4L5GA

Crystal structure of thermus thermophilus card
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of CarD, an essential mycobacterial transcription factor.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
molecule keywords CarD
total genus 47
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l5gA02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l5gA01
4KMCA 2LQKA 4L5GA 4MFRA 4XAXB 2LT3A 2EYQA 2LT4A 4ILUA 2LT1A 4KBMB
chains in the Genus database with same CATH superfamily
2QA4T 2DYIA 4L6V5 5FW9A 2XQ6A 1ZQ1A 3AEFA 2K6DA 3PFSA 2CT3A 3VU3C 5J39A 3NTKA 4F17A 3KDSE 3NGPA 3ZEFB 2KSSA 3QBYA 3FEOA 2F5TX 3QWYA 4DEXA 3T1HT 1OULA 2A3DA 3S4UA 4H9QC 3CD6A 3NFCA 3NTHA 4J9CA 2KYBA 1I5LA 3E22E 2W63A 4HVUA 4JZ3A 3VYGA 4IDZA 5CA1E 1VQLA 4A56A 1YI2Q 3CQGB 4J9GA 1KQ2A 3PDYA 5AQFB 2WZIA 3MP1A 4X64T 3FJ5A 3C4ZA 4LDYA 4ZGEB 2BKPA 3H41A 2WCAA 4ZI2C 2HL5C 5FU7B 2DZ9A 4BB7A 5EK4A 3JCMd 5DLQE 5GMKe 3KBTA 2RHXA 3L1AA 4MZTA 3QDRB 3JCMc 3D0TA 2LMJA 1UJ0A 3BE3A 4ZI3C 1AWJA 1X27A 1YHQA 1FMKA 3F70A 3ZMSB 2DXUA 4Q5WA 3JC6C 4DV6T 1K8AR 3JSCA 2LTOA 2MCNA 2GTJA 2V7MA 2CUBA 3PUZF 4CXYA 4ILAA 1Q82R 3RYIE 1WDXA 2WS3A 5GAMf 1Q81U 1OU9A 2XPKA 1J3TA 2D9DA 2ODUA 3OBVE 5LJNA 3FIFA 2MAMA 2D8HA 3A98A 2MPKA 4ATOA 2DTIA 4NPPA 2YXYA 1NG2A 1OEDC 1UK5A 3CWZB 2M67A 4X1KE 1OOTA 3ONLC 2JIWA 3OMCA 4X34A 1O3XA 3G6ET 2BTTA 5CKFA 1KD1R 3CC4T 1VQOQ 5JRCB 2C0SA 2CPTA 5LNKA 1YW0A 3A7MA 3CCUT 1JJ2A 2A08A 4XQ3A 5CQXA 3RGLA 2N9DA 2QGSA 2P0KA 5GJVB 4DQ2A 1JQQA 3SDZA 2LOPA 3RH3A 4E7KA 1O75A 5FWCA 1MUZA 1KNZA 1HX8A 5KYUA 5GANd 3RRCA 2XDPA 1WZOA 4FYVB 2A7YA 3AAIA 4B3RT 4HFDA 2LEHA 4B3TT 3CCLA 3ASKA 2COYA 3NRXA 3I56A 2X67A 4BUGA 2NTXA 3Q5DA 2XD0A 2H7OA 5EK3A 2VVNA 3P4SA 2EYQA 2NTYA 4J6YA 3LSVA 3RIRA 2DILA 2R58A 2QEXT 2DXBA 2BG9A 2D9TA 4ORZA 2DL8A 1K9AA 5GJWB 1W0AA 4AQYT 1FX7A 1KQSS 4OB2B 2E5VA 1OU8A 2F2XA 3LGFA 4YTLA 1B34A 3UT5E 1N5ZA 2V7LA 4ZOLE 3QK6A 4M78E 1ZP0A 1GBQA 1X01A 1QMCA 4HCCA 1JNRA 2NYSA 2YDQA 5KX5E 3GPLA 5GANj 1F1BB 2KQWA 1KF6A 3DLMA 2YDSA 4M7AG 4OHFA 1UGRB 4Y28E 3QUJA 2SEMA 1BB9A 1PSFA 2BBHA 5CFBA 2CXLA 3AEAA 2DE0X 3CCQA 3AECA 1UURA 2OI3A 4XTUA 1RUWA 1BYMA 2X3WD 3P8HA 2DBMA 2EKHA 4XU0A 2NOXA 2K2VA 4HFCA 3C50A 4TV9E 4ELYC 1E2AA 2IIUA 4MBQA 3I55A 3AXJB 1IJ6A 3X26B 3UDCA 1VQ5Q 3OY9A 4WNKA 3SWHA 1B3QA 2VL0A 2UXCT 3F31A 1D0XA 5JH7E 3HFNA 3CBMA 1X6OA 4U72A 1VOMA 4PJOB 3MP6A 4PLIA 4Q25A 2WY2A 1JJ2P 2HPLA 1PCXA 2WP9A 2KT8A 3CCUA 2K57A 3K3QC 3OW2A 5JRCA 4KGXB 1QVPA 1FJGT 2F1LA 3TSZA 4IDOA 4C92G 2LHNA 1IRXA 2KXDA 2JQQA 1X2KA 2CHNA 4LFBT 5DQWA 2KYMA 3X25B 4WCIA 4DR3T 2VL8A 4F8HA 4TUYE 1MMGA 1R8OB 3EG0A 1N9SA 3AA7B 3VU7H 3PIPA 1VQNT 4MDXA 2DXTA 3ZEHA 1YJ9Q 1AD5A 4ISSA 5LMUT 2KMTA 4IUUA 1YP5A 4FCYA 1X69A 3AA1B 1VCTA 4JDSA 3TLUA 2CE7A 1WJSA 4HVWA 3JAFA 1NEKA 3ZL7C 3G4ST 1ZUKA 1V29B 5HWYA 3CCMA 4DA4A 4JEHB 4AFUC 4G63A 2J62A 1ZUYA 3VS6A 3CCVT 2DWGA 1VQMT 1FMVA 4DR6T 1WQ7A 4PK5A 1NPPA 2FB7A 2MBGA 2ENMA 3IA3A 1PRLC 5IH2A 4YLHA 2QI2A 2X4WA 4BA9A 1AHJB 2CP6A 3RKWA 4M7AC 3PURA 3C94A 4DBRA 3P4PA 5LJMA 5KMGP 5BMVE 1VIFA 2DAQA 1YITT 2LNHB 2QRXA 3P4QA 2LC4A 5HK3A 2JS2A 1IJ5A 2W61A 1TS9A 5HXHA 5FNVE 1YJNA 1U06A 2C0TA 2MAWA 3SWNC 4DBFA 4PJOA 3JAME 5JREA 4ZN3A 2O4XA 5BR8T 2X9HA 3ANWA 2BVLA 2KRSA 3OB9A 2DZCA 3V8JA 2OV9A 1G3YA 1OXZA 1U1SA 4OMFB 3KV6A 1K9MC 3RNJA 3K3OA 4YTNA 4LF9T 4XTZA 4AQFA 4JS4A 1S72T 4ZI3D 2HH7A 3GNGA 3JCMJ 4AKGA 1YJNT 1JBMA 2V7IA 3H0IA 1YIJQ 1S35A 1UGSB 3PNWC 3KVBA 3FXDB 1QVGP 1YWOA 2K79A 3RIUA 2OTJT 2PG8A 4PNOA 3I5SA 5LXTE 1K73R 3P7IA 4F7UE 3G71Q 4VUBA 5LHGB 3SOLA 2IAKA 3AA6B 2JPFA 5JR9C 3MJXA 3M0PA 3RR6A 3PTAA 2NWBA 5E0OA 3ZYKA 1UB4A 2QK0A 3C0CA 2KGTA 2DNUA 2JS0A 3I5RA 4IUQA 4ZGDB 2WWVA 3ME9A 3RC3A 4QH5A 3E9FA 3HPWA 8ATCB 3AHUA 4DUZT 3ZMTB 4AFQC 1ZKEA 2XKOC 2VYTA 3EGDA 3UQ4A 4C5GA 2F5KA 1M1FA 2CP0A 3V7RA 4JRPA 1K1ZA 4DV3T 5HWXA 4EMHA 3UUNA 3UUBA 5DM7R 1BCOA 3AE2A 3OYXA 1Q95G 2E64A 2RPNA 3L39A 1DU2A 4DOWA 3H0FA 5CR2A 2L3RA 1BU1A 1AOJA 3DKMA 2WZHA 1IB8A 4U31A 3D7SB 4E7IA 2CBJA 2LHRA 5HEHA 4GYRA 1PC0A 2RO0A 3CC7A 2EHOC 3BK9A 4JI8T 5DABA 1XZYA 2V7KA 3OW2S 3FJPA 4Z89A 5AFUL 2EGCA 3CPZA 2YU2A 3CBOA 4ZZBA 1BI1A 3OBWA 3QIIA 4MZPA 4PKCC 2A28A 4AI6A 3IHRA 4TWFA 3TSWA 3EI0A 3CCMQ 1VQKQ 2WBLA 1B34B 4OYJA 5AQIB 3GWHA 2V6YB 3DJBA 2GCXA 4JZ4A 1Q86R 3C95A 1VQ8T 5IHKA 1KJWA 2X0HA 2W10A 2LT4A 5GAOq 2LKGA 2R5AA 1IBMT 5JQGE 3GA8A 2H3JA 3UFGA 2VKJA 1T72A 2JTEA 2LSJA 1XMQT 2GQVA 3FDRA 5LJ5j 4I43B 1T8BA 3EG1A 1OYXA 1EIFA 2YINA 3CIRA 2K3YA 4R56A 2DXCA 2HKQB 4QXBB 1AT1B 2QGFB 5HEJA 3QJYA 3O1JA 2ZPBB 4M78G 1EX4A 5FU7C 5GAN7 3OYHA 2RM4A 4YHHT 3HTRA 4M75C 3VJPA 2D0QB 1VCSA 3A1PA 2L3PA 2OTLT 4C0FA 4L9IA 2LDMA 5CB4E 1KC8U 3ONXA 4ILCA 3JCMg 3CMLA 2AXDS 3T1YT 3WI3A 2YRVA 5L8RE 4HT8A 3ULRB 1Z8UA 1NENA 2HN2A 4K0KT 2HNIA 1Q7YC 4RTTA 2LE8A 3OS0A 3BFMA 2DVJA 5IHNA 3CC2T 4O4HE 4O6JA 2M9UA 5AQHB 5IHYA 4F16A 2W67A 1Y64B 2XI9A 1T0JA 4QVZA 3UTKA 2FZKB 4CN6A 1G83A 5LHIB 4B9WA 2VGMA 3QOFA 4DBHA 2OTJQ 2E9XB 2AK5A 1WQWA 5KE2A 4ANJA 3NTIA 1KSWA 2LRLA 2DD5A 3CMEQ 4IE4A 4GYSA 1M90R 2W66A 2XAFB 3HKSA 1QCOA 2VKOA 1TWBA 2OTJA 1MIVA 1TXQA 2RI5A 1QUUA 2A2FX 1GFCA 4B6MA 4YHJA 1OPLA 4H9RC 2EYWA 2CM0A 4O5VA 2NLUA 1UECA 2FHDA 5JTGA 1R0CB 3CCJQ 5GAMd 4IE5A 4X65T 1K8AC 4KP3C 2CCQA 5LG4A 2HHHT 3AEDA 3AE1A 2GGRA 2Q9QA 2WAUA 2CRBA 2QASA 4OGEA 2CWOA 1JRIA 1QWEA 3OYNA 2XASB 3RI5A 3L2ZA 2K48A 5CA0E 3L2QA 3OA6A 1QKXA 1QSDA 5IWAT 1YKHB 3ZMZB 3EH2A 4J6XA 1VQ6T 5FP3A 2E9XC 1N34T 3E0ZA 2FZGB 3EG9B 2WWUA 5LOVE 3MHXA 1GCPA 4F6RC 1G3WA 5CO7A 4U3CA 3V5SA 4ASKA 3JCMe 1RAAB 3CC4Q 3REAB 1UCUA 4RTXA 1CHUA 3AEGA 3MACA 1OI1A 2L3LA 2CSIA 1WLXA 3GLXA 1YKEB 1Q81C 5KYWA 4LFCT 3ZN0B 5L3DB 3P4RA 1IHVA 5GAN4 2K5LA 3UATA 3EVYA 5FL1A 2QAZA 2QQSA 3SS1A 1PKTA 2BE9B 4HFBA 1ZHCA 2NR4A 5AQTB 4HEAA 3ZJ2A 2H88A 4JUYA 4JI1T 4QQGA 4PJOD 3CCSA 5EG2A 3RC8A 3C51A 4TZ4C 2XAQB 3Q5WA 5FMNA 4JPBW 3KV9A 3SRZA 3SB2A 3DLLA 1NYFA 4HFHA 2RK1A 4P1NA 4COFA 3EGDB 1OPKA 5ECAA 2XDDA 2KI7A 5L3CB 5GAN2 1NJIC 1UUEA 1KHIA 2C0IA 3LH5A 4XZCA 1YFNA 2RQVA 4M7AB 2BS2A 3H9NA 4E2FB 4X1IE 3UU6A 4JJDA 4OMNA 4IHJE 5ETWA 4F04B 4UR9A 3HFOA 1MIYA 3PUGA 2UUBT 4II1A 4HN9A 1LCKA 5HXSA 1RAIB 4AG1C 3A8MB 2V8IA 4QX8B 5L4EA 1X79A 2J47A 4F14A 3CCQT 3NBXX 4M7DF 4KHZF 3I35A 5J1GA 4JI6T 3M9QA 2F69A 2M6BA 3INZA 4A4GA 3N9LA 1H3ZA 3PJAA 3RIAA 3G1JA 4HCZA 2LOSA 2RN8A 1D0ZA 4QHOA 5LJ3h 1HCIA 4TWHA 1M3BA 3AE7A 1TUGB 4TWDA 2EQKA 4CI0C 2X68A 2XAJB 2OA5A 4OX9T 4IGUA 5LB7B 4CQIA 2L9QA 2EQIA 3QC9A 3VKIA 4HFEA 4C8QC 3FZMB 1NAFA 4E47A 3CCRA 2NUPB 4ZTJA 2IHR1 2KEAA 4U74A 1S1NA 4C90A 5LL6S 5LCYA 4CC2A 2BZXA 2PVDB 3Q5EA 4LDUA 4LXCA 2E6ZA 3WAJA 2RA1A 1CKAA 4LN2A 3L2UA 4DO0A 1M8VA 2RI2A 2KSRA 2EWNA 4IDPA 1BIBA 1VA7A 2RH2A 1M2VB 3FB9A 1YJWT 1PHTA 1PD1A 2DL5A 1WGSA 3ESLA 1I81A 4A54A 3MK7C 2KLQA 1X6BA 3UU5A 1BR4A 4GOUA 2DERA 3GNFB 4LD6A 5FYMA 3SFEA 2XHCA 1UGQB 5JDGA 3UQ7A 5LGTB 1AZGB 3CCVA 2B1EA 1AZEA 2X4XA 4M78B 1LJOA 3PTRB 2XIDA 5C8YE 2P9BA 2ZLYA 1LKXA 1NLOC 1UX5A 2QYWA 5D6YA 4ILBA 2H89A 5CKBA 4N4IA 2VKNA 3VS3A 3CCVQ 3CC4A 5GMKj 1Y96B 3L2RA 2XM1A 2D0UA 1VQ9T 5HYAA 3C4WA 4F7UG 3RLFF 3O1HA 3RRWA 5L3FB 4KULA 4WYVA 4JYAT 3VKGA 5D6XA 3OS2A 5L23A 2XQ3A 4I55E 4BJNA 1VQNA 3TLWA 4M75E 4J5YA 4H9PC 2DL4A 5LA6E 2ZPEB 1X75C 3FZLB 7AT1B 4KH1B 3OPCA 2KY9A 1HSQA 4IUTA 4B9XA 3V5UA 2UXDT 3OYYA 3OYZA 1VQNQ 4CN1A 3VRZA 2NUPA 1TUCA 2PFVA 2V1RA 5IT9E 2PTFA 2RJFA 1CSKA 4I4TE 3PUXF 4WZXA 5GMKl 4DV7T 2LJ0A 2KR3A 2HQHA 2XZEA 1RAFB 4JI7T 1OWAA 3L09A 2CYZB 3ZSTA 4J9FA 1R0BG 2K4YA 4AKLA 4ME7A 5AQLB 4ZS2A 4IE6A 4CN4A 1HXDA 1TTHB 3E19A 4IE0A 3AAAB 1GCQA 2AT1B 5CKHA 1VQ5T 5GAN6 4N0AC 1WR0A 5HY6A 2WSSV 3EG9A 1YHQT 2RD1A 4PJMA 3QUIA 3L2WA 5ABFB 1QQJA 3LYIA 5LJ5h 4D8DA 4GY5A 1K73C 3ZC1A 2YSQA 1WA7A 1VRBA 2HEQA 5DLOA 4ADZA 4X62T 1YQ4A 5HXEA 4IUVA 2FYKA 1VQ4Q 2IPOB 2DEQA 5C6SA 5L2LA 1ZV4X 2MPXC 1M3AA 3X28B 3HA4A 5AQMB 4TVRA 2E9XD 3OSVA 4HVVA 2RHIA 3JB9J 4YSZA 2Q9QD 3M4YA 2GNCA 3S3OA 3PGGA 4J9DA 1RAEB 3ETUA 4YSXA 1C6VX 3PIOA 2H7VC 2JT4A 4P0BA 2RHZA 2RMOA 4M77B 2ROTA 5GMKi 4QXHB 2JOYA 3DP7A 4C8QD 2EJ9A 4C0DB 3HKCE 4AKIA 2L0AA 3JB9F 1M4ZA 4PJOF 1D1CA 3PUYF 3U78A 2XQ4A 3B57A 2ABLA 2JMHA 4C91A 3KVAA 2MIOA 2J6FA 1E6GA 2WDRA 2H3EB 2OX7A 1MMDA 2PZ1A 3N5BB 1T98A 1D1BA 4OVAA 2E3HA 3AE9A 2CH4A 2LJ1A 3C4SA 2RJCA 3AXJA 1S72Q 2VKHA 2QVAA 3FLGA 3Q9DA 4I0UA 3CQXC 4TX5A 2L8DA 3AT1B 4HXJA 2CREA 3THKA 5GAOn 1GFDA 5LHHB 1W70A 5CAIA 1M1KU 1VQ7T 4R0KA 2ZM8A 3OBYA 2W0ZA 1G2BA 2AIRB 1VQKT 3RERA 3OYJA 4M7AA 1BI2A 2PUKB 4LDXA 1Q86C 1QVFS 4L0RA 5CQYA 1NWMX 1M30A 2EJFA 3PUWF 1HG2A 1SUMB 2I6HA 3O9XA 3CXCA 2M0OA 5CGMA 4FSXA 4M7DC 2AZVA 3EG3A 3VS7A 2JRKA 3L2VA 1BCMA 2N1GA 1V9DA 2PUOB 2X35A 4IKFA 3CKDA 4CI3B 4DR4T 3JC6D 1T7SA 4ELZC 1KEYA 1Y71A 4HKEA 1YI2A 4YY3T 2E10A 3BQKA 2OTLQ 2BZ8A 2SRCA 4J9EA 4HCBA 2LT3A 1XNIA 2EPDA 2O88A 1YITA 4QH1A 3CCEA 5AQOB 4NS5A 1VYVA 4C0ZA 5FY1A 2E5LT 4UVAB 1RAGB 5J3BA 2YRDA 3VKHA 4KGZB 4U33A 5DQVA 4ZHQE 1M3CA 4M77E 4OF1A 3MO8A 4KMCA 1SHGA 2YWWA 1K9MU 3M59A 4AXPA 2CA5A 3IF8B 5KCHA 1UX4A 3RPUA 1SSFA 2LVMA 2DTHA 4H9NC 1NZ9A 5AQUB 4PW8A 1P92A 3EHZA 3IQLA 3PT9A 3KINB 4HKAA 4RUGA 5LG3A 2F2VA 2Y4YA 2C0OA 1HFAA 2XSBA 4BE1A 3H3MA 5GAMg 1Q7YR 4OP0A 2V8SV 2P4TA 1Y07A 3CCET 4PK4A 5FVLA 3LDQB 3ZC0A 5M9OA 3M55A 2V8JA 2P84A 5LP6E 1ABQA 1HTJF 1PD0A 5JDQA 2HPJA 2IDOB 2LRQA 1AEYA 1I1JA 4FI5A 5KXJA 4OB1B 1NLPC 1VYTA 1SHFA 3EH1A 4OMQA 4YXDA 3NWIA 3LX7A 3JCMX 2LQNA 3PJAJ 4BJMA 3M5AA 2VXEA 3VS2A 5LJ3d 1QLYA 1WHKA 5I2SA 2YHTA 4UEMA 3RMSA 1OQKA 2X9YA 3OYBA 1EFNA 3KBUA 4EXTA 3SWNB 2FL7A 3VRAA 3F2EA 2X0YA 3LW5E 4E7SA 3H6ZA 3M0RA 3A8YC 4EGWA 2X4YA 2NUTA 2Z6EA 4P5NA 2LQ8A 1OEDB 2EHOA 1Y01A 4C92E 2QQRA 2EGEA 4N78D 4DVDA 3HI2A 3CEYA 5AQRB 1W2BP 3JB9G 2A0FB 4J7FA 1LRZA 3CD6Q 1UGVA 1W0BA 2KRNA 4C92B 3WVEB 4HFVA 4FYYB 1VQ7Q 1IAPA 1I6ZA 3CQCB 3CC2Q 4HT9A 3H3AA 2NW8A 1RLPC 2QA7A 3K3NA 1ZA1B 1MV0B 1BBZA 2JMCA 2O9VA 2J4GA 2IVWA 1PKSA 3TVTA 3VUBA 3GP8A 1VIEA 3VS4A 5CIUA 3RHWA 4XTWA 3JB9I 4J7IA 3CC2A 1Z9ZA 2K3WA 1JNZA 2ZGWA 4E7JA 1R8IA 2FJBA 1B07A 2QDLA 2L3QA 3U23A 4YFSA 2K2MA 4KGVB 3I1AA 5IXBA 2GQIA 1FYNA 2XK0A 1SG5A 1TSFA 4A4EA 4N4GA 1JXOA 3ANWB 4RMOA 1NBEB 1RL2A 3FC3A 5HK0A 2QTXA 2Y90A 1ZX6A 2VVKA 2E8IA 3RYCE 2XDBA 2I0NA 2XMFA 1M7KA 3SFDA 2WU5A 2RF0A 1YN8A 5GONE 