4L5GA

Crystal structure of thermus thermophilus card
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CarD
publication title Structure and function of CarD, an essential mycobacterial transcription factor.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
total genus 47
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l5gA02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l5gA01
2LT4A 4KMCA 4MFRA 4XAXB 2LT1A 2LQKA 2LT3A 4ILUA 4KBMB 4L5GA 2EYQA
chains in the Genus database with same CATH superfamily
5LNKA 1WLXA 4DR7T 4C0DB 1PD1A 4M7AA 3U3IA 3P8BB 5GAMd 3M0TA 1VYVA 2ZPEB 2PTFA 5CKEA 2Y4YA 5LBQB 1OOTA 4PJOA 5KXJA 3G4SQ 2M6BA 2VGMA 1G73A 1WIEA 1Y96A 4ESRA 1VQ6Q 3N5LA 2LE8A 5AQQB 5FU7B 4XTYA 4FCYA 3MZKB 3H0HA 1GRIA 2DL5A 3PGGA 3CPFA 3META 2LJ3A 2QEXA 3M55A 4RKUE 3QUJA 4IIOA 4OMQA 4PFZA 2BIVA 3EG1A 1MIWA 3VRBA 2JTFA 4P0BA 3G71A 4AKIA 7AT1B 1PRMC 5EG2A 2CP6A 1KQSP 4AIUA 2WSEE 4KGXB 4LDUA 3L8RA 3OQ5A 3CCEQ 2YWWA 1Y07A 4M78A 4I4TE 2HKQB 2V8KA 3JC6C 3V8LA 4NXNT 1Y7XA 3RMSA 1M3BA 5M9OA 4MDWA 3WXMB 4UEMA 1BIBA 2LSYA 4LD6A 4LMJA 2F5TX 2YSQA 3T1HT 3AT1B 1NENA 2FUPA 4CN4A 1WHHA 1YJ9Q 2OV9A 2V5CA 1WHGA 3MP8A 4HVVA 2DX1A 4IUVA 3UUNA 2EKHA 4JEUB 4F7UE 4B9XA 2H88A 1TG0A 2HBWA 3PJAA 1UJ0A 2EWNA 5LJ5e 3CCJQ 2WMOA 3LGFA 1QSDA 5IHNA 3CWZB 3IBPA 2A3LA 5J2UE 4HKAA 4WBOA 4CRIA 4E7HA 2QA7A 4NXMT 2D0QB 2QQBA 1VIFA 2Y8DA 1UB4A 3RLFF 2NWMA 3ONJA 4OMOA 3JAME 1XMQT 2EYZA 1D1CA 3ABVA 2DXTA 5DJQC 3PNWC 3OYHA 1SE7A 3VV0A 2XSBA 5GANd 4E7ZA 1LCKA 4M75F 1W0AA 4AXPA 1A0NB 1Z8UA 1NG2A 5EK4A 4RTYA 3G6EQ 2EHOB 3CC4A 3GA8A 3JSCA 2NW9A 2JUFA 2EGEA 4L5GA 1SPKA 5JR9A 1D3BB 1G8XA 2YDLA 4GLKA 1QP2A 3O8VA 3ZBDA 4HWDA 5KYXB 1RAGB 2P9BA 3S3OA 3OS5A 1KQ2A 3CCST 2J4GA 2MK5A 1BR0A 2R5AA 2OX7A 2YUNA 5CQYA 4M7AG 5AQFB 5LHGB 1HF8A 3QKJA 1VQKA 3SWNC 1WQ7A 4ZNXA 3U23A 2HZYA 4ADZA 1K0SA 1O3XA 3A8HB 5KDMC 2LRKA 1HFAA 4CN1A 1QCNA 4Z89A 2E2AA 4PK6A 3OMGA 1AWOA 5L23A 4HWFA 2AIRB 3PIOA 2WWVA 5JDGA 1W9RA 1OU9A 2K79A 4O2AE 3ASKA 3PV0F 3X28B 3QB5A 2ES0A 4A63B 1Q81C 3T8OA 3AE8A 3RQUA 4ZHQE 4JJBA 1NAFA 2NUTB 2V5DA 1UGOA 1UDLA 4ZEYA 4E7SA 4B6MA 2A2FX 5JDNA 1M7KA 1IHVA 3IA3A 5ABHA 3EUHA 1RAHB 3CK6A 5GMKl 3TCJA 4C91A 4ELYC 3OPCA 2K5BB 2XMFA 2FJBA 3O9XA 1Q81R 3QYGB 2DF6A 4BACA 5GAMe 3VS4A 4C0ZA 4GLMA 1BCOA 2ODUA 4OB2B 4ZGEB 2QAZA 1FX7A 3A8MB 3PUAA 1UGQB 2DFUA 4DV2T 2EJFA 4EIWA 4TNWA 2MOZA 3ZFJA 2W66A 2CZ7B 2GTJA 2KY9A 2B86A 3OB9A 4PAGA 4XAXB 1U1TA 1M1GA 2LX9A 1GFDA 3EGUA 3C94A 1N5ZA 1KFZA 2HMAA 3C95A 1WHJA 2CLYC 2XZEA 2GTOA 4B3MT 2QASA 4JRPA 3JCMW 3UU3A 4IREA 4E2FB 1WX6A 2HPJA 3CCRQ 4HKEA 1JNZA 1UGVA 1D1BA 4B9WA 2GGRA 2J06A 4BI8B 1X6OA 3CMLA 2JM9A 2JS0A 5HEHA 3PUVF 3X24B 4HFHA 1SRMA 2E3IA 3OSVA 3CX8B 3OYZA 4RCCA 4C92C 2CWYA 1W09A 4XZCA 4KI0F 1M90U 5AQSB 5LGUB 3NFCA 5LJ5g 4DQ2A 5DLOA 5A0LA 1RUWA 3BFMA 5AQTB 1O9SA 4YLHA 1SHFA 2J6FA 3OYFA 2M0OA 4M7DD 5FL1A 4IUUA 3ZT6A 5IN1A 5HEJA 3N9OA 2ECZA 1W2BS 2E5QA 3J81E 1U4QA 1N32T 2K4YA 2JMKA 1Q7YR 1FMWA 2D2SA 2DD5A 2A9UA 2LHRA 2O4XA 3HRTA 2FZCB 5AQHB 2KRMA 3OA6A 3P50A 1OPKA 2RM4A 4ZGJB 3NGPA 3S3MA 2BG9A 3I9YA 4C8QB 3TKLB 5GANe 4F6RC 2VUBA 2CT3A 4U2YA 2JMAA 2KRNA 4JRIA 5IAYA 5JQGE 3L1AA 4ZN3A 3CQCB 2QQAA 4N0AC 3KV6A 2PVOB 5LHIB 5LJ5h 2D6FA 3EVYA 2L3QA 4JPBW 2CZ0B 1IXDA 3GPLA 4JV5T 2LOSA 1YW0A 1ZV4X 3JB9G 4UR9A 2QGGA 2HSEB 3PMIA 2K7AA 2LM2A 1XZYA 4J7FA 2P0PA 3M4GA 2Y48B 3P8CD 3CQTA 5JDHA 5GAN4 2ZCFB 2WSCE 4PKCC 4TWDA 1XNIA 4XU0A 3ZMVB 5FROA 3HI2A 3N9LA 1JBMA 3PUGA 1LNXA 1XJWB 5GANj 1U5PA 2A08A 2BBHA 4JLGA 2KWIB 2E9XA 3OS2A 1AEYA 2XAGB 5HXRA 2DVEA 5ETWA 5F5WA 5EK3A 1KJWA 1UHCA 5IYZE 2WM9A 3K8PC 1C6VX 3NZQA 3V7SA 2XK0A 1N34T 3ZN0B 2M51A 4Q25A 1E6HA 1WYCA 3JB9F 5GAMg 3QJYA 3TLSA 2LNVA 2BZXA 2BZYA 3OBYA 2EAYA 1Q82U 3CPZA 3JADA 4X66T 2F4VT 1GL5A 4WZXA 3BDLA 4WTOB 5FXVA 1OU8A 2K5IA 2YLCA 3UDCA 5KE3A 1WR0A 2P4TA 2VL0A 4C92E 1VQOA 3GP8A 5LJ3d 3V7CA 1V29B 4J8OA 2EBPA 4UF0A 5LXTE 2EHOA 2XAQB 2OAWA 4M77F 2XG8D 2N9DA 3I55A 5LG4A 4PLIA 2JRKA 4TWFA 5JVDE 1S1NA 2HKNA 2KNBB 3J9X1 5AQVB 2FL7A 1EZZB 2P84A 2RK2A 1OEDB 3PJAJ 4M75C 4DUZT 2A37A 1OQKA 1D0XA 3L09A 2CGHA 2NP9A 1JRIA 4KBMB 3CCQT 1QUUA 2RJCA 3BQLA 2KNDA 2XQ4A 1FWZA 3UU5A 2DMOA 5GAMh 5GAOl 3LSVA 3TSZA 3ZC0A 3HPWA 2JMCA 1TH7A 1LVKA 2W00A 3ZT7A 4ZZBA 5CQXA 1BBZA 1WJSA 2V1QA 4HCKA 2EVRA 1W2BA 2JS2A 3MEUA 4F7UF 1QVFS 5LB7B 5AFUL 2DEUA 4KMCA 3EFSA 4AKHA 3UU8A 3OYEA 1N9RA 1SG5A 2OTLT 4C90A 3OY9A 1YJNT 5GAOp 2CXLA 5HXCA 5KYNA 2DXUA 4QX8B 4RTZA 3PU3A 1BI0A 4EMKC 3NTHA 4AQFC 4IE0A 4I43B 5FXWA 2D0UA 2ZM6T 5AQRB 1ZA1B 1YHQA 3SWNA 1R8OB 5GANg 2O88A 3AAEB 2ZLYA 3FZMB 1KC8U 1JJ2S 1FYNA 3KV4A 3L2ZA 3P4PA 5C6SA 3CBMA 4RUGA 2XDBA 2MWOA 1DJ7B 4PNOA 3NTKA 3X20B 1YIJA 2XICA 1I5LA 1SHGA 2UUCT 1PD0A 4J9BA 3RR6A 1FXXA 2YUOA 3M9QA 2QGFB 3URGA 5GAN2 3PTRB 3GMIA 5C0MA 3I0OA 5J1GA 2K3BA 1VCSA 2CP2A 4D6WA 3CPWP 3DB3A 4JLIA 1ZHIA 4E7JA 4JLEA 3NMZC 4RMOA 2GFAA 4II1A 4EDUA 3I9QA 1UK5A 2FRWA 2L89A 2FPFA 3KBTA 3INZA 4ZN1A 3JB9J 4KRTA 1HD3A 4C0GA 3M65A 3LBXA 2EYWA 4ERRA 3SS1A 2HPLA 2ZPGB 4IDQA 3RKWA 3AEGA 4LDWA 5CKHA 3I0QA 2LZ6B 1MGQA 2JXBA 5HEUA 5GANh 2UXBT 3TLWA 4F14A 4ZI2D 5GAOn 2WB5A 3I9WA 2VYTA 3KBGA 3CD6A 4DV1T 2MPXC 1YD8G 1GXIE 2L3PA 4WYVA 3BY7A 5HEGA 4E7KA 3QSUA 4M7AB 5L3GB 2JQHA 1HG2A 2X4WA 3HP9A 2RI2A 3C12A 3MCAB 4M75E 4JI7T 1KHIA 5FWBA 5BR8T 1HSQA 4XU2A 5GANf 1EZ3A 5GMKi 5IHYA 2JNGA 2V7JA 1IB8A 3RHWA 4C8QA 2COYA 2LCSA 3HRUA 3Q5EA 2CZ1B 4JJCA 4AISA 2YRDA 2XASB 3SRZA 1OEBA 3NRYA 1RAFB 2E4HA 4MZMA 3NWIA 4JI4T 2ABLA 1W2BP 3FBZA 4G2AA 1WPYA 4HWIB 3CMEA 1UJYA 2M9UA 4C5IA 3RRCA 2BKPA 2DNUA 4PW8A 2FO0A 1M27C 3RIFA 2JTEA 4DOVA 1N36T 3VRYA 3QHSA 1IZNB 1U1SA 3LLRA 3CCEA 3J80E 1WCRA 2NOXA 3MJXA 3RIUC 4AFUC 1WYXA 2VQET 1S72T 3RDVA 1QVFA 2AT1B 4QKNA 1KG1A 4AMCA 1VQ7T 4QT7A 4QW2A 4JI0T 3C4XA 3HKSA 5IH2A 4JUVA 2X66A 1ZEEA 2HCKA 1YI2T 2M1HA 2ROLA 5LA6E 3EG2A 5J0ZA 3HTRA 3HL6A 4BE1A 4DMVA 4EAHA 4DBRA 1UGPB 1QWEA 5IXBA 1XNRT 4LF8T 5IHKA 4JI5T 2VGNA 1JEGA 3SFMA 1JJ2A 2HHHT 1V9DA 2RPAA 3HKCE 1IBKT 3RPUA 2YRVA 2CE7A 3HRSA 4DV5T 2CKKA 4J7IA 3J7AF 1TSFA 1NEBA 1TS9A 4BY6C 3ZYLA 3CIRA 2GFUA 4BE2A 1G3SA 5JR9B 4TV9E 1YWOA 4IUTA 4KUMB 4EZHA 2NUPA 1M3AA 3LGLA 3VS5A 2I0MA 2QQ9A 1T3SA 4HFEA 3OVUA 4HTEA 3VUZA 1PCXA 5FXZA 3S4UA 2NWBA 1PSFA 2DJZA 2YDQA 1UX4A 1JU5C 2BZBA 5GONE 2Q9QD 4ZTJA 1HCIA 1XMOT 2LCLA 5LJNA 4OMFB 1LVFA 3CCQQ 3M54A 2GNCA 3N9MA 3CQGB 4M77C 1YJWT 1NYGA 2CBIA 2QA4T 5FWCA 2WU5A 2QGSA 5AQNB 3RX6A 3WAKA 4M7DE 4MZTA 4C92G 4EOZB 3PTAA 3P7IA 5AQKB 1WJRA 3DTOA 3OYAA 1MV0B 2UU9T 4YSZA 2CP7A 4H63V 1T72A 2B1EA 2VC8A 3AVSA 2WMNA 2XAHB 5CJ5A 4OYKA 3OYXA 3JV3A 4YY3T 4M75A 4OB1B 1UFFA 1YJNQ 3KV9A 1L0VA 3CCLT 3GOXA 1TTHB 2DYIA 3V8JA 1I0CA 2DA9A 4GK5E 4KH0B 4YTPA 1RAEB 2K9GA 1UUSA 1ZLMA 4O4IE 2O9VA 2DIGA 2MWPA 1R8IA 2CMRA 1SEMA 4FYWB 5F3JA 3CC2A 1G3WA 2CYZB 4QQGA 3FRNA 3M0PA 5GAN5 3PVQA 1VQPA 2CS7A 3RRWA 4X1IE 4C92F 1FMVA 3PUZF 4UV8B 2BDEA 2HL3A 3OKQA 5DQWA 4A4FA 2KINB 2L8KA 4X20E 4HVUA 4FM4B 3KDSE 4ZI3D 4JJNK 2DXBA 3K3QC 4EMKA 5I2SA 1YCSB 4ILUA 5FNVE 1HX1B 4AQFA 4L59A 4C8QD 3SWHA 1X27A 4XQ3A 4MLKA 1UX5A 3DKMA 2Y90A 3L2WA 5IT9E 2EQKA 3MO8A 5FY7A 3U78A 2BKOA 1IRXA 4DA4A 2XPKA 1ZSZC 3RERA 2XQAA 2YK0A 2XM2A 2DEQA 1VQ8T 2VXEA 1PHTA 4GKKT 4K0UA 4J6XA 2YDRA 2XJ7A 2FB7A 3C51A 1SHZC 5ABFA 1RI0A 2O4XB 5LJMA 3ZSTA 3OYLA 3VS6A 2UXCT 2PQWA 5J26A 1BCMA 2V6YA 4AQGA 4IIMA 2KAFA 2VKNA 1ZKEA 2BG9B 4ZI2C 2LC4A 3HR0A 1YP5A 2LVMA 3RKGA 2CXDA 4M77E 2RQTA 1X75C 2EKOA 2LJ1A 2QI2A 3D7SB 4U7YA 4LDVA 2KSSA 1J5WA 2JJ9A 2RNAA 3EG3A 3OBWA 3CC7Q 3HHTB 2JOYA 2FYKA 5HAXA 5IWAT 4QQ6A 5HEOA 1M90R 1AWJA 4QH4A 3OYCA 1I4K1 1FMKA 1KD1U 4MBQA 4UVBB 3UFGA 1DU2A 1MV3A 3NHNA 4A54A 3X25B 5FXXA 5KYUA 4BDYA 5L4HA 5AQIB 3ER0A 1D0YA 5JRCA 4M75G 2VASA 3ZYKA 3FC3A 2CA5A 3EHQA 3OTOT 2WDVA 4RCBA 4P5NA 1I07A 3A8YC 2GQVA 1ZX6A 2BE9B 2K48A 3FZHB 2BS2A 3UA6A 1VQ4T 3L39A 2QQSA 1S72Q 3M5AA 3ZMTB 1QKXA 5GJVB 5D6XA 5BMVE 2ZPBB 3OS0A 2H7VC 2Y6XA 2E9XB 3DJBA 4H9SE 1VQ7Q 1VQLT 2LQWA 5LMNT 1JNRA 3CMAT 5EZYE 4DUYT 1R77A 1YI2Q 1U3OA 1NYFA 3REBB 3RYFE 3AA6B 3N2GE 4HN9A 3P4QA 1Z9QA 1Q95G 3W15B 2XAJB 1TUGB 4EEDA 2K2VA 4IE5A 4B3TT 2LJ0A 4E6RA 3NRXA 2DVJA 1K4US 1TWBA 1WHLA 4DV4T 3OYKA 5E0OA 5FYMA 1HYOA 5D6YA 2A0FB 3JAFA 3OYNA 1VQ9T 4IKFA 5GAOq 2QYZA 1WXTA 3RIUA 4LE9A 3JCMe 4UF0B 2NTXA 2EJ9A 2AKLA 1OX9A 2JTMA 2X51A 1KNRA 2ZM8A 4XU3A 3KXTA 4O2BE 4V2SA 2E8IA 3R84B 2L9QA 4U74A 4DOWA 4ILBA 4UC4A 3QWYA 2AHJB 4EPCA 3OSSC 9ATCB 1YKHB 1MMAA 5LJ5j 4XTVA 3L2RA 2V7IA 1VQ5A 4PL6A 2WQYA 4IUQA 3GBQA 2YDSA 1KQ1A 4H9RC 3VKHA 2XQ8A 3F2EA 3M53A 2SPCA 2LCCA 4QQDA 3M0UA 4E7IA 1YJWQ 2EJGA 2MTQA 3CCSA 1Z9ZA 2QA4Q 4CZZB 2J6OA 1VQKT 2VURA 4CI1B 2COWA 2C0OA 3DLMA 3C4ZA 1Q82R 1QKWA 2V7MA 2Q9QC 1MUZA 2PZ1A 3AE6A 3Q5XA 2PFVA 3QBYA 4U3CA 2KDSA 3VYGA 1NEGA 4EB6E 1FIOA 2QDLA 4LD9K 4DO0A 3MA9A 3EDVA 4IE4A 4QXHB 4RTWA 1YITQ 2W67A 1BK2A 1SSFA 1CSKA 3E9FA 4X34A 1QVPA 2CBJA 4CC2A 5ADXL 2XQ6A 4DR2T 3SWNB 3CCLQ 4RG2A 4XTUA 4HCZA 2ACZA 4B3ST 1VIEA 4GIWA 1WGSA 4M77A 4BI4A 2XDPA 4J2CA 1KNZA 4N4HA 3SOLA 3RH3A 4HFVA 3CCMA 2O01E 2MBGA 1K8AU 4M7DG 2RHXA 1M9SA 1WHMA 2H7OA 2LSGA 2KI7A 2A3DA 3NZPA 2JQQA 1RLQC 1VA7A 1YQ4A 2WWUA 2FPEA 2JZ2A 3EFRA 3VR8A 5M4YA 1JB0E 5GAOr 1NPRA 2L2PA 3L3PA 4Z88A 4M7AD 4PFOA 2HN1A 5HWYA 2WDRA 4QX7B 3G7ZA 2NTYA 3JB9H 4ATOA 2N2NA 1N8RU 1QQJA 4PJOD 2DL1A 2XHEB 4QXCB 1UGSB 4H9OC 3UUMA 3HA4A 4UVCB 3V7RA 3LBXB 4D8KA 1YFNA 3PUYF 2EQIA 1KC8C 1RACB 3QB5K 3S3NA 4IDNA 3PE0A 4DR6T 1E6GA 3ZN1B 2JW4A 2X9WA 3KFVA 5GAMj 4DBHA 4F7UA 4PJJA 2RD1A 4TNVA 1Q7YC 4Z8AA 2XIDA 2IAKA 4DR3T 1R0CB 2PG8A 1KC8R 4M7DF 2LRQA 2N1GA 3V5UA 4M78D 4IDOA 2I2LA 2KQWA 1VQ8Q 2W63A 5CVIA 2OTJT 1VYTA 2CLYB 2RP4A 3UF4A 2EGAA 2CHNA 3JB9I 4DBQA 2P0QA 4A53A 4YHHT 3M59A 4G63A 1V76A 3EHRA 1M2VB 4C92B 3AXJA 3JCMg 1MIYA 1M62A 2DK3A 3Q2MA 5FL0A 2BS3A 2HQXA 3ZKRA 5KMGP 3QDFA 4FU6A 2VWFA 1PKSA 4R0KA 1F1BB 4M4ZA 3H37A 4O5VA 5KE2A 4LUEA 3K3OA 1EFNA 2YU2A 4H9NC 4PK5A 5JH7E 1ZSZA 1M2OA 4WW0A 1NWMX 4OB0B 4GYSA 4HE8A 3ANWA 2RA1A 2H3JA 4EYYR 2JIWA 1YXRA 5L47A 1YN8A 3DP7A 4FW2A 3JCMV 3SHWA 4WCIA 5I11A 1EX4A 4WF2A 3CCUA 4M77G 2OI3A 5LJ5f 4COFA 1VQ4Q 2G6FX 2CHOA 1W1FA 4I0UA 5J3BA 3WVDB 2HL5C 1LRZA 3UTKA 1OPLA 3H0FA 3KBUA 1O75A 1RI9A 3JCMh 1VQLQ 4TVRA 2DJQA 3SDZA 4ZS3A 2BE7D 