4L5GA

Crystal structure of thermus thermophilus card
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
b'EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEELN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CarD
publication title Structure and function of CarD, an essential mycobacterial transcription factor.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
total genus 47
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l5gA02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l5gA01
2LT3A 4L5GA 4MFRA 4XAXB 2LT4A 2LT1A 2EYQA 4ILUA 2LQKA 4KMCA 4KBMB
chains in the Genus database with same CATH superfamily
1J1JA 2CXFA 3AB3B 4I0UA 2JS2A 4QQDA 5LHHB 4BB7A 3CMET 1UJ0A 2DL3A 2RA1A 4GYSA 3CCEQ 2GQIA 5ETWA 5FY1A 2CWOA 4TN7B 2MF2A 3VS2A 5ABGA 4FL6A 2HKNA 2BBHA 4HGAA 3R6OA 3M53A 3UDCA 4WTOB 2RQUA 3NFCA 4EMGA 1FMKA 2DL5A 4HWIB 1RLPC 4JRKA 4DBHA 4IREA 4EIWA 1RABB 2O31A 2BKPA 1GCPA 1GFCA 3EG3A 1CSKA 3SDZA 2CP5A 1XQHA 1NEBA 3DJBA 2V7KA 2G3RA 2RQRA 4RCBA 4XQ3A 2LQNA 3FHNA 4ZNXA 3HA4A 2QQ9A 2F5KA 2LP5A 2NUZA 2OAWA 3JB9H 1H92A 3PTAA 1SSFA 2ZM8A 3OW2S 2NLUA 3UUMA 3HL8A 5L4HA 3CCET 3PUXF 1HG5A 3EABA 1KC8C 2L89A 4PKCC 4M7AA 3EG0A 2Z6EA 4X1YE 3M58A 4BI8B 1WHGA 1WPYA 2ED0A 1FX7A 5LNKA 4KUDK 1EIFA 5J26A 3AE1A 4N0AA 3QC9A 3I9WA 4DV5T 5CA0E 3FEOA 2KSRA 1ZA2B 2K57A 3L42A 4YTLA 3OPCA 5HEOA 2J4GA 4ANJA 2ZPIB 4OF1A 3UATA 3CEYA 4TV9E 3FIFA 2VKNA 5D6XA 3RI5A 2EJ9A 3ZMVB 3Q5DA 4PFPA 2OA5A 2X9XA 2BS3A 4ZGEB 3J9X1 4U33A 4WNKA 1VQLA 2K5BB 2VGNA 4LE9A 2WB5A 1VQOA 1HNZT 1QVFA 3UTKA 3B5MA 2X35A 3CCQQ 4PW8A 1LVKA 4RTWA 2EFIA 3CCUA 3P8CD 4UF0A 1WXTA 1JRIA 1J3TA 3QG1A 3FZKB 2LEHA 1PWTA 1U1TA 2FG0A 2QDLA 1ZHIA 2R6GF 2ESWA 3M54A 3AEFA 3OBYA 3H8ZA 4B3ST 1MMAA 1OEDA 4JEHB 4M7AB 4HWFA 5AQGB 2RHYA 2CPTA 3PJAJ 1WDXA 1WGSA 2A36A 3HPWA 4JYAT 4E7SA 2KQWA 1OXZA 2KVQG 4ZGDB 3CK6A 5AQQB 3CCRA 3ZT5A 4CC2A 2DX1A 1SF9A 3ULRB 3I35A 4DMVA 3QDRB 2YDQA 3ETVA 3OYBA 3CXCP 4OB3B 3QUJA 4JV5T 1AWWA 4HFIA 1JNRA 5KMGP 3RIRA 3O8VA 4B9XA 3CCQT 3MJXA 1X6BA 3BE3A 4ILAA 2BUDA 3BQKA 2VL0A 3OYZA 4LFBT 4N4HA 4PNOA 2MCNA 3TLWA 1XNIA 2LJ1A 4A98A 5GAMd 5GAOr 4U2ZA 1VQPT 1VQ8T 4PK4A 5GAOp 1KHCA 1WXBA 1WJRA 4M75D 1Y71A 2A7YA 4FSSA 3L2RA 3TLTA 4FIBA 4C5GA 4UF0B 2NWBA 3ZN0B 2MBGA 1LJOA 1N8RR 1VQ5Q 2KAFA 3C4WA 2V8KA 4E7LA 3SRZA 1WA7A 3QB5K 2BBJA 1WYXA 3Q9DA 1XNQT 1NBEB 3X25B 4ZS2A 4BY6C 4HFCA 3AHUA 2JPFA 2AKLA 2QYZA 1WRDA 2EKOA 2H3EB 2DZ9A 2XQ8A 5JRCA 1F1BB 2LE8A 5F8PA 3N2GE 2DRMA 2UUCT 3T9NA 2XTLA 2MTQA 1IBLT 4DV3T 4AFZC 4MDWA 4D6WA 1OULA 3EGXA 3FZHB 4K0UA 2OLTA 4MMKA 2DLRA 4EMKB 2ZLYA 2ECZA 1HR0T 3EGDB 4RTXA 2JJ9A 3IEEA 1X2KA 3M59A 1YKHB 5LJ3h 3AEDA 3S3MA 1W6XA 4KH1B 3CX7B 1SRLA 1YP5A 2KSSA 2HSPA 2Y8DA 5KYYA 1QVGP 3JSCA 4EMHA 2VL8A 2W66A 2J1DG 5GJWB 4MALA 3AAAB 3JCMJ 2LKHA 4DMWA 2Y4XA 3M0RA 2ACZA 4AG2C 1MHNA 1DU2A 3RRCA 1VQ5A 2BS4A 1J5ET 4DBRA 5EK3A 3G4SQ 3CMAQ 3I56A 2G6FX 4LUDA 1YITA 2VXFA 5LB7B 2JVVA 1N36T 2V8IA 1YJ9A 2XJ7A 2WP9A 4BJMA 2FHDA 3A8LB 2V5CA 3UU4A 2VK9A 3DP7A 1I5OB 2KDSA 5JDHA 2ABLA 3UU6A 5LGTB 4EIKA 2PUOB 5LCYA 2WSFE 3P4WA 3HTRA 2FRWA 1UTIA 4A4HA 3PIPA 2CYZB 3A7MA 4ZHQE 4M75E 5I11A 2QQBA 4O8SA 2D0NA 3EGXB 2ZZDA 3N5BB 4AQFC 4ORZA 3A8YC 1AJ3A 3JCMX 1K4US 2ES0A 2W62A 4O4LE 1BR2A 1BCMA 3TQ7P 5GAN3 1EFNA 4MLKA 4XU0A 1IREB 3PUWF 4HVWA 2DWGA 3P4RA 2ZPBB 1UFFA 3UWNA 3TVTA 3A8MB 3IQLA 4XAXB 3E2UA 2B76A 2Q9QA 3RQWA 1D0ZA 4A5XA 2QTXA 4WYVA 5GMKm 3JB9D 1PRLC 2DA9A 4M77A 5GAN4 3CIRA 3EGUA 1KC8U 5AQPB 4AKRB 4Y28E 3G4SA 3CMAA 3LH0A 2XI9A 3HHTB 3LWIA 4UV9B 4MMLA 1KD1R 3RC8A 2EIFA 3TLUA 1VCTA 3JCMf 1VQNQ 2EQKA 2M1HA 5LXTE 3VKGA 3BFMA 2DNXA 4TVRA 2HKQB 2WY2A 4M7DA 2QA4Q 4F17A 4ZGJB 5LJ5f 1RLQC 3PJAA 3RGLA 1KG1A 3L8RA 2WAUA 2DXTA 4O4IE 4N4GA 1NLPC 3EHZA 2CBJA 4UXNB 1OEBA 2EYQA 4N4IA 5KYUA 2M16A 4KMCA 3UULA 5AQJB 2DKGA 5C0MA 1BI2A 1YJWT 3RUXA 4VUBA 2P4TA 1Z9QA 2HL5C 4C0GA 3UPUA 3RIAA 4EYYR 3EFOA 3JC6D 1W09A 3RKOA 2ZPFB 4KUIA 1GCQA 1JQQA 2ZGWA 3FXDB 4PLIA 3UT1A 4MZTA 1TUCA 4C92D 4ZTJA 2XQAA 2JNGA 1VQNT 2QI2A 3GA8A 3C95A 1OI1A 3RYHE 2P84A 4DO0A 2MPKA 3WI3A 2DTIA 1M30A 2K2VA 1KIKA 1UECA 5DLOA 3RMQA 2KWHA 2QA4T 2YOEA 4HWCA 1E7OA 4M77B 3FDRA 4IIJE 2RF0A 2BKOA 3DB4A 2SEMA 1NENA 1OX8A 2KROA 3OYXA 2AK5A 3KV4A 4PJOC 1ZEEA 4HFEA 5JVDE 5KXJA 1I5LA 4F7UB 2V8SV 1QVFS 3AA6B 4M7DB 4EEBA 2QEXQ 1K0XA 3RYIE 3JCMb 5CKFA 2F2XA 2C06A 2X3XD 5IAYA 2K5IA 2JTEA 4Z02A 3VS3A 5DM7R 1ZUUA 2RQTA 4AKIA 4MDXA 1K8AU 5GANh 4UVAB 2WDVA 3AEBA 3FXEB 3EFOB 1IGUA 2D9TA 1B34A 4D8DA 2HH7A 3E9GA 3KV5A 2XSBA 1R0BG 4QX7B 2COYA 3QNUA 1WZOA 2CSIA 1HSQA 2ROTA 3I55A 4GYRA 4RMOA 4QWNB 1RAGB 4LNPA 2VVKA 3TKLB 4YSYA 2JIWA 1K0SA 2PU9B 1Q82R 4IIMA 1M62A 2J05A 3DKMA 2N1GA 2K9AA 2V5DA 5CQYA 2QEXT 3QHSA 4RKUE 4M7AC 4ADZA 2XPKA 1HX1B 1PNJA 4OMQA 3CC4T 1NJIC 1K8AR 4EGWA 3AAEB 2BZYA 4NPPA 2DETA 3K3NA 1W2BP 3C98B 2E12A 5CQXA 2NW7A 4KGVB 3SFDA 5BR8T 4N0AC 1XNRT 5CFBA 1XDPA 3CQCB 4WBOA 1YQ4A 1YIJA 4LMJA 5M9OA 5FMNA 2E3HA 4C92E 5HXEA 2W10A 4DOWA 4F7UG 4AMCA 1VOMA 1WYBA 2FJAA 2N2NA 3IA3A 5CO7A 1U1SA 1LCKA 3C64A 3PNWC 2YN6A 3N9OA 1D3BA 2GTOA 5LJ3d 3G6EA 1S72Q 2KT8A 3Q5EA 3EI0A 1UEBA 3NHNA 1KSWA 3EG2A 1BI0A 4DVDA 2O2OA 2RMOA 1VQMT 3OYFA 4E6RA 3FBLA 3PGGA 3EDUA 1XOVA 2W00A 1B34B 4DUYT 4HE8A 3ER0A 4ELYC 4NOYA 2V7LA 4KP3C 1UGPB 1XMOT 1YJNA 1OWAA 4DR7T 2NUPA 3KUFA 3VUZA 5CGMA 1N27A 2E9XD 3CCSA 4CZZB 2DYBA 3MHXA 3TREA 2HD0A 1OEDC 1XTDA 2DXUA 4F04B 3FB9A 2V8JA 3VJPA 3EG9A 1X9BA 5LMNT 2C0OA 4M7AF 1K73C 2DBKA 3H0IA 2CH4A 3OYLA 3E08A 5AQKB 1IRXA 5AQUB 3SFMA 4RTVA 2LNVA 2HN2A 4YHHT 2CT3A 5GAMf 3CCVQ 3OW2A 1LRZA 1BR4A 2IIUA 3QPHA 2KT1A 4X1VA 3KFVA 3S6WA 4Y91A 1S72A 3TSWA 3BDLA 2E3IA 4WZXA 1QWFA 1UUEA 4IL9A 2GFAA 1D3BB 1HFAA 2MOXA 2LHRA 2K7AA 3LK3B 2FBWA 4XZCA 3VKIA 4KHPT 3HP9A 1C6VX 3M55A 1MMNA 4O2BE 4PNIA 5LHGB 1JJ2P 3RPUA 1HJDA 1SKUB 1M90C 2JQ9A 4DIDB 3FJ5A 5JREA 1NEGA 4J6YA 5CAIA 2E5LT 4FCYA 4J9GA 2J62A 2EQIA 2XIDA 2UXNB 2MWPA 3A1PA 5LYJE 3TCJA 4KX6A 2IG0A 2X51A 3FZMB 4DR3T 1PSEA 4OP0A 3HSBA 3CCVT 1DJ7B 2COWA 4J5YA 4J9EA 3PV0F 2H7VC 1N9SA 3MEWA 3HR0A 3ONXA 2GFUA 4C8QE 5C3JA 2LKGA 3LBXA 1JU5C 3CC2Q 2IW5B 2KYMA 4XBFB 3U23A 2E6ZA 4LMLA 2UXDT 4HT9A 4XU2A 2UUBT 1QKXA 2CSQA 1E6HA 3OYMA 4GKKT 2YINA 4QVDA 4NUVA 4O4JE 2G0UA 3ZSSA 5LHIB 2FEIA 3ZMUB 1ZX6A 1NAFA 2J7IA 2LC4A 5GAOq 2W61A 1OU9A 3DTOA 3CD6Q 1M9SA 2K3WA 4UR9A 3CCJQ 1D1CA 3CPZA 4UV8B 4JBWF 3SOLA 1X27A 2DILA 2FYKA 2JW4A 2Y4YA 2GCXA 3PUYF 2COZA 2R5AA 4JZ4A 1SE7A 5TAOA 2HBPA 4TWDA 2CZ1B 3MP1A 5JDLA 5AQHB 4ZOLE 1CUNA 4J9HA 2YUOA 2FJDA 2XMFA 4II1A 1O9SA 2YU2A 1ZUYA 2XY8B 3OYCA 2MIOA 2QDYB 2XD0A 1GBQA 1BU1A 3CCLQ 1VQ6Q 2LJ0A 3ZC1A 1YI2A 3CC2A 4BY6B 3O1IA 4YFSA 4QKNA 2ZM6T 4CN4A 3MACA 3JADA 3LSVA 2Y48B 2HPJA 1IJ5A 1MMDA 3LLRA 3QBYA 4BE0A 1SUMB 3WVEB 2RJFA 2VASA 1N32T 3M65A 1ZSGA 1X69A 4CXXA 4Q5WA 2X4WA 2C5IT 2KY9A 3N9NA 1N33T 3CQXC 3CD6A 2L8DA 3VYGA 3RIFA 2L5QA 3CCJA 3T1YT 5GANd 1QCNA 2FZGB 4GLMA 5HXCA 5H6QB 4RTTA 3PDYA 1M4ZA 2ZPHB 3QB5A 5L3FB 1KF6A 3ZCJA 4JI0T 2HBWA 4KRTA 2EHOA 2Q9QC 2IUBA 2O4XB 1VQ6T 1KFZA 3ANWA 4M77C 3M5AA 4BDZA 3CKDA 2QVAA 1FIOA 2WSSV 4LMKA 5GONE 5CIUA 2L3SA 3OYGA 3LJCA 1V29B 1NJIU 1Q86C 3HRUA 5GAN5 4UIGA 1BIAA 2AZVA 4MHCA 5L47A 2K6DA 1ZKEA 3CCLA 4HFHA 2I0MA 4DR1T 1VRBA 3ZJ1A 2M51A 3M56A 3ZN1B 2H8HA 2HAXA 3VS6A 4M7DC 2CP0A 1W1FA 1TTHB 5DABA 1X6GA 2CH4W 2LJLA 3FZFB 2K4YA 2P0PA 3LW5E 4M78D 2AT1B 5FRMA 2V1RA 3N9MA 1NE8A 2RQWA 3CMLA 5I21A 3SS1A 4J7FA 3L2VA 2EGEA 3GMIA 2L0AA 4FW1A 3UA6A 1TUDA 1L0VA 1W4SA 3CX6B 2RJEA 1MV0B 4ATOA 2OTJA 1YWOA 1QQJA 1NJIR 2RP4A 5ABHA 2E5VA 4L59A 2NUTA 3LGLA 2B8AA 3JCMV 2RPNA 2DEQA 4AQGA 1GRIA 1GCQC 3PFSA 1PM3A 3KVAA 2CP2A 4C8QA 8ATCB 5GAN2 4OB0B 1WJSA 2NOXA 2LCCA 1T0JA 4V2SA 3PUSA 3GNGA 2WSEE 3WVDB 1VIFA 4JJBA 2VWAA 4DR5T 1VQKA 2V1QA 1M5Q1 2RI2A 4U2YA 2CDTA 3NVOA 5C6SA 3ANWB 2ED1A 4O6JA 4NS5A 1BB9A 4M77F 6AT1B 3I9YA 1AEYA 4JRIA 2CE7A 4PJOA 2DL7A 2E9XA 2RM4A 1H8KA 2VUBA 2BG9A 4C5IA 5KCOA 1K73U 4DOVA 5HEJA 3H9NA 5FRNA 1XJWB 4TUYE 5IHNA 3JCMc 3QYHB 4F7UF 3GP8A 1OV3A 4BA9A 4EZ4A 4M7DF 1TS9A 1GXIE 4DV2T 2IC9A 3NBXX 4ASKA 4C5EA 4IUTA 1T3LA 4OMPA 3HRSA 3KV6A 3HKEE 5GANj 4JS5A 3I9QA 1I1JA 2LDMA 1KNZA 2GF7A 3AE7A 4IDZA 4DBQA 2EQMA 1NZ9A 3ZYMA 3TSZA 4OK0A 3GLXA 3CPWP 4AKGA 1U5SA 1QCOA 1VQLQ 1M90U 3VS7A 4HCZA 3TLVA 1VQOQ 4JI3T 5A0LA 3VS1A 3CMEA 1MIYA 3MA9A 4M78E 3UA7A 3CCUQ 1Q95G 1A0NB 5KCHA 3LK2B 3JB9I 3RLFF 1TU0B 5A1LA 3IHRA 4JI6T 1TOVA 3AE4A 3RESA 5IXBA 2HCKA 3L2UA 2JMCA 1AWXA 3PU3A 1VQ9A 1SHGA 1VCSA 4HVVA 3MP8A 2DYIA 4PJOB 2OTLA 3PUAA 2RH2A 3F70A 1AD5A 2DVEA 3I5SA 8AT1B 1UCUA 5LJ3f 1M90R 5ECAA 4GBQA 4K11A 2LCLA 3CCRQ 5L3BB 1N6AA 4YSXA 1U5PA 2KT9A 2V7IA 2VVNA 4OYKA 3RKGA 2DD5A 3RIUC 2AKKA 3OYIA 1JNZA 2DL4A 4HFBA 4H63H 3JCMg 2CZ6B 4DEXA 1IBMT 2X66A 3KVBA 1VQOT 2A9UA 3VR8A 1HCIA 5JR9C 1PD1A 4G63A 4CQIA 5JH7E 2YK0A 2JXBA 2EJGA 4QVZA 3PVQA 3GF5A 5LJ5g 3ZMTB 2JMKA 1OOTA 2R58A 3JAFA 4XU1A 1SA0E 2NYSA 3HFNA 1SPKA 2EW3A 4BI3A 3DLLA 4OMFB 4RG2A 2EQUA 3MKDA 1MNEA 2MYSA 1V76A 1TXQA 3KFWX 3PUQA 1UUSA 1M2OA 1N9RA 2GBQA 2RO0A 4ILUA 5BMVE 4HTEA 4IDQA 3A5XA 1LVFA 5D6YA 3CCRT 2WQYA 4ZN3A 3M4GA 3RF1A 4IDNA 4F14A 2ZMAA 5ABFA 3CWZB 3E22E 4OHFA 4KGXB 4H63V 4WCIA 5CA1E 5GAOm 2CCQA 5J2UE 3AAIA 4B3RT 2ZM0A 3V5UA 2KNBB 4Z8AA 3OYYA 2XDPA 2VKHA 3EVYA 4R56A 4ME7A 3LK42 1SHFA 1UDLA 4GIWA 3O5ZA 3QWYA 4IUUA 2WACA 4A56A 2VQET 1OPKA 2JZ2A 2RJDA 4IUVA 5FL0A 2HQXA 3ZLIA 2K3BA 3OYAA 4LF8T 3VRYA 2CZ0B 4JI8T 3H3AA 1JBMA 1G3TA 5L23A 2KNDA 1Q86U 3NMZC 1UHCA 3ZSTA 3PVLA 4B6XA 2CXDA 1R0CB 2LLYA 5FLXE 3I56Q 4Z88A 2K48A 5HCKA 1YITQ 4OGEA 4ZI7E 2DRKA 4BE1A 1YJ9Q 1YW0A 1R8IA 1OEDB 3QWXX 2YUQA 3ZPOA 4M7AG 3M9QA 3SWHA 3UUBA 3RKWA 1Y96A 1UX5A 4M78A 5HXRA 1RI9A 2BTTA 2J6FA 4ZZBA 3CBPA 4I50E 1Q86R 4YTPA 1PSFA 4HVUA 1VQPA 2EKHA 2A3LA 2V1DB 5FWBA 4IT4A 1KK7A 3H37A 1AVZC 3A8OB 3OS0A 2DIQA 4H9NC 1VQ5T 1VUBA 2DTOA 2CLYB 2E5KA 3RMSA 1G73A 4C0FA 3N5LA 2Y90A 1FYNA 4C92C 3I56T 3FRNA 2DXBA 5CVIA 2H89A 4RTUA 5FU6C 3V8LA 2HQEA 1YJ9T 1VQ7A 1HXDA 4EAHA 1NEKA 2OX7A 2NR4A 2CZ7B 2EBPA 5KH6A 4WBNE 1VIEA 3LDQB 5M4YA 3AEEA 5HCJA 1WYCA 5A0GA 4KGZB 3NRYA 3SWNA 4ILBA 2AHJB 3CQTA 3CC7A 5H6RB 3UQ7A 1UURA 3CX8B 5GANf 4FSXA 2VVSA 5JRCB 2KYBA 1Y96B 2CMRA 3ZMZB 3RYFE 2CUBA 2XM1A 5JTGA 1Z8UA 1FXXA 2EYWA 2HDAA 3X26B 1MGQA 1WNLA 2YT6A 4COFA 