2M0YA 4EZHA 4P0AA 4JRIA 2WDQA 1Q7YU 3EFRA 3NKZA 1NE8A 5EZYE 1Z0PA 3CCLT 1VQ5A 3N2GE 2X0LB 3ZYMA 1WXUA 1WHMA 4RTWA 4M1PA 3OKQA 4EB6E 4N4HA 4QQ6A 3F57A 5HEUA 1ZA2B 3M56A 3O8VA 2KWHA 2FPDA 3K8PC 3RQWA 2FRYA 4FT2A 3JCMP 4UV8B 2G6FX 3OMGA 2PVGB 2ACXA 3N9NA 4AT1B 2AE9A 3JCMb 5IHIA 5FU6B 3EAEA 5LGUB 4J8OA 5C2TA 3SHWA 2XY8B 4DEYA 2YU1A 1WNLA 3OYKA 4PL6A 4B6XA 4A53A 3ZLIA 2P0QA 1Y0MA 2BDEA 2LP5A 2KVQG 2ZPGB 2DBKA 1K0SA 2DEUA 2EYYA 3FHNA 5AQPB 5HAXA 1OEDA 2EHOB 4UC4A 3I56Q 1KHCA 2J05A 3VHLA 2HL3A 3V7SA 1U4QA 2FPFA 3GN5B 4IT4A 2IG0A 1KG1A 2LZ6B 4KRTA 3AB3B 4NXNT 4YJ3E 3M57A 1HX1B 3CXCP 2C5IT 4B3ST 2F2WA 1D3BB 4QXCB 1G3TA 5I11A 3CXCS 4M77A 4JJNK 3CMEA 1XDPA 2EBPA 2L2PA 5C0MA 1VQ6Q 3QNUA 1H7CA 3OYIA 3CMAA 2IC9A 4DV5T 4GK5E 3TREA 1C0MA 3RYHE 5A0LA 3HKDE 5L3BB 2WU2A 2CH4W 3ETVA 3H37A 4AFZC 5LYJE 4FW1A 5KH6A 2K7AA 1KQ1A 3DB4A 8AT1B 4A63B 2MOXA 1IGQA 2CKKA 2NWMA 3CCQQ 2JUFA 3PMTA 5GAOp 5A1LA 4KUMB 5JDFA 4H9OC 1V1CA 2IMLA 4OMPA 2JVVA 4M78D 1HNZT 3I55Q 1YJWA 3NRYA 4XK8E 2O31A 1YHQQ 3JCMf 3SEMA 3RYFE 1N8RR 3O4XE 1NEGA 2K3BA 1ZLMA 1QVGS 1UFFA 2HMAA 4IL9A 3RUXA 3J7Yq 4LF7T 4IIMA 2EQJA 5L4HA 1VQPQ 2L3SA 3QYHB 3N2OA 1ZSZC 1YCYA 3P8CD 3N9PA 4PLLA 1G3SA 4DR7T 3V8LA 1VYUA 1WR6A 1BK2A 3CPFA 4A5XA 2V1DB 3NZPA 2LLYA 4CXXA 2PJQA 2G3RA 2LQKA 2XAGB 2KZ7B 2DYBA 2AHJB 3R6OA 5I21A 4C5IA 1WFDA 1NPRA 2QQ9A 3GOXA 4FM4B 1YJ9A 1UG1A 2XICA 5HKCA 3EABA 4XTXA 3R6NA 5H6RB 1N9RA 1Q82C 4LMJA 1ZOYA 5LJ3j 3Q2MA 3S6WA 2M02A 1WCRA 3G71A 4V2SA 4X1YE 4YJ2E 5F3JA 2WSCE 4AIUA 2J06A 4J9IA 3C4XA 2FBWA 4Z8AA 5CVIA 2PQWA 1WYBA 5LJ5d 4ISTA 2DX1A 3OSSC 3QDFA 3CCLQ 2KXPB 3M0QA 4C8QA 5JR9B 4H9SE 1AWWA 1WJRA 2DETA 2XQ8A 3FZFB 1BI0A 1UGPB 2WSEE 4BDZA 1YNZA 5FXXA 2GBQA 4M77F 3UUXB 1N6AA 4ZTFA 2OJ2A 1Z9QA 2KWIB 2CLYB 4X9DA 4OMOA 2VK9A 2Y8DA 4JLEA 1ZBJA 3M53A 5HXRA 1LOJA 1W2BS 3AEEA 1EZ3A 4WBNE 2LM2A 3EUHA 3TLSA 1FXXA 4EIWA 5H6QB 4WBOA 4YTPA 3J81E 1VUBA 2J6OA 2ZZDA 3QB5A 2N2NA 2JTFA 1N27A 2Q9QB 4IIJE 1K73U 2M51A 3WAKA 2DTOA 4IDNA 2F4VT 1U5PA 4U7YA 4UVCB 2L8KA 1VQ6A 2DCFA 3O1IA 4M77D 2EFIA 3ZT5A 3ZBDA 1M5Q1 3N2KE 1YCSB 1KC8R 4J2CA 5TAOA 2LSYA 1WJQA 2KK4A 5KYYB 2VQFT 4RCCA 2P4RA 1JO8A 1VQ4T 1XMOT 2E70A 3A8LB 4LF6T 3BDUA 2FJDA 3SWNA 1QKWA 2YUQA 2YDRA 2GK9A 2CLYC 2RHYA 5LGNB 2E2AA 4JV5T 4KH0B 2BKDN 4M78A 1X9BA 4E7LA 1TU0B 3AE4A 2MWPA 4JBWF 3ZMUB 2R5MA 5LJ3f 1E1HB 4FW2A 4TN7B 2LNVA 3PVLA 3W15B 4AFSC 1YD8G 1BI3A 1OV3A 2KE9A 1PSEA 2YUNA 2YUPA 3GIBA 4HGAA 3OW2P 1UDLA 4ZI7E 1M27C 4AQFC 2FJAA 2I0MA 2NW9A 2XQ7A 2DD4A 3E9GA 4DBQA 4MALA 3MCAB 1M8MA 4JS5A 1CKBA 1QCFA 3B13A 2LKHA 3GF5A 4KHPT 3G6EQ 4MZMA 4RCBA 2LSIA 2DNXA 3M65A 3HHTB 1U8RA 2KT1A 5GMKh 2VASA 3AAEB 4LF8T 2V26A 4KX6A 1YIJT 1QWFA 2R57A 2LSKA 3FBZA 1HF8A 4J83A 5JR9A 3I56T 3ZSSA 1M90U 1UUSA 1W9RA 3AE6A 4M7DB 4Y91A 5ABGA 4L59A 1TH7A 3MEWA 3V8KA 4N0AA 1VQLQ 2JJ9A 5IAYA 2EVRA 2DIQA 1SEMA 3LWIA 5DY9A 3JB9H 3MA9A 1I0CA 4B3MT 4C8QE 3VS1A 1D0YA 4M78F 3HP9A 2SPCA 5LBMA 4EYYR 2X3XD 4M7AE 4JI4T 2BKOA 3ZMVB 2CWYA 1GQEA 2EGAA 1T0HA 2EQUA 2WACA 5FY7A 2BVMA 2VWAA 5GAMh 1Y96A 2GFUA 1YITQ 2JM9A 1G5VA 3WXMB 3OYAA 2H8HA 2CXDA 2JXBA 1H92A 2CZ1B 4O4JE 3FRNA 3N9QA 4LMLA 1YQ3A 1J1JA 2YOEA 2VUBA 5CKEA 3MKDA 3M3ZB 4PNIA 2CMRA 3P8BB 3EDVA 4QH4A 1HD3A 4WF2A 3C12A 4ZXLA 1WX6A 1BKBA 4HCKA 4BI4A 1UHCA 1UGOA 3T9NA 1KD1C 4EZ4A 2E65A 3ZKRA 2EW3A 4RTVA 3FXEB 3JV3A 3MEUA 1K9MR 4K0UA 2D0TA 4BE2A 1MNEA 4PFPA 1M90C 4M75F 2CBIA 2Y6XA 1BR1A 2FEIA 4V1Av 3CCJA 3CCJT 3JADA 4ZEYA 3CC7T 2YK0A 1OEBA 3CX8B 2IIMA 3VS5A 1QLBA 3BQLA 3KFVA 5GAN5 2VXFA 4EOZB 4X9CA 4DR5T 2QGGA 4O2BE 4LDWA 3VV0A 2XTLA 2DPPB 4MHCA 3LGLA 2Y4XA 2HAXA 4C92A 1K8AU 1N33T 4TV8E 3CD6T 5ABFA 2EYXA 4X1VA 4BACA 4M75A 4M4ZA 2W2UA 3VUZA 3A5ZB 1LVFA 4UXNB 5M4YA 2HZYA 3C64A 3OTOT 2V1QA 4ESRA 4JEUB 2RPAA 2GF7A 4HWIB 2MF2A 3EGXA 1D09B 3OJAA 2HKNA 2Z0WA 3RKGA 2XQAA 3CCST 2VURA 1MMNA 2DHRA 5AQVB 2BKNA 1H8KA 2MK5A 2WDVA 1Q82U 5J2TE 1PWTA 1LVKA 1KNPA 4E6RA 3CQTA 2QG9B 2PU9B 2BZBA 3J9X1 5GAOr 3RIFA 4C92F 4LD9K 1H641 3HKEE 1T3SA 1J5ET 1YBYA 2QQBA 1ZSGA 3KXTA 2HD0A 3REBB 1I8FA 4A4KA 3TEEA 4C5EA 4LMKA 4MMKA 1IBLT 2RK2A 2XJ7A 5ABEA 3EFOB 5FVKA 2EJGA 3AVRA 3UU4A 4O4IE 1S72A 4YTMA 3UUMA 5L3EB 2LT1A 4MLKA 4ZGJB 3LJCA 4AKHA 4LUEA 5EC7A 2JZ2A 1MHNA 2WSFE 4D8KA 1BR0A 3AVSA 3HR0A 4XU3A 4AKRB 2CS7A 4EMKA 5FWBA 4C0GA 4E7ZA 4JLIA 3OYDA 2QA4A 3P4WA 4PJOC 3AA0B 3PMIA 1E6HA 4NUVA 3QZ5B 4Z02A 4IUPA 2RHUA 2K5BB 2CGHA 4A4FA 4AMCA 2YLBA 5CJ5A 4NOYA 2CDTA 2QXFA 3CMAQ 4M7AF 5JDHA 1HYOA 3P8DA 3QG1A 2FUPA 4WTOB 2ATCB 4RG8A 2XU8A 4AQGA 1VQKA 3TQ7P 2EKOA 1JXMA 5I2MA 2DO3A 1KFYA 2BBJA 4GLMA 1EZZB 1ABOA 1IO6A 1WHLA 3EGXB 2V5DA 3VS0A 2JMKA 4Z8XA 2X9XA 2V6YA 1X2QA 5ADXL 3ZPOA 2EHOD 2E4HA 2DL1A 1TG0A 3NHNA 3RIUC 5CK9A 3CX6B 3EHRA 2D1XA 3UULA 1QW1A 3PUQA 2FZCB 5F8PA 1VQOT 2X51A 3NMZC 4X5TA 2G0UA 4H63V 4QX7B 2YLCA 1K4US 2VKDA 1TOVA 4M77G 3URGA 4YT0A 2E3IA 2DLRA 2W00A 5AQNB 3G4SA 4IE7A 3VYHB 1L0VA 2ZPHB 1QVFP 4L5GA 5I22A 2E6NA 2WQYA 2C5KT 4OGCA 4ZI2D 5D6WA 3AEBA 4GKKT 5FL0A 4H63H 1T3LA 3M0UA 3QWXX 4KUIA 4EPCA 4FYWB 2K24A 2OTLA 4JRKA 2CXFA 3OYCA 3TLVA 3M0SA 4PFZA 3VRYA 5FY0A 2JW4A 4BY6C 1WXBA 1KK7A 4JUVA 3SFMA 1WXTA 2DJZA 4RG2A 1I4K1 4C8QF 2UU9T 6AT1B 3UU8A 5KYYA 3NVOA 1VQOA 1QVFA 2YKSA 2LX7A 3I55T 2RP4A 1US7B 4BD3A 4HA8A 3I0OA 3K1SA 3NZQA 5KE3A 1NM7A 4TNWA 2DL3A 2XUEA 1K0XA 3M0TA 2PBIA 3E2UA 4ERRA 1VQ8A 4G2AA 4BI3A 5KCOA 2W4XA 4UV9B 5HCMA 4HWHA 1A0NB 1Y57A 1ZHIA 5HCJA 3UA7A 3MEVA 1YWPA 1D3BA 5J2UE 3LBXB 3IBPA 1TUDA 5GANf 2LRKA 4KI0F 4DR1T 1QVGA 4HWDA 3TLTA 1RI0A 1FIOA 4ZS3A 2HDAA 3ZN1B 3LLRA 2ZM2A 4X66T 2GFAA 1GRIA 2UUCT 1SPKA 1XOVA 1WYCA 1RABB 5LJ5f 4JJCA 2E12A 2IC6A 4Z91A 4DMVA 2E5KA 1UJYA 2ED1A 2X9WA 1B7TA 4AG2C 3N5LA 2AZSA 5KYUB 1S94A 1NYGA 2W62A 4UF0A 4M75B 4EEDA 3HKBE 4IREA 2KDSA 2DFUA 3FZHB 4J9HA 4M7AD 4XAXB 4EV6A 3VR9A 2QTVA 4A97A 5AQJB 2HQXA 1Q81R 4M7DG 3M58A 4OMMA 1M1GA 4J9BA 2DI4A 4F7UA 3DB3A 4WW0A 2DIGA 2DRKA 3MP8A 5GAMj 4KUDK 1FEWA 4M77C 2VVSA 3OYEA 3G7ZA 2J6KA 4IDQA 4F7UF 4U2YA 2OLTA 4LUDA 2A36A 4NIQA 1MIWA 2NW7A 5AQKB 2X4JA 3OYFA 4AISA 2MOZA 1Y7XA 2DRMA 1KNRA 3QSUA 1M1KC 1NJIR 4FT4A 4U7IA 3EFSA 4RTZA 1HG5A 3LK2B 4QKNA 2CZ0B 3RF1A 2ZAEA 5A0GA 3ONJA 5D7UA 4C92D 2COZA 3B5MA 3LG7A 2HBPA 2K5IA 4M7DE 3G6EA 1XQHA 2BIVA 4DUYT 4BY6B 2V7JA 1M9SA 4OB0B 1VQ9Q 2Q9QC 4EMKB 1H3HA 2KT9A 3R84B 2O2OA 2K9AA 3RKYA 2M1HA 2B76A 3QHSA 3HRUA 3PV0F 2JM8A 4OMLA 1KD1U 2RQTA 2KMFA 1WI7A 1WYXA 3QKJA 5FROA 2YRCA 2QA4Q 5J0ZA 2E1HA 1DJ7B 3MZKB 1ZSZA 2HQEA 3LBXA 4QQDA 1WLPB 4MDWA 3JCMQ 1IZNB 2E9XA 3RESA 1V76A 5FU6C 2HSPA 2LJ3A 1I94T 2DK3A 5AT1B 3CC7Q 2I2LA 2JNGA 2DA9A 3FZKB 3N9OA 1SKUB 1KQSP 3U3IA 3CX7B 2LSGA 4HWFA 5A0DA 5GAN8 2PNIA 3UA6A 4O4LE 4UELA 3VRBA 3BY7A 3BW1A 3OYMA 1YJWQ 4CZZB 2XSAA 5EK2A 2KROA 4HTEA 3OYLA 5AQQB 5L3GB 2JQKA 2QEXQ 2DJQA 2BG9C 2R6GF 3H8ZA 5HXCA 1JU5C 2QYZA 2WM9A 2XG8D 5HCKA 2DL7A 2FPEA 1JEGA 1ARKA 2XQ5A 1Q86U 1RACB 1HJDA 3UPUA 1UE9A 3EFOA 2KNDA 2O4XB 2RNAA 1X43A 3VR8A 1YI2T 4FYXB 3CPWS 4PJLA 2UXBT 2CZ7B 4F7UB 4M7DD 3QPHA 5L47A 2ROLA 1UEBA 4GIWA 3RKXA 4BDYA 2LCSA 1RAHB 2FJEA 2DMOA 4JLGA 2XM2A 1G8XA 2COWA 1RLQC 4RTYA 9ATCB 1MNDA 3OS1A 5IYZE 3J80E 3A8GB 4RTUA 4Z88A 5LJ3g 1VQPA 3WVDB 2FRWA 3ER0A 4K11A 1ACMB 3JCMh 2A9UA 3TKLB 1VQ7A 2D0NA 2MI6A 1YIJA 3MEAA 2C5JA 1HNWT 3I9YA 1GL5A 3CPWP 2DVEA 3L8RA 4JJBA 3QB5K 2EYZA 3OQ5A 5GAMe 3KV5A 3I0QA 2E41A 3QO3A 4MMLA 1ZSZB 4XTYA 4QVCA 3GMIA 3CCEQ 4GBQA 2ES0A 5J26A 1JB0E 3ZFJA 1UHFA 2K9GA 4TNVA 4DNDA 2XQ9A 2YT6A 2NUZA 2VV5A 4CC7A 3JCMV 4JRQA 4EAHA 2J1DG 1VQPT 4IIOA 3HRTA 3ZCIA 4U2ZA 2A37A 1RI9A 5JDLA 4I50E 1ZUUA 1BR2A 5A2QE 2UUAT 2KNBB 1ZBXA 3I9QA 4BE0A 3MXZA 4LNPA 4EDUA 1OZ3A 3Q5XA 2NP9A 1GBRA 1W4SA 4M78C 2RB6A 1NJIU 5CKDA 3J7AF 2JQ9A 2VQET 4XBFB 3L42A 1PRMC 2D2SA 2ZPFB 2UXNB 1LNXA 4P09A 2M16A 1SSHA 4C8QB 2V5CA 3LK3B 3OVUA 2DWKA 1MV3A 2RQUA 5GMKm 4C92C 4UF0B 3FB2A 2KXCA 3PUSA 4DV4T 2YUOA 3CPWA 2V8KA 2DF6A 4C8QG 4PJNA 1U1TA 2MTQA 2EAYA 2J7IA 4DOVA 3HSBA 3CK6A 5LBQB 1ZEEA 1XTDA 4FJOA 4PK6A 3OYGA 3AE5A 3CMAT 1XNRT 3QXEB 5IUXA 2RA2A 2YDLA 1IGUA 1SF9A 3CMET 3CCMT 4PJOE 2LX9A 2MYSA 1IHWA 2CZ6B 4NL2A 3CVRA 4X20E 5AYFA 2ACZA 1XWMA 2RJEA 1X6GA 2HSEB 3PE0A 2RQWA 2DKGA 5F5WA 2C06A 2M6IA 2YEVC 2ESWA 5AQGB 1I07A 1KFZA 3ZJ1A 3ABVA 5AQSB 5FRMA 2QDYB 2JMAA 4EIKA 2LCLA 3LFMA 2V6XA 1HS7A 3CCRQ 3KBGA 4E7HA 4QWNB 2OAWA 1N32T 1IBKT 4LFAT 4O8SA 1SHZC 1M2OA 2KAFA 2IUBA 2YN6A 4DIDB 2XQYA 1PG5B 1AVZC 2X66A 3P50A 2EQMA 2HN1A 3CBPA 3CCUQ 4CC4B 1KQSA 2EIFA 3UF4A 1VQ9A 2BS4A 2WMOA 5ABHA 1R77A 1W09A 1U5SA 5HEGA 5GANh 4M75D 4KT0E 3HRSA 3UWNA 2JQHA 1GCQC 2KINB 4GLKA 1LPLA 5FLXE 5LMNT 2ZMAA 2D8JA 1PNJA 2RI3A 2Y48B 4DV0T 4DV2T 2RQRA 4NXMT 1RADB 2CHOA 4UVBB 5FXWA 3HL6A 4Y92A 2ED0A 3META 4MFRA 4QKUA 4JI3T 2ZM0A 2VGNA 2FVUA 1M62A 4ZN1A 2PTKA 1WFWA 4A4HA 4CC3A 3A8OB 1PM3A 3KFWX 3QYGB 1K76A 5JDMA 2ZPIB 2O9SA 5GANg 3QZ9B 2W0GA 4GKJT 4QW2A 1WRDA 3MPUB 2OAUA 3EG2A 3EAMA 1VQ8Q 2NUTB 2WMNA 4HWCA 2ODVA 4ZZCA 1BIAA 4DV1T 3LWHA 2ZCFB 3KUFA 2L5QA 5KYWB 1C1AA 3ZCJA 1NEBA 3PUVF 5GAOl 4OFZA 1N36T 4XU1A 4YSYA 3UT1A 5KYNA 1O9SA 1G73A 1WIEA 1W1FA 5CCAA 4R55A 1XDOA 4PFOA 2QEXA 1IXDA 3TCJA 2FO0A 1U3OA 4IL4A 3M54A 2XAHB 2KBTA 5LJ5e 4HFIA 2CP7A 2MMPA 5KYXA 2D5UA 2CP3A 2A3LA 3UU3A 4C0DC 1N8RU 2DM1A 2RJDA 3X20B 4KBMB 2L89A 1CUNA 2H3RA 4CI1B 2PVOB 3E1SA 4OB3B 5FXZA 1QCNA 2A72A 1N8RC 2JN0A 4HE8A 3DTOA 2LQWA 5GAOm 4O2AE 3T8OA 1OX9A 4BI8B 3JRZA 4PJOG 1WHHA 3BQIA 3G06A 1XNQT 4CRIA 4M7DA 4FIBA 5JVDE 3CCSQ 1HNXT 5C3JA 2K5FA 5FKYA 1E7OA 4LE9A 3H0HA 3RBBB 4EMKC 3ZT6A 3FBLA 3M4GA 3OS5A 1OEDE 3PU8A 3UFEA 4NL3A 1J5WA 1VQ4A 2VWFA 4M75G 3ZT7A 5FRNA 3QJ6A 3I9WA 3C98B 3Q1JA 1YJNQ 1VQMQ 3RX6A 3N9MA 3TU4K 1MGQA 3S3MA 3JB9D 3X24B 4CXWA 4EYUA 5JDNA 1I5OB 3EDUA 3PU3A 1W6XA 5LJ3e 3EGUA 2I59A 1VQMA 1AJ3A 3AE8A 1QP3A 2GTOA 2BZYA 1SA0E 3KV4A 2CEAA 3A8HB 2BE7D 4Z90A 1VQLT 2BUDA 5KDMC 2LCCA 2AKLA 2CP2A 2BS3A 5GAN3 2KRMA 2CT4A 1MMAA 1YXRA 1D1AA 2P0PA 1AWXA 3LH0A 2BG9B 4NUUA 1IREB 3HL8A 1SRMA 3A5XA 3RMQA 2FG0A 4PJJA 2DLPA 2CP5A 5FXVA 4UIGA 2HCKA 3BDLA 2IW5B 2LM9A 5GANe 2CUDA 4RKUE 2HBWA 1JJ2S 2LJLA 5HEOA 3PVQA 4ZNXA 4ILUA 1WHGA 4BAYB 2ECZA 1AWOA 3GN5A 4OYKA 4EEBA 1FWZA 3PUAA 4LDVA 3RKOA 2XHEB 1HR0T 1M1KR 3JCMW 4XU2A 3RDVA 1FMWA 3GBQA 4XTVA 3E08A 3RQUA 2CSQA 4FL6A 4LF5T 2VB6A 4DMWA 3X1DA 5KYXB 1E7PA 4PAGA 1HK9A 3NPFA 5LJ5g 4JI5T 4A98A 4CI2B 2O01E 5IXFA 3CCRT 2QQAA 3EHQA 2JTMA 3SD4A 4EMGA 4LF4T 1SRLA 3G4SQ 2MWOA 2VC8A 3V7CA 1KC8C 5IN1A 2K3XA 2UXXB 3G71T 2ZM6T 3JCFA 3S3NA 1UTIA 1XJWB 1OX8A 1SE7A 4DR2T 3O5ZA 2WB5A 3LK42 1OZ2A 2B86A 2E5QA 4FU6A 1IZ6A 1W2BA 4GK0E 4IURA 1YJ9T 3AE3A 5DJQC 4C5HA 3L3PA 4JI2T 1KIKA 2AKKA 4J6WA 1WPYA 1QP2A 3IEEA 2D6FA 4QT7A 1WHJA 4D6WA 1M2VA 2B8AA 2BG9E 1GXIE 4FSSA 3ZYLA 4QVDA 4OK0A 3JAEA 4JI0T