4NPPA 2E65A 2CSIA 5GJWB 2RQRA 4DV6T 3CMAQ 2AZSA 1I94T 1MMGA 3UU6A 1IGUA 1MNEA 3FZLB 1KK7A 3V8KA 3N2KE 2J62A 4IHJE 3B57A 2P0KA 1HJDA 4AFZC 2CSQA 3J7Yq 1B7TA 4Z91A 1BI1A 2EYQA 5ABEA 4LDXA 3CXCS 3PT9A 1X2KA 3JCMf 1XNQT 1ZQ1A 3AEAA 4TV8E 3E0ZA 2HN2A 4I50E 3JRZA 5A0GA 2SEMA 4C0FA 1VQ9Q 1D09B 4BI3A 4F7UG 2NUPB 1T7SA 4LNPA 1OEDC 5CKBA 5GMKm 1BR1A 2WCAA 1KHCA 2HH7A 3O1IA 3LDQB 1VQOT 1UEBA 4ZOLE 1K9AA 3TREA 1N6AA 4CXXA 2LT4A 3LX7A 1C0MA 3EI0A 1RAAB 4OFZA 2FZKB 1W4SA 2VKDA 2QTVA 1NLPC 4DVDA 3UUXB 2LX7A 2MCNA 4HGAA 4I55E 2XM1A 1WXUA 5D7UA 1VCTA 3CX7B 5FU6C 2CM0A 4ZI7E 4CI0C 2RF0A 3GNFB 1WYBA 1AHJB 1G2BA 3ZMUB 3QXEB 4ELZC 1VQKQ 3QNUA 3QOFA 1WDXA 2KT1A 2DL8A 3CCQA 3VHLA 4HT8A 3BK9A 3I56T 2H3RA 4UIGA 3SB2A 4YHJA 4HT9A 1X69A 3CCVT 2DTHA 5AQOB 3FZKB 1WA7A 2VV5A 1LOJA 2V7LA 2CZ6B 2RQVA 3FXDB 2K3XA 3L2QA 3ZCJA 4M75B 5GAMf 3ZLIA 1FJGT 3C4WA 2CXFA 4QXBB 1WXBA 3H41A 3P4RA 4DR4T 3A7MA 1BB9A 1WFWA 3MPUB 4ME7A 5GAN6 3P4SA 2KROA 3BW1A 1JXMA 2OTLA 2CCQA 1T0HA 4Y28E 4L0RA 3BE3A 1R0BG 1YHQT 2YXYA 4P09A 3RBBB 2LT1A 3AHUA 4LF9T 2CP5A 2QTXA 2RJDA 1ZBXA 3AE3A 3EHZA 2JMHA 5TAOA 2K24A 1YIJT 4QVZA 2X4JA 5L3CB 1OXZA 3JCMP 2VVSA 1E2AA 4HFDA 2F1LA 3JCMc 2KT9A 1QLBA 3UUBA 1B34A 4JRKA 4BB7A 5FP3A 3MP6A 1M1KU 4EMKB 3LG7A 2M67A 3JCMX 2YN6A 5LYJE 5JREA 3EG9A 2A72A 3TLUA 3VS3A 3LJCA 2NUZA 3AVRA 1RABB 2C0TA 1ZUYA 2DXCA 2A36A 2HQHA 4XTZA 3SEMA 2ZAEA 1AOJA 1OEDE 4PJOC 3VU7H 4UXNB 3UT1A 1T8BA 2D0NA 2DIQA 2WAUA 4QWNB 4AQYT 4XK8E 3KFWX 5ABFB 1X79A 2L3LA 2VB6A 2DKGA 2V6YB 4RTUA 3QK6A 2RJFA 4FL6A 4OMMA 2OTJQ 1TU0B 1BR4A 3E1SA 2MAMA 2C5KT 2KWHA 3FB2A 2KMFA 3GN5A 3QUIA 3AE2A 3FDRA 4FSXA 4CQIA 3E9GA 2J05A 4BJNA 1X43A 4DBFA 3MKDA 2E41A 3UULA 2PUOB 4M7DC 3H3AA 1VQMT 1M2VA 2YRCA 4U2ZA 1JO8A 4M78C 5JDFA 2XSAA 4C92A 2XY8B 3AEBA 2AKKA 3CC7T 3G4SA 5HCKA 8ATCB 4DIDB 1KQSS 2E1HA 2E9XD 1X9BA 3AEFA 4NUVA 2ZMAA 2JVVA 5LJ3e 1VQ6A 2CUDA 3H0IA 1K0XA 5KCOA 1CKAA 4C5GA 1AZGB 4ASKA 3EFOA 1IHWA 2DL3A 2VXFA 1K73U 1IJ5A 3O1JA 5KYUB 4BUGA 5GAN8 4LUDA 5JRCB 5HXEA 2XQYA 4L9IA 1BYMA 3CMET 1UHFA 3CBPA 2IC6A 4HEAA 4IL4A 2IDOB 1E1HB 1I6ZA 2XUEA 1H641 4LF4T 3CX6B 3EH2A 2M02A 3AE9A 2K5FA 2M0YA 3NKZA 2CWOA 4TZ4C 2WSSV 2MMPA 2LKGA 2O9SA 2LRLA 2EHOD 4A97A 2JPFA 1XDPA 4DR1T 1M3CA 3VS7A 1GFCA 4H9QC 4FT2A 1YJ9A 1M8VA 1I1JA 4C5HA 2E5LT 4M1PA 4BJMA 3Q9DA 3IF8B 4ANJA 4KX6A 1WRDA 4JYAT 2DI4A 2DD4A 1MNDA 2WP9A 4N0AA 5LJ3j 1S72A 3CBOA 2PVDB 3HFNA 2LP5A 2CDTA 1SSHA 4BE0A 4QKUA 2ATCB 1OWAA 3CCJA 5I22A 1B07A 3A5ZB 4YSYA 5HY6A 5GAOm 2IPOB 2A7YA 1HNWT 4FJOA 2LHNA 1KD1R 1YI2A 4KGZB 4N78D 1HTJF 2LSIA 2O2OA 4DEXA 4JI2T 3NTIA 5LMUT 5C3JA 2LJLA 3VRAA 3VUBA 4M7AE 3UPUA 5A2QE 1CKBA 2DBKA 2FVUA 2VKJA 2X0YA 2KXCA 1VQOQ 4PJOE 2DL4A 3G6EA 5ECAA 3LFMA 2V6XA 2VQFT 1YNZA 1BR2A 1HG5A 3OYBA 6AT1B 1UTIA 3H8ZA 4JEHB 1BKBA 3JCFA 2IIMA 2G0UA 2X4YA 3JCMJ 4CC7A 3RMQA 3R6NA 4QH5A 2VKHA 1N33T 2B8AA 3PU8A 2E6ZA 3AA0B 2VWAA 4YTNA 1HNXT 3EGDA 2IG0A 4BY6B 4EZ4A 4M78E 1ACMB 4JS4A 2MOXA 2J1DG 3LK3B 2F2VA 4ILAA 4N4GA 4L6V5 2HQEA 1H7CA 2K3YA 3I56Q 2LSKA 3CCVQ 1H3ZA 3F31A 4IE6A 4U31A 3QZ5B 2FEIA 1YITT 2EGCA 2WZHA 1WJQA 2DLRA 4ILCA 1AVZC 4LDYA 2RI5A 4X64T 5KX5E 2UXNB 2FJDA 1SKUB 2DNXA 1RLPC 3ZMZB 3E22E 2XQ7A 1VQNT 2IIUA 3EAEA 4M77B 4CC3A 1W70A 1ABOA 1KQSA 1QVGS 3ZJ2A 3QO3A 1J5ET 3ZC1A 5AQUB 3P8HA 1QVFP 4HA8A 5HYAA 1YHQQ 3CCLA 3C64A 4P1NA 5LJ3g 3CC2T 4IDZA 1QWFA 2V8SV 3S6WA 5LG3A 2KZ7B 1T98A 4F04B 3REAB 1VQPT 5LOVE 3ZJ1A 2IUBA 4PJNA 1YIJQ 2E5KA 4WNKA 3FZFB 4J9GA 3O1HA 4NL2A 2NR4A 4J9EA 1JXOA 2HAXA 2L3RA 2QQRA 4OGEA 2KRSA 1JJ2P 1D0ZA 2KE9A 1KFYA 2QG9B 3JAEA 3TLVA 1K8AC 3H6ZA 4RTVA 2KEAA 4CC4B 4F7UB 3BQKA 2LSJA 4O4HE 4BA9A 3CCRA 4H63H 3CVRA 2RHYA 1UE9A 1PKTA 4C0DC 1U5SA 2FPDA 2QVAA 2OLTA 1ZBJA 3M3ZB 2J7IA 5IUXA 5JTGA 2K9AA 5EC7A 1K8AR 4IT4A 2H8HA 5LJ3h 3BDUA 1N8RC 2FJEA 5CIUA 2BG9C 2V1DB 4X1KE 1BI3A 3SD4A 3VU3C 4QVDA 4DR5T 4GYRA 5FU7C 1GQEA 4FYXB 2CP0A 2AZVA 2RA2A 2VVKA 2JQ9A 3QJ6A 3ZMSB 2RO0A 1WHKA 2ZZDA 2E10A 2FRYA 1M90C 4J6WA 2Z6EA 2XD0A 1N8RR 4NS5A 1VQ8A 1VOMA 3AXJB 4EMHA 1SA0E 3FIFA 4KUIA 4JJDA 5LJ3f 4TWHA 2D0TA 4CN6A 1VQMQ 4J83A 4OX9T 1BIAA 4JDSA 2UXDT 4X5TA 2K57A 2IHR1 1HNZT 2E5VA 3H3MA 5LGNB 3CKDA 1PWTA 3H9NA 4PNIA 2WDQA 1NBEB 5CB4E 1W6XA 2QEXT 1X6GA 2XU8A 4GK0E 1ZSZB 1MMNA 1BI2A 3MEVA 4OMNA 4AG2C 4J9DA 4HCBA 5L2LA 3FXEB 2D8HA 2D9TA 3G71T 3VJPA 3GWHA 1IJ6A 2MYSA 3ETUA 3ANWB 4NL3A 2BUDA 2W0ZA 4PLLA 2XDDA 4Z02A 1LPLA 2WZIA 3CMEQ 2DYBA 3OW2S 1OYXA 3AAIA 2E9XC 4KHZF 4FT4A 4GKJT 5FY1A 4IIJE 1WQWA 2DHRA 1HX8A 3PFSA 2LQ8A 4M7DA 3A98A 1Q86U 3OYYA 5GAN7 2ESWA 3VS2A 4DEYA 4Y92A 3TLTA 4X1YE 2RMOA 1WZOA 3LK42 1VRBA 2DE0X 4OMPA 2MIOA 1VQ4A 4PK4A 3N9PA 3ZYMA 5CCAA 3ZPOA 3RKXA 3OYJA 3A5XA 2MPKA 1M4ZA 1VQLA 1M30A 2W61A 1T0JA 1QVGA 4GBQA 2EHOC 2GK9A 4A4KA 3CMAA 3HFOA 5FKYA 4LFAT 5I2MA 2AE9A 3WAJA 4ZGDB 1IBMT 2CH4A 2ZPFB 3AB3B 2LKHA 4HFBA 1ZHCA 5CO7A 4O6JA 3HKEE 1Z0PA 2OA5A 4X62T 4E7LA 2LT3A 1K9MU 4A4GA 3VKIA 3CC4T 2O31A 1G3YA 4ISSA 1Y01A 1Y71A 3MHXA 1VQ9A 1GCQC 2NW8A 1OX8A 3N9QA 3L2UA 2DERA 3OYGA 4EGWA 4HXJA 2SRCA 4M75D 2BG9E 1Q82C 5JDMA 4AI6A 4CXWA 1H3HA 4OK0A 2HEQA 1VQ5T 4UV9B 1OI1A 1RADB 1V1CA 4NOYA 4IE7A 3BQIA 1HS7A 5L3EB 2QK0A 1PRLC 2FZGB 3A8GB 4U33A 3RQWA 2KVQG 4PJLA 3Q1JA 2RHZA 1ZOYA 5HCJA 2X0HA 2R6GF 4OYJA 4LF5T 2PUKB 8AT1B 2PBIA 3RIRA 1VUBA 5GAN3 4FYVB 4Y91A 4IDPA 5LHHB 4HVWA 4PJOG 3EH1A 4O4JE 2ED1A 5GMKe 4ISTA 3RYIE 4F17A 4J6YA 3EAMA 3IHRA 2CT4A 2GF7A 2L5QA 4X65T 2G3RA 4JI3T 2KT8A 5KCHA 4O8SA 1VQNQ 3I5SA 3ZEHA 4QVCA 2PTKA 1SRLA 2D9DA 2H3EB 2WU2A 4KP3C 4YXDA 1PC0A 4IUPA 2WS3A 2R58A 4AG1C 3OYIA 5KYWA 4XBFB 4EYUA 3FB9A 2IVWA 5DABA 3QZ9B 1NJIU 1WI7A 4M78G 3WVEB 3ZT5A 1M1FA 5CR2A 3D0TA 3CCMT 2Q9QB 5FY0A 4KUDK 1MHNA 3DB4A 4H9PC 3NBXX 2RK1A 3CC2Q 3UWNA 3P4WA 3UT5E 2K2MA 4M7AF 2JN0A 3AECA 3LYIA 3CPWS 4IL9A 3OW2A 1VQPQ 5L4EA 2LMJA 2V8JA 2DZCA 3UA7A 1U8RA 3OBVE 2CEAA 1B34B 3EGXA 4PJOF 1I8FA 2DL7A 5J39A 5AQPB 1T3LA 1P92A 5GMKj 1QVGP 2XHCA 1PM3A 4K11A 2YEVC 1NLOC 2C06A 5IHIA 5L3DB 4C5EA 3RC8A 3QPHA 3I35A 4AKRB 2K6DA 3EG9B 3M58A 1QCOA 2XAFB 3F70A 2KXPB 2V7KA 4ZXLA 2C5IT 4LMLA 3TVTA 2QDYB 2KMTA 2OAUA 5CFBA 4AKLA 2AXDS 4ZI3C 1PNJA 1AZEA 4BD3A 3P8DA 4R56A 4YT0A 3RYHE 4JS5A 5I21A 1OV3A 1SF9A 4M78F 2WY2A 3LH0A 2HD0A 3MXZA 1HK9A 3MEWA 2ROTA 2LNHB 1IGQA 1K1ZA 3FBLA 1M1KC 4C8QC 2I6HA 1E7PA 1AJ3A 2YLBA 2YKSA 2RJEA 3Q5DA 1OULA 1LKXA 3GN5B 2OJ2A 3M56A 3M4YA 3AA7B 4MMKA 2JM8A 3AA1B 2X68A 3ZSSA 5KYYB 1I81A 4JUYA 4F16A 4B3RT 1ZSGA 4OVAA 1WR6A 2W4XA 2X9HA 4X9CA 2OTJA 2KBTA 1M1KR 3F57A 3LH5A 1QW1A 4RTTA 4A4HA 2XI9A 3PDYA 4U72A 5JDLA 2EFIA 4KH1B 3THKA 5AQMB 1WLPB 3EFOB 2V8IA 4RG8A 2RI3A 2ZGWA 4OB3B 3T9NA 2E70A 2RQWA 5D6WA 2W62A 2QEXQ 5CKDA 3OS1A 3QWXX 1UCUA 4F8HA 1XOVA 3GNGA 3G71Q 5HWXA 2UUBT 4MZPA 2V26A 2E12A 1FEWA 2KR3A 2LDMA 4PFPA 1CUNA 1K76A 2F5KA 4AT1B 5FLXE 4Z8XA 1QP3A 3E2UA 4FI5A 2DBMA 1WNLA 1ZUKA 2LEHA 4K0KT 4LN2A 3X1DA 2EQUA 5IXFA 2CPTA 5FVLA 3SFDA 1GBRA 3AE4A 1ZP0A 3RIAA 2X0LB 2COZA 1ABQA 4J9FA 1ARKA 2KYBA 3CCUT 2CRBA 4A4EA 4J5YA 2A28A 3RKOA 1HR0T 1K73C 3VKGA 4EIKA 3OMCA 4WBNE 2RHUA 4GOUA 2ZPHB 3HSBA 2X4XA 3OW2P 2XQ9A 4HWHA 2KXDA 1X6BA 2L3SA 5HXSA 4XTXA 2CP3A 1MIVA 1US7B 3TU4K 1SUMB 1K73R 2R5MA 1IREB 1G83A 2DWKA 2D1XA 5CAIA 3JCMb 4DNDA 2FHDA 3I1AA 2HBPA 2JT4A 2FBWA 5CKFA 4IGUA 3HL8A 5JDQA 4LF7T 3L2VA 3CPWA 4DV3T 2J6KA 3M0RA 4BAYB 5FMNA 4NUUA 3FJ5A 1HXDA 2FG0A 3CC4Q 3JB9D 2RHIA 3I55T 1N27A 3X26B 1NZ9A 2DPPB 4ZTFA 1OZ3A 2YINA 2YUPA 3IQLA 3EG0A 3QG1A 2AK5A 3C4SA 1RAIB 1Y0MA 3VR9A 5GMKh 4C8QE 4RTXA 3R6OA 2DWGA 1VQ5Q 2CREA 4R55A 1B3QA 3N9NA 1TOVA 4EEBA 3T1YT 2RQUA 4M77D 2RB6A 2DAQA 2LM9A 1BU1A 3WI3A 3EGDB 1D3BA 4YJ2E 1Q81U 1YWPA 2DM1A 3M57A 5KYXA 3CCSQ 4PJMA 2X3XD 2LLYA 5CA0E 2IW5B 1C1AA 2C0IA 4AKGA 2KGTA 4MFRA 1GCQA 1H8KA 3QC9A 3I56A 4HCCA 2BVMA 1Y57A 4Z90A 3PVLA 3C98B 3CCVA 1AT1B 2QYWA 5FU6B 4TX5A 3QDRB 2ZM0A 1M5Q1 2NW7A 2KSRA 4YTMA 3OYMA 4CI3B 3E08A 1YJNA 3ZCIA 1XTDA 2NUTA 3RNJA 4JI6T 1LJOA 3ZL7C 1WFDA 4YFSA 2VL8A 2W10A 4VUBA 3CCMQ 3UFEA 2Q9QA 1U06A 4NIQA 3KVBA 1N9SA 2LQKA 2NYSA 1YQ3A 5FVKA 2X9XA 4FIBA 3AE5A 3NVOA 4DMWA 2L8DA 1W0BA 3HKBE 1UG1A 4D8DA 4HWCA 1ZUUA 3SFEA 4A56A 2UUAT 4LF6T 2Y4XA 5HK0A 5LBMA 2X35A 3RKYA 1Y64B 1QLYA 2P4RA 3RUXA 1Q7YU 5H6QB 4MDXA 2WSFE 5DY9A 3RI5A 1NEKA 4M7AC 2GCXA 3FEOA 2Z0WA 2BTTA 2E3HA 3EABA 2VKOA 1OZ2A 2I59A 1TUDA 2ACXA 3KVAA 3CD6T 1UURA 3CXCA 3UATA 2M6IA 3I5RA 2PJQA 2XTLA 2DLPA 5LP6E 2WACA 5L3BB 1I5OB 1S35A 1AD5A 4YTLA 4JZ4A 2DZ9A 4HFCA 1ZA2B 2DO3A 2IMLA 4DV7T 5L3FB 2B76A 3PUSA 3VS1A 5KYYA 1G5VA 4OGCA 3LW5E 3RC3A 1GBQA 4DV0T 5HCMA 3G1JA 3E19A 4QH1A 2H89A 4OHFA 4AFSC 2LOPA 2UXXB 4A98A 2MAWA 3G06A 5CK9A 3ULRB 4JRQA 4EXTA 4IURA 5FRNA 4PJOB 5HXHA 2XQ5A 3G4ST 3ETVA 2CUBA 4MHCA 5H6RB 4UELA 1Y96B 3LWHA 1VQMA 1VQ6T 4LXCA 3GIBA 4GY5A 3CC7A 2EYYA 3JC6D 3UQ4A 3ESLA 3DLLA 1G3TA 3TQ7P 3PIPA 2E6NA 2X3WD 2D5UA 2JQKA 4V1Av 3RGLA 3MK7C 3TSWA 3CQXC 1J1JA 2PNIA 3FLGA 4JI8T 3PUQA 2DTIA 3C0CA 5EK2A 1H92A 4M7DB 3IEEA 5FRMA 3MEAA 3CCET 4M78B 3MACA 2YU1A 2X9YA 2BS4A 2BZ8A 4KULA 2DILA 1E7OA 4OP0A 5CA1E 1KD1C 3CCUQ 3CEYA 3RF1A 4EMGA 5HKCA 2C5JA 2VK9A 4KT0E 1KIKA 3A8LB 1YJ9T 4BDZA 2KK4A 2F2XA 2MI6A 3N5BB 2EQJA 1VQ7A 3A1PA 3GF5A 1VYUA 2NLUA 2D8JA 3LK2B 3FHNA 3ONLC 1XQHA 3ONXA 2QRXA 5JR9C 3CCJT 3JCMQ 2DTOA 4X9DA 1UECA 1Q86C 4OF1A 4JI1T 5AT1B 2FJAA 5C8YE 1KEYA 1X2QA 1IBLT 2W0GA 5DQVA 1IZ6A 2RN8A 1S94A 1D1AA 4X1VA 1PSEA 4TN7B 1NPPA 1Q86R 4KGVB 1QMCA 2HDAA 2BBJA 2E64A 3QYHB 4AFQC 3I55Q 2HSPA 3CXCP 3B5MA 2YUQA 4FYYB 2DETA 1AWXA 3UQ7A 3G6ET 1M8MA 2K3WA 3K1SA 5CGMA 3M0QA 1JQQA 5FW9A 4E47A 4LFBT 3EDUA 4TUYE 3Q5WA 4MALA 3M0SA 2X67A 4U7IA 5C2TA 3GLXA 4ZS2A 1YKEB 1K9MC 2I0NA 1IAPA 5LCYA 3KUFA 4P0AA 3AE1A 2MF2A 4B6XA 2RPNA 2YHTA 1YJWA 5F8PA 1OEDA 5LL6S 2IC9A 1GCPA 2K5LA 3QIIA 4OMLA 5AQLB 2QA4A 2PU9B 4JBWF 1IO6A 5DLQE 3PUWF 4J9IA 5AQGB 4ZZCA 2PVGB 3A8OB 1XDOA 1YBYA 3KINB 3K3NA 1K9MR 1NE8A 2GQIA 3OYDA 1AWWA 4XU1A 2WBLA 4LFCT 3VYHB 3PMTA 5LJ5d 1CHUA 3AEDA 4C8QG 2LQNA 1KF6A 1NM7A 5AYFA 1YITA 1KSWA 5KYWB 2DRMA 4J9CA 1KNPA 4YJ3E 2ZM2A 3ME9A 2ED0A 2DRKA 4FW1A 3LWIA 2ENMA 1VQNA 3AEEA 2OTLQ 4Q5WA 4QHOA 2XKOC 4CXYA 2L0AA 1MMDA 3C50A 1X01A 5DM7R 3KV5A 2EQMA 1QCFA 3EGXB 3TEEA 1UGRB 5LGTB 5J2TE 3AAAB 3JCMd 2ODVA 2EYXA 2KLQA 2HNIA 3PUXF 2KYMA 3L42A 5HK3A 2BKDN 5KH6A 2YOEA 3O5ZA 2EW3A 1YCYA 2J47A 1RL2A 4C8QF 1NJIC 3VRZA 3AE7A 4C92D 2DCFA 1J3TA 3O4XE 3UU4A 3V5SA 2F69A 1EIFA 2QXFA 2V1RA 4CI2B 1PG5B 4LMKA 1XWMA 3FJPA 4HFIA 4MMLA 3PURA 3RYCE 3CCRT 1UUEA 3VS0A 5ABGA 1NJIR 3N2OA 2BVLA 2LTOA 3MP1A 4KHPT 3CD6Q 5AQJB 3HKDE 4A5XA 4ORZA 3OJAA 2F2WA 2RH2A 2ZPIB 4N4IA 4XTWA 2M16A 2W2UA 1TXQA 5L8RE 3B13A 2EIFA 3NPFA 4EV6A 2CH4W 2C0SA 5A1LA 2BKNA 2VVNA 2XQ3A 4YSXA 1TUCA 3RESA 2R57A 4FSSA 2GBQA 4J9HA 2YT6A 4JZ3A 4UVAB 4O4LE 5A0DA 2EPDA 3ZEFB