3G4ST 3CMAT 2P0KA 4P5NA 3OA6A 2E1HA 4DV1T 5KYYB 1JXMA 4A53A 4HFVA 5GAMg 2EHOC 1M1KC 4Z91A 2GTJA 2E70A 2WDQA 2DWKA 3GN5A 3EAMA 3MEAA 1ABOA 2VURA 2L3RA 1O75A 1HF8A 4RCCA 5L3DB 3GIBA 1AZEA 1QSDA 4H9PC 4LD6A 2SPCA 4DR6T 1R77A 1QMCA 2X0HA 2E2AA 2WMOA 2FVUA 1I8FA 4MBQA 4LF4T 5EC7A 3KXTA 2ODUA 3OW2P 3RR6A 2WWUA 4QXBB 4EV6A 1KC8R 3VU7H 1Q7YC 2P0QA 4ILCA 3PU8A 3M0TA 3FLGA 1T3SA 1E7PA 1G3YA 2YUNA 2HZYA 3OMGA 2A72A 4QX8B 4C0DB 2XQ6A 5FXWA 2XAFB 1Y7XA 3M57A 1GFDA 2N9DA 1WR0A 4C8QC 2J6KA 3GNFB 4QH5A 3HKDE 1WHHA 2KEAA 2PJQA 3JB9J 3C4ZA 1YNZA 1K76A 1W9RA 4IE6A 4B6MA 3I55Q 1SHZC 1YWPA 2Q9QB 2XICA 4AISA 1YFNA 3HI2A 3JCMQ 4YHJA 5L4EA 3CXCA 1ZBXA 3GN5B 1WHJA 5AQRB 3G71A 4GK5E 5HYAA 4KI0F 2MMPA 2E9XC 3OBWA 4NL3A 2BG9C 1C1AA 1TH7A 4IIOA 5EG2A 2XQ3A 2ACXA 2LSGA 4ERRA 1CKAA 1YIJQ 4OYJA 1VYUA 3VS0A 1KQSS 4IL4A 4Z8XA 1H641 2LCSA 1WFDA 1FEWA 3P8DA 1QP2A 4J7IA 1NYFA 4FJOA 2WWVA 5KYUB 2HQHA 2FL7A 1Y01A 2DAQA 5GMKl 3I55T 1VQ4Q 3G6EQ 4CRIA 2FZKB 1AT1B 3M0PA 3NGPA 4L6V5 3KBTA 5AQOB 2FRYA 1QUUA 3VRAA 3PMIA 2X9HA 4IHJE 5ABEA 3JRZA 1QCFA 2LHNA 4BI4A 2HMAA 3MCAB 4M75A 2VB6A 1Q81C 3SD4A 5GMKi 1YJNQ 1YIJT 3OMCA 5JDMA 4HKEA 3CCSQ 4K0KT 4M77G 5A0DA 3UT5E 4IDOA 3CBOA 2D9DA 4HT8A 2CP6A 4PL6A 2DPPB 2JMHA 2VKDA 4DV7T 4PJOF 4V1Av 1QVGA 1I81A 3KV9A 1K9MC 4AFSC 3G6ET 4IDPA 2CS7A 2CP3A 4LF7T 3RIUA 3UFGA 3V5SA 3NTHA 4M7DG 4GY5A 2X9WA 2IVWA 4E7KA 4EPCA 3Q5WA 4OGCA 1VQ4A 4XTXA 3AVRA 3B57A 5JR9A 4YJ2E 2UXCT 4MZMA 3ZYLA 1NM7A 2X9YA 1LOJA 3EHQA 1YJNT 2YSQA 2UU9T 2NW9A 4JI4T 4LDVA 4UC4A 4JRPA 3LX7A 2QGSA 4XK8E 3CCST 4KH0B 3JCMh 4IE7A 3UUXB 5FP3A 2M6BA 4LF9T 2KBTA 2WSCE 4E7JA 5CKDA 3AE6A 1BBZA 2VC8A 3OYDA 1S1NA 4QVCA 3V7RA 3BDUA 5JDNA 2LRKA 5J2TE 2X4JA 1OZ3A 3A8HB 3S3NA 4X1KE 5I2SA 1S72T 4QHOA 2I59A 3ONLC 1WX6A 5L8RE 1MIWA 1YHQQ 2D0TA 3ZC0A 1KQ1A 1QVPA 4TX5A 5L3GB 2VGMA 4LFAT 4P09A 1ZA1B 5FY0A 2RHXA 1MMGA 3SB2A 2BIVA 1M27C 4EZHA 4J9CA 1ARKA 3WAJA 2CLYC 4GKJT 3RERA 3ZMSB 5JR9B 5FXZA 1QP3A 4JDSA 2X67A 3CCMA 3OYJA 4U3CA 3F2EA 2RQVA 2K9GA 4H9QC 5C2TA 3AA7B 2JTMA 3F31A 2DIGA 3MEVA 2JMAA 2C0IA 4LDWA 2W2UA 4DV0T 4HN9A 4J6XA 1RAAB 3E0ZA 4KULA 2NUPB 4XTWA 1RAFB 3I0OA 3OS1A 2YDRA 3L39A 1WQWA 1ZV4X 3RBBB 2WS3A 3KDSE 2IC6A 1G3SA 2VXEA 4A4KA 3BQLA 5AQIB 4DNDA 4F8HA 1E1HB 3RYCE 4ZI2D 3EG9B 3ABVA 4JRQA 1YI2Q 1YHQA 1K9AA 2P4RA 4ZI3C 5ADXL 4Y92A 3BQIA 1IJ6A 4ZEYA 4M78C 2RA2A 1Q7YU 2DVJA 4M7AD 3OS5A 2KK4A 4FYXB 3JCMe 2XQ7A 1SSHA 5LBQB 2RI3A 3GBQA 4A4FA 2RI5A 4JLEA 5A2QE 1YCYA 1X01A 4JEUB 1M8MA 2W4XA 1X75C 1B07A 1RI0A 1PRMC 1T8BA 5LJ5e 4DEYA 4IKFA 4C0ZA 3QIIA 5LJ3g 3AE8A 4AKLA 4C91A 3T1HT 4C92A 5AQFB 2FJBA 2D8JA 1UK5A 4B3TT 3AE3A 1Q7YR 1I6ZA 4OMMA 1YI2T 3AA1B 4U7YA 3CC2T 3NRXA 5LGNB 1I0CA 3D0TA 5CB4E 1PHTA 2RHIA 3RH3A 5HWXA 1RAEB 2DCFA 3QDFA 4NXNT 5FW9A 2LM2A 1RAIB 2X0YA 2DFUA 3H41A 4DBFA 4TNWA 2MPXC 3SHWA 5GAOn 3B13A 2D2SA 4F6RC 3UQ4A 5F5WA 1ZSZA 3L2WA 1ZQ1A 3SWNC 4A63B 1B7TA 4QXHB 4BDYA 4JLGA 1NPRA 1UJYA 1JEGA 3P50A 2XDBA 2CBIA 3LBXB 2CREA 1M3CA 3CCJT 3CD6T 1OYXA 5DY9A 2QXFA 1LKXA 3CXCS 1NWMX 5IHIA 2K5LA 2K24A 3HKCE 4ZZCA 2E6NA 2KRMA 2QQRA 4C0DC 2OTJQ 1ZOYA 4FYYB 3PT9A 4LDXA 2FPDA 4X62T 4CI0C 4IUPA 1E2AA 2MWOA 1QVFP 1IBKT 3RQUA 2EAYA 5KYXA 1W2BA 3UUNA 3W15B 4CC3A 4PK5A 5FKYA 2NWMA 1OQKA 2QAZA 4XTVA 1I94T 2YEVC 3CCLT 4C92B 4NUUA 1Q81U 4JI7T 5FU6B 1VQKQ 2KE9A 4YSZA 3A5ZB 4LDUA 1N8RC 3VYHB 4M7AE 2BKDN 3O1JA 4FU6A 4HA8A 2E10A 4YJ3E 3OTOT 3AEGA 3N9QA 5LGUB 4DV6T 1WLPB 3JB9G 1GL5A 2OV9A 2PG8A 2V7JA 4RG8A 1QLBA 1AOJA 3LWHA 4QH4A 2L3QA 2OTJT 1K9MU 4OX9T 1BR1A 2HNIA 2R57A 2C5JA 1IXDA 2W63A 2EWNA 5HXSA 3H0HA 4O2AE 2B1EA 3AE2A 1Q81R 1IHVA 4J9DA 2PUKB 3O9XA 3ME9A 5CR2A 2FB7A 4ISSA 2XHEB 4DQ2A 3Q5XA 4ZTFA 4B3MT 3OS2A 2XAJB 3L1AA 3V8KA 3DB3A 3GOXA 2GNCA 1VQKT 2RHUA 5CCAA 4PK6A 4AQYT 1QVGS 2KI7A 3D7SB 5KYXB 1T7SA 5EK4A 2AIRB 5IT9E 5CKHA 3VV0A 1OPLA 5EZYE 4LF5T 2XG8D 2EHOB 3CMEQ 4PAGA 1AWJA 1PKTA 1W70A 2QQAA 2ZAEA 3P8BB 4QXCB 4CC4B 4EOZB 2DD4A 5IUXA 1IZ6A 1BK2A 2EGAA 3OJAA 2LNHB 3JAME 2WZHA 3C12A 5AQMB 5FY7A 2WU5A 1UGSB 2RN8A 4BUGA 3P7IA 1NG2A 5L3CB 2MOZA 3QKJA 2CP7A 1VQ9Q 2K3XA 2K2MA 3H0FA 2OTLQ 2KXCA 4HKAA 3U78A 3ZT6A 2BS2A 4J9FA 1VYTA 1PCXA 2PTKA 1JJ2A 2BZBA 2PBIA 3G06A 4ISTA 2EYZA 5LBMA 4X64T 2H88A 1FJGT 2FPEA 4BD3A 2XM2A 3OKQA 3S3OA 2NUTB 4J6WA 3LH5A 1K73R 4HCKA 5FNVE 1EZ3A 3KBGA 5GANg 5LG3A 5GAMe 3S4UA 1TSFA 2A0FB 4C8QB 3QZ9B 3P4QA 5AFUL 3X24B 2C5KT 2XK0A 2ODVA 2R5MA 3M0SA 3MEUA 1VQ9T 2MAWA 1N5ZA 4M75C 3JAEA 1KNRA 3NKZA 1YBYA 2OTLT 4CN6A 3QUIA 5J1GA 2JS0A 4LN2A 4ESRA 3OBVE 5LJNA 1KD1C 3K3QC 1IHWA 2QQSA 5KYWA 4NIQA 2KLQA 4HWHA 2KRNA 5JDFA 4IGUA 4OMNA 3ZBDA 3ZCIA 3OYKA 2Q9QD 2E9XB 4C90A 2BG9B 3HRTA 4M77D 2CHNA 5L2LA 4QQGA 3J7AF 2JQQA 2L3PA 3QJYA 2CM0A 3P4PA 4ZN1A 2K3YA 1VQLT 2AE9A 5IWAT 4EB6E 2JT4A 1U8RA 1Y57A 3HL6A 1XMQT 2LQWA 1X79A 4FM4B 3CCUT 4X65T 2IIMA 4M7DD 2LMJA 3VS4A 3CCEA 2IHR1 3VRZA 2IAKA 3PUZF 2A08A 2O88A 1WQ7A 1X6OA 2JTFA 1FWZA 2XU8A 3THKA 4JZ3A 1PD0A 2JQHA 2CA5A 3RC3A 2DF6A 1KFYA 2A37A 4C8QG 2DO3A 1KQSA 5LJ5j 2PQWA 2HPLA 5D7UA 3MP6A 4X66T 4M75F 4CXYA 4HCCA 3PURA 3G7ZA 2M0OA 3REAB 5LJMA 5KYWB 3UU5A 2KR3A 1UE9A 5GMKh 4M1PA 4P1NA 5AQLB 5FYMA 2XHCA 3LYIA 1IZNB 4PJOG 3NZQA 4X5TA 2VQFT 1U06A 2LSJA 3MXZA 2QGFB 2KINB 4EXTA 2MI6A 1US7B 2PNIA 3FC3A 1M3AA 4BE2A 1B3QA 4DR4T 3T8OA 1VQPQ 1VQ8Q 4QH1A 4H9SE 4HXJA 4IE4A 2C0TA 2CXLA 3TEEA 4RTZA 2BDEA 3FB2A 2RK1A 2PTFA 1BI3A 1V9DA 1HYOA 2W0ZA 2FJEA 1W0BA 3VKHA 1ABQA 1WR6A 3MPUB 3MK7C 2YRDA 4TWFA 5AQVB 3QOFA 2ZPGB 3A8GB 4EMKA 3E1SA 2LVMA 3C50A 2M02A 3TU4K 4M77E 1G5VA 5JQGE 2KXPB 1VQ7Q 3EGDA 1N8RU 1HG2A 3CVRA 4TWHA 1Q82C 2XAGB 3MZKB 3E19A 1EX4A 2HEQA 3VU3C 3REBB 1NLOC 5FROA 1K8AC 2CWYA 3PUGA 4F7UE 3PTRB 4JUYA 2DBMA 1S35A 1W2BS 2H7OA 2DERA 3M4YA 2EYYA 1UGOA 4M7DE 2F2VA 4O4HE 3TLSA 3CCQA 1HD3A 1H3HA 2M67A 4L0RA 5ABFB 2DI4A 2JOYA 2KGTA 4FYVB 2A28A 5CJ5A 4R0KA 2XSAA 3I0QA 3E9FA 3CC7Q 1KQ2A 1WJQA 4NXMT 2GK9A 4PJJA 2F5TX 4ZXLA 1IAPA 3NWIA 3OYHA 4YTNA 1M3BA 4KT0E 3URGA 1VQ8A 2YLBA 5FVLA 4UVCB 4Q25A 4RUGA 4IE0A 2EYXA 1VQ7T 4F16A 3EDVA 3FZLB 2BZ8A 3JC6C 3LG7A 2RNAA 3QXEB 3MO8A 3GPLA 5FVKA 1I4K1 1ZUKA 1I07A 4X1IE 1MIVA 2CT4A 3ESLA 3AA0B 2LZ6B 3P8HA 3JCMP 1YITT 5I22A 5GMKe 2CRBA 2O01E 1M8VA 5GAOl 3VUBA 3CC7T 1X2QA 4U74A 1X43A 4EDUA 4X20E 3JB9F 4TV8E 1QLYA 1WIEA 3ZT7A 2MAMA 3RKYA 2YDSA 1IO6A 1ZSZC 3OVUA 3UF4A 4XTUA 3KINB 2WDRA 2WU2A 2YXYA 1UX4A 3ZEHA 3CPWA 3L2QA 2MK5A 5GAN6 2C0SA 4FW2A 4OFZA 4GLKA 4M78B 1E6GA 5IN1A 5HK3A 3EG1A 5AQNB 1YD8G 2X0LB 2YWWA 3NTKA 1JO8A 1O3XA 3K1SA 3EUHA 5CK9A 2W0GA 2O9VA 5DLQE 4D8KA 5GAN8 4PLLA 1HNXT 7AT1B 2DJZA 4EYUA 1C0MA 2EVRA 1G8XA 4OB2B 4FT2A 5IH2A 4NL2A 2LOSA 2F4VT 1JJ2S 2UUAT 3GWHA 1U4QA 4C92F 5J0ZA 1T98A 1KEYA 3UFEA 3RX6A 1RACB 1KD1U 3PMTA 4X34A 2WCAA 2XUEA 3C4XA 1WFWA 4J9BA 2W67A 2ROLA 5GAMj 2DM1A 3JCFA 2CGHA 3AT1B 2PVGB 3RNJA 4HWDA 3G71Q 2RB6A 2BZXA 4X9DA 3U3IA 2V7MA 1YJWQ 2WMNA 1K1ZA 4YXDA 1UB4A 4LXCA 1KNPA 5CKBA 4YT0A 2QYWA 3ZEFB 2F2WA 3SWNB 3EH1A 3JV3A 1V1CA 5F3JA 5JDQA 1HX8A 1WCRA 2JQKA 2LSIA 4YTMA 2EJFA 3OYEA 3M0QA 5AYFA 4M78G 2KMFA 3M3ZB 2LSKA 4H9RC 4JLIA 4F7UA 2D0UA 1M1GA 5LJ3e 1M7KA 1P92A 2E8IA 3VR9A 4I4TE 4TNVA 2K5FA 1IB8A 5AT1B 1Z9ZA 4XTZA 1YXRA 3G71T 4RTYA 1VA7A 3K3OA 1YCSB 1S94A 1N34T 2X3WD 4N78D 4CXWA 3QSUA 2BE7D 2ATCB 3I1AA 2IPOB 2YLCA 1RL2A 1YQ3A 2FUPA 1UHFA 2F69A 3VS5A 1H3ZA 4Z90A 1WHLA 1YJWA 2KZ7B 2DK3A 4OB1B 1GBRA 5HEHA 2V26A 4BJNA 2HL3A 5IHKA 3HKSA 2LQ8A 1D09B 1XDOA 5J3BA 1D1AA 4JI1T 1WXUA 2CUDA 5DQWA 1VQNA 2P9BA 1D0YA 1KJWA 2OI3A 4AG1C 4XTYA 1BKBA 1ACMB 4JPBW 5FU7B 4CI1B 2A3DA 2B86A 1QWEA 2QA4A 3PE0A 2BKNA 2QTVA 4GOUA 1HS7A 2NTYA 1QKWA 2LT4A 2JRKA 3LFMA 1Y07A 2AZSA 5EK2A 3CC4Q 4C8QF 1IGQA 4LF6T 1Q82U 3META 1ZHCA 2D5UA 2PFVA 2WBLA 3IBPA 1EZZB 1ZP0A 5LA6E 2X68A 1BYMA 3HKBE 2GQVA 2DHRA 1PG5B 2HHHT 3AEAA 2LX7A 4MFRA 1T0HA 1CKBA 1UGRB 2EQJA 1BCOA 4J8OA 5HKCA 2EHOD 5LG4A 2FPFA 1H7CA 2DEUA 4OMOA 2VYTA 2CEAA 3NZPA 3UU8A 3ZJ2A 1WHMA 4YLHA 4OVAA 1VQ4T 2XDDA 2E5QA 2BVLA 3Q2MA 4ZI2C 3V8JA 4AIUA 3M0UA 3K8PC 4QKUA 3QO3A 5FWCA 1VQMQ 4JJNK 2EGCA 4BAYB 4KHZF 2JM9A 2FO0A 2GGRA 2FZCB 2YKSA 4BACA 4PFZA 3INZA 1FMVA 5JDGA 2NW8A 4DA4A 1U3OA 2H3RA 4PFOA 3J80E 2QEXA 2OJ2A 2DXCA 3CC4A 5IXFA 2E64A 3CCMQ 1TWBA 2JM8A 3X20B 2DMOA 4GK0E 1J5WA 4P0BA 4DV4T 2A2FX 4X9CA 2YU1A 4ELZC 2WZIA 3HFOA 2I6HA 2X4XA 4XU3A 3A98A 4CI2B 4M75B 2E41A 1ZLMA 3WAKA 4E2FB 3RKXA 4IE5A 2HSEB 5LJ5h 4C8QD 4LFCT 5HEUA 4A97A 2XAQB 4LDYA 1XZYA 1OU8A 2Z0WA 5GMKj 2WM9A 3P4SA 2J6OA 2Y6XA 4L9IA 4WW0A 1HK9A 3QYGB 2VWFA 2NTXA 4AI6A 2HN1A 4PJMA 4QT7A 3RDVA 2L3LA 2YUPA 1UG1A 2E4HA 4EEDA 4J9IA 4A4EA 3RRWA 1VQMA 2LSYA 4FI5A 4H9OC 4AFQC 2LRQA 2QASA 4PJOD 3CCMT 1TG0A 4E47A 1VYVA 2XZEA 1RAHB 4UEMA 4A4GA 2J47A 2M9UA 4PJLA 3CQGB 2LOPA 2XASB 3ETUA 3ASKA 4DR2T 5GANe 2IDOB 4UELA 4U72A 2V6YA 1Y64B 1ZBJA 5HAXA 2KMTA 3OB9A 5D6WA 1M1KU 2RD1A 3CPWS 2LQKA 5KX5E 4JJDA 4EMKC 4CC7A 2KXDA 5FXXA 1NPPA 2D8HA 2LX9A 2RK2A 3N2KE 4LD9K 4UVBB 2BE9B 2XQ5A 2D1XA 2I0NA 3CPFA 5E0OA 2IMLA 3ZYKA 2OAUA 5DQVA 2VKOA 4E7HA 1YHQT 1Z0PA 2QGGA 3PUVF 3V7SA 2M0YA 4M75G 2EPDA 4AFUC 3R84B 3CBMA 3G1JA 2H3JA 1YKEB 3BK9A 3FBZA 5HY6A 5GAN7 2CHOA 3QJ6A 1M1KR 2DTHA 5AQSB 5FXVA 5LP6E 3FJPA 5I2MA 4J2CA 2BVMA 4JUVA 5LOVE 1RUWA 4C5HA 1AHJB 3AXJA 3O1HA 1SG5A 5C8YE 2PVDB 4AT1B 2AXDS 3QK6A 3X1DA 2M6IA 3VHLA 2E65A 4AKHA 4KUMB 4I55E 1YN8A 3LGFA 1LPLA 3J7Yq 1HTJF 2D6FA 1BI1A 4I43B 1MUZA 2PZ1A 3EFRA 3C51A 3QZ5B 3BY7A 2VV5A 5L3EB 1NYGA 2V6YB 2YRVA 2O9SA 1RADB 3CCVA 1UGQB 2DZCA 5KDMC 1R8OB 1G2BA 4MZPA 2KRSA 3N9LA 1AZGB 3ONJA 5KYNA 3KBUA 2RPAA 5LJ3j 5GJVB 5CKEA 5LL6S 2YHTA 3NTIA 1PC0A 1QW1A 5HCMA 1WHKA 4YY3T 3AVSA 2LJ3A 5HEGA 5FL1A 4Z89A 4PJOE 3BW1A 2BG9E 2QA7A 4QQ6A 1WI7A 3ZFJA 2QRXA 1MV3A 2PVOB 2NP9A 3H6ZA 2O4XA 3ZKRA 4PJNA 3PIOA 2F1LA 2YRCA 3EH2A 1XWMA 9ATCB 2L2PA 2RHZA 4ZS3A 1KHIA 2J06A 1W0AA 3JCMW 1M2VA 2LT3A 2KWIB 4HCBA 2ZPEB 3X28B 3H3MA 3OQ5A 3UU3A 5HXHA 4G2AA 4DUZT 1G83A 4M78F 4CI3B 2ZM2A 2DJQA 2ZCFB 3EHRA 3AXJB 4JS4A 1SEMA 3L09A 3Q1JA 3DLMA 3SEMA 1BR0A 2XAHB 4M4ZA 5DJQC 2VKJA 2CKKA 2DE0X 2RJCA 1SRMA 3IF8B 4U7IA 4J83A 3WXMB 1KQSP 2LTOA 2UXXB 1BIBA 4TZ4C 5J39A 1PKSA 1WLXA 2JN0A 5IHYA 1HNWT 4AQFA 1JB0E 2LT1A 1CHUA 4U31A 3C4SA 3R6NA 3J81E 1Y0MA 5GAMh 2I2LA 4AXPA 4JI2T 1LNXA 1D0XA 4OMLA 4KBMB 4HEAA 3L3PA 1FMWA 3AECA 3OSSC 3L2ZA 1ZSZB 2DNUA 1JXOA 1UGVA 5IYZE 1M1FA 3V7CA 2QG9B 3N9PA 3RHWA 4B9WA 1OZ2A 1M2VB 4O5VA 2DLPA 4R55A 1D1BA 5FU7C 4LUEA 1VQ6A 4WF2A 4P0AA 1TUGB 4HFDA 2UXBT 4ZI3D 4FYWB 5KE2A 3OYNA 2XKOC 3OSVA 4E7IA 4IURA 1K9MR 5HK0A 2QK0A 2ENMA 2K79A 3AE5A 2LM9A 2L8KA 3JCMd 3I5RA 3O4XE 2XQYA 5KE3A 3VRBA 4FT4A 2X4YA 4A54A 2V6XA 4E7ZA 2JUFA 4C92G 2XQ4A 5AQTB 4IUQA 3F57A 5LMUT 5LJ5d 3OY9A 1OEDE 5HWYA 2D0QB 1OX9A 3EFSA 1G3WA 2XQ9A 4QW2A 2DL8A 1GQEA 1T72A 4L5GA 3C0CA 2SRCA 3N2OA 3NPFA 1MNDA 2DL1A 4CN1A 4JI5T 2L9QA 3ZL7C 2YDLA 3C94A 3AE9A 2LRLA 4JJCA 3EAEA 1AWOA 3SFEA
