVUA 3OBWA 4KGZB 2ZGWA 4H9RC 3JCMV 5ABHA 2J4GA 3PJAJ 4O4IE 3N9MA 4ZOLE 2XI9A 5HYAA 2D0TA 3KVAA 1M27C 1VA7A 3A8YC 4XAXB 3JCMQ 1MIWA 1M8MA 2YDLA 4WW0A 4C0FA 3IEEA 4Z8XA 2COWA 3JCFA 2GQVA 3P7IA 4LDYA 4M7AE 1K9MU 3AVSA 2DVEA 5FVKA 2CHNA 4DOVA 5LGNB 4IIJE 3CC7T 4BD3A 2CEAA 4NL2A 2H3JA 2H88A 4ZTFA 3ZCJA 4IHJE 1K73C 4ADZA 4G2AA 2EHOC 4H9NC 3ZYLA 3R6NA 4XTZA 2MI6A 3QJYA 3E9FA 4C0ZA 4HFBA 3L2RA 4JI8T 3UQ7A 1UGVA 3LJCA 4GLKA 3CD6T 5EK3A 2V6XA 2XAJB 2D0QB 2NTYA 2KZ7B 4VUBA 3JB9H 4M7DB 3V8LA 3RKYA 4ILUA 4DMVA 4YXDA 1Z9ZA 2JMAA 1SHFA 4FIBA 4M78B 2RA2A 2FBWA 2KNBB 2N9DA 4J83A 4K0KT 2LDMA 3EFRA 5CKDA 4ZGDB 4EMKC 3AE5A 5L23A 1VQ5T 4M7DA 2JQHA 3HTRA 3UUXB 2DIGA 3RQWA 1XMOT 3A8LB 2K5IA 5JDNA 4Y92A 4C92B 3L2UA 3A8OB 4EYYR 4M78A 2X4XA 4FYXB 4HFDA 4IE4A 2M67A 2MWOA 5GANe 2UUAT 1QP2A 1RABB 4C92A 2QA4A 2YINA 1VYTA 3NKZA 4ZTJA 4UF0B 2F5TX 4DO0A 4FT4A 3MZKB 1MUZA 1UEBA 2B76A 2DI4A 1VYUA 2AE9A 5AQTB 1LCKA 3DKMA 4MMLA 4LMJA 1H3HA 1OYXA 3EAEA 3MP8A 3VJPA 2DWKA 3RERA 3VYGA 4E7SA 1T8BA 1KC8R 2IG0A 2VKNA 4U72A 2NUZA 1IBMT 4L5GA 4P1NA 2YOEA 2GK9A 4AFQC 2FJAA 2EYWA 2RHUA 5DM7R 3RGLA 1WI7A 2W0ZA 1BR4A 5I2MA 1IHVA 2YU1A 5CKFA 3QZ9B 4CXWA 1VOMA 4CN4A 5L3EB 4JZ4A 5EZYE 1WR6A 4DUZT 3G1JA 1OU9A 2LVMA 4M4ZA 1YITQ 2LX9A 3OW2P 4QXBB 5C6SA 1Q7YC 1UHCA 2E9XC 3K8PC 5AQVB 5FYMA 1GFCA 4OHFA 1AZEA 1CUNA 1UGOA 3KFWX 5HCMA 4DR2T 2EHOA 1ZUYA 1W2BA 4M7DD 1X6BA 3EG9B 3FB9A 3P4PA 4A4HA 3SEMA 5AQQB 1YI2A 3EHZA 1BR2A 1I0CA 4M78D 1K8AR 3UWNA 4DR1T 3LGFA 3IHRA 4XZCA 3EG0A 1XOVA 2WACA 3EG9A 2ZPGB 5FMNA 2BG9C 2M51A 2P4TA 1W0AA 4EMKB 2A0FB 4CI2B 4BUGA 1YJWQ 2QQBA 3PUSA 3UQ4A 1WPYA 3P4WA 2UXNB 3C4XA 4LF7T 4YLHA 1WIEA 3BE3A 4JZ3A 4KH1B 4DR6T 4EMKA 5LG4A 3A8MB 1YJNA 1X2QA 3MEWA 1VIEA 1VCTA 2QEXT 2K5BB 1E6GA 2XM2A 3EHRA 2HZYA 2WWVA 2EGEA 4U31A 2CP2A 4LD6A 1J3TA 5GAMg 2ENMA 4KH0B 1HK9A 1JNZA 3M5AA 2XG8D 4X20E 1KNRA 2XQ3A 3OS5A 4X9DA 1YHQA 4PK4A 4Y28E 2LJ1A 5IT9E 1VQLA 3C50A 4M77G 5FNVE 2VV5A 3K1SA 2EYQA 3H0IA 2W10A 3JCMg 3VKGA 3X24B 5DLOA 3F31A 3OYJA 4L6V5 3CCQT 2QTVA 1FEWA 3MO8A 2OTJA 4XU0A 1Q86R 2K48A 3FZFB 2COYA 2WZIA 4OFZA 1OPKA 5J2TE 1QLBA 1IB8A 2KQWA 2DWGA 2YDRA 2DRMA 3HL8A 4DR3T 3AEDA 4YHHT 3N9PA 2EW3A 5FL0A 2HMAA 4UELA 2W63A 5LB7B 3MK7C 2DETA 3A5XA 4M77F 5BMVE 3CX7B 2A9UA 2H8HA 4WCIA 3RMSA 3O4XE 1S94A 1M3AA 1PRLC 2CT3A 1YCSB 4LMLA 3GP8A 1WHGA 3T1HT 2BG9B 3TEEA 2YKSA 2EJGA 2FYKA 4ISTA 1ZLMA 2JM9A 2WSCE 3MP1A 4JLIA 4BDZA 5JDFA 4B3MT 3EH2A 4WZXA 3MCAB 1X6OA 4J7FA 1RADB 5LJ5g 1JEGA 3AAAB 4IUTA 1JJ2A 5FY1A 1YKHB 4MMKA 2BG9A 2VGMA 2AKKA 5GAMe 4M7DG 3FJPA 5CKEA 2XICA 1JQQA 2L89A 3V8JA 4TZ4C 2R5AA 4EEDA 2UXBT 1I1JA 2E10A 4HCKA 3M56A 5D6WA 5EG2A 4PJOG 2A3DA 2VKDA 3CVRA 4JI1T 1SG5A 2DF6A 5IHKA 4C92G 2LSGA 1SSHA 1US7B 3E19A 5CIUA 3CC7Q 1UX4A 3IF8B 3CMET 3KV5A 3RRCA 5IYZE 2HDAA 5GANd 3FZHB 4DV1T 2CREA 4RTTA 4AXPA 4NUVA 1IBKT 1D3BB 2QGFB 2VGNA 1XNRT 4M7DF 3H6ZA 2E70A 3QSUA 1IJ5A 2DK3A 2E3IA 2XHCA 3ZMSB 3HRTA 1HNWT 4C8QB 4PJOF 1D3BA 3OYAA 4II1A 2EIFA 4TWDA 1NPRA 3QHSA 4OMOA 1LKXA 1IO6A 2D9TA 3C0CA 4C92F 3JB9I 3CD6Q 3I9YA 3JAFA 4M77E 2EVRA 4DQ2A 2CT4A 3ZKRA 4C8QA 3V8KA 4G63A 4DBRA 4HWFA 2E64A 1VQ5Q 2EAYA 3C64A 2ZCFB 2XHEB 2CCQA 1TH7A 2HBPA 3M59A 4YSZA 1ZUUA 1SRLA 1GBRA 4BJNA 3LWIA 1OX8A 4UC4A 1MV0B 5LJ5e 2YT6A 2XAQB 2K2MA 1MMAA 5LGUB 3CQTA 1AWJA 1EZ3A 2EYYA 1YFNA 2V7LA 1TOVA 2G0UA 3AE9A 5CA0E 1YQ3A 1KHCA 2V26A 4HFCA 4IREA 1TTHB 3J80E 5KDMC 1BR0A 2AZVA 4ILBA 3BQLA 1X9BA 2RHZA 3AEBA 3Q5WA 4ORZA 3N9QA 1UGRB 2JMKA 3AA6B 2QTXA 5IUXA 3EGXA 3VRBA 1KIKA 5KYWA 1WCRA 3RYCE 2MAMA 1SEMA 2VUBA 1N6AA 4ZI2D 4AI6A 2GNCA 1M3CA 3RIUC 5CQXA 4JI6T 3VS4A 2CXFA 3MXZA 2EFIA 1YITA 2LQWA 2RMOA 1N34T 3EFOB 1WLPB 2YRDA 3QBYA 2EGAA 4OMQA 5L4HA 2E5QA 2M6IA 4PLIA 1K73R 4JI4T 3TLTA 2VK9A 3VRAA 2J05A 4PJOE 5HK0A 3I56T 1BR1A 3EI0A 3EFOA 2CPTA 4CC4B 5CGMA 3NRXA 4N78D 2BTTA 2X4JA 4C92E 4C8QD 7AT1B 1WR0A 4KT0E 1LOJA 1Q81C 1M1KR 2YLBA 2QQ9A 2KWIB 3TU4K 1XTDA 4X62T 1SF9A 1KD1U 4I0UA 2LOPA 4X66T 3CCUT 1YJWA 2RHXA 3X25B 2VURA 2DBKA 2QGGA 1FMWA 4ZN1A 1TSFA 2ES0A 1AWOA 1D09B 4OP0A 1YNZA 3SDZA 1BI3A 3UT1A 5H6RB 4NXNT 3KV9A 3PURA 4WBOA 4QXCB 1HG2A 3L1AA 5FU7C 4R56A 2DTHA 4LMKA 1VQOA 4UVAB 1XJWB 4O8SA 5AQHB 3RNJA 5KE2A 2RQVA 4BE0A 1NJIU 1VQNA 1QVGP 3JC6D 5KYUB 2QEXQ 3OJAA 2MPXC 3M9QA 3AE4A 1XDOA 2LEHA 2AZSA 1M8VA 2LP5A 2ZAEA 3ZSTA 1G73A 5ABGA 3OMGA 2CZ0B 3MP6A 5KYUA 2CP0A 4LF5T 3OW2S 1ZKEA 3PFSA 1PC0A 2G6FX 1OV3A 3EAMA 2JUFA 4DBFA 4LF8T 2NUTB 3TLUA 2COZA 2M16A 1T3SA 2DEUA 3PUVF 2DYBA 4YJ3E 4Z88A 3T9NA 2BKDN 3RX6A 1CKBA 4BY6C 2NUTA 4M75B 2XQ9A 4J9IA 1ABOA 3CCQQ 1VRBA 2H7VC 2WSSV 4HT8A 1MNEA 3Q5DA 2R5MA 4AQYT 5GAMd 3CCET 3AAIA 5AQGB 5ADXL 4J7IA 2JTMA 1ZA1B 1UUEA 4HWDA 4M75A 1Q7YR 3JCMJ 3Q9DA 4DR4T 4D8KA 3PJAA 3SWNC 2E2AA 2WSEE 1K76A 2YHTA 4J9GA 2IW5B 2V5CA 1W0BA 3LFMA 1M4ZA 5LJNA 1U4QA 1SHZC 4B3ST 1VUBA 2DZCA 4GLMA 4JPBW 5A0LA 4P0AA 2CP5A 3CCLQ 4TN7B 5FVLA 3QPHA 3C4WA 2RI3A 1MIVA 4FYWB 5F3JA 4LDVA 1R8IA 1NEKA 2DM1A 4M7AD 1X69A 3K3OA 2QQSA 1VCSA 4NOYA 1NM7A 2SEMA 3VS2A 4QH1A 2V1DB 5KMGP 2KT8A 1E6HA 4C90A 2K2VA 2VVKA 3LG7A 2FPEA 4QX7B 1IGQA 2CH4A 1VQ4A 2HL3A 3CC7A 2BVMA 3JCMc 3ZMTB 3LLRA 2KRSA 2DL1A 2JT4A 5FY7A 2MCNA 2CBIA 2V7IA 4CN6A 1FYNA 4D6WA 4F7UB 1RACB 3CMEQ 5I21A 2CLYC 2VL0A 1OWAA 4M75D 3LK3B 1QSDA 2XQ5A 2YSQA 2CA5A 3ZBDA 4E7KA 2DL4A 3OMCA 4PJNA 3CD6A 3P4QA 9ATCB 2XD0A 4F7UA 3H9NA 2JS2A 5HXEA 4FW1A 2WZHA 2WMNA 4AFUC 4TNWA 4JEHB 4ZZCA 2QAZA 4DV4T 2YDSA 2BG9E 1S1NA 4OGCA 1GCQC 2HAXA 2W4XA 1VQ5A 3CCMA 3WVEB 2HSEB 3QOFA 1QVFA 4C0DC 2EQIA 1UDLA 1K9AA 4P09A 4HVVA 5AFUL 2IUBA 1T7SA 1UG1A 2OI3A 2HNIA 5HWYA 3BQKA 2DPPB 4N0AA 2NLUA 5JRCB 5GAOn 4A98A 2VYTA 2WU5A 3QZ5B 1KC8U 2DZ9A 2YXYA 2DERA 2WQYA 3CPWP 2O9SA 1HS7A 5GJWB 4OMLA 2SRCA 1JRIA 2WB5A 3PUGA 1U3OA 1G5VA 4JJDA 5JRCA 3EG1A 2Z6EA 5CKHA 5GMKj 2KY9A 5I22A 3QUJA 2Y6XA 3H41A 4CQIA 4KGVB 2WS3A 4B9WA 4J8OA 1NG2A 3N5LA 1PKSA 2V7KA 4JUVA 2RB6A 1WHMA 3QYGB 4TWFA 3OYBA 2XQ7A 2DXBA 3G6EA 3NTIA 4DEXA
chains in the Genus database with same CATH topology
4P5NA 1ZHIA 3ZYKA 3DB4A 4QVZA 1U8RA 1UB4A 5J3BA 3LX7A 5A0GA 1IREB 3SOLA 3ASKA 2JOYA 3A8HB 3P8CD 3ZJ1A 3SWHA 1QVPA 3HHTB 1N9RA 2X4WA 1NPPA 4CXYA 2I59A 2ZLYA 2RJDA 4PK5A 4A4FA 2NOXA 5GAOq 4M7DC 4WBNE 4HEAA 3M65A 4M78C 3S4UA 1VQ6T 4C0DB 3ER0A 1OZ3A 3QKJA 2ZM2A 4M75G 4IGUA 3M4YA 3CBMA 4HT9A 2XU8A 3JB9D 4E7ZA 4IUUA 4EZ4A 1YJ9A 2QEXA 1HG5A 3Q1JA 2FHDA 3EVYA 3N9OA 2V8IA 4XTVA 1M90C 2C06A 2ZPEB 2PU9B 3OA6A 1WJQA 3N9NA 3RKXA 2RJEA 4OVAA 3FBZA 4MZMA 3G71T 4UIGA 3H8ZA 2X9HA 2GCXA 3PU8A 4EB6E 3OYXA 4X1IE 1Q86U 4M75F 1ZHCA 3RYFE 4AQGA 3CCVT 2VXEA 4RG8A 3I9WA 3FRNA 4C5EA 4ZI7E 2LOSA 4BDYA 3I1AA 5L3CB 3RC3A 2D0UA 4PJMA 3P8DA 1BI0A 4BI8B 1YKEB 3E08A 5LJMA 3CXCS 2NTXA 2X9WA 2ZM0A 2PVOB 1UGPB 3NTHA 4N4IA 2JTFA 3OKQA 2X68A 1QVGS 4MDXA 5HXCA 2K9AA 4UXNB 1D0ZA 3V5SA 1MHNA 2YEVC 3QXEB 3NZPA 4A4KA 2N2NA 3RC8A 4OB0B 3O9XA 2X4YA 3WXMB 4RKUE 4XU3A 3CC2T 5C8YE 2X66A 2L9QA 3RUXA 3F70A 4EOZB 4F7UF 5GAN8 2A7YA 2K4YA 2ZPBB 4I50E 4BA9A 4KUMB 3V7CA 2K24A 1S72A 3FIFA 4UF0A 5GAN2 3A8GB 5GAOr 3H37A 3E1SA 3R84B 3NFCA 2W61A 1WJRA 3SS1A 1Y7XA 3AVRA 2CM0A 5GANf 1SA0E 5LJ3d 3ETVA 4V2SA 3DB3A 4UEMA 2LQKA 4PKCC 2D5UA 3JB9J 4GOUA 5JQGE 3C94A 4PFOA 2RH2A 3UULA 3JB9F 2Y4XA 1NE8A 3URGA 5LBMA 5FXXA 2NW9A 3CKDA 5KCHA 3TKLB 3EDUA 5KE3A 4OB3B 3DLMA 2L5QA 4A56A 3HI2A 5JH7E 4BJMA 2CXLA 1D1BA 2L8DA 2JPFA 4HCBA 3OS2A 1YBYA 1K73U 1Y64B 4KUDK 3BDLA 4JEUB 4ZI2C 2GFAA 4HKEA 5H6QB 4BACA 1M1KU 3E22E 2DHRA 4KBMB 2LCCA 1KNZA 1BI1A 4MHCA 5HXSA 2RJFA 3G4SA 3OYNA 3QK6A 3MHXA 2QQAA 1JB0E 2LCLA 5JDMA 1ZBXA 2I2LA 2WMOA 2X51A 2RI2A 2X9XA 3ZFJA 5EK2A 1G3SA 4C8QC 3CCUA 3CBOA 2XASB 2VWAA 3L2QA 1OI1A 3CPWS 4IE6A 4JRQA 5M4YA 3ZMUB 4U74A 4O4LE 4HN9A 3CCLT 2ZZDA 4BB7A 5J39A 4TV9E 5CCAA 2Y48B 2QA7A 3K3QC 4CI1B 3JC6C 1W4SA 1Z0PA 2P0PA 1HX8A 4PAGA 3V7SA 2A72A 2FVUA 1S35A 2EKOA 4LDWA 2SPCA 3FHNA 2JQQA 4M78G 4J6XA 3OBYA 4M1PA 4EDUA 3RKOA 3HKCE 5J2UE 4JLGA 1SSFA 1Q7YU 2JN0A 4IE7A 1KD1C 2XAFB 1MMDA 1PSEA 2DIQA 3JCMe 3CCEA 3LWHA 5JDHA 4CXXA 1HCIA 3GN5B 4Y91A 1BI2A 5HXHA 4EAHA 2PQWA 3W15B 5GAMf 4M78F 2XK0A 1D0XA 3GN5A 4YJ2E 3VKHA 2LHRA 2OTLT 2X35A 1NJIC 4J6YA 4JS4A 4OB1B 3TREA 3BDUA 4XTYA 5A2QE 2GF7A 4QKNA 3E9GA 3L3PA 2CGHA 5HY6A 2PJQA 5D6XA 5GMKh 3VUZA 3TCJA 4MALA 3J81E 4M7AC 3P8BB 1LRZA 4O6JA 1WQWA 4E7JA 2RI5A 5GAN7 2K57A 4UVCB 5GANh 2H7OA 3PNWC 1B7TA 4E7HA 3WAJA 