4L5GA

Crystal structure of thermus thermophilus card
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of CarD, an essential mycobacterial transcription factor.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
molecule keywords CarD
total genus 47
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l5gA02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l5gA01
4KMCA 4MFRA 2LT4A 4L5GA 2EYQA 4ILUA 4XAXB 2LT1A 2LT3A 2LQKA 4KBMB
chains in the Genus database with same CATH superfamily
3MJXA 3H3MA 2UXCT 3G6EA 3RYCE 2DLRA 1PG5B 3EAMA 2QA4Q 2C0TA 2DL8A 3CXCA 1LVKA 1JNRA 1KC8R 3PMIA 5LJ3e 1M90C 2OTLQ 5C0MA 5LOVE 3DB4A 2K2VA 3EAEA 1Z0PA 4G63A 3MXZA 3URGA 5L3GB 1V76A 2RQWA 4A4GA 3CC2T 3PU8A 2WB5A 4QH5A 3SFDA 1W6XA 2WS3A 4X65T 1FMKA 1H92A 2BKOA 3L09A 1RAAB 4BACA 3C50A 3IF8B 3GF5A 1Z8UA 2ZM6T 4IDPA 1IREB 2J47A 5F8PA 5KMGP 5AQIB 3QWYA 4M75G 1JEGA 2JNGA 5E0OA 2XJ7A 2LSGA 1YBYA 2LHNA 2XM1A 1JJ2P 2ZAEA 3CD6T 3EH2A 3M56A 4C5HA 3LH5A 3QG1A 4CI3B 2FZCB 3MCAB 4JJNK 4N4GA 2J6FA 1TUDA 5GAN3 5LJ3h 4DV5T 4TNWA 4RKUE 3IEEA 2BS4A 3CQGB 4OMQA 2DKGA 3CMAT 4X62T 4ZTFA 2B86A 4M7DA 2GNCA 3FJ5A 1QVFS 3AEFA 2E9XD 2DEUA 2HH7A 4HFHA 1ZUYA 3UU6A 4IUTA 3QIIA 4KGVB 5AQVB 4YXDA 2EGEA 2CZ1B 2EQKA 1PCXA 3ZEHA 1ABQA 1M27C 1QSDA 2AKLA 4DOWA 2GCXA 2EYXA 3SD4A 3CWZB 1TOVA 4M77E 3JCMb 2NWBA 5AT1B 3EI0A 3ZEFB 1WYBA 3H0FA 4PK6A 4LFAT 5FY7A 3R84B 4HTEA 2EYQA 3MK7C 1EZZB 5HK3A 4E6RA 2C0IA 4L0RA 2QTVA 2HDAA 2JQQA 2SEMA 2CPTA 2G6FX 4EMKC 5AQRB 3LBXB 1WHMA 3OYNA 5CVIA 1TXQA 4M78C 2K3BA 3P4QA 5EZYE 5A2QE 3CCRT 5AQMB 1U06A 1NLOC 2NR4A 4ME7A 1RAEB 4WNKA 3H3AA 3ZN0B 1FWZA 1YI2T 2LT4A 2VVNA 5AQHB 2N1GA 2D5UA 3A8LB 4R56A 2FHDA 4UF0B 3QYHB 3S6WA 5DQVA 3P7IA 2IVWA 1WHHA 3X28B 2IIMA 3DLMA 2LSIA 1BU1A 1PD0A 2YRCA 2I59A 1IBMT 4KGXB 4PKCC 1MMGA 2QK0A 3JB9G 3UT5E 5FP3A 4A56A 4U31A 3CCSA 4AKHA 2M02A 2OTLT 2O4XA 1J1JA 1D0ZA 3EG9B 3M58A 3E0ZA 2CS7A 5KCOA 1LKXA 4KRTA 3M0QA 3U3IA 3VV0A 5C2TA 4WF2A 2QG9B 1KHCA 2ODVA 3ZJ1A 4JI2T 4CC7A 2DO3A 1D09B 2BVLA 1OULA 4TUYE 3JCMV 3CCQQ 1VIEA 2CP6A 2ACXA 2FJDA 2A7YA 4RCBA 2DTOA 3ZN1B 2EYYA 1Y07A 3H41A 3L2QA 3X20B 3EGXA 5KX5E 4KUIA 2K7AA 2RHZA 2PFVA 4QX7B 1YIJQ 1W70A 2OJ2A 2LJ3A 3O1JA 2QDLA 4M78E 2DETA 4Z02A 1RAIB 4H63V 4QQDA 3CK6A 4EDUA 1V9DA 2DA9A 2RI5A 4J9EA 1VQPT 1Q81U 3X25B 2FPDA 5LJ5h 2KXPB 4Q5WA 1WYCA 2JZ2A 5CKBA 3SDZA 1XJWB 4M7DE 2VV5A 4D8DA 3OYJA 2XY8B 5HXRA 1VUBA 3ETUA 2LX9A 2E9XA 1YP5A 5BR8T 2E41A 1Q7YC 2JQKA 1ABOA 2JMCA 3P4PA 3ZT7A 2ZMAA 3ZCIA 4YHJA 1S1NA 4YSZA 3QYGB 1FJGT 5GAOr 4AXPA 2W2UA 3NRXA 2EFIA 1ZA1B 3DLLA 3MO8A 2C06A 1W4SA 2PJQA 4XU2A 1K73C 4HT8A 4JYAT 3N9MA 4CXXA 2W4XA 3QB5A 2DERA 2X4YA 3S3MA 4HGAA 2EHOC 4NUUA 2O4XB 4YTLA 2EHOB 2OA5A 5CQYA 2M51A 1X43A 3NTHA 2XG8D 1JQQA 1K9MU 1KNPA 4UV8B 4C90A 1I0CA 3I5SA 3SOLA 2EPDA 2QEXT 2D8HA 2CEAA 3OVUA 3JCMh 4ASKA 1SSHA 3P4WA 4LDXA 4Y92A 4OMOA 3HHTB 2CCQA 1YD8G 3HRTA 4HWDA 2J1DG 2K4YA 2DXCA 3UDCA 3F2EA 3UA6A 3I0OA 3FZFB 3ULRB 2RN8A 3NZPA 3AEDA 4UVAB 1H3ZA 3G71T 2NOXA 3ASKA 4CZZB 4A54A 5GANg 3EGUA 4PNIA 2DIGA 1M62A 2UUCT 1UJYA 4OHFA 1IB8A 3ZT6A 2CBIA 2E3HA 4F6RC 1ZEEA 4DR5T 1V1CA 3P8HA 3M54A 4XQ3A 1WR6A 2DI4A 3CD6A 5CO7A 3N9OA 1BYMA 4BY6C 4JLEA 4TV8E 2FL7A 5FU7C 2QEXQ 2P4TA 2QTXA 4RTXA 2ESWA 4LF9T 5KE3A 2ACZA 1HD3A 2EHOA 3KV5A 5J0ZA 3HRSA 2H3EB 5LJ3d 1MUZA 4FYWB 2WDQA 3I55Q 2HN2A 4BDZA 2RQVA 1OI1A 2O9SA 4V1Av 2Y48B 1AZGB 2CXLA 1W09A 4LF5T 1VQMA 2A72A 1CHUA 3LSVA 5FXXA 2K48A 1S72T 4ZI2D 1N8RC 4Y28E 4DUYT 3VS5A 1VYTA 3RIUC 2XSAA 5LBQB 4K0UA 2O01E 1HTJF 3PU3A 1OZ2A 3PNWC 2RA1A 2KEAA 4J6XA 4JRIA 5IH2A 1E6GA 3AEBA 5DY9A 4PJOA 3C64A 3CKDA 4M7AA 3C12A 3OA6A 1QKXA 2XQ3A 1SG5A 2V6YA 3PUWF 5LJ3g 4OB2B 5L3BB 2IUBA 1RAHB 5FY0A 3CPFA 3OSSC 2V8JA 2JIWA 2KXCA 4FM4B 5L2LA 2FG0A 1WFWA 3CCRA 3DTOA 2NP9A 2FYKA 4FI5A 4JRPA 3HL6A 2DL4A 4IIMA 1UTIA 4J9CA 3CCSQ 2OAWA 3BQIA 5ABFA 3Q2MA 4LMJA 3TCJA 4M77B 1O75A 4RG8A 3OS2A 1Q95G 2VGMA 3PFSA 5JH7E 2RK1A 2FPEA 2XKOC 2O2OA 4IDQA 2CSIA 2HQEA 4M78B 4QW2A 1ZP0A 2C5KT 3BK9A 4A4HA 3LLRA 3C0CA 1Y0MA 2QGSA 4EOZB 3LJCA 1VCTA 3NZQA 3A5XA 1AOJA 3EG3A 4WBNE 1YKEB 2YRDA 3AVRA 4X20E 1C1AA 5EC7A 5CKEA 1VIFA 1I94T 3I56T 4B6XA 3GNFB 3CMLA 4C92E 4XBFB 3FHNA 4JI8T 2WMOA 1N32T 2KRMA 4EMKA 3M0PA 1XZYA 1OX8A 3L2WA 1RI0A 2LRKA 5AQSB 2XQYA 4MALA 1FXXA 1VQ4T 4DR3T 1WYXA 5DABA 2BG9E 1RAGB 4B3MT 4RTWA 1MNDA 2D0QB 3QJ6A 2J62A 1QCNA 2DF6A 4QXHB 3B5MA 4H9RC 2FPFA 4FYXB 4OX9T 1ZBJA 2K5FA 1QP3A 2KMTA 2M9UA 2HQXA 5GMKj 1A0NB 1X75C 2CH4A 2V8SV 3MEWA 1I07A 4NPPA 2E12A 1OEBA 1ZSZC 3N2OA 2V6YB 4A5XA 1X2KA 5KYXB 1PSEA 2KT1A 2RP4A 2WCAA 5EG2A 2HKNA 4DR6T 1Z9ZA 1TWBA 3KV9A 3SS1A 1YWPA 3I9QA 2BIVA 4EYUA 1IBLT 4KH1B 2LJ1A 3D7SB 4TV9E 3CPWA 1M7KA 1D3BB 1OV3A 5L4HA 4ZNXA 3RR6A 4HFBA 2ZPGB 5DLQE 4WBOA 5HXCA 4JS4A 3CCJA 2V7IA 1ZUUA 4F7UA 1WR0A 1UGPB 4JI1T 3N5LA 4N78D 5DM7R 1OPKA 4RMOA 3P4RA 4HKAA 4JI3T 1RLPC 2CUBA 3ZYKA 1XMOT 3K1SA 5CJ5A 4LE9A 5AQTB 3JCMW 1NE8A 2MPKA 1EZ3A 1QW1A 4GKKT 2KMFA 2L8KA 4P09A 1OU9A 5FROA 2LMJA 1RADB 4ZI3D 2DD4A 2FRYA 2WY2A 4R55A 3NTIA 3RYHE 2EQMA 3UT1A 3CMEA 5LCYA 3KVAA 4KHZF 2MTQA 2KT8A 3IA3A 2CE7A 2IMLA 1VQ9T 1OEDB 5HEUA 5HWXA 4KUMB 3SRZA 3LX7A 2V5CA 1CKBA 3AXJA 1I81A 2YOEA 3OYDA 3RI5A 2DXTA 2KSSA 8AT1B 3G71A 1QCFA 2HEQA 1YJ9T 4QVCA 2H7OA 5ADXL 4GK0E 5IXFA 4HCCA 3MACA 5A0LA 1YCSB 4A63B 2CHNA 5GANe 1X27A 4PJNA 4N0AA 4QT7A 5J3BA 2E5VA 3O1HA 2J6KA 1CKAA 4UIGA 2LX7A 1ZLMA 1YNZA 2XPKA 1ZSZB 5GJWB 2RJCA 2GK9A 5LB7B 4IIJE 2VGNA 4ISTA 4M77G 4F7UF 2V1RA 4XU1A 2WM9A 4PJOE 2WSFE 2J06A 3VRYA 3K8PC 2DMOA 4EMHA 4YSYA 5AQQB 2CWOA 2FJEA 4ZZCA 2IIUA 4C92F 3M57A 5LYJE 4NIQA 4AQFC 2LQNA 4IE0A 2AK5A 4TN7B 3EG0A 2LDMA 4B6MA 1BCOA 4M7DB 2SPCA 2NUPB 3PMTA 2CP2A 1VQOA 2GGRA 2X67A 2RF0A 3UUMA 2FB7A 4F8HA 3FXDB 1SPKA 1SA0E 3TKLB 3QDFA 4YTPA 3M65A 2FJAA 3VUBA 2RQTA 1R0CB 5LJ3f 3M9QA 1G2BA 4M7DD 3AE6A 5JDNA 2B8AA 2ATCB 4XTXA 2DXBA 2HCKA 2VXEA 1GQEA 4MDXA 2LM2A 4K11A 1TS9A 1PD1A 2HHHT 2LM9A 4A4FA 5HAXA 3UPUA 1QVFP 2OLTA 1ZHIA 3A1PA 4HCZA 1E6HA 4ZEYA 1V29B 4RTTA 3MP1A 3P50A 4AKIA 3ANWB 2KGTA 4X9DA 5HEOA 5CGMA 2E5LT 5GMKh 3OS0A 2WSEE 3M55A 5FMNA 4C92A 1VQOQ 1HYOA 2CKKA 1N27A 1M2VA 4LDWA 3OYZA 1G3TA 2CXDA 3Q5XA 1FMVA 4XTZA 1X6GA 2I6HA 1G5VA 3U23A 1XDPA 2KWHA 3RH3A 4AT1B 1VQPA 2HPJA 4YSXA 2KYMA 2F2VA 4YTMA 3OYEA 3ZBDA 4AG1C 3GA8A 4FYVB 2XDDA 2D0NA 3NFCA 2LNHB 3OYYA 1OWAA 5KCHA 2ROLA 3VRBA 2C5IT 3I56A 1JO8A 1HFAA 2LKHA 4DR7T 3J81E 2BG9B 3B57A 3ZKRA 2RNAA 4E7KA 2LSJA 4ZN3A 1Q86U 6AT1B 3UUBA 3VKGA 4F04B 3CPWS 1ZUKA 3CBMA 4FYYB 5J2UE 2CT4A 4BAYB 3ZT5A 1Q7YU 2CZ6B 3FC3A 2EYZA 3E9FA 3IBPA 4TVRA 4JS5A 1YCYA 1NEGA 3X24B 4MZPA 1WQ7A 3H0HA 3CC2Q 1LOJA 1YIJA 2YDQA 4AQYT 2RPAA 3I35A 4M77C 1KD1R 2CLYC 4KBMB 2X68A 2G0UA 1YJNA 1E2AA 4EMKB 3PUVF 1WHGA 2VWFA 1J5WA 4YFSA 5JR9A 2MIOA 2RMOA 3N9PA 2LRLA 1CSKA 4D6WA 1BI3A 4MHCA 2VKJA 1G83A 1XOVA 3EGDA 4F7UE 4EEDA 1HSQA 2GFUA 1HCIA 4IUVA 4JJDA 3GP8A 3L3PA 3JCFA 2A9UA 4OVAA 3GN5B 4ZN1A 1UGSB 2QVAA 5CCAA 1UE9A 4QHOA 1E1HB 3CCJT 3L2RA 1NYFA 4DBFA 2BKDN 3JCMf 1T98A 4HCBA 1K9MR 3JADA 2E5KA 3JB9H 4B9WA 2QDYB 4X1KE 3C94A 3QWXX 1IBKT 4B3TT 2K3YA 3CCET 4KULA 3OS5A 1BI2A 2IPOB 3CCUQ 1VQMT 3M4GA 1WZOA 1LJOA 2YEVC 1KF6A 2EJGA 3OBYA 1KQSP 1X9BA 3H9NA 3JCMP 1K9MC 2Z6EA 2JM9A 3JCMQ 4E7SA 4X9CA 2KVQG 1S72A 4I43B 3CCMA 2EKOA 2DD5A 2YUQA 1OOTA 3AE5A 3KBTA 5KH6A 3UF4A 2HNIA 4R0KA 2XAHB 2AZVA 4M77A 3CPZA 3C4SA 1MIVA 2FBWA 1K8AR 1WLXA 2XTLA 2P4RA 1T7SA 4M78A 2F5KA 4X5TA 1MIWA 3T8OA 4KX6A 2BUDA 1Q81R 5FXZA 3SEMA 4PJOB 1UHFA 3GWHA 2V7JA 1IGUA 4C91A 4U7IA 2EQJA 2MOZA 3AEEA 4BY6B 2WSSV 2MAWA 3HR0A 2KAFA 4M7AG 2JQ9A 1OEDA 1PSFA 2A36A 2R5AA 4XU0A 5C3JA 2V1QA 4PFZA 4LDUA 3M0TA 2EKHA 1WX6A 2DBMA 3HFOA 1ZSGA 3HFNA 2VURA 1S35A 1UX4A 1YN8A 3CCRQ 3AHUA 1HNXT 3W15B 4HWIB 3NKZA 5D6XA 1WI7A 5IHYA 3OYMA 4L59A 2JPFA 2JS0A 3OJAA 3RKOA 2DVJA 5IHNA 5I21A 2AIRB 1Y64B 4DR2T 3OSVA 3QHSA 1XMQT 4J9GA 1UB4A 3EG2A 1M5Q1 4U72A 5FL1A 1M4ZA 4J9BA 2K3XA 3CEYA 2D9TA 2DM1A 4AKGA 3I55T 2P0QA 4DVDA 2YINA 2L3LA 2DTIA 4UVBB 4NL2A 3P8CD 3ZCJA 2W61A 2MWPA 4JJCA 5FLXE 4QVDA 5I22A 3DKMA 4ZS3A 5LJNA 3RRCA 3AE4A 1HJDA 3HRUA 1H8KA 4NS5A 1YITQ 4LXCA 5JDQA 4DV4T 1ZSZA 3PIOA 2NUPA 3CMAQ 4QH1A 2JTFA 3V7SA 5L23A 3EFSA 4M78D 1NBEB 2F2WA 1M3CA 4OGCA 2RB6A 4AQFA 3NGPA 5FRNA 3HKEE 4HE8A 1UCUA 4F7UG 5JR9C 1PM3A 3OMGA 4DMVA 4M7AC 5ABFB 3GIBA 3JAME 1YFNA 4A4KA 3J80E 4CI1B 1K1ZA 2ZLYA 5GAN8 3QB5K 3EDUA 3PV0F 1K9AA 1QKWA 3OB9A 2YRVA 3O5ZA 1X79A 5L3CB 4LMLA 1KJWA 2R58A 3EUHA 2HZYA 4BJNA 1JNZA 2XUEA 4C8QG 3ZSSA 5CIUA 3HTRA 4XTUA 3V8KA 3LK2B 4ZS2A 4RG2A 1MNEA 4Z90A 4PAGA 1M9SA 2RJFA 5GAOq 2E1HA 3VS4A 2CUDA 4UF0A 3ZMVB 3P8BB 1QVGS 3TLTA 2KY9A 2WU2A 5KYYB 5FU6B 5JDMA 1KQSA 4C0DC 1YJWQ 3A7MA 2ZPIB 2FRWA 2KNDA 4WTOB 1VQ6Q 3G7ZA 5H6QB 3L39A 4DEXA 3QK6A 4IL9A 4M7DC 4LF8T 1YWOA 3AE9A 3C51A 4FSSA 4UEMA 2L3PA 3RKWA 2LCCA 1AWXA 3ZMTB 2SRCA 4DV6T 1LCKA 3B13A 2JVVA 2CGHA 5LJ5g 2D6FA 1QLBA 3K3QC 2KT9A 3UUXB 1M1KC 2L3QA 4ERRA 1GBQA 1KC8U 5LJMA 4C0ZA 2P0KA 1YJ9A 2CLYB 4JLGA 3VS3A 4ZGJB 4MMLA 2M6BA 2Y4XA 1YJWT 2X9WA 3FB9A 4M7AB 4OP0A 5LGUB 2KRNA 3CCUA 3TLUA 2F4VT 2QQRA 5LP6E 3J7AF 2JOYA 1SSFA 1KHIA 2KQWA 2JQHA 2JM8A 1AWWA 4RCCA 2E9XC 5HXEA 3P8DA 5IYZE 4CC4B 1IO6A 3IQLA 2K24A 2OTJA 1T0HA 1Q86C 3CC4Q 2XIDA 5JREA 1L0VA 2MCNA 2UXXB 4IIOA 3CCEA 2KNBB 2BDEA 1F1BB 1ACMB 1YW0A 3HL8A 1G3WA 1YJ9Q 2E70A 2DZ9A 3BQKA 4GYSA 1E7OA 1WJRA 3LK3B 4YT0A 4O6JA 4DNDA 1TUGB 1FYNA 4C0DB 1K0XA 3NWIA 4CQIA 4BA9A 4PJOG 4QKNA 3KXTA 1QQJA 1SUMB 1VQLQ 3G71Q 5GANh 4RUGA 1K73U 2OI3A 1HF8A 3LWIA 2K6DA 4DA4A 2HBPA 1OZ3A 2JRKA 3AXJB 3OBWA 4RTYA 