chains in the Genus database with same CATH topology
5LNKA 1WLXA 4C0DB 4M7AA 3U3IA 3P8BB 5GAMd 2ZPEB 5CKEA 2Y4YA 5LBQB 4PJOA 2VGMA 1G73A 1Y96A 3N5LA 2LE8A 5FU7B 4XTYA 3MZKB 3PGGA 3CPFA 3META 2QEXA 3M55A 4RKUE 3QUJA 2BIVA 1MIWA 2JTFA 4P0BA 3G71A 4AKIA 5EG2A 4LDUA 2WSEE 3OQ5A 1Y07A 4M78A 4I4TE 2V8KA 3JC6C 3V8LA 1Y7XA 3RMSA 5M9OA 4MDWA 3WXMB 4UEMA 1BIBA 2LSYA 4LD6A 2F5TX 3MP8A 4IUVA 3UUNA 4JEUB 4F7UE 4B9XA 2EWNA 5LJ5e 2WMOA 3LGFA 1QSDA 3CWZB 3IBPA 2A3LA 5J2UE 4HKAA 4WBOA 4CRIA 4E7HA 2QA7A 2D0QB 2QQBA 1VIFA 2Y8DA 1UB4A 3JAME 1D1CA 2DXTA 5DJQC 3PNWC 3OYHA 3VV0A 5GANd 4E7ZA 4M75F 4AXPA 5EK4A 2EHOB 3CC4A 3GA8A 3JSCA 2NW9A 2JUFA 4L5GA 5JR9A 1D3BB 1G8XA 4GLKA 1QP2A 3O8VA 3ZBDA 2P9BA 3S3OA 3OS5A 1KQ2A 3CCST 1BR0A 2R5AA 5CQYA 4M7AG 5LHGB 1HF8A 3QKJA 1VQKA 3SWNC 1WQ7A 4ADZA 1O3XA 3A8HB 5KDMC 1HFAA 3OMGA 4PK6A 3PIOA 5JDGA 4O2AE 3ASKA 3X28B 2ES0A 1Q81C 3T8OA 4ZHQE 1NAFA 4E7SA 2A2FX 5JDNA 3EUHA 5GMKl 3TCJA 4C91A 4ELYC 2K5BB 3O9XA 3QYGB 4BACA 5GAMe 4C0ZA 2ODUA 4OB2B 4ZGEB 1FX7A 3A8MB 3PUAA 1UGQB 2EJFA 4EIWA 2MOZA 3ZFJA 2CZ7B 2KY9A 3OB9A 4PAGA 4XAXB 1U1TA 1M1GA 2LX9A 3C94A 3C95A 2CLYC 4JRPA 3JCMW 2HPJA 4HKEA 4B9WA 1D1BA 4BI8B 1X6OA 3CMLA 3X24B 4C92C 3OSVA 3CX8B 3OYZA 4RCCA 2CWYA 4XZCA 1M90U 5LGUB 3NFCA 5LJ5g 4DQ2A 5DLOA 5A0LA 3BFMA 1O9SA 4YLHA 3OYFA 2M0OA 4M7DD 4IUUA 5IN1A 3N9OA 1W2BS 2E5QA 3J81E 1U4QA 2K4YA 2JMKA 1FMWA 2D2SA 2DD5A 3HRTA 2LHRA 2O4XA 3OA6A 2RM4A 4ZGJB 3S3MA 3I9YA 4C8QB 3TKLB 5GANe 4F6RC 2VUBA 4JRIA 5IAYA 5JQGE 3L1AA 4ZN3A 3CQCB 2QQAA 4N0AC 3KV6A 2PVOB 5LHIB 5LJ5h 2D6FA 3EVYA 2CZ0B 3GPLA 2LOSA 1YW0A 1ZV4X 3JB9G 3PMIA 4J7FA 2P0PA 3M4GA 2Y48B 3P8CD 5JDHA 5GAN4 2ZCFB 2WSCE 4PKCC 1XNIA 4XU0A 3ZMVB 5FROA 3HI2A 3N9LA 1JBMA 3PUGA 1LNXA 5GANj 1U5PA 4JLGA 2KWIB 2E9XA 3OS2A 2XAGB 5HXRA 2DVEA 5ETWA 5EK3A 5IYZE 2WM9A 3K8PC 3NZQA 3V7SA 2XK0A 3ZN0B 1WYCA 3JB9F 5GAMg 3QJYA 2LNVA 3OBYA 2EAYA 1Q82U 3CPZA 3BDLA 5FXVA 2K5IA 2YLCA 3UDCA 5KE3A 2P4TA 1VQOA 4C92E 3GP8A 5LJ3d 3V7CA 1V29B 4J8OA 4UF0A 5LXTE 2EHOA 2XAQB 4M77F 2XG8D 2N9DA 3I55A 5LG4A 4PLIA 2JRKA 5JVDE 3J9X1 2FL7A 2RK2A 4M75C 1D0XA 3L09A 2CGHA 2NP9A 1JRIA 4KBMB 3CCQT 1QUUA 2RJCA 3BQLA 2KNDA 1FWZA 5GAMh 5GAOl 3ZC0A 3HPWA 1TH7A 1LVKA 2W00A 5CQXA 1WJSA 1W2BA 1QVFS 3MEUA 4F7UF 5AFUL 4KMCA 3EFSA 4AKHA 3OYEA 1N9RA 2OTLT 4C90A 3OY9A 1YJNT 5GAOp 2CXLA 5HXCA 2DXUA 4QX8B 3PU3A 1BI0A 4EMKC 3NTHA 4AQFC 4IE0A 4I43B 5FXWA 2D0UA 1YHQA 3SWNA 1R8OB 5GANg 3AAEB 2ZLYA 1KC8U 1JJ2S 3KV4A 3L2ZA 5C6SA 3CBMA 2XDBA 2MWOA 1DJ7B 4PNOA 3NTKA 3X20B 1YIJA 2XICA 1I5LA 1FXXA 3M9QA 5GAN2 3URGA 3PTRB 3GMIA 5C0MA 3I0OA 5J1GA 4D6WA 4E7JA 3DB3A 4JLIA 1ZHIA 4JLEA 4RMOA 2GFAA 4II1A 4EDUA 4ZN1A 2L89A 3KBTA 3INZA 3JB9J 4C0GA 3M65A 3LBXA 4ERRA 3SS1A 2HPLA 2ZPGB 3RKWA 4LDWA 5CKHA 3I0QA 1MGQA 5GANh 4ZI2D 5GAOn 3I9WA 2VYTA 3KBGA 3CD6A 1YD8G 1GXIE 3BY7A 4E7KA 3QSUA 4M7AB 5L3GB 1HG2A 2X4WA 3HP9A 2RI2A 3C12A 3MCAB 4M75E 1KHIA 4XU2A 5GANf 1EZ3A 5GMKi 5IHYA 2JNGA 2V7JA 4C8QA 3HRUA 2CZ1B 2XASB 3SRZA 3NRYA 4MZMA 3FBZA 4G2AA 1WPYA 3CMEA 2M9UA 4C5IA 3RRCA 4PW8A 4DOVA 3QHSA 1IZNB 1U1SA 3LLRA 3CCEA 3J80E 2NOXA 3MJXA 1S72T 1QVFA 4QKNA 1KG1A 1VQ7T 4QW2A 3C4XA 3HKSA 4JUVA 2X66A 1ZEEA 1YI2T 2M1HA 5LA6E 4BE1A 3HL6A 4DMVA 4EAHA 4DBRA 1UGPB 2VGNA 3SFMA 1JJ2A 1V9DA 3HKCE 3RPUA 2YRVA 2CE7A 3HRSA 2CKKA 4J7IA 3J7AF 4BY6C 3ZYLA 2GFUA 4BE2A 1G3SA 5JR9B 4TV9E 4IUTA 4KUMB 4EZHA 3LGLA 2QQ9A 4HTEA 3VUZA 5FXZA 3S4UA 2NWBA 1PSFA 2DJZA 1UX4A 2BZBA 5GONE 2Q9QD 4ZTJA 1HCIA 2LCLA 5LJNA 4OMFB 1LVFA 3M54A 3N9MA 3CQGB 4M77C 1YJWT 2QA4T 2QGSA 3RX6A 3WAKA 4M7DE 4MZTA 4C92G 4EOZB 3PTAA 3P7IA 1WJRA 3OYAA 3DTOA 4H63V 2B1EA 2VC8A 3AVSA 2WMNA 2XAHB 4OYKA 3OYXA 4M75A 4OB1B 3KV9A 3CCLT 3GOXA 3V8JA 4GK5E 4O4IE 2DIGA 2MWPA 2CMRA 5F3JA 3CC2A 1G3WA 2CYZB 4QQGA 3FRNA 5GAN5 1VQPA 2CS7A 3RRWA 4X1IE 4C92F 1FMVA 4UV8B 2BDEA 3OKQA 5DQWA 4A4FA 2KINB 2L8KA 4X20E 4FM4B 3KDSE 4ZI3D 4JJNK 2DXBA 3K3QC 4EMKA 5I2SA 4ILUA 5FNVE 4AQFA 4L59A 4C8QD 3SWHA 4XQ3A 4MLKA 1UX5A 3DKMA 2Y90A 3L2WA 5IT9E 2EQKA 3MO8A 5FY7A 3U78A 4DA4A 3RERA 2YK0A 2DEQA 1VQ8T 2VXEA 4K0UA 4J6XA 2FB7A 3C51A 1SHZC 1RI0A 2O4XB 5LJMA 3OYLA 2PQWA 5J26A 4AQGA 2KAFA 1ZKEA 2LC4A 4ZI2C 3HR0A 2LVMA 2CXDA 4M77E 1X75C 2EKOA 2QI2A 4LDVA 2KSSA 2JJ9A 3OBWA 3HHTB 2JOYA 2FYKA 5HAXA 4QQ6A 3OYCA 1I4K1 1KD1U 4MBQA 4UVBB 4A54A 3X25B 5FXXA 4BDYA 3ER0A 1D0YA 5JRCA 4M75G 2VASA 3ZYKA 3FC3A 2CA5A 4RCBA 4P5NA 2GQVA 2K48A 1VQ4T 2QQSA 3M5AA 3ZMTB 5D6XA 5BMVE 2ZPBB 3OS0A 2H7VC 2Y6XA 2E9XB 3DJBA 4H9SE 1VQLT 3CMAT 5EZYE 3RYFE 3AA6B 3N2GE 4HN9A 3W15B 2XAJB 2K2VA 4IE5A 3NRXA 3OYKA 5E0OA 5FYMA 5D6YA 3OYNA 1VQ9T 4IKFA 5GAOq 3JCMe 4UF0B 2NTXA 2EJ9A 2JTMA 4XU3A 2X51A 2ZM8A 4V2SA 3KXTA 4O2BE 2E8IA 3R84B 2L9QA 4U74A 4DOWA 4UC4A 2AHJB 4EPCA 3OSSC 1YKHB 1MMAA 5LJ5j 4XTVA 3L2RA 2V7IA 1VQ5A 4PL6A 4IUQA 1KQ1A 4H9RC 3VKHA 3F2EA 3M53A 2SPCA 2LCCA 4QQDA 4E7IA 2EJGA 2MTQA 3CCSA 4CZZB 1VQKT 4CI1B 3DLMA 3C4ZA 2V7MA 2Q9QC 3Q5XA 3QBYA 2PFVA 2KDSA 3VYGA 4EB6E 1FIOA 4LD9K 4DO0A 3MA9A 3EDVA 4IE4A 4QXHB 1SSFA 3E9FA 4X34A 1QVPA 5ADXL 3SWNB 4RG2A 4XTUA 4HCZA 1VIEA 4GIWA 1WGSA 4M77A 4BI4A 2XDPA 4J2CA 1KNZA 4N4HA 3SOLA 3RH3A 4HFVA 3CCMA 2O01E 2MBGA 1K8AU 4M7DG 2RHXA 1M9SA 2H7OA 2LSGA 2A3DA 3NZPA 2JQQA 2WWUA 2JZ2A 3EFRA 5M4YA 1JB0E 5GAOr 1NPRA 3L3PA 4M7AD 4PFOA 5HWYA 4QX7B 3G7ZA 2NTYA 3JB9H 4ATOA 2N2NA 1N8RU 4PJOD 2XHEB 4QXCB 1UGSB 4H9OC 3UUMA 3HA4A 4UVCB 3V7RA 3LBXB 1KC8C 3S3NA 3PE0A 5GAMj 3ZN1B 2X9WA 4F7UA 4PJJA 2RD1A 1Q7YC 2XIDA 2IAKA 2PG8A 4M7DF 2LRQA 2N1GA 3V5UA 4M78D 2I2LA 2KQWA 2W63A 5CVIA 2OTJT 2CLYB 2RP4A 3JB9I 4DBQA 2P0QA 4A53A 3M59A 4G63A 4C92B 3JCMg 1MIYA 2DK3A 3Q2MA 2HQXA 5KMGP 4FU6A 4O5VA 3H37A 5KE2A 3K3OA 2YU2A 4H9NC 4PK5A 5JH7E 4WW0A 1NWMX 4OB0B 4GYSA 4HE8A 3ANWA 2RA1A 2H3JA 4EYYR 3DP7A 3JCMV 4WF2A 3CCUA 4M77G 5LJ5f 5J3BA 3WVDB 1LRZA 3UTKA 3KBUA 1O75A 3JCMh 4TVRA 3SDZA 4ZS3A 2E65A 1MMGA 1MNEA 1KK7A 3V8KA 3N2KE 4IHJE 3B57A 2P0KA 3J7Yq 1B7TA 1BI1A 2EYQA 4LDXA 3CXCS 3PT9A 3JCMf 1ZQ1A 4TV8E 3E0ZA 4I50E 3JRZA 5A0GA 4C0FA 4BI3A 4F7UG 5CKBA 5GMKm 1BR1A 1KHCA 1VQOT 2HH7A 3O1IA 1UEBA 4ZOLE 3TREA 1N6AA 4CXXA 2LT4A 3LX7A 4OFZA 1W4SA 2VKDA 4DVDA 3UUXB 4HGAA 4I55E 3CX7B 5FU6C 2CM0A 4ZI7E 4CI0C 3GNFB 1WYBA 1AHJB 3ZMUB 3QXEB 4ELZC 3CCQA 3VHLA 4HT8A 3BK9A 3I56T 2H3RA 4UIGA 3SB2A 4YHJA 4HT9A 3CCVT 2DTHA 2VV5A 1LOJA 2V7LA 2CZ6B 3FXDB 2K3XA 3L2QA 3ZCJA 4M75B 5GAMf 3ZLIA 3C4WA 2CXFA 4QXBB 4ME7A 5GAN6 3BW1A 2OTLA 2CCQA 4Y28E 4L0RA 1YHQT 4P09A 2LT1A 3AHUA 2QTXA 2RJDA 1ZBXA 5TAOA 2JMHA 2K24A 1YIJT 4QVZA 2X4JA 5L3CB 1OXZA 3JCMP 3JCMc 2KT9A 1B34A 4JRKA 4BB7A 5FP3A 3MP6A 1M1KU 4EMKB 3LG7A 2M67A 3JCMX 5LYJE 5JREA 2A72A 3LJCA 3AVRA 2DXCA 4XTZA 4PJOC 3VU7H 4UXNB 3UT1A 2DIQA 2WAUA 4QWNB 4XK8E 3KFWX 1X79A 2L3LA 2VB6A 2DKGA 3QK6A 2RJFA 4FL6A 1BR4A 3E1SA 2MAMA 2C5KT 2KWHA 3FB2A 2KMFA 3GN5A 3QUIA 4FSXA 3FDRA 4CQIA 3E9GA 4BJNA 3MKDA 2E41A 3UULA 2PUOB 4M7DC 3H3AA 1VQMT 4M78C 5JDFA 4C92A 3CC7T 3G4SA 1KQSS 2E1HA 2E9XD 4NUVA 5LJ3e 1VQ6A 2ZMAA 2JVVA 5KCOA 4C5GA 4ASKA 2VXFA 1K73U 1IJ5A 3O1JA 4BUGA 5GAN8 5JRCB 5HXEA 2XQYA 4L9IA 1BYMA 3CMET 3CBPA 2IC6A 4HEAA 1E1HB 2XUEA 1H641 3CX6B 2K5FA 2CWOA 4TZ4C 2WSSV 2MMPA 2EHOD 2JPFA 1M8VA 4FT2A 4H9QC 1YJ9A 4C5HA 4M1PA 4BJMA 3Q9DA 3IF8B 4ANJA 1WRDA 2DI4A 2DD4A 1MNDA 4N0AA 5LJ3j 1S72A 3CBOA 2PVDB 3HFNA 4BE0A 1OWAA 3CCJA 3A5ZB 5HY6A 5GAOm 2A7YA 4FJOA 2LHNA 1YI2A 4N78D 1HTJF 2LSIA 3NTIA 2LJLA 3VUBA 4M7AE 3UPUA 5A2QE 2FVUA 2VKJA 4PJOE 3G6EA 3LFMA 1BR2A 1HG5A 3OYBA 3H8ZA 4JEHB 1BKBA 2G0UA 2X4YA 3JCMJ 3RMQA 3R6NA 2VKHA 2B8AA 3PU8A 2E6ZA 3AA0B 2VWAA 2IG0A 4BY6B 4EZ4A 4M78E 4JS4A 2J1DG 3LK3B 4N4GA 4L6V5 2HQEA 1H7CA 2K3YA 2LSKA 1H3ZA 3F31A 4IE6A 3QZ5B 1YITT 1WJQA 2DLRA 4LDYA 2RI5A 5KX5E 2UXNB 2DNXA 3ZMZB 3E22E 1VQNT 3EAEA 4M77B 1KQSA 1QVGS 3ZJ2A 3QO3A 3ZC1A 3P8HA 4HA8A 5HYAA 3CCLA 3C64A 5LJ3g 3CC2T 4IDZA 3S6WA 2KZ7B 1T98A 1VQPT 5LOVE 3ZJ1A 4PJNA 4WNKA 3O1HA 4NL2A 2HAXA 2L3RA 2QQRA 4OGEA 1D0ZA 1K8AC 3H6ZA 4F7UB 3BQKA 2LSJA 4O4HE 4BA9A 3CCRA 4H63H 3CVRA 2RHYA 4C0DC 2K9AA 5LJ3h 1N8RC 3BDUA 5CIUA 2V1DB 1BI3A 4X1KE 3SD4A 3VU3C 4QVDA 4GYRA 5FU7C 2RA2A 3QJ6A 3ZMSB 2RO0A 2ZZDA 2E10A 1M90C 4J6WA 2Z6EA 2XD0A 4NS5A 1VQ8A 1VOMA 4EMHA 1SA0E 3FIFA 4KUIA 5LJ3f 2D0TA 4J83A 1BIAA 4JDSA 2K57A 5LGNB 3CKDA 4PNIA 5CB4E 2QEXT 2XU8A 4GK0E 1MMNA 1BI2A 3MEVA 4HCBA 5L2LA 3FXEB 2D9TA 3G71T 3VJPA 3GWHA 1IJ6A 2MYSA 3ETUA 3ANWB 4NL3A 2BUDA 4PLLA 2XDDA 4Z02A 3OW2S 1OYXA 3AAIA 2E9XC 4FT4A 5FY1A 4IIJE 1WQWA 2DHRA 1HX8A 3PFSA 2LQ8A 4M7DA 1Q86U 3OYYA 5GAN7 4X1YE 3LK42 1VRBA 1VQ4A 4PK4A 3N9PA 3ZYMA 5CCAA 3ZPOA 3RKXA 3OYJA 3A5XA 1M4ZA 1VQLA 1QVGA 2W61A 2EHOC 2GK9A 4A4KA 3CMAA 3HFOA 5I2MA 3WAJA 4ZGDB 2ZPFB 3AB3B 1ZHCA 5CO7A 4O6JA 3HKEE 1Z0PA 2OA5A 4E7LA 2LT3A 1K9MU 4A4GA 3VKIA 3CC4T 1G3YA 4ISSA 1Y71A 3MHXA 1VQ9A 2NW8A 3N9QA 3L2UA 3OYGA 4M75D 1Q82C 5JDMA 4AI6A 4CXWA 4OK0A 1VQ5T 4UV9B 1OI1A 4NOYA 4IE7A 3BQIA 1HS7A 5L3EB 3A8GB 2KVQG 4PJLA 3Q1JA 2RHZA 4OYJA 2PUKB 2PBIA 3RIRA 1VUBA 5GAN3 4Y91A 5LHHB 4PJOG 4O4JE 5GMKe 4ISTA 3RYIE 4J6YA 3IHRA 2GF7A 2L5QA 2G3RA 5KCHA 4O8SA 3ZEHA 4QVCA 3OYIA 4KP3C 4IUPA 2R58A 4XBFB 4EYUA 3FB9A 2IVWA 5DABA 3QZ9B 1NJIU 4M78G 3WVEB 1M1FA 5CR2A 3D0TA 3CCMT 2Q9QB 5FY0A 4KUDK 1MHNA 3DB4A 4H9PC 3NBXX 2RK1A 3UWNA 3UT5E 4M7AF 2JN0A 3CPWS 3LYIA 3OW2A 2V8JA 2DZCA 1U8RA 3OBVE 2CEAA 1B34B 4PJOF 1I8FA 5J39A 1P92A 5GMKj 2XHCA 2C06A 2YEVC 5L3DB 4C5EA 3RC8A 3QPHA 4AKRB 3M58A 2XAFB 3F70A 2KXPB 2V7KA 2C5IT 2QDYB 2KMTA 2OAUA 4AKLA 4ZI3C 4BD3A 3P8DA 4R56A 3RYHE 4JS5A 5I21A 4M78F 3LH0A 2HD0A 3MXZA 1HK9A 3MEWA 3FBLA 1M1KC 4C8QC 2YLBA 1AJ3A 2RJEA 1LKXA 3GN5B 3M56A 3M4YA 3AA7B 4MMKA 3AA1B 2X68A 1I81A 4JUYA 4OVAA 1WR6A 2X9HA 4X9CA 2OTJA 3F57A 1QW1A 4A4HA 2XI9A 3PDYA 4U72A 5JDLA 2EFIA 2V8IA 4RG8A 2RI3A 2ZGWA 4OB3B 3T9NA 2E70A 5D6WA 