2PBIA 4QXHB 4ERRA 1WNLA 2IVWA 5CA1E 4MFRA 4QQ6A 2NWBA 3M58A 2K3XA 5LP6E 2YLCA 2HQXA 3EFSA 1UCUA 2RD1A 4R55A 1WYBA 5IN1A 4EPCA 1WGSA 2ZPIB 2QGSA 2PFVA 5LJ5f 1LJOA 4M7DE 4M75C 4J6WA 2XUEA 4V1Av 4M78E 2DLRA 2RHIA 2E8IA 2OAUA 3D0TA 5JR9B 2HPJA 3CPZA 5GMKm 4K0UA 2MYSA 3M4GA 1PSFA 3KV6A 4HA8A 4MBQA 3N2OA 5LHIB 2XQYA 5JR9A 2KT9A 4P0BA 1IZ6A 2CE7A 4AQFC 2V7MA 2ZPFB 3RYIE 2K3YA 3OW2A 2XDBA 2HD0A 4O5VA 4DOWA 2D2SA 1IJ6A 4GIWA 3UFEA 4HTEA 4X9CA 4M7AB 3KBTA 2J1DG 4AKRB 1EIFA 4EYUA 4BE1A 2DNXA 3OYEA 3RIRA 4M7AA 5F8PA 3FLGA 2LRQA 3KXTA 2ACXA 4TV8E 5LJ3j 5FXWA 1R8OB 5DY9A 4QHOA 3LBXB 3HFOA 1XNIA 4DMWA 1YW0A 3AAEB 4H9QC 4KUIA 3QUIA 3CCRT 5JDLA 5FP3A 4XTWA 3LBXA 4XBFB 5FY0A 2PUKB 1KC8C 4PK6A 4TVRA 3H3AA 2LT1A 1VQ6A 2DKGA 2JVVA 3GLXA 3HFNA 4JLEA 3ZCIA 3QYHB 1MGQA 4N0AC 5GAOp 4KP3C 4OK0A 1HXDA 2XKOC 2X0LB 3JCMd 4A53A 4DNDA 3KDSE 3MEUA 4NS5A 3DLLA 3CQXC 4AQFA 1Y07A 1N27A 3CQCB 3CCJT 3PDYA 1YIJT 4C8QG 4HKAA 2DTIA 4QX8B 5DABA 1K8AC 4CZZB 5LXTE 4QW2A 1NWMX 5A1LA 5GAMh 2C0SA 2DD4A 1KQSS 5LYJE 3HKBE 2LHNA 2LSJA 5GAN4 3O1HA 1N9SA 5FU6B 5HAXA 5CR2A 1ZQ1A 1G8XA 2DJZA 1Q81U 3LW5E 3C95A 2EQJA 2RHYA 3JRZA 4PFPA 2PVGB 4X1YE 5LJ5d 4C8QF 2WBLA 3SD4A 1VQMT 1AJ3A 1Q82C 3PMTA 1H7CA 3OBVE 3GNFB 4ZN3A 2VL8A 3I0OA 4QVCA 3ESLA 1ZEEA 2CYZB 1HF8A 2XDPA 3F2EA 3B57A 3ONXA 1VQKT 2LTOA 3CC2A 5LNKA 3K3NA 4C5HA 1RI0A 3EUHA 2W0GA 1Q86C 3LGLA 2MWPA 3PUAA 1AHJB 1FX7A 5LJ5h 2RK1A 1K9MC 3BFMA 3LK42 3ZLIA 2DO3A 2JZ2A 2MF2A 1T98A 3HL6A 3ZMZB 1P92A 3KBGA 4BI4A 5FXZA 4CRIA 2OA5A 1X75C 1ZV4X 2Q9QC 2ZMAA 5L3BB 3M55A 3ZN1B 2DXCA 2LSYA 1MMGA 3FB2A 3HKDE 2A3LA 5GANj 2VB6A 2NW8A 4C8QE 5KX5E 4OGEA 3ZYMA 4M7AG 4B6XA 4TUYE 5IAYA 3X20B 4IDZA 1U5PA 1BIAA 4PJJA 5LJ3f 4FU6A 3OB9A 1U1SA 2IC6A 4ZS3A 3PU3A 2M9UA 3F57A 4FL6A 3QIIA 3BW1A 2C5KT 2FB7A 3VV0A 2L3LA 4LDUA 4ELZC 3OYZA 4ATOA 1KG1A 1VQPT 3RYHE 4M7AF 2W00A 3HA4A 1UGQB 3HPWA 4EMGA 4L9IA 1VQ8T 2PVDB 4OB2B 2RA1A 1KQ2A 2CKKA 5GMKl 3WI3A 5LOVE 3ZC1A 3E0ZA 3NBXX 2MMPA 3M54A 3DP7A 1QUUA 1VIFA 2DCFA 3BK9A 3G7ZA 2Q9QB 4AKIA 2KXPB 4E47A 4PW8A 4DBQA 3CQGB 2CMRA 4N4GA 1QVGA 5KCOA 2Q9QA 5JDQA 3CCQA 4M77B 2CS7A 3I55T 3CPFA 1JBMA 2B8AA 3N9LA 3VYHB 4ZGEB 5GANg 5J26A 4M77A 3AHUA 2E6ZA 1X79A 3SRZA 1UGSB 1KK7A 2WSFE 3PTAA 3HKSA 1D1AA 1XQHA 3CCLA 1VQ4T 1VQ9T 3RMQA 4H9SE 4C5IA 2Y4YA 3HP9A 2RO0A 5I2SA 1YCYA 4JRKA 2KVQG 4F7UG 2BZBA 3O8VA 5LGTB 2VKOA 1FWZA 3RESA 1M1KC 4QQDA 2E12A 2R57A 5FXVA 5L3DB 4AKHA 4X1KE 2LC4A 4XQ3A 2HH7A 4NL3A 3CCST 3KUFA 3ZEFB 5FRMA 2VC8A 2CZ6B 2X9YA 5GMKe 3OYIA 3PE0A 3CCMT 1FXXA 2Q9QD 4M75E 4PJOB 1MIYA 2L3RA 2V8JA 3GA8A 3N2GE 3RPUA 3CMEA 2XIDA 3GNGA 2E1HA 3JB9G 3L2VA 2Y8DA 4PJOA 4M77D 5A0DA 3PT9A 2KDSA 3MJXA 5GAMj 4H9PC 3OQ5A 3UDCA 3MEVA 3S3NA 2WAUA 3ZN0B 2OTLA 2BVLA 3J7AF 4ZS2A 2YK0A 3QG1A 4PJLA 3JAME 5KH6A 2DXUA 3A5ZB 3INZA 1N8RU 1FMVA 3MKDA 1M90U 3G6ET 5GAOm 2XAHB 2LQ8A 4GY5A 4JDSA 3O1JA 1X01A 3OYLA 2EHOB 2JRKA 2KSSA 1LVFA 5M9OA 2YU2A 3ME9A 5L8RE 1MMNA 5LJ3h 5GONE 5TAOA 4A54A 4F7UE 2RM4A 2QQRA 2WWUA 3J9X1 4PJOD 3KV4A 1VQ7T 3FEOA 4AKGA 4UV8B 4RCCA 5LJ5j 4C92D 3CPWA 3CC4T 3HRUA 5E0OA 1LNXA 3I56A 1WJSA 3CMAT 2R58A 1O9SA 3VU3C 5GAN5 1YJ9T 3AA7B 4IUQA 1W2BS 4H63H 5C0MA 3LYIA 1QP3A 2NP9A 3B13A 1BYMA 3U3IA 2RK2A 3WAKA 5LHHB 4MZPA 3JCMb 5L2LA 2QXFA 3R6OA 3HKEE 3NRYA 3OSSC 4NUUA 4FM4B 3V5UA 4A4EA 3GMIA 3FBLA 1I4K1 2M0OA 2EHOD 5FROA 2VKJA 3UUMA 3NTKA 1V29B 5GMKi 3C4SA 5DLQE 2E9XB 2LT3A 4IE5A 2BUDA 2JNGA 4FT2A 4I43B 5FLXE 4DA4A 2KK4A 3M57A 4LD9K 2E9XA 5L3FB 5JVDE 1WYCA 3PMIA 4Q5WA 1I5LA 2P0QA 4C0GA 4AKLA 2ZM8A 2F5KA 2D6FA 3CCRA 4EIWA 1Y96B 1RL2A 3N5BB 2LM9A 3ZEHA 3FDRA 4OYJA 4F6RC 1Y96A 5JR9C 4YFSA 2RP4A 2QA4T 2DEQA 4HE8A 5J1GA 4QVDA 5CVIA 4X34A 3T8OA 2JMHA 5LA6E 1O75A 3L09A 2ZPHB 4WNKA 2XTLA 4QQGA 3HRSA 1S72T 4EZHA 2E41A 2ODVA 1V9DA 3CCJA 2MTQA 1YIJA 3RH3A 3JCMf 4WF2A 2DXTA 1JJ2S 2BIVA 3AA0B 4L59A 4EMHA 3C12A 4RCBA 3UUNA 4C5GA 2E9XD 2L8KA 2P9BA 2C5JA 3FXEB 2CWYA 3OY9A 2HQEA 3NZQA 3I0QA 2XDDA 3BQIA 5D6YA 3PUQA 1D1CA 2KMFA 2KWHA 2GFUA 1U1TA 1YI2T 2CZ1B 3FC3A 1VQMA 5CO7A 5LHGB 3OSVA 4N4HA 1YD8G 2W62A 1OZ2A 5HXRA 2EQMA 1MNDA 4LDXA 3QDRB 3QC9A 5GAN6 3J7Yq 1LVKA 2KNDA 1NZ9A 4FI5A 1M5Q1 1DJ7B 3AA1B 2KMTA 5CAIA 4PNIA 4I55E 1VQKA 1WLXA 2UXXB 1YJNT 3RRWA 4YTLA 5EK4A 1G3YA 2QDYB 4JUYA 3CX8B 1OXZA 4KMCA 4ISSA 5HKCA 4MZTA 4HGAA 2V8KA 3ZC0A 3PIOA 2EJ9A 4CI0C 1YHQT 3G4ST 2X67A 1VQLT 3M53A 4PLLA 4DVDA 3GF5A 1H641 3GWHA 4UV9B 5IHYA 3CMLA 5GAN3 3X26B 3GIBA 4CI3B 4PNOA 2OTJT 3PTRB 3AB3B 4FJOA 3VUBA 5DQVA 5DQWA 2IC9A 1KQ1A 2AHJB 5GAOl 3HR0A 1HTJF 4O4HE 5ETWA 3WVDB 5L3GB 3HSBA 5FU6C 3L42A 4XU1A 2MOZA 1M9SA 2K5LA 4HCCA 4I4TE 2CXDA 4QWNB 2ODUA 1WQ7A 4TX5A 3VU7H 4XTXA 3DJBA 4XTUA 5AYFA 4IE0A 2FL7A 4O4JE 5JDGA 4YHJA 1UX5A 3VKIA 2LSKA 1VQPA 3S6WA 2B1EA 4E7IA 1KHIA 4GK0E 4L0RA 4H9OC 2QI2A 1KQSA 3ZJ2A 3CBPA 4MDWA 1VQ8A 1D0YA 3LK2B 4UVBB 2EQUA 1FIOA 2C5IT 2E65A 4H63V 2O4XB 4JS5A 5CB4E 4J2CA 4ZI3C 2F69A 3P8HA 4OMFB 4BE2A 3L2ZA 4IKFA 2MBGA 5HWXA 3EDVA 3V7RA 3MACA 3PGGA 3X28B 2O4XA 4OF1A 3G71A 4B9XA 1GXIE 3BY7A 1WRDA 1IAPA 4J5YA 2KINB 2K5FA 2KLQA 2HPLA 4MLKA 4ELYC 3CCVA 3I55A 4HFVA 4RG2A 3RKWA 2N1GA 3O1IA 5DJQC 2LSIA 3OYKA 2O01E 4KULA 1M1GA 2LE8A 5FU7B 2CZ7B 4O2BE 4BAYB 1QW1A 3META 3C98B 3JCMh 3OYHA 3GPLA 4O2AE 1B34B 5LJ3g 1NAFA 2IAKA 4C91A 3OYFA 1Y71A 1G3TA 1VQ9A 3ZMVB 4JJNK 2VXFA 2DD5A 1M1FA 3IBPA 3KVBA 3C51A 2RJCA 1B34A 2P0KA 4BI3A 4FSXA 1IZNB 3OYGA 4IUVA 2V7JA 4ZHQE 4GYRA 4GYSA 4HCZA 3JCMX 5LL6S 3MEAA 3KBUA 1G3WA 3ZPOA 4BY6B 3OYDA 2PG8A 1YITT 3CCSA 2EQKA 3ANWB 5CQYA 3VHLA 2WM9A 3UT5E 2EJFA 4RMOA 3ANWA 2CWOA 5CK9A 3OS1A 3SWNB 3UPUA 5LBQB 4EXTA 3CEYA 3LH0A 3SWNA 3OS0A 3QJ6A 1YJWT 2M1HA 4M77C 2A2FX 3KINB 4ANJA 5LJ3e 1O3XA 1I8FA 2DAQA 2YRVA 2BDEA 4OYKA 1VQOT 3N2KE 2NW7A 2Y90A 4ME7A 3QO3A 1QVFS 3CX6B 4XK8E 4XU2A 1VQNT 3OYYA 3CWZB 3OYCA 1I81A 2EWNA 4IUPA 2LT4A 1HFAA 4IURA 4Z02A 4E7LA 2G3RA 4GK5E 3JSCA 3SFMA 2XAGB 2H3RA 2VASA 5FRNA 4JRPA 1K8AU 3S3MA 2LNVA 2CLYB 1BKBA 2DTOA 4A4GA 3Q5XA 2LJLA 1BIBA 4JRIA 3SB2A 1E1HB 5HK3A 3JCMW 4ZI3D 3S3OA 3OYMA 3MA9A 1VQ7A 3L2WA 5JREA 5LCYA 3CC4A 4PJOC 3PIPA 4ASKA 3GOXA 5CKBA 1Q82U 4C92C 3ETUA 3Q2MA 3CMAA 3U78A 3CXCA 4PL6A 2JJ9A 4ZGJB 3JCMP 3FXDB 1H3ZA 1N8RC 3DTOA 2E6NA 2PUOB 2KAFA 3UTKA 2VKHA 3C4ZA 3OBWA 2ZGWA 4H9RC 3JCMV 4O4IE 3N9MA 4ZOLE 2XI9A 5HYAA 2D0TA 3KVAA 4XAXB 3JCMQ 1MIWA 4WW0A 4C0FA 3IEEA 4Z8XA 2GQVA 4M7AE 3P7IA 4LDYA 1K9MU 3AVSA 2DVEA 4DOVA 5LGNB 4IIJE 3CC7T 4BD3A 2CEAA 4NL2A 2H3JA 4ZTFA 3ZCJA 4IHJE 1K73C 4ADZA 4G2AA 2EHOC 4H9NC 3ZYLA 3R6NA 4XTZA 2MI6A 3QJYA 3E9FA 4C0ZA 3L2RA 3LJCA 4GLKA 3CD6T 5EK3A 2XAJB 2D0QB 2NTYA 2KZ7B 4VUBA 3JB9H 4M7DB 3V8LA 3RKYA 4ILUA 4DMVA 4FIBA 4M78B 2RA2A 2N9DA 4J83A 2LDMA 3EFRA 5CKDA 4ZGDB 4EMKC 1VQ5T 4M7DA 3UUXB 2DIGA 3A8LB 4C92B 2K5IA 5JDNA 3L2UA 3A8OB 4EYYR 4M78A 2X4XA 4IE4A 2M67A 2MWOA 5GANe 1QP2A 2QA4A 4C92A 2YINA 4ZTJA 4UF0B 2F5TX 4DO0A 4FT4A 3MZKB 1UEBA 2DI4A 3DKMA 4MMLA 1OYXA 3EAEA 3MP8A 3VJPA 2DWKA 3RERA 3VYGA 4E7SA 2IG0A 4U72A 4L5GA 2GK9A 5DM7R 2RHUA 1BR4A 5I2MA 2YU1A 5CKFA 3QZ9B 4CXWA 1VOMA 5L3EB 5EZYE 1WR6A 2LVMA 2LX9A 4QXBB 5C6SA 1Q7YC 2E9XC 3K8PC 5FYMA 4OHFA 1CUNA 3KFWX 1W2BA 2EHOA 4M7DD 3FB9A 4A4HA 1YI2A 4M78D 1BR2A 3UWNA 3LGFA 3IHRA 4XZCA 2WACA 1XOVA 2ZPGB 5FMNA 2P4TA 4EMKB 4CI2B 4BUGA 2QQBA 3PUSA 1WPYA 2UXNB 3C4XA 4YLHA 4EMKA 5LG4A 3A8MB 1YJNA 3MEWA 1VIEA 2QEXT 2K5BB 4LD6A 5GAMg 1HK9A 3M5AA 2XG8D 4X20E 3OS5A 4X9DA 1YHQA 4PK4A 4Y28E 5IT9E 1VQLA 3C50A 4M77G 5FNVE 2VV5A 2EYQA 3JCMg 3VKGA 3X24B 5DLOA 3F31A 3OYJA 4L6V5 3CCQT 1FEWA 3MO8A 2OTJA 4XU0A 2K48A 4OFZA 5J2TE 2KQWA 2DWGA 3HL8A 3N9PA 4UELA 2W63A 3MK7C 3A5XA 4M77F 5BMVE 3CX7B 3RMSA 3O4XE 1S94A 3GP8A 3TEEA 2EJGA 2FYKA 4ISTA 2WSCE 4BDZA 3MP1A 4JLIA 5JDFA 3MCAB 4J7FA 1X6OA 5LJ5g 3AAAB 4IUTA 1JJ2A 5FY1A 1YKHB 4MMKA 2VGMA 4M7DG 5GAMe 3FJPA 5CKEA 2XICA 2L89A 3V8JA 4TZ4C 2R5AA 2E10A 5EG2A 3M56A 5D6WA 4PJOG 2A3DA 2VKDA 3CVRA 4C92G 2LSGA 1US7B 3E19A 5CIUA 1UX4A 3IF8B 3CMET 3KV5A 3RRCA 5IYZE 5GANd 4AXPA 4NUVA 1D3BB 2VGNA 4M7DF 3H6ZA 2E70A 3QSUA 1IJ5A 2DK3A 2XHCA 3ZMSB 3HRTA 4C8QB 4PJOF 1D3BA 3OYAA 4II1A 2EIFA 1NPRA 3QHSA 1LKXA 2D9TA 3JB9I 4C92F 3I9YA 4M77E 4DQ2A 4C8QA 3V8KA 4G63A 4DBRA 2E64A 2EAYA 3C64A 2ZCFB 2XHEB 2CCQA 1TH7A 2HBPA 3M59A 4BJNA 3LWIA 4UC4A 5LJ5e 2XAQB 1MMAA 5LGUB 1EZ3A 2V7LA 2G0UA 5CA0E 1KHCA 2V26A 3J80E 5KDMC 1BR0A 3BQLA 2RHZA 3Q5WA 3N9QA 1UGRB 2JMKA 3AA6B 2QTXA 