chains in the Genus database with same CATH topology
2QA4T 4L6V5 1ZQ1A 3PFSA 3VU3C 5J39A 3NTKA 3KDSE 3ZEFB 2KSSA 3QBYA 3FEOA 2F5TX 2A3DA 3S4UA 4H9QC 3CD6A 3NFCA 3NTHA 1I5LA 3E22E 2W63A 3VYGA 4IDZA 5CA1E 1VQLA 4A56A 3CQGB 1KQ2A 3PDYA 3MP1A 3C4ZA 4LDYA 4ZGEB 4ZI2C 5FU7B 2DZ9A 4BB7A 5EK4A 3JCMd 5DLQE 5GMKe 3KBTA 2RHXA 3L1AA 4MZTA 3QDRB 3JCMc 3D0TA 4ZI3C 1YHQA 3F70A 3ZMSB 2DXUA 4Q5WA 3JC6C 3JSCA 2LTOA 2V7MA 4CXYA 3RYIE 5GAMf 1Q81U 2ODUA 5LJNA 3OBVE 3FIFA 2MAMA 4ATOA 2DTIA 3CWZB 2M67A 4X1KE 3OMCA 4X34A 1O3XA 3G6ET 5CKFA 3CC4T 5JRCB 2C0SA 5LNKA 1YW0A 3CCUT 1JJ2A 4XQ3A 5CQXA 2N9DA 2QGSA 2P0KA 4DQ2A 3SDZA 2LOPA 3RH3A 4E7KA 1O75A 1KNZA 1HX8A 5GANd 3RRCA 2XDPA 2A7YA 3AAIA 2LEHA 3CCLA 3ASKA 3I56A 3NRXA 2X67A 4BUGA 2NTXA 2XD0A 2H7OA 5EK3A 2EYQA 2NTYA 4J6YA 3RIRA 2R58A 2QEXT 2DXBA 2D9TA 1FX7A 1KQSS 4OB2B 3LGFA 4YTLA 1B34A 3UT5E 2V7LA 4ZOLE 3QK6A 4M78E 1X01A 4HCCA 5KX5E 3GPLA 5GANj 2KQWA 3DLMA 4M7AG 4OHFA 1UGRB 4Y28E 3QUJA 1PSFA 2CXLA 3CCQA 4XTUA 1BYMA 3P8HA 4XU0A 2NOXA 2K2VA 3C50A 4TV9E 4ELYC 4MBQA 3I55A 1IJ6A 3X26B 3UDCA 3OY9A 4WNKA 3SWHA 3F31A 1D0XA 3HFNA 5JH7E 3CBMA 1X6OA 4U72A 1VOMA 4PJOB 4PLIA 3MP6A 2HPLA 3CCUA 2K57A 3K3QC 3OW2A 5JRCA 1QVPA 4C92G 2LHNA 2JQQA 5DQWA 3X25B 2VL8A 4TUYE 1MMGA 1R8OB 1N9SA 3AA7B 3VU7H 3PIPA 1VQNT 4MDXA 2DXTA 3ZEHA 4ISSA 2KMTA 4IUUA 3AA1B 4JDSA 2CE7A 1WJSA 3G4ST 1V29B 5HWYA 3CCMA 4DA4A 4JEHB 4G63A 3CCVT 2DWGA 1VQMT 1FMVA 1WQ7A 4PK5A 1NPPA 2FB7A 2MBGA 4YLHA 2QI2A 2X4WA 4BA9A 1AHJB 3RKWA 4M7AC 3PURA 3C94A 4DBRA 5LJMA 5KMGP 5BMVE 1VIFA 2DAQA 1YITT 2LC4A 5HK3A 1IJ5A 2W61A 5HXHA 5FNVE 1YJNA 3SWNC 4PJOA 3JAME 5JREA 4ZN3A 2O4XA 2X9HA 3ANWA 2BVLA 3OB9A 2DZCA 3V8JA 1G3YA 4OMFB 1OXZA 1U1SA 3KV6A 1K9MC 3K3OA 4XTZA 4AQFA 4JS4A 1S72T 4ZI3D 2HH7A 3GNGA 3JCMJ 4AKGA 1YJNT 1JBMA 2V7IA 1S35A 1UGSB 3PNWC 3KVBA 3FXDB 2OTJT 2PG8A 4PNOA 5LXTE 3P7IA 4F7UE 4VUBA 5LHGB 3SOLA 2IAKA 3AA6B 2JPFA 5JR9C 3MJXA 3PTAA 2NWBA 5E0OA 3ZYKA 1UB4A 4ZGDB 4IUQA 3ME9A 3RC3A 3E9FA 3HPWA 3AHUA 3ZMTB 1ZKEA 2XKOC 2VYTA 4C5GA 2F5KA 1M1FA 3V7RA 4JRPA 5HWXA 4EMHA 3UUNA 5DM7R 3OYXA 2E64A 5CR2A 4DOWA 2L3RA 3DKMA 4E7IA 2LHRA 4GYRA 2RO0A 3CC7A 2EHOC 3BK9A 5DABA 2V7KA 3OW2S 3FJPA 5AFUL 3CPZA 2YU2A 3CBOA 1BI1A 3OBWA 4MZPA 4PKCC 3QIIA 4AI6A 3IHRA 2WBLA 1B34B 4OYJA 3GWHA 3DJBA 2GCXA 3C95A 1VQ8T 2LT4A 5GAOq 2R5AA 5JQGE 3GA8A 2H3JA 2VKJA 2LSJA 2GQVA 3FDRA 5LJ5j 4I43B 1OYXA 1EIFA 2YINA 4R56A 2K3YA 2DXCA 4QXBB 3QJYA 3O1JA 2ZPBB 4M78G 5GAN7 5FU7C 3OYHA 2RM4A 4M75C 3VJPA 2D0QB 2OTLT 4C0FA 4L9IA 2LDMA 5CB4E 1KC8U 3ONXA 3JCMg 3CMLA 3WI3A 2YRVA 5L8RE 4HT8A 2HNIA 1Q7YC 3OS0A 2LE8A 3BFMA 4O4HE 4O6JA 2M9UA 5IHYA 1Y64B 2XI9A 4QVZA 3UTKA 5LHIB 4B9WA 2VGMA 2E9XB 1WQWA 5KE2A 4ANJA 3NTIA 2DD5A 4IE4A 4GYSA 2XAFB 3HKSA 2VKOA 2OTJA 1MIVA 2RI5A 1QUUA 2A2FX 4YHJA 4H9RC 2CM0A 4O5VA 2NLUA 2FHDA 5GAMd 4IE5A 1K8AC 4KP3C 2CCQA 5LG4A 2Q9QA 2WAUA 4OGEA 2CWOA 1JRIA 3OYNA 2XASB 3L2ZA 2K48A 5CA0E 3L2QA 3OA6A 1QSDA 1YKHB 3ZMZB 4J6XA 1VQ6T 5FP3A 2E9XC 3E0ZA 2WWUA 5LOVE 3MHXA 4F6RC 1G3WA 5CO7A 3V5SA 4ASKA 3JCMe 1UCUA 3MACA 1OI1A 2L3LA 1WLXA 3GLXA 1YKEB 1Q81C 3ZN0B 5L3DB 5GAN4 2K5LA 3EVYA 2QQSA 3SS1A 1ZHCA 3ZJ2A 4HEAA 4QQGA 4PJOD 4JUYA 3CCSA 5EG2A 3RC8A 3C51A 4TZ4C 2XAQB 3Q5WA 5FMNA 3DLLA 3KV9A 3SRZA 3SB2A 2XDDA 2RK1A 5L3CB 5GAN2 1NJIC 1KHIA 4XZCA 4M7AB 4X1IE 4IHJE 5ETWA 3HFOA 1MIYA 3PUGA 4II1A 4HN9A 5HXSA 3A8MB 2V8IA 4QX8B 1X79A 3CCQT 3NBXX 4M7DF 5J1GA 3M9QA 2F69A 3INZA 4A4GA 3N9LA 1H3ZA 4HCZA 2LOSA 1D0ZA 4QHOA 5LJ3h 1HCIA 2EQKA 4CI0C 2X68A 2XAJB 2OA5A 4IGUA 4CQIA 2L9QA 3QC9A 3VKIA 4C8QC 4E47A 1NAFA 3CCRA 4ZTJA 4U74A 5LL6S 4C90A 5LCYA 2PVDB 4LDUA 2E6ZA 3WAJA 2RA1A 3L2UA 4DO0A 1M8VA 2RI2A 2EWNA 1BIBA 2RH2A 3FB9A 1YJWT 1WGSA 3ESLA 1I81A 4A54A 3MK7C 2KLQA 1BR4A 4GOUA 3GNFB 4LD6A 5FYMA 2XHCA 1UGQB 5JDGA 5LGTB 3CCVA 2B1EA 2X4XA 4M78B 1LJOA 3PTRB 2XIDA 5C8YE 2P9BA 2ZLYA 1LKXA 1UX5A 5D6YA 5CKBA 4N4IA 3CC4A 5GMKj 1Y96B 3L2RA 2D0UA 1VQ9T 5HYAA 3C4WA 4F7UG 3O1HA 3RRWA 5L3FB 4KULA 3VKGA 5D6XA 3OS2A 4I55E 4BJNA 1VQNA 4M75E 4J5YA 4H9PC 5LA6E 2ZPEB 1X75C 2KY9A 4IUTA 4B9XA 3V5UA 3OYYA 3OYZA 2PFVA 5IT9E 2RJFA 4I4TE 5GMKl 1OWAA 3L09A 2CYZB 2K4YA 4AKLA 4ME7A 4ZS2A 4IE6A 1HXDA 3E19A 4IE0A 3AAAB 5CKHA 1VQ5T 5GAN6 4N0AC 5HY6A 2WSSV 1YHQT 2RD1A 4PJMA 3QUIA 3L2WA 3LYIA 5LJ5h 4GY5A 1K73C 3ZC1A 1VRBA 5DLOA 4ADZA 5HXEA 4IUVA 2FYKA 2DEQA 5C6SA 5L2LA 1ZV4X 3X28B 3HA4A 4TVRA 2E9XD 3OSVA 2RHIA 3JB9J 3S3OA 2Q9QD 3M4YA 3PGGA 3ETUA 3PIOA 2H7VC 4P0BA 2RHZA 4M77B 5GMKi 4QXHB 2JOYA 3DP7A 4C8QD 2EJ9A 4C0DB 3HKCE 4AKIA 3JB9F 1M4ZA 4PJOF 1D1CA 3U78A 3B57A 2JMHA 4C91A 3KVAA 1MMDA 4OVAA 3N5BB 1T98A 1D1BA 3C4SA 2RJCA 2VKHA 3FLGA 3Q9DA 2L8DA 3CQXC 4TX5A 5GAOn 5LHHB 5CAIA 1M1KU 1VQ7T 2ZM8A 3OBYA 1VQKT 3RERA 3OYJA 4M7AA 1BI2A 2PUKB 4LDXA 1Q86C 1QVFS 4L0RA 5CQYA 1NWMX 2EJFA 1HG2A 3O9XA 3CXCA 2M0OA 4FSXA 4M7DC 2JRKA 3L2VA 2N1GA 1V9DA 2PUOB 2X35A 4IKFA 3CKDA 4CI3B 3JC6D 4ELZC 1Y71A 4HKEA 1YI2A 2E10A 3BQKA 4HCBA 2LT3A 1XNIA 1YITA 3CCEA 4NS5A 4C0ZA 5FY1A 4UVAB 5J3BA 3VKHA 5DQVA 4ZHQE 4OF1A 4M77E 4C92A 3MO8A 4KMCA 1K9MU 3M59A 4AXPA 2CA5A 3IF8B 5KCHA 1UX4A 3RPUA 1SSFA 2LVMA 2DTHA 4H9NC 1NZ9A 1P92A 4PW8A 3PT9A 3KINB 4HKAA 2Y4YA 1HFAA 4BE1A 5GAMg 4OP0A 2P4TA 1Y07A 3CCET 4PK4A 3ZC0A 5M9OA 3M55A 2V8JA 5LP6E 1HTJF 5JDQA 2HPJA 2LRQA 4FI5A 4OB1B 3LX7A 3JCMX 5I2SA 4BJMA 3M5AA 2VXEA 5LJ3d 2YHTA 4UEMA 3RMSA 2X9YA 3OYBA 3KBUA 4EXTA 3SWNB 2FL7A 3F2EA 3LW5E 4E7SA 3H6ZA 2X4YA 2Z6EA 4P5NA 2LQ8A 2EHOA 4C92E 2QQRA 4N78D 4DVDA 3HI2A 3CEYA 3JB9G 4J7FA 1LRZA 4C92B 3WVEB 4HFVA 1IAPA 4HT9A 3CQCB 3H3AA 2NW8A 2QA7A 3K3NA 2IVWA 3VUBA 3GP8A 1VIEA 5CIUA 4XTWA 3JB9I 4J7IA 3CC2A 4E7JA 2ZGWA 4YFSA 3I1AA 2XK0A 4A4EA 4N4GA 3ANWB 4RMOA 1RL2A 3FC3A 5HK0A 2QTXA 2Y90A 2E8IA 3RYCE 2XDBA 5GONE 4EZHA 4P0AA 4JRIA 1Q7YU 3EFRA 1NE8A 5EZYE 1Z0PA 3CCLT 1VQ5A 3N2GE 2X0LB 3ZYMA 4M1PA 3OKQA 4EB6E 4N4HA 4QQ6A 3F57A 3M56A 3O8VA 2KWHA 3K8PC 4FT2A 3JCMP 4UV8B 3OMGA 2PVGB 2ACXA 3N9NA 3JCMb 5FU6B 3EAEA 5LGUB 4J8OA 2YU1A 1WNLA 3OYKA 4PL6A 4B6XA 4A53A 3ZLIA 2P0QA 2BDEA 2ZPGB 2KVQG 3FHNA 5HAXA 2EHOB 4UC4A 1KHCA 3VHLA 3V7SA 1U4QA 3GN5B 2IG0A 1KG1A 3AB3B 4YJ3E 3M57A 2C5IT 1D3BB 4QXCB 1G3TA 3CXCS 4M77A 4JJNK 3CMEA 5C0MA 1H7CA 3OYIA 3CMAA 2IC9A 4GK5E 3TREA 3RYHE 5A0LA 3HKDE 5L3BB 3ETVA 3H37A 5LYJE 5KH6A 1KQ1A 3DB4A 2CKKA 2JUFA 3PMTA 5GAOp 5A1LA 4KUMB 5JDFA 4H9OC 2JVVA 4M78D 1YJWA 3NRYA 4XK8E 3JCMf 3RYFE 3O4XE 1QVGS 3RUXA 3J7Yq 2EQJA 3QYHB 3N2OA 1YCYA 3P8CD 3N9PA 4PLLA 1G3SA 3V8LA 1WR6A 3CPFA 2V1DB 3NZPA 4CXXA 2PJQA 2G3RA 2LQKA 2XAGB 2KZ7B 2AHJB 3R6OA 5I21A 4C5IA 1NPRA 2QQ9A 3GOXA 4FM4B 1YJ9A 2XICA 5HKCA 4XTXA 5H6RB 3R6NA 1N9RA 1Q82C 5LJ3j 3Q2MA 3S6WA 3G71A 4V2SA 4X1YE 4YJ2E 5F3JA 2WSCE 3C4XA 5CVIA 2PQWA 1WYBA 5LJ5d 4ISTA 3OSSC 2KXPB 4C8QA 5JR9B 4H9SE 1WJRA 1BI0A 1UGPB 2WSEE 4BDZA 5FXXA 4M77F 3UUXB 1N6AA 4ZTFA 2KWIB 2CLYB 4X9DA 2VK9A 2Y8DA 4JLEA 1W2BS 3M53A 5HXRA 1LOJA 1EZ3A 4WBNE 3EUHA 1FXXA 4EIWA 5H6QB 4WBOA 3J81E 1VUBA 2ZZDA 2N2NA 2JTFA 1N27A 2Q9QB 4IIJE 1K73U 3WAKA 2DTOA 1U5PA 4UVCB 2L8KA 1VQ6A 2DCFA 3O1IA 4M77D 2EFIA 3ZBDA 1M5Q1 3N2KE 4J2CA 5TAOA 2LSYA 1WJQA 2KK4A 4RCCA 1VQ4T 2E70A 3A8LB 3BDUA 3SWNA 2GK9A 2CLYC 2RHYA 5LGNB 2BKDN 4M78A 4E7LA 2MWPA 3ZMUB 2R5MA 5LJ3f 1E1HB 4TN7B 2LNVA 3W15B 1YD8G 1BI3A 1PSEA 3GIBA 4HGAA 4ZI7E 4AQFC 2NW9A 2DD4A 3E9GA 4DBQA 4MALA 3MCAB 4JS5A 3B13A 3GF5A 4MZMA 4RCBA 2LSIA 2DNXA 3M65A 3HHTB 1U8RA 5GMKh 2VASA 3AAEB 2V26A 1YIJT 2R57A 2LSKA 3FBZA 1HF8A 4J83A 5JR9A 3I56T 1M90U 4M7DB 4Y91A 4L59A 1TH7A 3MEWA 3V8KA 4N0AA 2JJ9A 5IAYA 2DIQA 3JB9H 3LWIA 5DY9A 3MA9A 4C8QE 1D0YA 4M78F 3HP9A 2SPCA 5LBMA 4EYYR 4M7AE 3ZMVB 2CWYA 2EQUA 2WACA 5FY7A 2BVMA 2VWAA 5GAMh 1Y96A 2GFUA 1G5VA 3WXMB 3OYAA 2CXDA 2CZ1B 4O4JE 3FRNA 3N9QA 2VUBA 5CKEA 3MKDA 4PNIA 2CMRA 3P8BB 3EDVA 4WF2A 3C12A 1BKBA 4BI4A 3T9NA 1KD1C 4EZ4A 2E65A 3FXEB 3MEUA 4K0UA 2D0TA 4BE2A 1MNEA 4PFPA 1M90C 4M75F 3CCJA 2Y6XA 1BR1A 3CCJT 4V1Av 3CC7T 2YK0A 3CX8B 3BQLA 5GAN5 2VXFA 4EOZB 4X9CA 4O2BE 4LDWA 3VV0A 2XTLA 2DPPB 4MHCA 3LGLA 2Y4XA 2HAXA 1K8AU 4TV8E 3CD6T 4BACA 4M75A 3VUZA 3A5ZB 1LVFA 4UXNB 5M4YA 3C64A 4JEUB 2GF7A 2MF2A 3OJAA 3CCST 1MMNA 2DHRA 1Q82U 5J2TE 1LVKA 2PU9B 2BZBA 3J9X1 5GAOr 4C92F 4LD9K 1H641 3HKEE 1YBYA 2QQBA 3KXTA 2HD0A 1I8FA 4A4KA 3TEEA 4C5EA 4MMKA 2RK2A 2EJGA 3AVRA 1S72A 4O4IE 3UUMA 5L3EB 2LT1A 4MLKA 4ZGJB 3LJCA 4AKHA 2JZ2A 1MHNA 2WSFE 1BR0A 3AVSA 3HR0A 4XU3A 4AKRB 2CS7A 4EMKA 4PJOC 4C0GA 4E7ZA 4JLIA 3OYDA 2QA4A 3AA0B 3PMIA 4NUVA 3QZ5B 4Z02A 4IUPA 2RHUA 2K5BB 2CGHA 4A4FA 2YLBA 4NOYA 2QXFA 4M7AF 5JDHA 3P8DA 3QG1A 4RG8A 2XU8A 4AQGA 1VQKA 2EKOA 5I2MA 2DO3A 2JMKA 4Z8XA 2X9XA 5ADXL 3ZPOA 2EHOD 5CK9A 3CX6B 3UULA 1QW1A 3PUQA 5F8PA 1VQOT 2X51A 2G0UA 4H63V 4QX7B 2YLCA 2VKDA 4M77G 3URGA 2DLRA 2W00A 3G4SA 4IE7A 3VYHB 2ZPHB 4L5GA 2E6NA 2C5KT 4OGCA 4ZI2D 5D6WA 4H63H 4KUIA 4EPCA 2OTLA 2K24A 4JRKA 2CXFA 3OYCA 5FY0A 4BY6C 1KK7A 4JUVA 3SFMA 2DJZA 4RG2A 1I4K1 4C8QF 1QVFA 1VQOA 3I55T 2RP4A 1US7B 4BD3A 4HA8A 3I0OA 3NZQA 5KE3A 2XUEA 2PBIA 4ERRA 1VQ8A 4G2AA 4BI3A 5KCOA 4UV9B 1ZHIA 3MEVA 1D3BA 5J2UE 3LBXB 3IBPA 5GANf 1QVGA 1RI0A 1FIOA 4ZS3A 3ZN1B 3LLRA 2ZM2A 2GFAA 1XOVA 1WYCA 5LJ5f 2E12A 2IC6A 4DMVA 2X9WA 1B7TA 3N5LA 1S94A 2W62A 4UF0A 4M75B 3HKBE 2KDSA 4M7AD 4XAXB 4M7DG 2HQXA 3M58A 1M1GA 2DI4A 4F7UA 3DB3A 4WW0A 2DIGA 3MP8A 5GAMj 4KUDK 1FEWA 4M77C 3OYEA 3G7ZA 4F7UF 1MIWA 2NW7A 2X4JA 3OYFA 2MOZA 1Y7XA 3QSUA 1M1KC 4FT4A 3EFSA 1HG5A 3LK2B 4QKNA 2CZ0B 5A0GA 4C92D 3LG7A 2HBPA 2K5IA 4M7DE 3G6EA 1XQHA 2BIVA 4BY6B 2V7JA 1M9SA 4OB0B 2Q9QC 4EMKB 2KT9A 3R84B 2K9AA 3RKYA 2M1HA 3QHSA 3HRUA 1KD1U 2KMFA 3QKJA 5FROA 2E1HA 1DJ7B 3MZKB 2HQEA 3LBXA 4QQDA 4MDWA 3JCMQ 1IZNB 2E9XA 3RESA 5FU6C 2DK3A 2I2LA 2JNGA 3N9OA 3U3IA 3CX7B 2LSGA 5GAN8 5A0DA 4O4LE 4UELA 3BY7A 3OYMA 3BW1A 4CZZB 5EK2A 