5EK2A 4EIKA 4IL4A 4WW0A 3I9YA 4HFVA 1JJ2S 3EH1A 1ZKEA 4BUGA 2DK3A 3A8MB 2NUTA 5GANj 3TSZA 2IHR1 2L8DA 2QYZA 4AISA 3X1DA 2AKKA 2COYA 1KSWA 4JJBA 5CA0E 3EHRA 1WHKA 3VKIA 2N9DA 1W2BS 2DNUA 4JEUB 4P5NA 4C5IA 1Q81C 3REAB 1IZ6A 5KXJA 3NTKA 4UR9A 4HVWA 3HI2A 1K8AC 1NG2A 2XICA 4DMWA 3RDVA 5HCJA 5LL6S 4FW1A 4C92D 1E7PA 1HXDA 2JJ9A 4J83A 1YITA 1UK5A 5GAN6 4DEYA 2LQ8A 3VR8A 3X26B 2H7VC 4FT2A 3QPHA 2QASA 3QUIA 1WHJA 3KFWX 2LCLA 2NWMA 3JSCA 2FVUA 1YHQQ 3M53A 1VQ9Q 4J8OA 5HKCA 3C4XA 1PHTA 1J5ET 4DV0T 3WVEB 4XTYA 4HWCA 1YQ4A 1OEDC 4UXNB 2MI6A 3I56Q 4M7AE 2RPNA 4JBWF 1QMCA 3CCVA 3CX6B 5AQOB 1WCRA 4MZMA 2RH2A 4OGEA 4OMMA 4UVCB 4ILUA 1W1FA 2XI9A 5GANf 2VKHA 1AT1B 1TH7A 4DV7T 4BDYA 1NM7A 3RMQA 3LW5E 4EIWA 3GOXA 4NXMT 4HFCA 3RKGA 4EEBA 3RYFE 3E19A 3JC6C 3PJAJ 2EJFA 4L6V5 3VRZA 2KI7A 5LHHB 2CP5A 5JVDE 3VS7A 2JW4A 4ILCA 2L9QA 4OYKA 2PUKB 4ZGEB 5GMKi 3AAIA 4PL6A 5JDHA 2YU1A 2DAQA 2LC4A 3LGLA 4PJJA 1Q82R 2ED1A 3I9WA 5GAMf 1US7B 4MFRA 3BE3A 3AT1B 3LWHA 1M1FA 2BKNA 2BKPA 2VL0A 1K4US 2Q9QD 5JRCA 2WDRA 4LMKA 4BI8B 2X0HA 1SEMA 2P84A 5FKYA 3V7RA 3OYGA 3VS1A 4DUZT 3VS6A 4AFSC 5ABHA 1GXIE 3F57A 3EFRA 3M0UA 5HXSA 2WP9A 4B3RT 1SHFA 4JI5T 1SE7A 4CI0C 2JUFA 1M30A 2LEHA 2X9HA 3EHQA 1D1BA 1VYUA 5DQWA 3OYHA 1K8AU 2PVDB 2DIQA 2OTLA 1RACB 2FUPA 2PVOB 5GAMe 1IGQA 1AEYA 2D1XA 4LF4T 2RHYA 2XQ7A 3VU7H 3KVBA 4P1NA 2JMKA 1S72Q 3JCMc 4HEAA 3ME9A 4DBHA 1KQ2A 4M77D 1D1CA 1UG1A 5D7UA 1U3OA 4ELZC 4AI6A 4I50E 1O3XA 5C8YE 3WAJA 3AE7A 3FB2A 2RJDA 1VQOT 3QUJA 4X1IE 2O31A 3VRAA 2P0PA 3RUXA 3DJBA 4D8KA 2RK2A 3ABVA 2AXDS 3A5ZB 1KG1A 2D9DA 3I1AA 3V8LA 2H89A 1SRMA 4CN6A 4QXBB 1MV3A 1AVZC 4YY3T 3SFEA 2CP7A 3QNUA 3VU3C 4X34A 4LUEA 3HA4A 2VXFA 3PUQA 3SWHA 5KYWA 1P92A 4BB7A 5AFUL 3E22E 4DIDB 5HWYA 3FDRA 4O2AE 1M8VA 2MMPA 4H9QC 2O88A 5DJQC 4YHHT 3N9QA 3F31A 3N9LA 4UELA 2IC6A 2KYBA 2VASA 2KZ7B 3RQWA 3CD6Q 1WXUA 2K9AA 5GAN7 4IUUA 5AQUB 4IDNA 1QLYA 1ZBXA 5GAMd 2WMNA 3M0SA 5IWAT 3ZLIA 4HFEA 3OTOT 3UFGA 2VQET 4QWNB 3AB3B 2IAKA 2GBQA 1NWMX 4C92C 3MA9A 3PUZF 3BFMA 1UUSA 1NEKA 2CBJA 4NL3A 4ILBA 2F2XA 3CC4A 2IC9A 3RC8A 3I55A 4H9SE 2VQFT 4A53A 4O2BE 4FCYA 4CRIA 4JDSA 4DV1T 1PWTA 1VQ8T 2RHIA 3EG9A 5IAYA 2YUOA 2R57A 3NMZC 4PLIA 3N2KE 1HX8A 2RI3A 3C4ZA 3CQTA 4J7IA 3REBB 4BD3A 3OYAA 3TQ7P 2X51A 2A2FX 3KINB 4LF7T 3QZ9B 3TSWA 3RERA 2L2PA 2X66A 3NVOA 1GCQC 2V6XA 4IE5A 4KH0B 2AT1B 3DP7A 2X3WD 1VQNQ 2WU5A 2O9VA 1M1GA 2F69A 4I4TE 1W0BA 3N5BB 3EFOB 3L42A 4M4ZA 3JB9I 3C98B 3RESA 1X6BA 1M2OA 4PJOF 3C4WA 1OYXA 4M78F 1VQPQ 2D2SA 5LXTE 3BY7A 4OMNA 4M75E 1BBZA 3PGGA 4J7FA 3OYXA 4BI4A 4NXNT 2OV9A 1DJ7B 1WNLA 1YIJT 2DZCA 1N6AA 4QXCB 1YITT 2KLQA 3KBGA 3PDYA 4U7YA 3EGDB 3F70A 2LJLA 2I0NA 2DL7A 4MZTA 2GTJA 2WACA 2CMRA 4IT4A 1WIEA 3R6OA 1G3SA 4DBQA 3N9NA 1KNZA 1XNQT 2EGCA 1BR2A 1NPRA 2XAQB 4HN9A 2E65A 2Y6XA 3FEOA 3RIRA 3CCVT 3A8HB 2BS2A 3VYHB 5JDGA 4HFDA 1QUUA 2Q9QC 3JAEA 3MP8A 5HY6A 5A0DA 2C5JA 2DLPA 4GKJT 2ABLA 1H641 2ZGWA 4Z91A 1EIFA 4FW2A 1WFDA 1T3SA 1UGQB 4COFA 1MMAA 3FJPA 2DYIA 3N2GE 3TVTA 1VQ6A 2F1LA 1YI2Q 3Q9DA 1I5OB 2DL3A 5F3JA 4PNOA 1WXTA 3CIRA 4DR1T 2LT3A 4C8QE 3KFVA 1W2BP 4CI2B 2UUAT 3VS2A 4AIUA 1TG0A 4J9DA 2V26A 2DJQA 3MEUA 3ONLC 2E8IA 3WXMB 1Q7YR 2J4GA 2HSEB 3CCUT 1BKBA 3L1AA 4UC4A 5FNVE 5FWBA 4C8QF 5CKFA 4E7HA 3G6EQ 3RHWA 1OXZA 2DFUA 4M7DF 2IG0A 3BDUA 1OPLA 2X4JA 4JLIA 3RRWA 1EX4A 4ANJA 3KUFA 3HKSA 2W67A 1ZV4X 1X01A 3CCJQ 4LD9K 3ZPOA 4YLHA 2FEIA 2A37A 4C8QB 2CZ0B 4C8QC 3OYLA 1CUNA 2PTKA 2H3RA 3V8JA 2YU2A 4TWFA 1I4K1 2PTFA 2BZYA 4UV9B 1RI9A 4JEHB 3SWNB 3INZA 5EK4A 1FIOA 1Y96A 1R8OB 2PUOB 1VQMQ 9ATCB 1XQHA 2XQ6A 1OQKA 5GJVB 4MBQA 2NW9A 5CA1E 2ZM0A 3MZKB 5GONE 4E7JA 3VKHA 4ZXLA 3QKJA 2A0FB 3FIFA 3EVYA 3CXCP 1UX5A 2XMFA 4WYVA 5FVLA 2KSRA 3A8OB 3RKXA 5KE2A 2K5IA 2BZBA 2A3LA 3A8GB 3CCST 3E9GA 4HFIA 3OYKA 2Y90A 3JCMX 3LBXA 4I0UA 5AYFA 3ZL7C 3O9XA 2ZM8A 4PJOC 4AKRB 1BI0A 1HK9A 1N34T 4J9IA 3ZYLA 4H63H 2ZCFB 3QXEB 4XU3A 4IE7A 5IHKA 4PJLA 1MMDA 4GY5A 3CCMQ 5AQJB 2K2MA 2YDLA 2DCFA 2PVGB 3PUXF 2W0ZA 4PJMA 3P4SA 2VC8A 4AG2C 2RHXA 1TTHB 1UFFA 4VUBA 3A8YC 2W63A 2PZ1A 5C6SA 1U4QA 2NW8A 2EQUA 3CVRA 1PKTA 3RKYA 3S3NA 2XD0A 4EMGA 5LMNT 4FT4A 3GLXA 3VUZA 4H9PC 2MPXC 2YK0A 1N8RR 5HEGA 1SHZC 3FBLA 4OK0A 4F14A 3MHXA 1BI1A 3UWNA 1KFYA 3OMCA 1KK7A 2ENMA 4AQGA 2VUBA 2PQWA 2UXBT 2RQRA 2ZPHB 1UUEA 1T0JA 1WQWA 1VQNA 2GQVA 1PNJA 4X1YE 4ZTJA 2HN1A 3U78A 1GRIA 1WJSA 1VQ8A 1BR0A 2DX1A 2D0TA 2A08A 1HG2A 2JS2A 4X1VA 2BVMA 3KBUA 4AMCA 1K0SA 2V7MA 1U1TA 2YT6A 2AHJB 3FLGA 5GAN5 1SRLA 1G3YA 1HNZT 5AQLB 2EW3A 2EHOD 2J05A 2Q9QA 4RTVA 3Q5DA 3RMSA 4M75A 1IXDA 1AJ3A 2MWOA 4OMLA 1UDLA 4FL6A 2A3DA 2LHRA 1M90U 4MLKA 4LD6A 1IZNB 2CM0A 5CFBA 1ZA2B 5D6YA 2DJZA 1VQ9A 1OEDE 1TU0B 4JPBW 2CA5A 1B34A 2G3RA 2X0YA 5IUXA 2MYSA 3WAKA 2ODUA 3HKDE 3T1HT 2QGGA 3EG1A 3TU4K 3RBBB 3OYBA 3CC7T 4IURA 1UEBA 4HCKA 4M7AF 2JMHA 1JXOA 4GK5E 2XU8A 3VS0A 2BBHA 1XNIA 3LGFA 4ATOA 3RLFF 2J7IA 2MK5A 4O4IE 3D0TA 3ZMUB 3G1JA 2ED0A 2KRSA 4AKLA 4JV5T 2WBLA 3CCQA 2NTXA 4J9HA 1Y7XA 4KMCA 2Y8DA 3G4ST 4F17A 2VYTA 2R6GF 4ADZA 2E6ZA 5FY1A 2L3SA 1M1KR 2QQSA 2VWAA 4JI7T 1HS7A 4RTZA 1M1KU 2CP3A 4HT9A 4QVZA 2BG9C 1N9RA 2MBGA 2DEQA 4FU6A 2DRMA 3BQLA 1VOMA 4OB3B 5LJ5f 3JB9F 2COWA 4QKUA 1XWMA 2ZPFB 4Y91A 3Q1JA 2OTJT 1VRBA 1YQ3A 5IXBA 4HVVA 2ZM2A 1IRXA 5IN1A 2BE9B 1JJ2A 4OMFB 5LA6E 1JBMA 1M2VB 4IUPA 3TREA 2FZKB 2E3IA 1WHLA 4ESRA 2XAFB 3LG7A 2CP0A 1YJNQ 2LQWA 1T3LA 2A28A 1HNWT 1DU2A 1YHQT 2Z0WA 4O4JE 2CT3A 3GBQA 3WVDB 4U2ZA 1BB9A 1VQKQ 2YLCA 1KD1C 4ZHQE 1VQ5A 2M0OA 1O9SA 3UFEA 2BG9A 3CX8B 1GL5A 5LJ5e 1D3BA 1LVFA 2DRKA 1WLPB 2QQ9A 2QA7A 3ZSTA 1MMNA 1QVGP 3LYIA 3OKQA 1WXBA 2L5QA 5AQNB 4JZ4A 3LFMA 5FVKA 2EYWA 1JXMA 2WSCE 4YJ3E 5M4YA 3L2ZA 2HBWA 2CSQA 3RNJA 3J9X1 5L4EA 4V2SA 1IHWA 2UUBT 4U2YA 1KFZA 1LNXA 1VQKT 3M0RA 1KQ1A 1KD1U 3JCMd 5KYXA 1JU5C 2LVMA 5GMKe 1AHJB 4ORZA 2CRBA 4G2AA 2V5DA 4Z8AA 4DO0A 1ZHCA 4IUQA 3AE3A 3V7CA 3MKDA 2W10A 4P0BA 4DR4T 5GAOm 4M7DG 2XASB 1GFDA 4LDVA 3H37A 1BR1A 3O1IA 5JDFA 2DILA 4AFQC 3BDLA 3OYIA 1AWJA 4M75C 2K3WA 3A98A 4YJ2E 3AEAA 4LFBT 4C8QA 3PVQA 2E2AA 4Z89A 1Q86R 2P9BA 3AVSA 2BS3A 2XK0A 3DB3A 1GCPA 1VQ7A 3H8ZA 3OW2A 4ZI3C 2KROA 3L2VA 4M75F 2BBJA 3AA7B 3HKBE 2JN0A 2K9GA 2VKNA 4O5VA 4YTNA 2ECZA 2YXYA 2UXNB 1GFCA 3S3OA 2KE9A 4X64T 5KYNA 1AD5A 3G4SQ 1IJ6A 1MV0B 2QQBA 2YN6A 1Y01A 5A0GA 5GAN2 1W2BA 4ZI2C 2PBIA 3JCMe 3HKCE 2HD0A 3PJAA 4GLMA 3CQCB 3EGXB 3PUYF 3TLWA 4AFZC 2LP5A 2C0SA 2NUZA 3OS1A 1B07A 3JC6D 2BZXA 2KINB 3RQUA 1VQNT 3QSUA 1Q82C 5AQKB 4E7LA 4TX5A 4PW8A 2H3JA 4ELYC 4U3CA 2MAMA 1HX1B 2NYSA 3CMAA 3FRNA 2W0GA 3FZHB 3VHLA 1QWFA 4KHPT 4ISSA 4LNPA 3LDQB 4XZCA 3CBPA 3QC9A 1R8IA 2EJ9A 2X4XA 2ZPBB 1IJ5A 3QZ5B 1G8XA 1J3TA 4TNVA 4CC3A 1TUCA 1PKSA 4IKFA 1AZEA 2RO0A 2XQ8A 1NLPC 5FU7B 2DBKA 1FX7A 1VYVA 1RLQC 2X35A 3CCMT 3RX6A 3OBVE 5F5WA 1BIBA 1N5ZA 2LCSA 5IT9E 1KNRA 2FO0A 3AAEB 4CXYA 5JDLA 5GMKm 4CN1A 3T9NA 1QCOA 1XDOA 1U8RA 1U5PA 1VQ6T 3H6ZA 5LJ5d 3CC7A 1UGVA 4LF6T 3ZJ2A 2YDSA 4CXWA 3EHZA 2FJBA 2YUNA 3CMET 2ES0A 3AAAB 2KWIB 2EVRA 4OB0B 5ETWA 2JTMA 5CAIA 5J1GA 2W66A 3M5AA 4E2FB 2N2NA 2VVSA 5LMUT 2V8IA 2PU9B 3BW1A 2XQAA 4F7UB 2XZEA 4C5EA 1W9RA 2W00A 2EIFA 1YI2A 2WZHA 3GMIA 2M6IA 1B7TA 3GN5A 1B34B 4DOVA 3ONJA 2LZ6B 4KUDK 2JTEA 4C92B 2DYBA 5CKDA 4JZ3A 2VK9A 3UU5A 4PJOD 3ETVA 3MP6A 4EXTA 2DHRA 2Q9QB 2YHTA 1X69A 1W0AA 4M78G 3JB9D 5I11A 4BJMA 4PK4A 2HL5C 1VQ5Q 4EAHA 5J39A 2RI2A 3PUGA 3ESLA 4M75D 2HL3A 2QQAA 3RGLA 5KYUB 3CCLQ 3CCLA 2M1HA 2OTJQ 3IHRA 3HP9A 2NLUA 5EK3A 2QA4T 3RC3A 4E7ZA 4OFZA 3S4UA 1KQSS 5AQPB 2K5LA 4IGUA 2XDBA 4A97A 4CN4A 1MGQA 2KBTA 1U5SA 4C8QD 2XSBA 1HG5A 3FXEB 4HWFA 5KYWB 2DE0X 4B9XA 1I8FA 2K57A 4LN2A 1NJIC 3JAFA 4M7AD 3PUAA 2XQ9A 2QI2A 2YLBA 5CQXA 2M0YA 1AWOA 2WWUA 1I1JA 4TWDA 3HSBA 3G6ET 5ECAA 4HWHA 3J7Yq 2V1DB 3O4XE 3EFOA 2EQIA 3PIPA 2XQ4A 4DQ2A 1VQKA 1LPLA 1D0YA 4L5GA 1R77A 3QDRB 3I0QA 2OAUA 4A4EA 3Q5WA 3V5UA 2COZA 1X6OA 2HSPA 1UHCA 5KYUA 4BI3A 2GFAA 4KT0E 2J6OA 1WPYA 4XTWA 1M3BA 2X0LB 4GLKA 4PFPA 4C5GA 2EWNA 2LOPA 1UGOA 2X9XA 2XAGB 1JB0E 1VQLT 1NAFA 3KDSE 4LFCT 2CH4W 5HK0A 3OYCA 1I5LA 4U33A 2GTOA 2YSQA 4E47A 2XM2A 3JCMJ 5L3EB 1PRLC 1U1SA 3JV3A 1H3HA 2MF2A 1BCMA 2DTHA 1VQ4Q 2JT4A 2NTYA 4Q25A 1FEWA 1H7CA 3KV4A 1UGRB 3ANWA 5A1LA 3UU8A 3M3ZB 1VQ7T 3O8VA 4J2CA 4QX8B 2E4HA 5JTGA 5LG3A 1UURA 4U74A 4B3ST 1NZ9A 4ZOLE 2QAZA 5L8RE 3CPWP 2QEXA 3K3NA 1QVPA 4XTVA 3UA7A 4ILAA 2DVEA 4AFUC 4PFOA 1QP2A 3CXCS 2KR3A 4EZHA 2RHUA 1FMWA 4A98A 2BTTA 2DWKA 5CR2A 5ABGA 3AA0B 3PT9A 1VQ7Q 2VKDA 1WA7A 1G73A 5FU6C 2JMAA 3TLVA 5FXVA 4M1PA 5LNKA 4NOYA 1SKUB 1YJNT 2CYZB 3META 4TZ4C 5J26A 3CCQT 4QQGA 1VQ8Q 3JB9J 3NHNA 5CKHA 3G4SA 2HPLA 3UTKA 2H8HA 4Z88A 2LOSA 2ROTA 2HAXA 3PTAA 1QWEA 5FWCA 1C6VX 3NRYA 4X66T 4C92G 3AEGA 4GOUA 3RIAA 4EV6A 5LHIB 2LT1A 5FXWA 4KGZB 1NEBA 2CWYA 3RIUA 2YWWA 4J5YA 4GYRA 5KYYA 5LBMA 2M67A 2L0AA 2VL8A 1NJIU 3JRZA 1Y71A 3ZC1A 5JR9B 5HEJA 1XNRT 1MHNA 3OPCA 3RF1A 3FBZA 2CREA 3PVLA 1GCQA 1YXRA 2MOXA 2RQUA 4XK8E 5FL0A 3SWNA 3UUNA 4WZXA 1R0BG 2PG8A 2E64A 2FZGB 4ZI7E 2XQ5A 1Y96B 4O8SA 3CCVQ 2IW5B 2HQHA 1D1AA 3EDVA 8ATCB 4Z8XA 2Y4YA 3PURA 4K0KT 4FIBA 1Z9QA 2LE8A 3NBXX 2V7KA 2C0OA 2PNIA 4HVUA 4J9FA 4JI6T 2HMAA 2K5BB 1T72A 2GF7A 2I2LA 5GAOp 4JI0T 4N4IA 1VQ5T 1B3QA 2E5QA 4OF1A 3L2UA 1KC8C 2H88A 1ARKA 3QOFA 2IDOB 1Y57A 3ER0A 1NENA 1SF9A 3SB2A 2D0UA 1WDXA 5AQFB 3AA6B 3LK42 2R5MA 2QXFA 2UU9T 3QJYA 3G06A 1D0XA 3AE1A 2KDSA 3ZYMA 2OX7A 4IDZA 5H6RB 3FZMB 3E2UA 3FZLB 3SWNC 3VYGA 2XHCA 3KV6A 1KEYA 3RYIE 2RM4A 4BE0A 4OYJA 4O4LE 3ONXA 3OYFA 3H0IA 5FYMA 3UU3A 3VJPA 5HEHA 5KDMC 2NW7A 5LGTB 2D8JA 5CB4E 2WQYA 1YKHB 2F5TX 5L3FB 