2W62A 5CKDA 3OS1A 1UCUA 1XOVA 3GNGA 5HWXA 4MZPA 2V26A 2E12A 1FEWA 2LDMA 4PFPA 1CUNA 2F5KA 5FLXE 4Z8XA 1QP3A 4FI5A 1WNLA 2LEHA 2EQUA 2X0LB 3CCUT 4A4EA 4J5YA 3RKOA 1K73C 3VKGA 3OMCA 4WBNE 2RHUA 4GOUA 2ZPHB 3HSBA 2X4XA 4XTXA 5HXSA 1MIVA 1US7B 3TU4K 2R5MA 1IREB 2DWKA 5CAIA 3JCMb 4DNDA 2FHDA 3I1AA 2HBPA 5CKFA 4IGUA 3HL8A 5JDQA 3L2VA 3CPWA 4BAYB 5FMNA 4NUUA 1HXDA 3JB9D 2RHIA 3I55T 1N27A 3X26B 1NZ9A 2DPPB 4ZTFA 1OZ3A 2YINA 3QG1A 3C4SA 5GMKh 4C8QE 3R6OA 2DWGA 4R55A 3N9NA 4M77D 2RB6A 2DAQA 2LM9A 3WI3A 1D3BA 4YJ2E 1Q81U 3M57A 4PJMA 5CA0E 2IW5B 4AKGA 4MFRA 3QC9A 3I56A 4HCCA 2BVMA 3CCVA 3C98B 5FU6B 4TX5A 3QDRB 2ZM0A 1M5Q1 2NW7A 3OYMA 4CI3B 3E08A 1YJNA 3ZCIA 1XTDA 1LJOA 4YFSA 2VL8A 4VUBA 3UFEA 2Q9QA 3KVBA 1N9SA 2LQKA 2X9XA 4FIBA 4DMWA 2L8DA 3HKBE 4A56A 2Y4XA 5HK0A 5LBMA 2X35A 3RKYA 1Y64B 3RUXA 1Q7YU 4MDXA 5H6QB 2WSFE 5DY9A 4M7AC 2GCXA 3FEOA 2VKOA 1OZ2A 2I59A 2ACXA 3KVAA 3CD6T 3CXCA 2PJQA 2XTLA 2WACA 5LP6E 5L3BB 1S35A 4YTLA 2DZ9A 2DO3A 5L3FB 3PUSA 1G5VA 4OGCA 3LW5E 3RC3A 3E19A 4OHFA 2LOPA 2UXXB 5CK9A 4JRQA 4EXTA 4IURA 5FRNA 4PJOB 5HXHA 3G4ST 3ETVA 4MHCA 5H6RB 4UELA 1Y96B 3LWHA 1VQMA 1VQ6T 3GIBA 4GY5A 3CC7A 3JC6D 3ESLA 3DLLA 1G3TA 3PIPA 2E6NA 2D5UA 4V1Av 3MK7C 3CQXC 3FLGA 3PUQA 2DTIA 5EK2A 4M7DB 3IEEA 5FRMA 3MEAA 3CCET 4M78B 3MACA 2YU1A 2X9YA 4KULA 4OP0A 5CA1E 1KD1C 3CEYA 4EMGA 5HKCA 2C5JA 2VK9A 4KT0E 3A8LB 1YJ9T 4BDZA 2KK4A 2MI6A 3N5BB 2EQJA 1VQ7A 3GF5A 2NLUA 3LK2B 3FHNA 1XQHA 3ONXA 5JR9C 3CCJT 3JCMQ 2DTOA 4X9DA 1Q86C 4OF1A 5C8YE 2W0GA 5DQVA 1IZ6A 1S94A 1D1AA 1PSEA 4TN7B 1NPPA 2E64A 3QYHB 3G6ET 4E47A 3EDUA 4TUYE 3Q5WA 4MALA 2X67A 3GLXA 4ZS2A 1YKEB 1K9MC 1IAPA 5LCYA 3KUFA 4P0AA 2MF2A 4B6XA 2YHTA 1YJWA 5F8PA 5LL6S 2IC9A 2K5LA 3QIIA 2QA4A 2PU9B 5DLQE 3A8OB 2PVGB 1YBYA 3KINB 3K3NA 1NE8A 3OYDA 4XU1A 2WBLA 3VYHB 3PMTA 5LJ5d 4C8QG 5AYFA 1YITA 4YJ3E 2ZM2A 3ME9A 3LWIA 1VQNA 4Q5WA 4QHOA 2XKOC 4CXYA 1MMDA 3C50A 1X01A 5DM7R 3KV5A 2EQMA 3TEEA 1UGRB 5LGTB 5J2TE 3AAAB 3JCMd 2ODVA 2KLQA 2HNIA 3L42A 5HK3A 2BKDN 5KH6A 1YCYA 1RL2A 4C8QF 1NJIC 4C92D 2DCFA 3O4XE 3V5SA 2F69A 1EIFA 2QXFA 4CI2B 3FJPA 4MMLA 3PURA 3RYCE 3CCRT 3N2OA 2BVLA 2LTOA 3MP1A 4XTWA 3HKDE 3OJAA 2ZPIB 2RH2A 4N4IA 2M16A 5L8RE 3B13A 2EIFA 2C0SA 5A1LA 3RESA 2R57A 4UVAB 4O4LE 5A0DA 3ZEFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LT4 A;  4KMC A;  4MFR A;  4XAX B;  2LT1 A;  2LQK A;  2LT3 A;  4ILU A;  4KBM B;  4L5G A;  2EYQ A; 
#chains in the Genus database with same CATH topology
 5LNK A;  1WLX A;  4DR7 T;  4C0D B;  1PD1 A;  4M7A A;  3U3I A;  3P8B B;  5GAM d;  3M0T A;  1VYV A;  2ZPE B;  2PTF A;  5CKE A;  2Y4Y A;  5LBQ B;  1OOT A;  4PJO A;  5KXJ A;  3G4S Q;  2M6B A;  2VGM A;  1G73 A;  1WIE A;  1Y96 A;  4ESR A;  1VQ6 Q;  3N5L A;  2LE8 A;  5AQQ B;  5FU7 B;  4XTY A;  4FCY A;  3MZK B;  3H0H A;  1GRI A;  2DL5 A;  3PGG A;  3CPF A;  3MET A;  2LJ3 A;  2QEX A;  3M55 A;  4RKU E;  3QUJ A;  4IIO A;  4OMQ A;  4PFZ A;  2BIV A;  3EG1 A;  1MIW A;  3VRB A;  2JTF A;  4P0B A;  3G71 A;  4AKI A;  7AT1 B;  1PRM C;  5EG2 A;  2CP6 A;  1KQS P;  4AIU A;  2WSE E;  4KGX B;  4LDU A;  3L8R A;  3OQ5 A;  3CCE Q;  2YWW A;  1Y07 A;  4M78 A;  4I4T E;  2HKQ B;  2V8K A;  3JC6 C;  3V8L A;  4NXN T;  1Y7X A;  3RMS A;  1M3B A;  5M9O A;  4MDW A;  3WXM B;  4UEM A;  1BIB A;  2LSY A;  4LD6 A;  4LMJ A;  2F5T X;  2YSQ A;  3T1H T;  3AT1 B;  1NEN A;  2FUP A;  4CN4 A;  1WHH A;  1YJ9 Q;  2OV9 A;  2V5C A;  1WHG A;  3MP8 A;  4HVV A;  2DX1 A;  4IUV A;  3UUN A;  2EKH A;  4JEU B;  4F7U E;  4B9X A;  2H88 A;  1TG0 A;  2HBW A;  3PJA A;  1UJ0 A;  2EWN A;  5LJ5 e;  3CCJ Q;  2WMO A;  3LGF A;  1QSD A;  5IHN A;  3CWZ B;  3IBP A;  2A3L A;  5J2U E;  4HKA A;  4WBO A;  4CRI A;  4E7H A;  2QA7 A;  4NXM T;  2D0Q B;  2QQB A;  1VIF A;  2Y8D A;  1UB4 A;  3RLF F;  2NWM A;  3ONJ A;  4OMO A;  3JAM E;  1XMQ T;  2EYZ A;  1D1C A;  3ABV A;  2DXT A;  5DJQ C;  3PNW C;  3OYH A;  1SE7 A;  3VV0 A;  2XSB A;  5GAN d;  4E7Z A;  1LCK A;  4M75 F;  1W0A A;  4AXP A;  1A0N B;  1Z8U A;  1NG2 A;  5EK4 A;  4RTY A;  3G6E Q;  2EHO B;  3CC4 A;  3GA8 A;  3JSC A;  2NW9 A;  2JUF A;  2EGE A;  4L5G A;  1SPK A;  5JR9 A;  1D3B B;  1G8X A;  2YDL A;  4GLK A;  1QP2 A;  3O8V A;  3ZBD A;  4HWD A;  5KYX B;  1RAG B;  2P9B A;  3S3O A;  3OS5 A;  1KQ2 A;  3CCS T;  2J4G A;  2MK5 A;  1BR0 A;  2R5A A;  2OX7 A;  2YUN A;  5CQY A;  4M7A G;  5AQF B;  5LHG B;  1HF8 A;  3QKJ A;  1VQK A;  3SWN C;  1WQ7 A;  4ZNX A;  3U23 A;  2HZY A;  4ADZ A;  1K0S A;  1O3X A;  3A8H B;  5KDM C;  2LRK A;  1HFA A;  4CN1 A;  1QCN A;  4Z89 A;  2E2A A;  4PK6 A;  3OMG A;  1AWO A;  5L23 A;  4HWF A;  2AIR B;  3PIO A;  2WWV A;  5JDG A;  1W9R A;  1OU9 A;  2K79 A;  4O2A E;  3ASK A;  3PV0 F;  3X28 B;  3QB5 A;  2ES0 A;  4A63 B;  1Q81 C;  3T8O A;  3AE8 A;  3RQU A;  4ZHQ E;  4JJB A;  1NAF A;  2NUT B;  2V5D A;  1UGO A;  1UDL A;  4ZEY A;  4E7S A;  4B6M A;  2A2F X;  5JDN A;  1M7K A;  1IHV A;  3IA3 A;  5ABH A;  3EUH A;  1RAH B;  3CK6 A;  5GMK l;  3TCJ A;  4C91 A;  4ELY C;  3OPC A;  2K5B B;  2XMF A;  2FJB A;  3O9X A;  1Q81 R;  3QYG B;  2DF6 A;  4BAC A;  5GAM e;  3VS4 A;  4C0Z A;  4GLM A;  1BCO A;  2ODU A;  4OB2 B;  4ZGE B;  2QAZ A;  1FX7 A;  3A8M B;  3PUA A;  1UGQ B;  2DFU A;  4DV2 T;  2EJF A;  4EIW A;  4TNW A;  2MOZ A;  3ZFJ A;  2W66 A;  2CZ7 B;  2GTJ A;  2KY9 A;  2B86 A;  3OB9 A;  4PAG A;  4XAX B;  1U1T A;  1M1G A;  2LX9 A;  1GFD A;  3EGU A;  3C94 A;  1N5Z A;  1KFZ A;  2HMA A;  3C95 A;  1WHJ A;  2CLY C;  2XZE A;  2GTO A;  4B3M T;  2QAS A;  4JRP A;  3JCM W;  3UU3 A;  4IRE A;  4E2F B;  1WX6 A;  2HPJ A;  3CCR Q;  4HKE A;  1JNZ A;  1UGV A;  1D1B A;  4B9W A;  2GGR A;  2J06 A;  4BI8 B;  1X6O A;  3CML A;  2JM9 A;  2JS0 A;  5HEH A;  3PUV F;  3X24 B;  4HFH A;  1SRM A;  2E3I A;  3OSV A;  3CX8 B;  3OYZ A;  4RCC A;  4C92 C;  2CWY A;  1W09 A;  4XZC A;  4KI0 F;  1M90 U;  5AQS B;  5LGU B;  3NFC A;  5LJ5 g;  4DQ2 A;  5DLO A;  5A0L A;  1RUW A;  3BFM A;  5AQT B;  1O9S A;  4YLH A;  1SHF A;  2J6F A;  3OYF A;  2M0O A;  4M7D D;  5FL1 A;  4IUU A;  3ZT6 A;  5IN1 A;  5HEJ A;  3N9O A;  2ECZ A;  1W2B S;  2E5Q A;  3J81 E;  1U4Q A;  1N32 T;  2K4Y A;  2JMK A;  1Q7Y R;  1FMW A;  2D2S A;  2DD5 A;  2A9U A;  2LHR A;  2O4X A;  3HRT A;  2FZC B;  5AQH B;  2KRM A;  3OA6 A;  3P50 A;  1OPK A;  2RM4 A;  4ZGJ B;  3NGP A;  3S3M A;  2BG9 A;  3I9Y A;  4C8Q B;  3TKL B;  5GAN e;  4F6R C;  2VUB A;  2CT3 A;  4U2Y A;  2JMA A;  2KRN A;  4JRI A;  5IAY A;  5JQG E;  3L1A A;  4ZN3 A;  3CQC B;  2QQA A;  4N0A C;  3KV6 A;  2PVO B;  5LHI B;  5LJ5 h;  2D6F A;  3EVY A;  2L3Q A;  4JPB W;  2CZ0 B;  1IXD A;  3GPL A;  4JV5 T;  2LOS A;  1YW0 A;  1ZV4 X;  3JB9 G;  4UR9 A;  2QGG A;  2HSE B;  3PMI A;  2K7A A;  2LM2 A;  1XZY A;  4J7F A;  2P0P A;  3M4G A;  2Y48 B;  3P8C D;  3CQT A;  5JDH A;  5GAN 4;  2ZCF B;  2WSC E;  4PKC C;  4TWD A;  1XNI A;  4XU0 A;  3ZMV B;  5FRO A;  3HI2 A;  3N9L A;  1JBM A;  3PUG A;  1LNX A;  1XJW B;  5GAN j;  1U5P A;  2A08 A;  2BBH A;  4JLG A;  2KWI B;  2E9X A;  3OS2 A;  1AEY A;  2XAG B;  5HXR A;  2DVE A;  5ETW A;  5F5W A;  5EK3 A;  1KJW A;  1UHC A;  5IYZ E;  2WM9 A;  3K8P C;  1C6V X;  3NZQ A;  3V7S A;  2XK0 A;  1N34 T;  3ZN0 B;  2M51 A;  4Q25 A;  1E6H A;  1WYC A;  3JB9 F;  5GAM g;  3QJY A;  3TLS A;  2LNV A;  2BZX A;  2BZY A;  3OBY A;  2EAY A;  1Q82 U;  3CPZ A;  3JAD A;  4X66 T;  2F4V T;  1GL5 A;  4WZX A;  3BDL A;  4WTO B;  5FXV A;  1OU8 A;  2K5I A;  2YLC A;  3UDC A;  5KE3 A;  1WR0 A;  2P4T A;  2VL0 A;  4C92 E;  1VQO A;  3GP8 A;  5LJ3 d;  3V7C A;  1V29 B;  4J8O A;  2EBP A;  4UF0 A;  5LXT E;  2EHO A;  2XAQ B;  2OAW A;  4M77 F;  2XG8 D;  2N9D A;  3I55 A;  5LG4 A;  4PLI A;  2JRK A;  4TWF A;  5JVD E;  1S1N A;  2HKN A;  2KNB B;  3J9X 1;  5AQV B;  2FL7 A;  1EZZ B;  2P84 A;  2RK2 A;  1OED B;  3PJA J;  4M75 C;  4DUZ T;  2A37 A;  1OQK A;  1D0X A;  3L09 A;  2CGH A;  2NP9 A;  1JRI A;  4KBM B;  3CCQ T;  1QUU A;  2RJC A;  3BQL A;  2KND A;  2XQ4 A;  1FWZ A;  3UU5 A;  2DMO A;  5GAM h;  5GAO l;  3LSV A;  3TSZ A;  3ZC0 A;  3HPW A;  2JMC A;  1TH7 A;  1LVK A;  2W00 A;  3ZT7 A;  4ZZB A;  5CQX A;  1BBZ A;  1WJS A;  2V1Q A;  4HCK A;  2EVR A;  1W2B A;  2JS2 A;  3MEU A;  4F7U F;  1QVF S;  5LB7 B;  5AFU L;  2DEU A;  4KMC A;  3EFS A;  4AKH A;  3UU8 A;  3OYE A;  1N9R A;  1SG5 A;  2OTL T;  4C90 A;  3OY9 A;  1YJN T;  5GAO p;  2CXL A;  5HXC A;  5KYN A;  2DXU A;  4QX8 B;  4RTZ A;  3PU3 A;  1BI0 A;  4EMK C;  3NTH A;  4AQF C;  4IE0 A;  4I43 B;  5FXW A;  2D0U A;  2ZM6 T;  5AQR B;  1ZA1 B;  1YHQ A;  3SWN A;  1R8O B;  5GAN g;  2O88 A;  3AAE B;  2ZLY A;  3FZM B;  1KC8 U;  1JJ2 S;  1FYN A;  3KV4 A;  3L2Z A;  3P4P A;  5C6S A;  3CBM A;  4RUG A;  2XDB A;  2MWO A;  1DJ7 B;  4PNO A;  3NTK A;  3X20 B;  1YIJ A;  2XIC A;  1I5L A;  1SHG A;  2UUC T;  1PD0 A;  4J9B A;  3RR6 A;  1FXX A;  2YUO A;  3M9Q A;  2QGF B;  3URG A;  5GAN 2;  3PTR B;  3GMI A;  5C0M A;  3I0O A;  5J1G A;  2K3B A;  1VCS A;  2CP2 A;  4D6W A;  3CPW P;  3DB3 A;  4JLI A;  1ZHI A;  4E7J A;  4JLE A;  3NMZ C;  4RMO A;  2GFA A;  4II1 A;  4EDU A;  3I9Q A;  1UK5 A;  2FRW A;  2L89 A;  2FPF A;  3KBT A;  3INZ A;  4ZN1 A;  3JB9 J;  4KRT A;  1HD3 A;  4C0G A;  3M65 A;  3LBX A;  2EYW A;  4ERR A;  3SS1 A;  2HPL A;  2ZPG B;  4IDQ A;  3RKW A;  3AEG A;  4LDW A;  5CKH A;  3I0Q A;  2LZ6 B;  1MGQ A;  2JXB A;  5HEU A;  5GAN h;  2UXB T;  3TLW A;  4F14 A;  4ZI2 D;  5GAO n;  2WB5 A;  3I9W A;  2VYT A;  3KBG A;  3CD6 A;  4DV1 T;  2MPX C;  1YD8 G;  1GXI E;  2L3P A;  4WYV A;  3BY7 A;  5HEG A;  4E7K A;  3QSU A;  4M7A B;  5L3G B;  2JQH A;  1HG2 A;  2X4W A;  3HP9 A;  2RI2 A;  3C12 A;  3MCA B;  4M75 E;  4JI7 T;  1KHI A;  5FWB A;  5BR8 T;  1HSQ A;  4XU2 A;  5GAN f;  1EZ3 A;  5GMK i;  5IHY A;  2JNG A;  2V7J A;  1IB8 A;  3RHW A;  4C8Q A;  2COY A;  2LCS A;  3HRU A;  3Q5E A;  2CZ1 B;  4JJC A;  4AIS A;  2YRD A;  2XAS B;  3SRZ A;  1OEB A;  3NRY A;  1RAF B;  2E4H A;  4MZM A;  3NWI A;  4JI4 T;  2ABL A;  1W2B P;  3FBZ A;  4G2A A;  1WPY A;  4HWI B;  3CME A;  1UJY A;  2M9U A;  4C5I A;  3RRC A;  2BKP A;  2DNU A;  4PW8 A;  2FO0 A;  1M27 C;  3RIF A;  2JTE A;  4DOV A;  1N36 T;  3VRY A;  3QHS A;  1IZN B;  1U1S A;  3LLR A;  3CCE A;  3J80 E;  1WCR A;  2NOX A;  3MJX A;  3RIU C;  4AFU C;  1WYX