3RYCE 2VUBA 2MAMA 1N6AA 4ZI2D 4AI6A 5CQXA 2CXFA 3MXZA 2EFIA 1YITA 3QBYA 2E5QA 4PLIA 2VK9A 4PJOE 5HK0A 3I56T 1BR1A 3NRXA 4N78D 2X4JA 4C92E 1Q81C 4C8QD 4KT0E 1LOJA 2YLBA 2QQ9A 2KWIB 3TU4K 1XTDA 1KD1U 2LOPA 3CCUT 1YJWA 2RHXA 3X25B 4ZN1A 1FMWA 2ES0A 4OP0A 3SDZA 1BI3A 3UT1A 5H6RB 3KV9A 3PURA 4WBOA 4QXCB 1HG2A 3L1AA 5FU7C 4R56A 2DTHA 1VQOA 4UVAB 4O8SA 5KE2A 4BE0A 1NJIU 1VQNA 3JC6D 3OJAA 3M9QA 2LEHA 1M8VA 1G73A 3OMGA 2CZ0B 3MP6A 3OW2S 1ZKEA 3PFSA 2JUFA 2M16A 4YJ3E 3T9NA 2BKDN 3RX6A 4BY6C 4M75B 1VRBA 2H7VC 2WSSV 4HT8A 1MNEA 2R5MA 5GAMd 3CCET 3AAIA 5ADXL 4J7IA 2JTMA 4M75A 3JCMJ 3Q9DA 3SWNC 2WSEE 2YHTA 2IW5B 3LFMA 1M4ZA 5LJNA 1U4QA 1SHZC 1VUBA 2DZCA 5A0LA 4P0AA 4TN7B 3QPHA 3C4WA 2RI3A 1MIVA 5F3JA 4LDVA 4M7AD 3K3OA 2QQSA 4NOYA 2V1DB 5KMGP 4C90A 2K2VA 3LG7A 4QX7B 1VQ4A 3CC7A 2BVMA 3JCMc 3ZMTB 3LLRA 5FY7A 2V7IA 4D6WA 4F7UB 5I21A 2CLYC 1OWAA 4M75D 3LK3B 1QSDA 2CA5A 3ZBDA 4E7KA 3OMCA 4PJNA 3CD6A 2XD0A 4F7UA 5HXEA 2WMNA 4JEHB 4OGCA 2HAXA 1VQ5A 3CCMA 3WVEB 1QVFA 4C0DC 4P09A 5AFUL 2HNIA 5HWYA 3BQKA 2DPPB 4N0AA 2NLUA 5JRCB 5GAOn 2VYTA 3QZ5B 1KC8U 2DZ9A 1HS7A 1JRIA 3PUGA 1G5VA 5JRCA 2Z6EA 5CKHA 5GMKj 2KY9A 3QUJA 2Y6XA 4CQIA 4B9WA 4J8OA 3N5LA 2V7KA 4JUVA 2RB6A 3OYBA 3QYGB 2DXBA 3G6EA 3NTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQK A;  4KBM B;  2EYQ A;  4MFR A;  4ILU A;  4KMC A;  2LT4 A;  2LT1 A;  4XAX B;  2LT3 A;  4L5G A; 
#chains in the Genus database with same CATH topology
 4P5N A;  1ZHI A;  3ZYK A;  3DB4 A;  1HJD A;  4QVZ A;  1U8R A;  1UB4 A;  2MAW A;  5J3B A;  3LX7 A;  1TUG B;  5A0G A;  3UU5 A;  1IRE B;  3SOL A;  4J9F A;  2JOY A;  3ASK A;  3A8H B;  3P8C D;  3ZJ1 A;  3SWH A;  1QVP A;  4RTU A;  3HHT B;  1N9R A;  2W2U A;  3I56 Q;  1PCX A;  5IHN A;  2X4W A;  1NPP A;  1R0B G;  4CXY A;  3M0P A;  3VR8 A;  2I59 A;  2ZLY A;  1PG5 B;  4IL9 A;  2RJD A;  4PK5 A;  4A4F A;  2NOX A;  5GAO q;  4M7D C;  4WBN E;  4HEA A;  3M65 A;  1DU2 A;  2AIR B;  1WHK A;  4M78 C;  3S4U A;  1VQ6 T;  4C0D B;  3ER0 A;  4JBW F;  1OZ3 A;  4LNP A;  2E4H A;  3QKJ A;  2ZM2 A;  2Z0W A;  4M75 G;  2FPD A;  4IGU A;  3CBM A;  3M4Y A;  4HT9 A;  2XU8 A;  3PUX F;  3UU4 A;  1YWP A;  4E7Z A;  5AQJ B;  4DR5 T;  2RQW A;  4IUU A;  3JB9 D;  4EZ4 A;  2IML A;  1YJ9 A;  2EYX A;  2QEX A;  2XJ7 A;  1HG5 A;  3Q1J A;  2FHD A;  3EVY A;  3N9O A;  2V8I A;  3H0F A;  4XTV A;  4IIM A;  5GJV B;  4ESR A;  1M90 C;  2ZPE B;  2C06 A;  4AG2 C;  3PUZ F;  3RHW A;  2PU9 B;  2L3Q A;  3OA6 A;  1WJQ A;  2AKL A;  1AZG B;  5HEH A;  1T0H A;  2JXB A;  3N9N A;  2ED0 A;  3RKX A;  2RJE A;  4OVA A;  3FBZ A;  4MZM A;  3G71 T;  4UIG A;  3H8Z A;  2X9H A;  2GCX A;  3PU8 A;  4EB6 E;  2WDR A;  3OYX A;  5AQR B;  4X1I E;  1Q86 U;  4M75 F;  1ZHC A;  2EYZ A;  1KF6 A;  4LXC A;  3RYF E;  4AQG A;  2BKN A;  2YUO A;  1ZUK A;  2VXE A;  3QDF A;  3CCV T;  2A37 A;  4RG8 A;  3RLF F;  1QQJ A;  1PRM C;  2LJ0 A;  3I9W A;  2KRM A;  2RQR A;  3FRN A;  4C5E A;  3UAT A;  3UU6 A;  3P4R A;  4ZI7 E;  2LOS A;  4BDY A;  3I1A A;  5L3C B;  3RC3 A;  2D0U A;  4PJM A;  3CCE Q;  3P8D A;  2O88 A;  1BI0 A;  4BI8 B;  3SFE A;  2JM8 A;  2MIO A;  1YKE B;  1Q81 R;  3E08 A;  5LJM A;  3UF4 A;  3CXC S;  2NTX A;  2X9W A;  2ZM0 A;  2PVO B;  1UGP B;  3NTH A;  1TUD A;  4N4I A;  3UU3 A;  2JTF A;  1OU8 A;  2ROT A;  4X1V A;  3OKQ A;  2X68 A;  1QVG S;  3T1Y T;  1QMC A;  4MDX A;  5HXC A;  2K9A A;  4UXN B;  1D0Z A;  3V5S A;  1MHN A;  2YEV C;  3QXE B;  3A7M A;  3NZP A;  4YTN A;  3KFV A;  2N2N A;  3RC8 A;  5AQS B;  4OB0 B;  2LX7 A;  2IHR 1;  3O9X A;  3Q5E A;  1RAE B;  2X4Y A;  3M3Z B;  4DV6 T;  5J0Z A;  5ABE A;  5LG3 A;  3WXM B;  4RKU E;  4XU3 A;  3CC2 T;  4IDQ A;  5EC7 A;  5C8Y E;  3JV3 A;  2X66 A;  2L9Q A;  3RUX A;  2RQU A;  1YQ4 A;  1AWX A;  1Y01 A;  3F70 A;  4EOZ B;  1UUR A;  4CC7 A;  8ATC B;  4F7U F;  5GAN 8;  2A7Y A;  2K4Y A;  2ZPB B;  4I50 E;  4BA9 A;  4KUM B;  3V7C A;  2K24 A;  2DLP A;  1S72 A;  1E7P A;  3FIF A;  4UF0 A;  5GAN 2;  3A8G B;  5GAO r;  3H37 A;  2DBM A;  2LLY A;  1UTI A;  2J06 A;  1HNZ T;  1TG0 A;  3E1S A;  3R84 B;  3NFC A;  2W61 A;  2JTE A;  4OMM A;  1TXQ A;  2WP9 A;  2M6B A;  1XWM A;  3SS1 A;  1WJR A;  1Y7X A;  3AVR A;  2CM0 A;  2K3W A;  1OED B;  2LJ3 A;  1I94 T;  5GAN f;  2XMF A;  1SA0 E;  5LJ3 d;  3ETV A;  1F1B B;  4V2S A;  3DB3 A;  4UEM A;  2DNU A;  3OPC A;  2LQK A;  4PKC C;  2D5U A;  3JB9 J;  4GOU A;  2XQ8 A;  3QNU A;  1OED A;  1L0V A;  5HEO A;  5JQG E;  3C94 A;  4PFO A;  2RH2 A;  3UUL A;  2FZG B;  2F2X A;  3JB9 F;  3QB5 K;  4LUE A;  2Y4X A;  1NE8 A;  3URG A;  1TUC A;  5LBM A;  2PNI A;  1KNP A;  5AQF B;  3CIR A;  5FXX A;  2NW9 A;  1AT1 B;  2ESW A;  3CKD A;  5KCH A;  1KJW A;  1Q95 G;  3TKL B;  2HHH T;  3EDU A;  5KE3 A;  4OB3 B;  1GQE A;  3DLM A;  2L5Q A;  4A56 A;  1KSW A;  2W66 A;  3HI2 A;  5JH7 E;  4DR7 T;  4BJM A;  2C0O A;  3SHW A;  1UEC A;  2CXL A;  5CFB A;  5AQN B;  2V6Y B;  1D1B A;  2L8D A;  2JIW A;  2JPF A;  4HCB A;  5KXJ A;  3OS2 A;  1YBY A;  1K73 U;  1Y64 B;  4KUD K;  3BDL A;  4JEU B;  2V6Y A;  4ZI2 C;  2GFA A;  2XY8 B;  1YP5 A;  4HKE A;  4JI5 T;  5H6Q B;  4BAC A;  1M1K U;  3E22 E;  3P50 A;  2DHR A;  4KBM B;  3I35 A;  1JO8 A;  2LCC A;  3I9Q A;  1KNZ A;  1BI1 A;  2EPD A;  4MHC A;  5HXS A;  2RJF A;  3G4S A;  1WHH A;  3OYN A;  2LM2 A;  3QK6 A;  3MHX A;  2FRY A;  3EAB A;  2DRK A;  2FO0 A;  1JB0 E;  2LCL A;  2QQA A;  1KQS P;  5JDM A;  1ZBX A;  2I2L A;  2WMO A;  2X51 A;  4FCY A;  2RI2 A;  5L47 A;  1T3L A;  2V8S V;  2X9X A;  2WDQ A;  3ZFJ A;  5EK2 A;  2C0I A;  1G3S A;  4C8Q C;  3CCU A;  2LKG A;  3CBO A;  1B07 A;  2XAS B;  2KT1 A;  4J9E A;  2VWA A;  5LMN T;  2M0Y A;  1PNJ A;  3H3M A;  3L2Q A;  3NHN A;  3REB B;  1OI1 A;  3CPW S;  2WDV A;  4IE6 A;  1WXT A;  4JRQ A;  4JV5 T;  5HEG A;  5M4Y A;  4ZEY A;  1VQ6 Q;  3ZMU B;  2QK0 A;  4U74 A;  1HYO A;  2NYS A;  4O4L E;  4HN9 A;  4DV0 T;  3CCL T;  3OVU A;  2ZZD A;  4BB7 A;  4U2Z A;  2A36 A;  5J39 A;  4TV9 E;  5CCA A;  2Y48 B;  2QA7 A;  3K3Q C;  4CI1 B;  2ED1 A;  3JC6 C;  1W4S A;  1Z0P A;  2J6F A;  2P0P A;  3ZSS A;  1HX8 A;  4PAG A;  4YTP A;  3V7S A;  2A72 A;  2FVU A;  1S35 A;  2QYW A;  2EKO A;  4LDW A;  2XZE A;  1WXB A;  2SPC A;  5C2T A;  3FHN A;  2JQQ A;  4M78 G;  3G71 Q;  4J6X A;  3OBY A;  1XNQ T;  2HN1 A;  4M1P A;  2JMC A;  4B3T T;  3RKO A;  4EDU A;  2CSQ A;  3HKC E;  5J2U E;  4JLG A;  1SSF A;  1BU1 A;  1Q7Y U;  3RR6 A;  2JN0 A;  3CCV Q;  2CDT A;  4IE7 A;  1KD1 C;  2XAF B;  1MMD A;  1PSE A;  2DIQ A;  1GFD A;  4AIU A;  3JCM e;  3CCE A;  3LWH A;  5JDH A;  4CXX A;  1HCI A;  3B5M A;  3GN5 B;  3ZL7 C;  4Y91 A;  2HEQ A;  1JU5 C;  1BI2 A;  5HXH A;  4EAH A;  2PQW A;  3W15 B;  2ZM6 T;  5GAM f;  4M78 F;  5D7U A;  5AQL B;  1D0X A;  3GN5 A;  4YJ2 E;  3VKH A;  2XK0 A;  2LHR A;  2OTL T;  2X35 A;  1NJI C;  4J6Y A;  4JS4 A;  4OB1 B;  3TRE A;  8AT1 B;  2P84 A;  4FSS A;  3BDU A;  4XTY A;  5A2Q E;  1ZSZ B;  4QKN A;  2GF7 A;  1PD0 A;  3E9G A;  4KX6 A;  4LE9 A;  1N36 T;  4IIO A;  3L3P A;  2BZY A;  2CGH A;  5HY6 A;  2PJQ A;  5D6X A;  5GMK h;  2E5K A;  1ZSZ A;  3VUZ A;  1WYX A;  3TCJ A;  3FZK B;  3PUY F;  4MAL A;  4RTW A;  3J81 E;  1JXO A;  1LRZ A;  3P8B B;  4O6J A;  4M7A C;  1WQW A;  4E7J A;  2RI5 A;  2VVN A;  3CC2 Q;  5GAN 7;  2BBJ A;  1N8R R;  2K57 A;  4UVC B;  3CCS Q;  5GAN h;  2H7O A;  4AMC A;  3PNW C;  1B7T A;  4LFC T;  4E7H A;  3WAJ A;  2FZK B;  2JQK A;  1WHL A;  2PBI A;  2ATC B;  4DV7 T;  3LH5 A;  4QXH B;  4ERR A;  1WNL A;  1A0N B;  2IVW A;  5CA1 E;  4MFR A;  4QQ6 A;  4AG1 C;  2NWB A;  3M58 A;  2K3X A;  4JJC A;  1QKX A;  4JI2 T;  5LP6 E;  2IPO B;  2KXC A;  2YLC A;  2HQX A;  3UFG A;  1UCU A;  3EFS A;  2RD1 A;  4R55 A;  1U06 A;  1WYB A;  1T72 A;  1X43 A;  2RNA A;  5IN1 A;  4EPC A;  4YY3 T;  2V1Q A;  1WGS A;  2ZPI B;  2FJD A;  2QGS A;  1I6Z A;  2PFV A;  5LJ5 f;  1LJO A;  4QKU A;  4M7D E;  1XMQ T;  4M75 C;  4WYV A;  2FUP A;  4J6W A;  2XUE A;  4V1A v;  4QH4 A;  1PWT A;  4M78 E;  2DLR A;  2RHI A;  2NWM A;  2F1L A;  2E8I A;  2WCA A;  3D0T A;  2OAU A;  5JR9 B;  2HPJ A;  3CPZ A;  1RI9 A;  2AK5 A;  5GMK m;  1WFD A;  4K0U A;  2MYS A;  3M4G A;  1PSF A;  2D1X A;  3KV6 A;  4HA8 A;  4MBQ A;  3N2O A;  4EIK A;  5LHI B;  2XQY A;  4COF A;  5JR9 A;  2KT9 A;  4FYY B;  4P0B A;  1IZ6 A;  2CE7 A;  4AQF C;  2V7M A;  4F8H A;  2ZPF B;  3RYI E;  2K3Y A;  1NEB A;  3I5R A;  