chains in the Genus database with same CATH topology
2CXFA 3AB3B 4QQDA 5LHHB 4BB7A 3CMET 2RA1A 4GYSA 5ETWA 5FY1A 2CWOA 4TN7B 2MF2A 4FL6A 4HGAA 3R6OA 3M53A 3UDCA 3NFCA 4EMGA 4JRKA 4EIWA 3SDZA 1XQHA 3DJBA 2V7KA 2G3RA 4RCBA 4XQ3A 3FHNA 3HA4A 2QQ9A 2F5KA 3JB9H 3PTAA 1SSFA 2ZM8A 3OW2S 2NLUA 3UUMA 3HL8A 3CCET 1HG5A 1KC8C 2L89A 4PKCC 4M7AA 2Z6EA 4X1YE 3M58A 4BI8B 1WPYA 1FX7A 5LNKA 4KUDK 1EIFA 5J26A 4N0AA 3QC9A 3I9WA 5CA0E 3FEOA 2K57A 3L42A 4YTLA 4ANJA 2ZPIB 4OF1A 3CEYA 4TV9E 3FIFA 5D6XA 2EJ9A 3ZMVB 4PFPA 2OA5A 2X9XA 4ZGEB 3J9X1 4WNKA 1VQLA 2K5BB 2VGNA 1VQOA 1QVFA 3UTKA 2X35A 4PW8A 1LVKA 3CCUA 2EFIA 3P8CD 4UF0A 1JRIA 3QG1A 2LEHA 1U1TA 1ZHIA 3M54A 3OBYA 3H8ZA 1MMAA 4JEHB 4M7AB 2RHYA 1WGSA 3HPWA 4E7SA 2KQWA 1OXZA 2KVQG 4ZGDB 3CCRA 4DMVA 3QDRB 3OYBA 3ETVA 4OB3B 3QUJA 5KMGP 3RIRA 3O8VA 4B9XA 3CCQT 3MJXA 2BUDA 3BQKA 3OYZA 4PNOA 4N4HA 1XNIA 5GAMd 5GAOr 1VQPT 1VQ8T 4PK4A 5GAOp 1KHCA 1WJRA 4M75D 1Y71A 2A7YA 3L2RA 4FIBA 4C5GA 4UF0B 2NWBA 3ZN0B 2MBGA 1LJOA 2KAFA 3C4WA 2V8KA 4E7LA 3SRZA 3Q9DA 3X25B 4ZS2A 4BY6C 3AHUA 2JPFA 1WRDA 2EKOA 2DZ9A 5JRCA 2LE8A 5F8PA 3N2GE 3T9NA 2XTLA 2MTQA 4MDWA 4D6WA 4K0UA 4MMKA 4EMKB 2DLRA 2ZLYA 2JJ9A 3IEEA 3M59A 1YKHB 5LJ3h 3S3MA 3CX7B 2KSSA 2Y8DA 3JSCA 4EMHA 2VL8A 2J1DG 4MALA 3AAAB 3JCMJ 4DMWA 2Y4XA 1MHNA 3RRCA 1VQ5A 4DBRA 5EK3A 3I56A 1YITA 2VXFA 2JVVA 2V8IA 1YJ9A 4BJMA 2FHDA 3A8LB 2VK9A 3DP7A 2KDSA 5JDHA 5LGTB 2PUOB 5LCYA 2WSFE 4A4HA 3PIPA 2CYZB 4ZHQE 4M75E 2QQBA 4O8SA 2ZZDA 3N5BB 4AQFC 1AJ3A 3JCMX 2ES0A 2W62A 4O4LE 1BR2A 5GAN3 4MLKA 4XU0A 1IREB 2DWGA 2ZPBB 3UWNA 3A8MB 4XAXB 2Q9QA 5GMKm 1D0ZA 2QTXA 3JB9D 4M77A 5GAN4 1KC8U 4AKRB 4Y28E 3G4SA 3CMAA 3LH0A 2XI9A 3HHTB 3LWIA 4UV9B 4MMLA 3RC8A 2EIFA 3JCMf 2EQKA 2M1HA 5LXTE 3VKGA 3BFMA 2DNXA 4TVRA 4M7DA 4ZGJB 5LJ5f 1KG1A 2WAUA 2DXTA 4O4IE 4N4GA 2EYQA 4UXNB 4N4IA 5C0MA 2M16A 4KMCA 3UULA 1YJWT 2DKGA 1BI2A 3RUXA 4VUBA 2P4TA 3UPUA 4C0GA 4EYYR 3JC6D 3RKOA 2ZPFB 4KUIA 4PLIA 2ZGWA 3FXDB 3UT1A 4MZTA 4C92D 4ZTJA 2JNGA 1VQNT 2QI2A 3GA8A 3C95A 1OI1A 3RYHE 4DO0A 3WI3A 2DTIA 2K2VA 2QA4T 5DLOA 3RMQA 2KWHA 4M77B 3FDRA 4IIJE 3DB4A 3OYXA 3KV4A 4PJOC 1ZEEA 5JVDE 1I5LA 4F7UB 1QVFS 3AA6B 4M7DB 3RYIE 3JCMb 5CKFA 2C06A 5IAYA 2K5IA 4Z02A 5DM7R 4AKIA 4MDXA 1K8AU 5GANh 4UVAB 3FXEB 2D9TA 1B34A 2HH7A 3E9GA 3KV5A 4QX7B 3I55A 4GYRA 4RMOA 4QWNB 3TKLB 2PU9B 3DKMA 2N1GA 2K9AA 5CQYA 2QEXT 3QHSA 4RKUE 4M7AC 4ADZA 1NJIC 3CC4T 3AAEB 3K3NA 3C98B 2E12A 5CQXA 2NW7A 4N0AC 3CQCB 4WBOA 1YIJA 5M9OA 5FMNA 4C92E 5HXEA 4DOWA 4F7UG 1VOMA 1WYBA 2N2NA 5CO7A 1U1SA 3C64A 3PNWC 3N9OA 1D3BA 3G6EA 5LJ3d 1UEBA 1BI0A 4DVDA 1VQMT 3OYFA 3FBLA 3PGGA 3EDUA 1XOVA 2W00A 1B34B 4HE8A 3ER0A 4ELYC 4NOYA 2V7LA 4KP3C 1UGPB 1YJNA 1OWAA 3KUFA 3VUZA 1N27A 2E9XD 3CCSA 4CZZB 3MHXA 3TREA 2HD0A 2DXUA 1XTDA 3FB9A 2V8JA 3VJPA 4M7AF 1K73C 3OYLA 3E08A 3SFMA 2LNVA 5GAMf 3OW2A 1LRZA 1BR4A 3QPHA 3S6WA 4Y91A 1S72A 3BDLA 2GFAA 1D3BB 1HFAA 2LHRA 3LK3B 4XZCA 3VKIA 3HP9A 3M55A 1MMNA 4O2BE 4PNIA 5LHGB 3RPUA 1M90C 5JREA 4J6YA 5CAIA 2XIDA 2UXNB 2MWPA 5LYJE 3TCJA 2IG0A 2X51A 4OP0A 1PSEA 3HSBA 3CCVT 1DJ7B 4J5YA 2H7VC 1N9SA 3MEWA 3HR0A 3ONXA 2GFUA 4C8QE 3LBXA 2IW5B 4XBFB 2E6ZA 4HT9A 4XU2A 3OYMA 2YINA 4QVDA 4NUVA 4O4JE 2G0UA 5LHIB 3ZMUB 2LC4A 1NAFA 5GAOq 2W61A 3DTOA 1M9SA 1D1CA 3CPZA 4UV8B 3SOLA 2FYKA 2Y4YA 2GCXA 2R5AA 5TAOA 2HBPA 2CZ1B 3MP1A 5JDLA 4ZOLE 1CUNA 4II1A 1O9SA 2YU2A 3OYCA 2QDYB 2XD0A 3ZC1A 1YI2A 3CC2A 4BY6B 3O1IA 4YFSA 4QKNA 3MACA 2Y48B 2HPJA 1IJ5A 1MMDA 3LLRA 3QBYA 4BE0A 3WVEB 2RJFA 2VASA 3M65A 4CXXA 4Q5WA 2X4WA 2C5IT 2KY9A 3N9NA 3CQXC 3CD6A 2L8DA 3VYGA 2L5QA 3CCJA 5GANd 5HXCA 5H6QB 3PDYA 1M4ZA 2ZPHB 5L3FB 3ZCJA 2EHOA 2Q9QC 2O4XB 1VQ6T 3ANWA 4M77C 3M5AA 4BDZA 3CKDA 1FIOA 2WSSV 5GONE 5CIUA 3OYGA 3LJCA 1V29B 1NJIU 1Q86C 3HRUA 5GAN5 4UIGA 1BIAA 4MHCA 1ZKEA 3CCLA 1VRBA 3ZJ1A 3M56A 3ZN1B 2HAXA 4M7DC 3LW5E 5DABA 2K4YA 5FRMA 2LJLA 4M78D 2P0PA 3N9MA 1NE8A 5I21A 3CMLA 3SS1A 4J7FA 3L2VA 3GMIA 1W4SA 3CX6B 2RJEA 4ATOA 2OTJA 2RP4A 4L59A 3LGLA 2B8AA 3JCMV 2DEQA 4AQGA 3PFSA 3KVAA 4C8QA 5GAN2 4OB0B 1WJSA 2NOXA 2LCCA 4V2SA 3PUSA 3GNGA 2WSEE 3WVDB 1VIFA 2VWAA 1VQKA 1M5Q1 2RI2A 5C6SA 3ANWB 4O6JA 4NS5A 4M77F 3I9YA 4JRIA 2CE7A 4PJOA 5KCOA 2E9XA 2RM4A 2VUBA 4C5IA 1K73U 4DOVA 5FRNA 4TUYE 3JCMc 3QYHB 4F7UF 3GP8A 4BA9A 4EZ4A 4M7DF 1GXIE 2IC9A 3NBXX 4ASKA 4C5EA 4IUTA 3HRSA 3KV6A 3HKEE 5GANj 4JS5A 2LDMA 1KNZA 2GF7A 4IDZA 2EQMA 4DBQA 1NZ9A 3ZYMA 4OK0A 3GLXA 4AKGA 1M90U 4HCZA 5A0LA 3CMEA 1MIYA 3MA9A 4M78E 5KCHA 3LK2B 3JB9I 5A1LA 3IHRA 3RESA 3L2UA 3PU3A 1VQ9A 3MP8A 4PJOB 2OTLA 3PUAA 2RH2A 3F70A 2DVEA 1UCUA 5LJ3f 2LCLA 5L3BB 1N6AA 1U5PA 2KT9A 2V7IA 2DD5A 4OYKA 3OYIA 4H63H 3JCMg 2CZ6B 2X66A 3KVBA 1VQOT 1HCIA 5JR9C 4G63A 4CQIA 5JH7E 2YK0A 2EJGA 4QVZA 5LJ5g 3GF5A 3ZMTB 2JMKA 2R58A 4XU1A 1SA0E 3HFNA 4BI3A 3DLLA 4OMFB 4RG2A 2EQUA 3MKDA 1MNEA 2MYSA 3KFWX 3PUQA 1N9RA 2RO0A 4ILUA 5BMVE 4HTEA 3A5XA 1LVFA 5D6YA 3CCRT 4ZN3A 3M4GA 2ZMAA 3CWZB 3E22E 4OHFA 4H63V 5CA1E 5GAOm 2CCQA 5J2UE 3AAIA 2ZM0A 3V5UA 3OYYA 2XDPA 2VKHA 3EVYA 4R56A 4ME7A 3LK42 4GIWA 4IUUA 2WACA 4A56A 2JZ2A 2RJDA 4IUVA 2HQXA 3ZLIA 3OYAA 2CZ0B 3H3AA 1JBMA 1G3TA 2KNDA 1Q86U 4B6XA 2CXDA 5FLXE 2K48A 4OGEA 4ZI7E 4BE1A 1YW0A 3ZPOA 4M7AG 3M9QA 3SWHA 3RKWA 1Y96A 1UX5A 4M78A 5HXRA 3CBPA 4I50E 1PSFA 1VQPA 2A3LA 2V1DB 1KK7A 3H37A 3A8OB 3OS0A 2DIQA 4H9NC 1VQ5T 1VUBA 2DTOA 2CLYB 3RMSA 1G73A 4C0FA 3N5LA 2Y90A 3I56T 4C92C 3FRNA 2DXBA 5CVIA 5FU6C 1YJ9T 3V8LA 2HQEA 1VQ7A 1HXDA 4EAHA 2CZ7B 5KH6A 4WBNE 1VIEA 5M4YA 1WYCA 5A0GA 3NRYA 3SWNA 2AHJB 3CC7A 5H6RB 3CX8B 5GANf 4FSXA 5JRCB 1Y96B 2CMRA 3ZMZB 3RYFE 1FXXA 3X26B 1MGQA 1WNLA 3G4ST 3CMAT 2P0KA 4P5NA 3OA6A 2E1HA 4A53A 4HFVA 5GAMg 2EHOC 1M1KC 2E70A 2DWKA 3GN5A 3MEAA 2L3RA 1O75A 1HF8A 4RCCA 5L3DB 3GIBA 1QSDA 4H9PC 4LD6A 2SPCA 2WMOA 2FVUA 1I8FA 4MBQA 3KXTA 2ODUA 2WWUA 4QXBB 3VU7H 1Q7YC 2P0QA 3PU8A 3FLGA 1G3YA 3OMGA 2A72A 4QX8B 4C0DB 5FXWA 2XAFB 1Y7XA 3M57A 2N9DA 4C8QC 3GNFB 3HKDE 2PJQA 3JB9J 3C4ZA 4IE6A 1SHZC 2Q9QB 2XICA 3HI2A 3JCMQ 4YHJA 3CXCA 1ZBXA 3GN5B 3G71A 4GK5E 5HYAA 2MMPA 2E9XC 3OBWA 4NL3A 1TH7A 5EG2A 2ACXA 2LSGA 4ERRA 4OYJA 1KQSS 4Z8XA 1H641 1FEWA 3P8DA 1QP2A 4J7IA 4FJOA 2FL7A 2DAQA 5GMKl 3I55T 4CRIA 4L6V5 3KBTA 1QUUA 3PMIA 2X9HA 4IHJE 3JRZA 2LHNA 4BI4A 3MCAB 4M75A 2VB6A 1Q81C 3SD4A 5GMKi 1YIJT 3OMCA 5JDMA 4HKEA 4M77G 5A0DA 3UT5E 3CBOA 4HT8A 4PL6A 2DPPB 2JMHA 2VKDA 4PJOF 4V1Av 1QVGA 1I81A 3KV9A 1K9MC 3G6ET 2CS7A 3V5SA 3NTHA 4M7DG 4GY5A 2X9WA 2IVWA 4E7KA 4EPCA 3Q5WA 4OGCA 1VQ4A 4XTXA 3AVRA 3B57A 5JR9A 4YJ2E 4MZMA 3ZYLA 2X9YA 1LOJA 1YJNT 2NW9A 4LDVA 4UC4A 4JRPA 3LX7A 2QGSA 4XK8E 3CCST 3JCMh 4IE7A 3UUXB 5FP3A 2WSCE 4E7JA 5CKDA 2VC8A 3OYDA 4QVCA 3V7RA 3BDUA 5JDNA 5J2TE 2X4JA 1OZ3A 3A8HB 3S3NA 4X1KE 5I2SA 1S72T 4QHOA 2I59A 5L8RE 1MIWA 2D0TA 3ZC0A 1KQ1A 1QVPA 4TX5A 5L3GB 2VGMA 4P09A 5FY0A 2RHXA 1MMGA 3SB2A 2BIVA 4EZHA 3WAJA 2CLYC 3RERA 3ZMSB 5JR9B 5FXZA 1QP3A 4JDSA 2X67A 3CCMA 3OYJA 3F2EA 4H9QC 3AA7B 2JTMA 3F31A 2DIGA 3MEVA 4LDWA 4HN9A 4J6XA 3E0ZA 4KULA 4XTWA 3I0OA 3OS1A 1WQWA 1ZV4X 3KDSE 2IC6A 1G3SA 2VXEA 4A4KA 3BQLA 4DNDA 1E1HB 3RYCE 4ZI2D 4JRQA 1YHQA 4ZI3C 5ADXL 3BQIA 1IJ6A 4M78C 2RA2A 1Q7YU 4M7AD 3OS5A 2KK4A 3JCMe 5LBQB 2RI3A 4A4FA 2RI5A 4JLEA 5A2QE 1YCYA 1X01A 4JEUB 1X75C 1RI0A 5LJ5e 4IKFA 4C0ZA 3QIIA 5LJ3g 4AKLA 4C91A 4C92A 1YI2T 3AA1B 3CC2T 3NRXA 5LGNB 3D0TA 5CB4E 2RHIA 3RH3A 5HWXA 2DCFA 5GAOn 3B13A 2D2SA 4F6RC 3L2WA 1ZQ1A 3SWNC 4BDYA 1B7TA 4QXHB 4JLGA 1NPRA 2XDBA 3LBXB 3CD6T 3CCJT 1OYXA 5DY9A 2QXFA 1LKXA 3CXCS 1NWMX 2K5LA 2K24A 3HKCE 2E6NA 4C0DC 2QQRA 3PT9A 4LDXA 4CI0C 4IUPA 2MWOA 2EAYA 1W2BA 3UUNA 3W15B 4PK5A 4XTVA 3CCLT 2YEVC 4C92B 4NUUA 1Q81U 5FU6B 3A5ZB 4LDUA 1N8RC 3VYHB 4M7AE 2BKDN 3O1JA 4FU6A 4HA8A 2E10A 4YJ3E 3N9QA 5LGUB 3JB9G 2PG8A 2V7JA 4RG8A 3LWHA 2OTJT 1K9MU 1BR1A 2HNIA 2R57A 2C5JA 2W63A 2EWNA 5HXSA 4O2AE 2B1EA 2PUKB 3O9XA 3ME9A 5CR2A 2FB7A 4ISSA 2XHEB 4DQ2A 3Q5XA 4ZTFA 3OS2A 2XAJB 3L1AA 3V8KA 3DB3A 3GOXA 1VQKT 2RHUA 5CCAA 4PK6A 1QVGS 5EK4A 5IT9E 5CKHA 3VV0A 5EZYE 2XG8D 2EHOB 4PAGA 2QQAA 3P8BB 4QXCB 4EOZB 2DD4A 1IZ6A 3OJAA 3JAME 3C12A 5FY7A 1UGSB 4BUGA 3P7IA 5L3CB 2MOZA 3QKJA 2K3XA 4HKAA 3U78A 1JJ2A 2BZBA 2PBIA 4ISTA 5LBMA 4BD3A 3OKQA 3S3OA 4J6WA 5FNVE 1EZ3A 3KBGA 5GANg 5GAMe 3S4UA 4C8QB 3QZ9B 5AFUL 3X24B 2C5KT 2XK0A 2ODVA 2R5MA 1VQ9T 3MEUA 4M75C 1YBYA 2OTLT 3QUIA 5J1GA 3OBVE 5LJNA 1KD1C 3K3QC 2QQSA 2KLQA 5JDFA 4IGUA 3ZBDA 3ZCIA 3OYKA 2Q9QD 2E9XB 4C90A 3HRTA 4M77D 5L2LA 4QQGA 3J7AF 2JQQA 3QJYA 2CM0A 4ZN1A 2K3YA 1VQLT 1U8RA 4EB6E 3HL6A 4FM4B 1X79A 3CCUT 4M7DD 3CCEA 2IAKA 1WQ7A 1X6OA 2JTFA 1FWZA 2XU8A 2CA5A 3RC3A 4C8QG 2DO3A 1KQSA 5LJ5j 2PQWA 2HPLA 3MP6A 4M75F 4CXYA 4HCCA 3PURA 3G7ZA 2M0OA 5LJMA 5GMKh 4M1PA 2XHCA 5FYMA 3LYIA 1IZNB 4PJOG 3NZQA 2LSJA 3MXZA 2KINB 4EXTA 2MI6A 1US7B 3FC3A 4BE2A 3T8OA 4H9SE 4IE4A 2CXLA 3TEEA 2BDEA 3FB2A 2RK1A 1BI3A 1V9DA 3VKHA 1WR6A 3MK7C 2ZPGB 3A8GB 4EMKA 3E1SA 2LVMA 3C50A 3TU4K 4M77E 1G5VA 5JQGE 2KXPB 1N8RU 1HG2A 3CVRA 1Q82C 2XAGB 3MZKB 3E19A 3VU3C 5FROA 1K8AC 2CWYA 3PUGA 4F7UE 3PTRB 4JUYA 1W2BS 1S35A 2H7OA 3M4YA 4M7DE 4O4HE 3CCQA 2M67A 4L0RA 2JOYA 2DI4A 3I0QA 3E9FA 1KQ2A 1WJQA 2GK9A 4PJJA 2F5TX 1IAPA 3OYHA 1VQ8A 3URGA 4KT0E 2YLBA 4UVCB 4IE0A 1VQ7T 3EDVA 3JC6C 3LG7A 3QXEB 3GPLA 3MO8A 1I4K1 4X1IE 1MIVA 3ESLA 3AA0B 3P8HA 3JCMP 1YITT 5GMKe 2O01E 1M8VA 5GAOl 3VUBA 3CC7T 4U74A 4EDUA 4X20E 3JB9F 4TV8E 2MAMA 3RKYA 4XTUA 3KINB 1UX4A 3ZEHA 3CPWA 3L2QA 5GAN6 2C0SA 4OFZA 4GLKA 4M78B 5IN1A 5HK3A 3NTKA 1YD8G 2X0LB 1O3XA 3EUHA 5CK9A 2W0GA 5DLQE 5GAN8 4PLLA 2DJZA 4EYUA 1G8XA 4OB2B 4FT2A 4NL2A 2LOSA 1JJ2S 3GWHA 1U4QA 4C92F 1T98A 3UFEA 3RX6A 1KD1U 3PMTA 4X34A 2XUEA 3C4XA 5GAMj 2CGHA 2PVGB 2RB6A 4X9DA 3U3IA 