4HTEA 3OYLA 5L3GB 3H8ZA 5HXCA 2WM9A 2XG8D 1Q86U 3UPUA 2KNDA 2O4XB 1YI2T 3CPWS 4PJLA 2CZ7B 4F7UB 4M7DD 3QPHA 1UEBA 4GIWA 3RKXA 4BDYA 4JLGA 1G8XA 1MNDA 3OS1A 5IYZE 3J80E 3A8GB 5LJ3g 1VQPA 3WVDB 3ER0A 3JCMh 3TKLB 1VQ7A 2MI6A 1YIJA 3MEAA 2C5JA 3I9YA 2DVEA 3OQ5A 5GAMe 3KV5A 3I0QA 2E41A 3QO3A 4MMLA 4XTYA 4QVCA 3GMIA 2ES0A 5J26A 1JB0E 3ZFJA 4DNDA 2VV5A 3JCMV 4JRQA 4EAHA 2J1DG 1VQPT 3HRTA 3ZCIA 5JDLA 4I50E 1BR2A 5A2QE 1ZBXA 4BE0A 3MXZA 4EDUA 1OZ3A 3Q5XA 2NP9A 1W4SA 4M78C 2RB6A 1NJIU 5CKDA 3J7AF 4XBFB 3L42A 2D2SA 2ZPFB 2UXNB 1LNXA 4P09A 2M16A 4C8QB 3LK3B 2DWKA 5GMKm 4C92C 4UF0B 3FB2A 3PUSA 3CPWA 2V8KA 4C8QG 4PJNA 1U1TA 2MTQA 2EAYA 4DOVA 3HSBA 5LBQB 1ZEEA 1XTDA 4FJOA 4PK6A 3OYGA 3CMAT 3QXEB 2RA2A 3CMET 3CCMT 4PJOE 2LX9A 2MYSA 2CZ6B 4NL2A 3CVRA 4X20E 5AYFA 2RJEA 3PE0A 2DKGA 2C06A 2YEVC 3ZJ1A 5FRMA 2QDYB 2LCLA 3LFMA 1HS7A 3KBGA 4E7HA 4QWNB 4O8SA 1SHZC 2KAFA 2XQYA 2X66A 2EQMA 3CBPA 1KQSA 1VQ9A 2EIFA 2WMOA 5GANh 4M75D 4KT0E 3HRSA 3UWNA 2KINB 4GLKA 5FLXE 2ZMAA 2RI3A 2Y48B 5FXWA 4UVBB 3HL6A 3META 4MFRA 2ZM0A 2VGNA 2FVUA 4ZN1A 4A4HA 3A8OB 3KFWX 3QYGB 5JDMA 2ZPIB 5GANg 3QZ9B 2W0GA 4QW2A 1WRDA 2OAUA 2WMNA 2ODVA 1BIAA 3LWHA 2ZCFB 3KUFA 2L5QA 3ZCJA 5GAOl 4OFZA 4XU1A 3UT1A 3CC2T 1O9SA 1G73A 5CCAA 4R55A 4PFOA 2QEXA 3TCJA 3M54A 2XAHB 5LJ5e 2MMPA 2D5UA 2A3LA 4C0DC 1N8RU 2RJDA 3X20B 4KBMB 2L89A 1CUNA 2H3RA 3E1SA 4CI1B 2PVOB 4OB3B 5FXZA 2A72A 1N8RC 2JN0A 4HE8A 3DTOA 5GAOm 4O2AE 3T8OA 4BI8B 3JRZA 4PJOG 3BQIA 4M7DA 4CRIA 4FIBA 5JVDE 2K5FA 4EMKC 3M4GA 3FBLA 3OS5A 3PU8A 3UFEA 4NL3A 1VQ4A 4M75G 5FRNA 3QJ6A 3I9WA 3C98B 3Q1JA 3RX6A 3N9MA 3TU4K 1MGQA 3S3MA 3JB9D 3X24B 4CXWA 4EYUA 5JDNA 3EDUA 3PU3A 5LJ3e 2I59A 1VQMA 1AJ3A 1QP3A 1SA0E 3KV4A 2CEAA 3A8HB 1VQLT 2BUDA 5KDMC 2LCCA 5GAN3 1MMAA 1D1AA 2P0PA 3LH0A 4NUUA 1IREB 3HL8A 3RMQA 3A5XA 4PJJA 5FXVA 4UIGA 3BDLA 2IW5B 2LM9A 5GANe 4RKUE 1JJ2S 2LJLA 4ILUA 4BAYB 3GN5A 4OYKA 1FWZA 3PUAA 4LDVA 3RKOA 2XHEB 3JCMW 4XU2A 1FMWA 4XTVA 3E08A 4FL6A 2VB6A 4DMWA 4PAGA 1HK9A 5LJ5g 4CI2B 2O01E 3CCRT 2QQAA 2JTMA 3SD4A 4EMGA 2MWOA 2VC8A 3V7CA 1KC8C 5IN1A 2K3XA 2UXXB 3G71T 3S3NA 3LK42 1OZ2A 2E5QA 4FU6A 1IZ6A 1W2BA 4GK0E 4IURA 1YJ9T 5DJQC 4C5HA 3L3PA 4J6WA 1WPYA 1QP2A 3IEEA 2D6FA 4D6WA 2B8AA 1GXIE 3ZYLA 4QVDA 4OK0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMC A;  2LQK A;  4L5G A;  4MFR A;  4XAX B;  2LT3 A;  2EYQ A;  2LT4 A;  4ILU A;  2LT1 A;  4KBM B; 
#chains in the Genus database with same CATH topology
 2QA4 T;  2DYI A;  4L6V 5;  5FW9 A;  2XQ6 A;  1ZQ1 A;  3AEF A;  2K6D A;  3PFS A;  2CT3 A;  3VU3 C;  5J39 A;  3NTK A;  4F17 A;  3KDS E;  3NGP A;  3ZEF B;  2KSS A;  3QBY A;  3FEO A;  2F5T X;  3QWY A;  4DEX A;  3T1H T;  1OUL A;  2A3D A;  3S4U A;  4H9Q C;  3CD6 A;  3NFC A;  3NTH A;  4J9C A;  2KYB A;  1I5L A;  3E22 E;  2W63 A;  4HVU A;  4JZ3 A;  3VYG A;  4IDZ A;  5CA1 E;  1VQL A;  4A56 A;  1YI2 Q;  3CQG B;  4J9G A;  1KQ2 A;  3PDY A;  5AQF B;  2WZI A;  3MP1 A;  4X64 T;  3FJ5 A;  3C4Z A;  4LDY A;  4ZGE B;  2BKP A;  3H41 A;  2WCA A;  4ZI2 C;  2HL5 C;  5FU7 B;  2DZ9 A;  4BB7 A;  5EK4 A;  3JCM d;  5DLQ E;  5GMK e;  3KBT A;  2RHX A;  3L1A A;  4MZT A;  3QDR B;  3JCM c;  3D0T A;  2LMJ A;  1UJ0 A;  3BE3 A;  4ZI3 C;  1AWJ A;  1X27 A;  1YHQ A;  1FMK A;  3F70 A;  3ZMS B;  2DXU A;  4Q5W A;  3JC6 C;  4DV6 T;  1K8A R;  3JSC A;  2LTO A;  2MCN A;  2GTJ A;  2V7M A;  2CUB A;  3PUZ F;  4CXY A;  4ILA A;  1Q82 R;  3RYI E;  1WDX A;  2WS3 A;  5GAM f;  1Q81 U;  1OU9 A;  2XPK A;  1J3T A;  2D9D A;  2ODU A;  3OBV E;  5LJN A;  3FIF A;  2MAM A;  2D8H A;  3A98 A;  2MPK A;  4ATO A;  2DTI A;  4NPP A;  2YXY A;  1NG2 A;  1OED C;  1UK5 A;  3CWZ B;  2M67 A;  4X1K E;  1OOT A;  3ONL C;  2JIW A;  3OMC A;  4X34 A;  1O3X A;  3G6E T;  2BTT A;  5CKF A;  1KD1 R;  3CC4 T;  1VQO Q;  5JRC B;  2C0S A;  2CPT A;  5LNK A;  1YW0 A;  3A7M A;  3CCU T;  1JJ2 A;  2A08 A;  4XQ3 A;  5CQX A;  3RGL A;  2N9D A;  2QGS A;  2P0K A;  5GJV B;  4DQ2 A;  1JQQ A;  3SDZ A;  2LOP A;  3RH3 A;  4E7K A;  1O75 A;  5FWC A;  1MUZ A;  1KNZ A;  1HX8 A;  5KYU A;  5GAN d;  3RRC A;  2XDP A;  1WZO A;  4FYV B;  2A7Y A;  3AAI A;  4B3R T;  4HFD A;  2LEH A;  4B3T T;  3CCL A;  3ASK A;  2COY A;  3NRX A;  3I56 A;  2X67 A;  4BUG A;  2NTX A;  3Q5D A;  2XD0 A;  2H7O A;  5EK3 A;  2VVN A;  3P4S A;  2EYQ A;  2NTY A;  4J6Y A;  3LSV A;  3RIR A;  2DIL A;  2R58 A;  2QEX T;  2DXB A;  2BG9 A;  2D9T A;  4ORZ A;  2DL8 A;  1K9A A;  5GJW B;  1W0A A;  4AQY T;  1FX7 A;  1KQS S;  4OB2 B;  2E5V A;  1OU8 A;  2F2X A;  3LGF A;  4YTL A;  1B34 A;  3UT5 E;  1N5Z A;  2V7L A;  4ZOL E;  3QK6 A;  4M78 E;  1ZP0 A;  1GBQ A;  1X01 A;  1QMC A;  4HCC A;  1JNR A;  2NYS A;  2YDQ A;  5KX5 E;  3GPL A;  5GAN j;  1F1B B;  2KQW A;  1KF6 A;  3DLM A;  2YDS A;  4M7A G;  4OHF A;  1UGR B;  4Y28 E;  3QUJ A;  2SEM A;  1BB9 A;  1PSF A;  2BBH A;  5CFB A;  2CXL A;  3AEA A;  2DE0 X;  3CCQ A;  3AEC A;  1UUR A;  2OI3 A;  4XTU A;  1RUW A;  1BYM A;  2X3W D;  3P8H A;  2DBM A;  2EKH A;  4XU0 A;  2NOX A;  2K2V A;  4HFC A;  3C50 A;  4TV9 E;  4ELY C;  1E2A A;  2IIU A;  4MBQ A;  3I55 A;  3AXJ B;  1IJ6 A;  3X26 B;  3UDC A;  1VQ5 Q;  3OY9 A;  4WNK A;  3SWH A;  1B3Q A;  2VL0 A;  2UXC T;  3F31 A;  1D0X A;  5JH7 E;  3HFN A;  3CBM A;  1X6O A;  4U72 A;  1VOM A;  4PJO B;  3MP6 A;  4PLI A;  4Q25 A;  2WY2 A;  1JJ2 P;  2HPL A;  1PCX A;  2WP9 A;  2KT8 A;  3CCU A;  2K57 A;  3K3Q C;  3OW2 A;  5JRC A;  4KGX B;  1QVP A;  1FJG T;  2F1L A;  3TSZ A;  4IDO A;  4C92 G;  2LHN A;  1IRX A;  2KXD A;  2JQQ A;  1X2K A;  2CHN A;  4LFB T;  5DQW A;  2KYM A;  3X25 B;  4WCI A;  4DR3 T;  2VL8 A;  4F8H A;  4TUY E;  1MMG A;  1R8O B;  3EG0 A;  1N9S A;  3AA7 B;  3VU7 H;  3PIP A;  1VQN T;  4MDX A;  2DXT A;  3ZEH A;  1YJ9 Q;  1AD5 A;  4ISS A;  5LMU T;  2KMT A;  4IUU A;  1YP5 A;  4FCY A;  1X69 A;  3AA1 B;  1VCT A;  4JDS A;  3TLU A;  2CE7 A;  1WJS A;  4HVW A;  3JAF A;  1NEK A;  3ZL7 C;  3G4S T;  1ZUK A;  1V29 B;  5HWY A;  3CCM A;  4DA4 A;  4JEH B;  4AFU C;  4G63 A;  2J62 A;  1ZUY A;  3VS6 A;  3CCV T;  2DWG A;  1VQM T;  1FMV A;  4DR6 T;  1WQ7 A;  4PK5 A;  1NPP A;  2FB7 A;  2MBG A;  2ENM A;  3IA3 A;  1PRL C;  5IH2 A;  4YLH A;  2QI2 A;  2X4W A;  4BA9 A;  1AHJ B;  2CP6 A;  3RKW A;  4M7A C;  3PUR A;  3C94 A;  4DBR A;  3P4P A;  5LJM A;  5KMG P;  5BMV E;  1VIF A;  2DAQ A;  1YIT T;  2LNH B;  2QRX A;  3P4Q A;  2LC4 A;  5HK3 A;  2JS2 A;  1IJ5 A;  2W61 A;  1TS9 A;  5HXH A;  5FNV E;  1YJN A;  1U06 A;  2C0T A;  2MAW A;  3SWN C;  4DBF A;  4PJO A;  3JAM E;  5JRE A;  4ZN3 A;  2O4X A;  5BR8 T;  2X9H A;  3ANW A;  2BVL A;  2KRS A;  3OB9 A;  2DZC A;  3V8J A;  2OV9 A;  1G3Y A;  1OXZ A;  1U1S A;  4OMF B;  3KV6 A;  1K9M C;  3RNJ A;  3K3O A;  4YTN A;  4LF9 T;  4XTZ A;  4AQF A;  4JS4 A;  1S72 T;  4ZI3 D;  2HH7 A;  3GNG A;  3JCM J;  4AKG A;  1YJN T;  1JBM A;  2V7I A;  3H0I A;  1YIJ Q;  1S35 A;  1UGS B;  3PNW C;  3KVB A;  3FXD B;  1QVG P;  1YWO A;  2K79 A;  3RIU A;  2OTJ T;  2PG8 A;  4PNO A;  3I5S A;  5LXT E;  1K73 R;  3P7I A;  4F7U E;  3G71 Q;  4VUB A;  5LHG B;  3SOL A;  2IAK A;  3AA6 B;  2JPF A;  5JR9 C;  3MJX A;  3M0P A;  3RR6 A;  3PTA A;  2NWB A;  5E0O A;  3ZYK A;  1UB4 A;  2QK0 A;  3C0C A;  2KGT A;  2DNU A;  2JS0 A;  3I5R A;  4IUQ A;  4ZGD B;  2WWV A;  3ME9 A;  3RC3 A;  4QH5 A;  3E9F A;  3HPW A;  8ATC B;  3AHU A;  4DUZ T;  3ZMT B;  4AFQ C;  1ZKE A;  2XKO C;  2VYT A;  3EGD A;  3UQ4 A;  4C5G A;  2F5K A;  1M1F A;  2CP0 A;  3V7R A;  4JRP A;  1K1Z A;  4DV3 T;  5HWX A;  4EMH A;  3UUN A;  3UUB A;  5DM7 R;  1BCO A;  3AE2 A;  3OYX A;  1Q95 G;  2E64 A;  2RPN A;  3L39 A;  1DU2 A;  4DOW A;  3H0F A;  5CR2 A;  2L3R A;  1BU1 A;  1AOJ A;  3DKM A;  2WZH A;  1IB8 A;  4U31 A;  3D7S B;  4E7I A;  2CBJ A;  2LHR A;  5HEH A;  4GYR A;  1PC0 A;  2RO0 A;  3CC7 A;  2EHO C;  3BK9 A;  4JI8 T;  5DAB A;  1XZY A;  2V7K A;  3OW2 S;  3FJP A;  4Z89 A;  5AFU L;  2EGC A;  3CPZ A;  2YU2 A;  3CBO A;  4ZZB A;  1BI1 A;  3OBW A;  3QII A;  4MZP A;  4PKC C;  2A28 A;  4AI6 A;  3IHR A;  4TWF A;  3TSW A;  3EI0 A;  3CCM Q;  1VQK Q;  2WBL A;  1B34 B;  4OYJ A;  5AQI B;  3GWH A;  2V6Y B;  3DJB A;  2GCX A;  4JZ4 A;  1Q86 R;  3C95 A;  1VQ8 T;  5IHK A;  1KJW A;  2X0H A;  2W10 A;  2LT4 A;  5GAO q;  2LKG A;  2R5A A;  1IBM T;  5JQG E;  3GA8 A;  2H3J A;  3UFG A;  2VKJ A;  1T72 A;  2JTE A;  2LSJ A;  1XMQ T;  2GQV A;  3FDR A;  5LJ5 j;  4I43 B;  1T8B A;  3EG1 A;  1OYX A;  1EIF A;  2YIN A;  3CIR A;  2K3Y A;  4R56 A;  2DXC A;  2HKQ B;  4QXB B;  1AT1 B;  2QGF B;  5HEJ A;  3QJY A;  3O1J A;  2ZPB B;  4M78 G;  1EX4 A;  5FU7 C;  5GAN 7;  3OYH A;  2RM4 A;  4YHH T;  3HTR A;  4M75 C;  3VJP A;  2D0Q B;  1VCS A;  3A1P A;  2L3P A;  2OTL T;  4C0F A;  4L9I A;  2LDM A;  5CB4 E;  1KC8 U;  3ONX A;  4ILC A;  3JCM g;  3CML A;  2AXD S;  3T1Y T;  3WI3 A;  2YRV A;  5L8R E;  4HT8 A;  3ULR B;  1Z8U A;  1NEN A;  2HN2 A;  4K0K T;  2HNI A;  1Q7Y C;  4RTT A;  2LE8 A;  3OS0 A;  3BFM A;  2DVJ A;  5IHN A;  3CC2 T;  4O4H E;  4O6J A;  2M9U A;  5AQH B;  5IHY A;  4F16 A;  2W67 A;  1Y64 B;  2XI9 A;  1T0J A;  4QVZ A;  3UTK A;  2FZK B;  4CN6 A;  1G83 A;  5LHI B;  4B9W A;  2VGM A;  3QOF A;  4DBH A;  2OTJ Q;  2E9X B;  2AK5 A;  1WQW A;  5KE2 A;  4ANJ A;  3NTI A;  1KSW A;  2LRL A;  2DD5 A;  3CME Q;  4IE4 A;  4GYS A;  1M90 R;  2W66 A;  2XAF B;  3HKS A;  1QCO A;  2VKO A;  1TWB A;  2OTJ A;  1MIV A;  1TXQ A;  2RI5 A;  1QUU A;  2A2F X;  1GFC A;  4B6M A;  4YHJ A;  1OPL A;  4H9R C;  2EYW A;  2CM0 A;  4O5V A;  2NLU A;  1UEC A;  2FHD A;  5JTG A;  1R0C B;  3CCJ Q;  5GAM d;  4IE5 A;  4X65 T;  1K8A C;  4KP3 C;  2CCQ A;  5LG4 A;  2HHH T;  3AED A;  3AE1 A;  2GGR A;  2Q9Q A;  2WAU A;  2CRB A;  2QAS A;  4OGE A;  2CWO A;  1JRI A;  1QWE A;  3OYN A;  2XAS B;  3RI5 A;  3L2Z A;  2K48 A;  5CA0 E;  3L2Q A;  3OA6 A;  1QKX A;  1QSD A;  5IWA T;  1YKH B;  3ZMZ B;  3EH2 A;  4J6X A;  1VQ6 T;  5FP3 A;  2E9X C;  1N34 T;  3E0Z A;  2FZG B;  3EG9 B;  2WWU A;  5LOV E;  3MHX A;  1GCP A;  4F6R C;  1G3W A;  5CO7 A;  4U3C A;  3V5S A;  4ASK A;  3JCM e;  1RAA B;  3CC4 Q;  3REA B;  1UCU A;  4RTX A;  1CHU A;  3AEG A;  3MAC A;  1OI1 A;  2L3L A;  2CSI A;  1WLX A;  3GLX A;  1YKE B;  1Q81 C;  5KYW A;  4LFC T;  3ZN0 B;  5L3D B;  3P4R A;  1IHV A;  5GAN 4;  