3M59A 3OW2S 2M16A 3CC2A 3I5RA 2BZ8A 3EABA 3CCLT 5L3DB 1IAPA 5IHIA 2QA4A 4OB1B 3GPLA 4RTUA 1RUWA 1VQ4A 1UECA 1ZQ1A 4EGWA 4KP3C 2X4WA 3ZC0A 2CXFA 1Q82U 5GANd 2CHOA 1OU8A 2KK4A 2JXBA 3AA1B 2DXUA 2WZIA 5AQGB 5HCMA 3OQ5A 3Q5EA 3ZFJA 5GAOn 5HYAA 5JRCB 3E1SA 3MEVA 1PC0A 4LDYA 4C0GA 2VVKA 4II1A 1BR4A 2RD1A 3THKA 4FSXA 1K76A 1ZOYA 3T1YT 5FW9A 2VKOA 2LRQA 2ZPEB 4EB6E 4DBRA 1WGSA 4J6YA 5GAMj 1K73R 3AECA 7AT1B 2I0MA 1M90R 1EFNA 1WRDA 5I2MA 1NJIR 2LSYA 5TAOA 3TLSA 3CMEQ 2UXDT 4JUYA 3GNGA 1RAFB 2LJ0A 3C95A 4P0AA 3V5SA 3JCMg 2LQKA 1T8BA 1KIKA 4MMKA 1VQLA 3K3OA 2YKSA 4IE6A 4HXJA 3CBOA 3QBYA 4HA8A 4OMPA 2DNXA 4NUVA 2L89A 2AE9A 3HPWA 4M75B 1X2QA 2RA2A 4F16A 4EYYR 2LLYA 2NUTB 5L47A 3PUSA 2WDVA 4KI0F 5D6WA 5GAN4 4LUDA 4EPCA 5J2TE 2X9YA 4PLLA 2B1EA 3RPUA 3RIFA 4I55E 5DLOA 3CCEQ 4JRQA 2W62A 2B76A 1N8RU 4ZGDB 3SFMA 4WCIA 4JUVA 2V7LA 1JRIA 5GAMh 4BE1A 4QQ6A 2HKQB 2YDRA 1XTDA 4JRKA 2DWGA 2YUPA 3TEEA 4O4HE 1QVFA 5LG4A 4ZZBA 1TSFA 2X3XD 2ZZDA 3PTRB 1VCSA 4IDOA 1NYGA 2LNVA 2DPPB 2EBPA 2E9XB 4N0AC 4CC2A 2QGFB 5LGNB 5ABEA 2AZSA 5CK9A 3CQXC 4IREA 4C0FA 3OY9A 3CC7Q 4HKEA 2KXDA 4GBQA 5GAOl 1QVGA 1GBRA 3WI3A 5HXHA 3PE0A 2XHEB 2DL5A 5I2SA 4IE4A 5FRMA 3QO3A 4XAXB 3AE8A 4TWHA 3OW2P 2QRXA 1S94A 4BE2A 1YHQA 2K79A 5HCKA 1YJWA 3L8RA 4EZ4A 2XAJB 3MPUB 2EGAA 4E7IA 4L9IA 5M9OA 1PRMC 3FZKB 3E08A 1BK2A 4J6WA 2CZ7B 5LJ3j 3UULA 2BE7D 1N9SA 2QYWA 3UQ4A 5LJ5j 1NPPA 2EAYA 4H9NC 5GAMg 3UQ7A 1I6ZA 3SHWA 2WWVA 1ZX6A 1SHGA 4N4HA 2V8KA 2LSKA 2LTOA 4H9OC 4DV2T 3CC4T 4FJOA 2CDTA 2RJEA 3LH0A 3R6NA 3MEAA 1IHVA 3AE2A 3UU4A 2GQIA 1HR0T 4JI4T 4DV3T 1UJ0A 3M4YA 2E10A 2XDPA 1BIAA 2VB6A 3NPFA 4IHJE 2LKGA 3VR9A 1RL2A 3UATA 2E6NA 2L3RA 2WAUA 5BMVE 3CX7B 4MDWA 1N33T 1C0MA 5LHGB 1N36T 5GMKl 2DL1A 1OX9A 4QH4A 1WJQA 1LRZA 1M8MA 5JQGE 4GIWA 1RABB 1VA7A 3ZMSB 1MIYA 4PK5A 1M3AA 4M77F 3ZMZB
chains in the Genus database with same CATH topology
3MJXA 3G6EA 3RYCE 2DLRA 3CXCA 1LVKA 3PMIA 5LJ3e 1M90C 5C0MA 5LOVE 3DB4A 2K2VA 3EAEA 1Z0PA 4G63A 3MXZA 3URGA 5L3GB 3CC2T 4A4GA 3PU8A 3L09A 4BACA 3C50A 3IF8B 3GF5A 1IREB 5F8PA 5KMGP 4M75G 2JNGA 5E0OA 2LSGA 1YBYA 2LHNA 3CD6T 3M56A 4C5HA 3QG1A 4CI3B 3MCAB 4JJNK 4N4GA 5GAN3 5LJ3h 4RKUE 3IEEA 3CQGB 2DKGA 3CMAT 4ZTFA 4M7DA 1QVFS 2E9XD 2HH7A 4IUTA 3QIIA 2CZ1B 2EQKA 3ZEHA 1QSDA 4DOWA 2GCXA 3SD4A 3CWZB 4M77E 3JCMb 2NWBA 3ZEFB 1WYBA 4PK6A 5FY7A 3R84B 4HTEA 2EYQA 3MK7C 5HK3A 4L0RA 2JQQA 4EMKC 3LBXB 3OYNA 5CVIA 4M78C 5EZYE 5A2QE 3CCRT 4ME7A 4WNKA 3H3AA 3ZN0B 1FWZA 1YI2T 2LT4A 2N1GA 2D5UA 3A8LB 4R56A 2FHDA 4UF0B 3QYHB 3S6WA 5DQVA 3P7IA 2IVWA 3X28B 3DLMA 2LSIA 2I59A 4PKCC 1MMGA 3JB9G 3UT5E 5FP3A 4A56A 3CCSA 2OTLT 4AKHA 2O4XA 1D0ZA 3M58A 3E0ZA 2CS7A 5KCOA 1LKXA 3U3IA 3VV0A 4WF2A 1KHCA 2ODVA 3ZJ1A 2DO3A 2BVLA 3JCMV 4TUYE 1VIEA 2ACXA 2A7YA 4RCBA 2DTOA 3ZN1B 3L2QA 1Y07A 3X20B 5KX5E 4KUIA 2RHZA 2PFVA 4QX7B 3O1JA 4M78E 4Z02A 4H63V 4QQDA 4EDUA 1V9DA 2RI5A 1VQPT 1Q81U 3X25B 5LJ5h 2KXPB 4Q5WA 1WYCA 2JZ2A 5CKBA 3SDZA 4M7DE 2VV5A 3OYJA 5HXRA 1VUBA 3ETUA 2LX9A 2E9XA 2E41A 1Q7YC 2ZMAA 3ZCIA 4YHJA 3QYGB 5GAOr 4AXPA 2EFIA 3NRXA 2C06A 3DLLA 3MO8A 1W4SA 2PJQA 4XU2A 1K73C 4HT8A 3N9MA 4CXXA 2X4YA 3S3MA 4HGAA 2EHOC 4NUUA 2O4XB 4YTLA 2EHOB 2OA5A 5CQYA 3NTHA 2XG8D 1K9MU 4UV8B 4C90A 3SOLA 2QEXT 2CEAA 3JCMh 4ASKA 4LDXA 3HRTA 3HHTB 2CCQA 1YD8G 2K4YA 2J1DG 2DXCA 3UDCA 3F2EA 3I0OA 3NZPA 4UVAB 1H3ZA 3G71T 2NOXA 3ASKA 4CZZB 4A54A 5GANg 4PNIA 2DIGA 4OHFA 3KXTA 3P8HA 4F6RC 1ZEEA 3M54A 4XQ3A 1WR6A 2DI4A 3CD6A 5CO7A 3N9OA 1BYMA 4BY6C 4JLEA 4TV8E 2FL7A 5FU7C 2P4TA 2QTXA 5KE3A 2EHOA 3KV5A 3HRSA 5LJ3d 4BDZA 1OI1A 4V1Av 2Y48B 2CXLA 1VQMA 2A72A 5FXXA 2K48A 1S72T 4ZI2D 1N8RC 4Y28E 5LBQB 4K0UA 2O01E 1HTJF 3PU3A 1OZ2A 3PNWC 2RA1A 4J6XA 4JRIA 5DY9A 4PJOA 3C64A 3CKDA 4M7AA 3C12A 3OA6A 5LJ3g 4OB2B 5L3BB 5FY0A 3CPFA 3OSSC 2V8JA 4FM4B 5L2LA 3CCRA 3DTOA 2NP9A 2FYKA 4FI5A 4JRPA 3HL6A 3BQIA 3Q2MA 3TCJA 4M77B 1O75A 4RG8A 3OS2A 2VGMA 3PFSA 5JH7E 2RK1A 2XKOC 4M78B 2HQEA 4QW2A 2C5KT 3BK9A 4A4HA 3LLRA 2QGSA 4EOZB 3LJCA 3NZQA 3A5XA 4WBNE 1YKEB 3AVRA 4X20E 5CKEA 1VIFA 3I56T 4B6XA 3GNFB 3CMLA 4C92E 4XBFB 3FHNA 2WMOA 4EMKA 3L2WA 1RI0A 2XQYA 4MALA 1FXXA 1VQ4T 5DABA 1MNDA 2D0QB 3QJ6A 4QXHB 4H9RC 2K5FA 1QP3A 2KMTA 2M9UA 2HQXA 5GMKj 1X75C 3MEWA 2E12A 3N2OA 1PSEA 2RP4A 5EG2A 3KV9A 3SS1A 2BIVA 4EYUA 4TV9E 3CPWA 1D3BB 2ZPGB 5DLQE 4WBOA 5HXCA 4JS4A 3CCJA 2V7IA 4F7UA 1UGPB 3N5LA 4N78D 5DM7R 4RMOA 4HKAA 3ZYKA 3JCMW 1NE8A 1EZ3A 1QW1A 2KMFA 2L8KA 4P09A 5FROA 2DD4A 4ZI3D 4R55A 3NTIA 3RYHE 2EQMA 3UT1A 3CMEA 5LCYA 3KVAA 2MTQA 2CE7A 1VQ9T 4KUMB 5HWXA 3SRZA 3LX7A 1I81A 3OYDA 2DXTA 2KSSA 3G71A 1YJ9T 4QVCA 2H7OA 5ADXL 4GK0E 4HCCA 3MACA 5A0LA 5GANe 4PJNA 4N0AA 5J3BA 3O1HA 4UIGA 2RJCA 2GK9A 4IIJE 2VGNA 4ISTA 4M77G 4F7UF 4XU1A 2WM9A 4PJOE 2WSFE 3K8PC 4EMHA 2CWOA 4C92F 3M57A 5LYJE 4AQFC 4IE0A 4TN7B 2LDMA 4M7DB 2SPCA 3PMTA 1VQOA 2X67A 3UUMA 2FB7A 3FXDB 1SA0E 3TKLB 3M65A 3VUBA 5LJ3f 3M9QA 4M7DD 5JDNA 2B8AA 4XTXA 2DXBA 2VXEA 4MDXA 2LM9A 4A4FA 5HAXA 3UPUA 1ZHIA 4HCZA 1V29B 3MP1A 4AKIA 3ANWB 4X9DA 5GMKh 3OS0A 2WSEE 3M55A 5FMNA 4C92A 2CKKA 1N27A 4LDWA 3OYZA 1G3TA 2CXDA 3Q5XA 1FMVA 4XTZA 1G5VA 1VQPA 2KWHA 3RH3A 2HPJA 3OYEA 3ZBDA 3GA8A 2XDDA 3NFCA 3OYYA 1OWAA 5KCHA 2C5IT 3I56A 1HFAA 3J81E 3B57A 4E7KA 2LSJA 4ZN3A 1Q86U 3VKGA 3CPWS 3CBMA 5J2UE 4BAYB 1Q7YU 2CZ6B 3FC3A 3E9FA 3IBPA 4TVRA 4JS5A 1YCYA 3X24B 4MZPA 1WQ7A 1LOJA 1YIJA 4M77C 2CLYC 4KBMB 2X68A 2G0UA 1YJNA 4EMKB 4YFSA 5JR9A 3N9PA 4D6WA 1BI3A 4MHCA 2VKJA 1XOVA 4F7UE 2GFUA 1HCIA 4IUVA 3GP8A 3L3PA 4OVAA 3GN5B 4ZN1A 1UGSB 5CCAA 4QHOA 1E1HB 3CCJT 3L2RA 2BKDN 3JCMf 1T98A 4HCBA 3JB9H 4B9WA 2QDYB 4X1KE 3C94A 2K3YA 3CCET 4KULA 3OS5A 1BI2A 1VQMT 3M4GA 1LJOA 2YEVC 2EJGA 3OBYA 3JCMP 1K9MC 2Z6EA 3JCMQ 4E7SA 4X9CA 2KVQG 1S72A 4I43B 3CCMA 2EKOA 2DD5A 3KBTA 5KH6A 2HNIA 2XAHB 4M77A 3CPZA 3C4SA 1MIVA 1WLXA 2XTLA 4M78A 2F5KA 1MIWA 3T8OA 2BUDA 5FXZA 4PJOB 3GWHA 2V7JA 4C91A 2EQJA 2MOZA 4BY6B 2WSSV 3HR0A 2KAFA 4M7AG 1PSFA 2R5AA 4XU0A 4LDUA 3HFOA 3HFNA 1S35A 1UX4A 3AHUA 3W15B 5D6XA 3OYMA 5IHYA 4L59A 2JPFA 3OJAA 3RKOA 5I21A 1Y64B 3OSVA 3QHSA 1UB4A 1M5Q1 4U72A 1M4ZA 2K3XA 3CEYA 2D9TA 4AKGA 3I55T 2P0QA 4DVDA 2YINA 2L3LA 2DTIA 4UVBB 4NL2A 3P8CD 3ZCJA 2W61A 2MWPA 5FLXE 4QVDA 3DKMA 4ZS3A 5LJNA 3RRCA 3HRUA 4NS5A 5JDQA 3PIOA 2JTFA 3V7SA 3EFSA 4M78D 4OGCA 2RB6A 4AQFA 5FRNA 3HKEE 4HE8A 1UCUA 4F7UG 5JR9C 3OMGA 4DMVA 4M7AC 3GIBA 3JAME 4A4KA 3J80E 4CI1B 2ZLYA 5GAN8 3EDUA 3OB9A 2YRVA 1X79A 5L3CB 2R58A 3EUHA 4BJNA 2XUEA 4C8QG 5CIUA 4XTUA 3V8KA 3LK2B 4ZS2A 4RG2A 1MNEA 1M9SA 4PAGA 2RJFA 5GAOq 2E1HA 4UF0A 3ZMVB 3P8BB 1QVGS 2KY9A 5FU6B 5JDMA 1KQSA 4C0DC 2ZPIB 2KNDA 3G7ZA 5H6QB 3QK6A 4M7DC 3C51A 4UEMA 3RKWA 2LCCA 3ZMTB 3B13A 2JVVA 2CGHA 5LJ5g 2D6FA 3K3QC 2KT9A 3UUXB 1M1KC 4ERRA 1KC8U 5LJMA 4C0ZA 2P0KA 1YJ9A 2CLYB 4JLGA 4ZGJB 4MMLA 2Y4XA 1YJWT 2X9WA 3FB9A 4M7AB 4OP0A 5LGUB 3CCUA 2QQRA 5LP6E 3J7AF 2JOYA 1SSFA 1KHIA 2KQWA 4RCCA 2E9XC 5HXEA 3P8DA 5IYZE 2K24A 2OTJA 1Q86C 2XIDA 5JREA 2UXXB 3CCEA 2BDEA 3HL8A 1YW0A 1G3WA 2E70A 2DZ9A 3BQKA 4GYSA 1WJRA 3LK3B 4O6JA 4DNDA 4C0DB 4CQIA 4BA9A 4PJOG 4QKNA 5GANh 1K73U 1HF8A 3LWIA 4DA4A 2HBPA 1OZ3A 2JRKA 3OBWA 5EK2A 4WW0A 3I9YA 4HFVA 1JJ2S 1ZKEA 4BUGA 2DK3A 3A8MB 5GANj 2L8DA 5CA0E 3VKIA 1W2BS 2N9DA 4JEUB 4P5NA 4C5IA 1Q81C 1IZ6A 3NTKA 3HI2A 1K8AC 2XICA 4DMWA 5LL6S 4C92D 1HXDA 2JJ9A 4J83A 1YITA 5GAN6 2LQ8A 3X26B 2H7VC 4FT2A 3QPHA 3QUIA 3KFWX 2LCLA 3JSCA 2FVUA 3M53A 4J8OA 5HKCA 3C4XA 3WVEB 4XTYA 4UXNB 2MI6A 4M7AE 3CCVA 3CX6B 4MZMA 4OGEA 2RH2A 4UVCB 4ILUA 2XI9A 5GANf 2VKHA 1TH7A 4BDYA 3RMQA 3LW5E 4EIWA 3GOXA 3RYFE 3E19A 3JC6C 4L6V5 2EJFA 5LHHB 5JVDE 4ZGEB 2L9QA 4OYKA 2PUKB 5GMKi 4PL6A 3AAIA 5JDHA 2YU1A 2DAQA 2LC4A 3LGLA 4PJJA 5GAMf 3I9WA 1US7B 4MFRA 3LWHA 1M1FA 2Q9QD 5JRCA 4BI8B 3V7RA 3OYGA 1GXIE 3F57A 3EFRA 5HXSA 4CI0C 2JUFA 2LEHA 2X9HA 1D1BA 5DQWA 3OYHA 1K8AU 2PVDB 2DIQA 2OTLA 2PVOB 5GAMe 2RHYA 3VU7H 3KVBA 2JMKA 3JCMc 4HEAA 3ME9A 1KQ2A 4M77D 1D1CA 4ELZC 4AI6A 4I50E 1O3XA 5C8YE 3WAJA 3FB2A 2RJDA 1VQOT 3QUJA 4X1IE 2P0PA 3RUXA 3DJBA 2RK2A 3A5ZB 1KG1A 3I1AA 3V8LA 4QXBB 3VU3C 4X34A 3HA4A 2VXFA 3PUQA 3SWHA 1P92A 4BB7A 5AFUL 3E22E 5HWYA 3FDRA 4O2AE 1M8VA 2MMPA 4H9QC 5DJQC 3N9QA 3F31A 3N9LA 4UELA 2IC6A 2VASA 2KZ7B 2K9AA 5GAN7 4IUUA 1ZBXA 5GAMd 2WMNA 3ZLIA 4C92C 4QWNB 3AB3B 2IAKA 1NWMX 3MA9A 3BFMA 3CC4A 4NL3A 2IC9A 3RC8A 3I55A 4H9SE 4A53A 4O2BE 4CRIA 4JDSA 1VQ8T 2RHIA 5IAYA 2R57A 4PLIA 3N2KE 1HX8A 2RI3A 3C4ZA 4J7IA 4BD3A 3OYAA 2X51A 2A2FX 3KINB 3QZ9B 3RERA 2X66A 4IE5A 3DP7A 1M1GA 2F69A 4I4TE 3N5BB 3JB9I 3L42A 3C98B 3RESA 4PJOF 3C4WA 1OYXA 4M78F 2D2SA 5LXTE 3BY7A 4M75E 3PGGA 4J7FA 3OYXA 4BI4A 1DJ7B 1WNLA 1YIJT 2DZCA 1N6AA 4QXCB 1YITT 2KLQA 3KBGA 3PDYA 3F70A 2LJLA 4MZTA 2WACA 2CMRA 3R6OA 1G3SA 4DBQA 3N9NA 1KNZA 1BR2A 1NPRA 2XAQB 4HN9A 2E65A 2Y6XA 3FEOA 3RIRA 3CCVT 3A8HB 3VYHB 5JDGA 1QUUA 2Q9QC 3MP8A 5HY6A 5A0DA 2C5JA 1H641 2ZGWA 1EIFA 1UGQB 1MMAA 3FJPA 1VQ6A 3N2GE 3Q9DA 5F3JA 4PNOA 2LT3A 4C8QE 4CI2B 2V26A 3MEUA 2E8IA 3WXMB 3CCUT 1BKBA 3L1AA 4UC4A 5FNVE 4C8QF 5CKFA 4E7HA 1OXZA 4M7DF 2IG0A 3BDUA 2X4JA 4JLIA 3RRWA 4ANJA 3KUFA 3HKSA 1ZV4X 1X01A 4LD9K 3ZPOA 4YLHA 4C8QB 2CZ0B 4C8QC 3OYLA 1CUNA 3V8JA 2H3RA 2YU2A 1I4K1 4UV9B 3SWNB 4JEHB 3INZA 5EK4A 1FIOA 1Y96A 1R8OB 2PUOB 1XQHA 4MBQA 2NW9A 5CA1E 2ZM0A 3MZKB 5GONE 4E7JA 3VKHA 3QKJA 3FIFA 3EVYA 1UX5A 3A8OB 3RKXA 5KE2A 2K5IA 2BZBA 2A3LA 3A8GB 3CCST 3E9GA 3OYKA 2Y90A 3JCMX 3LBXA 5AYFA 3O9XA 2ZM8A 4PJOC 4AKRB 1BI0A 1HK9A 3ZYLA 2ZCFB 4H63H 3QXEB 4XU3A 4IE7A 4PJLA 1MMDA 4GY5A 2DCFA 2PVGB 4PJMA 2VC8A 2RHXA 4VUBA 2W63A 5C6SA 