3OW2 A;  2XDB A;  5JTG A;  1ZP0 A;  3AE1 A;  2HD0 A;  4O5V A;  4IDO A;  2RQT A;  4DOW A;  2D2S A;  1IJ6 A;  4GIW A;  3UFE A;  3NMZ C;  3CXC P;  4HTE A;  4A4K A;  4X9C A;  4M7A B;  3KBT A;  3VRZ A;  2KXD A;  4PFZ A;  2J1D G;  4AKR B;  1ZX6 A;  4TNV A;  2F2V A;  2IIM A;  1EIF A;  4EYU A;  4BE1 A;  2DNX A;  3OYE A;  3RIR A;  4M7A A;  1VQ7 Q;  5F8P A;  3FLG A;  3TVT A;  2LRQ A;  2BS4 A;  1ZBJ A;  3KXT A;  2ACX A;  2DFU A;  4TV8 E;  3NPF A;  5LJ3 j;  5FXW A;  4GKK T;  1OEB A;  1R8O B;  1UE9 A;  5DY9 A;  4QHO A;  2KRN A;  3LBX B;  3HFO A;  2CSI A;  1XNI A;  4DMW A;  2CUB A;  1YW0 A;  3UA7 A;  3AAE B;  4H9Q C;  4KUI A;  3QUI A;  4HVW A;  4F16 A;  3CCR T;  5JDL A;  5FP3 A;  4XTW A;  3LBX A;  2DE0 X;  4XBF B;  1NLO C;  3A1P A;  5FY0 A;  2PUK B;  1KC8 C;  2I6H A;  4PK6 A;  4TVR A;  3H3A A;  2LT1 A;  1VQ6 A;  1VYV A;  4LFB T;  2DKG A;  2CP6 A;  2JVV A;  1G83 A;  3GLX A;  3HFN A;  4JLE A;  3ZCI A;  3QYH B;  1MGQ A;  4N0A C;  1NYF A;  1WDX A;  5GAO p;  4KP3 C;  2E5V A;  4OK0 A;  1HXD A;  2GTO A;  2XKO C;  2X0H A;  1CKA A;  2X0L B;  1HSQ A;  3JCM d;  4DEY A;  3G06 A;  4A53 A;  1Z9Q A;  4DND A;  3KDS E;  3MEU A;  1GRI A;  1RAG B;  4NS5 A;  3DLL A;  3CQX C;  4AQF A;  1Y07 A;  1N27 A;  4U3C A;  3CQC B;  3CCJ T;  3PDY A;  1YIJ T;  4NXM T;  4C8Q G;  3QWY A;  4HKA A;  2DTI A;  4QX8 B;  5DAB A;  1M7K A;  1K8A C;  4CZZ B;  5LXT E;  4QW2 A;  1NWM X;  5A1L A;  5GAM h;  2C0S A;  2MPK A;  2LKH A;  2DD4 A;  5LYJ E;  4ILC A;  3HKB E;  1KQS S;  1C6V X;  4R0K A;  4LFA T;  3RIA A;  2LHN A;  2LSJ A;  2GGR A;  5GAN 4;  3O1H A;  4A5X A;  4Z89 A;  1N9S A;  5FU6 B;  5HCJ A;  2XSB A;  5HAX A;  2RF0 A;  1ZQ1 A;  1G8X A;  5CR2 A;  2O9V A;  2DJZ A;  1Q81 U;  4LF9 T;  3PUW F;  3C95 A;  3LW5 E;  2EQJ A;  2RHY A;  3JRZ A;  2VWF A;  3FZL B;  4PFP A;  4LN2 A;  2PVG B;  4X1Y E;  1BBZ A;  5LJ5 d;  3A98 A;  4C8Q F;  2BS3 A;  2WBL A;  5KYY B;  3SD4 A;  1VQM T;  1AJ3 A;  1Q82 C;  3PMT A;  1H7C A;  3OBV E;  3GNF B;  1SE7 A;  4IDP A;  2DA9 A;  4ZN3 A;  2VL8 A;  3I0O A;  5IXF A;  2QA4 Q;  4QVC A;  3ESL A;  5KYY A;  1T0J A;  2OTL Q;  4YSY A;  3THK A;  1TU0 B;  3VS0 A;  4HWH A;  1UJ0 A;  2BE9 B;  1ZEE A;  2CYZ B;  1HF8 A;  2HKQ B;  2XDP A;  3F2E A;  3B57 A;  3ONX A;  3NGP A;  5AT1 B;  1VQK T;  1W2B P;  2LTO A;  3X1D A;  5IXB A;  3CC2 A;  1NEG A;  4ZNX A;  5LNK A;  3K3N A;  4IDN A;  1RI0 A;  3EG2 A;  4C5H A;  3EUH A;  2W0G A;  1X27 A;  2OX7 A;  1Q86 C;  3LGL A;  3OTO T;  3UUB A;  2MWP A;  4E6R A;  2H89 A;  3PUA A;  1AHJ B;  1FX7 A;  5LJ5 h;  2RK1 A;  4HFE A;  1AVZ C;  1K9M C;  3BFM A;  3LK4 2;  3ZLI A;  2DO3 A;  2JZ2 A;  4EEB A;  2VQE T;  2MF2 A;  3ABV A;  1T98 A;  3HL6 A;  2KR3 A;  3ZMZ B;  1P92 A;  3KBG A;  4BI4 A;  5FXZ A;  4CRI A;  2OA5 A;  1X75 C;  1ZV4 X;  2Q9Q C;  2ZMA A;  2LRK A;  5L3B B;  5IH2 A;  3M55 A;  3ZN1 B;  3VR9 A;  2DXC A;  1SUM B;  2LSY A;  2X0Y A;  1MMG A;  3FB2 A;  3HKD E;  2VVS A;  1SKU B;  2BKP A;  3UU8 A;  2A3L A;  5GAN j;  2CUD A;  2VB6 A;  2NW8 A;  4C8Q E;  3SFD A;  5KX5 E;  4OGE A;  2BS2 A;  1RUW A;  3ZYM A;  4M7A G;  4B6X A;  1E2A A;  4TUY E;  2HBW A;  2QDL A;  5IWA T;  3RIF A;  2AXD S;  2GQI A;  5IAY A;  2CP3 A;  4AIS A;  3X20 B;  4IDZ A;  1UJY A;  2I0N A;  2X3X D;  1U5P A;  1BIA A;  4PJJ A;  5LJ3 f;  4Z90 A;  4FU6 A;  3I5S A;  1NEN A;  3OB9 A;  1U1S A;  2DL7 A;  4QT7 A;  1YJN Q;  2IC6 A;  4ZS3 A;  2RPN A;  1SRM A;  4HWI B;  2KYM A;  2O2O A;  3PU3 A;  1RLP C;  2M9U A;  3F57 A;  3ULR B;  4FL6 A;  3QII A;  3BW1 A;  1QLY A;  2C5K T;  2FB7 A;  3VS7 A;  3VV0 A;  2L3L A;  4LDU A;  4RTV A;  4ELZ C;  3OYZ A;  4ATO A;  1QWF A;  2KEA A;  1VQP T;  1KG1 A;  3RYH E;  4M7A F;  2V5D A;  3PV0 F;  2W00 A;  3EH1 A;  3HA4 A;  1UGQ B;  1QCN A;  3HPW A;  3TQ7 P;  4EMG A;  4L9I A;  1VQL Q;  4YSX A;  2J7I A;  1VQ8 T;  2DX1 A;  2PVD B;  2QYZ A;  4OB2 B;  2RA1 A;  1KQ2 A;  2CKK A;  4GKJ T;  5GMK l;  3WI3 A;  4AFZ C;  5LOV E;  3ZC1 A;  2OTJ Q;  3E0Z A;  3NBX X;  2MMP A;  3M54 A;  3DP7 A;  1EX4 A;  1QUU A;  2BE7 D;  1VIF A;  2DCF A;  1JJ2 P;  3BK9 A;  3G7Z A;  2XQ4 A;  2Q9Q B;  4AKI A;  1IRX A;  4J9C A;  2RN8 A;  2KXP B;  4E47 A;  4PW8 A;  2OV9 A;  4DBQ A;  1ZOY A;  4KI0 F;  2B86 A;  3CQG B;  1V76 A;  5HEJ A;  2CMR A;  4N4G A;  1QVG A;  5AQM B;  5KCO A;  2Q9Q A;  5JDQ A;  3CCQ A;  1WXU A;  2F2W A;  2CS7 A;  4M77 B;  3I55 T;  1ARK A;  2K3B A;  3CPF A;  1JBM A;  2B8A A;  3TLW A;  1OED C;  3N9L A;  3VYH B;  4ZGE B;  5GAN g;  2XQ6 A;  3CCR Q;  2LRL A;  5J26 A;  4M77 A;  2L3S A;  3AHU A;  2E6Z A;  4JI3 T;  1X79 A;  3SRZ A;  2J6O A;  1UGS B;  1KK7 A;  3L8R A;  3TLS A;  3AEC A;  3AXJ B;  2WSF E;  3PTA A;  2UUC T;  2DYI A;  3AT1 B;  3HKS A;  1D1A A;  3AEA A;  1XQH A;  3CCL A;  1VQ4 T;  1VQ9 T;  5KYX B;  4J9B A;  4H9S E;  3RMQ A;  4C5I A;  2Y4Y A;  3HP9 A;  1PHT A;  2RO0 A;  5I2S A;  3AXJ A;  1YCY A;  1UUS A;  4JRK A;  2KVQ G;  4F7U G;  5KYN A;  2BZB A;  3O8V A;  5LGT B;  4JYA T;  1J5W A;  2VKO A;  4RTY A;  5KYX A;  3LSV A;  4X65 T;  1FWZ A;  3RES A;  1M1K C;  2FJE A;  4QQD A;  4ZXL A;  2E12 A;  5L4E A;  2R57 A;  5FXV A;  5L3D B;  4AKH A;  3CCJ Q;  1OX9 A;  2M02 A;  2J47 A;  1YIJ Q;  1QCF A;  4X1K E;  2LC4 A;  3IA3 A;  4XQ3 A;  2HH7 A;  4NL3 A;  3CCS T;  3EHQ A;  3KUF A;  2K9G A;  3ZEF B;  5FRM A;  2VC8 A;  2CZ6 B;  2FEI A;  2X9Y A;  5GMK e;  3OYI A;  3RKG A;  3TLV A;  3UA6 A;  3PE0 A;  4HXJ A;  3CCM T;  1FXX A;  2Q9Q D;  1NYG A;  4M75 E;  1MIY A;  4PJO B;  2PTK A;  2UUB T;  2XQA A;  2L3R A;  2A08 A;  2V8J A;  1RAI B;  3GA8 A;  3N2G E;  3RPU A;  1FJG T;  2K7A A;  3CME A;  1ZA2 B;  2XID A;  3GNG A;  2E1H A;  4GBQ A;  3JB9 G;  3L2V A;  2Y8D A;  2BBH A;  4J9H A;  4PJO A;  4M77 D;  1H92 A;  1OUL A;  5A0D A;  3PT9 A;  2KDS A;  3MJX A;  3GBQ A;  5GAM j;  4B6M A;  4H9P C;  3OQ5 A;  1XZY A;  3UDC A;  3MEV A;  3S3N A;  2WAU A;  1VQM Q;  3ZN0 B;  2OTL A;  2BVL A;  3J7A F;  4DV3 T;  2QAS A;  4ZS2 A;  2YUN A;  1R0C B;  1C0M A;  2YK0 A;  3M0T A;  4OMP A;  3QG1 A;  4PJL A;  3JAM E;  5KH6 A;  2DL3 A;  2DXU A;  3A5Z B;  3INZ A;  2LCS A;  2EKH A;  4HFH A;  4U33 A;  1N8R U;  1FMV A;  3MKD A;  1M90 U;  4A63 B;  3G6E T;  5GAO m;  2XAH B;  1VQK Q;  2LQ8 A;  4GY5 A;  4JDS A;  4OX9 T;  3RDV A;  3VS6 A;  3O1J A;  1X01 A;  4DBH A;  5LMU T;  2KBT A;  2LQN A;  5CJ5 A;  3OYL A;  2EHO B;  2WY2 A;  2UU9 T;  2JRK A;  1R77 A;  2KSS A;  1BK2 A;  1LVF A;  5M9O A;  2YU2 A;  1QWE A;  3ME9 A;  4U7Y A;  3JAD A;  5L8R E;  1MMN A;  4OMN A;  5LJ3 h;  5GON E;  5TAO A;  4A54 A;  4F7U E;  2RM4 A;  2FZC B;  4ILA A;  2QQR A;  2WWU A;  3J9X 1;  1BCO A;  3KV4 A;  4PJO D;  1VQ7 T;  3AE3 A;  3FEO A;  2XM1 A;  4UV8 B;  4AKG A;  4RCC A;  3REA B;  2K6D A;  5LJ5 j;  4C92 D;  2DVJ A;  3VS3 A;  3AE2 A;  3CPW A;  3CC4 T;  3HRU A;  5E0O A;  2V1R A;  2FRW A;  1LNX A;  4YT0 A;  2PTF A;  4EGW A;  2DL5 A;  1WJS A;  2J6K A;  2R58 A;  3I56 A;  3CMA T;  3H0H A;  3ZT7 A;  1O9S A;  3VU3 C;  5GAN 5;  4ZZB A;  1YJ9 T;  1HNX T;  4CC2 A;  1VQO Q;  1N5Z A;  3MPU B;  3E2U A;  3AA7 B;  4IUQ A;  1AWW A;  1W2B S;  2HN2 A;  2F4V T;  4KGX B;  1Q82 R;  3RQU A;  4H63 H;  1K1Z A;  3LYI A;  5C0M A;  1VQN Q;  4LF6 T;  1QP3 A;  4B3R T;  2NP9 A;  3B13 A;  1Z8U A;  1BYM A;  2YUQ A;  3U3I A;  2RK2 A;  3WAK A;  5LHH B;  4MZP A;  3JCM b;  5L2L A;  2QXF A;  3R6O A;  3HKE E;  4Z91 A;  2KGT A;  3NRY A;  1ZSZ C;  2D9D A;  3OSS C;  1K4U S;  1B3Q A;  4NUU A;  2JQ9 A;  5AQP B;  4FM4 B;  3V5U A;  4A4E A;  1VQP Q;  3ONJ A;  3GMI A;  3FBL A;  1I4K 1;  1X6G A;  2M0O A;  5FWC A;  1W9R A;  2EHO D;  5FRO A;  2XSA A;  2VKJ A;  1VQ8 Q;  3UUM A;  2KYB A;  1OOT A;  3NTK A;  1V29 B;  2CH4 W;  3C4S A;  5GMK i;  2OJ2 A;  1M62 A;  5DLQ E;  2E9X B;  3O5Z A;  2LT3 A;  4IE5 A;  1K9M R;  2BUD A;  3AE8 A;  2K79 A;  4LF4 T;  2JNG A;  4FT2 A;  4I43 B;  5FLX E;  2CP7 A;  4DA4 A;  2KK4 A;  3M57 A;  4LD9 K;  2CBJ A;  3AEE A;  2E9X A;  5L3F B;  5JVD E;  1WYC A;  2YRC A;  3PMI A;  5F5W A;  1ACM B;  4Q5W A;  1I5L A;  1Y57 A;  2JS0 A;  2YDQ A;  3AE7 A;  2EBP A;  2P0Q A;  3IQL A;  4C0G A;  1TS9 A;  3M0S A;  1IGU A;  4AKL A;  2ZM8 A;  2F5K A;  2D6F A;  3CCR A;  4EIW A;  6AT1 B;  1YXR A;  1Y96 B;  1RL2 A;  3N5B B;  3I55 Q;  2LM9 A;  3ZEH A;  3FDR A;  2UXC T;  4OYJ A;  4F6R C;  3AEG A;  5AQI B;  1Y96 A;  3U23 A;  4X64 T;  2C0T A;  2J62 