A;  2VQE T;  1S72 T;  3RDV A;  1QVF A;  2AT1 B;  4QKN A;  1KG1 A;  4AMC A;  1VQ7 T;  4QT7 A;  4QW2 A;  4JI0 T;  3C4X A;  3HKS A;  5IH2 A;  4JUV A;  2X66 A;  1ZEE A;  2HCK A;  1YI2 T;  2M1H A;  2ROL A;  5LA6 E;  3EG2 A;  5J0Z A;  3HTR A;  3HL6 A;  4BE1 A;  4DMV A;  4EAH A;  4DBR A;  1UGP B;  1QWE A;  5IXB A;  1XNR T;  4LF8 T;  5IHK A;  4JI5 T;  2VGN A;  1JEG A;  3SFM A;  1JJ2 A;  2HHH T;  1V9D A;  2RPA A;  3HKC E;  1IBK T;  3RPU A;  2YRV A;  2CE7 A;  3HRS A;  4DV5 T;  2CKK A;  4J7I A;  3J7A F;  1TSF A;  1NEB A;  1TS9 A;  4BY6 C;  3ZYL A;  3CIR A;  2GFU A;  4BE2 A;  1G3S A;  5JR9 B;  4TV9 E;  1YWO A;  4IUT A;  4KUM B;  4EZH A;  2NUP A;  1M3A A;  3LGL A;  3VS5 A;  2I0M A;  2QQ9 A;  1T3S A;  4HFE A;  3OVU A;  4HTE A;  3VUZ A;  1PCX A;  5FXZ A;  3S4U A;  2NWB A;  1PSF A;  2DJZ A;  2YDQ A;  1UX4 A;  1JU5 C;  2BZB A;  5GON E;  2Q9Q D;  4ZTJ A;  1HCI A;  1XMO T;  2LCL A;  5LJN A;  4OMF B;  1LVF A;  3CCQ Q;  3M54 A;  2GNC A;  3N9M A;  3CQG B;  4M77 C;  1YJW T;  1NYG A;  2CBI A;  2QA4 T;  5FWC A;  2WU5 A;  2QGS A;  5AQN B;  3RX6 A;  3WAK A;  4M7D E;  4MZT A;  4C92 G;  4EOZ B;  3PTA A;  3P7I A;  5AQK B;  1WJR A;  3DTO A;  3OYA A;  1MV0 B;  2UU9 T;  4YSZ A;  2CP7 A;  4H63 V;  1T72 A;  2B1E A;  2VC8 A;  3AVS A;  2WMN A;  2XAH B;  5CJ5 A;  4OYK A;  3OYX A;  3JV3 A;  4YY3 T;  4M75 A;  4OB1 B;  1UFF A;  1YJN Q;  3KV9 A;  1L0V A;  3CCL T;  3GOX A;  1TTH B;  2DYI A;  3V8J A;  1I0C A;  2DA9 A;  4GK5 E;  4KH0 B;  4YTP A;  1RAE B;  2K9G A;  1UUS A;  1ZLM A;  4O4I E;  2O9V A;  2DIG A;  2MWP A;  1R8I A;  2CMR A;  1SEM A;  4FYW B;  5F3J A;  3CC2 A;  1G3W A;  2CYZ B;  4QQG A;  3FRN A;  3M0P A;  5GAN 5;  3PVQ A;  1VQP A;  2CS7 A;  3RRW A;  4X1I E;  4C92 F;  1FMV A;  3PUZ F;  4UV8 B;  2BDE A;  2HL3 A;  3OKQ A;  5DQW A;  4A4F A;  2KIN B;  2L8K A;  4X20 E;  4HVU A;  4FM4 B;  3KDS E;  4ZI3 D;  4JJN K;  2DXB A;  3K3Q C;  4EMK A;  5I2S A;  1YCS B;  4ILU A;  5FNV E;  1HX1 B;  4AQF A;  4L59 A;  4C8Q D;  3SWH A;  1X27 A;  4XQ3 A;  4MLK A;  1UX5 A;  3DKM A;  2Y90 A;  3L2W A;  5IT9 E;  2EQK A;  3MO8 A;  5FY7 A;  3U78 A;  2BKO A;  1IRX A;  4DA4 A;  2XPK A;  1ZSZ C;  3RER A;  2XQA A;  2YK0 A;  2XM2 A;  2DEQ A;  1VQ8 T;  2VXE A;  1PHT A;  4GKK T;  4K0U A;  4J6X A;  2YDR A;  2XJ7 A;  2FB7 A;  3C51 A;  1SHZ C;  5ABF A;  1RI0 A;  2O4X B;  5LJM A;  3ZST A;  3OYL A;  3VS6 A;  2UXC T;  2PQW A;  5J26 A;  1BCM A;  2V6Y A;  4AQG A;  4IIM A;  2KAF A;  2VKN A;  1ZKE A;  2BG9 B;  4ZI2 C;  2LC4 A;  3HR0 A;  1YP5 A;  2LVM A;  3RKG A;  2CXD A;  4M77 E;  2RQT A;  1X75 C;  2EKO A;  2LJ1 A;  2QI2 A;  3D7S B;  4U7Y A;  4LDV A;  2KSS A;  1J5W A;  2JJ9 A;  2RNA A;  3EG3 A;  3OBW A;  3CC7 Q;  3HHT B;  2JOY A;  2FYK A;  5HAX A;  5IWA T;  4QQ6 A;  5HEO A;  1M90 R;  1AWJ A;  4QH4 A;  3OYC A;  1I4K 1;  1FMK A;  1KD1 U;  4MBQ A;  4UVB B;  3UFG A;  1DU2 A;  1MV3 A;  3NHN A;  4A54 A;  3X25 B;  5FXX A;  5KYU A;  4BDY A;  5L4H A;  5AQI B;  3ER0 A;  1D0Y A;  5JRC A;  4M75 G;  2VAS A;  3ZYK A;  3FC3 A;  2CA5 A;  3EHQ A;  3OTO T;  2WDV A;  4RCB A;  4P5N A;  1I07 A;  3A8Y C;  2GQV A;  1ZX6 A;  2BE9 B;  2K48 A;  3FZH B;  2BS2 A;  3UA6 A;  1VQ4 T;  3L39 A;  2QQS A;  1S72 Q;  3M5A A;  3ZMT B;  1QKX A;  5GJV B;  5D6X A;  5BMV E;  2ZPB B;  3OS0 A;  2H7V C;  2Y6X A;  2E9X B;  3DJB A;  4H9S E;  1VQ7 Q;  1VQL T;  2LQW A;  5LMN T;  1JNR A;  3CMA T;  5EZY E;  4DUY T;  1R77 A;  1YI2 Q;  1U3O A;  1NYF A;  3REB B;  3RYF E;  3AA6 B;  3N2G E;  4HN9 A;  3P4Q A;  1Z9Q A;  1Q95 G;  3W15 B;  2XAJ B;  1TUG B;  4EED A;  2K2V A;  4IE5 A;  4B3T T;  2LJ0 A;  4E6R A;  3NRX A;  2DVJ A;  1K4U S;  1TWB A;  1WHL A;  4DV4 T;  3OYK A;  5E0O A;  5FYM A;  1HYO A;  5D6Y A;  2A0F B;  3JAF A;  3OYN A;  1VQ9 T;  4IKF A;  5GAO q;  2QYZ A;  1WXT A;  3RIU A;  4LE9 A;  3JCM e;  4UF0 B;  2NTX A;  2EJ9 A;  2AKL A;  1OX9 A;  2JTM A;  2X51 A;  1KNR A;  2ZM8 A;  4XU3 A;  3KXT A;  4O2B E;  4V2S A;  2E8I A;  3R84 B;  2L9Q A;  4U74 A;  4DOW A;  4ILB A;  4UC4 A;  3QWY A;  2AHJ B;  4EPC A;  3OSS C;  9ATC B;  1YKH B;  1MMA A;  5LJ5 j;  4XTV A;  3L2R A;  2V7I A;  1VQ5 A;  4PL6 A;  2WQY A;  4IUQ A;  3GBQ A;  2YDS A;  1KQ1 A;  4H9R C;  3VKH A;  2XQ8 A;  3F2E A;  3M53 A;  2SPC A;  2LCC A;  4QQD A;  3M0U A;  4E7I A;  1YJW Q;  2EJG A;  2MTQ A;  3CCS A;  1Z9Z A;  2QA4 Q;  4CZZ B;  2J6O A;  1VQK T;  2VUR A;  4CI1 B;  2COW A;  2C0O A;  3DLM A;  3C4Z A;  1Q82 R;  1QKW A;  2V7M A;  2Q9Q C;  1MUZ A;  2PZ1 A;  3AE6 A;  3Q5X A;  2PFV A;  3QBY A;  4U3C A;  2KDS A;  3VYG A;  1NEG A;  4EB6 E;  1FIO A;  2QDL A;  4LD9 K;  4DO0 A;  3MA9 A;  3EDV A;  4IE4 A;  4QXH B;  4RTW A;  1YIT Q;  2W67 A;  1BK2 A;  1SSF A;  1CSK A;  3E9F A;  4X34 A;  1QVP A;  2CBJ A;  4CC2 A;  5ADX L;  2XQ6 A;  4DR2 T;  3SWN B;  3CCL Q;  4RG2 A;  4XTU A;  4HCZ A;  2ACZ A;  4B3S T;  1VIE A;  4GIW A;  1WGS A;  4M77 A;  4BI4 A;  2XDP A;  4J2C A;  1KNZ A;  4N4H A;  3SOL A;  3RH3 A;  4HFV A;  3CCM A;  2O01 E;  2MBG A;  1K8A U;  4M7D G;  2RHX A;  1M9S A;  1WHM A;  2H7O A;  2LSG A;  2KI7 A;  2A3D A;  3NZP A;  2JQQ A;  1RLQ C;  1VA7 A;  1YQ4 A;  2WWU A;  2FPE A;  2JZ2 A;  3EFR A;  3VR8 A;  5M4Y A;  1JB0 E;  5GAO r;  1NPR A;  2L2P A;  3L3P A;  4Z88 A;  4M7A D;  4PFO A;  2HN1 A;  5HWY A;  2WDR A;  4QX7 B;  3G7Z A;  2NTY A;  3JB9 H;  4ATO A;  2N2N A;  1N8R U;  1QQJ A;  4PJO D;  2DL1 A;  2XHE B;  4QXC B;  1UGS B;  4H9O C;  3UUM A;  3HA4 A;  4UVC B;  3V7R A;  3LBX B;  4D8K A;  1YFN A;  3PUY F;  2EQI A;  1KC8 C;  1RAC B;  3QB5 K;  3S3N A;  4IDN A;  3PE0 A;  4DR6 T;  1E6G A;  3ZN1 B;  2JW4 A;  2X9W A;  3KFV A;  5GAM j;  4DBH A;  4F7U A;  4PJJ A;  2RD1 A;  4TNV A;  1Q7Y C;  4Z8A A;  2XID A;  2IAK A;  4DR3 T;  1R0C B;  2PG8 A;  1KC8 R;  4M7D F;  2LRQ A;  2N1G A;  3V5U A;  4M78 D;  4IDO A;  2I2L A;  2KQW A;  1VQ8 Q;  2W63 A;  5CVI A;  2OTJ T;  1VYT A;  2CLY B;  2RP4 A;  3UF4 A;  2EGA A;  2CHN A;  3JB9 I;  4DBQ A;  2P0Q A;  4A53 A;  4YHH T;  3M59 A;  4G63 A;  1V76 A;  3EHR A;  1M2V B;  4C92 B;  3AXJ A;  3JCM g;  1MIY A;  1M62 A;  2DK3 A;  3Q2M A;  5FL0 A;  2BS3 A;  2HQX A;  3ZKR A;  5KMG P;  3QDF A;  4FU6 A;  2VWF A;  1PKS A;  4R0K A;  1F1B B;  4M4Z A;  3H37 A;  4O5V A;  5KE2 A;  4LUE A;  3K3O A;  1EFN A;  2YU2 A;  4H9N C;  4PK5 A;  5JH7 E;  1ZSZ A;  1M2O A;  4WW0 A;  1NWM X;  4OB0 B;  4GYS A;  4HE8 A;  3ANW A;  2RA1 A;  2H3J A;  4EYY R;  2JIW A;  1YXR A;  5L47 A;  1YN8 A;  3DP7 A;  4FW2 A;  3JCM V;  3SHW A;  4WCI A;  5I11 A;  1EX4 A;  4WF2 A;  3CCU A;  4M77 G;  2OI3 A;  5LJ5 f;  4COF A;  1VQ4 Q;  2G6F X;  2CHO A;  1W1F A;  4I0U A;  5J3B A;  3WVD B;  2HL5 C;  1LRZ A;  3UTK A;  1OPL A;  3H0F A;  3KBU A;  1O75 A;  1RI9 A;  3JCM h;  1VQL Q;  4TVR A;  2DJQ A;  3SDZ A;  4ZS3 A;  2BE7 D;  4NPP A;  2E65 A;  2CSI A;  5GJW B;  2RQR A;  4DV6 T;  3CMA Q;  2AZS A;  1I94 T;  1MMG A;  3UU6 A;  1IGU A;  1MNE A;  3FZL B;  1KK7 A;  3V8K A;  3N2K E;  2J62 A;  4IHJ E;  3B57 A;  2P0K A;  1HJD A;  4AFZ C;  2CSQ A;  3J7Y q;  1B7T A;  4Z91 A;  1BI1 A;  2EYQ A;  5ABE A;  4LDX A;  3CXC S;  3PT9 A;  1X2K A;  3JCM f;  1XNQ T;  1ZQ1 A;  3AEA A;  4TV8 E;  3E0Z A;  2HN2 A;  4I50 E;  3JRZ A;  5A0G A;  2SEM A;  4C0F A;  1VQ9 Q;  1D09 B;  4BI3 A;  4F7U G;  2NUP B;  1T7S A;  4LNP A;  1OED C;  5CKB A;  5GMK m;  1BR1 A;  2WCA A;  1KHC A;  2HH7 A;  3O1I A;  3LDQ B;  1VQO T;  1UEB A;  4ZOL E;  1K9A A;  3TRE A;  1N6A A;  4CXX A;  2LT4 A;  3LX7 A;  1C0M A;  3EI0 A;  1RAA B;  4OFZ A;  2FZK B;  1W4S A;  2VKD A;  2QTV A;  1NLP C;  4DVD A;  3UUX B;  2LX7 A;  2MCN A;  4HGA A;  4I55 E;  2XM1 A;  1WXU A;  5D7U A;  1VCT A;  3CX7 B;  5FU6 C;  2CM0 A;  4ZI7 E;  4CI0 C;  2RF0 A;  3GNF B;  1WYB A;  1AHJ B;  1G2B A;  3ZMU B;  3QXE B;  4ELZ C;  1VQK Q;  3QNU A;  3QOF A;  1WDX A;  2KT1 A;  2DL8 A;  3CCQ A;  3VHL A;  4HT8 A;  3BK9 A;  3I56 T;  2H3R A;  4UIG A;  3SB2 A;  4YHJ A;  4HT9 A;  1X69 A;  3CCV T;  2DTH A;  5AQO B;  3FZK B;  1WA7 A;  2VV5 A;  1LOJ A;  2V7L A;  2CZ6 B;  2RQV A;  3FXD B;  2K3X A;  3L2Q A;  3ZCJ A;  4M75 B;  5GAM f;  3ZLI A;  1FJG T;  3C4W A;  2CXF A;  4QXB B;  1WXB A;  3H41 A;  3P4R A;  4DR4 T;  3A7M A;  1BB9 A;  1WFW A;  3MPU B;  4ME7 A;  5GAN 6;  3P4S A;  2KRO A;  3BW1 A;  1JXM A;  2OTL A;  2CCQ A;  1T0H A;  4Y28 E;  4L0R A;  3BE3 A;  1R0B G;  1YHQ T;  2YXY A;  4P09 A;  3RBB B;  2LT1 A;  3AHU A;  4LF9 T;  2CP5 A;  2QTX A;  2RJD A;  1ZBX A;  3AE3 A;  3EHZ A;  2JMH A;  5TAO A;  2K24 A;  1YIJ T;  4QVZ A;  2X4J A;  5L3C B;  1OXZ A;  3JCM P;  2VVS A;  1E2A A;  4HFD A;  2F1L A;  3JCM c;  2KT9 A;  1QLB A;  3UUB A;  1B34 A;  4JRK A;  4BB7 A;  5FP3 A;  3MP6 A;  1M1K U;  4EMK B;  3LG7 A;  2M67 A;  3JCM X;  2YN6 A;  5LYJ E;  5JRE A;  3EG9 A;  2A72 A;  3TLU A;  3VS3 A;  3LJC A;  2NUZ A;  3AVR A;  1RAB B;  2C0T A;  1ZUY A;  2DXC A;  2A36 A;  2HQH A;  4XTZ A;  3SEM A;  2ZAE A;  1AOJ A;  1OED E;  4PJO C;  3VU7 H;  4UXN B;  3UT1 A;  1T8B A;  2D0N A;  2DIQ A;  2WAU A;  4QWN B;  4AQY T;  4XK8 E;  3KFW X;  5ABF B;  1X79 A;  2L3L A;  2VB6 A;  2DKG A;  2V6Y B;  4RTU A;  3QK6 A;  2RJF A;  4FL6 A;  4OMM A;  2OTJ Q;  1TU0 B;  1BR4 A;  3E1S A;  2MAM A;  2C5K T;  2KWH A;  3FB2 A;  2KMF A;  3GN5 A;  3QUI A;  3AE2 A;  3FDR A;  4FSX A;  4CQI A;  3E9G A;  2J05 A;  4BJN A;  1X43 A;  4DBF A;  3MKD A;  2E41 A;  3UUL A;  2PUO B;  4M7D C;  3H3A A;  1VQM T;  1M2V A;  2YRC A;  4U2Z A;  1JO8 A;  4M78 C;  5JDF A;  2XSA A;  4C92 A;  2XY8 B;  3AEB A;  2AKK A;  3CC7 T;  3G4S A;  5HCK A;  8ATC B;  4DID B;  1KQS S;  2E1H A;  2E9X D;  1X9B A;  3AEF A;  4NUV A;  2ZMA A;  2JVV A;  5LJ3 e;  1VQ6 A;  2CUD A;  3H0I A;  1K0X A;  5KCO A;  1CKA A;  4C5G A;  1AZG B;  4ASK A;  3EFO A;  1IHW A;  2DL3 A;  2VXF A;  1K73 U;  1IJ5 A;  3O1J A;  5KYU B;  4BUG A;  5GAN 8;  4LUD A;  5JRC B;  5HXE A;  2XQY A;  4L9I A;  1BYM A;  3CME T;  1UHF A;  3CBP A;  2IC6 A;  4HEA A;  4IL4 A;  2IDO B;  1E1H B;  1I6Z A;  2XUE A;  1H64 1;  4LF4 T;  3CX6 B;  3EH2 A;  2M02 A;  3AE9 A;  2K5F A;  2M0Y A;  3NKZ A;  2CWO A;  4TZ4 C;  2WSS V;  2MMP A;  2LKG A;  2O9S A;  2LRL A;  2EHO D;  4A97 A;  2JPF A;  1XDP A;  4DR1 T;  1M3C A;  3VS7 A;  1GFC A;  4H9Q C;  4FT2 A;  1YJ9 A;  1M8V A;  1I1J A;  4C5H