2K5L A;  3UAT A;  3EVY A;  5FL1 A;  2QAZ A;  2QQS A;  3SS1 A;  1PKT A;  2BE9 B;  4HFB A;  1ZHC A;  2NR4 A;  5AQT B;  4HEA A;  3ZJ2 A;  2H88 A;  4JUY A;  4JI1 T;  4QQG A;  4PJO D;  3CCS A;  5EG2 A;  3RC8 A;  3C51 A;  4TZ4 C;  2XAQ B;  3Q5W A;  5FMN A;  4JPB W;  3KV9 A;  3SRZ A;  3SB2 A;  3DLL A;  1NYF A;  4HFH A;  2RK1 A;  4P1N A;  4COF A;  3EGD B;  1OPK A;  5ECA A;  2XDD A;  2KI7 A;  5L3C B;  5GAN 2;  1NJI C;  1UUE A;  1KHI A;  2C0I A;  3LH5 A;  4XZC A;  1YFN A;  2RQV A;  4M7A B;  2BS2 A;  3H9N A;  4E2F B;  4X1I E;  3UU6 A;  4JJD A;  4OMN A;  4IHJ E;  5ETW A;  4F04 B;  4UR9 A;  3HFO A;  1MIY A;  3PUG A;  2UUB T;  4II1 A;  4HN9 A;  1LCK A;  5HXS A;  1RAI B;  4AG1 C;  3A8M B;  2V8I A;  4QX8 B;  5L4E A;  1X79 A;  2J47 A;  4F14 A;  3CCQ T;  3NBX X;  4M7D F;  4KHZ F;  3I35 A;  5J1G A;  4JI6 T;  3M9Q A;  2F69 A;  2M6B A;  3INZ A;  4A4G A;  3N9L A;  1H3Z A;  3PJA A;  3RIA A;  3G1J A;  4HCZ A;  2LOS A;  2RN8 A;  1D0Z A;  4QHO A;  5LJ3 h;  1HCI A;  4TWH A;  1M3B A;  3AE7 A;  1TUG B;  4TWD A;  2EQK A;  4CI0 C;  2X68 A;  2XAJ B;  2OA5 A;  4OX9 T;  4IGU A;  5LB7 B;  4CQI A;  2L9Q A;  2EQI A;  3QC9 A;  3VKI A;  4HFE A;  4C8Q C;  3FZM B;  1NAF A;  4E47 A;  3CCR A;  2NUP B;  4ZTJ A;  2IHR 1;  2KEA A;  4U74 A;  1S1N A;  4C90 A;  5LL6 S;  5LCY A;  4CC2 A;  2BZX A;  2PVD B;  3Q5E A;  4LDU A;  4LXC A;  2E6Z A;  3WAJ A;  2RA1 A;  1CKA A;  4LN2 A;  3L2U A;  4DO0 A;  1M8V A;  2RI2 A;  2KSR A;  2EWN A;  4IDP A;  1BIB A;  1VA7 A;  2RH2 A;  1M2V B;  3FB9 A;  1YJW T;  1PHT A;  1PD1 A;  2DL5 A;  1WGS A;  3ESL A;  1I81 A;  4A54 A;  3MK7 C;  2KLQ A;  1X6B A;  3UU5 A;  1BR4 A;  4GOU A;  2DER A;  3GNF B;  4LD6 A;  5FYM A;  3SFE A;  2XHC A;  1UGQ B;  5JDG A;  3UQ7 A;  5LGT B;  1AZG B;  3CCV A;  2B1E A;  1AZE A;  2X4X A;  4M78 B;  1LJO A;  3PTR B;  2XID A;  5C8Y E;  2P9B A;  2ZLY A;  1LKX A;  1NLO C;  1UX5 A;  2QYW A;  5D6Y A;  4ILB A;  2H89 A;  5CKB A;  4N4I A;  2VKN A;  3VS3 A;  3CCV Q;  3CC4 A;  5GMK j;  1Y96 B;  3L2R A;  2XM1 A;  2D0U A;  1VQ9 T;  5HYA A;  3C4W A;  4F7U G;  3RLF F;  3O1H A;  3RRW A;  5L3F B;  4KUL A;  4WYV A;  4JYA T;  3VKG A;  5D6X A;  3OS2 A;  5L23 A;  2XQ3 A;  4I55 E;  4BJN A;  1VQN A;  3TLW A;  4M75 E;  4J5Y A;  4H9P C;  2DL4 A;  5LA6 E;  2ZPE B;  1X75 C;  3FZL B;  7AT1 B;  4KH1 B;  3OPC A;  2KY9 A;  1HSQ A;  4IUT A;  4B9X A;  3V5U A;  2UXD T;  3OYY A;  3OYZ A;  1VQN Q;  4CN1 A;  3VRZ A;  2NUP A;  1TUC A;  2PFV A;  2V1R A;  5IT9 E;  2PTF A;  2RJF A;  1CSK A;  4I4T E;  3PUX F;  4WZX A;  5GMK l;  4DV7 T;  2LJ0 A;  2KR3 A;  2HQH A;  2XZE A;  1RAF B;  4JI7 T;  1OWA A;  3L09 A;  2CYZ B;  3ZST A;  4J9F A;  1R0B G;  2K4Y A;  4AKL A;  4ME7 A;  5AQL B;  4ZS2 A;  4IE6 A;  4CN4 A;  1HXD A;  1TTH B;  3E19 A;  4IE0 A;  3AAA B;  1GCQ A;  2AT1 B;  5CKH A;  1VQ5 T;  5GAN 6;  4N0A C;  1WR0 A;  5HY6 A;  2WSS V;  3EG9 A;  1YHQ T;  2RD1 A;  4PJM A;  3QUI A;  3L2W A;  5ABF B;  1QQJ A;  3LYI A;  5LJ5 h;  4D8D A;  4GY5 A;  1K73 C;  3ZC1 A;  2YSQ A;  1WA7 A;  1VRB A;  2HEQ A;  5DLO A;  4ADZ A;  4X62 T;  1YQ4 A;  5HXE A;  4IUV A;  2FYK A;  1VQ4 Q;  2IPO B;  2DEQ A;  5C6S A;  5L2L A;  1ZV4 X;  2MPX C;  1M3A A;  3X28 B;  3HA4 A;  5AQM B;  4TVR A;  2E9X D;  3OSV A;  4HVV A;  2RHI A;  3JB9 J;  4YSZ A;  2Q9Q D;  3M4Y A;  2GNC A;  3S3O A;  3PGG A;  4J9D A;  1RAE B;  3ETU A;  4YSX A;  1C6V X;  3PIO A;  2H7V C;  2JT4 A;  4P0B A;  2RHZ A;  2RMO A;  4M77 B;  2ROT A;  5GMK i;  4QXH B;  2JOY A;  3DP7 A;  4C8Q D;  2EJ9 A;  4C0D B;  3HKC E;  4AKI A;  2L0A A;  3JB9 F;  1M4Z A;  4PJO F;  1D1C A;  3PUY F;  3U78 A;  2XQ4 A;  3B57 A;  2ABL A;  2JMH A;  4C91 A;  3KVA A;  2MIO A;  2J6F A;  1E6G A;  2WDR A;  2H3E B;  2OX7 A;  1MMD A;  2PZ1 A;  3N5B B;  1T98 A;  1D1B A;  4OVA A;  2E3H A;  3AE9 A;  2CH4 A;  2LJ1 A;  3C4S A;  2RJC A;  3AXJ A;  1S72 Q;  2VKH A;  2QVA A;  3FLG A;  3Q9D A;  4I0U A;  3CQX C;  4TX5 A;  2L8D A;  3AT1 B;  4HXJ A;  2CRE A;  3THK A;  5GAO n;  1GFD A;  5LHH B;  1W70 A;  5CAI A;  1M1K U;  1VQ7 T;  4R0K A;  2ZM8 A;  3OBY A;  2W0Z A;  1G2B A;  2AIR B;  1VQK T;  3RER A;  3OYJ A;  4M7A A;  1BI2 A;  2PUK B;  4LDX A;  1Q86 C;  1QVF S;  4L0R A;  5CQY A;  1NWM X;  1M30 A;  2EJF A;  3PUW F;  1HG2 A;  1SUM B;  2I6H A;  3O9X A;  3CXC A;  2M0O A;  5CGM A;  4FSX A;  4M7D C;  2AZV A;  3EG3 A;  3VS7 A;  2JRK A;  3L2V A;  1BCM A;  2N1G A;  1V9D A;  2PUO B;  2X35 A;  4IKF A;  3CKD A;  4CI3 B;  4DR4 T;  3JC6 D;  1T7S A;  4ELZ C;  1KEY A;  1Y71 A;  4HKE A;  1YI2 A;  4YY3 T;  2E10 A;  3BQK A;  2OTL Q;  2BZ8 A;  2SRC A;  4J9E A;  4HCB A;  2LT3 A;  1XNI A;  2EPD A;  2O88 A;  1YIT A;  4QH1 A;  3CCE A;  5AQO B;  4NS5 A;  1VYV A;  4C0Z A;  5FY1 A;  2E5L T;  4UVA B;  1RAG B;  5J3B A;  2YRD A;  3VKH A;  4KGZ B;  4U33 A;  5DQV A;  4ZHQ E;  1M3C A;  4M77 E;  4OF1 A;  3MO8 A;  4KMC A;  1SHG A;  2YWW A;  1K9M U;  3M59 A;  4AXP A;  2CA5 A;  3IF8 B;  5KCH A;  1UX4 A;  3RPU A;  1SSF A;  2LVM A;  2DTH A;  4H9N C;  1NZ9 A;  5AQU B;  4PW8 A;  1P92 A;  3EHZ A;  3IQL A;  3PT9 A;  3KIN B;  4HKA A;  4RUG A;  5LG3 A;  2F2V A;  2Y4Y A;  2C0O A;  1HFA A;  2XSB A;  4BE1 A;  3H3M A;  5GAM g;  1Q7Y R;  4OP0 A;  2V8S V;  2P4T A;  1Y07 A;  3CCE T;  4PK4 A;  5FVL A;  3LDQ B;  3ZC0 A;  5M9O A;  3M55 A;  2V8J A;  2P84 A;  5LP6 E;  1ABQ A;  1HTJ F;  1PD0 A;  5JDQ A;  2HPJ A;  2IDO B;  2LRQ A;  1AEY A;  1I1J A;  4FI5 A;  5KXJ A;  4OB1 B;  1NLP C;  1VYT A;  1SHF A;  3EH1 A;  4OMQ A;  4YXD A;  3NWI A;  3LX7 A;  3JCM X;  2LQN A;  3PJA J;  4BJM A;  3M5A A;  2VXE A;  3VS2 A;  5LJ3 d;  1QLY A;  1WHK A;  5I2S A;  2YHT A;  4UEM A;  3RMS A;  1OQK A;  2X9Y A;  3OYB A;  1EFN A;  3KBU A;  4EXT A;  3SWN B;  2FL7 A;  3VRA A;  3F2E A;  2X0Y A;  3LW5 E;  4E7S A;  3H6Z A;  3M0R A;  3A8Y C;  4EGW A;  2X4Y A;  2NUT A;  2Z6E A;  4P5N A;  2LQ8 A;  1OED B;  2EHO A;  1Y01 A;  4C92 E;  2QQR A;  2EGE A;  4N78 D;  4DVD A;  3HI2 A;  3CEY A;  5AQR B;  1W2B P;  3JB9 G;  2A0F B;  4J7F A;  1LRZ A;  3CD6 Q;  1UGV A;  1W0B A;  2KRN A;  4C92 B;  3WVE B;  4HFV A;  4FYY B;  1VQ7 Q;  1IAP A;  1I6Z A;  3CQC B;  3CC2 Q;  4HT9 A;  3H3A A;  2NW8 A;  1RLP C;  2QA7 A;  3K3N A;  1ZA1 B;  1MV0 B;  1BBZ A;  2JMC A;  2O9V A;  2J4G A;  2IVW A;  1PKS A;  3TVT A;  3VUB A;  3GP8 A;  1VIE A;  3VS4 A;  5CIU A;  3RHW A;  4XTW A;  3JB9 I;  4J7I A;  3CC2 A;  1Z9Z A;  2K3W A;  1JNZ A;  2ZGW A;  4E7J A;  1R8I A;  2FJB A;  1B07 A;  2QDL A;  2L3Q A;  3U23 A;  4YFS A;  2K2M A;  4KGV B;  3I1A A;  5IXB A;  2GQI A;  1FYN A;  2XK0 A;  1SG5 A;  1TSF A;  4A4E A;  4N4G A;  1JXO A;  3ANW B;  4RMO A;  1NBE B;  1RL2 A;  3FC3 A;  5HK0 A;  2QTX A;  2Y90 A;  1ZX6 A;  2VVK A;  2E8I A;  3RYC E;  2XDB A;  2I0N A;  2XMF A;  1M7K A;  3SFD A;  2WU5 A;  2RF0 A;  1YN8 A;  5GON E;  2M0Y A;  4EZH A;  4P0A A;  4JRI A;  2WDQ A;  1Q7Y U;  3EFR A;  3NKZ A;  1NE8 A;  5EZY E;  1Z0P A;  3CCL T;  1VQ5 A;  3N2G E;  2X0L B;  3ZYM A;  1WXU A;  1WHM A;  4RTW A;  4M1P A;  3OKQ A;  4EB6 E;  4N4H A;  4QQ6 A;  3F57 A;  5HEU A;  1ZA2 B;  3M56 A;  3O8V A;  2KWH A;  2FPD A;  3K8P C;  3RQW A;  2FRY A;  4FT2 A;  3JCM P;  4UV8 B;  2G6F X;  3OMG A;  2PVG B;  2ACX A;  3N9N A;  4AT1 B;  2AE9 A;  3JCM b;  5IHI A;  5FU6 B;  3EAE A;  5LGU B;  4J8O A;  5C2T A;  3SHW A;  2XY8 B;  4DEY A;  2YU1 A;  1WNL A;  3OYK A;  4PL6 A;  4B6X A;  4A53 A;  3ZLI A;  2P0Q A;  1Y0M A;  2BDE A;  2LP5 A;  2KVQ G;  2ZPG B;  2DBK A;  1K0S A;  2DEU A;  2EYY A;  3FHN A;  5AQP B;  5HAX A;  1OED A;  2EHO B;  4UC4 A;  3I56 Q;  1KHC A;  2J05 A;  3VHL A;  2HL3 A;  3V7S A;  1U4Q A;  2FPF A;  3GN5 B;  4IT4 A;  2IG0 A;  1KG1 A;  2LZ6 B;  4KRT A;  3AB3 B;  4NXN T;  4YJ3 E;  3M57 A;  1HX1 B;  3CXC P;  2C5I T;  4B3S T;  2F2W A;  1D3B B;  4QXC B;  1G3T A;  5I11 A;  3CXC S;  4M77 A;  4JJN K;  3CME A;  1XDP A;  2EBP A;  2L2P A;  5C0M A;  1VQ6 Q;  3QNU A;  1H7C A;  3OYI A;  3CMA A;  2IC9 A;  4DV5 T;  4GK5 E;  3TRE A;  1C0M A;  3RYH E;  5A0L A;  3HKD E;  5L3B B;  2WU2 A;  2CH4 W;  3ETV A;  3H37 A;  4AFZ C;  5LYJ E;  4FW1 A;  5KH6 A;  2K7A A;  1KQ1 A;  3DB4 A;  8AT1 B;  4A63 B;  2MOX A;  1IGQ A;  2CKK A;  2NWM A;  3CCQ Q;  2JUF A;  3PMT A;  5GAO p;  5A1L A;  4KUM B;  5JDF A;  4H9O C;  1V1C A;  2IML A;  4OMP A;  2JVV A;  4M78 D;  1HNZ T;  3I55 Q;  1YJW A;  3NRY A;  4XK8 E;  2O31 A;  1YHQ Q;  3JCM f;  3SEM A;  3RYF E;  1N8R R;  3O4X E;  1NEG A;  2K3B A;  1ZLM A;  1QVG S;  1UFF A;  2HMA A;  4IL9 A;  3RUX A;  3J7Y q;  4LF7 T;  4IIM A;  2EQJ A;  5L4H A;  1VQP Q;  2L3S A;  3QYH B;  3N2O A;  1ZSZ C;  1YCY A;  3P8C D;  3N9P A;  4PLL A;  1G3S A;  4DR7 T;  3V8L A;  1VYU A;  1WR6 A;  1BK2 A;  3CPF A;  4A5X A;  2V1D B;  3NZP A;  2LLY A;  4CXX A;  2PJQ A;  2G3R A;  2LQK A;  2XAG B;  2KZ7 B;  2DYB A;  2AHJ B;  3R6O A;  5I21 A;  4C5I A;  1WFD A;  1NPR A;  2QQ9 A;  3GOX A;  4FM4 B;  1YJ9 A;  1UG1 A;  2XIC A;  5HKC A;  3EAB A;  4XTX A;  3R6N A;  5H6R B;  1N9R A;  1Q82 C;  4LMJ A;  1ZOY A;  5LJ3 j;  3Q2M A;  3S6W A;  2M02 A;  1WCR A;  3G71 A;  4V2S A;  4X1Y E;  4YJ2 E;  5F3J A;  2WSC E;  4AIU A;  2J06 A;  4J9I A;  3C4X A;  2FBW A;  4Z8A A;  5CVI A;  2PQW A;  1WYB A;  5LJ5 d;  4IST A;  2DX1 A;  3OSS C;  3QDF A;  3CCL Q;  2KXP B;  3M0Q A;  4C8Q A;  5JR9 B;  4H9S E;  1AWW A;  1WJR A;  2DET A;  2XQ8 A;  3FZF B;  1BI0 A;  1UGP B;  2WSE E;  4BDZ A;  1YNZ A;  5FXX A;  2GBQ A;  4M77 F;  3UUX B;  1N6A A;  4ZTF A;  2OJ2 A;  1Z9Q A;  2KWI B;  2CLY B;  4X9D A;  4OMO A;  2VK9 A;  2Y8D A;  4JLE A;  1ZBJ A;  3M53 A;  5HXR A;  1LOJ A;  1W2B S;  3AEE A;  1EZ3 A;  4WBN E;  2LM2 A;  3EUH A;  3TLS A;  1FXX A;  4EIW A;  5H6Q B;  4WBO A;  4YTP A;  3J81 E;  1VUB A;  2J6O A;  2ZZD A;  3QB5 A;  2N2N A;  2JTF A;  1N27 A;  2Q9Q B;  4IIJ E;  1K73 U;  2M51 A;  3WAK A;  2DTO A;  4IDN A;  2F4V T;  1U5P A;  4U7Y A;  4UVC B;  2L8K A;  1VQ6 A;  2DCF A;  3O1I A;  4M77 D;  2EFI A;  3ZT5 A;  3ZBD A;  1M5Q 1;  3N2K E;  1YCS B;  1KC8 R;  4J2C A;  5TAO A;  2LSY A;  1WJQ A;  2KK4 A;  5KYY B;  2VQF T;  4RCC A;  2P4R A;  1JO8 A;  1VQ4 T;  1XMO T;  2E70 A;  3A8L B;  4LF6 T;  3BDU A;  2FJD A;  3SWN A;  1QKW A;  2YUQ A;  2YDR A;  2GK9 A;  2CLY C;  2RHY A;  5LGN B;  2E2A A;  4JV5 T;  4KH0 