1U4QA 2NW8A 2EQUA 3CVRA 3RKYA 3S3NA 2XD0A 4EMGA 4FT4A 3GLXA 3VUZA 4H9PC 2YK0A 1SHZC 3FBLA 4OK0A 3MHXA 1BI1A 3UWNA 3OMCA 1KK7A 4AQGA 2VUBA 2PQWA 2ZPHB 1WQWA 1VQNA 2GQVA 4X1YE 4ZTJA 3U78A 1WJSA 1VQ8A 1BR0A 2D0TA 1HG2A 2BVMA 3KBUA 2V7MA 1U1TA 2AHJB 3FLGA 5GAN5 1G3YA 2EHOD 2Q9QA 3RMSA 4M75A 1AJ3A 2MWOA 4FL6A 2A3DA 2LHRA 1M90U 4MLKA 4LD6A 1IZNB 2CM0A 5D6YA 2DJZA 1VQ9A 2CA5A 1B34A 2G3RA 2MYSA 3WAKA 2ODUA 3HKDE 3TU4K 3OYBA 3CC7T 4IURA 1UEBA 4M7AF 2JMHA 4GK5E 2XU8A 1XNIA 3LGFA 4ATOA 4O4IE 3D0TA 3ZMUB 4AKLA 2WBLA 3CCQA 2NTXA 1Y7XA 4KMCA 2Y8DA 3G4ST 2VYTA 4ADZA 2E6ZA 5FY1A 2QQSA 2VWAA 1HS7A 1M1KU 4HT9A 4QVZA 1N9RA 2MBGA 2DEQA 4FU6A 3BQLA 1VOMA 4OB3B 5LJ5f 3JB9F 2ZPFB 4Y91A 3Q1JA 2OTJT 1VRBA 2ZM2A 5IN1A 1JJ2A 4OMFB 5LA6E 1JBMA 4IUPA 3TREA 2XAFB 3LG7A 1YHQT 4O4JE 3WVDB 2YLCA 1KD1C 4ZHQE 1VQ5A 2M0OA 1O9SA 3UFEA 3CX8B 5LJ5e 1D3BA 1LVFA 2QQ9A 2QA7A 1MMNA 3LYIA 3OKQA 2L5QA 3LFMA 2WSCE 4YJ3E 5M4YA 3L2ZA 3J9X1 4V2SA 1LNXA 1VQKT 1KQ1A 1KD1U 3JCMd 2LVMA 5GMKe 1AHJB 4G2AA 4DO0A 1ZHCA 4IUQA 3V7CA 3MKDA 4P0BA 5GAOm 4M7DG 2XASB 4LDVA 3H37A 1BR1A 3O1IA 5JDFA 3BDLA 3OYIA 4M75C 4YJ2E 4C8QA 2P9BA 3AVSA 2XK0A 3DB3A 1VQ7A 3H8ZA 3OW2A 4ZI3C 3L2VA 4M75F 3AA7B 3HKBE 2JN0A 4O5VA 2UXNB 3S3OA 1IJ6A 2QQBA 5A0GA 5GAN2 1W2BA 4ZI2C 2PBIA 3JCMe 3HKCE 2HD0A 3CQCB 2C0SA 3OS1A 3JC6D 2KINB 1VQNT 3QSUA 1Q82C 4E7LA 4TX5A 4PW8A 2H3JA 4ELYC 2MAMA 3CMAA 3FRNA 2W0GA 3VHLA 4ISSA 4XZCA 3CBPA 3QC9A 2EJ9A 2X4XA 2ZPBB 1IJ5A 3QZ5B 1G8XA 4IKFA 2RO0A 5FU7B 1FX7A 2X35A 3CCMT 3RX6A 3OBVE 1BIBA 5IT9E 3AAEB 4CXYA 5JDLA 5GMKm 3T9NA 1U8RA 1U5PA 1VQ6T 3H6ZA 5LJ5d 3CC7A 3ZJ2A 4CXWA 3CMET 2ES0A 3AAAB 2KWIB 4OB0B 5ETWA 2JTMA 5CAIA 5J1GA 3M5AA 2N2NA 2V8IA 2PU9B 3BW1A 4F7UB 4C5EA 2W00A 2EIFA 1YI2A 3GMIA 1B7TA 3GN5A 1B34B 4DOVA 4KUDK 4C92B 5CKDA 2VK9A 4PJOD 3ETVA 3MP6A 4EXTA 2DHRA 2Q9QB 2YHTA 4M78G 3JB9D 4BJMA 4PK4A 4EAHA 5J39A 2RI2A 3PUGA 3ESLA 4M75D 2QQAA 3CCLA 2M1HA 3IHRA 3HP9A 2NLUA 5EK3A 2QA4T 3RC3A 4E7ZA 4OFZA 3S4UA 1KQSS 2K5LA 4IGUA 2XDBA 1MGQA 4C8QD 1HG5A 3FXEB 4B9XA 1I8FA 2K57A 1NJIC 4M7AD 3PUAA 2QI2A 5CQXA 2YLBA 2WWUA 3HSBA 3G6ET 3J7Yq 2V1DB 3O4XE 3PIPA 4DQ2A 1VQKA 1D0YA 4L5GA 3QDRB 3I0QA 2OAUA 4A4EA 3Q5WA 3V5UA 1X6OA 4BI3A 2GFAA 4KT0E 1WPYA 4XTWA 4GLKA 2X0LB 4C5GA 4PFPA 2EWNA 2LOPA 2X9XA 2XAGB 1JB0E 1VQLT 1NAFA 3KDSE 3OYCA 5HK0A 1I5LA 4E47A 3JCMJ 5L3EB 1U1SA 2MF2A 2DTHA 2NTYA 1FEWA 1H7CA 3KV4A 1UGRB 3ANWA 5A1LA 1VQ7T 3O8VA 4J2CA 4QX8B 4U74A 1NZ9A 5L8RE 4ZOLE 2QEXA 3K3NA 1QVPA 4XTVA 2DVEA 4PFOA 1QP2A 3CXCS 4EZHA 2RHUA 1FMWA 2DWKA 5CR2A 3AA0B 3PT9A 2VKDA 1G73A 5FU6C 5FXVA 4M1PA 5LNKA 4NOYA 1YJNT 2CYZB 3META 4TZ4C 5J26A 3CCQT 4QQGA 3JB9J 5CKHA 3G4SA 2HPLA 3UTKA 2LOSA 2HAXA 3PTAA 3NRYA 4C92G 4GOUA 5LHIB 2LT1A 5FXWA 2CWYA 4J5YA 4GYRA 5LBMA 2M67A 2VL8A 1NJIU 3JRZA 1Y71A 3ZC1A 5JR9B 1MHNA 3FBZA 4XK8E 3SWNA 3UUNA 2PG8A 2E64A 4ZI7E 1Y96B 4O8SA 2IW5B 1D1AA 3EDVA 4Z8XA 2Y4YA 3PURA 4FIBA 2LE8A 3NBXX 2V7KA 2K5BB 2GF7A 2I2LA 5GAOp 4N4IA 1VQ5T 2E5QA 4OF1A 3L2UA 1KC8C 3ER0A 3SB2A 2D0UA 3AA6B 3LK42 2R5MA 2QXFA 3QJYA 1D0XA 2KDSA 3ZYMA 4IDZA 5H6RB 3SWNC 3VYGA 2XHCA 3KV6A 3RYIE 2RM4A 4BE0A 4OYJA 4O4LE 3ONXA 3OYFA 5FYMA 3VJPA 5KDMC 2NW7A 5LGTB 2F5TX 5CB4E 3M59A 1YKHB 3OW2S 5L3FB 3CC2A 2M16A 3CCLT 5L3DB 1IAPA 2QA4A 4OB1B 3GPLA 1VQ4A 1ZQ1A 4KP3C 2X4WA 3ZC0A 2CXFA 1Q82U 5GANd 2KK4A 3AA1B 2DXUA 3OQ5A 3ZFJA 5GAOn 5HYAA 5JRCB 3E1SA 3MEVA 4LDYA 4C0GA 4II1A 1BR4A 2RD1A 4FSXA 2VKOA 2LRQA 2ZPEB 4EB6E 4DBRA 1WGSA 4J6YA 5GAMj 1WRDA 5I2MA 2LSYA 5TAOA 4JUYA 3GNGA 3C95A 4P0AA 3V5SA 3JCMg 2LQKA 4MMKA 1VQLA 3K3OA 4IE6A 3CBOA 3QBYA 4HA8A 2DNXA 4NUVA 2L89A 3HPWA 4M75B 2RA2A 4EYYR 3PUSA 5D6WA 5GAN4 4EPCA 5J2TE 2X9YA 4PLLA 2B1EA 3RPUA 4I55E 5DLOA 4JRQA 2W62A 1N8RU 4ZGDB 3SFMA 4JUVA 2V7LA 1JRIA 5GAMh 4BE1A 4QQ6A 1XTDA 4JRKA 2DWGA 3TEEA 4O4HE 1QVFA 5LG4A 2ZZDA 3PTRB 2LNVA 2DPPB 2E9XB 4N0AC 5LGNB 5CK9A 3CQXC 4C0FA 3OY9A 4HKEA 1QVGA 5GAOl 3WI3A 5HXHA 3PE0A 2XHEB 5I2SA 5FRMA 4IE4A 3QO3A 4XAXB 1S94A 4BE2A 1YHQA 1YJWA 4EZ4A 2XAJB 4E7IA 4L9IA 5M9OA 3E08A 4J6WA 2CZ7B 5LJ3j 3UULA 1N9SA 5LJ5j 1NPPA 2EAYA 4H9NC 5GAMg 4N4HA 2V8KA 2LSKA 2LTOA 4H9OC 3CC4T 4FJOA 2RJEA 3LH0A 3R6NA 3MEAA 3M4YA 2E10A 2XDPA 1BIAA 2VB6A 4IHJE 1RL2A 2E6NA 2L3RA 2WAUA 5BMVE 3CX7B 4MDWA 5LHGB 5GMKl 1WJQA 1LRZA 5JQGE 4GIWA 3ZMSB 1MIYA 4PK5A 4M77F 3ZMZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMC A;  4MFR A;  2LT4 A;  4L5G A;  2EYQ A;  4ILU A;  4XAX B;  2LT1 A;  2LT3 A;  2LQK A;  4KBM B; 
#chains in the Genus database with same CATH topology
 3MJX A;  3H3M A;  2UXC T;  3G6E A;  3RYC E;  2DLR A;  1PG5 B;  3EAM A;  2QA4 Q;  2C0T A;  2DL8 A;  3CXC A;  1LVK A;  1JNR A;  1KC8 R;  3PMI A;  5LJ3 e;  1M90 C;  2OTL Q;  5C0M A;  5LOV E;  3DB4 A;  2K2V A;  3EAE A;  1Z0P A;  4G63 A;  3MXZ A;  3URG A;  5L3G B;  1V76 A;  2RQW A;  4A4G A;  3CC2 T;  3PU8 A;  2WB5 A;  4QH5 A;  3SFD A;  1W6X A;  2WS3 A;  4X65 T;  1FMK A;  1H92 A;  2BKO A;  3L09 A;  1RAA B;  4BAC A;  3C50 A;  3IF8 B;  3GF5 A;  1Z8U A;  2ZM6 T;  4IDP A;  1IRE B;  2J47 A;  5F8P A;  5KMG P;  5AQI B;  3QWY A;  4M75 G;  1JEG A;  2JNG A;  5E0O A;  2XJ7 A;  2LSG A;  1YBY A;  2LHN A;  2XM1 A;  1JJ2 P;  2ZAE A;  3CD6 T;  3EH2 A;  3M56 A;  4C5H A;  3LH5 A;  3QG1 A;  4CI3 B;  2FZC B;  3MCA B;  4JJN K;  4N4G A;  2J6F A;  1TUD A;  5GAN 3;  5LJ3 h;  4DV5 T;  4TNW A;  4RKU E;  3IEE A;  2BS4 A;  3CQG B;  4OMQ A;  2DKG A;  3CMA T;  4X62 T;  4ZTF A;  2B86 A;  4M7D A;  2GNC A;  3FJ5 A;  1QVF S;  3AEF A;  2E9X D;  2DEU A;  2HH7 A;  4HFH A;  1ZUY A;  3UU6 A;  4IUT A;  3QII A;  4KGV B;  5AQV B;  4YXD A;  2EGE A;  2CZ1 B;  2EQK A;  1PCX A;  3ZEH A;  1ABQ A;  1M27 C;  1QSD A;  2AKL A;  4DOW A;  2GCX A;  2EYX A;  3SD4 A;  3CWZ B;  1TOV A;  4M77 E;  3JCM b;  2NWB A;  5AT1 B;  3EI0 A;  3ZEF B;  1WYB A;  3H0F A;  4PK6 A;  4LFA T;  5FY7 A;  3R84 B;  4HTE A;  2EYQ A;  3MK7 C;  1EZZ B;  5HK3 A;  4E6R A;  2C0I A;  4L0R A;  2QTV A;  2HDA A;  2JQQ A;  2SEM A;  2CPT A;  2G6F X;  4EMK C;  5AQR B;  3LBX B;  1WHM A;  3OYN A;  5CVI A;  1TXQ A;  4M78 C;  2K3B A;  3P4Q A;  5EZY E;  5A2Q E;  3CCR T;  5AQM B;  1U06 A;  1NLO C;  2NR4 A;  4ME7 A;  1RAE B;  4WNK A;  3H3A A;  3ZN0 B;  1FWZ A;  1YI2 T;  2LT4 A;  2VVN A;  5AQH B;  2N1G A;  2D5U A;  3A8L B;  4R56 A;  2FHD A;  4UF0 B;  3QYH B;  3S6W A;  5DQV A;  3P7I A;  2IVW A;  1WHH A;  3X28 B;  2IIM A;  3DLM A;  2LSI A;  1BU1 A;  1PD0 A;  2YRC A;  2I59 A;  1IBM T;  4KGX B;  4PKC C;  1MMG A;  2QK0 A;  3JB9 G;  3UT5 E;  5FP3 A;  4A56 A;  4U31 A;  3CCS A;  4AKH A;  2M02 A;  2OTL T;  2O4X A;  1J1J A;  1D0Z A;  3EG9 B;  3M58 A;  3E0Z A;  2CS7 A;  5KCO A;  1LKX A;  4KRT A;  3M0Q A;  3U3I A;  3VV0 A;  5C2T A;  4WF2 A;  2QG9 B;  1KHC A;  2ODV A;  3ZJ1 A;  4JI2 T;  4CC7 A;  2DO3 A;  1D09 B;  2BVL A;  1OUL A;  4TUY E;  3JCM V;  3CCQ Q;  1VIE A;  2CP6 A;  2ACX A;  2FJD A;  2A7Y A;  4RCB A;  2DTO A;  3ZN1 B;  2EYY A;  1Y07 A;  3H41 A;  3L2Q A;  3X20 B;  3EGX A;  5KX5 E;  4KUI A;  2K7A A;  2RHZ A;  2PFV A;  4QX7 B;  1YIJ Q;  1W70 A;  2OJ2 A;  2LJ3 A;  3O1J A;  2QDL A;  4M78 E;  2DET A;  4Z02 A;  1RAI B;  4H63 V;  4QQD A;  3CK6 A;  4EDU A;  1V9D A;  2DA9 A;  2RI5 A;  4J9E A;  1VQP T;  1Q81 U;  3X25 B;  2FPD A;  5LJ5 h;  2KXP B;  4Q5W A;  1WYC A;  2JZ2 A;  5CKB A;  3SDZ A;  1XJW B;  4M7D E;  2VV5 A;  4D8D A;  3OYJ A;  2XY8 B;  5HXR A;  1VUB A;  3ETU A;  2LX9 A;  2E9X A;  1YP5 A;  5BR8 T;  2E41 A;  1Q7Y C;  2JQK A;  1ABO A;  2JMC A;  3P4P A;  3ZT7 A;  2ZMA A;  3ZCI A;  4YHJ A;  1S1N A;  4YSZ A;  3QYG B;  1FJG T;  5GAO r;  4AXP A;  2W2U A;  3NRX A;  2EFI A;  1ZA1 B;  3DLL A;  3MO8 A;  2C06 A;  1W4S A;  2PJQ A;  4XU2 A;  1K73 C;  4HT8 A;  4JYA T;  3N9M A;  4CXX A;  2W4X A;  3QB5 A;  2DER A;  2X4Y A;  3S3M A;  4HGA A;  2EHO C;  4NUU A;  2O4X B;  4YTL A;  2EHO B;  2OA5 A;  5CQY A;  2M51 A;  1X43 A;  3NTH A;  2XG8 D;  1JQQ A;  1K9M U;  1KNP A;  4UV8 B;  4C90 A;  1I0C A;  3I5S A;  3SOL A;  2EPD A;  2QEX T;  2D8H A;  2CEA A;  3OVU A;  3JCM h;  4ASK A;  1SSH A;  3P4W A;  4LDX A;  4Y92 A;  4OMO A;  3HHT B;  2CCQ A;  1YD8 G;  3HRT A;  4HWD A;  2J1D G;  2K4Y A;  2DXC A;  3UDC A;  3F2E A;  3UA6 A;  3I0O A;  3FZF B;  3ULR B;  2RN8 A;  3NZP A;  3AED A;  4UVA B;  1H3Z A;  3G71 T;  2NOX A;  3ASK A;  4CZZ B;  4A54 A;  5GAN g;  3EGU A;  4PNI A;  2DIG A;  1M62 A;  2UUC T;  1UJY A;  4OHF A;  1IB8 A;  3ZT6 A;  2CBI A;  2E3H A;  4F6R C;  1ZEE A;  4DR5 T;  1V1C A;  3P8H A;  3M54 A;  4XQ3 A;  1WR6 A;  2DI4 A;  3CD6 A;  5CO7 A;  3N9O A;  1BYM A;  4BY6 C;  4JLE A;  4TV8 E;  2FL7 A;  5FU7 C;  2QEX Q;  2P4T A;  2QTX A;  4RTX A;  2ESW A;  4LF9 T;  5KE3 A;  2ACZ A;  1HD3 A;  2EHO A;  3KV5 A;  5J0Z A;  3HRS A;  2H3E B;  5LJ3 d;  1MUZ A;  4FYW B;  2WDQ A;  3I55 Q;  2HN2 A;  4BDZ A;  2RQV A;  1OI1 A;  2O9S A;  4V1A v;  2Y48 B;  1AZG B;  2CXL A;  1W09 A;  4LF5 T;  1VQM A;  2A72 A;  1CHU A;  3LSV A;  5FXX A;  2K48 A;  1S72 T;  4ZI2 D;  1N8R C;  4Y28 E;  4DUY T;  3VS5 A;  1VYT A;  3RIU C;  2XSA A;  5LBQ B;  4K0U A;  2O01 E;  1HTJ F;  3PU3 A;  1OZ2 A;  3PNW C;  2RA1 A;  2KEA A;  4J6X A;  4JRI A;  5IH2 A;  1E6G A;  3AEB A;  5DY9 A;  4PJO A;  3C64 A;  3CKD A;  4M7A A;  3C12 A;  3OA6 A;  1QKX A;  2XQ3 A;  1SG5 A;  2V6Y A;  3PUW F;  5LJ3 g;  4OB2 B;  5L3B B;  2IUB A;  1RAH B;  5FY0 A;  3CPF A;  3OSS C;  2V8J A;  2JIW A;  2KXC A;  4FM4 B;  5L2L A;  2FG0 A;  1WFW A;  3CCR A;  3DTO A;  2NP9 A;  2FYK A;  4FI5 A;  4JRP A;  3HL6 A;  2DL4 A;  4IIM A;  1UTI A;  4J9C A;  3CCS Q;  2OAW A;  3BQI