A;  2E5L T;  4M1P A;  4BJM A;  3Q9D A;  3IF8 B;  4ANJ A;  4KX6 A;  1WRD A;  4JYA T;  2DI4 A;  2DD4 A;  1MND A;  2WP9 A;  4N0A A;  5LJ3 j;  1S72 A;  3CBO A;  2PVD B;  3HFN A;  2LP5 A;  2CDT A;  1SSH A;  4BE0 A;  4QKU A;  2ATC B;  1OWA A;  3CCJ A;  5I22 A;  1B07 A;  3A5Z B;  4YSY A;  5HY6 A;  5GAO m;  2IPO B;  2A7Y A;  1HNW T;  4FJO A;  2LHN A;  1KD1 R;  1YI2 A;  4KGZ B;  4N78 D;  1HTJ F;  2LSI A;  2O2O A;  4DEX A;  4JI2 T;  3NTI A;  5LMU T;  5C3J A;  2LJL A;  3VRA A;  3VUB A;  4M7A E;  3UPU A;  5A2Q E;  1CKB A;  2DBK A;  2FVU A;  2VKJ A;  2X0Y A;  2KXC A;  1VQO Q;  4PJO E;  2DL4 A;  3G6E A;  5ECA A;  3LFM A;  2V6X A;  2VQF T;  1YNZ A;  1BR2 A;  1HG5 A;  3OYB A;  6AT1 B;  1UTI A;  3H8Z A;  4JEH B;  1BKB A;  3JCF A;  2IIM A;  2G0U A;  2X4Y A;  3JCM J;  4CC7 A;  3RMQ A;  3R6N A;  4QH5 A;  2VKH A;  1N33 T;  2B8A A;  3PU8 A;  2E6Z A;  3AA0 B;  2VWA A;  4YTN A;  1HNX T;  3EGD A;  2IG0 A;  4BY6 B;  4EZ4 A;  4M78 E;  1ACM B;  4JS4 A;  2MOX A;  2J1D G;  3LK3 B;  2F2V A;  4ILA A;  4N4G A;  4L6V 5;  2HQE A;  1H7C A;  2K3Y A;  3I56 Q;  2LSK A;  3CCV Q;  1H3Z A;  3F31 A;  4IE6 A;  4U31 A;  3QZ5 B;  2FEI A;  1YIT T;  2EGC A;  2WZH A;  1WJQ A;  2DLR A;  4ILC A;  1AVZ C;  4LDY A;  2RI5 A;  4X64 T;  5KX5 E;  2UXN B;  2FJD A;  1SKU B;  2DNX A;  1RLP C;  3ZMZ B;  3E22 E;  2XQ7 A;  1VQN T;  2IIU A;  3EAE A;  4M77 B;  4CC3 A;  1W70 A;  1ABO A;  1KQS A;  1QVG S;  3ZJ2 A;  3QO3 A;  1J5E T;  3ZC1 A;  5AQU B;  3P8H A;  1QVF P;  4HA8 A;  5HYA A;  1YHQ Q;  3CCL A;  3C64 A;  4P1N A;  5LJ3 g;  3CC2 T;  4IDZ A;  1QWF A;  2V8S V;  3S6W A;  5LG3 A;  2KZ7 B;  1T98 A;  4F04 B;  3REA B;  1VQP T;  5LOV E;  3ZJ1 A;  2IUB A;  4PJN A;  1YIJ Q;  2E5K A;  4WNK A;  3FZF B;  4J9G A;  3O1H A;  4NL2 A;  2NR4 A;  4J9E A;  1JXO A;  2HAX A;  2L3R A;  2QQR A;  4OGE A;  2KRS A;  1JJ2 P;  1D0Z A;  2KE9 A;  1KFY A;  2QG9 B;  3JAE A;  3TLV A;  1K8A C;  3H6Z A;  4RTV A;  2KEA A;  4CC4 B;  4F7U B;  3BQK A;  2LSJ A;  4O4H E;  4BA9 A;  3CCR A;  4H63 H;  3CVR A;  2RHY A;  1UE9 A;  1PKT A;  4C0D C;  1U5S A;  2FPD A;  2QVA A;  2OLT A;  1ZBJ A;  3M3Z B;  2J7I A;  5IUX A;  5JTG A;  2K9A A;  5EC7 A;  1K8A R;  4IT4 A;  2H8H A;  5LJ3 h;  3BDU A;  1N8R C;  2FJE A;  5CIU A;  2BG9 C;  2V1D B;  4X1K E;  1BI3 A;  3SD4 A;  3VU3 C;  4QVD A;  4DR5 T;  4GYR A;  5FU7 C;  1GQE A;  4FYX B;  2CP0 A;  2AZV A;  2RA2 A;  2VVK A;  2JQ9 A;  3QJ6 A;  3ZMS B;  2RO0 A;  1WHK A;  2ZZD A;  2E10 A;  2FRY A;  1M90 C;  4J6W A;  2Z6E A;  2XD0 A;  1N8R R;  4NS5 A;  1VQ8 A;  1VOM A;  3AXJ B;  4EMH A;  1SA0 E;  3FIF A;  4KUI A;  4JJD A;  5LJ3 f;  4TWH A;  2D0T A;  4CN6 A;  1VQM Q;  4J83 A;  4OX9 T;  1BIA A;  4JDS A;  2UXD T;  4X5T A;  2K57 A;  2IHR 1;  1HNZ T;  2E5V A;  3H3M A;  5LGN B;  3CKD A;  1PWT A;  3H9N A;  4PNI A;  2WDQ A;  1NBE B;  5CB4 E;  1W6X A;  2QEX T;  1X6G A;  2XU8 A;  4GK0 E;  1ZSZ B;  1MMN A;  1BI2 A;  3MEV A;  4OMN A;  4AG2 C;  4J9D A;  4HCB A;  5L2L A;  3FXE B;  2D8H A;  2D9T A;  3G71 T;  3VJP A;  3GWH A;  1IJ6 A;  2MYS A;  3ETU A;  3ANW B;  4NL3 A;  2BUD A;  2W0Z A;  4PLL A;  2XDD A;  4Z02 A;  1LPL A;  2WZI A;  3CME Q;  2DYB A;  3OW2 S;  1OYX A;  3AAI A;  2E9X C;  4KHZ F;  4FT4 A;  4GKJ T;  5FY1 A;  4IIJ E;  1WQW A;  2DHR A;  1HX8 A;  3PFS A;  2LQ8 A;  4M7D A;  3A98 A;  1Q86 U;  3OYY A;  5GAN 7;  2ESW A;  3VS2 A;  4DEY A;  4Y92 A;  3TLT A;  4X1Y E;  2RMO A;  1WZO A;  3LK4 2;  1VRB A;  2DE0 X;  4OMP A;  2MIO A;  1VQ4 A;  4PK4 A;  3N9P A;  3ZYM A;  5CCA A;  3ZPO A;  3RKX A;  3OYJ A;  3A5X A;  2MPK A;  1M4Z A;  1VQL A;  1M30 A;  2W61 A;  1T0J A;  1QVG A;  4GBQ A;  2EHO C;  2GK9 A;  4A4K A;  3CMA A;  3HFO A;  5FKY A;  4LFA T;  5I2M A;  2AE9 A;  3WAJ A;  4ZGD B;  1IBM T;  2CH4 A;  2ZPF B;  3AB3 B;  2LKH A;  4HFB A;  1ZHC A;  5CO7 A;  4O6J A;  3HKE E;  1Z0P A;  2OA5 A;  4X62 T;  4E7L A;  2LT3 A;  1K9M U;  4A4G A;  3VKI A;  3CC4 T;  2O31 A;  1G3Y A;  4ISS A;  1Y01 A;  1Y71 A;  3MHX A;  1VQ9 A;  1GCQ C;  2NW8 A;  1OX8 A;  3N9Q A;  3L2U A;  2DER A;  3OYG A;  4EGW A;  4HXJ A;  2SRC A;  4M75 D;  2BG9 E;  1Q82 C;  5JDM A;  4AI6 A;  4CXW A;  1H3H A;  4OK0 A;  2HEQ A;  1VQ5 T;  4UV9 B;  1OI1 A;  1RAD B;  1V1C A;  4NOY A;  4IE7 A;  3BQI A;  1HS7 A;  5L3E B;  2QK0 A;  1PRL C;  2FZG B;  3A8G B;  4U33 A;  3RQW A;  2KVQ G;  4PJL A;  3Q1J A;  2RHZ A;  1ZOY A;  5HCJ A;  2X0H A;  2R6G F;  4OYJ A;  4LF5 T;  2PUK B;  8AT1 B;  2PBI A;  3RIR A;  1VUB A;  5GAN 3;  4FYV B;  4Y91 A;  4IDP A;  5LHH B;  4HVW A;  4PJO G;  3EH1 A;  4O4J E;  2ED1 A;  5GMK e;  4IST A;  3RYI E;  4F17 A;  4J6Y A;  3EAM A;  3IHR A;  2CT4 A;  2GF7 A;  2L5Q A;  4X65 T;  2G3R A;  4JI3 T;  2KT8 A;  5KCH A;  4O8S A;  1VQN Q;  3I5S A;  3ZEH A;  4QVC A;  2PTK A;  1SRL A;  2D9D A;  2H3E B;  2WU2 A;  4KP3 C;  4YXD A;  1PC0 A;  4IUP A;  2WS3 A;  2R58 A;  4AG1 C;  3OYI A;  5KYW A;  4XBF B;  4EYU A;  3FB9 A;  2IVW A;  5DAB A;  3QZ9 B;  1NJI U;  1WI7 A;  4M78 G;  3WVE B;  3ZT5 A;  1M1F A;  5CR2 A;  3D0T A;  3CCM T;  2Q9Q B;  5FY0 A;  4KUD K;  1MHN A;  3DB4 A;  4H9P C;  3NBX X;  2RK1 A;  3CC2 Q;  3UWN A;  3P4W A;  3UT5 E;  2K2M A;  4M7A F;  2JN0 A;  3AEC A;  3LYI A;  3CPW S;  4IL9 A;  3OW2 A;  1VQP Q;  5L4E A;  2LMJ A;  2V8J A;  2DZC A;  3UA7 A;  1U8R A;  3OBV E;  2CEA A;  1B34 B;  3EGX A;  4PJO F;  1I8F A;  2DL7 A;  5J39 A;  5AQP B;  1T3L A;  1P92 A;  5GMK j;  1QVG P;  2XHC A;  1PM3 A;  4K11 A;  2YEV C;  1NLO C;  2C06 A;  5IHI A;  5L3D B;  4C5E A;  3RC8 A;  3QPH A;  3I35 A;  4AKR B;  2K6D A;  3EG9 B;  3M58 A;  1QCO A;  2XAF B;  3F70 A;  2KXP B;  2V7K A;  4ZXL A;  2C5I T;  4LML A;  3TVT A;  2QDY B;  2KMT A;  2OAU A;  5CFB A;  4AKL A;  2AXD S;  4ZI3 C;  1PNJ A;  1AZE A;  4BD3 A;  3P8D A;  4R56 A;  4YT0 A;  3RYH E;  4JS5 A;  5I21 A;  1OV3 A;  1SF9 A;  4M78 F;  2WY2 A;  3LH0 A;  2HD0 A;  3MXZ A;  1HK9 A;  3MEW A;  2ROT A;  2LNH B;  1IGQ A;  1K1Z A;  3FBL A;  1M1K C;  4C8Q C;  2I6H A;  1E7P A;  1AJ3 A;  2YLB A;  2YKS A;  2RJE A;  3Q5D A;  1OUL A;  1LKX A;  3GN5 B;  2OJ2 A;  3M56 A;  3M4Y A;  3AA7 B;  4MMK A;  2JM8 A;  3AA1 B;  2X68 A;  3ZSS A;  5KYY B;  1I81 A;  4JUY A;  4F16 A;  4B3R T;  1ZSG A;  4OVA A;  1WR6 A;  2W4X A;  2X9H A;  4X9C A;  2OTJ A;  2KBT A;  1M1K R;  3F57 A;  3LH5 A;  1QW1 A;  4RTT A;  4A4H A;  2XI9 A;  3PDY A;  4U72 A;  5JDL A;  2EFI A;  4KH1 B;  3THK A;  5AQM B;  1WLP B;  3EFO B;  2V8I A;  4RG8 A;  2RI3 A;  2ZGW A;  4OB3 B;  3T9N A;  2E70 A;  2RQW A;  5D6W A;  2W62 A;  2QEX Q;  5CKD A;  3OS1 A;  3QWX X;  1UCU A;  4F8H A;  1XOV A;  3GNG A;  3G71 Q;  5HWX A;  2UUB T;  4MZP A;  2V26 A;  2E12 A;  1FEW A;  2KR3 A;  2LDM A;  4PFP A;  1CUN A;  1K76 A;  2F5K A;  4AT1 B;  5FLX E;  4Z8X A;  1QP3 A;  3E2U A;  4FI5 A;  2DBM A;  1WNL A;  1ZUK A;  2LEH A;  4K0K T;  4LN2 A;  3X1D A;  2EQU A;  5IXF A;  2CPT A;  5FVL A;  3SFD A;  1GBR A;  3AE4 A;  1ZP0 A;  3RIA A;  2X0L B;  2COZ A;  1ABQ A;  4J9F A;  1ARK A;  2KYB A;  3CCU T;  2CRB A;  4A4E A;  4J5Y A;  2A28 A;  3RKO A;  1HR0 T;  1K73 C;  3VKG A;  4EIK A;  3OMC A;  4WBN E;  2RHU A;  4GOU A;  2ZPH B;  3HSB A;  2X4X A;  3OW2 P;  2XQ9 A;  4HWH A;  2KXD A;  1X6B A;  2L3S A;  5HXS A;  4XTX A;  2CP3 A;  1MIV A;  1US7 B;  3TU4 K;  1SUM B;  1K73 R;  2R5M A;  1IRE B;  1G83 A;  2DWK A;  2D1X A;  5CAI A;  3JCM b;  4DND A;  2FHD A;  3I1A A;  2HBP A;  2JT4 A;  2FBW A;  5CKF A;  4IGU A;  3HL8 A;  5JDQ A;  4LF7 T;  3L2V A;  3CPW A;  4DV3 T;  2J6K A;  3M0R A;  4BAY B;  5FMN A;  4NUU A;  3FJ5 A;  1HXD A;  2FG0 A;  3CC4 Q;  3JB9 D;  2RHI A;  3I55 T;  1N27 A;  3X26 B;  1NZ9 A;  2DPP B;  4ZTF A;  1OZ3 A;  2YIN A;  2YUP A;  3IQL A;  3EG0 A;  3QG1 A;  2AK5 A;  3C4S A;  1RAI B;  1Y0M A;  3VR9 A;  5GMK h;  4C8Q E;  4RTX A;  3R6O A;  2DWG A;  1VQ5 Q;  2CRE A;  4R55 A;  1B3Q A;  3N9N A;  1TOV A;  4EEB A;  3T1Y T;  2RQU A;  4M77 D;  2RB6 A;  2DAQ A;  2LM9 A;  1BU1 A;  3WI3 A;  3EGD B;  1D3B A;  4YJ2 E;  1Q81 U;  1YWP A;  2DM1 A;  3M57 A;  5KYX A;  3CCS Q;  4PJM A;  2X3X D;  2LLY A;  5CA0 E;  2IW5 B;  1C1A A;  2C0I A;  4AKG A;  2KGT A;  4MFR A;  1GCQ A;  1H8K A;  3QC9 A;  3I56 A;  4HCC A;  2BVM A;  1Y57 A;  4Z90 A;  3PVL A;  3C98 B;  3CCV A;  1AT1 B;  2QYW A;  5FU6 B;  4TX5 A;  3QDR B;  2ZM0 A;  1M5Q 1;  2NW7 A;  2KSR A;  4YTM A;  3OYM A;  4CI3 B;  3E08 A;  1YJN A;  3ZCI A;  1XTD A;  2NUT A;  3RNJ A;  4JI6 T;  1LJO A;  3ZL7 C;  1WFD A;  4YFS A;  2VL8 A;  2W10 A;  4VUB A;  3CCM Q;  3UFE A;  2Q9Q A;  1U06 A;  4NIQ A;  3KVB A;  1N9S A;  2LQK A;  2NYS A;  1YQ3 A;  5FVK A;  2X9X A;  4FIB A;  3AE5 A;  3NVO A;  4DMW A;  2L8D A;  1W0B A;  3HKB E;  1UG1 A;  4D8D A;  4HWC A;  1ZUU A;  3SFE A;  4A56 A;  2UUA T;  4LF6 T;  2Y4X A;  5HK0 A;  5LBM A;  2X35 A;  3RKY A;  1Y64 B;  1QLY A;  2P4R A;  3RUX A;  1Q7Y U;  5H6Q B;  4MDX A;  2WSF E;  5DY9 A;  3RI5 A;  1NEK A;  4M7A C;  2GCX A;  3FEO A;  2Z0W A;  2BTT A;  2E3H A;  3EAB A;  2VKO A;  1OZ2 A;  2I59 A;  1TUD A;  2ACX A;  3KVA A;  3CD6 T;  1UUR A;  3CXC A;  3UAT A;  2M6I A;  3I5R A;  2PJQ A;  2XTL A;  2DLP A;  5LP6 E;  2WAC A;  5L3B B;  1I5O B;  1S35 A;  1AD5 A;  4YTL A;  4JZ4 A;  2DZ9 A;  4HFC A;  1ZA2 B;  2DO3 A;  2IML A;  4DV7 T;  5L3F B;  2B76 A;  3PUS A;  3VS1 A;  5KYY A;  1G5V A;  4OGC A;  3LW5 E;  3RC3 A;  1GBQ A;  4DV0 T;  5HCM A;  3G1J A;  3E19 A;  4QH1 A;  2H89 A;  4OHF A;  4AFS C;  2LOP A;  2UXX B;  4A98 A;  2MAW A;  3G06 A;  5CK9 A;  3ULR B;  4JRQ A;  4EXT A;  4IUR A;  5FRN A;  4PJO B;  5HXH A;  2XQ5 A;  3G4S T;  3ETV A;  2CUB A;  4MHC A;  5H6R B;  4UEL A;  1Y96 B;  3LWH A;  1VQM A;  1VQ6 T;  4LXC A;  3GIB A;  4GY5 A;  3CC7 A;  2EYY A;  3JC6 D;  3UQ4 A;  3ESL A;  3DLL A;  1G3T A;  3TQ7 P;  3PIP A;  2E6N A;  2X3W D;  2D5U A;  2JQK A;  4V1A v;  3RGL A;  3MK7 C;  3TSW A;  3CQX C;  1J1J A;  2PNI A;  3FLG A;  4JI8 T;  3PUQ A;  2DTI A;  3C0C A;  5EK2 A;  1H92 A;  4M7D B;  3IEE A;  5FRM A;  3MEA A;  3CCE T;  4M78 B;  3MAC A;  2YU1 A;  2X9Y A;  2BS4 A;  2BZ8 A;  4KUL A;  2DIL A;  1E7O A;  4OP0 A;  5CA1 E;  1KD1 C;  3CCU Q;  3CEY A;  3RF1 A;  4EMG A;  5HKC A;  2C5J A;  2VK9 A;  4KT0 E;  1KIK A;  3A8L B;  1YJ9 T;  4BDZ A;  2KK4 A;  2F2X A;  2MI6 A;  3N5B B;  2EQJ A;  