A;  5JR9 C;  4YFS A;  2RP4 A;  2QA4 T;  4JJB A;  2DEQ A;  4HE8 A;  1UK5 A;  5J1G A;  4QVD A;  5CVI A;  4X34 A;  3P4S A;  1QCO A;  3RI5 A;  3T8O A;  1BB9 A;  2JMH A;  5LA6 E;  1O75 A;  4QH5 A;  3L09 A;  2ZPH B;  4TWH A;  1VQ4 Q;  1VQ9 Q;  4WNK A;  2XTL A;  4QQG A;  3HRS A;  1S72 T;  4EZH A;  2E41 A;  4A97 A;  2ODV A;  1V9D A;  3CCJ A;  1QVF P;  2MTQ A;  3RF1 A;  1YIJ A;  3RH3 A;  3JCM f;  4WF2 A;  2DXT A;  1JJ2 S;  2BIV A;  3AA0 B;  2HQH A;  2ACZ A;  4X5T A;  1AD5 A;  1WFW A;  2KRO A;  4L59 A;  4EMH A;  3C12 A;  4RCB A;  2E3H A;  3UUN A;  4C5G A;  2E9X D;  2QG9 B;  2L8K A;  1N33 T;  2P9B A;  2C5J A;  3FXE B;  1M90 R;  2CWY A;  3OY9 A;  2HQE A;  3NZQ A;  1I5O B;  3I0Q A;  2XDD A;  3BQI A;  1SPK A;  5D6Y A;  1YN8 A;  1PD1 A;  3M0Q A;  3CCM Q;  1PM3 A;  3PUQ A;  5HCK A;  1D1C A;  1WHJ A;  2KMF A;  2KWH A;  1W1F A;  2GFU A;  1U1T A;  2MK5 A;  1YI2 T;  2CZ1 B;  4AFS C;  3FC3 A;  5CO7 A;  1VQM A;  5LHG B;  3OSV A;  4RTZ A;  4N4H A;  4EV6 A;  1YD8 G;  2W62 A;  1OZ2 A;  5HXR A;  1KEY A;  2EQM A;  5FWB A;  3TSW A;  1MND A;  3EGX B;  4LDX A;  5KYW B;  3QDR B;  1ZSG A;  3ZT5 A;  2LNH B;  3QC9 A;  1PKT A;  5GAN 6;  3J7Y q;  1LVK A;  2KND A;  1NZ9 A;  4FI5 A;  2MOX A;  1E7O A;  1DJ7 B;  1M5Q 1;  1M3B A;  3VS5 A;  3AA1 B;  2QRX A;  2KMT A;  4PNI A;  5CAI A;  2L0A A;  4YTM A;  4I55 E;  1VQK A;  1WLX A;  2UXX B;  1RLQ C;  4IL4 A;  3RRW A;  1YJN T;  1RAH B;  1NBE B;  4F14 A;  4YTL A;  5EK4 A;  1G3Y A;  2QDY B;  4JUY A;  1AEY A;  3CX8 B;  2HCK A;  1OXZ A;  4KMC A;  3G6E Q;  3JAE A;  2HL5 C;  4ISS A;  4HFI A;  1U5S A;  5HKC A;  4MZT A;  4HGA A;  4WTO B;  2V8K A;  3ZC0 A;  1ABQ A;  3PIO A;  2EJ9 A;  4CI0 C;  1YHQ T;  3G4S T;  2X67 A;  1VQL T;  3M53 A;  5FL1 A;  4DVD A;  3EG3 A;  4PLL A;  3GF5 A;  3TSZ A;  1H64 1;  2D8H A;  4Z8A A;  2R6G F;  3GWH A;  1M2V B;  4UV9 B;  1W70 A;  1IBL T;  1OQK A;  1UHF A;  2AT1 B;  5IHY A;  3CML A;  5GAN 3;  3X26 B;  3GIB A;  2LZ6 B;  4CI3 B;  2DJQ A;  4PNO A;  2OTJ T;  3PTR B;  3AB3 B;  4FJO A;  3VUB A;  1CHU A;  5DQV A;  5DQW A;  1M2V A;  2IC9 A;  1KQ1 A;  2AHJ B;  5GAO l;  2JW4 A;  1OED E;  3HR0 A;  1HTJ F;  4O4H E;  5ETW A;  4FW2 A;  5L3G B;  2KE9 A;  1X2K A;  3EGU A;  4U7I A;  5FU6 C;  3L42 A;  4XU1 A;  3HSB A;  1BCM A;  2MOZ A;  1XDP A;  3FZM B;  3CC4 Q;  1M9S A;  1EZZ B;  2K5L A;  2GBQ A;  4JI7 T;  1QKW A;  4HCC A;  2VQF T;  4I4T E;  3CMA Q;  3NWI A;  2CXD A;  1HR0 T;  4QWN B;  2ODU A;  1YJ9 Q;  1WQ7 A;  4TX5 A;  4NIQ A;  2CHO A;  1TWB A;  3VU7 H;  1YWO A;  2YUP A;  4XTX A;  3DJB A;  4FYV B;  4XTU A;  5AYF A;  4IE0 A;  1I07 A;  4O4J E;  2FL7 A;  5JDG A;  4YHJ A;  1UX5 A;  2YWW A;  3VKI A;  2LSK A;  1VQP A;  2UXD T;  3S6W A;  2B1E A;  4E7I A;  1KHI A;  4GK0 E;  2D0N A;  4L0R A;  4AT1 B;  4H9O C;  1V1C A;  2EGC A;  2QI2 A;  4NPP A;  3L39 A;  2ABL A;  3ZJ2 A;  1KQS A;  3LDQ B;  2OLT A;  5C3J A;  4CN1 A;  2W67 A;  3CBP A;  4MDW A;  1VQ8 A;  1D0Y A;  4RUG A;  4J9D A;  3LK2 B;  4UVB B;  3WVD B;  4DV2 T;  2EQU A;  1FIO A;  3RIU A;  2C5I T;  2E65 A;  1MV3 A;  4H63 V;  2O4X B;  3D7S B;  5HEU A;  4JS5 A;  5CB4 E;  4J2C A;  4ZI3 C;  1IXD A;  1Y0M A;  2F69 A;  3P8H A;  4OMF B;  4BE2 A;  3L2Z A;  2P4R A;  4IKF A;  2MBG A;  5HWX A;  3EDV A;  3M0U A;  1NLP C;  3V7R A;  3MAC A;  1GL5 A;  3PGG A;  3X28 B;  2O4X A;  4OF1 A;  3G71 A;  4B9X A;  1OPL A;  1UFF A;  1GXI E;  5AQU B;  1WRD A;  1IAP A;  3BY7 A;  2E5L T;  3CK6 A;  2D8J A;  4J5Y A;  2KIN B;  1HX1 B;  2K5F A;  2KLQ A;  1IHW A;  2HPL A;  4MLK A;  4ELY C;  3CCV A;  3I55 A;  4HFV A;  5AQK B;  4RG2 A;  3ZT6 A;  2BZX A;  3RKW A;  2N1G A;  3O1I A;  5DJQ C;  2LSI A;  3OYK A;  2O01 E;  1GBQ A;  4KUL A;  1M1G A;  1RAA B;  2LE8 A;  4KHZ F;  4LUD A;  2KI7 A;  5FU7 B;  2CZ7 B;  4O2B E;  4BAY B;  1HD3 A;  1K0X A;  4UR9 A;  1QW1 A;  2CRB A;  3MET A;  3C98 B;  3JCM h;  4K11 A;  2BKO A;  3OYH A;  2X3W D;  2FG0 A;  3GPL A;  4O2A E;  1B34 B;  5LJ3 g;  1NAF A;  2IAK A;  4C91 A;  3OYF A;  1Y71 A;  1G3T A;  1VQ9 A;  3ZMV B;  4JJN K;  2VXF A;  2DD5 A;  3QB5 A;  2L2P A;  1M1F A;  3IBP A;  3KVB A;  1JXM A;  3C51 A;  3PVQ A;  2RJC A;  1B34 A;  2P0K A;  4BI3 A;  3EGD B;  4FSX A;  1IZN B;  3OYG A;  1J5E T;  2QVA A;  4IUV A;  2V7J A;  5AQO B;  4ZHQ E;  1S72 Q;  4GYR A;  1W09 A;  4GYS A;  2HKN A;  2I0M A;  2O31 A;  4HCZ A;  1WA7 A;  3JCM X;  5LL6 S;  3EGD A;  1RAF B;  3MEA A;  3ONL C;  1KFY A;  3KBU A;  1G3W A;  3ZPO A;  5FW9 A;  4BY6 B;  3OYD A;  2PG8 A;  1YIT T;  2A28 A;  3CCS A;  2EQK A;  3ANW B;  5CQY A;  2RPA A;  3VHL A;  2WM9 A;  3UT5 E;  2EJF A;  5IHI A;  5I11 A;  4JI0 T;  4DUY T;  3VRY A;  4RMO A;  2FJB A;  4Q25 A;  3ANW A;  2CWO A;  5CK9 A;  3OS1 A;  3SWN B;  1CSK A;  3UPU A;  5LBQ B;  4EXT A;  3CEY A;  1K0S A;  3LH0 A;  2YN6 A;  3SWN A;  3RBB B;  4F04 B;  1EFN A;  2ROL A;  1YI2 Q;  3OS0 A;  3QJ6 A;  1YJW T;  2M1H A;  4M77 C;  1G2B A;  4E2F B;  4F17 A;  1JNR A;  2A2F X;  3KIN B;  4ANJ A;  4RTX A;  1WZO A;  5LJ3 e;  1KD1 R;  1O3X A;  5FKY A;  1I8F A;  2DAQ A;  2YRV A;  2BDE A;  2XPK A;  4OYK A;  1VQO T;  3N2K E;  4U2Y A;  1M2O A;  2NW7 A;  2Y90 A;  2GTJ A;  2LMJ A;  4ME7 A;  1AOJ A;  3QO3 A;  1QVF S;  3CX6 B;  4XK8 E;  4XU2 A;  1VQN T;  2IDO B;  4KHP T;  3OYY A;  3CWZ B;  3OYC A;  4CC3 A;  1I81 A;  1LPL A;  2EWN A;  4IUP A;  2WU2 A;  2LT4 A;  3PVL A;  1HFA A;  5BR8 T;  4IUR A;  1M30 A;  1NJI R;  4Z02 A;  4D8D A;  4E7L A;  2G3R A;  4GK5 E;  3JSC A;  4IT4 A;  2IIU A;  3FJ5 A;  1KFZ A;  3SFM A;  2XAG B;  2H3R A;  1H8K A;  2VAS A;  5FRN A;  4JRP A;  2NUP B;  1K8A U;  3S3M A;  1C1A A;  2LNV A;  2CLY B;  1BKB A;  2DL8 A;  2DTO A;  4A4G A;  3Q5X A;  2LJL A;  1BIB A;  4JRI A;  3SB2 A;  4HWC A;  1YHQ Q;  2ECZ A;  3AE6 A;  1E1H B;  5HK3 A;  4DID B;  3G4S Q;  3JCM W;  2OAW A;  2NUP A;  4KRT A;  4ZI3 D;  5ECA A;  3QWX X;  1J1J A;  2DIL A;  3OYM A;  3S3O A;  3MA9 A;  1VQ7 A;  2HSP A;  2NR4 A;  3L2W A;  1W6X A;  3M0R A;  5JRE A;  5LCY A;  1N32 T;  3CCU Q;  1GCP A;  3CC4 A;  4PJO C;  3PIP A;  2KSR A;  3AEF A;  4ASK A;  1FMK A;  3GOX A;  2BZ8 A;  4DV5 T;  5CKB A;  1Q82 U;  1GCQ A;  4C92 C;  3ETU A;  3Q2M A;  2PZ1 A;  3CMA A;  3U78 A;  1SHG A;  1WX6 A;  2JJ9 A;  4PL6 A;  4ZGJ B;  3CXC A;  3JCM P;  3VS1 A;  3FXD B;  5ABF B;  1H3Z A;  2FPF A;  2DMO A;  1N8R C;  2L3P A;  3DTO A;  2E6N A;  2PUO B;  3NVO A;  2KAF A;  3UTK A;  5ABF A;  2VKH A;  3C4Z A;  2H3E B;  4HVU A;  3OBW A;  4KGZ B;  2ZGW A;  4H9R C;  3JCM V;  5ABH A;  2J4G A;  3PJA J;  4O4I E;  3N9M A;  4ZOL E;  2XI9 A;  5HYA A;  2D0T A;  3KVA A;  1M27 C;  1VA7 A;  3A8Y C;  4XAX B;  3JCM Q;  1MIW A;  1M8M A;  2YDL A;  4WW0 A;  4C0F A;  3IEE A;  4Z8X A;  2COW A;  3JCF A;  2GQV A;  3P7I A;  4LDY A;  4M7A E;  1K9M U;  3AVS A;  2DVE A;  5FVK A;  2CHN A;  4DOV A;  5LGN B;  4IIJ E;  3CC7 T;  4BD3 A;  2CEA A;  4NL2 A;  2H3J A;  2H88 A;  4ZTF A;  3ZCJ A;  4IHJ E;  1K73 C;  4ADZ A;  4G2A A;  2EHO C;  4H9N C;  3ZYL A;  3R6N A;  4XTZ A;  2MI6 A;  3QJY A;  3E9F A;  4C0Z A;  4HFB A;  3L2R A;  4JI8 T;  3UQ7 A;  1UGV A;  3LJC A;  4GLK A;  3CD6 T;  5EK3 A;  2V6X A;  2XAJ B;  2D0Q B;  2NTY A;  2KZ7 B;  4VUB A;  3JB9 H;  4M7D B;  3V8L A;  3RKY A;  4ILU A;  4DMV A;  4YXD A;  1Z9Z A;  2JMA A;  1SHF A;  4FIB A;  4M78 B;  2RA2 A;  2FBW A;  2KNB B;  2N9D A;  4J83 A;  4K0K T;  2LDM A;  3EFR A;  5CKD A;  4ZGD B;  4EMK C;  3AE5 A;  5L23 A;  1VQ5 T;  4M7D A;  2JQH A;  3HTR A;  3UUX B;  2DIG A;  3RQW A;  1XMO T;  3A8L B;  2K5I A;  5JDN A;  4Y92 A;  4C92 B;  3L2U A;  3A8O B;  4EYY R;  4M78 A;  2X4X A;  4FYX B;  4HFD A;  4IE4 A;  2M67 A;  2MWO A;  5GAN e;  2UUA T;  1QP2 A;  1RAB B;  4C92 A;  2QA4 A;  2YIN A;  1VYT A;  3NKZ A;  4ZTJ A;  4UF0 B;  2F5T X;  4DO0 A;  4FT4 A;  3MZK B;  1MUZ A;  1UEB A;  2B76 A;  2DI4 A;  1VYU A;  2AE9 A;  5AQT B;  1LCK A;  3DKM A;  4MML A;  4LMJ A;  1H3H A;  1OYX A;  3EAE A;  3MP8 A;  3VJP A;  2DWK A;  3RER A;  3VYG A;  4E7S A;  1T8B A;  1KC8 R;  2IG0 A;  2VKN A;  4U72 A;  2NUZ A;  1IBM T;  4L5G A;  4P1N A;  2YOE A;  2GK9 A;  4AFQ C;  2FJA A;  2EYW A;  2RHU A;  5DM7 R;  3RGL A;  1WI7 A;  2W0Z A;  1BR4 A;  5I2M A;  1IHV A;  2YU1 A;  5CKF A;  3QZ9 B;  4CXW A;  1VOM A;  4CN4 A;  5L3E B;  4JZ4 A;  5EZY E;  1WR6 A;  4DUZ T;  3G1J A;  1OU9 A;  2LVM A;  4M4Z A;  1YIT Q;  2LX9 A;  3OW2 P;  4QXB