B;  2BKD N;  4M78 A;  1X9B A;  4E7L A;  1TU0 B;  3AE4 A;  2MWP A;  4JBW F;  3ZMU B;  2R5M A;  5LJ3 f;  1E1H B;  4FW2 A;  4TN7 B;  2LNV A;  3PVL A;  3W15 B;  4AFS C;  1YD8 G;  1BI3 A;  1OV3 A;  2KE9 A;  1PSE A;  2YUN A;  2YUP A;  3GIB A;  4HGA A;  3OW2 P;  1UDL A;  4ZI7 E;  1M27 C;  4AQF C;  2FJA A;  2I0M A;  2NW9 A;  2XQ7 A;  2DD4 A;  3E9G A;  4DBQ A;  4MAL A;  3MCA B;  1M8M A;  4JS5 A;  1CKB A;  1QCF A;  3B13 A;  2LKH A;  3GF5 A;  4KHP T;  3G6E Q;  4MZM A;  4RCB A;  2LSI A;  2DNX A;  3M65 A;  3HHT B;  1U8R A;  2KT1 A;  5GMK h;  2VAS A;  3AAE B;  4LF8 T;  2V26 A;  4KX6 A;  1YIJ T;  1QWF A;  2R57 A;  2LSK A;  3FBZ A;  1HF8 A;  4J83 A;  5JR9 A;  3I56 T;  3ZSS A;  1M90 U;  1UUS A;  1W9R A;  3AE6 A;  4M7D B;  4Y91 A;  5ABG A;  4L59 A;  1TH7 A;  3MEW A;  3V8K A;  4N0A A;  1VQL Q;  2JJ9 A;  5IAY A;  2EVR A;  2DIQ A;  1SEM A;  3LWI A;  5DY9 A;  3JB9 H;  3MA9 A;  1I0C A;  4B3M T;  4C8Q E;  3VS1 A;  1D0Y A;  4M78 F;  3HP9 A;  2SPC A;  5LBM A;  4EYY R;  2X3X D;  4M7A E;  4JI4 T;  2BKO A;  3ZMV B;  2CWY A;  1GQE A;  2EGA A;  1T0H A;  2EQU A;  2WAC A;  5FY7 A;  2BVM A;  2VWA A;  5GAM h;  1Y96 A;  2GFU A;  1YIT Q;  2JM9 A;  1G5V A;  3WXM B;  3OYA A;  2H8H A;  2CXD A;  2JXB A;  1H92 A;  2CZ1 B;  4O4J E;  3FRN A;  3N9Q A;  4LML A;  1YQ3 A;  1J1J A;  2YOE A;  2VUB A;  5CKE A;  3MKD A;  3M3Z B;  4PNI A;  2CMR A;  3P8B B;  3EDV A;  4QH4 A;  1HD3 A;  4WF2 A;  3C12 A;  4ZXL A;  1WX6 A;  1BKB A;  4HCK A;  4BI4 A;  1UHC A;  1UGO A;  3T9N A;  1KD1 C;  4EZ4 A;  2E65 A;  3ZKR A;  2EW3 A;  4RTV A;  3FXE B;  3JV3 A;  3MEU A;  1K9M R;  4K0U A;  2D0T A;  4BE2 A;  1MNE A;  4PFP A;  1M90 C;  4M75 F;  2CBI A;  2Y6X A;  1BR1 A;  2FEI A;  4V1A v;  3CCJ A;  3CCJ T;  3JAD A;  4ZEY A;  3CC7 T;  2YK0 A;  1OEB A;  3CX8 B;  2IIM A;  3VS5 A;  1QLB A;  3BQL A;  3KFV A;  5GAN 5;  2VXF A;  4EOZ B;  4X9C A;  4DR5 T;  2QGG A;  4O2B E;  4LDW A;  3VV0 A;  2XTL A;  2DPP B;  4MHC A;  3LGL A;  2Y4X A;  2HAX A;  4C92 A;  1K8A U;  1N33 T;  4TV8 E;  3CD6 T;  5ABF A;  2EYX A;  4X1V A;  4BAC A;  4M75 A;  4M4Z A;  2W2U A;  3VUZ A;  3A5Z B;  1LVF A;  4UXN B;  5M4Y A;  2HZY A;  3C64 A;  3OTO T;  2V1Q A;  4ESR A;  4JEU B;  2RPA A;  2GF7 A;  4HWI B;  2MF2 A;  3EGX A;  1D09 B;  3OJA A;  2HKN A;  2Z0W A;  3RKG A;  2XQA A;  3CCS T;  2VUR A;  1MMN A;  2DHR A;  5AQV B;  2BKN A;  1H8K A;  2MK5 A;  2WDV A;  1Q82 U;  5J2T E;  1PWT A;  1LVK A;  1KNP A;  4E6R A;  3CQT A;  2QG9 B;  2PU9 B;  2BZB A;  3J9X 1;  5GAO r;  3RIF A;  4C92 F;  4LD9 K;  1H64 1;  3HKE E;  1T3S A;  1J5E T;  1YBY A;  2QQB A;  1ZSG A;  3KXT A;  2HD0 A;  3REB B;  1I8F A;  4A4K A;  3TEE A;  4C5E A;  4LMK A;  4MMK A;  1IBL T;  2RK2 A;  2XJ7 A;  5ABE A;  3EFO B;  5FVK A;  2EJG A;  3AVR A;  3UU4 A;  4O4I E;  1S72 A;  4YTM A;  3UUM A;  5L3E B;  2LT1 A;  4MLK A;  4ZGJ B;  3LJC A;  4AKH A;  4LUE A;  5EC7 A;  2JZ2 A;  1MHN A;  2WSF E;  4D8K A;  1BR0 A;  3AVS A;  3HR0 A;  4XU3 A;  4AKR B;  2CS7 A;  4EMK A;  5FWB A;  4C0G A;  4E7Z A;  4JLI A;  3OYD A;  2QA4 A;  3P4W A;  4PJO C;  3AA0 B;  3PMI A;  1E6H A;  4NUV A;  3QZ5 B;  4Z02 A;  4IUP A;  2RHU A;  2K5B B;  2CGH A;  4A4F A;  4AMC A;  2YLB A;  5CJ5 A;  4NOY A;  2CDT A;  2QXF A;  3CMA Q;  4M7A F;  5JDH A;  1HYO A;  3P8D A;  3QG1 A;  2FUP A;  4WTO B;  2ATC B;  4RG8 A;  2XU8 A;  4AQG A;  1VQK A;  3TQ7 P;  2EKO A;  1JXM A;  5I2M A;  2DO3 A;  1KFY A;  2BBJ A;  4GLM A;  1EZZ B;  1ABO A;  1IO6 A;  1WHL A;  3EGX B;  2V5D A;  3VS0 A;  2JMK A;  4Z8X A;  2X9X A;  2V6Y A;  1X2Q A;  5ADX L;  3ZPO A;  2EHO D;  2E4H A;  2DL1 A;  1TG0 A;  3NHN A;  3RIU C;  5CK9 A;  3CX6 B;  3EHR A;  2D1X A;  3UUL A;  1QW1 A;  3PUQ A;  2FZC B;  5F8P A;  1VQO T;  2X51 A;  3NMZ C;  4X5T A;  2G0U A;  4H63 V;  4QX7 B;  2YLC A;  1K4U S;  2VKD A;  1TOV A;  4M77 G;  3URG A;  4YT0 A;  2E3I A;  2DLR A;  2W00 A;  5AQN B;  3G4S A;  4IE7 A;  3VYH B;  1L0V A;  2ZPH B;  1QVF P;  4L5G A;  5I22 A;  2E6N A;  2WQY A;  2C5K T;  4OGC A;  4ZI2 D;  5D6W A;  3AEB A;  4GKK T;  5FL0 A;  4H63 H;  1T3L A;  3M0U A;  3QWX X;  4KUI A;  4EPC A;  4FYW B;  2K24 A;  2OTL A;  4JRK A;  2CXF A;  3OYC A;  3TLV A;  3M0S A;  4PFZ A;  3VRY A;  5FY0 A;  2JW4 A;  4BY6 C;  1WXB A;  1KK7 A;  4JUV A;  3SFM A;  1WXT A;  2DJZ A;  4RG2 A;  1I4K 1;  4C8Q F;  2UU9 T;  6AT1 B;  3UU8 A;  5KYY A;  3NVO A;  1VQO A;  1QVF A;  2YKS A;  2LX7 A;  3I55 T;  2RP4 A;  1US7 B;  4BD3 A;  4HA8 A;  3I0O A;  3K1S A;  3NZQ A;  5KE3 A;  1NM7 A;  4TNW A;  2DL3 A;  2XUE A;  1K0X A;  3M0T A;  2PBI A;  3E2U A;  4ERR A;  1VQ8 A;  4G2A A;  4BI3 A;  5KCO A;  2W4X A;  4UV9 B;  5HCM A;  4HWH A;  1A0N B;  1Y57 A;  1ZHI A;  5HCJ A;  3UA7 A;  3MEV A;  1YWP A;  1D3B A;  5J2U E;  3LBX B;  3IBP A;  1TUD A;  5GAN f;  2LRK A;  4KI0 F;  4DR1 T;  1QVG A;  4HWD A;  3TLT A;  1RI0 A;  1FIO A;  4ZS3 A;  2HDA A;  3ZN1 B;  3LLR A;  2ZM2 A;  4X66 T;  2GFA A;  1GRI A;  2UUC T;  1SPK A;  1XOV A;  1WYC A;  1RAB B;  5LJ5 f;  4JJC A;  2E12 A;  2IC6 A;  4Z91 A;  4DMV A;  2E5K A;  1UJY A;  2ED1 A;  2X9W A;  1B7T A;  4AG2 C;  3N5L A;  2AZS A;  5KYU B;  1S94 A;  1NYG A;  2W62 A;  4UF0 A;  4M75 B;  4EED A;  3HKB E;  4IRE A;  2KDS A;  2DFU A;  3FZH B;  4J9H A;  4M7A D;  4XAX B;  4EV6 A;  3VR9 A;  2QTV A;  4A97 A;  5AQJ B;  2HQX A;  1Q81 R;  4M7D G;  3M58 A;  4OMM A;  1M1G A;  4J9B A;  2DI4 A;  4F7U A;  3DB3 A;  4WW0 A;  2DIG A;  2DRK A;  3MP8 A;  5GAM j;  4KUD K;  1FEW A;  4M77 C;  2VVS A;  3OYE A;  3G7Z A;  2J6K A;  4IDQ A;  4F7U F;  4U2Y A;  2OLT A;  4LUD A;  2A36 A;  4NIQ A;  1MIW A;  2NW7 A;  5AQK B;  2X4J A;  3OYF A;  4AIS A;  2MOZ A;  1Y7X A;  2DRM A;  1KNR A;  3QSU A;  1M1K C;  1NJI R;  4FT4 A;  4U7I A;  3EFS A;  4RTZ A;  1HG5 A;  3LK2 B;  4QKN A;  2CZ0 B;  3RF1 A;  2ZAE A;  5A0G A;  3ONJ A;  5D7U A;  4C92 D;  2COZ A;  3B5M A;  3LG7 A;  2HBP A;  2K5I A;  4M7D E;  3G6E A;  1XQH A;  2BIV A;  4DUY T;  4BY6 B;  2V7J A;  1M9S A;  4OB0 B;  1VQ9 Q;  2Q9Q C;  4EMK B;  1H3H A;  2KT9 A;  3R84 B;  2O2O A;  2K9A A;  3RKY A;  2M1H A;  2B76 A;  3QHS A;  3HRU A;  3PV0 F;  2JM8 A;  4OML A;  1KD1 U;  2RQT A;  2KMF A;  1WI7 A;  1WYX A;  3QKJ A;  5FRO A;  2YRC A;  2QA4 Q;  5J0Z A;  2E1H A;  1DJ7 B;  3MZK B;  1ZSZ A;  2HQE A;  3LBX A;  4QQD A;  1WLP B;  4MDW A;  3JCM Q;  1IZN B;  2E9X A;  3RES A;  1V76 A;  5FU6 C;  2HSP A;  2LJ3 A;  1I94 T;  2DK3 A;  5AT1 B;  3CC7 Q;  2I2L A;  2JNG A;  2DA9 A;  3FZK B;  3N9O A;  1SKU B;  1KQS P;  3U3I A;  3CX7 B;  2LSG A;  4HWF A;  5A0D A;  5GAN 8;  2PNI A;  3UA6 A;  4O4L E;  4UEL A;  3VRB A;  3BY7 A;  3BW1 A;  3OYM A;  1YJW Q;  4CZZ B;  2XSA A;  5EK2 A;  2KRO A;  4HTE A;  3OYL A;  5AQQ B;  5L3G B;  2JQK A;  2QEX Q;  2DJQ A;  2BG9 C;  2R6G F;  3H8Z A;  5HXC A;  1JU5 C;  2QYZ A;  2WM9 A;  2XG8 D;  5HCK A;  2DL7 A;  2FPE A;  1JEG A;  1ARK A;  2XQ5 A;  1Q86 U;  1RAC B;  1HJD A;  3UPU A;  1UE9 A;  3EFO A;  2KND A;  2O4X B;  2RNA A;  1X43 A;  3VR8 A;  1YI2 T;  4FYX B;  3CPW S;  4PJL A;  2UXB T;  2CZ7 B;  4F7U B;  4M7D D;  3QPH A;  5L47 A;  2ROL A;  1UEB A;  4GIW A;  3RKX A;  4BDY A;  2LCS A;  1RAH B;  2FJE A;  2DMO A;  4JLG A;  2XM2 A;  1G8X A;  2COW A;  1RLQ C;  4RTY A;  9ATC B;  1MND A;  3OS1 A;  5IYZ E;  3J80 E;  3A8G B;  4RTU A;  4Z88 A;  5LJ3 g;  1VQP A;  3WVD B;  2FRW A;  3ER0 A;  4K11 A;  1ACM B;  3JCM h;  2A9U A;  3TKL B;  1VQ7 A;  2D0N A;  2MI6 A;  1YIJ A;  3MEA A;  2C5J A;  1HNW T;  3I9Y A;  1GL5 A;  3CPW P;  2DVE A;  3L8R A;  4JJB A;  3QB5 K;  2EYZ A;  3OQ5 A;  5GAM e;  3KV5 A;  3I0Q A;  2E41 A;  3QO3 A;  4MML A;  1ZSZ B;  4XTY A;  4QVC A;  3GMI A;  3CCE Q;  4GBQ A;  2ES0 A;  5J26 A;  1JB0 E;  3ZFJ A;  1UHF A;  2K9G A;  4TNV A;  4DND A;  2XQ9 A;  2YT6 A;  2NUZ A;  2VV5 A;  4CC7 A;  3JCM V;  4JRQ A;  4EAH A;  2J1D G;  1VQP T;  4IIO A;  3HRT A;  3ZCI A;  4U2Z A;  2A37 A;  1RI9 A;  5JDL A;  4I50 E;  1ZUU A;  1BR2 A;  5A2Q E;  2UUA T;  2KNB B;  1ZBX A;  3I9Q A;  4BE0 A;  3MXZ A;  4LNP A;  4EDU A;  1OZ3 A;  3Q5X A;  2NP9 A;  1GBR A;  1W4S A;  4M78 C;  2RB6 A;  1NJI U;  5CKD A;  3J7A F;  2JQ9 A;  2VQE T;  4XBF B;  3L42 A;  1PRM C;  2D2S A;  2ZPF B;  2UXN B;  1LNX A;  4P09 A;  2M16 A;  1SSH A;  4C8Q B;  2V5C A;  3LK3 B;  3OVU A;  2DWK A;  1MV3 A;  2RQU A;  5GMK m;  4C92 C;  4UF0 B;  3FB2 A;  2KXC A;  3PUS A;  4DV4 T;  2YUO A;  3CPW A;  2V8K A;  2DF6 A;  4C8Q G;  4PJN A;  1U1T A;  2MTQ A;  2EAY A;  2J7I A;  4DOV A;  3HSB A;  3CK6 A;  5LBQ B;  1ZEE A;  1XTD A;  4FJO A;  4PK6 A;  3OYG A;  3AE5 A;  3CMA T;  1XNR T;  3QXE B;  5IUX A;  2RA2 A;  2YDL A;  1IGU A;  1SF9 A;  3CME T;  3CCM T;  4PJO E;  2LX9 A;  2MYS A;  1IHW A;  2CZ6 B;  4NL2 A;  3CVR A;  4X20 E;  5AYF A;  2ACZ A;  1XWM A;  2RJE A;  1X6G A;  2HSE B;  3PE0 A;  2RQW A;  2DKG A;  5F5W A;  2C06 A;  2M6I A;  2YEV C;  2ESW A;  5AQG B;  1I07 A;  1KFZ A;  3ZJ1 A;  3ABV A;  5AQS B;  5FRM A;  2QDY B;  2JMA A;  4EIK A;  2LCL A;  3LFM A;  2V6X A;  1HS7 A;  3CCR Q;  3KBG A;  4E7H A;  4QWN B;  2OAW A;  1N32 T;  1IBK T;  4LFA T;  4O8S A;  1SHZ C;  1M2O A;  2KAF A;  2IUB A;  2YN6 A;  4DID B;  2XQY A;  1PG5 B;  1AVZ C;  2X66 A;  3P50 A;  2EQM A;  2HN1 A;  3CBP A;  3CCU Q;  4CC4 B;  1KQS A;  2EIF A;  3UF4 A;  1VQ9 A;  2BS4 A;  2WMO A;  5ABH A;  1R77 A;  1W09 A;  1U5S A;  5HEG A;  5GAN h;  4M75 D;  4KT0 E;  3HRS A;  3UWN A;  2JQH A;  1GCQ C;  2KIN B;  4GLK A;  1LPL A;  5FLX E;  5LMN T;  2ZMA A;  2D8J A;  1PNJ A;  2RI3 A;  2Y48 B;  4DV0 T;  4DV2 T;  2RQR A;  4NXM T;  1RAD B;  2CHO A;  4UVB B;  5FXW A;  3HL6 A;  4Y92 A;  2ED0 A;  3MET A;  4MFR A;  4QKU A;  4JI3 T;  2ZM0 A;  2VGN A;  2FVU A;  1M62 A;  4ZN1 A;  2PTK A;  1WFW A;  4A4H A;  4CC3 A;  3A8O B;  1PM3 A;  3KFW X;  3QYG B;  1K76 A;  5JDM A;  2ZPI B;  2O9S A;  5GAN g;  3QZ9 B;  2W0G A;  4GKJ T;  4QW2 A;  1WRD A;  3MPU B;  2OAU A;  3EG2 A;  3EAM A;  1VQ8 Q;  2NUT B;  2WMN A;  4HWC A;  2ODV A;  4ZZC A;  1BIA A;  4DV1 T;  3LWH A;  2ZCF B;  3KUF A;  2L5Q A;  5KYW B;  1C1A A;  3ZCJ A;  1NEB A;  3PUV F;  5GAO l;  4OFZ A;  1N36 T;  4XU1 A;  4YSY A;  3UT1 A;  5KYN A;  1O9S A;  1G73 A;  1WIE A;  1W1F A;  5CCA A;  4R55 A;  1XDO A;  4PFO A;  2QEX A;  1IXD A;  3TCJ A;  2FO0 A;  1U3O A;  