1VQ7 A;  3A1P A;  3GF5 A;  1VYU A;  2NLU A;  2D8J A;  3LK2 B;  3FHN A;  3ONL C;  1XQH A;  3ONX A;  2QRX A;  5JR9 C;  3CCJ T;  3JCM Q;  2DTO A;  4X9D A;  1UEC A;  1Q86 C;  4OF1 A;  4JI1 T;  5AT1 B;  2FJA A;  5C8Y E;  1KEY A;  1X2Q A;  1IBL T;  2W0G A;  5DQV A;  1IZ6 A;  2RN8 A;  1S94 A;  1D1A A;  4X1V A;  1PSE A;  4TN7 B;  1NPP A;  1Q86 R;  4KGV B;  1QMC A;  2HDA A;  2BBJ A;  2E64 A;  3QYH B;  4AFQ C;  3I55 Q;  2HSP A;  3CXC P;  3B5M A;  2YUQ A;  4FYY B;  2DET A;  1AWX A;  3UQ7 A;  3G6E T;  1M8M A;  2K3W A;  3K1S A;  5CGM A;  3M0Q A;  1JQQ A;  5FW9 A;  4E47 A;  4LFB T;  3EDU A;  4TUY E;  3Q5W A;  4MAL A;  3M0S A;  2X67 A;  4U7I A;  5C2T A;  3GLX A;  4ZS2 A;  1YKE B;  1K9M C;  2I0N A;  1IAP A;  5LCY A;  3KUF A;  4P0A A;  3AE1 A;  2MF2 A;  4B6X A;  2RPN A;  2YHT A;  1YJW A;  5F8P A;  1OED A;  5LL6 S;  2IC9 A;  1GCP A;  2K5L A;  3QII A;  4OML A;  5AQL B;  2QA4 A;  2PU9 B;  4JBW F;  1IO6 A;  5DLQ E;  3PUW F;  4J9I A;  5AQG B;  4ZZC A;  2PVG B;  3A8O B;  1XDO A;  1YBY A;  3KIN B;  3K3N A;  1K9M R;  1NE8 A;  2GQI A;  3OYD A;  1AWW A;  4XU1 A;  2WBL A;  4LFC T;  3VYH B;  3PMT A;  5LJ5 d;  1CHU A;  3AED A;  4C8Q G;  2LQN A;  1KF6 A;  1NM7 A;  5AYF A;  1YIT A;  1KSW A;  5KYW B;  2DRM A;  4J9C A;  1KNP A;  4YJ3 E;  2ZM2 A;  3ME9 A;  2ED0 A;  2DRK A;  4FW1 A;  3LWI A;  2ENM A;  1VQN A;  3AEE A;  2OTL Q;  4Q5W A;  4QHO A;  2XKO C;  4CXY A;  2L0A A;  1MMD A;  3C50 A;  1X01 A;  5DM7 R;  3KV5 A;  2EQM A;  1QCF A;  3EGX B;  3TEE A;  1UGR B;  5LGT B;  5J2T E;  3AAA B;  3JCM d;  2ODV A;  2EYX A;  2KLQ A;  2HNI A;  3PUX F;  2KYM A;  3L42 A;  5HK3 A;  2BKD N;  5KH6 A;  2YOE A;  3O5Z A;  2EW3 A;  1YCY A;  2J47 A;  1RL2 A;  4C8Q F;  1NJI C;  3VRZ A;  3AE7 A;  4C92 D;  2DCF A;  1J3T A;  3O4X E;  3UU4 A;  3V5S A;  2F69 A;  1EIF A;  2QXF A;  2V1R A;  4CI2 B;  1PG5 B;  4LMK A;  1XWM A;  3FJP A;  4HFI A;  4MML A;  3PUR A;  3RYC E;  3CCR T;  1UUE A;  3VS0 A;  5ABG A;  1NJI R;  3N2O A;  2BVL A;  2LTO A;  3MP1 A;  4KHP T;  3CD6 Q;  5AQJ B;  3HKD E;  4A5X A;  4ORZ A;  3OJA A;  2F2W A;  2RH2 A;  2ZPI B;  4N4I A;  4XTW A;  2M16 A;  2W2U A;  1TXQ A;  5L8R E;  3B13 A;  2EIF A;  3NPF A;  4EV6 A;  2CH4 W;  2C0S A;  5A1L A;  2BKN A;  2VVN A;  2XQ3 A;  4YSX A;  1TUC A;  3RES A;  2R57 A;  4FSS A;  2GBQ A;  4J9H A;  2YT6 A;  4JZ3 A;  4UVA B;  4O4L E;  5A0D A;  2EPD A;  3ZEF B; 
#chains in the Genus database with same CATH homology
 5LNK A;  1WLX A;  4C0D B;  4M7A A;  3U3I A;  3P8B B;  5GAM d;  2ZPE B;  5CKE A;  2Y4Y A;  5LBQ B;  4PJO A;  2VGM A;  1G73 A;  1Y96 A;  3N5L A;  2LE8 A;  5FU7 B;  4XTY A;  3MZK B;  3PGG A;  3CPF A;  3MET A;  2QEX A;  3M55 A;  4RKU E;  3QUJ A;  2BIV A;  1MIW A;  2JTF A;  4P0B A;  3G71 A;  4AKI A;  5EG2 A;  4LDU A;  2WSE E;  3OQ5 A;  1Y07 A;  4M78 A;  4I4T E;  2V8K A;  3JC6 C;  3V8L A;  1Y7X A;  3RMS A;  5M9O A;  4MDW A;  3WXM B;  4UEM A;  1BIB A;  2LSY A;  4LD6 A;  2F5T X;  3MP8 A;  4IUV A;  3UUN A;  4JEU B;  4F7U E;  4B9X A;  2EWN A;  5LJ5 e;  2WMO A;  3LGF A;  1QSD A;  3CWZ B;  3IBP A;  2A3L A;  5J2U E;  4HKA A;  4WBO A;  4CRI A;  4E7H A;  2QA7 A;  2D0Q B;  2QQB A;  1VIF A;  2Y8D A;  1UB4 A;  3JAM E;  1D1C A;  2DXT A;  5DJQ C;  3PNW C;  3OYH A;  3VV0 A;  5GAN d;  4E7Z A;  4M75 F;  4AXP A;  5EK4 A;  2EHO B;  3CC4 A;  3GA8 A;  3JSC A;  2NW9 A;  2JUF A;  4L5G A;  5JR9 A;  1D3B B;  1G8X A;  4GLK A;  1QP2 A;  3O8V A;  3ZBD A;  2P9B A;  3S3O A;  3OS5 A;  1KQ2 A;  3CCS T;  1BR0 A;  2R5A A;  5CQY A;  4M7A G;  5LHG B;  1HF8 A;  3QKJ A;  1VQK A;  3SWN C;  1WQ7 A;  4ADZ A;  1O3X A;  3A8H B;  5KDM C;  1HFA A;  3OMG A;  4PK6 A;  3PIO A;  5JDG A;  4O2A E;  3ASK A;  3X28 B;  2ES0 A;  1Q81 C;  3T8O A;  4ZHQ E;  1NAF A;  4E7S A;  2A2F X;  5JDN A;  3EUH A;  5GMK l;  3TCJ A;  4C91 A;  4ELY C;  2K5B B;  3O9X A;  3QYG B;  4BAC A;  5GAM e;  4C0Z A;  2ODU A;  4OB2 B;  4ZGE B;  1FX7 A;  3A8M B;  3PUA A;  1UGQ B;  2EJF A;  4EIW A;  2MOZ A;  3ZFJ A;  2CZ7 B;  2KY9 A;  3OB9 A;  4PAG A;  4XAX B;  1U1T A;  1M1G A;  2LX9 A;  3C94 A;  3C95 A;  2CLY C;  4JRP A;  3JCM W;  2HPJ A;  4HKE A;  4B9W A;  1D1B A;  4BI8 B;  1X6O A;  3CML A;  3X24 B;  4C92 C;  3OSV A;  3CX8 B;  3OYZ A;  4RCC A;  2CWY A;  4XZC A;  1M90 U;  5LGU B;  3NFC A;  5LJ5 g;  4DQ2 A;  5DLO A;  5A0L A;  3BFM A;  1O9S A;  4YLH A;  3OYF A;  2M0O A;  4M7D D;  4IUU A;  5IN1 A;  3N9O A;  1W2B S;  2E5Q A;  3J81 E;  1U4Q A;  2K4Y A;  2JMK A;  1FMW A;  2D2S A;  2DD5 A;  3HRT A;  2LHR A;  2O4X A;  3OA6 A;  2RM4 A;  4ZGJ B;  3S3M A;  3I9Y A;  4C8Q B;  3TKL B;  5GAN e;  4F6R C;  2VUB A;  4JRI A;  5IAY A;  5JQG E;  3L1A A;  4ZN3 A;  3CQC B;  2QQA A;  4N0A C;  3KV6 A;  2PVO B;  5LHI B;  5LJ5 h;  2D6F A;  3EVY A;  2CZ0 B;  3GPL A;  2LOS A;  1YW0 A;  1ZV4 X;  3JB9 G;  3PMI A;  4J7F A;  2P0P A;  3M4G A;  2Y48 B;  3P8C D;  5JDH A;  5GAN 4;  2ZCF B;  2WSC E;  4PKC C;  1XNI A;  4XU0 A;  3ZMV B;  5FRO A;  3HI2 A;  3N9L A;  1JBM A;  3PUG A;  1LNX A;  5GAN j;  1U5P A;  4JLG A;  2KWI B;  2E9X A;  3OS2 A;  2XAG B;  5HXR A;  2DVE A;  5ETW A;  5EK3 A;  5IYZ E;  2WM9 A;  3K8P C;  3NZQ A;  3V7S A;  2XK0 A;  3ZN0 B;  1WYC A;  3JB9 F;  5GAM g;  3QJY A;  2LNV A;  3OBY A;  2EAY A;  1Q82 U;  3CPZ A;  3BDL A;  5FXV A;  2K5I A;  2YLC A;  3UDC A;  5KE3 A;  2P4T A;  1VQO A;  4C92 E;  3GP8 A;  5LJ3 d;  3V7C A;  1V29 B;  4J8O A;  4UF0 A;  5LXT E;  2EHO A;  2XAQ B;  4M77 F;  2XG8 D;  2N9D A;  3I55 A;  5LG4 A;  4PLI A;  2JRK A;  5JVD E;  3J9X 1;  2FL7 A;  2RK2 A;  4M75 C;  1D0X A;  3L09 A;  2CGH A;  2NP9 A;  1JRI A;  4KBM B;  3CCQ T;  1QUU A;  2RJC A;  3BQL A;  2KND A;  1FWZ A;  5GAM h;  5GAO l;  3ZC0 A;  3HPW A;  1TH7 A;  1LVK A;  2W00 A;  5CQX A;  1WJS A;  1W2B A;  1QVF S;  3MEU A;  4F7U F;  5AFU L;  4KMC A;  3EFS A;  4AKH A;  3OYE A;  1N9R A;  2OTL T;  4C90 A;  3OY9 A;  1YJN T;  5GAO p;  2CXL A;  5HXC A;  2DXU A;  4QX8 B;  3PU3 A;  1BI0 A;  4EMK C;  3NTH A;  4AQF C;  4IE0 A;  4I43 B;  5FXW A;  2D0U A;  1YHQ A;  3SWN A;  1R8O B;  5GAN g;  3AAE B;  2ZLY A;  1KC8 U;  1JJ2 S;  3KV4 A;  3L2Z A;  5C6S A;  3CBM A;  2XDB A;  2MWO A;  1DJ7 B;  4PNO A;  3NTK A;  3X20 B;  1YIJ A;  2XIC A;  1I5L A;  1FXX A;  3M9Q A;  5GAN 2;  3URG A;  3PTR B;  3GMI A;  5C0M A;  3I0O A;  5J1G A;  4D6W A;  4E7J A;  3DB3 A;  4JLI A;  1ZHI A;  4JLE A;  4RMO A;  2GFA A;  4II1 A;  4EDU A;  4ZN1 A;  2L89 A;  3KBT A;  3INZ A;  3JB9 J;  4C0G A;  3M65 A;  3LBX A;  4ERR A;  3SS1 A;  2HPL A;  2ZPG B;  3RKW A;  4LDW A;  5CKH A;  3I0Q A;  1MGQ A;  5GAN h;  4ZI2 D;  5GAO n;  3I9W A;  2VYT A;  3KBG A;  3CD6 A;  1YD8 G;  1GXI E;  3BY7 A;  4E7K A;  3QSU A;  4M7A B;  5L3G B;  1HG2 A;  2X4W A;  3HP9 A;  2RI2 A;  3C12 A;  3MCA B;  4M75 E;  1KHI A;  4XU2 A;  5GAN f;  1EZ3 A;  5GMK i;  5IHY A;  2JNG A;  2V7J A;  4C8Q A;  3HRU A;  2CZ1 B;  2XAS B;  3SRZ A;  3NRY A;  4MZM A;  3FBZ A;  4G2A A;  1WPY A;  3CME A;  2M9U A;  4C5I A;  3RRC A;  4PW8 A;  4DOV A;  3QHS A;  1IZN B;  1U1S A;  3LLR A;  3CCE A;  3J80 E;  2NOX A;  3MJX A;  1S72 T;  1QVF A;  4QKN A;  1KG1 A;  1VQ7 T;  4QW2 A;  3C4X A;  3HKS A;  4JUV A;  2X66 A;  1ZEE A;  1YI2 T;  2M1H A;  5LA6 E;  4BE1 A;  3HL6 A;  4DMV A;  4EAH A;  4DBR A;  1UGP B;  2VGN A;  3SFM A;  1JJ2 A;  1V9D A;  3HKC E;  3RPU A;  2YRV A;  2CE7 A;  3HRS A;  2CKK A;  4J7I A;  3J7A F;  4BY6 C;  3ZYL A;  2GFU A;  4BE2 A;  1G3S A;  5JR9 B;  4TV9 E;  4IUT A;  4KUM B;  4EZH A;  3LGL A;  2QQ9 A;  4HTE A;  3VUZ A;  5FXZ A;  3S4U A;  2NWB A;  1PSF A;  2DJZ A;  1UX4 A;  2BZB A;  5GON E;  2Q9Q D;  4ZTJ A;  1HCI A;  2LCL A;  5LJN A;  4OMF B;  1LVF A;  3M54 A;  3N9M A;  3CQG B;  4M77 C;  1YJW T;  2QA4 T;  2QGS A;  3RX6 A;  3WAK A;  4M7D E;  4MZT A;  4C92 G;  4EOZ B;  3PTA A;  3P7I A;  1WJR A;  3OYA A;  3DTO A;  4H63 V;  2B1E A;  2VC8 A;  3AVS A;  2WMN A;  2XAH B;  4OYK A;  3OYX A;  4M75 A;  4OB1 B;  3KV9 A;  3CCL T;  3GOX A;  3V8J A;  4GK5 E;  4O4I E;  2DIG A;  2MWP A;  2CMR A;  5F3J A;  3CC2 A;  1G3W A;  2CYZ B;  4QQG A;  3FRN A;  5GAN 5;  1VQP A;  2CS7 A;  3RRW A;  4X1I E;  4C92 F;  1FMV A;  4UV8 B;  2BDE A;  3OKQ A;  5DQW A;  4A4F A;  2KIN B;  2L8K A;  4X20 E;  4FM4 B;  3KDS E;  4ZI3 D;  4JJN K;  2DXB A;  3K3Q C;  4EMK A;  5I2S A;  4ILU A;  5FNV E;  4AQF A;  4L59 A;  4C8Q D;  3SWH A;  4XQ3 A;  4MLK A;  1UX5 A;  3DKM A;  2Y90 A;  3L2W A;  5IT9 E;  2EQK A;  3MO8 A;  5FY7 A;  3U78 A;  4DA4 A;  3RER A;  2YK0 A;  2DEQ A;  1VQ8 T;  2VXE A;  4K0U A;  4J6X A;  2FB7 A;  3C51 A;  1SHZ C;  1RI0 A;  2O4X B;  5LJM A;  3OYL A;  2PQW A;  5J26 A;  4AQG A;  2KAF A;  1ZKE A;  2LC4 A;  4ZI2 C;  3HR0 A;  2LVM A;  2CXD A;  4M77 E;  1X75 C;  2EKO A;  2QI2 A;  4LDV A;  2KSS A;  2JJ9 A;  3OBW A;  3HHT B;  2JOY A;  2FYK A;  5HAX A;  4QQ6 A;  3OYC A;  1I4K 1;  1KD1 U;  4MBQ A;  4UVB B;  4A54 A;  3X25 B;  5FXX A;  4BDY A;  3ER0 A;  1D0Y A;  5JRC A;  4M75 G;  2VAS A;  3ZYK A;  3FC3 A;  2CA5 A;  4RCB A;  4P5N A;  2GQV A;  2K48 A;  1VQ4 T;  2QQS A;  3M5A A;  3ZMT B;  5D6X A;  5BMV E;  2ZPB B;  3OS0 A;  2H7V C;  2Y6X A;  2E9X B;  3DJB A;  4H9S E;  1VQL T;  3CMA T;  5EZY E;  3RYF E;  3AA6 B;  3N2G E;  4HN9 A;  3W15 B;  2XAJ B;  2K2V A;  4IE5 A;  3NRX A;  3OYK A;  5E0O A;  5FYM A;  5D6Y A;  3OYN A;  1VQ9 T;  4IKF A;  5GAO q;  3JCM e;  4UF0 B;  2NTX A;  2EJ9 A;  2JTM A;  4XU3 A;  2X51 A;  2ZM8 A;  4V2S A;  3KXT A;  4O2B E;  2E8I A;  3R84 B;  2L9Q A;  4U74 A;  4DOW A;  4UC4 A;  2AHJ B;  4EPC A;  3OSS C;  1YKH B;  1MMA A;  5LJ5 j;  4XTV A;  3L2R A;  2V7I A;  1VQ5 A;  4PL6 A;  4IUQ A;  1KQ1 A;  4H9R C;  3VKH A;  3F2E A;  3M53 A;  2SPC A;  2LCC A;  4QQD A;  4E7I A;  2EJG A;  2MTQ A;  3CCS A;  4CZZ B;  1VQK T;  4CI1 B;  3DLM A;  3C4Z A;  2V7M A;  2Q9Q C;  3Q5X A;  3QBY A;  2PFV A;  2KDS A;  3VYG A;  4EB6 E;  1FIO A;  4LD9 K;  4DO0 A;  3MA9 A;  3EDV A;  4IE4 A;  4QXH B;  1SSF A;  3E9F A;  4X34 A;  1QVP A;  5ADX L;  3SWN B;  4RG2 A;  4XTU A;  4HCZ A;  1VIE A;  4GIW A;  1WGS A;  4M77 A;  4BI4 A;  2XDP A;  4J2C A;  1KNZ A;  4N4H A;  3SOL A;  3RH3 A;  4HFV A;  3CCM A;  2O01 E;  2MBG A;  1K8A U;  4M7D G;  2RHX A;  1M9S A;  2H7O A;  2LSG A;  2A3D A;  3NZP A;  2JQQ A;  2WWU A;  2JZ2 A;  3EFR A;  