B;  5C6S A;  1Q7Y C;  1UHC A;  2E9X C;  3K8P C;  5AQV B;  5FYM A;  1GFC A;  4OHF A;  1AZE A;  1CUN A;  1UGO A;  3KFW X;  5HCM A;  4DR2 T;  2EHO A;  1ZUY A;  1W2B A;  4M7D D;  1X6B A;  3EG9 B;  3FB9 A;  3P4P A;  4A4H A;  3SEM A;  5AQQ B;  1YI2 A;  3EHZ A;  1BR2 A;  1I0C A;  4M78 D;  1K8A R;  3UWN A;  4DR1 T;  3LGF A;  3IHR A;  4XZC A;  3EG0 A;  1XOV A;  2WAC A;  3EG9 A;  2ZPG B;  5FMN A;  2BG9 C;  2M51 A;  2P4T A;  1W0A A;  4EMK B;  2A0F B;  4CI2 B;  4BUG A;  1YJW Q;  2QQB A;  3PUS A;  3UQ4 A;  1WPY A;  3P4W A;  2UXN B;  3C4X A;  4LF7 T;  4YLH A;  1WIE A;  3BE3 A;  4JZ3 A;  4KH1 B;  4DR6 T;  4EMK A;  5LG4 A;  3A8M B;  1YJN A;  1X2Q A;  3MEW A;  1VIE A;  1VCT A;  2QEX T;  2K5B B;  1E6G A;  2XM2 A;  3EHR A;  2HZY A;  2WWV A;  2EGE A;  4U31 A;  2CP2 A;  4LD6 A;  1J3T A;  5GAM g;  2ENM A;  4KH0 B;  1HK9 A;  1JNZ A;  3M5A A;  2XG8 D;  4X20 E;  1KNR A;  2XQ3 A;  3OS5 A;  4X9D A;  1YHQ A;  4PK4 A;  4Y28 E;  2LJ1 A;  5IT9 E;  1VQL A;  3C50 A;  4M77 G;  5FNV E;  2VV5 A;  3K1S A;  2EYQ A;  3H0I A;  2W10 A;  3JCM g;  3VKG A;  3X24 B;  5DLO A;  3F31 A;  3OYJ A;  4L6V 5;  3CCQ T;  2QTV A;  1FEW A;  3MO8 A;  2OTJ A;  4XU0 A;  1Q86 R;  2K48 A;  3FZF B;  2COY A;  2WZI A;  4OFZ A;  1OPK A;  5J2T E;  1QLB A;  1IB8 A;  2KQW A;  2DWG A;  2YDR A;  2DRM A;  3HL8 A;  4DR3 T;  3AED A;  4YHH T;  3N9P A;  2EW3 A;  5FL0 A;  2HMA A;  4UEL A;  2W63 A;  5LB7 B;  3MK7 C;  2DET A;  3A5X A;  4M77 F;  5BMV E;  3CX7 B;  2A9U A;  2H8H A;  4WCI A;  3RMS A;  3O4X E;  1S94 A;  1M3A A;  1PRL C;  2CT3 A;  1YCS B;  4LML A;  3GP8 A;  1WHG A;  3T1H T;  2BG9 B;  3TEE A;  2YKS A;  2EJG A;  2FYK A;  4IST A;  1ZLM A;  2JM9 A;  2WSC E;  3MP1 A;  4JLI A;  4BDZ A;  5JDF A;  4B3M T;  3EH2 A;  4WZX A;  3MCA B;  1X6O A;  4J7F A;  1RAD B;  5LJ5 g;  1JEG A;  3AAA B;  4IUT A;  1JJ2 A;  5FY1 A;  1YKH B;  4MMK A;  2BG9 A;  2VGM A;  2AKK A;  5GAM e;  4M7D G;  3FJP A;  5CKE A;  2XIC A;  1JQQ A;  2L89 A;  3V8J A;  4TZ4 C;  2R5A A;  4EED A;  2UXB T;  1I1J A;  2E10 A;  4HCK A;  3M56 A;  5D6W A;  5EG2 A;  4PJO G;  2A3D A;  2VKD A;  3CVR A;  4JI1 T;  1SG5 A;  2DF6 A;  5IHK A;  4C92 G;  2LSG A;  1SSH A;  1US7 B;  3E19 A;  5CIU A;  3CC7 Q;  1UX4 A;  3IF8 B;  3CME T;  3KV5 A;  3RRC A;  5IYZ E;  2HDA A;  5GAN d;  3FZH B;  4DV1 T;  2CRE A;  4RTT A;  4AXP A;  4NUV A;  1IBK T;  1D3B B;  2QGF B;  2VGN A;  1XNR T;  4M7D F;  3H6Z A;  2E70 A;  3QSU A;  1IJ5 A;  2DK3 A;  2E3I A;  2XHC A;  3ZMS B;  3HRT A;  1HNW T;  4C8Q B;  4PJO F;  1D3B A;  3OYA A;  4II1 A;  2EIF A;  4TWD A;  1NPR A;  3QHS A;  4OMO A;  1LKX A;  1IO6 A;  2D9T A;  3C0C A;  4C92 F;  3JB9 I;  3CD6 Q;  3I9Y A;  3JAF A;  4M77 E;  2EVR A;  4DQ2 A;  2CT4 A;  3ZKR A;  4C8Q A;  3V8K A;  4G63 A;  4DBR A;  4HWF A;  2E64 A;  1VQ5 Q;  2EAY A;  3C64 A;  2ZCF B;  2XHE B;  2CCQ A;  1TH7 A;  2HBP A;  3M59 A;  4YSZ A;  1ZUU A;  1SRL A;  1GBR A;  4BJN A;  3LWI A;  1OX8 A;  4UC4 A;  1MV0 B;  5LJ5 e;  2YT6 A;  2XAQ B;  2K2M A;  1MMA A;  5LGU B;  3CQT A;  1AWJ A;  1EZ3 A;  2EYY A;  1YFN A;  2V7L A;  1TOV A;  2G0U A;  3AE9 A;  5CA0 E;  1YQ3 A;  1KHC A;  2V26 A;  4HFC A;  4IRE A;  1TTH B;  3J80 E;  5KDM C;  1BR0 A;  2AZV A;  4ILB A;  3BQL A;  1X9B A;  2RHZ A;  3AEB A;  3Q5W A;  4ORZ A;  3N9Q A;  1UGR B;  2JMK A;  3AA6 B;  2QTX A;  5IUX A;  3EGX A;  3VRB A;  1KIK A;  5KYW A;  1WCR A;  3RYC E;  2MAM A;  1SEM A;  2VUB A;  1N6A A;  4ZI2 D;  4AI6 A;  2GNC A;  1M3C A;  3RIU C;  5CQX A;  4JI6 T;  3VS4 A;  2CXF A;  3MXZ A;  2EFI A;  1YIT A;  2LQW A;  2RMO A;  1N34 T;  3EFO B;  1WLP B;  2YRD A;  3QBY A;  2EGA A;  4OMQ A;  5L4H A;  2E5Q A;  2M6I A;  4PLI A;  1K73 R;  4JI4 T;  3TLT A;  2VK9 A;  3VRA A;  2J05 A;  4PJO E;  5HK0 A;  3I56 T;  1BR1 A;  3EI0 A;  3EFO A;  2CPT A;  4CC4 B;  5CGM A;  3NRX A;  4N78 D;  2BTT A;  2X4J A;  4C92 E;  4C8Q D;  7AT1 B;  1WR0 A;  4KT0 E;  1LOJ A;  1Q81 C;  1M1K R;  2YLB A;  2QQ9 A;  2KWI B;  3TU4 K;  1XTD A;  4X62 T;  1SF9 A;  1KD1 U;  4I0U A;  2LOP A;  4X66 T;  3CCU T;  1YJW A;  2RHX A;  3X25 B;  2VUR A;  2DBK A;  2QGG A;  1FMW A;  4ZN1 A;  1TSF A;  2ES0 A;  1AWO A;  1D09 B;  4OP0 A;  1YNZ A;  3SDZ A;  1BI3 A;  3UT1 A;  5H6R B;  4NXN T;  3KV9 A;  3PUR A;  4WBO A;  4QXC B;  1HG2 A;  3L1A A;  5FU7 C;  4R56 A;  2DTH A;  4LMK A;  1VQO A;  4UVA B;  1XJW B;  4O8S A;  5AQH B;  3RNJ A;  5KE2 A;  2RQV A;  4BE0 A;  1NJI U;  1VQN A;  1QVG P;  3JC6 D;  5KYU B;  2QEX Q;  3OJA A;  2MPX C;  3M9Q A;  3AE4 A;  1XDO A;  2LEH A;  2AZS A;  1M8V A;  2LP5 A;  2ZAE A;  3ZST A;  1G73 A;  5ABG A;  3OMG A;  2CZ0 B;  3MP6 A;  5KYU A;  2CP0 A;  4LF5 T;  3OW2 S;  1ZKE A;  3PFS A;  1PC0 A;  2G6F X;  1OV3 A;  3EAM A;  2JUF A;  4DBF A;  4LF8 T;  2NUT B;  3TLU A;  2COZ A;  2M16 A;  1T3S A;  2DEU A;  3PUV F;  2DYB A;  4YJ3 E;  4Z88 A;  3T9N A;  2BKD N;  3RX6 A;  1CKB A;  4BY6 C;  2NUT A;  4M75 B;  2XQ9 A;  4J9I A;  1ABO A;  3CCQ Q;  1VRB A;  2H7V C;  2WSS V;  4HT8 A;  1MNE A;  3Q5D A;  2R5M A;  4AQY T;  5GAM d;  3CCE T;  3AAI A;  5AQG B;  5ADX L;  4J7I A;  2JTM A;  1ZA1 B;  1UUE A;  4HWD A;  4M75 A;  1Q7Y R;  3JCM J;  3Q9D A;  4DR4 T;  4D8K A;  3PJA A;  3SWN C;  2E2A A;  2WSE E;  1K76 A;  2YHT A;  4J9G A;  2IW5 B;  2V5C A;  1W0B A;  3LFM A;  1M4Z A;  5LJN A;  1U4Q A;  1SHZ C;  4B3S T;  1VUB A;  2DZC A;  4GLM A;  4JPB W;  5A0L A;  4P0A A;  2CP5 A;  3CCL Q;  4TN7 B;  5FVL A;  3QPH A;  3C4W A;  2RI3 A;  1MIV A;  4FYW B;  5F3J A;  4LDV A;  1R8I A;  1NEK A;  2DM1 A;  4M7A D;  1X69 A;  3K3O A;  2QQS A;  1VCS A;  4NOY A;  1NM7 A;  2SEM A;  3VS2 A;  4QH1 A;  2V1D B;  5KMG P;  2KT8 A;  1E6H A;  4C90 A;  2K2V A;  2VVK A;  3LG7 A;  2FPE A;  4QX7 B;  1IGQ A;  2CH4 A;  1VQ4 A;  2HL3 A;  3CC7 A;  2BVM A;  3JCM c;  3ZMT B;  3LLR A;  2KRS A;  2DL1 A;  2JT4 A;  5FY7 A;  2MCN A;  2CBI A;  2V7I A;  4CN6 A;  1FYN A;  4D6W A;  4F7U B;  1RAC B;  3CME Q;  5I21 A;  2CLY C;  2VL0 A;  1OWA A;  4M75 D;  3LK3 B;  1QSD A;  2XQ5 A;  2YSQ A;  2CA5 A;  3ZBD A;  4E7K A;  2DL4 A;  3OMC A;  4PJN A;  3CD6 A;  3P4Q A;  9ATC B;  2XD0 A;  4F7U A;  3H9N A;  2JS2 A;  5HXE A;  4FW1 A;  2WZH A;  2WMN A;  4AFU C;  4TNW A;  4JEH B;  4ZZC A;  2QAZ A;  4DV4 T;  2YDS A;  2BG9 E;  1S1N A;  4OGC A;  1GCQ C;  2HAX A;  2W4X A;  1VQ5 A;  3CCM A;  3WVE B;  2HSE B;  3QOF A;  1QVF A;  4C0D C;  2EQI A;  1UDL A;  1K9A A;  4P09 A;  4HVV A;  5AFU L;  2IUB A;  1T7S A;  1UG1 A;  2OI3 A;  2HNI A;  5HWY A;  3BQK A;  2DPP B;  4N0A A;  2NLU A;  5JRC B;  5GAO n;  4A98 A;  2VYT A;  2WU5 A;  3QZ5 B;  1KC8 U;  2DZ9 A;  2YXY A;  2DER A;  2WQY A;  3CPW P;  2O9S A;  1HS7 A;  5GJW B;  4OML A;  2SRC A;  1JRI A;  2WB5 A;  3PUG A;  1U3O A;  1G5V A;  4JJD A;  5JRC A;  3EG1 A;  2Z6E A;  5CKH A;  5GMK j;  2KY9 A;  5I22 A;  3QUJ A;  2Y6X A;  3H41 A;  4CQI A;  4KGV B;  2WS3 A;  4B9W A;  4J8O A;  1NG2 A;  3N5L A;  1PKS A;  2V7K A;  4JUV A;  2RB6 A;  1WHM A;  3QYG B;  4TWF A;  3OYB A;  2XQ7 A;  2DXB A;  3G6E A;  3NTI A;  4DEX A; 
#chains in the Genus database with same CATH homology
 4P5N A;  1ZHI A;  3ZYK A;  3DB4 A;  4QVZ A;  1U8R A;  1UB4 A;  5J3B A;  3LX7 A;  5A0G A;  1IRE B;  3SOL A;  3ASK A;  2JOY A;  3A8H B;  3P8C D;  3ZJ1 A;  3SWH A;  1QVP A;  3HHT B;  1N9R A;  2X4W A;  1NPP A;  4CXY A;  2I59 A;  2ZLY A;  2RJD A;  4PK5 A;  4A4F A;  2NOX A;  5GAO q;  4M7D C;  4WBN E;  4HEA A;  3M65 A;  4M78 C;  3S4U A;  1VQ6 T;  4C0D B;  3ER0 A;  1OZ3 A;  3QKJ A;  2ZM2 A;  4M75 G;  4IGU A;  3M4Y A;  3CBM A;  4HT9 A;  2XU8 A;  3JB9 D;  4E7Z A;  4IUU A;  4EZ4 A;  1YJ9 A;  2QEX A;  1HG5 A;  3Q1J A;  2FHD A;  3EVY A;  3N9O A;  2V8I A;  4XTV A;  1M90 C;  2C06 A;  2ZPE B;  2PU9 B;  3OA6 A;  1WJQ A;  3N9N A;  3RKX A;  2RJE A;  4OVA A;  3FBZ A;  4MZM A;  3G71 T;  4UIG A;  3H8Z A;  2X9H A;  2GCX A;  3PU8 A;  4EB6 E;  3OYX A;  4X1I E;  1Q86 U;  4M75 F;  1ZHC A;  3RYF E;  4AQG A;  3CCV T;  2VXE A;  4RG8 A;  3I9W A;  3FRN A;  4C5E A;  4ZI7 E;  2LOS A;  4BDY A;  3I1A A;  5L3C B;  3RC3 A;  2D0U A;  4PJM A;  3P8D A;  1BI0 A;  4BI8 B;  1YKE B;  3E08 A;  5LJM A;  3CXC S;  2NTX A;  2X9W A;  2ZM0 A;  2PVO B;  1UGP B;  3NTH A;  4N4I A;  2JTF A;  3OKQ A;  2X68 A;  1QVG S;  4MDX A;  5HXC A;  2K9A A;  4UXN B;  1D0Z A;  3V5S A;  1MHN A;  2YEV C;  3QXE B;  3NZP A;  4A4K A;  2N2N A;  3RC8 A;  4OB0 B;  3O9X A;  