A;  5ABF A;  3Q2M A;  4LMJ A;  3TCJ A;  4M77 B;  1O75 A;  4RG8 A;  3OS2 A;  1Q95 G;  2VGM A;  3PFS A;  5JH7 E;  2RK1 A;  2FPE A;  2XKO C;  2O2O A;  4IDQ A;  2CSI A;  2HQE A;  4M78 B;  4QW2 A;  1ZP0 A;  2C5K T;  3BK9 A;  4A4H A;  3LLR A;  3C0C A;  1Y0M A;  2QGS A;  4EOZ B;  3LJC A;  1VCT A;  3NZQ A;  3A5X A;  1AOJ A;  3EG3 A;  4WBN E;  1YKE B;  2YRD A;  3AVR A;  4X20 E;  1C1A A;  5EC7 A;  5CKE A;  1VIF A;  1I94 T;  3I56 T;  4B6X A;  3GNF B;  3CML A;  4C92 E;  4XBF B;  3FHN A;  4JI8 T;  2WMO A;  1N32 T;  2KRM A;  4EMK A;  3M0P A;  1XZY A;  1OX8 A;  3L2W A;  1RI0 A;  2LRK A;  5AQS B;  2XQY A;  4MAL A;  1FXX A;  1VQ4 T;  4DR3 T;  1WYX A;  5DAB A;  2BG9 E;  1RAG B;  4B3M T;  4RTW A;  1MND A;  2D0Q B;  3QJ6 A;  2J62 A;  1QCN A;  2DF6 A;  4QXH B;  3B5M A;  4H9R C;  2FPF A;  4FYX B;  4OX9 T;  1ZBJ A;  2K5F A;  1QP3 A;  2KMT A;  2M9U A;  2HQX A;  5GMK j;  1A0N B;  1X75 C;  2CH4 A;  2V8S V;  3MEW A;  1I07 A;  4NPP A;  2E12 A;  1OEB A;  1ZSZ C;  3N2O A;  2V6Y B;  4A5X A;  1X2K A;  5KYX B;  1PSE A;  2KT1 A;  2RP4 A;  2WCA A;  5EG2 A;  2HKN A;  4DR6 T;  1Z9Z A;  1TWB A;  3KV9 A;  3SS1 A;  1YWP A;  3I9Q A;  2BIV A;  4EYU A;  1IBL T;  4KH1 B;  2LJ1 A;  3D7S B;  4TV9 E;  3CPW A;  1M7K A;  1D3B B;  1OV3 A;  5L4H A;  4ZNX A;  3RR6 A;  4HFB A;  2ZPG B;  5DLQ E;  4WBO A;  5HXC A;  4JS4 A;  3CCJ A;  2V7I A;  1ZUU A;  4F7U A;  1WR0 A;  1UGP B;  4JI1 T;  3N5L A;  4N78 D;  5DM7 R;  1OPK A;  4RMO A;  3P4R A;  4HKA A;  4JI3 T;  1RLP C;  2CUB A;  3ZYK A;  1XMO T;  3K1S A;  5CJ5 A;  4LE9 A;  5AQT B;  3JCM W;  1NE8 A;  2MPK A;  1EZ3 A;  1QW1 A;  4GKK T;  2KMF A;  2L8K A;  4P09 A;  1OU9 A;  5FRO A;  2LMJ A;  1RAD B;  4ZI3 D;  2DD4 A;  2FRY A;  2WY2 A;  4R55 A;  3NTI A;  3RYH E;  2EQM A;  3UT1 A;  3CME A;  5LCY A;  3KVA A;  4KHZ F;  2MTQ A;  2KT8 A;  3IA3 A;  2CE7 A;  2IML A;  1VQ9 T;  1OED B;  5HEU A;  5HWX A;  4KUM B;  3SRZ A;  3LX7 A;  2V5C A;  1CKB A;  3AXJ A;  1I81 A;  2YOE A;  3OYD A;  3RI5 A;  2DXT A;  2KSS A;  8AT1 B;  3G71 A;  1QCF A;  2HEQ A;  1YJ9 T;  4QVC A;  2H7O A;  5ADX L;  4GK0 E;  5IXF A;  4HCC A;  3MAC A;  5A0L A;  1YCS B;  4A63 B;  2CHN A;  5GAN e;  1X27 A;  4PJN A;  4N0A A;  4QT7 A;  5J3B A;  2E5V A;  3O1H A;  2J6K A;  1CKA A;  4UIG A;  2LX7 A;  1ZLM A;  1YNZ A;  2XPK A;  1ZSZ B;  5GJW B;  2RJC A;  2GK9 A;  5LB7 B;  4IIJ E;  2VGN A;  4IST A;  4M77 G;  4F7U F;  2V1R A;  4XU1 A;  2WM9 A;  4PJO E;  2WSF E;  2J06 A;  3VRY A;  3K8P C;  2DMO A;  4EMH A;  4YSY A;  5AQQ B;  2CWO A;  2FJE A;  4ZZC A;  2IIU A;  4C92 F;  3M57 A;  5LYJ E;  4NIQ A;  4AQF C;  2LQN A;  4IE0 A;  2AK5 A;  4TN7 B;  3EG0 A;  2LDM A;  4B6M A;  1BCO A;  4M7D B;  2SPC A;  2NUP B;  3PMT A;  2CP2 A;  1VQO A;  2GGR A;  2X67 A;  2RF0 A;  3UUM A;  2FB7 A;  4F8H A;  3FXD B;  1SPK A;  1SA0 E;  3TKL B;  3QDF A;  4YTP A;  3M65 A;  2FJA A;  3VUB A;  2RQT A;  1R0C B;  5LJ3 f;  3M9Q A;  1G2B A;  4M7D D;  3AE6 A;  5JDN A;  2B8A A;  2ATC B;  4XTX A;  2DXB A;  2HCK A;  2VXE A;  1GQE A;  4MDX A;  2LM2 A;  4K11 A;  1TS9 A;  1PD1 A;  2HHH T;  2LM9 A;  4A4F A;  5HAX A;  3UPU A;  1QVF P;  2OLT A;  1ZHI A;  3A1P A;  4HCZ A;  1E6H A;  4ZEY A;  1V29 B;  4RTT A;  3MP1 A;  3P50 A;  4AKI A;  3ANW B;  2KGT A;  4X9D A;  5HEO A;  5CGM A;  2E5L T;  5GMK h;  3OS0 A;  2WSE E;  3M55 A;  5FMN A;  4C92 A;  1VQO Q;  1HYO A;  2CKK A;  1N27 A;  1M2V A;  4LDW A;  3OYZ A;  1G3T A;  2CXD A;  3Q5X A;  1FMV A;  4XTZ A;  1X6G A;  2I6H A;  1G5V A;  3U23 A;  1XDP A;  2KWH A;  3RH3 A;  4AT1 B;  1VQP A;  2HPJ A;  4YSX A;  2KYM A;  2F2V A;  4YTM A;  3OYE A;  3ZBD A;  4AG1 C;  3GA8 A;  4FYV B;  2XDD A;  2D0N A;  3NFC A;  2LNH B;  3OYY A;  1OWA A;  5KCH A;  2ROL A;  3VRB A;  2C5I T;  3I56 A;  1JO8 A;  1HFA A;  2LKH A;  4DR7 T;  3J81 E;  2BG9 B;  3B57 A;  3ZKR A;  2RNA A;  4E7K A;  2LSJ A;  4ZN3 A;  1Q86 U;  6AT1 B;  3UUB A;  3VKG A;  4F04 B;  3CPW S;  1ZUK A;  3CBM A;  4FYY B;  5J2U E;  2CT4 A;  4BAY B;  3ZT5 A;  1Q7Y U;  2CZ6 B;  3FC3 A;  2EYZ A;  3E9F A;  3IBP A;  4TVR A;  4JS5 A;  1YCY A;  1NEG A;  3X24 B;  4MZP A;  1WQ7 A;  3H0H A;  3CC2 Q;  1LOJ A;  1YIJ A;  2YDQ A;  4AQY T;  2RPA A;  3I35 A;  4M77 C;  1KD1 R;  2CLY C;  4KBM B;  2X68 A;  2G0U A;  1YJN A;  1E2A A;  4EMK B;  3PUV F;  1WHG A;  2VWF A;  1J5W A;  4YFS A;  5JR9 A;  2MIO A;  2RMO A;  3N9P A;  2LRL A;  1CSK A;  4D6W A;  1BI3 A;  4MHC A;  2VKJ A;  1G83 A;  1XOV A;  3EGD A;  4F7U E;  4EED A;  1HSQ A;  2GFU A;  1HCI A;  4IUV A;  4JJD A;  3GP8 A;  3L3P A;  3JCF A;  2A9U A;  4OVA A;  3GN5 B;  4ZN1 A;  1UGS B;  2QVA A;  5CCA A;  1UE9 A;  4QHO A;  1E1H B;  3CCJ T;  3L2R A;  1NYF A;  4DBF A;  2BKD N;  3JCM f;  1T98 A;  4HCB A;  1K9M R;  3JAD A;  2E5K A;  3JB9 H;  4B9W A;  2QDY B;  4X1K E;  3C94 A;  3QWX X;  1IBK T;  4B3T T;  2K3Y A;  3CCE T;  4KUL A;  3OS5 A;  1BI2 A;  2IPO B;  3CCU Q;  1VQM T;  3M4G A;  1WZO A;  1LJO A;  2YEV C;  1KF6 A;  2EJG A;  3OBY A;  1KQS P;  1X9B A;  3H9N A;  3JCM P;  1K9M C;  2Z6E A;  2JM9 A;  3JCM Q;  4E7S A;  4X9C A;  2KVQ G;  1S72 A;  4I43 B;  3CCM A;  2EKO A;  2DD5 A;  2YUQ A;  1OOT A;  3AE5 A;  3KBT A;  5KH6 A;  3UF4 A;  2HNI A;  4R0K A;  2XAH B;  2AZV A;  4M77 A;  3CPZ A;  3C4S A;  1MIV A;  2FBW A;  1K8A R;  1WLX A;  2XTL A;  2P4R A;  1T7S A;  4M78 A;  2F5K A;  4X5T A;  1MIW A;  3T8O A;  4KX6 A;  2BUD A;  1Q81 R;  5FXZ A;  3SEM A;  4PJO B;  1UHF A;  3GWH A;  2V7J A;  1IGU A;  4C91 A;  4U7I A;  2EQJ A;  2MOZ A;  3AEE A;  4BY6 B;  2WSS V;  2MAW A;  3HR0 A;  2KAF A;  4M7A G;  2JQ9 A;  1OED A;  1PSF A;  2A36 A;  2R5A A;  4XU0 A;  5C3J A;  2V1Q A;  4PFZ A;  4LDU A;  3M0T A;  2EKH A;  1WX6 A;  2DBM A;  3HFO A;  1ZSG A;  3HFN A;  2VUR A;  1S35 A;  1UX4 A;  1YN8 A;  3CCR Q;  3AHU A;  1HNX T;  3W15 B;  4HWI B;  3NKZ A;  5D6X A;  1WI7 A;  5IHY A;  3OYM A;  4L59 A;  2JPF A;  2JS0 A;  3OJA A;  3RKO A;  2DVJ A;  5IHN A;  5I21 A;  2AIR B;  1Y64 B;  4DR2 T;  3OSV A;  3QHS A;  1XMQ T;  4J9G A;  1UB4 A;  3EG2 A;  1M5Q 1;  4U72 A;  5FL1 A;  1M4Z A;  4J9B A;  2K3X A;  3CEY A;  2D9T A;  2DM1 A;  4AKG A;  3I55 T;  2P0Q A;  4DVD A;  2YIN A;  2L3L A;  2DTI A;  4UVB B;  4NL2 A;  3P8C D;  3ZCJ A;  2W61 A;  2MWP A;  4JJC A;  5FLX E;  4QVD A;  5I22 A;  3DKM A;  4ZS3 A;  5LJN A;  3RRC A;  3AE4 A;  1HJD A;  3HRU A;  1H8K A;  4NS5 A;  1YIT Q;  4LXC A;  5JDQ A;  4DV4 T;  1ZSZ A;  3PIO A;  2NUP A;  3CMA Q;  4QH1 A;  2JTF A;  3V7S A;  5L23 A;  3EFS A;  4M78 D;  1NBE B;  2F2W A;  1M3C A;  4OGC A;  2RB6 A;  4AQF A;  3NGP A;  5FRN A;  3HKE E;  4HE8 A;  1UCU A;  4F7U G;  5JR9 C;  1PM3 A;  3OMG A;  4DMV A;  4M7A C;  5ABF B;  3GIB A;  3JAM E;  1YFN A;  4A4K A;  3J80 E;  4CI1 B;  1K1Z A;  2ZLY A;  5GAN 8;  3QB5 K;  3EDU A;  3PV0 F;  1K9A A;  1QKW A;  3OB9 A;  2YRV A;  3O5Z A;  1X79 A;  5L3C B;  4LML A;  1KJW A;  2R58 A;  3EUH A;  2HZY A;  4BJN A;  1JNZ A;  2XUE A;  4C8Q G;  3ZSS A;  5CIU A;  3HTR A;  4XTU A;  3V8K A;  3LK2 B;  4ZS2 A;  4RG2 A;  1MNE A;  4Z90 A;  4PAG A;  1M9S A;  2RJF A;  5GAO q;  2E1H A;  3VS4 A;  2CUD A;  4UF0 A;  3ZMV B;  3P8B B;  1QVG S;  3TLT A;  2KY9 A;  2WU2 A;  5KYY B;  5FU6 B;  5JDM A;  1KQS A;  4C0D C;  1YJW Q;  3A7M A;  2ZPI B;  2FRW A;  2KND A;  4WTO B;  1VQ6 Q;  3G7Z A;  5H6Q B;  3L39 A;  4DEX A;  3QK6 A;  4IL9 A;  4M7D C;  4LF8 T;  1YWO A;  3AE9 A;  3C51 A;  4FSS A;  4UEM A;  2L3P A;  3RKW A;  2LCC A;  1AWX A;  3ZMT B;  2SRC A;  4DV6 T;  1LCK A;  3B13 A;  2JVV A;  2CGH A;  5LJ5 g;  2D6F A;  1QLB A;  3K3Q C;  2KT9 A;  3UUX B;  1M1K C;  2L3Q A;  4ERR A;  1GBQ A;  1KC8 U;  5LJM A;  4C0Z A;  2P0K A;  1YJ9 A;  2CLY B;  4JLG A;  3VS3 A;  4ZGJ B;  4MML A;  2M6B A;  2Y4X A;  1YJW T;  2X9W A;  3FB9 A;  4M7A B;  4OP0 A;  5LGU B;  2KRN A;  3CCU A;  3TLU A;  2F4V T;  2QQR A;  5LP6 E;  3J7A F;  2JOY A;  1SSF A;  1KHI A;  2KQW A;  2JQH A;  2JM8 A;  1AWW A;  4RCC A;  2E9X C;  5HXE A;  3P8D A;  5IYZ E;  4CC4 B;  1IO6 A;  3IQL A;  2K24 A;  2OTJ A;  1T0H A;  1Q86 C;  3CC4 Q;  2XID A;  5JRE A;  1L0V A;  2MCN A;  2UXX B;  4IIO A;  3CCE A;  2KNB B;  2BDE A;  1F1B B;  1ACM B;  1YW0 A;  3HL8 A;  1G3W A;  1YJ9 Q;  2E70 A;  2DZ9 A;  3BQK A;  4GYS A;  1E7O A;  1WJR A;  3LK3 B;  4YT0 A;  4O6J A;  4DND A;  1TUG B;  1FYN A;  4C0D B;  1K0X A;  3NWI A;  4CQI A;  4BA9 A;  4PJO G;  4QKN A;  3KXT A;  1QQJ A;  1SUM B;  1VQL Q;  3G71 Q;  5GAN h;  4RUG A;  1K73 U;  2OI3 A;  1HF8 A;  3LWI A;  2K6D A;  4DA4 A;  2HBP A;  1OZ3 A;  2JRK A;  3AXJ B;  3OBW A;  4RTY A;  5EK2 A;  4EIK A;  4IL4 A;  4WW0 A;  3I9Y A;  4HFV A;  1JJ2 S;  3EH1 A;  1ZKE A;  4BUG A;  2DK3 A;  3A8M B;  2NUT A;  5GAN j;  3TSZ A;  2IHR 1;  2L8D A;  2QYZ A;  4AIS A;  3X1D A;  2AKK A;  2COY A;  1KSW A;  4JJB A;  5CA0 E;  3EHR A;  1WHK A;  3VKI A;  2N9D A;  1W2B S;  2DNU A;  4JEU B;  4P5N A;  4C5I A;  1Q81 C;  3REA B;  1IZ6 A;  5KXJ A;  3NTK A;  4UR9 A;  4HVW A;  3HI2 A;  1K8A C;  1NG2 A;  2XIC A;  4DMW A;  3RDV A;  5HCJ A;  5LL6 S;  4FW1 A;  4C92 D;  1E7P A;  1HXD A;  2JJ9 A;  4J83 A;  1YIT A;  1UK5 A;  5GAN 6;  4DEY A;  2LQ8 A;  3VR8 A;  3X26 B;  2H7V C;  4FT2 A;  3QPH A;  2QAS A;  3QUI A;  1WHJ A;  3KFW X;  2LCL A;  2NWM A;  3JSC A;  2FVU A;  1YHQ Q;  3M53 A;  1VQ9 Q;  4J8O A;  5HKC A;  3C4X A;  1PHT A;  1J5E T;  4DV0 T;  3WVE B;  4XTY A;  4HWC A;  1YQ4 A;  1OED C;  4UXN B;  2MI6 A;  3I56 Q;  4M7A E;  2RPN A;  4JBW F;  1QMC A;  3CCV A;  3CX6 B;  5AQO B;  1WCR A;  4MZM A;  2RH2 A;  4OGE A;  4OMM A;  4UVC B;  4ILU A;  1W1F A;  2XI9 A;  5GAN f;  