2V7MA 2WMNA 1UB4A 5CKBA 3ZEFB 3SWNB 5F3JA 5JDQA 1HX8A 2LSIA 2EJFA 3OYEA 5AYFA 4M78G 2KMFA 4JLIA 2LSKA 4H9RC 4F7UA 2D0UA 1M1GA 5LJ3e 1P92A 2E8IA 4I4TE 2K5FA 4XTZA 3G71T 3K3OA 1S94A 4N78D 4CXWA 3QSUA 3I1AA 2YLCA 1RL2A 2F69A 1H3ZA 1YJWA 2KZ7B 2DK3A 4OB1B 4BJNA 2V26A 3HKSA 2LQ8A 5J3BA 1D1AA 5DQWA 1VQNA 2P9BA 1D0YA 4XTYA 1BKBA 5FU7B 4CI1B 2A3DA 2QA4A 3PE0A 4GOUA 1HS7A 2NTYA 2LT4A 2JRKA 3LFMA 1Y07A 5EK2A 4C8QF 1Q82U 3META 1ZHCA 2D5UA 2PFVA 2WBLA 3IBPA 5LA6E 2X68A 1BYMA 3HKBE 2GQVA 2DHRA 5HKCA 4MFRA 4J8OA 1UGRB 2EQJA 2EHOD 5LG4A 1H7CA 2VYTA 2CEAA 3NZPA 3ZJ2A 4OVAA 1VQ4T 4YLHA 2XDDA 2E5QA 2BVLA 3Q2MA 4ZI2C 3V8JA 3K8PC 3QO3A 4JJNK 4BAYB 4BACA 3INZA 1FMVA 5JDGA 2NW8A 4DA4A 2H3RA 4PFOA 3J80E 2QEXA 2DXCA 3CC4A 2E64A 3X20B 4GK0E 4P0BA 2A2FX 4X9CA 2YU1A 4ELZC 3HFOA 2X4XA 4XU3A 4M75B 4CI2B 2E41A 3WAKA 5LJ5h 3RKXA 4IE5A 4C8QD 2XAQB 4LDYA 5GMKj 2WM9A 2Y6XA 4L9IA 4WW0A 1HK9A 3QYGB 2NTXA 4AI6A 4PJMA 2L3LA 4A4EA 3RRWA 1VQMA 2LSYA 4FI5A 4H9OC 2LRQA 4PJOD 3CCMT 4E47A 4A4GA 4UEMA 2M9UA 4PJLA 3CQGB 2LOPA 2XASB 3ETUA 3ASKA 5GANe 4UELA 4U72A 1Y64B 2KMTA 5HAXA 5D6WA 3OB9A 1M1KU 2RD1A 3CPWS 2LQKA 5KX5E 4EMKC 5FXXA 1NPPA 2LX9A 2RK2A 3N2KE 4LD9K 4UVBB 3CPFA 5E0OA 2OAUA 3ZYKA 5DQVA 2VKOA 4E7HA 1YHQT 1Z0PA 3V7SA 4M75G 3R84B 3CBMA 2H3JA 1YKEB 3BK9A 3FBZA 5HY6A 5GAN7 3QJ6A 2DTHA 5FXVA 5LP6E 3FJPA 5I2MA 4J2CA 2BVMA 4JUVA 5LOVE 4C5HA 1AHJB 3O1HA 5C8YE 2PVDB 3QK6A 2E65A 3VHLA 4AKHA 4KUMB 4I55E 3LGFA 3J7Yq 1HTJF 2D6FA 1BI1A 4I43B 3EFRA 3C51A 3QZ5B 3BY7A 2VV5A 5L3EB 2YRVA 3CCVA 1UGQB 2DZCA 5KDMC 1R8OB 4MZPA 3N9LA 3KBUA 5LJ3j 5CKEA 5LL6S 2YHTA 3NTIA 1QW1A 3AVSA 4PJOE 3BW1A 2QA7A 4QQ6A 3ZFJA 2PVOB 2NP9A 3H6ZA 2O4XA 4PJNA 3PIOA 2RHZA 4ZS3A 1KHIA 3JCMW 2LT3A 2KWIB 4HCBA 2ZPEB 3X28B 3OQ5A 5HXHA 4G2AA 4M78F 4CI3B 2ZM2A 2ZCFB 4JS4A 3L09A 3Q1JA 3DLMA 1BR0A 2XAHB 5DJQC 2VKJA 2CKKA 2RJCA 3IF8B 4J83A 3WXMB 2LTOA 2UXXB 1BIBA 4TZ4C 5J39A 2JN0A 1WLXA 5IHYA 4AQFA 1JB0E 2LT1A 3C4SA 3R6NA 3J81E 5GAMh 2I2LA 4AXPA 1LNXA 1D0XA 4KBMB 4HEAA 3L3PA 1FMWA 3OSSC 3L2ZA 5IYZE 1M1FA 3V7CA 3N9PA 4B9WA 1OZ2A 4O5VA 4R55A 1D1BA 5FU7C 1VQ6A 4WF2A 4P0AA 4ZI3D 5KE2A 3OYNA 2XKOC 3OSVA 4E7IA 4IURA 5HK0A 3JCMd 2LM9A 2L8KA 3O4XE 2XQYA 5KE3A 4FT4A 2X4YA 4A54A 4E7ZA 2JUFA 4C92G 4IUQA 3F57A 5LJ5d 3OY9A 5HWYA 2D0QB 3EFSA 1G3WA 4QW2A 4L5GA 3N2OA 1MNDA 2L9QA 3C94A 3EAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT3 A;  4L5G A;  4MFR A;  4XAX B;  2LT4 A;  2LT1 A;  2EYQ A;  4ILU A;  2LQK A;  4KMC A;  4KBM B; 
#chains in the Genus database with same CATH topology
 1J1J A;  2CXF A;  3AB3 B;  4I0U A;  2JS2 A;  4QQD A;  5LHH B;  4BB7 A;  3CME T;  1UJ0 A;  2DL3 A;  2RA1 A;  4GYS A;  3CCE Q;  2GQI A;  5ETW A;  5FY1 A;  2CWO A;  4TN7 B;  2MF2 A;  3VS2 A;  5ABG A;  4FL6 A;  2HKN A;  2BBH A;  4HGA A;  3R6O A;  3M53 A;  3UDC A;  4WTO B;  2RQU A;  3NFC A;  4EMG A;  1FMK A;  2DL5 A;  4HWI B;  1RLP C;  4JRK A;  4DBH A;  4IRE A;  4EIW A;  1RAB B;  2O31 A;  2BKP A;  1GCP A;  1GFC A;  3EG3 A;  1CSK A;  3SDZ A;  2CP5 A;  1XQH A;  1NEB A;  3DJB A;  2V7K A;  2G3R A;  2RQR A;  4RCB A;  4XQ3 A;  2LQN A;  3FHN A;  4ZNX A;  3HA4 A;  2QQ9 A;  2F5K A;  2LP5 A;  2NUZ A;  2OAW A;  3JB9 H;  1H92 A;  3PTA A;  1SSF A;  2ZM8 A;  3OW2 S;  2NLU A;  3UUM A;  3HL8 A;  5L4H A;  3CCE T;  3PUX F;  1HG5 A;  3EAB A;  1KC8 C;  2L89 A;  4PKC C;  4M7A A;  3EG0 A;  2Z6E A;  4X1Y E;  3M58 A;  4BI8 B;  1WHG A;  1WPY A;  2ED0 A;  1FX7 A;  5LNK A;  4KUD K;  1EIF A;  5J26 A;  3AE1 A;  4N0A A;  3QC9 A;  3I9W A;  4DV5 T;  5CA0 E;  3FEO A;  2KSR A;  1ZA2 B;  2K57 A;  3L42 A;  4YTL A;  3OPC A;  5HEO A;  2J4G A;  4ANJ A;  2ZPI B;  4OF1 A;  3UAT A;  3CEY A;  4TV9 E;  3FIF A;  2VKN A;  5D6X A;  3RI5 A;  2EJ9 A;  3ZMV B;  3Q5D A;  4PFP A;  2OA5 A;  2X9X A;  2BS3 A;  4ZGE B;  3J9X 1;  4U33 A;  4WNK A;  1VQL A;  2K5B B;  2VGN A;  4LE9 A;  2WB5 A;  1VQO A;  1HNZ T;  1QVF A;  3UTK A;  3B5M A;  2X35 A;  3CCQ Q;  4PW8 A;  1LVK A;  4RTW A;  2EFI A;  3CCU A;  3P8C D;  4UF0 A;  1WXT A;  1JRI A;  1J3T A;  3QG1 A;  3FZK B;  2LEH A;  1PWT A;  1U1T A;  2FG0 A;  2QDL A;  1ZHI A;  2R6G F;  2ESW A;  3M54 A;  3AEF A;  3OBY A;  3H8Z A;  4B3S T;  1MMA A;  1OED A;  4JEH B;  4M7A B;  4HWF A;  5AQG B;  2RHY A;  2CPT A;  3PJA J;  1WDX A;  1WGS A;  2A36 A;  3HPW A;  4JYA T;  4E7S A;  2KQW A;  1OXZ A;  2KVQ G;  4ZGD B;  3CK6 A;  5AQQ B;  3CCR A;  3ZT5 A;  4CC2 A;  2DX1 A;  1SF9 A;  3ULR B;  3I35 A;  4DMV A;  3QDR B;  2YDQ A;  3ETV A;  3OYB A;  3CXC P;  4OB3 B;  3QUJ A;  4JV5 T;  1AWW A;  4HFI A;  1JNR A;  5KMG P;  3RIR A;  3O8V A;  4B9X A;  3CCQ T;  3MJX A;  1X6B A;  3BE3 A;  4ILA A;  2BUD A;  3BQK A;  2VL0 A;  3OYZ A;  4LFB T;  4N4H A;  4PNO A;  2MCN A;  3TLW A;  1XNI A;  2LJ1 A;  4A98 A;  5GAM d;  5GAO r;  4U2Z A;  1VQP T;  1VQ8 T;  4PK4 A;  5GAO p;  1KHC A;  1WXB A;  1WJR A;  4M75 D;  1Y71 A;  2A7Y A;  4FSS A;  3L2R A;  3TLT A;  4FIB A;  4C5G A;  4UF0 B;  2NWB A;  3ZN0 B;  2MBG A;  1LJO A;  1N8R R;  1VQ5 Q;  2KAF A;  3C4W A;  2V8K A;  4E7L A;  3SRZ A;  1WA7 A;  3QB5 K;  2BBJ A;  1WYX A;  3Q9D A;  1XNQ T;  1NBE B;  3X25 B;  4ZS2 A;  4BY6 C;  4HFC A;  3AHU A;  2JPF A;  2AKL A;  2QYZ A;  1WRD A;  2EKO A;  2H3E B;  2DZ9 A;  2XQ8 A;  5JRC A;  1F1B B;  2LE8 A;  5F8P A;  3N2G E;  2DRM A;  2UUC T;  3T9N A;  2XTL A;  2MTQ A;  1IBL T;  4DV3 T;  4AFZ C;  4MDW A;  4D6W A;  1OUL A;  3EGX A;  3FZH B;  4K0U A;  2OLT A;  4MMK A;  2DLR A;  4EMK B;  2ZLY A;  2ECZ A;  1HR0 T;  3EGD B;  4RTX A;  2JJ9 A;  3IEE A;  1X2K A;  3M59 A;  1YKH B;  5LJ3 h;  3AED A;  3S3M A;  1W6X A;  4KH1 B;  3CX7 B;  1SRL A;  1YP5 A;  2KSS A;  2HSP A;  2Y8D A;  5KYY A;  1QVG P;  3JSC A;  4EMH A;  2VL8 A;  2W66 A;  2J1D G;  5GJW B;  4MAL A;  3AAA B;  3JCM J;  2LKH A;  4DMW A;  2Y4X A;  3M0R A;  2ACZ A;  4AG2 C;  1MHN A;  1DU2 A;  3RRC A;  1VQ5 A;  2BS4 A;  1J5E T;  4DBR A;  5EK3 A;  3G4S Q;  3CMA Q;  3I56 A;  2G6F X;  4LUD A;  1YIT A;  2VXF A;  5LB7 B;  2JVV A;  1N36 T;  2V8I A;  1YJ9 A;  2XJ7 A;  2WP9 A;  4BJM A;  2FHD A;  3A8L B;  2V5C A;  3UU4 A;  2VK9 A;  3DP7 A;  1I5O B;  2KDS A;  5JDH A;  2ABL A;  3UU6 A;  5LGT B;  4EIK A;  2PUO B;  5LCY A;  2WSF E;  3P4W A;  3HTR A;  2FRW A;  1UTI A;  4A4H A;  3PIP A;  2CYZ B;  3A7M A;  4ZHQ E;  4M75 E;  5I11 A;  2QQB A;  4O8S A;  2D0N A;  3EGX B;  2ZZD A;  3N5B B;  4AQF C;  4ORZ A;  3A8Y C;  1AJ3 A;  3JCM X;  1K4U S;  2ES0 A;  2W62 A;  4O4L E;  1BR2 A;  1BCM A;  3TQ7 P;  5GAN 3;  1EFN A;  4MLK A;  4XU0 A;  1IRE B;  3PUW F;  4HVW A;  2DWG A;  3P4R A;  2ZPB B;  1UFF A;  3UWN A;  3TVT A;  3A8M B;  3IQL A;  4XAX B;  3E2U A;  2B76 A;  2Q9Q A;  3RQW A;  1D0Z A;  4A5X A;  2QTX A;  4WYV A;  5GMK m;  3JB9 D;  1PRL C;  2DA9 A;  4M77 A;  5GAN 4;  3CIR A;  3EGU A;  1KC8 U;  5AQP B;  4AKR B;  4Y28 E;  3G4S A;  3CMA A;  3LH0 A;  2XI9 A;  3HHT B;  3LWI A;  4UV9 B;  4MML A;  1KD1 R;  3RC8 A;  2EIF A;  3TLU A;  1VCT A;  3JCM f;  1VQN Q;  2EQK A;  2M1H A;  5LXT E;  3VKG A;  3BFM A;  2DNX A;  4TVR A;  2HKQ B;  2WY2 A;  4M7D A;  2QA4 Q;  4F17 A;  4ZGJ B;  5LJ5 f;  1RLQ C;  3PJA A;  3RGL A;  1KG1 A;  3L8R A;  2WAU A;  2DXT A;  4O4I E;  4N4G A;  1NLP C;  3EHZ A;  2CBJ A;  4UXN B;  1OEB A;  2EYQ A;  4N4I A;  5KYU A;  2M16 A;  4KMC A;  3UUL A;  5AQJ B;  2DKG A;  5C0M A;  1BI2 A;  1YJW T;  3RUX A;  4VUB A;  2P4T A;  1Z9Q A;  2HL5 C;  4C0G A;  3UPU A;  3RIA A;  4EYY R;  3EFO A;  3JC6 D;  1W09 A;  3RKO A;  2ZPF B;  4KUI A;  1GCQ A;  1JQQ A;  2ZGW A;  3FXD B;  4PLI A;  3UT1 A;  4MZT A;  1TUC A;  4C92 D;  4ZTJ A;  2XQA A;  2JNG A;  1VQN T;  2QI2 A;  3GA8 A;  3C95 A;  1OI1 A;  3RYH E;  2P84 A;  4DO0 A;  2MPK A;  3WI3 A;  2DTI A;  1M30 A;  2K2V A;  1KIK A;  1UEC A;  5DLO A;  3RMQ A;  2KWH A;  2QA4 T;  2YOE A;  4HWC A;  1E7O A;  4M77 B;  3FDR A;  4IIJ E;  2RF0 A;  2BKO A;  3DB4 A;  2SEM A;  1NEN A;  1OX8 A;  2KRO A;  3OYX A;  2AK5 A;  3KV4 A;  4PJO C;  1ZEE A;  4HFE A;  5JVD E;  5KXJ A;  1I5L A;  4F7U B;  2V8S V;  1QVF S;  3AA6 B;  4M7D B;  4EEB A;  2QEX Q;  1K0X A;  3RYI E;  3JCM b;  5CKF A;  2F2X A;  2C06 A;  2X3X D;  5IAY A;  2K5I A;  2JTE A;  4Z02 A;  3VS3 A;  5DM7 R;  1ZUU A;  2RQT A;  4AKI A;  4MDX A;  1K8A U;  5GAN h;  4UVA B;  2WDV A;  3AEB A;  3FXE B;  3EFO B;  1IGU A;  2D9T A;  1B34 A;  4D8D A;  2HH7 A;  3E9G A;  3KV5 A;  2XSB A;  1R0B G;  4QX7 B;  2COY A;  3QNU A;  1WZO A;  2CSI A;  1HSQ A;  2ROT A;  3I55 A;  4GYR A;  4RMO A;  4QWN B;  1RAG B;  4LNP A;  2VVK A;  3TKL B;  4YSY A;  2JIW A;  1K0S A;  2PU9 B;  1Q82 R;  4IIM A;  1M62 A;  2J05 A;  3DKM A;  2N1G A;  2K9A A;  2V5D A;  5CQY A;  2QEX T;  3QHS A;  4RKU E;  4M7A C;  4ADZ A;  2XPK A;  1HX1 B;  1PNJ A;  4OMQ A;  3CC4 T;  1NJI C;  1K8A R;  4EGW A;  3AAE B;  2BZY A;  4NPP A;  2DET A;  3K3N A;  1W2B P;  3C98 B;  2E12 A;  5CQX A;  2NW7 A;  4KGV B;  3SFD A;  5BR8 T;  4N0A C;  1XNR T;  5CFB A;  1XDP A;  3CQC B;  4WBO A;  1YQ4 A;  1YIJ A;  4LMJ A;  5M9O A;  5FMN A;  2E3H A;  4C92 E;  5HXE A;  2W10 A;  4DOW A;  4F7U G;  4AMC A;  1VOM A;  1WYB A;  2FJA A;  2N2N A;  3IA3 A;  5CO7 A;  1U1S A;  1LCK A;  3C64 A;  3PNW C;  2YN6 A;  3N9O A;  1D3B A;  2GTO A;  5LJ3 d;  3G6E A;  1S72 Q;  2KT8 A;  3Q5E A;  3EI0 A;  1UEB A;  3NHN A;  1KSW A;  3EG2 A;  1BI0 A;  4DVD A;  2O2O A;  2RMO A;  1VQM T;  3OYF A;  4E6R A;  3FBL A;  3PGG A;  3EDU A;  1XOV A;  2W00 A;  1B34 B;  4DUY T;  4HE8 A;  3ER0 A;  4ELY C;  4NOY A;  2V7L A;  4KP3 C;  1UGP B;  1XMO T;  1YJN A;  1OWA A;  4DR7 T;  2NUP A;  3KUF A;  3VUZ A;  5CGM A;  1N27 A;  2E9X D;  3CCS A;  4CZZ B;  2DYB A;  3MHX A;  3TRE A;  2HD0 A;  1OED C;  1XTD A;  2DXU A;  4F04 B;  3FB9 A;  2V8J A;  3VJP A;  3EG9 A;  1X9B A;  5LMN T;  2C0O A;  4M7A F;  1K73 C;  2DBK A;  3H0I A;  2CH4 A;  3OYL A;  3E08 A;  5AQK B;  1IRX A;  5AQU B;  3SFM A;  4RTV A;  2LNV A;  2HN2 A;  4YHH T;  2CT3 A;  5GAM f;  3CCV Q;  3OW2 A;  1LRZ A;  1BR4 A;  2IIU A;  3QPH A;  2KT1 A;  4X1V A;  3KFV A;  3S6W A;  4Y91 A;  1S72 A;  3TSW A;  3BDL A;  2E3I A;  4WZX A;  1QWF A;  1UUE A;  4IL9 A;  2GFA A;  1D3B B;  1HFA A;  2MOX A;  2LHR A;  2K7A A;  3LK3 B;  2FBW A;  4XZC A;  3VKI A;  4KHP T;  3HP9 A;  1C6V X;  3M55 A;  1MMN A;  4O2B E;  4PNI A;  5LHG