2X4Y A;  3WXM B;  4RKU E;  4XU3 A;  3CC2 T;  5C8Y E;  2X66 A;  2L9Q A;  3RUX A;  3F70 A;  4EOZ B;  4F7U F;  5GAN 8;  2A7Y A;  2K4Y A;  2ZPB B;  4I50 E;  4BA9 A;  4KUM B;  3V7C A;  2K24 A;  1S72 A;  3FIF A;  4UF0 A;  5GAN 2;  3A8G B;  5GAO r;  3H37 A;  3E1S A;  3R84 B;  3NFC A;  2W61 A;  1WJR A;  3SS1 A;  1Y7X A;  3AVR A;  2CM0 A;  5GAN f;  1SA0 E;  5LJ3 d;  3ETV A;  4V2S A;  3DB3 A;  4UEM A;  2LQK A;  4PKC C;  2D5U A;  3JB9 J;  4GOU A;  5JQG E;  3C94 A;  4PFO A;  2RH2 A;  3UUL A;  3JB9 F;  2Y4X A;  1NE8 A;  3URG A;  5LBM A;  5FXX A;  2NW9 A;  3CKD A;  5KCH A;  3TKL B;  3EDU A;  5KE3 A;  4OB3 B;  3DLM A;  2L5Q A;  4A56 A;  3HI2 A;  5JH7 E;  4BJM A;  2CXL A;  1D1B A;  2L8D A;  2JPF A;  4HCB A;  3OS2 A;  1YBY A;  1K73 U;  1Y64 B;  4KUD K;  3BDL A;  4JEU B;  4ZI2 C;  2GFA A;  4HKE A;  5H6Q B;  4BAC A;  1M1K U;  3E22 E;  2DHR A;  4KBM B;  2LCC A;  1KNZ A;  1BI1 A;  4MHC A;  5HXS A;  2RJF A;  3G4S A;  3OYN A;  3QK6 A;  3MHX A;  2QQA A;  1JB0 E;  2LCL A;  5JDM A;  1ZBX A;  2I2L A;  2WMO A;  2X51 A;  2RI2 A;  2X9X A;  3ZFJ A;  5EK2 A;  1G3S A;  4C8Q C;  3CCU A;  3CBO A;  2XAS B;  2VWA A;  3L2Q A;  1OI1 A;  3CPW S;  4IE6 A;  4JRQ A;  5M4Y A;  3ZMU B;  4U74 A;  4O4L E;  4HN9 A;  3CCL T;  2ZZD A;  4BB7 A;  5J39 A;  4TV9 E;  5CCA A;  2Y48 B;  2QA7 A;  3K3Q C;  4CI1 B;  3JC6 C;  1W4S A;  1Z0P A;  2P0P A;  1HX8 A;  4PAG A;  3V7S A;  2A72 A;  2FVU A;  1S35 A;  2EKO A;  4LDW A;  2SPC A;  3FHN A;  2JQQ A;  4M78 G;  4J6X A;  3OBY A;  4M1P A;  4EDU A;  3RKO A;  3HKC E;  5J2U E;  4JLG A;  1SSF A;  1Q7Y U;  2JN0 A;  4IE7 A;  1KD1 C;  2XAF B;  1MMD A;  1PSE A;  2DIQ A;  3JCM e;  3CCE A;  3LWH A;  5JDH A;  4CXX A;  1HCI A;  3GN5 B;  4Y91 A;  1BI2 A;  5HXH A;  4EAH A;  2PQW A;  3W15 B;  5GAM f;  4M78 F;  2XK0 A;  1D0X A;  3GN5 A;  4YJ2 E;  3VKH A;  2LHR A;  2OTL T;  2X35 A;  1NJI C;  4J6Y A;  4JS4 A;  4OB1 B;  3TRE A;  3BDU A;  4XTY A;  5A2Q E;  2GF7 A;  4QKN A;  3E9G A;  3L3P A;  2CGH A;  5HY6 A;  2PJQ A;  5D6X A;  5GMK h;  3VUZ A;  3TCJ A;  4MAL A;  3J81 E;  4M7A C;  3P8B B;  1LRZ A;  4O6J A;  1WQW A;  4E7J A;  2RI5 A;  5GAN 7;  2K57 A;  4UVC B;  5GAN h;  2H7O A;  3PNW C;  1B7T A;  4E7H A;  3WAJ A;  2PBI A;  4QXH B;  4ERR A;  1WNL A;  2IVW A;  5CA1 E;  4MFR A;  4QQ6 A;  2NWB A;  3M58 A;  2K3X A;  5LP6 E;  2YLC A;  2HQX A;  3EFS A;  1UCU A;  2RD1 A;  4R55 A;  1WYB A;  5IN1 A;  4EPC A;  1WGS A;  2ZPI B;  2QGS A;  2PFV A;  5LJ5 f;  1LJO A;  4M7D E;  4M75 C;  4J6W A;  2XUE A;  4V1A v;  4M78 E;  2DLR A;  2RHI A;  2E8I A;  2OAU A;  3D0T A;  5JR9 B;  2HPJ A;  3CPZ A;  5GMK m;  4K0U A;  2MYS A;  3M4G A;  1PSF A;  3KV6 A;  4HA8 A;  4MBQ A;  3N2O A;  5LHI B;  2XQY A;  5JR9 A;  2KT9 A;  4P0B A;  1IZ6 A;  2CE7 A;  4AQF C;  2V7M A;  2ZPF B;  3RYI E;  2K3Y A;  3OW2 A;  2XDB A;  2HD0 A;  4O5V A;  4DOW A;  2D2S A;  1IJ6 A;  4GIW A;  3UFE A;  4HTE A;  4X9C A;  4M7A B;  3KBT A;  2J1D G;  4AKR B;  1EIF A;  4EYU A;  4BE1 A;  2DNX A;  3OYE A;  3RIR A;  4M7A A;  5F8P A;  3FLG A;  2LRQ A;  3KXT A;  2ACX A;  4TV8 E;  5LJ3 j;  5FXW A;  1R8O B;  5DY9 A;  4QHO A;  3LBX B;  3HFO A;  1XNI A;  4DMW A;  1YW0 A;  3AAE B;  4H9Q C;  4KUI A;  3QUI A;  3CCR T;  5JDL A;  5FP3 A;  4XTW A;  3LBX A;  4XBF B;  5FY0 A;  2PUK B;  1KC8 C;  4PK6 A;  4TVR A;  3H3A A;  2LT1 A;  1VQ6 A;  2DKG A;  2JVV A;  3GLX A;  3HFN A;  4JLE A;  3ZCI A;  3QYH B;  1MGQ A;  4N0A C;  5GAO p;  4KP3 C;  4OK0 A;  1HXD A;  2XKO C;  2X0L B;  3JCM d;  4A53 A;  4DND A;  3KDS E;  3MEU A;  4NS5 A;  3DLL A;  3CQX C;  4AQF A;  1Y07 A;  1N27 A;  3CQC B;  3CCJ T;  3PDY A;  1YIJ T;  4C8Q G;  4HKA A;  2DTI A;  4QX8 B;  5DAB A;  1K8A C;  4CZZ B;  5LXT E;  4QW2 A;  1NWM X;  5A1L A;  5GAM h;  2C0S A;  2DD4 A;  1KQS S;  5LYJ E;  3HKB E;  2LHN A;  2LSJ A;  5GAN 4;  3O1H A;  1N9S A;  5FU6 B;  5HAX A;  5CR2 A;  1ZQ1 A;  1G8X A;  2DJZ A;  1Q81 U;  3LW5 E;  3C95 A;  2EQJ A;  2RHY A;  3JRZ A;  4PFP A;  2PVG B;  4X1Y E;  5LJ5 d;  4C8Q F;  2WBL A;  3SD4 A;  1VQM T;  1AJ3 A;  1Q82 C;  3PMT A;  1H7C A;  3OBV E;  3GNF B;  4ZN3 A;  2VL8 A;  3I0O A;  4QVC A;  3ESL A;  1ZEE A;  2CYZ B;  1HF8 A;  2XDP A;  3F2E A;  3B57 A;  3ONX A;  1VQK T;  2LTO A;  3CC2 A;  5LNK A;  3K3N A;  4C5H A;  1RI0 A;  3EUH A;  2W0G A;  1Q86 C;  3LGL A;  2MWP A;  3PUA A;  1AHJ B;  1FX7 A;  5LJ5 h;  2RK1 A;  1K9M C;  3BFM A;  3LK4 2;  3ZLI A;  2DO3 A;  2JZ2 A;  2MF2 A;  1T98 A;  3HL6 A;  3ZMZ B;  1P92 A;  3KBG A;  4BI4 A;  5FXZ A;  4CRI A;  2OA5 A;  1X75 C;  1ZV4 X;  2Q9Q C;  2ZMA A;  5L3B B;  3M55 A;  3ZN1 B;  2DXC A;  2LSY A;  1MMG A;  3FB2 A;  3HKD E;  2A3L A;  5GAN j;  2VB6 A;  2NW8 A;  4C8Q E;  5KX5 E;  4OGE A;  3ZYM A;  4M7A G;  4B6X A;  4TUY E;  5IAY A;  3X20 B;  4IDZ A;  1U5P A;  1BIA A;  4PJJ A;  5LJ3 f;  4FU6 A;  3OB9 A;  1U1S A;  2IC6 A;  4ZS3 A;  3PU3 A;  2M9U A;  3F57 A;  4FL6 A;  3QII A;  3BW1 A;  2C5K T;  2FB7 A;  3VV0 A;  2L3L A;  4LDU A;  4ELZ C;  3OYZ A;  4ATO A;  1KG1 A;  1VQP T;  3RYH E;  4M7A F;  2W00 A;  3HA4 A;  1UGQ B;  3HPW A;  4EMG A;  4L9I A;  1VQ8 T;  2PVD B;  4OB2 B;  2RA1 A;  1KQ2 A;  2CKK A;  5GMK l;  3WI3 A;  5LOV E;  3ZC1 A;  3E0Z A;  3NBX X;  2MMP A;  3M54 A;  3DP7 A;  1QUU A;  1VIF A;  2DCF A;  3BK9 A;  3G7Z A;  2Q9Q B;  4AKI A;  2KXP B;  4E47 A;  4PW8 A;  4DBQ A;  3CQG B;  2CMR A;  4N4G A;  1QVG A;  5KCO A;  2Q9Q A;  5JDQ A;  3CCQ A;  4M77 B;  2CS7 A;  3I55 T;  3CPF A;  1JBM A;  2B8A A;  3N9L A;  3VYH B;  4ZGE B;  5GAN g;  5J26 A;  4M77 A;  3AHU A;  2E6Z A;  1X79 A;  3SRZ A;  1UGS B;  1KK7 A;  2WSF E;  3PTA A;  3HKS A;  1D1A A;  1XQH A;  3CCL A;  1VQ4 T;  1VQ9 T;  3RMQ A;  4H9S E;  4C5I A;  2Y4Y A;  3HP9 A;  2RO0 A;  5I2S A;  1YCY A;  4JRK A;  2KVQ G;  4F7U G;  2BZB A;  3O8V A;  5LGT B;  2VKO A;  1FWZ A;  3RES A;  1M1K C;  4QQD A;  2E12 A;  2R57 A;  5FXV A;  5L3D B;  4AKH A;  4X1K E;  2LC4 A;  4XQ3 A;  2HH7 A;  4NL3 A;  3CCS T;  3KUF A;  3ZEF B;  5FRM A;  2VC8 A;  2CZ6 B;  2X9Y A;  5GMK e;  3OYI A;  3PE0 A;  3CCM T;  1FXX A;  2Q9Q D;  4M75 E;  4PJO B;  1MIY A;  2L3R A;  2V8J A;  3GA8 A;  3N2G E;  3RPU A;  3CME A;  2XID A;  3GNG A;  2E1H A;  3JB9 G;  3L2V A;  2Y8D A;  4PJO A;  4M77 D;  5A0D A;  3PT9 A;  2KDS A;  3MJX A;  5GAM j;  4H9P C;  3OQ5 A;  3UDC A;  3MEV A;  3S3N A;  2WAU A;  3ZN0 B;  2OTL A;  2BVL A;  3J7A F;  4ZS2 A;  2YK0 A;  3QG1 A;  4PJL A;  3JAM E;  5KH6 A;  2DXU A;  3A5Z B;  3INZ A;  1N8R U;  1FMV A;  3MKD A;  1M90 U;  3G6E T;  5GAO m;  2XAH B;  2LQ8 A;  4GY5 A;  4JDS A;  3O1J A;  1X01 A;  3OYL A;  2EHO B;  2JRK A;  2KSS A;  1LVF A;  5M9O A;  2YU2 A;  3ME9 A;  5L8R E;  1MMN A;  5LJ3 h;  5GON E;  5TAO A;  4A54 A;  4F7U E;  2RM4 A;  2QQR A;  2WWU A;  3J9X 1;  4PJO D;  3KV4 A;  1VQ7 T;  3FEO A;  4AKG A;  4UV8 B;  4RCC A;  5LJ5 j;  4C92 D;  3CPW A;  3CC4 T;  3HRU A;  5E0O A;  1LNX A;  3I56 A;  1WJS A;  3CMA T;  2R58 A;  1O9S A;  3VU3 C;  5GAN 5;  1YJ9 T;  3AA7 B;  4IUQ A;  1W2B S;  4H63 H;  5C0M A;  3LYI A;  1QP3 A;  2NP9 A;  3B13 A;  1BYM A;  3U3I A;  2RK2 A;  3WAK A;  5LHH B;  4MZP A;  3JCM b;  5L2L A;  2QXF A;  3R6O A;  3HKE E;  3NRY A;  3OSS C;  4NUU A;  4FM4 B;  3V5U A;  4A4E A;  3GMI A;  3FBL A;  1I4K 1;  2M0O A;  2EHO D;  5FRO A;  2VKJ A;  3UUM A;  3NTK A;  1V29 B;  5GMK i;  3C4S A;  5DLQ E;  2E9X B;  2LT3 A;  4IE5 A;  2BUD A;  2JNG A;  4FT2 A;  4I43 B;  5FLX E;  4DA4 A;  2KK4 A;  3M57 A;  4LD9 K;  2E9X A;  5L3F B;  5JVD E;  1WYC A;  3PMI A;  4Q5W A;  1I5L A;  2P0Q A;  4C0G A;  4AKL A;  2ZM8 A;  2F5K A;  2D6F A;  3CCR A;  4EIW A;  1Y96 B;  1RL2 A;  3N5B B;  2LM9 A;  3ZEH A;  3FDR A;  4OYJ A;  4F6R C;  1Y96 A;  5JR9 C;  4YFS A;  2RP4 A;  2QA4 T;  2DEQ A;  4HE8 A;  5J1G A;  4QVD A;  5CVI A;  4X34 A;  3T8O A;  2JMH A;  5LA6 E;  1O75 A;  3L09 A;  2ZPH B;  4WNK A;  2XTL A;  4QQG A;  3HRS A;  1S72 T;  4EZH A;  2E41 A;  2ODV A;  1V9D A;  3CCJ A;  2MTQ A;  1YIJ A;  3RH3 A;  3JCM f;  4WF2 A;  2DXT A;  1JJ2 S;  2BIV A;  3AA0 B;  4L59 A;  4EMH A;  3C12 A;  4RCB A;  3UUN A;  4C5G A;  2E9X D;  2L8K A;  2P9B A;  2C5J A;  3FXE B;  2CWY A;  3OY9 A;  2HQE A;  3NZQ A;  3I0Q A;  2XDD A;  3BQI A;  5D6Y A;  3PUQ A;  1D1C A;  2KMF A;  2KWH A;  2GFU A;  1U1T A;  1YI2 T;  2CZ1 B;  3FC3 A;  1VQM A;  5CO7 A;  5LHG B;  3OSV A;  4N4H A;  1YD8 G;  2W62 A;  1OZ2 A;  5HXR A;  