5M4Y A;  1JB0 E;  5GAO r;  1NPR A;  3L3P A;  4M7A D;  4PFO A;  5HWY A;  4QX7 B;  3G7Z A;  2NTY A;  3JB9 H;  4ATO A;  2N2N A;  1N8R U;  4PJO D;  2XHE B;  4QXC B;  1UGS B;  4H9O C;  3UUM A;  3HA4 A;  4UVC B;  3V7R A;  3LBX B;  1KC8 C;  3S3N A;  3PE0 A;  5GAM j;  3ZN1 B;  2X9W A;  4F7U A;  4PJJ A;  2RD1 A;  1Q7Y C;  2XID A;  2IAK A;  2PG8 A;  4M7D F;  2LRQ A;  2N1G A;  3V5U A;  4M78 D;  2I2L A;  2KQW A;  2W63 A;  5CVI A;  2OTJ T;  2CLY B;  2RP4 A;  3JB9 I;  4DBQ A;  2P0Q A;  4A53 A;  3M59 A;  4G63 A;  4C92 B;  3JCM g;  1MIY A;  2DK3 A;  3Q2M A;  2HQX A;  5KMG P;  4FU6 A;  4O5V A;  3H37 A;  5KE2 A;  3K3O A;  2YU2 A;  4H9N C;  4PK5 A;  5JH7 E;  4WW0 A;  1NWM X;  4OB0 B;  4GYS A;  4HE8 A;  3ANW A;  2RA1 A;  2H3J A;  4EYY R;  3DP7 A;  3JCM V;  4WF2 A;  3CCU A;  4M77 G;  5LJ5 f;  5J3B A;  3WVD B;  1LRZ A;  3UTK A;  3KBU A;  1O75 A;  3JCM h;  4TVR A;  3SDZ A;  4ZS3 A;  2E65 A;  1MMG A;  1MNE A;  1KK7 A;  3V8K A;  3N2K E;  4IHJ E;  3B57 A;  2P0K A;  3J7Y q;  1B7T A;  1BI1 A;  2EYQ A;  4LDX A;  3CXC S;  3PT9 A;  3JCM f;  1ZQ1 A;  4TV8 E;  3E0Z A;  4I50 E;  3JRZ A;  5A0G A;  4C0F A;  4BI3 A;  4F7U G;  5CKB A;  5GMK m;  1BR1 A;  1KHC A;  1VQO T;  2HH7 A;  3O1I A;  1UEB A;  4ZOL E;  3TRE A;  1N6A A;  4CXX A;  2LT4 A;  3LX7 A;  4OFZ A;  1W4S A;  2VKD A;  4DVD A;  3UUX B;  4HGA A;  4I55 E;  3CX7 B;  5FU6 C;  2CM0 A;  4ZI7 E;  4CI0 C;  3GNF B;  1WYB A;  1AHJ B;  3ZMU B;  3QXE B;  4ELZ C;  3CCQ A;  3VHL A;  4HT8 A;  3BK9 A;  3I56 T;  2H3R A;  4UIG A;  3SB2 A;  4YHJ A;  4HT9 A;  3CCV T;  2DTH A;  2VV5 A;  1LOJ A;  2V7L A;  2CZ6 B;  3FXD B;  2K3X A;  3L2Q A;  3ZCJ A;  4M75 B;  5GAM f;  3ZLI A;  3C4W A;  2CXF A;  4QXB B;  4ME7 A;  5GAN 6;  3BW1 A;  2OTL A;  2CCQ A;  4Y28 E;  4L0R A;  1YHQ T;  4P09 A;  2LT1 A;  3AHU A;  2QTX A;  2RJD A;  1ZBX A;  5TAO A;  2JMH A;  2K24 A;  1YIJ T;  4QVZ A;  2X4J A;  5L3C B;  1OXZ A;  3JCM P;  3JCM c;  2KT9 A;  1B34 A;  4JRK A;  4BB7 A;  5FP3 A;  3MP6 A;  1M1K U;  4EMK B;  3LG7 A;  2M67 A;  3JCM X;  5LYJ E;  5JRE A;  2A72 A;  3LJC A;  3AVR A;  2DXC A;  4XTZ A;  4PJO C;  3VU7 H;  4UXN B;  3UT1 A;  2DIQ A;  2WAU A;  4QWN B;  4XK8 E;  3KFW X;  1X79 A;  2L3L A;  2VB6 A;  2DKG A;  3QK6 A;  2RJF A;  4FL6 A;  1BR4 A;  3E1S A;  2MAM A;  2C5K T;  2KWH A;  3FB2 A;  2KMF A;  3GN5 A;  3QUI A;  4FSX A;  3FDR A;  4CQI A;  3E9G A;  4BJN A;  3MKD A;  2E41 A;  3UUL A;  2PUO B;  4M7D C;  3H3A A;  1VQM T;  4M78 C;  5JDF A;  4C92 A;  3CC7 T;  3G4S A;  1KQS S;  2E1H A;  2E9X D;  4NUV A;  5LJ3 e;  1VQ6 A;  2ZMA A;  2JVV A;  5KCO A;  4C5G A;  4ASK A;  2VXF A;  1K73 U;  1IJ5 A;  3O1J A;  4BUG A;  5GAN 8;  5JRC B;  5HXE A;  2XQY A;  4L9I A;  1BYM A;  3CME T;  3CBP A;  2IC6 A;  4HEA A;  1E1H B;  2XUE A;  1H64 1;  3CX6 B;  2K5F A;  2CWO A;  4TZ4 C;  2WSS V;  2MMP A;  2EHO D;  2JPF A;  1M8V A;  4FT2 A;  4H9Q C;  1YJ9 A;  4C5H A;  4M1P A;  4BJM A;  3Q9D A;  3IF8 B;  4ANJ A;  1WRD A;  2DI4 A;  2DD4 A;  1MND A;  4N0A A;  5LJ3 j;  1S72 A;  3CBO A;  2PVD B;  3HFN A;  4BE0 A;  1OWA A;  3CCJ A;  3A5Z B;  5HY6 A;  5GAO m;  2A7Y A;  4FJO A;  2LHN A;  1YI2 A;  4N78 D;  1HTJ F;  2LSI A;  3NTI A;  2LJL A;  3VUB A;  4M7A E;  3UPU A;  5A2Q E;  2FVU A;  2VKJ A;  4PJO E;  3G6E A;  3LFM A;  1BR2 A;  1HG5 A;  3OYB A;  3H8Z A;  4JEH B;  1BKB A;  2G0U A;  2X4Y A;  3JCM J;  3RMQ A;  3R6N A;  2VKH A;  2B8A A;  3PU8 A;  2E6Z A;  3AA0 B;  2VWA A;  2IG0 A;  4BY6 B;  4EZ4 A;  4M78 E;  4JS4 A;  2J1D G;  3LK3 B;  4N4G A;  4L6V 5;  2HQE A;  1H7C A;  2K3Y A;  2LSK A;  1H3Z A;  3F31 A;  4IE6 A;  3QZ5 B;  1YIT T;  1WJQ A;  2DLR A;  4LDY A;  2RI5 A;  5KX5 E;  2UXN B;  2DNX A;  3ZMZ B;  3E22 E;  1VQN T;  3EAE A;  4M77 B;  1KQS A;  1QVG S;  3ZJ2 A;  3QO3 A;  3ZC1 A;  3P8H A;  4HA8 A;  5HYA A;  3CCL A;  3C64 A;  5LJ3 g;  3CC2 T;  4IDZ A;  3S6W A;  2KZ7 B;  1T98 A;  1VQP T;  5LOV E;  3ZJ1 A;  4PJN A;  4WNK A;  3O1H A;  4NL2 A;  2HAX A;  2L3R A;  2QQR A;  4OGE A;  1D0Z A;  1K8A C;  3H6Z A;  4F7U B;  3BQK A;  2LSJ A;  4O4H E;  4BA9 A;  3CCR A;  4H63 H;  3CVR A;  2RHY A;  4C0D C;  2K9A A;  5LJ3 h;  1N8R C;  3BDU A;  5CIU A;  2V1D B;  1BI3 A;  4X1K E;  3SD4 A;  3VU3 C;  4QVD A;  4GYR A;  5FU7 C;  2RA2 A;  3QJ6 A;  3ZMS B;  2RO0 A;  2ZZD A;  2E10 A;  1M90 C;  4J6W A;  2Z6E A;  2XD0 A;  4NS5 A;  1VQ8 A;  1VOM A;  4EMH A;  1SA0 E;  3FIF A;  4KUI A;  5LJ3 f;  2D0T A;  4J83 A;  1BIA A;  4JDS A;  2K57 A;  5LGN B;  3CKD A;  4PNI A;  5CB4 E;  2QEX T;  2XU8 A;  4GK0 E;  1MMN A;  1BI2 A;  3MEV A;  4HCB A;  5L2L A;  3FXE B;  2D9T A;  3G71 T;  3VJP A;  3GWH A;  1IJ6 A;  2MYS A;  3ETU A;  3ANW B;  4NL3 A;  2BUD A;  4PLL A;  2XDD A;  4Z02 A;  3OW2 S;  1OYX A;  3AAI A;  2E9X C;  4FT4 A;  5FY1 A;  4IIJ E;  1WQW A;  2DHR A;  1HX8 A;  3PFS A;  2LQ8 A;  4M7D A;  1Q86 U;  3OYY A;  5GAN 7;  4X1Y E;  3LK4 2;  1VRB A;  1VQ4 A;  4PK4 A;  3N9P A;  3ZYM A;  5CCA A;  3ZPO A;  3RKX A;  3OYJ A;  3A5X A;  1M4Z A;  1VQL A;  1QVG A;  2W61 A;  2EHO C;  2GK9 A;  4A4K A;  3CMA A;  3HFO A;  5I2M A;  3WAJ A;  4ZGD B;  2ZPF B;  3AB3 B;  1ZHC A;  5CO7 A;  4O6J A;  3HKE E;  1Z0P A;  2OA5 A;  4E7L A;  2LT3 A;  1K9M U;  4A4G A;  3VKI A;  3CC4 T;  1G3Y A;  4ISS A;  1Y71 A;  3MHX A;  1VQ9 A;  2NW8 A;  3N9Q A;  3L2U A;  3OYG A;  4M75 D;  1Q82 C;  5JDM A;  4AI6 A;  4CXW A;  4OK0 A;  1VQ5 T;  4UV9 B;  1OI1 A;  4NOY A;  4IE7 A;  3BQI A;  1HS7 A;  5L3E B;  3A8G B;  2KVQ G;  4PJL A;  3Q1J A;  2RHZ A;  4OYJ A;  2PUK B;  2PBI A;  3RIR A;  1VUB A;  5GAN 3;  4Y91 A;  5LHH B;  4PJO G;  4O4J E;  5GMK e;  4IST A;  3RYI E;  4J6Y A;  3IHR A;  2GF7 A;  2L5Q A;  2G3R A;  5KCH A;  4O8S A;  3ZEH A;  4QVC A;  3OYI A;  4KP3 C;  4IUP A;  2R58 A;  4XBF B;  4EYU A;  3FB9 A;  2IVW A;  5DAB A;  3QZ9 B;  1NJI U;  4M78 G;  3WVE B;  1M1F A;  5CR2 A;  3D0T A;  3CCM T;  2Q9Q B;  5FY0 A;  4KUD K;  1MHN A;  3DB4 A;  4H9P C;  3NBX X;  2RK1 A;  3UWN A;  3UT5 E;  4M7A F;  2JN0 A;  3CPW S;  3LYI A;  3OW2 A;  2V8J A;  2DZC A;  1U8R A;  3OBV E;  2CEA A;  1B34 B;  4PJO F;  1I8F A;  5J39 A;  1P92 A;  5GMK j;  2XHC A;  2C06 A;  2YEV C;  5L3D B;  4C5E A;  3RC8 A;  3QPH A;  4AKR B;  3M58 A;  2XAF B;  3F70 A;  2KXP B;  2V7K A;  2C5I T;  2QDY B;  2KMT A;  2OAU A;  4AKL A;  4ZI3 C;  4BD3 A;  3P8D A;  4R56 A;  3RYH E;  4JS5 A;  5I21 A;  4M78 F;  3LH0 A;  2HD0 A;  3MXZ A;  1HK9 A;  3MEW A;  3FBL A;  1M1K C;  4C8Q C;  2YLB A;  1AJ3 A;  2RJE A;  1LKX A;  3GN5 B;  3M56 A;  3M4Y A;  3AA7 B;  4MMK A;  3AA1 B;  2X68 A;  1I81 A;  4JUY A;  4OVA A;  1WR6 A;  2X9H A;  4X9C A;  2OTJ A;  3F57 A;  1QW1 A;  4A4H A;  2XI9 A;  3PDY A;  4U72 A;  5JDL A;  2EFI A;  2V8I A;  4RG8 A;  2RI3 A;  2ZGW A;  4OB3 B;  3T9N A;  2E70 A;  5D6W A;  2W62 A;  5CKD A;  3OS1 A;  1UCU A;  1XOV A;  3GNG A;  5HWX A;  4MZP A;  2V26 A;  2E12 A;  1FEW A;  2LDM A;  4PFP A;  1CUN A;  2F5K A;  5FLX E;  4Z8X A;  1QP3 A;  4FI5 A;  1WNL A;  2LEH A;  2EQU A;  2X0L B;  3CCU T;  4A4E A;  4J5Y A;  3RKO A;  1K73 C;  3VKG A;  3OMC A;  4WBN E;  2RHU A;  4GOU A;  2ZPH B;  3HSB A;  2X4X A;  4XTX A;  5HXS A;  1MIV A;  1US7 B;  3TU4 K;  2R5M A;  1IRE B;  2DWK A;  5CAI A;  3JCM b;  4DND A;  2FHD A;  3I1A A;  2HBP A;  5CKF A;  4IGU A;  3HL8 A;  5JDQ A;  3L2V A;  3CPW A;  4BAY B;  5FMN A;  4NUU A;  1HXD A;  3JB9 D;  2RHI A;  3I55 T;  1N27 A;  3X26 B;  1NZ9 A;  2DPP B;  4ZTF A;  1OZ3 A;  2YIN A;  3QG1 A;  3C4S A;  5GMK h;  4C8Q E;  3R6O A;  2DWG A;  4R55 A;  3N9N A;  4M77 D;  2RB6 A;  2DAQ A;  2LM9 A;  3WI3 A;  1D3B A;  4YJ2 E;  1Q81 U;  3M57 A;  4PJM A;  5CA0 E;  2IW5 B;  4AKG A;  4MFR A;  3QC9 A;  3I56 A;  4HCC A;  2BVM A;  3CCV A;  3C98 B;  5FU6 B;  4TX5 A;  3QDR B;  2ZM0 A;  1M5Q 1;  2NW7 A;  3OYM A;  4CI3 B;  3E08 A;  1YJN A;  3ZCI A;  1XTD A;  1LJO A;  4YFS A;  2VL8 A;  4VUB A;  3UFE A;  2Q9Q A;  3KVB A;  1N9S A;  2LQK A;  2X9X A;  4FIB A;  4DMW A;  2L8D A;  3HKB E;  4A56 A;  2Y4X A;  5HK0 A;  5LBM A;  2X35 A;  3RKY A;  1Y64 B;  3RUX A;  1Q7Y U;  4MDX A;  5H6Q B;  2WSF E;  5DY9 A;  4M7A C;  2GCX A;  3FEO A;  2VKO A;  1OZ2 A;  2I59 A;  2ACX A;  3KVA A;  3CD6 T;  3CXC A;  2PJQ A;  2XTL A;  2WAC A;  5LP6 E;  5L3B B;  1S35 A;  4YTL A;  2DZ9 A;  2DO3 A;  5L3F B;  3PUS A;  1G5V A;  4OGC A;  3LW5 E;  3RC3 A;  3E19 A;  4OHF A;  2LOP A;  2UXX B;  5CK9 A;  4JRQ A;  4EXT A;  4IUR A;  5FRN A;  4PJO B;  5HXH A;  3G4S T;  3ETV A;  4MHC A;  5H6R B;  4UEL A;  1Y96 B;  3LWH A;  1VQM A;  1VQ6 T;  3GIB A;  4GY5 A;  3CC7 A;  3JC6 D;  3ESL A;  3DLL A;  1G3T A;  3PIP A;  2E6N A;  2D5U A;  4V1A v;  3MK7 C;  3CQX C;  3FLG A;  3PUQ A;  2DTI A;  5EK2 A;  4M7D B;  3IEE A;  5FRM A;  3MEA A;  3CCE T;  4M78 B;  3MAC A;  2YU1 A;  2X9Y A;  4KUL A;  4OP0 A;  5CA1 E;  1KD1 C;  3CEY A;  4EMG A;  5HKC A;  2C5J A;  2VK9 A;  4KT0 E;  3A8L B;  1YJ9 T;  4BDZ A;  2KK4 A;  2MI6 A;  3N5B B;  2EQJ A;  1VQ7 A;  3GF5 A;  2NLU A;  3LK2 B;  3FHN A;  1XQH A;  3ONX A;  5JR9 C;  3CCJ T;  3JCM Q;  2DTO A;  4X9D A;  1Q86 C;  4OF1 A;  5C8Y E;  2W0G A;  5DQV A;  1IZ6 A;  1S94 A;  1D1A A;  1PSE A;  4TN7 B;  1NPP A;  2E64 A;  3QYH B;  3G6E T;  4E47 A;  3EDU A;  4TUY E;  3Q5W A;  4MAL A;  2X67 A;  3GLX A;  4ZS2 A;  1YKE B;  1K9M C;  1IAP A;  5LCY A;  3KUF A;  4P0A A;  2MF2 A;  4B6X A;  2YHT A;  1YJW A;  5F8P A;  5LL6 S;  2IC9 A;  2K5L A;  3QII A;  2QA4 A;  2PU9 B;  5DLQ E;  3A8O B;  2PVG B;  1YBY A;  3KIN B;  3K3N A;  1NE8 A;  3OYD A;  4XU1 A;  2WBL A;  3VYH B;  3PMT A;  5LJ5 d;  4C8Q G;  5AYF A;  1YIT A;  4YJ3 E;  2ZM2 A;  3ME9 A;  3LWI A;  1VQN A;  4Q5W A;  4QHO A;  2XKO C;  4CXY A;  1MMD A;  3C50 A;  1X01 A;  5DM7 R;  3KV5 A;  2EQM A;  3TEE A;  1UGR B;  5LGT B;  5J2T E;  3AAA B;  3JCM d;  2ODV A;  2KLQ A;  2HNI A;  3L42 A;  5HK3 A;  2BKD N;  5KH6 A;  1YCY A;  1RL2 A;  4C8Q F;  1NJI C;  4C92 D;  2DCF A;  3O4X E;  3V5S A;  2F69 A;  1EIF A;  2QXF A;  4CI2 B;  3FJP A;  4MML A;  3PUR A;  3RYC E;  3CCR T;  3N2O A;  2BVL A;  2LTO A;  3MP1 A;  4XTW A;  3HKD E;  3OJA A;  2ZPI B;  2RH2 A;  4N4I A;  2M16 A;  5L8R E;  3B13 A;  2EIF A;  2C0S A;  5A1L A;  3RES A;  2R57 A;  4UVA B;  4O4L E;  5A0D A;  3ZEF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...