B;  1JJ2 P;  3RPU A;  1HJD A;  1SKU B;  1M90 C;  2JQ9 A;  4DID B;  3FJ5 A;  5JRE A;  1NEG A;  4J6Y A;  5CAI A;  2E5L T;  4FCY A;  4J9G A;  2J62 A;  2EQI A;  2XID A;  2UXN B;  2MWP A;  3A1P A;  5LYJ E;  3TCJ A;  4KX6 A;  2IG0 A;  2X51 A;  3FZM B;  4DR3 T;  1PSE A;  4OP0 A;  3HSB A;  3CCV T;  1DJ7 B;  2COW A;  4J5Y A;  4J9E A;  3PV0 F;  2H7V C;  1N9S A;  3MEW A;  3HR0 A;  3ONX A;  2GFU A;  4C8Q E;  5C3J A;  2LKG A;  3LBX A;  1JU5 C;  3CC2 Q;  2IW5 B;  2KYM A;  4XBF B;  3U23 A;  2E6Z A;  4LML A;  2UXD T;  4HT9 A;  4XU2 A;  2UUB T;  1QKX A;  2CSQ A;  1E6H A;  3OYM A;  4GKK T;  2YIN A;  4QVD A;  4NUV A;  4O4J E;  2G0U A;  3ZSS A;  5LHI B;  2FEI A;  3ZMU B;  1ZX6 A;  1NAF A;  2J7I A;  2LC4 A;  5GAO q;  2W61 A;  1OU9 A;  3DTO A;  3CD6 Q;  1M9S A;  2K3W A;  4UR9 A;  3CCJ Q;  1D1C A;  3CPZ A;  4UV8 B;  4JBW F;  3SOL A;  1X27 A;  2DIL A;  2FYK A;  2JW4 A;  2Y4Y A;  2GCX A;  3PUY F;  2COZ A;  2R5A A;  4JZ4 A;  1SE7 A;  5TAO A;  2HBP A;  4TWD A;  2CZ1 B;  3MP1 A;  5JDL A;  5AQH B;  4ZOL E;  1CUN A;  4J9H A;  2YUO A;  2FJD A;  2XMF A;  4II1 A;  1O9S A;  2YU2 A;  1ZUY A;  2XY8 B;  3OYC A;  2MIO A;  2QDY B;  2XD0 A;  1GBQ A;  1BU1 A;  3CCL Q;  1VQ6 Q;  2LJ0 A;  3ZC1 A;  1YI2 A;  3CC2 A;  4BY6 B;  3O1I A;  4YFS A;  4QKN A;  2ZM6 T;  4CN4 A;  3MAC A;  3JAD A;  3LSV A;  2Y48 B;  2HPJ A;  1IJ5 A;  1MMD A;  3LLR A;  3QBY A;  4BE0 A;  1SUM B;  3WVE B;  2RJF A;  2VAS A;  1N32 T;  3M65 A;  1ZSG A;  1X69 A;  4CXX A;  4Q5W A;  2X4W A;  2C5I T;  2KY9 A;  3N9N A;  1N33 T;  3CQX C;  3CD6 A;  2L8D A;  3VYG A;  3RIF A;  2L5Q A;  3CCJ A;  3T1Y T;  5GAN d;  1QCN A;  2FZG B;  4GLM A;  5HXC A;  5H6Q B;  4RTT A;  3PDY A;  1M4Z A;  2ZPH B;  3QB5 A;  5L3F B;  1KF6 A;  3ZCJ A;  4JI0 T;  2HBW A;  4KRT A;  2EHO A;  2Q9Q C;  2IUB A;  2O4X B;  1VQ6 T;  1KFZ A;  3ANW A;  4M77 C;  3M5A A;  4BDZ A;  3CKD A;  2QVA A;  1FIO A;  2WSS V;  4LMK A;  5GON E;  5CIU A;  2L3S A;  3OYG A;  3LJC A;  1V29 B;  1NJI U;  1Q86 C;  3HRU A;  5GAN 5;  4UIG A;  1BIA A;  2AZV A;  4MHC A;  5L47 A;  2K6D A;  1ZKE A;  3CCL A;  4HFH A;  2I0M A;  4DR1 T;  1VRB A;  3ZJ1 A;  2M51 A;  3M56 A;  3ZN1 B;  2H8H A;  2HAX A;  3VS6 A;  4M7D C;  2CP0 A;  1W1F A;  1TTH B;  5DAB A;  1X6G A;  2CH4 W;  2LJL A;  3FZF B;  2K4Y A;  2P0P A;  3LW5 E;  4M78 D;  2AT1 B;  5FRM A;  2V1R A;  3N9M A;  1NE8 A;  2RQW A;  3CML A;  5I21 A;  3SS1 A;  4J7F A;  3L2V A;  2EGE A;  3GMI A;  2L0A A;  4FW1 A;  3UA6 A;  1TUD A;  1L0V A;  1W4S A;  3CX6 B;  2RJE A;  1MV0 B;  4ATO A;  2OTJ A;  1YWO A;  1QQJ A;  1NJI R;  2RP4 A;  5ABH A;  2E5V A;  4L59 A;  2NUT A;  3LGL A;  2B8A A;  3JCM V;  2RPN A;  2DEQ A;  4AQG A;  1GRI A;  1GCQ C;  3PFS A;  1PM3 A;  3KVA A;  2CP2 A;  4C8Q A;  8ATC B;  5GAN 2;  4OB0 B;  1WJS A;  2NOX A;  2LCC A;  1T0J A;  4V2S A;  3PUS A;  3GNG A;  2WSE E;  3WVD B;  1VIF A;  4JJB A;  2VWA A;  4DR5 T;  1VQK A;  2V1Q A;  1M5Q 1;  2RI2 A;  4U2Y A;  2CDT A;  3NVO A;  5C6S A;  3ANW B;  2ED1 A;  4O6J A;  4NS5 A;  1BB9 A;  4M77 F;  6AT1 B;  3I9Y A;  1AEY A;  4JRI A;  2CE7 A;  4PJO A;  2DL7 A;  2E9X A;  2RM4 A;  1H8K A;  2VUB A;  2BG9 A;  4C5I A;  5KCO A;  1K73 U;  4DOV A;  5HEJ A;  3H9N A;  5FRN A;  1XJW B;  4TUY E;  5IHN A;  3JCM c;  3QYH B;  4F7U F;  3GP8 A;  1OV3 A;  4BA9 A;  4EZ4 A;  4M7D F;  1TS9 A;  1GXI E;  4DV2 T;  2IC9 A;  3NBX X;  4ASK A;  4C5E A;  4IUT A;  1T3L A;  4OMP A;  3HRS A;  3KV6 A;  3HKE E;  5GAN j;  4JS5 A;  3I9Q A;  1I1J A;  2LDM A;  1KNZ A;  2GF7 A;  3AE7 A;  4IDZ A;  4DBQ A;  2EQM A;  1NZ9 A;  3ZYM A;  3TSZ A;  4OK0 A;  3GLX A;  3CPW P;  4AKG A;  1U5S A;  1QCO A;  1VQL Q;  1M90 U;  3VS7 A;  4HCZ A;  3TLV A;  1VQO Q;  4JI3 T;  5A0L A;  3VS1 A;  3CME A;  1MIY A;  3MA9 A;  4M78 E;  3UA7 A;  3CCU Q;  1Q95 G;  1A0N B;  5KCH A;  3LK2 B;  3JB9 I;  3RLF F;  1TU0 B;  5A1L A;  3IHR A;  4JI6 T;  1TOV A;  3AE4 A;  3RES A;  5IXB A;  2HCK A;  3L2U A;  2JMC A;  1AWX A;  3PU3 A;  1VQ9 A;  1SHG A;  1VCS A;  4HVV A;  3MP8 A;  2DYI A;  4PJO B;  2OTL A;  3PUA A;  2RH2 A;  3F70 A;  1AD5 A;  2DVE A;  3I5S A;  8AT1 B;  1UCU A;  5LJ3 f;  1M90 R;  5ECA A;  4GBQ A;  4K11 A;  2LCL A;  3CCR Q;  5L3B B;  1N6A A;  4YSX A;  1U5P A;  2KT9 A;  2V7I A;  2VVN A;  4OYK A;  3RKG A;  2DD5 A;  3RIU C;  2AKK A;  3OYI A;  1JNZ A;  2DL4 A;  4HFB A;  4H63 H;  3JCM g;  2CZ6 B;  4DEX A;  1IBM T;  2X66 A;  3KVB A;  1VQO T;  2A9U A;  3VR8 A;  1HCI A;  5JR9 C;  1PD1 A;  4G63 A;  4CQI A;  5JH7 E;  2YK0 A;  2JXB A;  2EJG A;  4QVZ A;  3PVQ A;  3GF5 A;  5LJ5 g;  3ZMT B;  2JMK A;  1OOT A;  2R58 A;  3JAF A;  4XU1 A;  1SA0 E;  2NYS A;  3HFN A;  1SPK A;  2EW3 A;  4BI3 A;  3DLL A;  4OMF B;  4RG2 A;  2EQU A;  3MKD A;  1MNE A;  2MYS A;  1V76 A;  1TXQ A;  3KFW X;  3PUQ A;  1UUS A;  1M2O A;  1N9R A;  2GBQ A;  2RO0 A;  4ILU A;  5BMV E;  4HTE A;  4IDQ A;  3A5X A;  1LVF A;  5D6Y A;  3CCR T;  2WQY A;  4ZN3 A;  3M4G A;  3RF1 A;  4IDN A;  4F14 A;  2ZMA A;  5ABF A;  3CWZ B;  3E22 E;  4OHF A;  4KGX B;  4H63 V;  4WCI A;  5CA1 E;  5GAO m;  2CCQ A;  5J2U E;  3AAI A;  4B3R T;  2ZM0 A;  3V5U A;  2KNB B;  4Z8A A;  3OYY A;  2XDP A;  2VKH A;  3EVY A;  4R56 A;  4ME7 A;  3LK4 2;  1SHF A;  1UDL A;  4GIW A;  3O5Z A;  3QWY A;  4IUU A;  2WAC A;  4A56 A;  2VQE T;  1OPK A;  2JZ2 A;  2RJD A;  4IUV A;  5FL0 A;  2HQX A;  3ZLI A;  2K3B A;  3OYA A;  4LF8 T;  3VRY A;  2CZ0 B;  4JI8 T;  3H3A A;  1JBM A;  1G3T A;  5L23 A;  2KND A;  1Q86 U;  3NMZ C;  1UHC A;  3ZST A;  3PVL A;  4B6X A;  2CXD A;  1R0C B;  2LLY A;  5FLX E;  3I56 Q;  4Z88 A;  2K48 A;  5HCK A;  1YIT Q;  4OGE A;  4ZI7 E;  2DRK A;  4BE1 A;  1YJ9 Q;  1YW0 A;  1R8I A;  1OED B;  3QWX X;  2YUQ A;  3ZPO A;  4M7A G;  3M9Q A;  3SWH A;  3UUB A;  3RKW A;  1Y96 A;  1UX5 A;  4M78 A;  5HXR A;  1RI9 A;  2BTT A;  2J6F A;  4ZZB A;  3CBP A;  4I50 E;  1Q86 R;  4YTP A;  1PSF A;  4HVU A;  1VQP A;  2EKH A;  2A3L A;  2V1D B;  5FWB A;  4IT4 A;  1KK7 A;  3H37 A;  1AVZ C;  3A8O B;  3OS0 A;  2DIQ A;  4H9N C;  1VQ5 T;  1VUB A;  2DTO A;  2CLY B;  2E5K A;  3RMS A;  1G73 A;  4C0F A;  3N5L A;  2Y90 A;  1FYN A;  4C92 C;  3I56 T;  3FRN A;  2DXB A;  5CVI A;  2H89 A;  4RTU A;  5FU6 C;  3V8L A;  2HQE A;  1YJ9 T;  1VQ7 A;  1HXD A;  4EAH A;  1NEK A;  2OX7 A;  2NR4 A;  2CZ7 B;  2EBP A;  5KH6 A;  4WBN E;  1VIE A;  3LDQ B;  5M4Y A;  3AEE A;  5HCJ A;  1WYC A;  5A0G A;  4KGZ B;  3NRY A;  3SWN A;  4ILB A;  2AHJ B;  3CQT A;  3CC7 A;  5H6R B;  3UQ7 A;  1UUR A;  3CX8 B;  5GAN f;  4FSX A;  2VVS A;  5JRC B;  2KYB A;  1Y96 B;  2CMR A;  3ZMZ B;  3RYF E;  2CUB A;  2XM1 A;  5JTG A;  1Z8U A;  1FXX A;  2EYW A;  2HDA A;  3X26 B;  1MGQ A;  1WNL A;  2YT6 A;  4COF A;  3G4S T;  3CMA T;  2P0K A;  4P5N A;  3OA6 A;  2E1H A;  4DV1 T;  5KYY B;  1JXM A;  4A53 A;  4HFV A;  5GAM g;  2EHO C;  1M1K C;  4Z91 A;  2GTJ A;  2E70 A;  2WDQ A;  2DWK A;  3GN5 A;  3EAM A;  3MEA A;  1ABO A;  2VUR A;  2L3R A;  1O75 A;  1HF8 A;  4RCC A;  5L3D B;  3GIB A;  1AZE A;  1QSD A;  4H9P C;  4LD6 A;  2SPC A;  4DR6 T;  1R77 A;  1QMC A;  2X0H A;  2E2A A;  2WMO A;  2FVU A;  1I8F A;  4MBQ A;  4LF4 T;  5EC7 A;  3KXT A;  2ODU A;  3OW2 P;  3RR6 A;  2WWU A;  4QXB B;  4EV6 A;  1KC8 R;  3VU7 H;  1Q7Y C;  2P0Q A;  4ILC A;  3PU8 A;  3M0T A;  3FLG A;  1T3S A;  1E7P A;  1G3Y A;  2YUN A;  2HZY A;  3OMG A;  2A72 A;  4QX8 B;  4C0D B;  2XQ6 A;  5FXW A;  2XAF B;  1Y7X A;  3M57 A;  1GFD A;  2N9D A;  1WR0 A;  4C8Q C;  2J6K A;  3GNF B;  4QH5 A;  3HKD E;  1WHH A;  2KEA A;  2PJQ A;  3JB9 J;  3C4Z A;  1YNZ A;  1K76 A;  1W9R A;  4IE6 A;  4B6M A;  3I55 Q;  1SHZ C;  1YWP A;  2Q9Q B;  2XIC A;  4AIS A;  1YFN A;  3HI2 A;  3JCM Q;  4YHJ A;  5L4E A;  3CXC A;  1ZBX A;  3GN5 B;  1WHJ A;  5AQR B;  3G71 A;  4GK5 E;  5HYA A;  4KI0 F;  2MMP A;  2E9X C;  3OBW A;  4NL3 A;  2BG9 C;  1C1A A;  1TH7 A;  4IIO A;  5EG2 A;  2XQ3 A;  2ACX A;  2LSG A;  4ERR A;  1CKA A;  1YIJ Q;  4OYJ A;  1VYU A;  3VS0 A;  1KQS S;  4IL4 A;  4Z8X A;  1H64 1;  2LCS A;  1WFD A;  1FEW A;  3P8D A;  1QP2 A;  4J7I A;  1NYF A;  4FJO A;  2WWV A;  5KYU B;  2HQH A;  2FL7 A;  1Y01 A;  2DAQ A;  5GMK l;  3I55 T;  1VQ4 Q;  3G6E Q;  4CRI A;  2FZK B;  1AT1 B;  3M0P A;  3NGP A;  4L6V 5;  3KBT A;  5AQO B;  2FRY A;  1QUU A;  3VRA A;  3PMI A;  2X9H A;  4IHJ E;  5ABE A;  3JRZ A;  1QCF A;  2LHN A;  4BI4 A;  2HMA A;  3MCA B;  4M75 A;  2VB6 A;  1Q81 C;  3SD4 A;  5GMK i;  1YJN Q;  1YIJ T;  3OMC A;  5JDM A;  4HKE A;  3CCS Q;  4K0K T;  4M77 G;  5A0D A;  3UT5 E;  4IDO A;  3CBO A;  2D9D A;  4HT8 A;  2CP6 A;  4PL6 A;  2DPP B;  2JMH A;  2VKD A;  4DV7 T;  4PJO F;  4V1A v;  1QVG A;  1I81 A;  3KV9 A;  1K9M C;  4AFS C;  3G6E T;  4IDP A;  2CS7 A;  2CP3 A;  4LF7 T;  3RIU A;  3UFG A;  3V5S A;  3NTH A;  4M7D G;  4GY5 A;  2X9W A;  2IVW A;  4E7K A;  4EPC A;  3Q5W A;  4OGC A;  1VQ4 A;  4XTX A;  3AVR A;  3B57 A;  5JR9 A;  4YJ2 E;  2UXC T;  4MZM A;  3ZYL A;  1NM7 A;  2X9Y A;  1LOJ A;  3EHQ A;  1YJN T;  2YSQ A;  2UU9 T;  2NW9 A;  4JI4 T;  4LDV A;  4UC4 A;  4JRP A;  3LX7 A;  2QGS A;  4XK8 E;  3CCS T;  4KH0 B;  3JCM h;  4IE7 A;  3UUX B;  5FP3 A;  2M6B A;  4LF9 T;  2KBT A;  2WSC E;  4E7J A;  5CKD A;  3AE6 A;  1BBZ A;  2VC8 A;  3OYD A;  1S1N A;  4QVC A;  3V7R A;  3BDU A;  5JDN A;  2LRK A;  5J2T E;  2X4J A;  1OZ3 A;  3A8H B;  3S3N A;  4X1K E;  5I2S A;  1S72 T;  4QHO A;  2I59 A;  3ONL C;  1WX6 A;  5L8R E;  1MIW A;  1YHQ Q;  2D0T A;  3ZC0 A;  1KQ1 A;  1QVP A;  4TX5 A;  5L3G B;  2VGM A;  4LFA T;  4P09 A;  1ZA1 B;  5FY0 A;  2RHX A;  1MMG A;  3SB2 A;  2BIV A;  1M27 C;  4EZH A;  4J9C A;  1ARK A;  3WAJ A;  2CLY C;  4GKJ T;  3RER A;  3ZMS B;  5JR9 B;  5FXZ A;  1QP3 A;  4JDS A;  2X67 A;  3CCM A;  3OYJ A;  4U3C A;  3F2E A;  2RQV A;  2K9G A;  4H9Q C;  5C2T A;  3AA7 B;  2JTM A;  3F31 A;  2DIG A;  3MEV A;  2JMA A;  2C0I A;  4LDW A;  2W2U A;  4DV0 T;  4HN9 A;  4J6X A;  1RAA B;  3E0Z A;  4KUL A;  2NUP B;  4XTW A;  1RAF B;  3I0O A;  3OS1 A;  2YDR A;  3L39 A;  1WQW A;  1ZV4 X;  3RBB B;  2WS3 A;  3KDS E;  2IC6 A;  1G3S A;  2VXE A;  4A4K A;  3BQL A;  5AQI B;  4DND A;  4F8H A;  1E1H B;  3RYC E;  4ZI2 D;  3EG9 B;  3ABV A;  4JRQ A;  1YI2 Q;  1YHQ A;  1K9A A;  2P4R A;  4ZI3 C;  5ADX L;  4Y92 A;  3BQI A;  1IJ6 A;  4ZEY A;  4M78 C;  2RA2 