2EQM A;  1MND A;  4LDX A;  3QDR B;  3QC9 A;  5GAN 6;  3J7Y q;  1LVK A;  2KND A;  1NZ9 A;  4FI5 A;  1M5Q 1;  1DJ7 B;  3AA1 B;  2KMT A;  5CAI A;  4PNI A;  4I55 E;  1VQK A;  1WLX A;  2UXX B;  1YJN T;  3RRW A;  4YTL A;  5EK4 A;  1G3Y A;  2QDY B;  4JUY A;  3CX8 B;  1OXZ A;  4KMC A;  4ISS A;  5HKC A;  4MZT A;  4HGA A;  2V8K A;  3ZC0 A;  3PIO A;  2EJ9 A;  4CI0 C;  1YHQ T;  3G4S T;  2X67 A;  1VQL T;  3M53 A;  4PLL A;  4DVD A;  3GF5 A;  1H64 1;  3GWH A;  4UV9 B;  5IHY A;  3CML A;  5GAN 3;  3X26 B;  3GIB A;  4CI3 B;  4PNO A;  2OTJ T;  3PTR B;  3AB3 B;  4FJO A;  3VUB A;  5DQV A;  5DQW A;  2IC9 A;  1KQ1 A;  2AHJ B;  5GAO l;  3HR0 A;  1HTJ F;  4O4H E;  5ETW A;  3WVD B;  5L3G B;  3HSB A;  5FU6 C;  3L42 A;  4XU1 A;  2MOZ A;  1M9S A;  2K5L A;  4HCC A;  4I4T E;  2CXD A;  4QWN B;  2ODU A;  1WQ7 A;  4TX5 A;  3VU7 H;  4XTX A;  3DJB A;  4XTU A;  5AYF A;  4IE0 A;  2FL7 A;  4O4J E;  5JDG A;  4YHJ A;  1UX5 A;  3VKI A;  2LSK A;  1VQP A;  3S6W A;  2B1E A;  4E7I A;  1KHI A;  4GK0 E;  4L0R A;  4H9O C;  2QI2 A;  1KQS A;  3ZJ2 A;  3CBP A;  4MDW A;  1VQ8 A;  1D0Y A;  3LK2 B;  4UVB B;  2EQU A;  1FIO A;  2C5I T;  2E65 A;  4H63 V;  2O4X B;  4JS5 A;  5CB4 E;  4J2C A;  4ZI3 C;  2F69 A;  3P8H A;  4OMF B;  4BE2 A;  3L2Z A;  4IKF A;  2MBG A;  5HWX A;  3EDV A;  3V7R A;  3MAC A;  3PGG A;  3X28 B;  2O4X A;  4OF1 A;  3G71 A;  4B9X A;  1GXI E;  3BY7 A;  1WRD A;  1IAP A;  4J5Y A;  2KIN B;  2K5F A;  2KLQ A;  2HPL A;  4MLK A;  4ELY C;  3CCV A;  3I55 A;  4HFV A;  4RG2 A;  3RKW A;  2N1G A;  3O1I A;  5DJQ C;  2LSI A;  3OYK A;  2O01 E;  4KUL A;  1M1G A;  2LE8 A;  5FU7 B;  2CZ7 B;  4O2B E;  4BAY B;  1QW1 A;  3MET A;  3C98 B;  3JCM h;  3OYH A;  3GPL A;  4O2A E;  1B34 B;  5LJ3 g;  1NAF A;  2IAK A;  4C91 A;  3OYF A;  1Y71 A;  1G3T A;  1VQ9 A;  3ZMV B;  4JJN K;  2VXF A;  2DD5 A;  1M1F A;  3IBP A;  3KVB A;  3C51 A;  2RJC A;  1B34 A;  2P0K A;  4BI3 A;  4FSX A;  1IZN B;  3OYG A;  4IUV A;  2V7J A;  4ZHQ E;  4GYR A;  4GYS A;  4HCZ A;  3JCM X;  5LL6 S;  3MEA A;  3KBU A;  1G3W A;  3ZPO A;  4BY6 B;  3OYD A;  2PG8 A;  1YIT T;  3CCS A;  2EQK A;  3ANW B;  5CQY A;  3VHL A;  2WM9 A;  3UT5 E;  2EJF A;  4RMO A;  3ANW A;  2CWO A;  5CK9 A;  3OS1 A;  3SWN B;  3UPU A;  5LBQ B;  4EXT A;  3CEY A;  3LH0 A;  3SWN A;  3OS0 A;  3QJ6 A;  1YJW T;  2M1H A;  4M77 C;  2A2F X;  3KIN B;  4ANJ A;  5LJ3 e;  1O3X A;  1I8F A;  2DAQ A;  2YRV A;  2BDE A;  4OYK A;  1VQO T;  3N2K E;  2NW7 A;  2Y90 A;  4ME7 A;  3QO3 A;  1QVF S;  3CX6 B;  4XK8 E;  4XU2 A;  1VQN T;  3OYY A;  3CWZ B;  3OYC A;  1I81 A;  2EWN A;  4IUP A;  2LT4 A;  1HFA A;  4IUR A;  4Z02 A;  4E7L A;  2G3R A;  4GK5 E;  3JSC A;  3SFM A;  2XAG B;  2H3R A;  2VAS A;  5FRN A;  4JRP A;  1K8A U;  3S3M A;  2LNV A;  2CLY B;  1BKB A;  2DTO A;  4A4G A;  3Q5X A;  2LJL A;  1BIB A;  4JRI A;  3SB2 A;  1E1H B;  5HK3 A;  3JCM W;  4ZI3 D;  3S3O A;  3OYM A;  3MA9 A;  1VQ7 A;  3L2W A;  5JRE A;  5LCY A;  3CC4 A;  4PJO C;  3PIP A;  4ASK A;  3GOX A;  5CKB A;  1Q82 U;  4C92 C;  3ETU A;  3Q2M A;  3CMA A;  3U78 A;  3CXC A;  4PL6 A;  2JJ9 A;  4ZGJ B;  3JCM P;  3FXD B;  1H3Z A;  1N8R C;  3DTO A;  2E6N A;  2PUO B;  2KAF A;  3UTK A;  2VKH A;  3C4Z A;  3OBW A;  2ZGW A;  4H9R C;  3JCM V;  4O4I E;  3N9M A;  4ZOL E;  2XI9 A;  5HYA A;  2D0T A;  3KVA A;  4XAX B;  3JCM Q;  1MIW A;  4WW0 A;  4C0F A;  3IEE A;  4Z8X A;  2GQV A;  4M7A E;  3P7I A;  4LDY A;  1K9M U;  3AVS A;  2DVE A;  4DOV A;  5LGN B;  4IIJ E;  3CC7 T;  4BD3 A;  2CEA A;  4NL2 A;  2H3J A;  4ZTF A;  3ZCJ A;  4IHJ E;  1K73 C;  4ADZ A;  4G2A A;  2EHO C;  4H9N C;  3ZYL A;  3R6N A;  4XTZ A;  2MI6 A;  3QJY A;  3E9F A;  4C0Z A;  3L2R A;  3LJC A;  4GLK A;  3CD6 T;  5EK3 A;  2XAJ B;  2D0Q B;  2NTY A;  2KZ7 B;  4VUB A;  3JB9 H;  4M7D B;  3V8L A;  3RKY A;  4ILU A;  4DMV A;  4FIB A;  4M78 B;  2RA2 A;  2N9D A;  4J83 A;  2LDM A;  3EFR A;  5CKD A;  4ZGD B;  4EMK C;  1VQ5 T;  4M7D A;  3UUX B;  2DIG A;  3A8L B;  4C92 B;  2K5I A;  5JDN A;  3L2U A;  3A8O B;  4EYY R;  4M78 A;  2X4X A;  4IE4 A;  2M67 A;  2MWO A;  5GAN e;  1QP2 A;  2QA4 A;  4C92 A;  2YIN A;  4ZTJ A;  4UF0 B;  2F5T X;  4DO0 A;  4FT4 A;  3MZK B;  1UEB A;  2DI4 A;  3DKM A;  4MML A;  1OYX A;  3EAE A;  3MP8 A;  3VJP A;  2DWK A;  3RER A;  3VYG A;  4E7S A;  2IG0 A;  4U72 A;  4L5G A;  2GK9 A;  5DM7 R;  2RHU A;  1BR4 A;  5I2M A;  2YU1 A;  5CKF A;  3QZ9 B;  4CXW A;  1VOM A;  5L3E B;  5EZY E;  1WR6 A;  2LVM A;  2LX9 A;  4QXB B;  5C6S A;  1Q7Y C;  2E9X C;  3K8P C;  5FYM A;  4OHF A;  1CUN A;  3KFW X;  1W2B A;  2EHO A;  4M7D D;  3FB9 A;  4A4H A;  1YI2 A;  4M78 D;  1BR2 A;  3UWN A;  3LGF A;  3IHR A;  4XZC A;  2WAC A;  1XOV A;  2ZPG B;  5FMN A;  2P4T A;  4EMK B;  4CI2 B;  4BUG A;  2QQB A;  3PUS A;  1WPY A;  2UXN B;  3C4X A;  4YLH A;  4EMK A;  5LG4 A;  3A8M B;  1YJN A;  3MEW A;  1VIE A;  2QEX T;  2K5B B;  4LD6 A;  5GAM g;  1HK9 A;  3M5A A;  2XG8 D;  4X20 E;  3OS5 A;  4X9D A;  1YHQ A;  4PK4 A;  4Y28 E;  5IT9 E;  1VQL A;  3C50 A;  4M77 G;  5FNV E;  2VV5 A;  2EYQ A;  3JCM g;  3VKG A;  3X24 B;  5DLO A;  3F31 A;  3OYJ A;  4L6V 5;  3CCQ T;  1FEW A;  3MO8 A;  2OTJ A;  4XU0 A;  2K48 A;  4OFZ A;  5J2T E;  2KQW A;  2DWG A;  3HL8 A;  3N9P A;  4UEL A;  2W63 A;  3MK7 C;  3A5X A;  4M77 F;  5BMV E;  3CX7 B;  3RMS A;  3O4X E;  1S94 A;  3GP8 A;  3TEE A;  2EJG A;  2FYK A;  4IST A;  2WSC E;  4BDZ A;  3MP1 A;  4JLI A;  5JDF A;  3MCA B;  4J7F A;  1X6O A;  5LJ5 g;  3AAA B;  4IUT A;  1JJ2 A;  5FY1 A;  1YKH B;  4MMK A;  2VGM A;  4M7D G;  5GAM e;  3FJP A;  5CKE A;  2XIC A;  2L89 A;  3V8J A;  4TZ4 C;  2R5A A;  2E10 A;  5EG2 A;  3M56 A;  5D6W A;  4PJO G;  2A3D A;  2VKD A;  3CVR A;  4C92 G;  2LSG A;  1US7 B;  3E19 A;  5CIU A;  1UX4 A;  3IF8 B;  3CME T;  3KV5 A;  3RRC A;  5IYZ E;  5GAN d;  4AXP A;  4NUV A;  1D3B B;  2VGN A;  4M7D F;  3H6Z A;  2E70 A;  3QSU A;  1IJ5 A;  2DK3 A;  2XHC A;  3ZMS B;  3HRT A;  4C8Q B;  4PJO F;  1D3B A;  3OYA A;  4II1 A;  2EIF A;  1NPR A;  3QHS A;  1LKX A;  2D9T A;  3JB9 I;  4C92 F;  3I9Y A;  4M77 E;  4DQ2 A;  4C8Q A;  3V8K A;  4G63 A;  4DBR A;  2E64 A;  2EAY A;  3C64 A;  2ZCF B;  2XHE B;  2CCQ A;  1TH7 A;  2HBP A;  3M59 A;  4BJN A;  3LWI A;  4UC4 A;  5LJ5 e;  2XAQ B;  1MMA A;  5LGU B;  1EZ3 A;  2V7L A;  2G0U A;  5CA0 E;  1KHC A;  2V26 A;  3J80 E;  5KDM C;  1BR0 A;  3BQL A;  2RHZ A;  3Q5W A;  3N9Q A;  1UGR B;  2JMK A;  3AA6 B;  2QTX A;  3RYC E;  2VUB A;  2MAM A;  1N6A A;  4ZI2 D;  4AI6 A;  5CQX A;  2CXF A;  3MXZ A;  2EFI A;  1YIT A;  3QBY A;  2E5Q A;  4PLI A;  2VK9 A;  4PJO E;  5HK0 A;  3I56 T;  1BR1 A;  3NRX A;  4N78 D;  2X4J A;  4C92 E;  1Q81 C;  4C8Q D;  4KT0 E;  1LOJ A;  2YLB A;  2QQ9 A;  2KWI B;  3TU4 K;  1XTD A;  1KD1 U;  2LOP A;  3CCU T;  1YJW A;  2RHX A;  3X25 B;  4ZN1 A;  1FMW A;  2ES0 A;  4OP0 A;  3SDZ A;  1BI3 A;  3UT1 A;  5H6R B;  3KV9 A;  3PUR A;  4WBO A;  4QXC B;  1HG2 A;  3L1A A;  5FU7 C;  4R56 A;  2DTH A;  1VQO A;  4UVA B;  4O8S A;  5KE2 A;  4BE0 A;  1NJI U;  1VQN A;  3JC6 D;  3OJA A;  3M9Q A;  2LEH A;  1M8V A;  1G73 A;  3OMG A;  2CZ0 B;  3MP6 A;  3OW2 S;  1ZKE A;  3PFS A;  2JUF A;  2M16 A;  4YJ3 E;  3T9N A;  2BKD N;  3RX6 A;  4BY6 C;  4M75 B;  1VRB A;  2H7V C;  2WSS V;  4HT8 A;  1MNE A;  2R5M A;  5GAM d;  3CCE T;  3AAI A;  5ADX L;  4J7I A;  2JTM A;  4M75 A;  3JCM J;  3Q9D A;  3SWN C;  2WSE E;  2YHT A;  2IW5 B;  3LFM A;  1M4Z A;  5LJN A;  1U4Q A;  1SHZ C;  1VUB A;  2DZC A;  5A0L A;  4P0A A;  4TN7 B;  3QPH A;  3C4W A;  2RI3 A;  1MIV A;  5F3J A;  4LDV A;  4M7A D;  3K3O A;  2QQS A;  4NOY A;  2V1D B;  5KMG P;  4C90 A;  2K2V A;  3LG7 A;  4QX7 B;  1VQ4 A;  3CC7 A;  2BVM A;  3JCM c;  3ZMT B;  3LLR A;  5FY7 A;  2V7I A;  4D6W A;  4F7U B;  5I21 A;  2CLY C;  1OWA A;  4M75 D;  3LK3 B;  1QSD A;  2CA5 A;  3ZBD A;  4E7K A;  3OMC A;  4PJN A;  3CD6 A;  2XD0 A;  4F7U A;  5HXE A;  2WMN A;  4JEH B;  4OGC A;  2HAX A;  1VQ5 A;  3CCM A;  3WVE B;  1QVF A;  4C0D C;  4P09 A;  5AFU L;  2HNI A;  5HWY A;  3BQK A;  2DPP B;  4N0A A;  2NLU A;  5JRC B;  5GAO n;  2VYT A;  3QZ5 B;  1KC8 U;  2DZ9 A;  1HS7 A;  1JRI A;  3PUG A;  1G5V A;  5JRC A;  2Z6E A;  5CKH A;  5GMK j;  2KY9 A;  3QUJ A;  2Y6X A;  4CQI A;  4B9W A;  4J8O A;  3N5L A;  2V7K A;  4JUV A;  2RB6 A;  3OYB A;  3QYG B;  2DXB A;  3G6E A;  3NTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...