2VKH A;  1AT1 B;  1TH7 A;  4DV7 T;  4BDY A;  1NM7 A;  3RMQ A;  3LW5 E;  4EIW A;  3GOX A;  4NXM T;  4HFC A;  3RKG A;  4EEB A;  3RYF E;  3E19 A;  3JC6 C;  3PJA J;  2EJF A;  4L6V 5;  3VRZ A;  2KI7 A;  5LHH B;  2CP5 A;  5JVD E;  3VS7 A;  2JW4 A;  4ILC A;  2L9Q A;  4OYK A;  2PUK B;  4ZGE B;  5GMK i;  3AAI A;  4PL6 A;  5JDH A;  2YU1 A;  2DAQ A;  2LC4 A;  3LGL A;  4PJJ A;  1Q82 R;  2ED1 A;  3I9W A;  5GAM f;  1US7 B;  4MFR A;  3BE3 A;  3AT1 B;  3LWH A;  1M1F A;  2BKN A;  2BKP A;  2VL0 A;  1K4U S;  2Q9Q D;  5JRC A;  2WDR A;  4LMK A;  4BI8 B;  2X0H A;  1SEM A;  2P84 A;  5FKY A;  3V7R A;  3OYG A;  3VS1 A;  4DUZ T;  3VS6 A;  4AFS C;  5ABH A;  1GXI E;  3F57 A;  3EFR A;  3M0U A;  5HXS A;  2WP9 A;  4B3R T;  1SHF A;  4JI5 T;  1SE7 A;  4CI0 C;  2JUF A;  1M30 A;  2LEH A;  2X9H A;  3EHQ A;  1D1B A;  1VYU A;  5DQW A;  3OYH A;  1K8A U;  2PVD B;  2DIQ A;  2OTL A;  1RAC B;  2FUP A;  2PVO B;  5GAM e;  1IGQ A;  1AEY A;  2D1X A;  4LF4 T;  2RHY A;  2XQ7 A;  3VU7 H;  3KVB A;  4P1N A;  2JMK A;  1S72 Q;  3JCM c;  4HEA A;  3ME9 A;  4DBH A;  1KQ2 A;  4M77 D;  1D1C A;  1UG1 A;  5D7U A;  1U3O A;  4ELZ C;  4AI6 A;  4I50 E;  1O3X A;  5C8Y E;  3WAJ A;  3AE7 A;  3FB2 A;  2RJD A;  1VQO T;  3QUJ A;  4X1I E;  2O31 A;  3VRA A;  2P0P A;  3RUX A;  3DJB A;  4D8K A;  2RK2 A;  3ABV A;  2AXD S;  3A5Z B;  1KG1 A;  2D9D A;  3I1A A;  3V8L A;  2H89 A;  1SRM A;  4CN6 A;  4QXB B;  1MV3 A;  1AVZ C;  4YY3 T;  3SFE A;  2CP7 A;  3QNU A;  3VU3 C;  4X34 A;  4LUE A;  3HA4 A;  2VXF A;  3PUQ A;  3SWH A;  5KYW A;  1P92 A;  4BB7 A;  5AFU L;  3E22 E;  4DID B;  5HWY A;  3FDR A;  4O2A E;  1M8V A;  2MMP A;  4H9Q C;  2O88 A;  5DJQ C;  4YHH T;  3N9Q A;  3F31 A;  3N9L A;  4UEL A;  2IC6 A;  2KYB A;  2VAS A;  2KZ7 B;  3RQW A;  3CD6 Q;  1WXU A;  2K9A A;  5GAN 7;  4IUU A;  5AQU B;  4IDN A;  1QLY A;  1ZBX A;  5GAM d;  2WMN A;  3M0S A;  5IWA T;  3ZLI A;  4HFE A;  3OTO T;  3UFG A;  2VQE T;  4QWN B;  3AB3 B;  2IAK A;  2GBQ A;  1NWM X;  4C92 C;  3MA9 A;  3PUZ F;  3BFM A;  1UUS A;  1NEK A;  2CBJ A;  4NL3 A;  4ILB A;  2F2X A;  3CC4 A;  2IC9 A;  3RC8 A;  3I55 A;  4H9S E;  2VQF T;  4A53 A;  4O2B E;  4FCY A;  4CRI A;  4JDS A;  4DV1 T;  1PWT A;  1VQ8 T;  2RHI A;  3EG9 A;  5IAY A;  2YUO A;  2R57 A;  3NMZ C;  4PLI A;  3N2K E;  1HX8 A;  2RI3 A;  3C4Z A;  3CQT A;  4J7I A;  3REB B;  4BD3 A;  3OYA A;  3TQ7 P;  2X51 A;  2A2F X;  3KIN B;  4LF7 T;  3QZ9 B;  3TSW A;  3RER A;  2L2P A;  2X66 A;  3NVO A;  1GCQ C;  2V6X A;  4IE5 A;  4KH0 B;  2AT1 B;  3DP7 A;  2X3W D;  1VQN Q;  2WU5 A;  2O9V A;  1M1G A;  2F69 A;  4I4T E;  1W0B A;  3N5B B;  3EFO B;  3L42 A;  4M4Z A;  3JB9 I;  3C98 B;  3RES A;  1X6B A;  1M2O A;  4PJO F;  3C4W A;  1OYX A;  4M78 F;  1VQP Q;  2D2S A;  5LXT E;  3BY7 A;  4OMN A;  4M75 E;  1BBZ A;  3PGG A;  4J7F A;  3OYX A;  4BI4 A;  4NXN T;  2OV9 A;  1DJ7 B;  1WNL A;  1YIJ T;  2DZC A;  1N6A A;  4QXC B;  1YIT T;  2KLQ A;  3KBG A;  3PDY A;  4U7Y A;  3EGD B;  3F70 A;  2LJL A;  2I0N A;  2DL7 A;  4MZT A;  2GTJ A;  2WAC A;  2CMR A;  4IT4 A;  1WIE A;  3R6O A;  1G3S A;  4DBQ A;  3N9N A;  1KNZ A;  1XNQ T;  2EGC A;  1BR2 A;  1NPR A;  2XAQ B;  4HN9 A;  2E65 A;  2Y6X A;  3FEO A;  3RIR A;  3CCV T;  3A8H B;  2BS2 A;  3VYH B;  5JDG A;  4HFD A;  1QUU A;  2Q9Q C;  3JAE A;  3MP8 A;  5HY6 A;  5A0D A;  2C5J A;  2DLP A;  4GKJ T;  2ABL A;  1H64 1;  2ZGW A;  4Z91 A;  1EIF A;  4FW2 A;  1WFD A;  1T3S A;  1UGQ B;  4COF A;  1MMA A;  3FJP A;  2DYI A;  3N2G E;  3TVT A;  1VQ6 A;  2F1L A;  1YI2 Q;  3Q9D A;  1I5O B;  2DL3 A;  5F3J A;  4PNO A;  1WXT A;  3CIR A;  4DR1 T;  2LT3 A;  4C8Q E;  3KFV A;  1W2B P;  4CI2 B;  2UUA T;  3VS2 A;  4AIU A;  1TG0 A;  4J9D A;  2V26 A;  2DJQ A;  3MEU A;  3ONL C;  2E8I A;  3WXM B;  1Q7Y R;  2J4G A;  2HSE B;  3CCU T;  1BKB A;  3L1A A;  4UC4 A;  5FNV E;  5FWB A;  4C8Q F;  5CKF A;  4E7H A;  3G6E Q;  3RHW A;  1OXZ A;  2DFU A;  4M7D F;  2IG0 A;  3BDU A;  1OPL A;  2X4J A;  4JLI A;  3RRW A;  1EX4 A;  4ANJ A;  3KUF A;  3HKS A;  2W67 A;  1ZV4 X;  1X01 A;  3CCJ Q;  4LD9 K;  3ZPO A;  4YLH A;  2FEI A;  2A37 A;  4C8Q B;  2CZ0 B;  4C8Q C;  3OYL A;  1CUN A;  2PTK A;  2H3R A;  3V8J A;  2YU2 A;  4TWF A;  1I4K 1;  2PTF A;  2BZY A;  4UV9 B;  1RI9 A;  4JEH B;  3SWN B;  3INZ A;  5EK4 A;  1FIO A;  1Y96 A;  1R8O B;  2PUO B;  1VQM Q;  9ATC B;  1XQH A;  2XQ6 A;  1OQK A;  5GJV B;  4MBQ A;  2NW9 A;  5CA1 E;  2ZM0 A;  3MZK B;  5GON E;  4E7J A;  3VKH A;  4ZXL A;  3QKJ A;  2A0F B;  3FIF A;  3EVY A;  3CXC P;  1UX5 A;  2XMF A;  4WYV A;  5FVL A;  2KSR A;  3A8O B;  3RKX A;  5KE2 A;  2K5I A;  2BZB A;  2A3L A;  3A8G B;  3CCS T;  3E9G A;  4HFI A;  3OYK A;  2Y90 A;  3JCM X;  3LBX A;  4I0U A;  5AYF A;  3ZL7 C;  3O9X A;  2ZM8 A;  4PJO C;  4AKR B;  1BI0 A;  1HK9 A;  1N34 T;  4J9I A;  3ZYL A;  4H63 H;  2ZCF B;  3QXE B;  4XU3 A;  4IE7 A;  5IHK A;  4PJL A;  1MMD A;  4GY5 A;  3CCM Q;  5AQJ B;  2K2M A;  2YDL A;  2DCF A;  2PVG B;  3PUX F;  2W0Z A;  4PJM A;  3P4S A;  2VC8 A;  4AG2 C;  2RHX A;  1TTH B;  1UFF A;  4VUB A;  3A8Y C;  2W63 A;  2PZ1 A;  5C6S A;  1U4Q A;  2NW8 A;  2EQU A;  3CVR A;  1PKT A;  3RKY A;  3S3N A;  2XD0 A;  4EMG A;  5LMN T;  4FT4 A;  3GLX A;  3VUZ A;  4H9P C;  2MPX C;  2YK0 A;  1N8R R;  5HEG A;  1SHZ C;  3FBL A;  4OK0 A;  4F14 A;  3MHX A;  1BI1 A;  3UWN A;  1KFY A;  3OMC A;  1KK7 A;  2ENM A;  4AQG A;  2VUB A;  2PQW A;  2UXB T;  2RQR A;  2ZPH B;  1UUE A;  1T0J A;  1WQW A;  1VQN A;  2GQV A;  1PNJ A;  4X1Y E;  4ZTJ A;  2HN1 A;  3U78 A;  1GRI A;  1WJS A;  1VQ8 A;  1BR0 A;  2DX1 A;  2D0T A;  2A08 A;  1HG2 A;  2JS2 A;  4X1V A;  2BVM A;  3KBU A;  4AMC A;  1K0S A;  2V7M A;  1U1T A;  2YT6 A;  2AHJ B;  3FLG A;  5GAN 5;  1SRL A;  1G3Y A;  1HNZ T;  5AQL B;  2EW3 A;  2EHO D;  2J05 A;  2Q9Q A;  4RTV A;  3Q5D A;  3RMS A;  4M75 A;  1IXD A;  1AJ3 A;  2MWO A;  4OML A;  1UDL A;  4FL6 A;  2A3D A;  2LHR A;  1M90 U;  4MLK A;  4LD6 A;  1IZN B;  2CM0 A;  5CFB A;  1ZA2 B;  5D6Y A;  2DJZ A;  1VQ9 A;  1OED E;  1TU0 B;  4JPB W;  2CA5 A;  1B34 A;  2G3R A;  2X0Y A;  5IUX A;  2MYS A;  3WAK A;  2ODU A;  3HKD E;  3T1H T;  2QGG A;  3EG1 A;  3TU4 K;  3RBB B;  3OYB A;  3CC7 T;  4IUR A;  1UEB A;  4HCK A;  4M7A F;  2JMH A;  1JXO A;  4GK5 E;  2XU8 A;  3VS0 A;  2BBH A;  1XNI A;  3LGF A;  4ATO A;  3RLF F;  2J7I A;  2MK5 A;  4O4I E;  3D0T A;  3ZMU B;  3G1J A;  2ED0 A;  2KRS A;  4AKL A;  4JV5 T;  2WBL A;  3CCQ A;  2NTX A;  4J9H A;  1Y7X A;  4KMC A;  2Y8D A;  3G4S T;  4F17 A;  2VYT A;  2R6G F;  4ADZ A;  2E6Z A;  5FY1 A;  2L3S A;  1M1K R;  2QQS A;  2VWA A;  4JI7 T;  1HS7 A;  4RTZ A;  1M1K U;  2CP3 A;  4HT9 A;  4QVZ A;  2BG9 C;  1N9R A;  2MBG A;  2DEQ A;  4FU6 A;  2DRM A;  3BQL A;  1VOM A;  4OB3 B;  5LJ5 f;  3JB9 F;  2COW A;  4QKU A;  1XWM A;  2ZPF B;  4Y91 A;  3Q1J A;  2OTJ T;  1VRB A;  1YQ3 A;  5IXB A;  4HVV A;  2ZM2 A;  1IRX A;  5IN1 A;  2BE9 B;  1JJ2 A;  4OMF B;  5LA6 E;  1JBM A;  1M2V B;  4IUP A;  3TRE A;  2FZK B;  2E3I A;  1WHL A;  4ESR A;  2XAF B;  3LG7 A;  2CP0 A;  1YJN Q;  2LQW A;  1T3L A;  2A28 A;  1HNW T;  1DU2 A;  1YHQ T;  2Z0W A;  4O4J E;  2CT3 A;  3GBQ A;  3WVD B;  4U2Z A;  1BB9 A;  1VQK Q;  2YLC A;  1KD1 C;  4ZHQ E;  1VQ5 A;  2M0O A;  1O9S A;  3UFE A;  2BG9 A;  3CX8 B;  1GL5 A;  5LJ5 e;  1D3B A;  1LVF A;  2DRK A;  1WLP B;  2QQ9 A;  2QA7 A;  3ZST A;  1MMN A;  1QVG P;  3LYI A;  3OKQ A;  1WXB A;  2L5Q A;  5AQN B;  4JZ4 A;  3LFM A;  5FVK A;  2EYW A;  1JXM A;  2WSC E;  4YJ3 E;  5M4Y A;  3L2Z A;  2HBW A;  2CSQ A;  3RNJ A;  3J9X 1;  5L4E A;  4V2S A;  1IHW A;  2UUB T;  4U2Y A;  1KFZ A;  1LNX A;  1VQK T;  3M0R A;  1KQ1 A;  1KD1 U;  3JCM d;  5KYX A;  1JU5 C;  2LVM A;  5GMK e;  1AHJ B;  4ORZ A;  2CRB A;  4G2A A;  2V5D A;  4Z8A A;  4DO0 A;  1ZHC A;  4IUQ A;  3AE3 A;  3V7C A;  3MKD A;  2W10 A;  4P0B A;  4DR4 T;  5GAO m;  4M7D G;  2XAS B;  1GFD A;  4LDV A;  3H37 A;  1BR1 A;  3O1I A;  5JDF A;  2DIL A;  4AFQ C;  3BDL A;  3OYI A;  1AWJ A;  4M75 C;  2K3W A;  3A98 A;  4YJ2 E;  3AEA A;  4LFB T;  4C8Q A;  3PVQ A;  2E2A A;  4Z89 A;  1Q86 R;  2P9B A;  3AVS A;  2BS3 A;  2XK0 A;  3DB3 A;  1GCP A;  1VQ7 A;  3H8Z A;  3OW2 A;  4ZI3 C;  2KRO A;  3L2V A;  4M75 F;  2BBJ A;  3AA7 B;  3HKB E;  2JN0 A;  2K9G A;  2VKN A;  4O5V A;  4YTN A;  2ECZ A;  2YXY A;  2UXN B;  1GFC A;  3S3O A;  2KE9 A;  4X64 T;  5KYN A;  1AD5 A;  3G4S Q;  1IJ6 A;  1MV0 B;  2QQB A;  2YN6 A;  1Y01 A;  5A0G A;  5GAN 2;  1W2B A;  4ZI2 C;  2PBI A;  3JCM e;  3HKC E;  2HD0 A;  3PJA A;  4GLM A;  3CQC B;  3EGX B;  3PUY F;  3TLW A;  4AFZ C;  2LP5 A;  2C0S A;  2NUZ A;  3OS1 A;  1B07 A;  3JC6 D;  2BZX A;  2KIN B;  3RQU A;  1VQN T;  3QSU A;  1Q82 C;  5AQK B;  4E7L A;  4TX5 A;  4PW8 A;  2H3J A;  4ELY C;  4U3C A;  2MAM A;  1HX1 B;  2NYS A;  3CMA A;  3FRN A;  2W0G A;  3FZH B;  3VHL A;  1QWF A;  4KHP T;  4ISS A;  4LNP A;  3LDQ B;  4XZC A;  3CBP A;  3QC9 A;  1R8I A;  2EJ9 A;  2X4X A;  2ZPB B;  1IJ5 A;  3QZ5 B;  1G8X A;  1J3T A;  4TNV A;  4CC3 A;  1TUC A;  1PKS A;  4IKF A;  1AZE A;  2RO0 A;  2XQ8 A;  1NLP C;  5FU7 B;  2DBK A;  1FX7 A;  1VYV A;  1RLQ C;  2X35 A;  3CCM T;  3RX6 A;  3OBV E;  5F5W A;  1BIB A;  1N5Z A;  2LCS A;  5IT9 E;  1KNR A;  2FO0 A;  3AAE B;  4CXY A;  5JDL A;  5GMK m;  4CN1 A;  3T9N A;  1QCO A;  1XDO A;  1U8R A;  1U5P A;  1VQ6 T;  3H6Z A;  5LJ5 d;  3CC7 A;  1UGV A;  4LF6 T;  3ZJ2 A;  2YDS A;  4CXW A;  3EHZ A;  2FJB A;  2YUN A;  3CME T;  2ES0 A;  3AAA B;  2KWI B;  2EVR A;  4OB0 B;  5ETW A;  2JTM A;  5CAI A;  5J1G A;  2W66 A;  3M5A A;  4E2F B;  2N2N A;  2VVS A;  5LMU