A;  1Q7Y U;  2DVJ A;  4M7A D;  3OS5 A;  2KK4 A;  4FYX B;  3JCM e;  2XQ7 A;  1SSH A;  5LBQ B;  2RI3 A;  3GBQ A;  4A4F A;  2RI5 A;  4JLE A;  5A2Q E;  1YCY A;  1X01 A;  4JEU B;  1M8M A;  2W4X A;  1X75 C;  1B07 A;  1RI0 A;  1PRM C;  1T8B A;  5LJ5 e;  4DEY A;  4IKF A;  4C0Z A;  3QII A;  5LJ3 g;  3AE8 A;  4AKL A;  4C91 A;  3T1H T;  4C92 A;  5AQF B;  2FJB A;  2D8J A;  1UK5 A;  4B3T T;  3AE3 A;  1Q7Y R;  1I6Z A;  4OMM A;  1YI2 T;  3AA1 B;  4U7Y A;  3CC2 T;  3NRX A;  5LGN B;  1I0C A;  3D0T A;  5CB4 E;  1PHT A;  2RHI A;  3RH3 A;  5HWX A;  1RAE B;  2DCF A;  3QDF A;  4NXN T;  5FW9 A;  2LM2 A;  1RAI B;  2X0Y A;  2DFU A;  3H41 A;  4DBF A;  4TNW A;  2MPX C;  3SHW A;  5GAO n;  3B13 A;  2D2S A;  4F6R C;  3UQ4 A;  5F5W A;  1ZSZ A;  3L2W A;  1ZQ1 A;  3SWN C;  4A63 B;  1B7T A;  4QXH B;  4BDY A;  4JLG A;  1NPR A;  1UJY A;  1JEG A;  3P50 A;  2XDB A;  2CBI A;  3LBX B;  2CRE A;  1M3C A;  3CCJ T;  3CD6 T;  1OYX A;  5DY9 A;  2QXF A;  1LKX A;  3CXC S;  1NWM X;  5IHI A;  2K5L A;  2K24 A;  3HKC E;  4ZZC A;  2E6N A;  2KRM A;  2QQR A;  4C0D C;  2OTJ Q;  1ZOY A;  4FYY B;  3PT9 A;  4LDX A;  2FPD A;  4X62 T;  4CI0 C;  4IUP A;  1E2A A;  2MWO A;  1QVF P;  1IBK T;  3RQU A;  2EAY A;  5KYX A;  1W2B A;  3UUN A;  3W15 B;  4CC3 A;  4PK5 A;  5FKY A;  2NWM A;  1OQK A;  2QAZ A;  4XTV A;  1I94 T;  2YEV C;  3CCL T;  4C92 B;  4NUU A;  1Q81 U;  4JI7 T;  5FU6 B;  1VQK Q;  2KE9 A;  4YSZ A;  3A5Z B;  4LDU A;  1N8R C;  3VYH B;  4M7A E;  2BKD N;  3O1J A;  4FU6 A;  4HA8 A;  2E10 A;  4YJ3 E;  3OTO T;  3AEG A;  3N9Q A;  5LGU B;  4DV6 T;  1WLP B;  3JB9 G;  1GL5 A;  2OV9 A;  2PG8 A;  2V7J A;  4RG8 A;  1QLB A;  1AOJ A;  3LWH A;  4QH4 A;  2L3Q A;  2OTJ T;  1K9M U;  4OX9 T;  1BR1 A;  2HNI A;  2R57 A;  2C5J A;  1IXD A;  2W63 A;  2EWN A;  5HXS A;  3H0H A;  4O2A E;  2B1E A;  3AE2 A;  1Q81 R;  1IHV A;  4J9D A;  2PUK B;  3O9X A;  3ME9 A;  5CR2 A;  2FB7 A;  4ISS A;  2XHE B;  4DQ2 A;  3Q5X A;  4ZTF A;  4B3M T;  3OS2 A;  2XAJ B;  3L1A A;  3V8K A;  3DB3 A;  3GOX A;  2GNC A;  1VQK T;  2RHU A;  5CCA A;  4PK6 A;  4AQY T;  1QVG S;  2KI7 A;  3D7S B;  5KYX B;  1T7S A;  5EK4 A;  2AIR B;  5IT9 E;  5CKH A;  3VV0 A;  1OPL A;  5EZY E;  4LF5 T;  2XG8 D;  2EHO B;  3CME Q;  4PAG A;  1AWJ A;  1PKT A;  1W70 A;  2QQA A;  2ZAE A;  3P8B B;  4QXC B;  4CC4 B;  4EOZ B;  2DD4 A;  5IUX A;  1IZ6 A;  1BK2 A;  2EGA A;  3OJA A;  2LNH B;  3JAM E;  2WZH A;  3C12 A;  5AQM B;  5FY7 A;  2WU5 A;  1UGS B;  2RN8 A;  4BUG A;  3P7I A;  1NG2 A;  5L3C B;  2MOZ A;  3QKJ A;  2CP7 A;  1VQ9 Q;  2K3X A;  2K2M A;  3H0F A;  2OTL Q;  2KXC A;  4HKA A;  3U78 A;  3ZT6 A;  2BS2 A;  4J9F A;  1VYT A;  1PCX A;  2PTK A;  1JJ2 A;  2BZB A;  2PBI A;  3G06 A;  4IST A;  2EYZ A;  5LBM A;  4X64 T;  2H88 A;  1FJG T;  2FPE A;  4BD3 A;  2XM2 A;  3OKQ A;  3S3O A;  2NUT B;  4J6W A;  3LH5 A;  1K73 R;  4HCK A;  5FNV E;  1EZ3 A;  3KBG A;  5GAN g;  5LG3 A;  5GAM e;  3S4U A;  1TSF A;  2A0F B;  4C8Q B;  3QZ9 B;  3P4Q A;  5AFU L;  3X24 B;  2C5K T;  2XK0 A;  2ODV A;  2R5M A;  3M0S A;  3MEU A;  1VQ9 T;  2MAW A;  1N5Z A;  4M75 C;  3JAE A;  1KNR A;  3NKZ A;  1YBY A;  2OTL T;  4CN6 A;  3QUI A;  5J1G A;  2JS0 A;  4LN2 A;  4ESR A;  3OBV E;  5LJN A;  1KD1 C;  3K3Q C;  1IHW A;  2QQS A;  5KYW A;  4NIQ A;  2KLQ A;  4HWH A;  2KRN A;  5JDF A;  4IGU A;  4OMN A;  3ZBD A;  3ZCI A;  3OYK A;  2Q9Q D;  2E9X B;  4C90 A;  2BG9 B;  3HRT A;  4M77 D;  2CHN A;  5L2L A;  4QQG A;  3J7A F;  2JQQ A;  2L3P A;  3QJY A;  2CM0 A;  3P4P A;  4ZN1 A;  2K3Y A;  1VQL T;  2AE9 A;  5IWA T;  4EB6 E;  2JT4 A;  1U8R A;  1Y57 A;  3HL6 A;  1XMQ T;  2LQW A;  1X79 A;  4FM4 B;  3CCU T;  4X65 T;  2IIM A;  4M7D D;  2LMJ A;  3VS4 A;  3CCE A;  2IHR 1;  3VRZ A;  2IAK A;  3PUZ F;  2A08 A;  2O88 A;  1WQ7 A;  1X6O A;  2JTF A;  1FWZ A;  2XU8 A;  3THK A;  4JZ3 A;  1PD0 A;  2JQH A;  2CA5 A;  3RC3 A;  2DF6 A;  1KFY A;  2A37 A;  4C8Q G;  2DO3 A;  1KQS A;  5LJ5 j;  2PQW A;  2HPL A;  5D7U A;  3MP6 A;  4X66 T;  4M75 F;  4CXY A;  4HCC A;  3PUR A;  3G7Z A;  2M0O A;  3REA B;  5LJM A;  5KYW B;  3UU5 A;  2KR3 A;  1UE9 A;  5GMK h;  4M1P A;  4P1N A;  5AQL B;  5FYM A;  2XHC A;  3LYI A;  1IZN B;  4PJO G;  3NZQ A;  4X5T A;  2VQF T;  1U06 A;  2LSJ A;  3MXZ A;  2QGF B;  2KIN B;  4EXT A;  2MI6 A;  1US7 B;  2PNI A;  3FC3 A;  1M3A A;  4BE2 A;  1B3Q A;  4DR4 T;  3T8O A;  1VQP Q;  1VQ8 Q;  4QH1 A;  4H9S E;  4HXJ A;  4IE4 A;  2C0T A;  2CXL A;  3TEE A;  4RTZ A;  2BDE A;  3FB2 A;  2RK1 A;  2PTF A;  1BI3 A;  1V9D A;  1HYO A;  2W0Z A;  2FJE A;  1W0B A;  3VKH A;  1ABQ A;  1WR6 A;  3MPU B;  3MK7 C;  2YRD A;  4TWF A;  5AQV B;  3QOF A;  2ZPG B;  3A8G B;  4EMK A;  3E1S A;  2LVM A;  3C50 A;  2M02 A;  3TU4 K;  4M77 E;  1G5V A;  5JQG E;  2KXP B;  1VQ7 Q;  3EGD A;  1N8R U;  1HG2 A;  3CVR A;  4TWH A;  1Q82 C;  2XAG B;  3MZK B;  3E19 A;  1EX4 A;  2HEQ A;  3VU3 C;  3REB B;  1NLO C;  5FRO A;  1K8A C;  2CWY A;  3PUG A;  4F7U E;  3PTR B;  4JUY A;  2DBM A;  1S35 A;  1W2B S;  2H7O A;  2DER A;  3M4Y A;  2EYY A;  1UGO A;  4M7D E;  2F2V A;  4O4H E;  3TLS A;  3CCQ A;  1HD3 A;  1H3H A;  2M67 A;  4L0R A;  5ABF B;  2DI4 A;  2JOY A;  2KGT A;  4FYV B;  2A28 A;  5CJ5 A;  4R0K A;  2XSA A;  3I0Q A;  3E9F A;  3CC7 Q;  1KQ2 A;  1WJQ A;  4NXM T;  2GK9 A;  4PJJ A;  2F5T X;  4ZXL A;  1IAP A;  3NWI A;  3OYH A;  4YTN A;  1M3B A;  4KT0 E;  3URG A;  1VQ8 A;  2YLB A;  5FVL A;  4UVC B;  4Q25 A;  4RUG A;  4IE0 A;  2EYX A;  1VQ7 T;  4F16 A;  3EDV A;  3FZL B;  2BZ8 A;  3JC6 C;  3LG7 A;  2RNA A;  3QXE B;  3MO8 A;  3GPL A;  5FVK A;  1I4K 1;  1ZUK A;  1I07 A;  4X1I E;  1MIV A;  2CT4 A;  3ESL A;  3AA0 B;  2LZ6 B;  3P8H A;  3JCM P;  1YIT T;  5I22 A;  5GMK e;  2CRB A;  2O01 E;  1M8V A;  5GAO l;  3VUB A;  3CC7 T;  1X2Q A;  4U74 A;  1X43 A;  4EDU A;  4X20 E;  3JB9 F;  4TV8 E;  1QLY A;  1WIE A;  3ZT7 A;  2MAM A;  3RKY A;  2YDS A;  1IO6 A;  1ZSZ C;  3OVU A;  3UF4 A;  4XTU A;  3KIN B;  2WDR A;  2WU2 A;  2YXY A;  1UX4 A;  3ZEH A;  3CPW A;  3L2Q A;  2MK5 A;  5GAN 6;  2C0S A;  4FW2 A;  4OFZ A;  4GLK A;  4M78 B;  1E6G A;  5IN1 A;  5HK3 A;  3EG1 A;  5AQN B;  1YD8 G;  2X0L B;  2YWW A;  3NTK A;  1JO8 A;  1O3X A;  3K1S A;  3EUH A;  5CK9 A;  2W0G A;  2O9V A;  5DLQ E;  4D8K A;  5GAN 8;  4PLL A;  1HNX T;  7AT1 B;  2DJZ A;  4EYU A;  1C0M A;  2EVR A;  1G8X A;  4OB2 B;  4FT2 A;  5IH2 A;  4NL2 A;  2LOS A;  2F4V T;  1JJ2 S;  2UUA T;  3GWH A;  1U4Q A;  4C92 F;  5J0Z A;  1T98 A;  1KEY A;  3UFE A;  3RX6 A;  1RAC B;  1KD1 U;  3PMT A;  4X34 A;  2WCA A;  2XUE A;  3C4X A;  1WFW A;  4J9B A;  2W67 A;  2ROL A;  5GAM j;  2DM1 A;  3JCF A;  2CGH A;  3AT1 B;  2PVG B;  3RNJ A;  4HWD A;  3G71 Q;  2RB6 A;  2BZX A;  4X9D A;  3U3I A;  2V7M A;  1YJW Q;  2WMN A;  1K1Z A;  4YXD A;  1UB4 A;  4LXC A;  1KNP A;  5CKB A;  4YT0 A;  2QYW A;  3ZEF B;  2F2W A;  3SWN B;  3EH1 A;  3JV3 A;  1V1C A;  5F3J A;  5JDQ A;  1HX8 A;  1WCR A;  2JQK A;  2LSI A;  4YTM A;  2EJF A;  3OYE A;  3M0Q A;  5AYF A;  4M78 G;  2KMF A;  3M3Z B;  2LSK A;  4H9R C;  4JLI A;  4F7U A;  2D0U A;  1M1G A;  5LJ3 e;  1M7K A;  1P92 A;  2E8I A;  3VR9 A;  4I4T E;  4TNV A;  2K5F A;  1IB8 A;  5AT1 B;  1Z9Z A;  4XTZ A;  1YXR A;  3G71 T;  4RTY A;  1VA7 A;  3K3O A;  1YCS B;  1S94 A;  1N34 T;  2X3W D;  4N78 D;  4CXW A;  3QSU A;  2BE7 D;  2ATC B;  3I1A A;  2IPO B;  2YLC A;  1RL2 A;  1YQ3 A;  2FUP A;  1UHF A;  2F69 A;  3VS5 A;  1H3Z A;  4Z90 A;  1WHL A;  1YJW A;  2KZ7 B;  2DK3 A;  4OB1 B;  1GBR A;  5HEH A;  2V26 A;  4BJN A;  2HL3 A;  5IHK A;  3HKS A;  2LQ8 A;  1D09 B;  1XDO A;  5J3B A;  1D1A A;  4JI1 T;  1WXU A;  2CUD A;  5DQW A;  1VQN A;  2P9B A;  1D0Y A;  1KJW A;  2OI3 A;  4AG1 C;  4XTY A;  1BKB A;  1ACM B;  4JPB W;  5FU7 B;  4CI1 B;  2A3D A;  2B86 A;  1QWE A;  2QA4 A;  3PE0 A;  2BKN A;  2QTV A;  4GOU A;  1HS7 A;  2NTY A;  1QKW A;  2LT4 A;  2JRK A;  3LFM A;  1Y07 A;  2AZS A;  5EK2 A;  3CC4 Q;  4C8Q F;  1IGQ A;  4LF6 T;  1Q82 U;  3MET A;  1ZHC A;  2D5U A;  2PFV A;  2WBL A;  3IBP A;  1EZZ B;  1ZP0 A;  5LA6 E;  2X68 A;  1BYM A;  3HKB E;  2GQV A;  2DHR A;  1PG5 B;  2HHH T;  3AEA A;  2LX7 A;  4MFR A;  1T0H A;  1CKB A;  1UGR B;  2EQJ A;  1BCO A;  4J8O A;  5HKC A;  2EHO D;  5LG4 A;  2FPF A;  1H7C A;  2DEU A;  4OMO A;  2VYT A;  2CEA A;  3NZP A;  3UU8 A;  3ZJ2 A;  1WHM A;  4YLH A;  4OVA A;  1VQ4 T;  2XDD A;  2E5Q A;  2BVL A;  3Q2M A;  4ZI2 C;  3V8J A;  4AIU A;  3M0U A;  3K8P C;  4QKU A;  3QO3 A;  5FWC A;  1VQM Q;  4JJN K;  2EGC A;  4BAY B;  4KHZ F;  2JM9 A;  2FO0 A;  2GGR A;  2FZC B;  2YKS A;  4BAC A;  4PFZ A;  3INZ A;  1FMV A;  5JDG A;  2NW8 A;  4DA4 A;  1U3O A;  2H3R A;  4PFO A;  3J80 E;  2QEX A;  2OJ2 A;  2DXC A;  3CC4 A;  5IXF A;  2E64 A;  3CCM Q;  1TWB A;  2JM8 A;  3X20 B;  2DMO A;  4GK0 E;  1J5W A;  4P0B A;  4DV4 T;  2A2F X;  4X9C A;  2YU1 A;  4ELZ C;  2WZI A;  3HFO A;  2I6H A;  2X4X A;  4XU3 A;  3A98 A;  4CI2 B;  4M75 B;  2E41 A;  1ZLM A;  3WAK A;  4E2F B;  3RKX A;  4IE5 A;  2HSE B;  5LJ5 h;  4C8Q D;  4LFC T;  5HEU A;  4A97 A;  2XAQ B;  4LDY A;  1XZY A;  1OU8 A;  2Z0W A;  5GMK j;  2WM9 A;  3P4S A;  2J6O A;  2Y6X A;  4L9I A;  4WW0 A;  1HK9 A;  3QYG B;  2VWF A;  2NTX A;  4AI6 A;  2HN1 A;  4PJM A;  4QT7 A;  3RDV A;  2L3L A;  2YUP A;  1UG1 A;  2E4H A;  4EED A;  4J9I A;  4A4E A;  3RRW A;  1VQM A;  2LSY A;  4FI5 A;  4H9O C;  4AFQ C;  2LRQ A;  2QAS A;  4PJO D;  3CCM T;  1TG0 A;  4E47 A;  1VYV A;  2XZE A;  1RAH B;  4UEM A;  4A4G A;  2J47 A;  2M9U A;  4PJL A;  3CQG B;  2LOP A;  2XAS B;  3ETU A;  3ASK A;  4DR2 T;  5GAN e;  2IDO B;  4UEL A;  4U72 A;  2V6Y A;  1Y64 B;  1ZBJ A;  5HAX A;  2KMT A;  3OB9 A;  5D6W A;  1M1K U;  2RD1 A;  3CPW S;  2LQK A;  5KX5 E;  4JJD A;  4EMK C;  4CC7 A;  2KXD A;  5FXX A;  1NPP A;  2D8H A;  2LX9 A;  2RK2 A;  3N2K E;  4LD9 K;  4UVB B;  2BE9 B;  2XQ5 A;  2D1X A;  2I0N A;  3CPF A;  5E0O A;  2IML A;  3ZYK A;  2OAU A;  5DQV A;  2VKO A;  4E7H A;  1YHQ T;  1Z0P A;  2QGG A;  3PUV F;  3V7S A;  2M0Y A;  4M75 G;  2EPD A;  4AFU C;  3R84 B;  3CBM A;  3G1J A;  2H3J A;  1YKE B;  3BK9 A;  3FBZ A;  5HY6 A;  5GAN 7;  2CHO A;  3QJ6 A;  1M1K R;  2DTH A;  5AQS B;  5FXV A;  5LP6 E;  3FJP A;  5I2M A;  4J2C A;  2BVM A;  4JUV A;  5LOV E;  1RUW A;  4C5H A;  1AHJ B;  3AXJ A;  3O1H A;  