4IL4 A;  3M54 A;  2XAH B;  2KBT A;  5LJ5 e;  4HFI A;  2CP7 A;  2MMP A;  5KYX A;  2D5U A;  2CP3 A;  2A3L A;  3UU3 A;  4C0D C;  1N8R U;  2DM1 A;  2RJD A;  3X20 B;  4KBM B;  2L89 A;  1CUN A;  2H3R A;  4CI1 B;  2PVO B;  3E1S A;  4OB3 B;  5FXZ A;  1QCN A;  2A72 A;  1N8R C;  2JN0 A;  4HE8 A;  3DTO A;  2LQW A;  5GAO m;  4O2A E;  3T8O A;  1OX9 A;  4BI8 B;  3JRZ A;  4PJO G;  1WHH A;  3BQI A;  3G06 A;  1XNQ T;  4CRI A;  4M7D A;  4FIB A;  5JVD E;  3CCS Q;  1HNX T;  5C3J A;  2K5F A;  5FKY A;  1E7O A;  4LE9 A;  3H0H A;  3RBB B;  4EMK C;  3ZT6 A;  3FBL A;  3M4G A;  3OS5 A;  1OED E;  3PU8 A;  3UFE A;  4NL3 A;  1J5W A;  1VQ4 A;  2VWF A;  4M75 G;  3ZT7 A;  5FRN A;  3QJ6 A;  3I9W A;  3C98 B;  3Q1J A;  1YJN Q;  1VQM Q;  3RX6 A;  3N9M A;  3TU4 K;  1MGQ A;  3S3M A;  3JB9 D;  3X24 B;  4CXW A;  4EYU A;  5JDN A;  1I5O B;  3EDU A;  3PU3 A;  1W6X A;  5LJ3 e;  3EGU A;  2I59 A;  1VQM A;  1AJ3 A;  3AE8 A;  1QP3 A;  2GTO A;  2BZY A;  1SA0 E;  3KV4 A;  2CEA A;  3A8H B;  2BE7 D;  4Z90 A;  1VQL T;  2BUD A;  5KDM C;  2LCC A;  2AKL A;  2CP2 A;  2BS3 A;  5GAN 3;  2KRM A;  2CT4 A;  1MMA A;  1YXR A;  1D1A A;  2P0P A;  1AWX A;  3LH0 A;  2BG9 B;  4NUU A;  1IRE B;  3HL8 A;  1SRM A;  3A5X A;  3RMQ A;  2FG0 A;  4PJJ A;  2DLP A;  2CP5 A;  5FXV A;  4UIG A;  2HCK A;  3BDL A;  2IW5 B;  2LM9 A;  5GAN e;  2CUD A;  4RKU E;  2HBW A;  1JJ2 S;  2LJL A;  5HEO A;  3PVQ A;  4ZNX A;  4ILU A;  1WHG A;  4BAY B;  2ECZ A;  1AWO A;  3GN5 A;  4OYK A;  4EEB A;  1FWZ A;  3PUA A;  4LDV A;  3RKO A;  2XHE B;  1HR0 T;  1M1K R;  3JCM W;  4XU2 A;  3RDV A;  1FMW A;  3GBQ A;  4XTV A;  3E08 A;  3RQU A;  2CSQ A;  4FL6 A;  4LF5 T;  2VB6 A;  4DMW A;  3X1D A;  5KYX B;  1E7P A;  4PAG A;  1HK9 A;  3NPF A;  5LJ5 g;  4JI5 T;  4A98 A;  4CI2 B;  2O01 E;  5IXF A;  3CCR T;  2QQA A;  3EHQ A;  2JTM A;  3SD4 A;  4EMG A;  4LF4 T;  1SRL A;  3G4S Q;  2MWO A;  2VC8 A;  3V7C A;  1KC8 C;  5IN1 A;  2K3X A;  2UXX B;  3G71 T;  2ZM6 T;  3JCF A;  3S3N A;  1UTI A;  1XJW B;  1OX8 A;  1SE7 A;  4DR2 T;  3O5Z A;  2WB5 A;  3LK4 2;  1OZ2 A;  2B86 A;  2E5Q A;  4FU6 A;  1IZ6 A;  1W2B A;  4GK0 E;  4IUR A;  1YJ9 T;  3AE3 A;  5DJQ C;  4C5H A;  3L3P A;  4JI2 T;  1KIK A;  2AKK A;  4J6W A;  1WPY A;  1QP2 A;  3IEE A;  2D6F A;  4QT7 A;  1WHJ A;  4D6W A;  1M2V A;  2B8A A;  2BG9 E;  1GXI E;  4FSS A;  3ZYL A;  4QVD A;  4OK0 A;  3JAE A;  4JI0 T; 
#chains in the Genus database with same CATH homology
 2QA4 T;  4L6V 5;  1ZQ1 A;  3PFS A;  3VU3 C;  5J39 A;  3NTK A;  3KDS E;  3ZEF B;  2KSS A;  3QBY A;  3FEO A;  2F5T X;  2A3D A;  3S4U A;  4H9Q C;  3CD6 A;  3NFC A;  3NTH A;  1I5L A;  3E22 E;  2W63 A;  3VYG A;  4IDZ A;  5CA1 E;  1VQL A;  4A56 A;  3CQG B;  1KQ2 A;  3PDY A;  3MP1 A;  3C4Z A;  4LDY A;  4ZGE B;  4ZI2 C;  5FU7 B;  2DZ9 A;  4BB7 A;  5EK4 A;  3JCM d;  5DLQ E;  5GMK e;  3KBT A;  2RHX A;  3L1A A;  4MZT A;  3QDR B;  3JCM c;  3D0T A;  4ZI3 C;  1YHQ A;  3F70 A;  3ZMS B;  2DXU A;  4Q5W A;  3JC6 C;  3JSC A;  2LTO A;  2V7M A;  4CXY A;  3RYI E;  5GAM f;  1Q81 U;  2ODU A;  5LJN A;  3OBV E;  3FIF A;  2MAM A;  4ATO A;  2DTI A;  3CWZ B;  2M67 A;  4X1K E;  3OMC A;  4X34 A;  1O3X A;  3G6E T;  5CKF A;  3CC4 T;  5JRC B;  2C0S A;  5LNK A;  1YW0 A;  3CCU T;  1JJ2 A;  4XQ3 A;  5CQX A;  2N9D A;  2QGS A;  2P0K A;  4DQ2 A;  3SDZ A;  2LOP A;  3RH3 A;  4E7K A;  1O75 A;  1KNZ A;  1HX8 A;  5GAN d;  3RRC A;  2XDP A;  2A7Y A;  3AAI A;  2LEH A;  3CCL A;  3ASK A;  3I56 A;  3NRX A;  2X67 A;  4BUG A;  2NTX A;  2XD0 A;  2H7O A;  5EK3 A;  2EYQ A;  2NTY A;  4J6Y A;  3RIR A;  2R58 A;  2QEX T;  2DXB A;  2D9T A;  1FX7 A;  1KQS S;  4OB2 B;  3LGF A;  4YTL A;  1B34 A;  3UT5 E;  2V7L A;  4ZOL E;  3QK6 A;  4M78 E;  1X01 A;  4HCC A;  5KX5 E;  3GPL A;  5GAN j;  2KQW A;  3DLM A;  4M7A G;  4OHF A;  1UGR B;  4Y28 E;  3QUJ A;  1PSF A;  2CXL A;  3CCQ A;  4XTU A;  1BYM A;  3P8H A;  4XU0 A;  2NOX A;  2K2V A;  3C50 A;  4TV9 E;  4ELY C;  4MBQ A;  3I55 A;  1IJ6 A;  3X26 B;  3UDC A;  3OY9 A;  4WNK A;  3SWH A;  3F31 A;  1D0X A;  3HFN A;  5JH7 E;  3CBM A;  1X6O A;  4U72 A;  1VOM A;  4PJO B;  4PLI A;  3MP6 A;  2HPL A;  3CCU A;  2K57 A;  3K3Q C;  3OW2 A;  5JRC A;  1QVP A;  4C92 G;  2LHN A;  2JQQ A;  5DQW A;  3X25 B;  2VL8 A;  4TUY E;  1MMG A;  1R8O B;  1N9S A;  3AA7 B;  3VU7 H;  3PIP A;  1VQN T;  4MDX A;  2DXT A;  3ZEH A;  4ISS A;  2KMT A;  4IUU A;  3AA1 B;  4JDS A;  2CE7 A;  1WJS A;  3G4S T;  1V29 B;  5HWY A;  3CCM A;  4DA4 A;  4JEH B;  4G63 A;  3CCV T;  2DWG A;  1VQM T;  1FMV A;  1WQ7 A;  4PK5 A;  1NPP A;  2FB7 A;  2MBG A;  4YLH A;  2QI2 A;  2X4W A;  4BA9 A;  1AHJ B;  3RKW A;  4M7A C;  3PUR A;  3C94 A;  4DBR A;  5LJM A;  5KMG P;  5BMV E;  1VIF A;  2DAQ A;  1YIT T;  2LC4 A;  5HK3 A;  1IJ5 A;  2W61 A;  5HXH A;  5FNV E;  1YJN A;  3SWN C;  4PJO A;  3JAM E;  5JRE A;  4ZN3 A;  2O4X A;  2X9H A;  3ANW A;  2BVL A;  3OB9 A;  2DZC A;  3V8J A;  1G3Y A;  4OMF B;  1OXZ A;  1U1S A;  3KV6 A;  1K9M C;  3K3O A;  4XTZ A;  4AQF A;  4JS4 A;  1S72 T;  4ZI3 D;  2HH7 A;  3GNG A;  3JCM J;  4AKG A;  1YJN T;  1JBM A;  2V7I A;  1S35 A;  1UGS B;  3PNW C;  3KVB A;  3FXD B;  2OTJ T;  2PG8 A;  4PNO A;  5LXT E;  3P7I A;  4F7U E;  4VUB A;  5LHG B;  3SOL A;  2IAK A;  3AA6 B;  2JPF A;  5JR9 C;  3MJX A;  3PTA A;  2NWB A;  5E0O A;  3ZYK A;  1UB4 A;  4ZGD B;  4IUQ A;  3ME9 A;  3RC3 A;  3E9F A;  3HPW A;  3AHU A;  3ZMT B;  1ZKE A;  2XKO C;  2VYT A;  4C5G A;  2F5K A;  1M1F A;  3V7R A;  4JRP A;  5HWX A;  4EMH A;  3UUN A;  5DM7 R;  3OYX A;  2E64 A;  5CR2 A;  4DOW A;  2L3R A;  3DKM A;  4E7I A;  2LHR A;  4GYR A;  2RO0 A;  3CC7 A;  2EHO C;  3BK9 A;  5DAB A;  2V7K A;  3OW2 S;  3FJP A;  5AFU L;  3CPZ A;  2YU2 A;  3CBO A;  1BI1 A;  3OBW A;  4MZP A;  4PKC C;  3QII A;  4AI6 A;  3IHR A;  2WBL A;  1B34 B;  4OYJ A;  3GWH A;  3DJB A;  2GCX A;  3C95 A;  1VQ8 T;  2LT4 A;  5GAO q;  2R5A A;  5JQG E;  3GA8 A;  2H3J A;  2VKJ A;  2LSJ A;  2GQV A;  3FDR A;  5LJ5 j;  4I43 B;  1OYX A;  1EIF A;  2YIN A;  4R56 A;  2K3Y A;  2DXC A;  4QXB B;  3QJY A;  3O1J A;  2ZPB B;  4M78 G;  5GAN 7;  5FU7 C;  3OYH A;  2RM4 A;  4M75 C;  3VJP A;  2D0Q B;  2OTL T;  4C0F A;  4L9I A;  2LDM A;  5CB4 E;  1KC8 U;  3ONX A;  3JCM g;  3CML A;  3WI3 A;  2YRV A;  5L8R E;  4HT8 A;  2HNI A;  1Q7Y C;  3OS0 A;  2LE8 A;  3BFM A;  4O4H E;  4O6J A;  2M9U A;  5IHY A;  1Y64 B;  2XI9 A;  4QVZ A;  3UTK A;  5LHI B;  4B9W A;  2VGM A;  2E9X B;  1WQW A;  5KE2 A;  4ANJ A;  3NTI A;  2DD5 A;  4IE4 A;  4GYS A;  2XAF B;  3HKS A;  2VKO A;  2OTJ A;  1MIV A;  2RI5 A;  1QUU A;  2A2F X;  4YHJ A;  4H9R C;  2CM0 A;  4O5V A;  2NLU A;  2FHD A;  5GAM d;  4IE5 A;  1K8A C;  4KP3 C;  2CCQ A;  5LG4 A;  2Q9Q A;  2WAU A;  4OGE A;  2CWO A;  1JRI A;  3OYN A;  2XAS B;  3L2Z A;  2K48 A;  5CA0 E;  3L2Q A;  3OA6 A;  1QSD A;  1YKH B;  3ZMZ B;  4J6X A;  1VQ6 T;  5FP3 A;  2E9X C;  3E0Z A;  2WWU A;  5LOV E;  3MHX A;  4F6R C;  1G3W A;  5CO7 A;  3V5S A;  4ASK A;  3JCM e;  1UCU A;  3MAC A;  1OI1 A;  2L3L A;  1WLX A;  3GLX A;  1YKE B;  1Q81 C;  3ZN0 B;  5L3D B;  5GAN 4;  2K5L A;  3EVY A;  2QQS A;  3SS1 A;  1ZHC A;  3ZJ2 A;  4HEA A;  4QQG A;  4PJO D;  4JUY A;  3CCS A;  5EG2 A;  3RC8 A;  3C51 A;  4TZ4 C;  2XAQ B;  3Q5W A;  5FMN A;  3DLL A;  3KV9 A;  3SRZ A;  3SB2 A;  2XDD A;  2RK1 A;  5L3C B;  5GAN 2;  1NJI C;  1KHI A;  4XZC A;  4M7A B;  4X1I E;  4IHJ E;  5ETW A;  3HFO A;  1MIY A;  3PUG A;  4II1 A;  4HN9 A;  5HXS A;  3A8M B;  2V8I A;  4QX8 B;  1X79 A;  3CCQ T;  3NBX X;  4M7D F;  5J1G A;  3M9Q A;  2F69 A;  3INZ A;  4A4G A;  3N9L A;  1H3Z A;  4HCZ A;  2LOS A;  1D0Z A;  4QHO A;  5LJ3 h;  1HCI A;  2EQK A;  4CI0 C;  2X68 A;  2XAJ B;  2OA5 A;  4IGU A;  4CQI A;  2L9Q A;  3QC9 A;  3VKI A;  4C8Q C;  4E47 A;  1NAF A;  3CCR A;  4ZTJ A;  4U74 A;  5LL6 S;  4C90 A;  5LCY A;  2PVD B;  4LDU A;  2E6Z A;  3WAJ A;  2RA1 A;  3L2U A;  4DO0 A;  1M8V A;  2RI2 A;  2EWN A;  1BIB A;  2RH2 A;  3FB9 A;  1YJW T;  1WGS A;  3ESL A;  1I81 A;  4A54 A;  3MK7 C;  2KLQ A;  1BR4 A;  4GOU A;  3GNF B;  4LD6 A;  5FYM A;  2XHC A;  1UGQ B;  5JDG A;  5LGT B;  3CCV A;  2B1E A;  2X4X A;  4M78 B;  1LJO A;  3PTR B;  2XID A;  5C8Y E;  2P9B A;  2ZLY A;  1LKX A;  1UX5 A;  5D6Y A;  5CKB A;  4N4I A;  3CC4 A;  5GMK j;  1Y96 B;  3L2R A;  2D0U A;  1VQ9 T;  5HYA A;  3C4W A;  4F7U G;  3O1H A;  3RRW A;  5L3F B;  4KUL A;  3VKG A;  5D6X A;  3OS2 A;  4I55 E;  4BJN A;  1VQN A;  4M75 E;  4J5Y A;  4H9P C;  5LA6 E;  2ZPE B;  1X75 C;  2KY9 A;  4IUT A;  4B9X A;  3V5U A;  3OYY A;  3OYZ A;  2PFV A;  5IT9 E;  2RJF A;  4I4T E;  5GMK l;  1OWA A;  3L09 A;  2CYZ B;  2K4Y A;  4AKL A;  4ME7 A;  4ZS2 A;  4IE6 A;  1HXD A;  3E19 A;  4IE0 A;  3AAA B;  5CKH A;  1VQ5 T;  5GAN 6;  4N0A C;  5HY6 A;  2WSS V;  1YHQ T;  2RD1 A;  4PJM A;  3QUI A;  3L2W A;  3LYI A;  5LJ5 h;  4GY5 A;  1K73 C;  3ZC1 A;  1VRB A;  5DLO A;  4ADZ A;  5HXE A;  4IUV A;  2FYK A;  2DEQ A;  5C6S A;  5L2L A;  1ZV4 X;  3X28 B;  3HA4 A;  4TVR A;  2E9X D;  3OSV A;  2RHI A;  3JB9 J;  3S3O A;  2Q9Q D;  3M4Y A;  3PGG A;  3ETU A;  3PIO A;  2H7V C;  4P0B A;  2RHZ A;  4M77 B;  5GMK i;  4QXH B;  2JOY A;  3DP7 A;  4C8Q D;  2EJ9 A;  4C0D B;  3HKC E;  4AKI A;  3JB9 F;  1M4Z A;  4PJO F;  1D1C A;  3U78 A;  3B57 A;  2JMH A;  4C91 A;  3KVA A;  1MMD A;  4OVA A;  3N5B B;  1T98 A;  1D1B A;  3C4S A;  2RJC A;  2VKH A;  3FLG A;  3Q9D A;  2L8D A;  3CQX C;  4TX5 A;  5GAO n;  5LHH B;  5CAI A;  1M1K U;  1VQ7 T;  2ZM8 A;  3OBY A;  1VQK T;  3RER A;  3OYJ A;  4M7A A;  1BI2 A;  2PUK B;  4LDX A;  1Q86 C;  1QVF S;  4L0R A;  5CQY A;  1NWM X;  2EJF A;  1HG2 A;  3O9X A;  3CXC A;  2M0O A;  4FSX A;  4M7D C;  2JRK A;  3L2V A;  2N1G A;  1V9D A;  2PUO B;  2X35 A;  4IKF A;  3CKD A;  4CI3 B;  3JC6 D;  4ELZ C;  1Y71 A;  4HKE A;  1YI2 A;  2E10 A;  3BQK A;  4HCB A;  2LT3 A;  1XNI A;  1YIT A;  3CCE A;  4NS5 A;  4C0Z A;  5FY1 A;  4UVA B;  5J3B A;  3VKH A;  5DQV A;  4ZHQ E;  4OF1 A;  4M77 E;  4C92 A;  3MO8 A;  4KMC A;  1K9M U;  3M59 A;  4AXP A;  2CA5 A;  3IF8 B;  5KCH A;  1UX4 A;  3RPU A;  1SSF A;  2LVM A;  2DTH A;  4H9N C;  1NZ9 A;  1P92 A;  4PW8 A;  3PT9 A;  3KIN B;  4HKA A;  2Y4Y A;  1HFA A;  4BE1 A;  5GAM g;  4OP0 A;  2P4T A;  1Y07 A;  3CCE T;  4PK4 A;  3ZC0 A;  5M9O A;  3M55 A;  2V8J A;  5LP6 E;  1HTJ F;  5JDQ A;  2HPJ A;  2LRQ A;  4FI5 A;  4OB1 B;  3LX7 A;  3JCM X;  5I2S A;  4BJM A;  3M5A A;  2VXE A;  5LJ3 d;  2YHT A;  4UEM A;  3RMS A;  2X9Y A;  3OYB A;  3KBU A;  4EXT A;  3SWN B;  2FL7 A;  3F2E A;  3LW5 E;  4E7S A;  3H6Z A;  2X4Y A;  2Z6E A;  4P5N A;  2LQ8 A;  2EHO A;  4C92 E;  2QQR A;  4N78 D;  4DVD A;  3HI2 A;  3CEY A;  3JB9 G;  4J7F A;  1LRZ A;  4C92 B;  3WVE B;  4HFV A;  1IAP A;  4HT9 A;  3CQC B;  3H3A A;  2NW8 A;  2QA7 A;  3K3N A;  2IVW A;  3VUB A;  3GP8 A;  1VIE A;  5CIU A;  4XTW A;  3JB9 I;  4J7I A;  3CC2 A;  4E7J A;  2ZGW A;  4YFS A;  3I1A A;  2XK0 A;  4A4E A;  4N4G A;  3ANW B;  4RMO A;  1RL2 A;  3FC3 A;  5HK0 A;  2QTX A;  2Y90 A;  2E8I A;  3RYC E;  2XDB A;  5GON E;  4EZH A;  4P0A A;  4JRI A;  1Q7Y U;  3EFR A;  1NE8 A;  5EZY E;  1Z0P A;  3CCL T;  1VQ5 A;  3N2G E;  2X0L B;  3ZYM A;  4M1P A;  3OKQ A;  4EB6 E;  4N4H A;  4QQ6 A;  3F57 A;  3M56 A;  3O8V A;  2KWH A;  3K8P C;  4FT2 A;  3JCM P;  4UV8 B;  3OMG A;  2PVG B;  2ACX A;  3N9N A;  3JCM b;  5FU6 B;  3EAE A;  5LGU B;  4J8O A;  2YU1 A;  1WNL A;  3OYK A;  4PL6 A;  4B6X A;  4A53 A;  3ZLI A;  2P0Q A;  2BDE A;  2ZPG B;  2KVQ G;  3FHN A;  5HAX A;  2EHO B;  4UC4 A;  1KHC A;  3VHL A;  3V7S A;  1U4Q A;  3GN5 B;  2IG0 A;  1KG1 A;  3AB3 B;  4YJ3 E;  3M57 A;  2C5I T;  1D3B B;  4QXC B;  1G3T A;  3CXC S;  4M77 A;  4JJN K;  3CME A;  5C0M A;  1H7C A;  3OYI A;  3CMA A;  2IC9 A;  4GK5 E;  3TRE A;  3RYH E;  5A0L A;  3HKD E;  5L3B B;  3ETV A;  3H37 A;  5LYJ E;  5KH6 A;  1KQ1 A;  3DB4 A;  2CKK A;  2JUF A;  3PMT A;  5GAO p;  5A1L A;  4KUM B;  5JDF A;  4H9O C;  2JVV A;  4M78 D;  1YJW A;  3NRY A;  4XK8 E;  3JCM f;  3RYF E;  3O4X E;  1QVG S;  3RUX A;  3J7Y q;  2EQJ A;  3QYH B;  3N2O A;  1YCY A;  3P8C D;  3N9P A;  4PLL A;  1G3S A;  3V8L A;  1WR6 A;  3CPF A;  2V1D B;  3NZP A;  4CXX A;  2PJQ A;  2G3R A;  2LQK A;  2XAG B;  2KZ7 B;  2AHJ B;  3R6O A;  5I21 A;  4C5I A;  1NPR A;  2QQ9 A;  3GOX A;  4FM4 B;  1YJ9 A;  2XIC A;  5HKC A;  4XTX A;  5H6R B;  3R6N A;  1N9R A;  1Q82 C;  5LJ3 j;  3Q2M A;  3S6W A;  3G71 A;  4V2S A;  4X1Y E;  4YJ2 E;  5F3J A;  2WSC E;  3C4X A;  5CVI A;  2PQW A;  1WYB A;  5LJ5 d;  4IST A;  3OSS C;  2KXP B;  4C8Q A;  5JR9 B;  4H9S E;  1WJR A;  1BI0 A;  1UGP B;  2WSE E;  4BDZ A;  5FXX A;  4M77 F;  3UUX B;  1N6A A;  4ZTF A;  2KWI B;  2CLY B;  4X9D A;  2VK9 A;  2Y8D A;  4JLE A;  1W2B S;  3M53 A;  5HXR A;  1LOJ A;  1EZ3 A;  4WBN E;  3EUH A;  1FXX A;  4EIW A;  5H6Q B;  4WBO A;  3J81 E;  1VUB A;  2ZZD A;  2N2N A;  2JTF A;  1N27 A;  2Q9Q B;  4IIJ E;  1K73 U;  3WAK A;  2DTO A;  1U5P A;  4UVC B;  2L8K A;  1VQ6 A;  2DCF A;  3O1I A;  4M77 D;  2EFI A;  3ZBD A;  1M5Q 1;  3N2K E;  4J2C A;  5TAO A;  2LSY A;  1WJQ A;  2KK4 A;  4RCC A;  1VQ4 T;  2E70 A;  3A8L B;  3BDU A;  3SWN A;  2GK9 A;  2CLY C;  2RHY A;  5LGN B;  2BKD N;  4M78 A;  4E7L A;  2MWP A;  3ZMU B;  2R5M A;  5LJ3 f;  1E1H B;  4TN7 B;  2LNV A;  3W15 B;  1YD8 G;  1BI3 A;  1PSE A;  3GIB A;  4HGA A;  4ZI7 E;  4AQF C;  2NW9 A;  2DD4 A;  3E9G A;  4DBQ A;  4MAL A;  3MCA B;  4JS5 A;  3B13 A;  3GF5 A;  4MZM A;  4RCB A;  2LSI A;  2DNX A;  3M65 A;  3HHT B;  1U8R A;  5GMK h;  2VAS A;  3AAE B;  2V26 A;  1YIJ T;  2R57 A;  2LSK A;  3FBZ A;  1HF8 A;  4J83 A;  5JR9 A;  3I56 T;  1M90 U;  4M7D B;  4Y91 A;  4L59 A;  1TH7 A;  3MEW A;  3V8K A;  4N0A A;  2JJ9 A;  5IAY A;  2DIQ A;  3JB9 H;  3LWI A;  5DY9 A;  3MA9 A;  4C8Q E;  1D0Y A;  4M78 F;  3HP9 A;  2SPC A;  5LBM A;  4EYY R;  4M7A E;  3ZMV B;  2CWY A;  2EQU A;  2WAC A;  5FY7 A;  2BVM A;  2VWA A;  5GAM h;  1Y96 A;  2GFU A;  1G5V A;  3WXM B;  3OYA A;  2CXD A;  2CZ1 B;  4O4J E;  3FRN A;  3N9Q A;  2VUB A;  5CKE A;  3MKD A;  4PNI A;  2CMR A;  3P8B B;  3EDV A;  4WF2 A;  3C12 A;  1BKB A;  4BI4 A;  3T9N A;  1KD1 C;  4EZ4 A;  2E65 A;  3FXE B;  3MEU A;  4K0U A;  2D0T A;  4BE2 A;  1MNE A;  4PFP A;  1M90 C;  4M75 F;  3CCJ A;  2Y6X A;  1BR1 A;  3CCJ T;  4V1A v;  3CC7 T;  2YK0 A;  3CX8 B;  3BQL A;  5GAN 5;  2VXF A;  4EOZ B;  4X9C A;  4O2B E;  4LDW A;  3VV0 A;  2XTL A;  2DPP B;  4MHC A;  3LGL A;  2Y4X A;  2HAX A;  1K8A U;  4TV8 E;  3CD6 T;  4BAC A;  4M75 A;  3VUZ A;  3A5Z B;  1LVF A;  4UXN B;  5M4Y A;  3C64 A;  4JEU B;  2GF7 A;  2MF2 A;  3OJA A;  3CCS T;  1MMN A;  2DHR A;  1Q82 U;  5J2T E;  1LVK A;  2PU9 B;  2BZB A;  3J9X 1;  5GAO r;  4C92 F;  4LD9 K;  1H64 1;  3HKE E;  1YBY A;  2QQB A;  3KXT A;  2HD0 A;  1I8F A;  4A4K A;  3TEE A;  4C5E A;  4MMK A;  2RK2 A;  2EJG A;  3AVR A;  1S72 A;  4O4I E;  3UUM A;  5L3E B;  2LT1 A;  4MLK A;  4ZGJ B;  3LJC A;  4AKH A;  2JZ2 A;  1MHN A;  2WSF E;  1BR0 A;  3AVS A;  3HR0 A;  4XU3 A;  4AKR B;  2CS7 A;  4EMK A;  4PJO C;  4C0G A;  4E7Z A;  4JLI A;  3OYD A;  2QA4 A;  3AA0 B;  3PMI A;  4NUV A;  3QZ5 B;  4Z02 A;  4IUP A;  2RHU A;  2K5B B;  2CGH A;  4A4F A;  2YLB A;  4NOY A;  2QXF A;  4M7A F;  5JDH A;  3P8D A;  3QG1 A;  4RG8 A;  2XU8 A;  4AQG A;  1VQK A;  2EKO A;  5I2M A;  2DO3 A;  2JMK A;  4Z8X A;  2X9X A;  5ADX L;  3ZPO A;  2EHO D;  5CK9 A;  3CX6 B;  3UUL A;  1QW1 A;  3PUQ A;  5F8P A;  1VQO T;  2X51 A;  2G0U A;  4H63 V;  4QX7 B;  2YLC A;  2VKD A;  4M77 G;  3URG A;  2DLR A;  2W00 A;  3G4S A;  4IE7 A;  3VYH B;  2ZPH B;  4L5G A;  2E6N A;  2C5K T;  4OGC A;  4ZI2 D;  5D6W A;  4H63 H;  4KUI A;  4EPC A;  2OTL A;  2K24 A;  4JRK A;  2CXF A;  3OYC A;  5FY0 A;  4BY6 C;  1KK7 A;  4JUV A;  3SFM A;  2DJZ A;  4RG2 A;  1I4K 1;  4C8Q F;  1QVF A;  1VQO A;  3I55 T;  2RP4 A;  1US7 B;  4BD3 A;  4HA8 A;  3I0O A;  3NZQ A;  5KE3 A;  2XUE A;  2PBI A;  4ERR A;  1VQ8 A;  4G2A A;  4BI3 A;  5KCO A;  4UV9 B;  1ZHI A;  3MEV A;  1D3B A;  5J2U E;  3LBX B;  3IBP A;  5GAN f;  1QVG A;  1RI0 A;  1FIO A;  4ZS3 A;  3ZN1 B;  3LLR A;  2ZM2 A;  2GFA A;  1XOV A;  1WYC A;  5LJ5 f;  2E12 A;  2IC6 A;  4DMV A;  2X9W A;  1B7T A;  3N5L A;  1S94 A;  2W62 A;  4UF0 A;  4M75 B;  3HKB E;  2KDS A;  4M7A D;  4XAX B;  4M7D G;  2HQX A;  3M58 A;  1M1G A;  2DI4 A;  4F7U A;  3DB3 A;  4WW0 A;  2DIG A;  3MP8 A;  5GAM j;  4KUD K;  1FEW A;  4M77 C;  3OYE A;  3G7Z A;  4F7U F;  1MIW A;  2NW7 A;  2X4J A;  3OYF A;  2MOZ A;  1Y7X A;  3QSU A;  1M1K C;  4FT4 A;  3EFS A;  1HG5 A;  3LK2 B;  4QKN A;  2CZ0 B;  5A0G A;  4C92 D;  3LG7 A;  2HBP A;  2K5I A;  4M7D E;  3G6E A;  1XQH A;  2BIV A;  4BY6 B;  2V7J A;  1M9S A;  4OB0 B;  2Q9Q C;  4EMK B;  2KT9 A;  3R84 B;  2K9A A;  3RKY A;  2M1H A;  3QHS A;  3HRU A;  1KD1 U;  2KMF A;  3QKJ A;  5FRO A;  2E1H A;  1DJ7 B;  3MZK B;  2HQE A;  3LBX A;  4QQD A;  4MDW A;  3JCM Q;  1IZN B;  2E9X A;  3RES A;  5FU6 C;  2DK3 A;  2I2L A;  2JNG A;  3N9O A;  3U3I A;  3CX7 B;  2LSG A;  5GAN 8;  5A0D A;  4O4L E;  4UEL A;  3BY7 A;  3OYM A;  3BW1 A;  4CZZ B;  5EK2 A;  4HTE A;  3OYL A;  5L3G B;  3H8Z A;  5HXC A;  2WM9 A;  2XG8 D;  1Q86 U;  3UPU A;  2KND A;  2O4X B;  1YI2 T;  3CPW S;  4PJL A;  2CZ7 B;  4F7U B;  4M7D D;  3QPH A;  1UEB A;  4GIW A;  3RKX A;  4BDY A;  4JLG A;  1G8X A;  1MND A;  3OS1 A;  5IYZ E;  3J80 E;  3A8G B;  5LJ3 g;  1VQP A;  3WVD B;  3ER0 A;  3JCM h;  3TKL B;  1VQ7 A;  2MI6 A;  1YIJ A;  3MEA A;  2C5J A;  3I9Y A;  2DVE A;  3OQ5 A;  5GAM e;  3KV5 A;  3I0Q A;  2E41 A;  3QO3 A;  4MML A;  4XTY A;  4QVC A;  3GMI A;  2ES0 A;  5J26 A;  1JB0 E;  3ZFJ A;  4DND A;  2VV5 A;  3JCM V;  4JRQ A;  4EAH A;  2J1D G;  1VQP T;  3HRT A;  3ZCI A;  5JDL A;  4I50 E;  1BR2 A;  5A2Q E;  1ZBX A;  4BE0 A;  3MXZ A;  4EDU A;  1OZ3 A;  3Q5X A;  2NP9 A;  1W4S A;  4M78 C;  2RB6 A;  1NJI U;  5CKD A;  3J7A F;  4XBF B;  3L42 A;  2D2S A;  2ZPF B;  2UXN B;  1LNX A;  4P09 A;  2M16 A;  4C8Q B;  3LK3 B;  2DWK A;  5GMK m;  4C92 C;  4UF0 B;  3FB2 A;  3PUS A;  3CPW A;  2V8K A;  4C8Q G;  4PJN A;  1U1T A;  2MTQ A;  2EAY A;  4DOV A;  3HSB A;  5LBQ B;  1ZEE A;  1XTD A;  4FJO A;  4PK6 A;  3OYG A;  3CMA T;  3QXE B;  2RA2 A;  3CME T;  3CCM T;  4PJO E;  2LX9 A;  2MYS A;  2CZ6 B;  4NL2 A;  3CVR A;  4X20 E;  5AYF A;  2RJE A;  3PE0 A;  2DKG A;  2C06 A;  2YEV C;  3ZJ1 A;  5FRM A;  2QDY B;  2LCL A;  3LFM A;  1HS7 A;  3KBG A;  4E7H A;  4QWN B;  4O8S A;  1SHZ C;  2KAF A;  2XQY A;  2X66 A;  2EQM A;  3CBP A;  1KQS A;  1VQ9 A;  2EIF A;  2WMO A;  5GAN h;  4M75 D;  4KT0 E;  3HRS A;  3UWN A;  2KIN B;  4GLK A;  5FLX E;  2ZMA A;  2RI3 A;  2Y48 B;  5FXW A;  4UVB B;  3HL6 A;  3MET A;  4MFR A;  2ZM0 A;  2VGN A;  2FVU A;  4ZN1 A;  4A4H A;  3A8O B;  3KFW X;  3QYG B;  5JDM A;  2ZPI B;  5GAN g;  3QZ9 B;  2W0G A;  4QW2 A;  1WRD A;  2OAU A;  2WMN A;  2ODV A;  1BIA A;  3LWH A;  2ZCF B;  3KUF A;  2L5Q A;  3ZCJ A;  5GAO l;  4OFZ A;  4XU1 A;  3UT1 A;  3CC2 T;  1O9S A;  1G73 A;  5CCA A;  4R55 A;  4PFO A;  2QEX A;  3TCJ A;  3M54 A;  2XAH B;  5LJ5 e;  2MMP A;  2D5U A;  2A3L A;  4C0D C;  1N8R U;  2RJD A;  3X20 B;  4KBM B;  2L89 A;  1CUN A;  2H3R A;  3E1S A;  4CI1 B;  2PVO B;  4OB3 B;  5FXZ A;  2A72 A;  1N8R C;  2JN0 A;  4HE8 A;  3DTO A;  5GAO m;  4O2A E;  3T8O A;  4BI8 B;  3JRZ A;  4PJO G;  3BQI A;  4M7D A;  4CRI A;  4FIB A;  5JVD E;  2K5F A;  4EMK C;  3M4G A;  3FBL A;  3OS5 A;  3PU8 A;  3UFE A;  4NL3 A;  1VQ4 A;  4M75 G;  5FRN A;  3QJ6 A;  3I9W A;  3C98 B;  3Q1J A;  3RX6 A;  3N9M A;  3TU4 K;  1MGQ A;  3S3M A;  3JB9 D;  3X24 B;  4CXW A;  4EYU A;  5JDN A;  3EDU A;  3PU3 A;  5LJ3 e;  2I59 A;  1VQM A;  1AJ3 A;  1QP3 A;  1SA0 E;  3KV4 A;  2CEA A;  3A8H B;  1VQL T;  2BUD A;  5KDM C;  2LCC A;  5GAN 3;  1MMA A;  1D1A A;  2P0P A;  3LH0 A;  4NUU A;  1IRE B;  3HL8 A;  3RMQ A;  3A5X A;  4PJJ A;  5FXV A;  4UIG A;  3BDL A;  2IW5 B;  2LM9 A;  5GAN e;  4RKU E;  1JJ2 S;  2LJL A;  4ILU A;  4BAY B;  3GN5 A;  4OYK A;  1FWZ A;  3PUA A;  4LDV A;  3RKO A;  2XHE B;  3JCM W;  4XU2 A;  1FMW A;  4XTV A;  3E08 A;  4FL6 A;  2VB6 A;  4DMW A;  4PAG A;  1HK9 A;  5LJ5 g;  4CI2 B;  2O01 E;  3CCR T;  2QQA A;  2JTM A;  3SD4 A;  4EMG A;  2MWO A;  2VC8 A;  3V7C A;  1KC8 C;  5IN1 A;  2K3X A;  2UXX B;  3G71 T;  3S3N A;  3LK4 2;  1OZ2 A;  2E5Q A;  4FU6 A;  1IZ6 A;  1W2B A;  4GK0 E;  4IUR A;  1YJ9 T;  5DJQ C;  4C5H A;  3L3P A;  4J6W A;  1WPY A;  1QP2 A;  3IEE A;  2D6F A;  4D6W A;  2B8A A;  1GXI E;  3ZYL A;  4QVD A;  4OK0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...