1SG5 A;  5C8Y E;  2PVD B;  4AT1 B;  2AXD S;  3QK6 A;  3X1D A;  2M6I A;  3VHL A;  2E65 A;  4AKH A;  4KUM B;  4I55 E;  1YN8 A;  3LGF A;  1LPL A;  3J7Y q;  1HTJ F;  2D6F A;  1BI1 A;  4I43 B;  1MUZ A;  2PZ1 A;  3EFR A;  3C51 A;  3QZ5 B;  3BY7 A;  2VV5 A;  5L3E B;  1NYG A;  2V6Y B;  2YRV A;  2O9S A;  1RAD B;  3CCV A;  1UGQ B;  2DZC A;  5KDM C;  1R8O B;  1G2B A;  4MZP A;  2KRS A;  3N9L A;  1AZG B;  3ONJ A;  5KYN A;  3KBU A;  2RPA A;  5LJ3 j;  5GJV B;  5CKE A;  5LL6 S;  2YHT A;  3NTI A;  1PC0 A;  1QW1 A;  5HCM A;  1WHK A;  4YY3 T;  3AVS A;  2LJ3 A;  5HEG A;  5FL1 A;  4Z89 A;  4PJO E;  3BW1 A;  2BG9 E;  2QA7 A;  4QQ6 A;  1WI7 A;  3ZFJ A;  2QRX A;  1MV3 A;  2PVO B;  2NP9 A;  3H6Z A;  2O4X A;  3ZKR A;  4PJN A;  3PIO A;  2F1L A;  2YRC A;  3EH2 A;  1XWM A;  9ATC B;  2L2P A;  2RHZ A;  4ZS3 A;  1KHI A;  2J06 A;  1W0A A;  3JCM W;  1M2V A;  2LT3 A;  2KWI B;  4HCB A;  2ZPE B;  3X28 B;  3H3M A;  3OQ5 A;  3UU3 A;  5HXH A;  4G2A A;  4DUZ T;  1G83 A;  4M78 F;  4CI3 B;  2ZM2 A;  2DJQ A;  2ZCF B;  3EHR A;  3AXJ B;  4JS4 A;  1SEM A;  3L09 A;  3Q1J A;  3DLM A;  3SEM A;  1BR0 A;  2XAH B;  4M4Z A;  5DJQ C;  2VKJ A;  2CKK A;  2DE0 X;  2RJC A;  1SRM A;  3IF8 B;  4U7I A;  4J83 A;  3WXM B;  1KQS P;  2LTO A;  2UXX B;  1BIB A;  4TZ4 C;  5J39 A;  1PKS A;  1WLX A;  2JN0 A;  5IHY A;  1HNW T;  4AQF A;  1JB0 E;  2LT1 A;  1CHU A;  4U31 A;  3C4S A;  3R6N A;  3J81 E;  1Y0M A;  5GAM h;  2I2L A;  4AXP A;  4JI2 T;  1LNX A;  1D0X A;  4OML A;  4KBM B;  4HEA A;  3L3P A;  1FMW A;  3AEC A;  3OSS C;  3L2Z A;  1ZSZ B;  2DNU A;  1JXO A;  1UGV A;  5IYZ E;  1M1F A;  3V7C A;  2QG9 B;  3N9P A;  3RHW A;  4B9W A;  1OZ2 A;  1M2V B;  4O5V A;  2DLP A;  4R55 A;  1D1B A;  5FU7 C;  4LUE A;  1VQ6 A;  4WF2 A;  4P0A A;  1TUG B;  4HFD A;  2UXB T;  4ZI3 D;  4FYW B;  5KE2 A;  3OYN A;  2XKO C;  3OSV A;  4E7I A;  4IUR A;  1K9M R;  5HK0 A;  2QK0 A;  2ENM A;  2K79 A;  3AE5 A;  2LM9 A;  2L8K A;  3JCM d;  3I5R A;  3O4X E;  2XQY A;  5KE3 A;  3VRB A;  4FT4 A;  2X4Y A;  4A54 A;  2V6X A;  4E7Z A;  2JUF A;  4C92 G;  2XQ4 A;  5AQT B;  4IUQ A;  3F57 A;  5LMU T;  5LJ5 d;  3OY9 A;  1OED E;  5HWY A;  2D0Q B;  1OX9 A;  3EFS A;  1G3W A;  2XQ9 A;  4QW2 A;  2DL8 A;  1GQE A;  1T72 A;  4L5G A;  3C0C A;  2SRC A;  3N2O A;  3NPF A;  1MND A;  2DL1 A;  4CN1 A;  4JI5 T;  2L9Q A;  3ZL7 C;  2YDL A;  3C94 A;  3AE9 A;  2LRL A;  4JJC A;  3EAE A;  1AWO A;  3SFE A; 
#chains in the Genus database with same CATH homology
 2CXF A;  3AB3 B;  4QQD A;  5LHH B;  4BB7 A;  3CME T;  2RA1 A;  4GYS A;  5ETW A;  5FY1 A;  2CWO A;  4TN7 B;  2MF2 A;  4FL6 A;  4HGA A;  3R6O A;  3M53 A;  3UDC A;  3NFC A;  4EMG A;  4JRK A;  4EIW A;  3SDZ A;  1XQH A;  3DJB A;  2V7K A;  2G3R A;  4RCB A;  4XQ3 A;  3FHN A;  3HA4 A;  2QQ9 A;  2F5K A;  3JB9 H;  3PTA A;  1SSF A;  2ZM8 A;  3OW2 S;  2NLU A;  3UUM A;  3HL8 A;  3CCE T;  1HG5 A;  1KC8 C;  2L89 A;  4PKC C;  4M7A A;  2Z6E A;  4X1Y E;  3M58 A;  4BI8 B;  1WPY A;  1FX7 A;  5LNK A;  4KUD K;  1EIF A;  5J26 A;  4N0A A;  3QC9 A;  3I9W A;  5CA0 E;  3FEO A;  2K57 A;  3L42 A;  4YTL A;  4ANJ A;  2ZPI B;  4OF1 A;  3CEY A;  4TV9 E;  3FIF A;  5D6X A;  2EJ9 A;  3ZMV B;  4PFP A;  2OA5 A;  2X9X A;  4ZGE B;  3J9X 1;  4WNK A;  1VQL A;  2K5B B;  2VGN A;  1VQO A;  1QVF A;  3UTK A;  2X35 A;  4PW8 A;  1LVK A;  3CCU A;  2EFI A;  3P8C D;  4UF0 A;  1JRI A;  3QG1 A;  2LEH A;  1U1T A;  1ZHI A;  3M54 A;  3OBY A;  3H8Z A;  1MMA A;  4JEH B;  4M7A B;  2RHY A;  1WGS A;  3HPW A;  4E7S A;  2KQW A;  1OXZ A;  2KVQ G;  4ZGD B;  3CCR A;  4DMV A;  3QDR B;  3OYB A;  3ETV A;  4OB3 B;  3QUJ A;  5KMG P;  3RIR A;  3O8V A;  4B9X A;  3CCQ T;  3MJX A;  2BUD A;  3BQK A;  3OYZ A;  4PNO A;  4N4H A;  1XNI A;  5GAM d;  5GAO r;  1VQP T;  1VQ8 T;  4PK4 A;  5GAO p;  1KHC A;  1WJR A;  4M75 D;  1Y71 A;  2A7Y A;  3L2R A;  4FIB A;  4C5G A;  4UF0 B;  2NWB A;  3ZN0 B;  2MBG A;  1LJO A;  2KAF A;  3C4W A;  2V8K A;  4E7L A;  3SRZ A;  3Q9D A;  3X25 B;  4ZS2 A;  4BY6 C;  3AHU A;  2JPF A;  1WRD A;  2EKO A;  2DZ9 A;  5JRC A;  2LE8 A;  5F8P A;  3N2G E;  3T9N A;  2XTL A;  2MTQ A;  4MDW A;  4D6W A;  4K0U A;  4MMK A;  4EMK B;  2DLR A;  2ZLY A;  2JJ9 A;  3IEE A;  3M59 A;  1YKH B;  5LJ3 h;  3S3M A;  3CX7 B;  2KSS A;  2Y8D A;  3JSC A;  4EMH A;  2VL8 A;  2J1D G;  4MAL A;  3AAA B;  3JCM J;  4DMW A;  2Y4X A;  1MHN A;  3RRC A;  1VQ5 A;  4DBR A;  5EK3 A;  3I56 A;  1YIT A;  2VXF A;  2JVV A;  2V8I A;  1YJ9 A;  4BJM A;  2FHD A;  3A8L B;  2VK9 A;  3DP7 A;  2KDS A;  5JDH A;  5LGT B;  2PUO B;  5LCY A;  2WSF E;  4A4H A;  3PIP A;  2CYZ B;  4ZHQ E;  4M75 E;  2QQB A;  4O8S A;  2ZZD A;  3N5B B;  4AQF C;  1AJ3 A;  3JCM X;  2ES0 A;  2W62 A;  4O4L E;  1BR2 A;  5GAN 3;  4MLK A;  4XU0 A;  1IRE B;  2DWG A;  2ZPB B;  3UWN A;  3A8M B;  4XAX B;  2Q9Q A;  5GMK m;  1D0Z A;  2QTX A;  3JB9 D;  4M77 A;  5GAN 4;  1KC8 U;  4AKR B;  4Y28 E;  3G4S A;  3CMA A;  3LH0 A;  2XI9 A;  3HHT B;  3LWI A;  4UV9 B;  4MML A;  3RC8 A;  2EIF A;  3JCM f;  2EQK A;  2M1H A;  5LXT E;  3VKG A;  3BFM A;  2DNX A;  4TVR A;  4M7D A;  4ZGJ B;  5LJ5 f;  1KG1 A;  2WAU A;  2DXT A;  4O4I E;  4N4G A;  2EYQ A;  4UXN B;  4N4I A;  5C0M A;  2M16 A;  4KMC A;  3UUL A;  1YJW T;  2DKG A;  1BI2 A;  3RUX A;  4VUB A;  2P4T A;  3UPU A;  4C0G A;  4EYY R;  3JC6 D;  3RKO A;  2ZPF B;  4KUI A;  4PLI A;  2ZGW A;  3FXD B;  3UT1 A;  4MZT A;  4C92 D;  4ZTJ A;  2JNG A;  1VQN T;  2QI2 A;  3GA8 A;  3C95 A;  1OI1 A;  3RYH E;  4DO0 A;  3WI3 A;  2DTI A;  2K2V A;  2QA4 T;  5DLO A;  3RMQ A;  2KWH A;  4M77 B;  3FDR A;  4IIJ E;  3DB4 A;  3OYX A;  3KV4 A;  4PJO C;  1ZEE A;  5JVD E;  1I5L A;  4F7U B;  1QVF S;  3AA6 B;  4M7D B;  3RYI E;  3JCM b;  5CKF A;  2C06 A;  5IAY A;  2K5I A;  4Z02 A;  5DM7 R;  4AKI A;  4MDX A;  1K8A U;  5GAN h;  4UVA B;  3FXE B;  2D9T A;  1B34 A;  2HH7 A;  3E9G A;  3KV5 A;  4QX7 B;  3I55 A;  4GYR A;  4RMO A;  4QWN B;  3TKL B;  2PU9 B;  3DKM A;  2N1G A;  2K9A A;  5CQY A;  2QEX T;  3QHS A;  4RKU E;  4M7A C;  4ADZ A;  1NJI C;  3CC4 T;  3AAE B;  3K3N A;  3C98 B;  2E12 A;  5CQX A;  2NW7 A;  4N0A C;  3CQC B;  4WBO A;  1YIJ A;  5M9O A;  5FMN A;  4C92 E;  5HXE A;  4DOW A;  4F7U G;  1VOM A;  1WYB A;  2N2N A;  5CO7 A;  1U1S A;  3C64 A;  3PNW C;  3N9O A;  1D3B A;  3G6E A;  5LJ3 d;  1UEB A;  1BI0 A;  4DVD A;  1VQM T;  3OYF A;  3FBL A;  3PGG A;  3EDU A;  1XOV A;  2W00 A;  1B34 B;  4HE8 A;  3ER0 A;  4ELY C;  4NOY A;  2V7L A;  4KP3 C;  1UGP B;  1YJN A;  1OWA A;  3KUF A;  3VUZ A;  1N27 A;  2E9X D;  3CCS A;  4CZZ B;  3MHX A;  3TRE A;  2HD0 A;  2DXU A;  1XTD A;  3FB9 A;  2V8J A;  3VJP A;  4M7A F;  1K73 C;  3OYL A;  3E08 A;  3SFM A;  2LNV A;  5GAM f;  3OW2 A;  1LRZ A;  1BR4 A;  3QPH A;  3S6W A;  4Y91 A;  1S72 A;  3BDL A;  2GFA A;  1D3B B;  1HFA A;  2LHR A;  3LK3 B;  4XZC A;  3VKI A;  3HP9 A;  3M55 A;  1MMN A;  4O2B E;  4PNI A;  5LHG B;  3RPU A;  1M90 C;  5JRE A;  4J6Y A;  5CAI A;  2XID A;  2UXN B;  2MWP A;  5LYJ E;  3TCJ A;  2IG0 A;  2X51 A;  4OP0 A;  1PSE A;  3HSB A;  3CCV T;  1DJ7 B;  4J5Y A;  2H7V C;  1N9S A;  3MEW A;  3HR0 A;  3ONX A;  2GFU A;  4C8Q E;  3LBX A;  2IW5 B;  4XBF B;  2E6Z A;  4HT9 A;  4XU2 A;  3OYM A;  2YIN A;  4QVD A;  4NUV A;  4O4J E;  2G0U A;  5LHI B;  3ZMU B;  2LC4 A;  1NAF A;  5GAO q;  2W61 A;  3DTO A;  1M9S A;  1D1C A;  3CPZ A;  4UV8 B;  3SOL A;  2FYK A;  2Y4Y A;  2GCX A;  2R5A A;  5TAO A;  2HBP A;  2CZ1 B;  3MP1 A;  5JDL A;  4ZOL E;  1CUN A;  4II1 A;  1O9S A;  2YU2 A;  3OYC A;  2QDY B;  2XD0 A;  3ZC1 A;  1YI2 A;  3CC2 A;  4BY6 B;  3O1I A;  4YFS A;  4QKN A;  3MAC A;  2Y48 B;  2HPJ A;  1IJ5 A;  1MMD A;  3LLR A;  3QBY A;  4BE0 A;  3WVE B;  2RJF A;  2VAS A;  3M65 A;  4CXX A;  4Q5W A;  2X4W A;  2C5I T;  2KY9 A;  3N9N A;  3CQX C;  3CD6 A;  2L8D A;  3VYG A;  2L5Q A;  3CCJ A;  5GAN d;  5HXC A;  5H6Q B;  3PDY A;  1M4Z A;  2ZPH B;  5L3F B;  3ZCJ A;  2EHO A;  2Q9Q C;  2O4X B;  1VQ6 T;  3ANW A;  4M77 C;  3M5A A;  4BDZ A;  3CKD A;  1FIO A;  2WSS V;  5GON E;  5CIU A;  3OYG A;  3LJC A;  1V29 B;  1NJI U;  1Q86 C;  3HRU A;  5GAN 5;  4UIG A;  1BIA A;  4MHC A;  1ZKE A;  3CCL A;  1VRB A;  3ZJ1 A;  3M56 A;  3ZN1 B;  2HAX A;  4M7D C;  3LW5 E;  5DAB A;  2K4Y A;  5FRM A;  2LJL A;  4M78 D;  2P0P A;  3N9M A;  1NE8 A;  5I21 A;  3CML A;  3SS1 A;  4J7F A;  3L2V A;  3GMI A;  1W4S A;  3CX6 B;  2RJE A;  4ATO A;  2OTJ A;  2RP4 A;  4L59 A;  3LGL A;  2B8A A;  3JCM V;  2DEQ A;  4AQG A;  3PFS A;  3KVA A;  4C8Q A;  5GAN 2;  4OB0 B;  1WJS A;  2NOX A;  2LCC A;  4V2S A;  3PUS A;  3GNG A;  2WSE E;  3WVD B;  1VIF A;  2VWA A;  1VQK A;  1M5Q 1;  2RI2 A;  5C6S A;  3ANW B;  4O6J A;  4NS5 A;  4M77 F;  3I9Y A;  4JRI A;  2CE7 A;  4PJO A;  5KCO A;  2E9X A;  2RM4 A;  2VUB A;  4C5I A;  1K73 U;  4DOV A;  5FRN A;  4TUY E;  3JCM c;  3QYH B;  4F7U F;  3GP8 A;  4BA9 A;  4EZ4 A;  4M7D F;  1GXI E;  2IC9 A;  3NBX X;  4ASK A;  4C5E A;  4IUT A;  3HRS A;  3KV6 A;  3HKE E;  5GAN j;  4JS5 A;  2LDM A;  1KNZ A;  2GF7 A;  4IDZ A;  2EQM A;  4DBQ A;  1NZ9 A;  3ZYM A;  4OK0 A;  3GLX A;  4AKG A;  1M90 U;  4HCZ A;  5A0L A;  3CME A;  1MIY A;  3MA9 A;  4M78 E;  5KCH A;  3LK2 B;  3JB9 I;  5A1L A;  3IHR A;  3RES A;  3L2U A;  3PU3 A;  1VQ9 A;  3MP8 A;  4PJO B;  2OTL A;  3PUA A;  2RH2 A;  3F70 A;  2DVE A;  1UCU A;  5LJ3 f;  2LCL A;  5L3B B;  1N6A A;  1U5P A;  2KT9 A;  2V7I A;  2DD5 A;  4OYK A;  3OYI A;  4H63 H;  3JCM g;  2CZ6 B;  2X66 A;  3KVB A;  1VQO T;  1HCI A;  5JR9 C;  4G63 A;  4CQI A;  5JH7 E;  2YK0 A;  2EJG A;  4QVZ A;  5LJ5 g;  3GF5 A;  3ZMT B;  2JMK A;  2R58 A;  4XU1 A;  1SA0 E;  3HFN A;  4BI3 A;  3DLL A;  4OMF B;  4RG2 A;  2EQU A;  3MKD A;  1MNE A;  2MYS A;  3KFW X;  3PUQ A;  1N9R A;  2RO0 A;  4ILU A;  5BMV E;  4HTE A;  3A5X A;  1LVF A;  5D6Y A;  3CCR T;  4ZN3 A;  3M4G A;  2ZMA A;  3CWZ B;  3E22 E;  4OHF A;  4H63 V;  5CA1 E;  5GAO m;  2CCQ A;  5J2U E;  3AAI A;  2ZM0 A;  3V5U A;  3OYY A;  2XDP A;  2VKH A;  3EVY A;  4R56 A;  4ME7 A;  3LK4 2;  4GIW A;  4IUU A;  2WAC A;  4A56 A;  2JZ2 A;  2RJD A;  4IUV A;  2HQX A;  3ZLI A;  3OYA A;  2CZ0 B;  3H3A A;  1JBM A;  1G3T A;  2KND A;  1Q86 U;  4B6X A;  2CXD A;  5FLX E;  2K48 A;  4OGE A;  4ZI7 E;  4BE1 A;  1YW0 A;  3ZPO A;  4M7A G;  3M9Q A;  3SWH A;  3RKW A;  1Y96 A;  1UX5 A;  4M78 A;  5HXR A;  3CBP A;  4I50 E;  1PSF A;  1VQP A;  2A3L A;  2V1D B;  1KK7 A;  3H37 A;  3A8O B;  3OS0 A;  2DIQ A;  4H9N C;  1VQ5 T;  1VUB A;  2DTO A;  2CLY B;  3RMS A;  1G73 A;  4C0F A;  3N5L A;  2Y90 A;  3I56 T;  4C92 C;  3FRN A;  2DXB A;  5CVI A;  5FU6 C;  1YJ9 T;  3V8L A;  2HQE A;  1VQ7 A;  1HXD A;  4EAH A;  2CZ7 B;  5KH6 A;  4WBN E;  1VIE A;  5M4Y A;  1WYC A;  5A0G A;  3NRY A;  3SWN A;  2AHJ B;  3CC7 A;  5H6R B;  3CX8 B;  5GAN f;  4FSX A;  5JRC B;  1Y96 B;  2CMR A;  3ZMZ B;  3RYF E;  1FXX A;  3X26 B;  1MGQ A;  1WNL A;  3G4S T;  3CMA T;  2P0K A;  4P5N A;  3OA6 A;  2E1H A;  4A53 A;  4HFV A;  5GAM g;  2EHO C;  1M1K C;  2E70 A;  2DWK A;  3GN5 A;  3MEA A;  2L3R A;  1O75 A;  1HF8 A;  4RCC A;  5L3D B;  3GIB A;  1QSD A;  4H9P C;  4LD6 A;  2SPC A;  2WMO A;  2FVU A;  1I8F A;  4MBQ A;  3KXT A;  2ODU A;  2WWU A;  4QXB B;  3VU7 H;  1Q7Y C;  2P0Q A;  3PU8 A;  3FLG A;  1G3Y A;  3OMG A;  2A72 A;  4QX8 B;  4C0D B;  5FXW A;  2XAF B;  1Y7X A;  3M57 A;  2N9D A;  4C8Q C;  3GNF B;  3HKD E;  2PJQ A;  3JB9 J;  3C4Z A;  4IE6 A;  1SHZ C;  2Q9Q B;  2XIC A;  3HI2 A;  3JCM Q;  4YHJ A;  3CXC A;  1ZBX A;  3GN5 B;  3G71 A;  4GK5 E;  5HYA A;  2MMP A;  2E9X C;  3OBW A;  4NL3 A;  1TH7 A;  5EG2 A;  2ACX A;  2LSG A;  4ERR A;  4OYJ A;  1KQS S;  4Z8X A;  1H64 1;  1FEW A;  3P8D A;  1QP2 A;  4J7I A;  4FJO A;  2FL7 A;  2DAQ A;  5GMK l;  3I55 T;  4CRI A;  4L6V 5;  3KBT A;  1QUU A;  3PMI A;  2X9H A;  4IHJ E;  3JRZ A;  2LHN A;  4BI4 A;  3MCA B;  4M75 A;  2VB6 A;  1Q81 C;  3SD4 A;  5GMK i;  1YIJ T;  3OMC A;  5JDM A;  4HKE A;  4M77 G;  5A0D A;  3UT5 E;  3CBO A;  4HT8 A;  4PL6 A;  2DPP B;  2JMH A;  2VKD A;  4PJO F;  4V1A v;  1QVG A;  1I81 A;  3KV9 A;  1K9M C;  3G6E T;  2CS7 A;  3V5S A;  3NTH A;  4M7D G;  4GY5 A;  2X9W A;  2IVW A;  4E7K A;  4EPC A;  3Q5W A;  4OGC A;  1VQ4 A;  4XTX A;  3AVR A;  3B57 A;  5JR9 A;  4YJ2 E;  4MZM A;  3ZYL A;  2X9Y A;  1LOJ A;  1YJN T;  2NW9 A;  4LDV A;  4UC4 A;  4JRP A;  3LX7 A;  2QGS A;  4XK8 E;  3CCS T;  3JCM h;  4IE7 A;  3UUX B;  5FP3 A;  2WSC E;  4E7J A;  5CKD A;  2VC8 A;  3OYD A;  4QVC A;  3V7R A;  3BDU A;  5JDN A;  5J2T E;  2X4J A;  1OZ3 A;  3A8H B;  3S3N A;  4X1K E;  5I2S A;  1S72 T;  4QHO A;  2I59 A;  5L8R E;  1MIW A;  2D0T A;  3ZC0 A;  1KQ1 A;  1QVP A;  4TX5 A;  5L3G B;  2VGM A;  4P09 A;  5FY0 A;  2RHX A;  1MMG A;  3SB2 A;  2BIV A;  4EZH A;  3WAJ A;  2CLY C;  3RER A;  3ZMS B;  5JR9 B;  5FXZ A;  1QP3 A;  4JDS A;  2X67 A;  3CCM A;  3OYJ A;  3F2E A;  4H9Q C;  3AA7 B;  2JTM A;  3F31 A;  2DIG A;  3MEV A;  4LDW A;  4HN9 A;  4J6X A;  3E0Z A;  4KUL A;  4XTW A;  3I0O A;  3OS1 A;  1WQW A;  1ZV4 X;  3KDS E;  2IC6 A;  1G3S A;  2VXE A;  4A4K A;  3BQL A;  4DND A;  1E1H B;  3RYC E;  4ZI2 D;  4JRQ A;  1YHQ A;  4ZI3 C;  5ADX L;  3BQI A;  1IJ6 A;  4M78 C;  2RA2 A;  1Q7Y U;  4M7A D;  3OS5 A;  2KK4 A;  3JCM e;  5LBQ B;  2RI3 A;  4A4F A;  2RI5 A;  4JLE A;  5A2Q E;  1YCY A;  1X01 A;  4JEU B;  1X75 C;  1RI0 A;  5LJ5 e;  4IKF A;  4C0Z A;  3QII A;  5LJ3 g;  4AKL A;  4C91 A;  4C92 A;  1YI2 T;  3AA1 B;  3CC2 T;  3NRX A;  5LGN B;  3D0T A;  5CB4 E;  2RHI A;  3RH3 A;  5HWX A;  2DCF A;  5GAO n;  3B13 A;  2D2S A;  4F6R C;  3L2W A;  1ZQ1 A;  3SWN C;  4BDY A;  1B7T A;  4QXH B;  4JLG A;  1NPR A;  2XDB A;  3LBX B;  3CD6 T;  3CCJ T;  1OYX A;  5DY9 A;  2QXF A;  1LKX A;  3CXC S;  1NWM X;  2K5L A;  2K24 A;  3HKC E;  2E6N A;  4C0D C;  2QQR A;  3PT9 A;  4LDX A;  4CI0 C;  4IUP A;  2MWO A;  2EAY A;  1W2B A;  3UUN A;  3W15 B;  4PK5 A;  4XTV A;  3CCL T;  2YEV C;  4C92 B;  4NUU A;  1Q81 U;  5FU6 B;  3A5Z B;  4LDU A;  1N8R C;  3VYH B;  4M7A E;  2BKD N;  3O1J A;  4FU6 A;  4HA8 A;  2E10 A;  4YJ3 E;  3N9Q A;  5LGU B;  3JB9 G;  2PG8 A;  2V7J A;  4RG8 A;  3LWH A;  2OTJ T;  1K9M U;  1BR1 A;  2HNI A;  2R57 A;  2C5J A;  2W63 A;  2EWN A;  5HXS A;  4O2A E;  2B1E A;  2PUK B;  3O9X A;  3ME9 A;  5CR2 A;  2FB7 A;  4ISS A;  2XHE B;  4DQ2 A;  3Q5X A;  4ZTF A;  3OS2 A;  2XAJ B;  3L1A A;  3V8K A;  3DB3 A;  3GOX A;  1VQK T;  2RHU A;  5CCA A;  4PK6 A;  1QVG S;  5EK4 A;  5IT9 E;  5CKH A;  3VV0 A;  5EZY E;  2XG8 D;  2EHO B;  4PAG A;  2QQA A;  3P8B B;  4QXC B;  4EOZ B;  2DD4 A;  1IZ6 A;  3OJA A;  3JAM E;  3C12 A;  5FY7 A;  1UGS B;  4BUG A;  3P7I A;  5L3C B;  2MOZ A;  3QKJ A;  2K3X A;  4HKA A;  3U78 A;  1JJ2 A;  2BZB A;  2PBI A;  4IST A;  5LBM A;  4BD3 A;  3OKQ A;  3S3O A;  4J6W A;  5FNV E;  1EZ3 A;  3KBG A;  5GAN g;  5GAM e;  3S4U A;  4C8Q B;  3QZ9 B;  5AFU L;  3X24 B;  2C5K T;  2XK0 A;  2ODV A;  2R5M A;  1VQ9 T;  3MEU A;  4M75 C;  1YBY A;  2OTL T;  3QUI A;  5J1G A;  3OBV E;  5LJN A;  1KD1 C;  3K3Q C;  2QQS A;  2KLQ A;  5JDF A;  4IGU A;  3ZBD A;  3ZCI A;  3OYK A;  2Q9Q D;  2E9X B;  4C90 A;  3HRT A;  4M77 D;  5L2L A;  4QQG A;  3J7A F;  2JQQ A;  3QJY A;  2CM0 A;  4ZN1 A;  2K3Y A;  1VQL T;  1U8R A;  4EB6 E;  3HL6 A;  4FM4 B;  1X79 A;  3CCU T;  4M7D D;  3CCE A;  2IAK A;  1WQ7 A;  1X6O A;  2JTF A;  1FWZ A;  2XU8 A;  2CA5 A;  3RC3 A;  4C8Q G;  2DO3 A;  1KQS A;  5LJ5 j;  2PQW A;  2HPL A;  3MP6 A;  4M75 F;  4CXY A;  4HCC A;  3PUR A;  3G7Z A;  2M0O A;  5LJM A;  5GMK h;  4M1P A;  2XHC A;  5FYM A;  3LYI A;  1IZN B;  4PJO G;  3NZQ A;  2LSJ A;  3MXZ A;  2KIN B;  4EXT A;  2MI6 A;  1US7 B;  3FC3 A;  4BE2 A;  3T8O A;  4H9S E;  4IE4 A;  2CXL A;  3TEE A;  2BDE A;  3FB2 A;  2RK1 A;  1BI3 A;  1V9D A;  3VKH A;  1WR6 A;  3MK7 C;  2ZPG B;  3A8G B;  4EMK A;  3E1S A;  2LVM A;  3C50 A;  3TU4 K;  4M77 E;  1G5V A;  5JQG E;  2KXP B;  1N8R U;  1HG2 A;  3CVR A;  1Q82 C;  2XAG B;  3MZK B;  3E19 A;  3VU3 C;  5FRO A;  1K8A C;  2CWY A;  3PUG A;  4F7U E;  3PTR B;  4JUY A;  1W2B S;  1S35 A;  2H7O A;  3M4Y A;  4M7D E;  4O4H E;  3CCQ A;  2M67 A;  4L0R A;  2JOY A;  2DI4 A;  3I0Q A;  3E9F A;  1KQ2 A;  1WJQ A;  2GK9 A;  4PJJ A;  2F5T X;  1IAP A;  3OYH A;  1VQ8 A;  3URG A;  4KT0 E;  2YLB A;  4UVC B;  4IE0 A;  1VQ7 T;  3EDV A;  3JC6 C;  3LG7 A;  3QXE B;  3GPL A;  3MO8 A;  1I4K 1;  4X1I E;  1MIV A;  3ESL A;  3AA0 B;  3P8H A;  3JCM P;  1YIT T;  5GMK e;  2O01 E;  1M8V A;  5GAO l;  3VUB A;  3CC7 T;  4U74 A;  4EDU A;  4X20 E;  3JB9 F;  4TV8 E;  2MAM A;  3RKY A;  4XTU A;  3KIN B;  1UX4 A;  3ZEH A;  3CPW A;  3L2Q A;  5GAN 6;  2C0S A;  4OFZ A;  4GLK A;  4M78 B;  5IN1 A;  5HK3 A;  3NTK A;  1YD8 G;  2X0L B;  1O3X A;  3EUH A;  5CK9 A;  2W0G A;  5DLQ E;  5GAN 8;  4PLL A;  2DJZ A;  4EYU A;  1G8X A;  4OB2 B;  4FT2 A;  4NL2 A;  2LOS A;  1JJ2 S;  3GWH A;  1U4Q A;  4C92 F;  1T98 A;  3UFE A;  3RX6 A;  1KD1 U;  3PMT A;  4X34 A;  2XUE A;  3C4X A;  5GAM j;  2CGH A;  2PVG B;  2RB6 A;  4X9D A;  3U3I A;  2V7M A;  2WMN A;  1UB4 A;  5CKB A;  3ZEF B;  3SWN B;  5F3J A;  5JDQ A;  1HX8 A;  2LSI A;  2EJF A;  3OYE A;  5AYF A;  4M78 G;  2KMF A;  4JLI A;  2LSK A;  4H9R C;  4F7U A;  2D0U A;  1M1G A;  5LJ3 e;  1P92 A;  2E8I A;  4I4T E;  2K5F A;  4XTZ A;  3G71 T;  3K3O A;  1S94 A;  4N78 D;  4CXW A;  3QSU A;  3I1A A;  2YLC A;  1RL2 A;  2F69 A;  1H3Z A;  1YJW A;  2KZ7 B;  2DK3 A;  4OB1 B;  4BJN A;  2V26 A;  3HKS A;  2LQ8 A;  5J3B A;  1D1A A;  5DQW A;  1VQN A;  2P9B A;  1D0Y A;  4XTY A;  1BKB A;  5FU7 B;  4CI1 B;  2A3D A;  2QA4 A;  3PE0 A;  4GOU A;  1HS7 A;  2NTY A;  2LT4 A;  2JRK A;  3LFM A;  1Y07 A;  5EK2 A;  4C8Q F;  1Q82 U;  3MET A;  1ZHC A;  2D5U A;  2PFV A;  2WBL A;  3IBP A;  5LA6 E;  2X68 A;  1BYM A;  3HKB E;  2GQV A;  2DHR A;  5HKC A;  4MFR A;  4J8O A;  1UGR B;  2EQJ A;  2EHO D;  5LG4 A;  1H7C A;  2VYT A;  2CEA A;  3NZP A;  3ZJ2 A;  4OVA A;  1VQ4 T;  4YLH A;  2XDD A;  2E5Q A;  2BVL A;  3Q2M A;  4ZI2 C;  3V8J A;  3K8P C;  3QO3 A;  4JJN K;  4BAY B;  4BAC A;  3INZ A;  1FMV A;  5JDG A;  2NW8 A;  4DA4 A;  2H3R A;  4PFO A;  3J80 E;  2QEX A;  2DXC A;  3CC4 A;  2E64 A;  3X20 B;  4GK0 E;  4P0B A;  2A2F X;  4X9C A;  2YU1 A;  4ELZ C;  3HFO A;  2X4X A;  4XU3 A;  4M75 B;  4CI2 B;  2E41 A;  3WAK A;  5LJ5 h;  3RKX A;  4IE5 A;  4C8Q D;  2XAQ B;  4LDY A;  5GMK j;  2WM9 A;  2Y6X A;  4L9I A;  4WW0 A;  1HK9 A;  3QYG B;  2NTX A;  4AI6 A;  4PJM A;  2L3L A;  4A4E A;  3RRW A;  1VQM A;  2LSY A;  4FI5 A;  4H9O C;  2LRQ A;  4PJO D;  3CCM T;  4E47 A;  4A4G A;  4UEM A;  2M9U A;  4PJL A;  3CQG B;  2LOP A;  2XAS B;  3ETU A;  3ASK A;  5GAN e;  4UEL A;  4U72 A;  1Y64 B;  2KMT A;  5HAX A;  5D6W A;  3OB9 A;  1M1K U;  2RD1 A;  3CPW S;  2LQK A;  5KX5 E;  4EMK C;  5FXX A;  1NPP A;  2LX9 A;  2RK2 A;  3N2K E;  4LD9 K;  4UVB B;  3CPF A;  5E0O A;  2OAU A;  3ZYK A;  5DQV A;  2VKO A;  4E7H A;  1YHQ T;  1Z0P A;  3V7S A;  4M75 G;  3R84 B;  3CBM A;  2H3J A;  1YKE B;  3BK9 A;  3FBZ A;  5HY6 A;  5GAN 7;  3QJ6 A;  2DTH A;  5FXV A;  5LP6 E;  3FJP A;  5I2M A;  4J2C A;  2BVM A;  4JUV A;  5LOV E;  4C5H A;  1AHJ B;  3O1H A;  5C8Y E;  2PVD B;  3QK6 A;  2E65 A;  3VHL A;  4AKH A;  4KUM B;  4I55 E;  3LGF A;  3J7Y q;  1HTJ F;  2D6F A;  1BI1 A;  4I43 B;  3EFR A;  3C51 A;  3QZ5 B;  3BY7 A;  2VV5 A;  5L3E B;  2YRV A;  3CCV A;  1UGQ B;  2DZC A;  5KDM C;  1R8O B;  4MZP A;  3N9L A;  3KBU A;  5LJ3 j;  5CKE A;  5LL6 S;  2YHT A;  3NTI A;  1QW1 A;  3AVS A;  4PJO E;  3BW1 A;  2QA7 A;  4QQ6 A;  3ZFJ A;  2PVO B;  2NP9 A;  3H6Z A;  2O4X A;  4PJN A;  3PIO A;  2RHZ A;  4ZS3 A;  1KHI A;  3JCM W;  2LT3 A;  2KWI B;  4HCB A;  2ZPE B;  3X28 B;  3OQ5 A;  5HXH A;  4G2A A;  4M78 F;  4CI3 B;  2ZM2 A;  2ZCF B;  4JS4 A;  3L09 A;  3Q1J A;  3DLM A;  1BR0 A;  2XAH B;  5DJQ C;  2VKJ A;  2CKK A;  2RJC A;  3IF8 B;  4J83 A;  3WXM B;  2LTO A;  2UXX B;  1BIB A;  4TZ4 C;  5J39 A;  2JN0 A;  1WLX A;  5IHY A;  4AQF A;  1JB0 E;  2LT1 A;  3C4S A;  3R6N A;  3J81 E;  5GAM h;  2I2L A;  4AXP A;  1LNX A;  1D0X A;  4KBM B;  4HEA A;  3L3P A;  1FMW A;  3OSS C;  3L2Z A;  5IYZ E;  1M1F A;  3V7C A;  3N9P A;  4B9W A;  1OZ2 A;  4O5V A;  4R55 A;  1D1B A;  5FU7 C;  1VQ6 A;  4WF2 A;  4P0A A;  4ZI3 D;  5KE2 A;  3OYN A;  2XKO C;  3OSV A;  4E7I A;  4IUR A;  5HK0 A;  3JCM d;  2LM9 A;  2L8K A;  3O4X E;  2XQY A;  5KE3 A;  4FT4 A;  2X4Y A;  4A54 A;  4E7Z A;  2JUF A;  4C92 G;  4IUQ A;  3F57 A;  5LJ5 d;  3OY9 A;  5HWY A;  2D0Q B;  3EFS A;  1G3W A;  4QW2 A;  4L5G A;  3N2O A;  1MND A;  2L9Q A;  3C94 A;  3EAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...