T;  2V8I A;  2PU9 B;  3BW1 A;  2XQA A;  4F7U B;  2XZE A;  4C5E A;  1W9R A;  2W00 A;  2EIF A;  1YI2 A;  2WZH A;  3GMI A;  2M6I A;  1B7T A;  3GN5 A;  1B34 B;  4DOV A;  3ONJ A;  2LZ6 B;  4KUD K;  2JTE A;  4C92 B;  2DYB A;  5CKD A;  4JZ3 A;  2VK9 A;  3UU5 A;  4PJO D;  3ETV A;  3MP6 A;  4EXT A;  2DHR A;  2Q9Q B;  2YHT A;  1X69 A;  1W0A A;  4M78 G;  3JB9 D;  5I11 A;  4BJM A;  4PK4 A;  2HL5 C;  1VQ5 Q;  4EAH A;  5J39 A;  2RI2 A;  3PUG A;  3ESL A;  4M75 D;  2HL3 A;  2QQA A;  3RGL A;  5KYU B;  3CCL Q;  3CCL A;  2M1H A;  2OTJ Q;  3IHR A;  3HP9 A;  2NLU A;  5EK3 A;  2QA4 T;  3RC3 A;  4E7Z A;  4OFZ A;  3S4U A;  1KQS S;  5AQP B;  2K5L A;  4IGU A;  2XDB A;  4A97 A;  4CN4 A;  1MGQ A;  2KBT A;  1U5S A;  4C8Q D;  2XSB A;  1HG5 A;  3FXE B;  4HWF A;  5KYW B;  2DE0 X;  4B9X A;  1I8F A;  2K57 A;  4LN2 A;  1NJI C;  3JAF A;  4M7A D;  3PUA A;  2XQ9 A;  2QI2 A;  2YLB A;  5CQX A;  2M0Y A;  1AWO A;  2WWU A;  1I1J A;  4TWD A;  3HSB A;  3G6E T;  5ECA A;  4HWH A;  3J7Y q;  2V1D B;  3O4X E;  3EFO A;  2EQI A;  3PIP A;  2XQ4 A;  4DQ2 A;  1VQK A;  1LPL A;  1D0Y A;  4L5G A;  1R77 A;  3QDR B;  3I0Q A;  2OAU A;  4A4E A;  3Q5W A;  3V5U A;  2COZ A;  1X6O A;  2HSP A;  1UHC A;  5KYU A;  4BI3 A;  2GFA A;  4KT0 E;  2J6O A;  1WPY A;  4XTW A;  1M3B A;  2X0L B;  4GLK A;  4PFP A;  4C5G A;  2EWN A;  2LOP A;  1UGO A;  2X9X A;  2XAG B;  1JB0 E;  1VQL T;  1NAF A;  3KDS E;  4LFC T;  2CH4 W;  5HK0 A;  3OYC A;  1I5L A;  4U33 A;  2GTO A;  2YSQ A;  4E47 A;  2XM2 A;  3JCM J;  5L3E B;  1PRL C;  1U1S A;  3JV3 A;  1H3H A;  2MF2 A;  1BCM A;  2DTH A;  1VQ4 Q;  2JT4 A;  2NTY A;  4Q25 A;  1FEW A;  1H7C A;  3KV4 A;  1UGR B;  3ANW A;  5A1L A;  3UU8 A;  3M3Z B;  1VQ7 T;  3O8V A;  4J2C A;  4QX8 B;  2E4H A;  5JTG A;  5LG3 A;  1UUR A;  4U74 A;  4B3S T;  1NZ9 A;  4ZOL E;  2QAZ A;  5L8R E;  3CPW P;  2QEX A;  3K3N A;  1QVP A;  4XTV A;  3UA7 A;  4ILA A;  2DVE A;  4AFU C;  4PFO A;  1QP2 A;  3CXC S;  2KR3 A;  4EZH A;  2RHU A;  1FMW A;  4A98 A;  2BTT A;  2DWK A;  5CR2 A;  5ABG A;  3AA0 B;  3PT9 A;  1VQ7 Q;  2VKD A;  1WA7 A;  1G73 A;  5FU6 C;  2JMA A;  3TLV A;  5FXV A;  4M1P A;  5LNK A;  4NOY A;  1SKU B;  1YJN T;  2CYZ B;  3MET A;  4TZ4 C;  5J26 A;  3CCQ T;  4QQG A;  1VQ8 Q;  3JB9 J;  3NHN A;  5CKH A;  3G4S A;  2HPL A;  3UTK A;  2H8H A;  4Z88 A;  2LOS A;  2ROT A;  2HAX A;  3PTA A;  1QWE A;  5FWC A;  1C6V X;  3NRY A;  4X66 T;  4C92 G;  3AEG A;  4GOU A;  3RIA A;  4EV6 A;  5LHI B;  2LT1 A;  5FXW A;  4KGZ B;  1NEB A;  2CWY A;  3RIU A;  2YWW A;  4J5Y A;  4GYR A;  5KYY A;  5LBM A;  2M67 A;  2L0A A;  2VL8 A;  1NJI U;  3JRZ A;  1Y71 A;  3ZC1 A;  5JR9 B;  5HEJ A;  1XNR T;  1MHN A;  3OPC A;  3RF1 A;  3FBZ A;  2CRE A;  3PVL A;  1GCQ A;  1YXR A;  2MOX A;  2RQU A;  4XK8 E;  5FL0 A;  3SWN A;  3UUN A;  4WZX A;  1R0B G;  2PG8 A;  2E64 A;  2FZG B;  4ZI7 E;  2XQ5 A;  1Y96 B;  4O8S A;  3CCV Q;  2IW5 B;  2HQH A;  1D1A A;  3EDV A;  8ATC B;  4Z8X A;  2Y4Y A;  3PUR A;  4K0K T;  4FIB A;  1Z9Q A;  2LE8 A;  3NBX X;  2V7K A;  2C0O A;  2PNI A;  4HVU A;  4J9F A;  4JI6 T;  2HMA A;  2K5B B;  1T72 A;  2GF7 A;  2I2L A;  5GAO p;  4JI0 T;  4N4I A;  1VQ5 T;  1B3Q A;  2E5Q A;  4OF1 A;  3L2U A;  1KC8 C;  2H88 A;  1ARK A;  3QOF A;  2IDO B;  1Y57 A;  3ER0 A;  1NEN A;  1SF9 A;  3SB2 A;  2D0U A;  1WDX A;  5AQF B;  3AA6 B;  3LK4 2;  2R5M A;  2QXF A;  2UU9 T;  3QJY A;  3G06 A;  1D0X A;  3AE1 A;  2KDS A;  3ZYM A;  2OX7 A;  4IDZ A;  5H6R B;  3FZM B;  3E2U A;  3FZL B;  3SWN C;  3VYG A;  2XHC A;  3KV6 A;  1KEY A;  3RYI E;  2RM4 A;  4BE0 A;  4OYJ A;  4O4L E;  3ONX A;  3OYF A;  3H0I A;  5FYM A;  3UU3 A;  3VJP A;  5HEH A;  5KDM C;  2NW7 A;  5LGT B;  2D8J A;  5CB4 E;  2WQY A;  1YKH B;  2F5T X;  5L3F B;  3M59 A;  3OW2 S;  2M16 A;  3CC2 A;  3I5R A;  2BZ8 A;  3EAB A;  3CCL T;  5L3D B;  1IAP A;  5IHI A;  2QA4 A;  4OB1 B;  3GPL A;  4RTU A;  1RUW A;  1VQ4 A;  1UEC A;  1ZQ1 A;  4EGW A;  4KP3 C;  2X4W A;  3ZC0 A;  2CXF A;  1Q82 U;  5GAN d;  2CHO A;  1OU8 A;  2KK4 A;  2JXB A;  3AA1 B;  2DXU A;  2WZI A;  5AQG B;  5HCM A;  3OQ5 A;  3Q5E A;  3ZFJ A;  5GAO n;  5HYA A;  5JRC B;  3E1S A;  3MEV A;  1PC0 A;  4LDY A;  4C0G A;  2VVK A;  4II1 A;  1BR4 A;  2RD1 A;  3THK A;  4FSX A;  1K76 A;  1ZOY A;  3T1Y T;  5FW9 A;  2VKO A;  2LRQ A;  2ZPE B;  4EB6 E;  4DBR A;  1WGS A;  4J6Y A;  5GAM j;  1K73 R;  3AEC A;  7AT1 B;  2I0M A;  1M90 R;  1EFN A;  1WRD A;  5I2M A;  1NJI R;  2LSY A;  5TAO A;  3TLS A;  3CME Q;  2UXD T;  4JUY A;  3GNG A;  1RAF B;  2LJ0 A;  3C95 A;  4P0A A;  3V5S A;  3JCM g;  2LQK A;  1T8B A;  1KIK A;  4MMK A;  1VQL A;  3K3O A;  2YKS A;  4IE6 A;  4HXJ A;  3CBO A;  3QBY A;  4HA8 A;  4OMP A;  2DNX A;  4NUV A;  2L89 A;  2AE9 A;  3HPW A;  4M75 B;  1X2Q A;  2RA2 A;  4F16 A;  4EYY R;  2LLY A;  2NUT B;  5L47 A;  3PUS A;  2WDV A;  4KI0 F;  5D6W A;  5GAN 4;  4LUD A;  4EPC A;  5J2T E;  2X9Y A;  4PLL A;  2B1E A;  3RPU A;  3RIF A;  4I55 E;  5DLO A;  3CCE Q;  4JRQ A;  2W62 A;  2B76 A;  1N8R U;  4ZGD B;  3SFM A;  4WCI A;  4JUV A;  2V7L A;  1JRI A;  5GAM h;  4BE1 A;  4QQ6 A;  2HKQ B;  2YDR A;  1XTD A;  4JRK A;  2DWG A;  2YUP A;  3TEE A;  4O4H E;  1QVF A;  5LG4 A;  4ZZB A;  1TSF A;  2X3X D;  2ZZD A;  3PTR B;  1VCS A;  4IDO A;  1NYG A;  2LNV A;  2DPP B;  2EBP A;  2E9X B;  4N0A C;  4CC2 A;  2QGF B;  5LGN B;  5ABE A;  2AZS A;  5CK9 A;  3CQX C;  4IRE A;  4C0F A;  3OY9 A;  3CC7 Q;  4HKE A;  2KXD A;  4GBQ A;  5GAO l;  1QVG A;  1GBR A;  3WI3 A;  5HXH A;  3PE0 A;  2XHE B;  2DL5 A;  5I2S A;  4IE4 A;  5FRM A;  3QO3 A;  4XAX B;  3AE8 A;  4TWH A;  3OW2 P;  2QRX A;  1S94 A;  4BE2 A;  1YHQ A;  2K79 A;  5HCK A;  1YJW A;  3L8R A;  4EZ4 A;  2XAJ B;  3MPU B;  2EGA A;  4E7I A;  4L9I A;  5M9O A;  1PRM C;  3FZK B;  3E08 A;  1BK2 A;  4J6W A;  2CZ7 B;  5LJ3 j;  3UUL A;  2BE7 D;  1N9S A;  2QYW A;  3UQ4 A;  5LJ5 j;  1NPP A;  2EAY A;  4H9N C;  5GAM g;  3UQ7 A;  1I6Z A;  3SHW A;  2WWV A;  1ZX6 A;  1SHG A;  4N4H A;  2V8K A;  2LSK A;  2LTO A;  4H9O C;  4DV2 T;  3CC4 T;  4FJO A;  2CDT A;  2RJE A;  3LH0 A;  3R6N A;  3MEA A;  1IHV A;  3AE2 A;  3UU4 A;  2GQI A;  1HR0 T;  4JI4 T;  4DV3 T;  1UJ0 A;  3M4Y A;  2E10 A;  2XDP A;  1BIA A;  2VB6 A;  3NPF A;  4IHJ E;  2LKG A;  3VR9 A;  1RL2 A;  3UAT A;  2E6N A;  2L3R A;  2WAU A;  5BMV E;  3CX7 B;  4MDW A;  1N33 T;  1C0M A;  5LHG B;  1N36 T;  5GMK l;  2DL1 A;  1OX9 A;  4QH4 A;  1WJQ A;  1LRZ A;  1M8M A;  5JQG E;  4GIW A;  1RAB B;  1VA7 A;  3ZMS B;  1MIY A;  4PK5 A;  1M3A A;  4M77 F;  3ZMZ B; 
#chains in the Genus database with same CATH homology
 3MJX A;  3G6E A;  3RYC E;  2DLR A;  3CXC A;  1LVK A;  3PMI A;  5LJ3 e;  1M90 C;  5C0M A;  5LOV E;  3DB4 A;  2K2V A;  3EAE A;  1Z0P A;  4G63 A;  3MXZ A;  3URG A;  5L3G B;  3CC2 T;  4A4G A;  3PU8 A;  3L09 A;  4BAC A;  3C50 A;  3IF8 B;  3GF5 A;  1IRE B;  5F8P A;  5KMG P;  4M75 G;  2JNG A;  5E0O A;  2LSG A;  1YBY A;  2LHN A;  3CD6 T;  3M56 A;  4C5H A;  3QG1 A;  4CI3 B;  3MCA B;  4JJN K;  4N4G A;  5GAN 3;  5LJ3 h;  4RKU E;  3IEE A;  3CQG B;  2DKG A;  3CMA T;  4ZTF A;  4M7D A;  1QVF S;  2E9X D;  2HH7 A;  4IUT A;  3QII A;  2CZ1 B;  2EQK A;  3ZEH A;  1QSD A;  4DOW A;  2GCX A;  3SD4 A;  3CWZ B;  4M77 E;  3JCM b;  2NWB A;  3ZEF B;  1WYB A;  4PK6 A;  5FY7 A;  3R84 B;  4HTE A;  2EYQ A;  3MK7 C;  5HK3 A;  4L0R A;  2JQQ A;  4EMK C;  3LBX B;  3OYN A;  5CVI A;  4M78 C;  5EZY E;  5A2Q E;  3CCR T;  4ME7 A;  4WNK A;  3H3A A;  3ZN0 B;  1FWZ A;  1YI2 T;  2LT4 A;  2N1G A;  2D5U A;  3A8L B;  4R56 A;  2FHD A;  4UF0 B;  3QYH B;  3S6W A;  5DQV A;  3P7I A;  2IVW A;  3X28 B;  3DLM A;  2LSI A;  2I59 A;  4PKC C;  1MMG A;  3JB9 G;  3UT5 E;  5FP3 A;  4A56 A;  3CCS A;  2OTL T;  4AKH A;  2O4X A;  1D0Z A;  3M58 A;  3E0Z A;  2CS7 A;  5KCO A;  1LKX A;  3U3I A;  3VV0 A;  4WF2 A;  1KHC A;  2ODV A;  3ZJ1 A;  2DO3 A;  2BVL A;  3JCM V;  4TUY E;  1VIE A;  2ACX A;  2A7Y A;  4RCB A;  2DTO A;  3ZN1 B;  3L2Q A;  1Y07 A;  3X20 B;  5KX5 E;  4KUI A;  2RHZ A;  2PFV A;  4QX7 B;  3O1J A;  4M78 E;  4Z02 A;  4H63 V;  4QQD A;  4EDU A;  1V9D A;  2RI5 A;  1VQP T;  1Q81 U;  3X25 B;  5LJ5 h;  2KXP B;  4Q5W A;  1WYC A;  2JZ2 A;  5CKB A;  3SDZ A;  4M7D E;  2VV5 A;  3OYJ A;  5HXR A;  1VUB A;  3ETU A;  2LX9 A;  2E9X A;  2E41 A;  1Q7Y C;  2ZMA A;  3ZCI A;  4YHJ A;  3QYG B;  5GAO r;  4AXP A;  2EFI A;  3NRX A;  2C06 A;  3DLL A;  3MO8 A;  1W4S A;  2PJQ A;  4XU2 A;  1K73 C;  4HT8 A;  3N9M A;  4CXX A;  2X4Y A;  3S3M A;  4HGA A;  2EHO C;  4NUU A;  2O4X B;  4YTL A;  2EHO B;  2OA5 A;  5CQY A;  3NTH A;  2XG8 D;  1K9M U;  4UV8 B;  4C90 A;  3SOL A;  2QEX T;  2CEA A;  3JCM h;  4ASK A;  4LDX A;  3HRT A;  3HHT B;  2CCQ A;  1YD8 G;  2K4Y A;  2J1D G;  2DXC A;  3UDC A;  3F2E A;  3I0O A;  3NZP A;  4UVA B;  1H3Z A;  3G71 T;  2NOX A;  3ASK A;  4CZZ B;  4A54 A;  5GAN g;  4PNI A;  2DIG A;  4OHF A;  3KXT A;  3P8H A;  4F6R C;  1ZEE A;  3M54 A;  4XQ3 A;  1WR6 A;  2DI4 A;  3CD6 A;  5CO7 A;  3N9O A;  1BYM A;  4BY6 C;  4JLE A;  4TV8 E;  2FL7 A;  5FU7 C;  2P4T A;  2QTX A;  5KE3 A;  2EHO A;  3KV5 A;  3HRS A;  5LJ3 d;  4BDZ A;  1OI1 A;  4V1A v;  2Y48 B;  2CXL A;  1VQM A;  2A72 A;  5FXX A;  2K48 A;  1S72 T;  4ZI2 D;  1N8R C;  4Y28 E;  5LBQ B;  4K0U A;  2O01 E;  1HTJ F;  3PU3 A;  1OZ2 A;  3PNW C;  2RA1 A;  4J6X A;  4JRI A;  5DY9 A;  4PJO A;  3C64 A;  3CKD A;  4M7A A;  3C12 A;  3OA6 A;  5LJ3 g;  4OB2 B;  5L3B B;  5FY0 A;  3CPF A;  3OSS C;  2V8J A;  4FM4 B;  5L2L A;  3CCR A;  3DTO A;  2NP9 A;  2FYK A;  4FI5 A;  4JRP A;  3HL6 A;  3BQI A;  3Q2M A;  3TCJ A;  4M77 B;  1O75 A;  4RG8 A;  3OS2 A;  2VGM A;  3PFS A;  5JH7 E;  2RK1 A;  2XKO C;  4M78 B;  2HQE A;  4QW2 A;  2C5K T;  3BK9 A;  4A4H A;  3LLR A;  2QGS A;  4EOZ B;  3LJC A;  3NZQ A;  3A5X A;  4WBN E;  1YKE B;  3AVR A;  4X20 E;  5CKE A;  1VIF A;  3I56 T;  4B6X A;  3GNF B;  3CML A;  4C92 E;  4XBF B;  3FHN A;  2WMO A;  4EMK A;  3L2W A;  1RI0 A;  2XQY A;  4MAL A;  1FXX A;  1VQ4 T;  5DAB A;  1MND A;  2D0Q B;  3QJ6 A;  4QXH B;  4H9R C;  2K5F A;  1QP3 A;  2KMT A;  2M9U A;  2HQX A;  5GMK j;  1X75 C;  3MEW A;  2E12 A;  3N2O A;  1PSE A;  2RP4 A;  5EG2 A;  3KV9 A;  3SS1 A;  2BIV A;  4EYU A;  4TV9 E;  3CPW A;  1D3B B;  2ZPG B;  5DLQ E;  4WBO A;  5HXC A;  4JS4 A;  3CCJ A;  2V7I A;  4F7U A;  1UGP B;  3N5L A;  4N78 D;  5DM7 R;  4RMO A;  4HKA A;  3ZYK A;  3JCM W;  1NE8 A;  1EZ3 A;  1QW1 A;  2KMF A;  2L8K A;  4P09 A;  5FRO A;  2DD4 A;  4ZI3 D;  4R55 A;  3NTI A;  3RYH E;  2EQM A;  3UT1 A;  3CME A;  5LCY A;  3KVA A;  2MTQ A;  2CE7 A;  1VQ9 T;  4KUM B;  5HWX A;  3SRZ A;  3LX7 A;  1I81 A;  3OYD A;  2DXT A;  2KSS A;  3G71 A;  1YJ9 T;  4QVC A;  2H7O A;  5ADX L;  4GK0 E;  4HCC A;  3MAC A;  5A0L A;  5GAN e;  4PJN A;  4N0A A;  5J3B A;  3O1H A;  4UIG A;  2RJC A;  2GK9 A;  4IIJ E;  2VGN A;  4IST A;  4M77 G;  4F7U F;  4XU1 A;  2WM9 A;  4PJO E;  2WSF E;  3K8P C;  4EMH A;  2CWO A;  4C92 F;  3M57 A;  5LYJ E;  4AQF C;  4IE0 A;  4TN7 B;  2LDM A;  4M7D B;  2SPC A;  3PMT A;  1VQO A;  2X67 A;  3UUM A;  2FB7 A;  3FXD B;  1SA0 E;  3TKL B;  3M65 A;  3VUB A;  5LJ3 f;  3M9Q A;  4M7D D;  5JDN A;  2B8A A;  4XTX A;  2DXB A;  2VXE A;  4MDX A;  2LM9 A;  4A4F A;  5HAX A;  3UPU A;  1ZHI A;  4HCZ A;  1V29 B;  3MP1 A;  4AKI A;  3ANW B;  4X9D A;  5GMK h;  3OS0 A;  2WSE E;  3M55 A;  5FMN A;  4C92 A;  2CKK A;  1N27 A;  4LDW A;  3OYZ A;  1G3T A;  2CXD A;  3Q5X A;  1FMV A;  4XTZ A;  1G5V A;  1VQP A;  2KWH A;  3RH3 A;  2HPJ A;  3OYE A;  3ZBD A;  3GA8 A;  2XDD A;  3NFC A;  3OYY A;  1OWA A;  5KCH A;  2C5I T;  3I56 A;  1HFA A;  3J81 E;  3B57 A;  4E7K A;  2LSJ A;  4ZN3 A;  1Q86 U;  3VKG A;  3CPW S;  3CBM A;  5J2U E;  4BAY B;  1Q7Y U;  2CZ6 B;  3FC3 A;  3E9F A;  3IBP A;  4TVR A;  4JS5 A;  1YCY A;  3X24 B;  4MZP A;  1WQ7 A;  1LOJ A;  1YIJ A;  4M77 C;  2CLY C;  4KBM B;  2X68 A;  2G0U A;  1YJN A;  4EMK B;  4YFS A;  5JR9 A;  3N9P A;  4D6W A;  1BI3 A;  4MHC A;  2VKJ A;  1XOV A;  4F7U E;  2GFU A;  1HCI A;  4IUV A;  3GP8 A;  3L3P A;  4OVA A;  3GN5 B;  4ZN1 A;  1UGS B;  5CCA A;  4QHO A;  1E1H B;  3CCJ T;  3L2R A;  2BKD N;  3JCM f;  1T98 A;  4HCB A;  3JB9 H;  4B9W A;  2QDY B;  4X1K E;  3C94 A;  2K3Y A;  3CCE T;  4KUL A;  3OS5 A;  1BI2 A;  1VQM T;  3M4G A;  1LJO A;  2YEV C;  2EJG A;  3OBY A;  3JCM P;  1K9M C;  2Z6E A;  3JCM Q;  4E7S A;  4X9C A;  2KVQ G;  1S72 A;  4I43 B;  3CCM A;  2EKO A;  2DD5 A;  3KBT A;  5KH6 A;  2HNI A;  2XAH B;  4M77 A;  3CPZ A;  3C4S A;  1MIV A;  1WLX A;  2XTL A;  4M78 A;  2F5K A;  1MIW A;  3T8O A;  2BUD A;  5FXZ A;  4PJO B;  3GWH A;  2V7J A;  4C91 A;  2EQJ A;  2MOZ A;  4BY6 B;  2WSS V;  3HR0 A;  2KAF A;  4M7A G;  1PSF A;  2R5A A;  4XU0 A;  4LDU A;  3HFO A;  3HFN A;  1S35 A;  1UX4 A;  3AHU A;  3W15 B;  5D6X A;  3OYM A;  5IHY A;  4L59 A;  2JPF A;  3OJA A;  3RKO A;  5I21 A;  1Y64 B;  3OSV A;  3QHS A;  1UB4 A;  1M5Q 1;  4U72 A;  1M4Z A;  2K3X A;  3CEY A;  2D9T A;  4AKG A;  3I55 T;  2P0Q A;  4DVD A;  2YIN A;  2L3L A;  2DTI A;  4UVB B;  4NL2 A;  3P8C D;  3ZCJ A;  2W61 A;  2MWP A;  5FLX E;  4QVD A;  3DKM A;  4ZS3 A;  5LJN A;  3RRC A;  3HRU A;  4NS5 A;  5JDQ A;  3PIO A;  2JTF A;  3V7S A;  3EFS A;  4M78 D;  4OGC A;  2RB6 A;  4AQF A;  5FRN A;  3HKE E;  4HE8 A;  1UCU A;  4F7U G;  5JR9 C;  3OMG A;  4DMV A;  4M7A C;  3GIB A;  3JAM E;  4A4K A;  3J80 E;  4CI1 B;  2ZLY A;  5GAN 8;  3EDU A;  3OB9 A;  2YRV A;  1X79 A;  5L3C B;  2R58 A;  3EUH A;  4BJN A;  2XUE A;  4C8Q G;  5CIU A;  4XTU A;  3V8K A;  3LK2 B;  4ZS2 A;  4RG2 A;  1MNE A;  1M9S A;  4PAG A;  2RJF A;  5GAO q;  2E1H A;  4UF0 A;  3ZMV B;  3P8B B;  1QVG S;  2KY9 A;  5FU6 B;  5JDM A;  1KQS A;  4C0D C;  2ZPI B;  2KND A;  3G7Z A;  5H6Q B;  3QK6 A;  4M7D C;  3C51 A;  4UEM A;  3RKW A;  2LCC A;  3ZMT B;  3B13 A;  2JVV A;  2CGH A;  5LJ5 g;  2D6F A;  3K3Q C;  2KT9 A;  3UUX B;  1M1K C;  4ERR A;  1KC8 U;  5LJM A;  4C0Z A;  2P0K A;  1YJ9 A;  2CLY B;  4JLG A;  4ZGJ B;  4MML A;  2Y4X A;  1YJW T;  2X9W A;  3FB9 A;  4M7A B;  4OP0 A;  5LGU B;  3CCU A;  2QQR A;  5LP6 E;  3J7A F;  2JOY A;  1SSF A;  1KHI A;  2KQW A;  4RCC A;  2E9X C;  5HXE A;  3P8D A;  5IYZ E;  2K24 A;  2OTJ A;  1Q86 C;  2XID A;  5JRE A;  2UXX B;  3CCE A;  2BDE A;  3HL8 A;  1YW0 A;  1G3W A;  2E70 A;  2DZ9 A;  3BQK A;  4GYS A;  1WJR A;  3LK3 B;  4O6J A;  4DND A;  4C0D B;  4CQI A;  4BA9 A;  4PJO G;  4QKN A;  5GAN h;  1K73 U;  1HF8 A;  3LWI A;  4DA4 A;  2HBP A;  1OZ3 A;  2JRK A;  3OBW A;  5EK2 A;  4WW0 A;  3I9Y A;  4HFV A;  1JJ2 S;  1ZKE A;  4BUG A;  2DK3 A;  3A8M B;  5GAN j;  2L8D A;  5CA0 E;  3VKI A;  1W2B S;  2N9D A;  4JEU B;  4P5N A;  4C5I A;  1Q81 C;  1IZ6 A;  3NTK A;  3HI2 A;  1K8A C;  2XIC A;  4DMW A;  5LL6 S;  4C92 D;  1HXD A;  2JJ9 A;  4J83 A;  1YIT A;  5GAN 6;  2LQ8 A;  3X26 B;  2H7V C;  4FT2 A;  3QPH A;  3QUI A;  3KFW X;  2LCL A;  3JSC A;  2FVU A;  3M53 A;  4J8O A;  5HKC A;  3C4X A;  3WVE B;  4XTY A;  4UXN B;  2MI6 A;  4M7A E;  3CCV A;  3CX6 B;  4MZM A;  4OGE A;  2RH2 A;  4UVC B;  4ILU A;  2XI9 A;  5GAN f;  2VKH A;  1TH7 A;  4BDY A;  3RMQ A;  3LW5 E;  4EIW A;  3GOX A;  3RYF E;  3E19 A;  3JC6 C;  4L6V 5;  2EJF A;  5LHH B;  5JVD E;  4ZGE B;  2L9Q A;  4OYK A;  2PUK B;  5GMK i;  4PL6 A;  3AAI A;  5JDH A;  2YU1 A;  2DAQ A;  2LC4 A;  3LGL A;  4PJJ A;  5GAM f;  3I9W A;  1US7 B;  4MFR A;  3LWH A;  1M1F A;  2Q9Q D;  5JRC A;  4BI8 B;  3V7R A;  3OYG A;  1GXI E;  3F57 A;  3EFR A;  5HXS A;  4CI0 C;  2JUF A;  2LEH A;  2X9H A;  1D1B A;  5DQW A;  3OYH A;  1K8A U;  2PVD B;  2DIQ A;  2OTL A;  2PVO B;  5GAM e;  2RHY A;  3VU7 H;  3KVB A;  2JMK A;  3JCM c;  4HEA A;  3ME9 A;  1KQ2 A;  4M77 D;  1D1C A;  4ELZ C;  4AI6 A;  4I50 E;  1O3X A;  5C8Y E;  3WAJ A;  3FB2 A;  2RJD A;  1VQO T;  3QUJ A;  4X1I E;  2P0P A;  3RUX A;  3DJB A;  2RK2 A;  3A5Z B;  1KG1 A;  3I1A A;  3V8L A;  4QXB B;  3VU3 C;  4X34 A;  3HA4 A;  2VXF A;  3PUQ A;  3SWH A;  1P92 A;  4BB7 A;  5AFU L;  3E22 E;  5HWY A;  3FDR A;  4O2A E;  1M8V A;  2MMP A;  4H9Q C;  5DJQ C;  3N9Q A;  3F31 A;  3N9L A;  4UEL A;  2IC6 A;  2VAS A;  2KZ7 B;  2K9A A;  5GAN 7;  4IUU A;  1ZBX A;  5GAM d;  2WMN A;  3ZLI A;  4C92 C;  4QWN B;  3AB3 B;  2IAK A;  1NWM X;  3MA9 A;  3BFM A;  3CC4 A;  4NL3 A;  2IC9 A;  3RC8 A;  3I55 A;  4H9S E;  4A53 A;  4O2B E;  4CRI A;  4JDS A;  1VQ8 T;  2RHI A;  5IAY A;  2R57 A;  4PLI A;  3N2K E;  1HX8 A;  2RI3 A;  3C4Z A;  4J7I A;  4BD3 A;  3OYA A;  2X51 A;  2A2F X;  3KIN B;  3QZ9 B;  3RER A;  2X66 A;  4IE5 A;  3DP7 A;  1M1G A;  2F69 A;  4I4T E;  3N5B B;  3JB9 I;  3L42 A;  3C98 B;  3RES A;  4PJO F;  3C4W A;  1OYX A;  4M78 F;  2D2S A;  5LXT E;  3BY7 A;  4M75 E;  3PGG A;  4J7F A;  3OYX A;  4BI4 A;  1DJ7 B;  1WNL A;  1YIJ T;  2DZC A;  1N6A A;  4QXC B;  1YIT T;  2KLQ A;  3KBG A;  3PDY A;  3F70 A;  2LJL A;  4MZT A;  2WAC A;  2CMR A;  3R6O A;  1G3S A;  4DBQ A;  3N9N A;  1KNZ A;  1BR2 A;  1NPR A;  2XAQ B;  4HN9 A;  2E65 A;  2Y6X A;  3FEO A;  3RIR A;  3CCV T;  3A8H B;  3VYH B;  5JDG A;  1QUU A;  2Q9Q C;  3MP8 A;  5HY6 A;  5A0D A;  2C5J A;  1H64 1;  2ZGW A;  1EIF A;  1UGQ B;  1MMA A;  3FJP A;  1VQ6 A;  3N2G E;  3Q9D A;  5F3J A;  4PNO A;  2LT3 A;  4C8Q E;  4CI2 B;  2V26 A;  3MEU A;  2E8I A;  3WXM B;  3CCU T;  1BKB A;  3L1A A;  4UC4 A;  5FNV E;  4C8Q F;  5CKF A;  4E7H A;  1OXZ A;  4M7D F;  2IG0 A;  3BDU A;  2X4J A;  4JLI A;  3RRW A;  4ANJ A;  3KUF A;  3HKS A;  1ZV4 X;  1X01 A;  4LD9 K;  3ZPO A;  4YLH A;  4C8Q B;  2CZ0 B;  4C8Q C;  3OYL A;  1CUN A;  3V8J A;  2H3R A;  2YU2 A;  1I4K 1;  4UV9 B;  3SWN B;  4JEH B;  3INZ A;  5EK4 A;  1FIO A;  1Y96 A;  1R8O B;  2PUO B;  1XQH A;  4MBQ A;  2NW9 A;  5CA1 E;  2ZM0 A;  3MZK B;  5GON E;  4E7J A;  3VKH A;  3QKJ A;  3FIF A;  3EVY A;  1UX5 A;  3A8O B;  3RKX A;  5KE2 A;  2K5I A;  2BZB A;  2A3L A;  3A8G B;  3CCS T;  3E9G A;  3OYK A;  2Y90 A;  3JCM X;  3LBX A;  5AYF A;  3O9X A;  2ZM8 A;  4PJO C;  4AKR B;  1BI0 A;  1HK9 A;  3ZYL A;  2ZCF B;  4H63 H;  3QXE B;  4XU3 A;  4IE7 A;  4PJL A;  1MMD A;  4GY5 A;  2DCF A;  2PVG B;  4PJM A;  2VC8 A;  2RHX A;  4VUB A;  2W63 A;  5C6S A;  1U4Q A;  2NW8 A;  2EQU A;  3CVR A;  3RKY A;  3S3N A;  2XD0 A;  4EMG A;  4FT4 A;  3GLX A;  3VUZ A;  4H9P C;  2YK0 A;  1SHZ C;  3FBL A;  4OK0 A;  3MHX A;  1BI1 A;  3UWN A;  3OMC A;  1KK7 A;  4AQG A;  2VUB A;  2PQW A;  2ZPH B;  1WQW A;  1VQN A;  2GQV A;  4X1Y E;  4ZTJ A;  3U78 A;  1WJS A;  1VQ8 A;  1BR0 A;  2D0T A;  1HG2 A;  2BVM A;  3KBU A;  2V7M A;  1U1T A;  2AHJ B;  3FLG A;  5GAN 5;  1G3Y A;  2EHO D;  2Q9Q A;  3RMS A;  4M75 A;  1AJ3 A;  2MWO A;  4FL6 A;  2A3D A;  2LHR A;  1M90 U;  4MLK A;  4LD6 A;  1IZN B;  2CM0 A;  5D6Y A;  2DJZ A;  1VQ9 A;  2CA5 A;  1B34 A;  2G3R A;  2MYS A;  3WAK A;  2ODU A;  3HKD E;  3TU4 K;  3OYB A;  3CC7 T;  4IUR A;  1UEB A;  4M7A F;  2JMH A;  4GK5 E;  2XU8 A;  1XNI A;  3LGF A;  4ATO A;  4O4I E;  3D0T A;  3ZMU B;  4AKL A;  2WBL A;  3CCQ A;  2NTX A;  1Y7X A;  4KMC A;  2Y8D A;  3G4S T;  2VYT A;  4ADZ A;  2E6Z A;  5FY1 A;  2QQS A;  2VWA A;  1HS7 A;  1M1K U;  4HT9 A;  4QVZ A;  1N9R A;  2MBG A;  2DEQ A;  4FU6 A;  3BQL A;  1VOM A;  4OB3 B;  5LJ5 f;  3JB9 F;  2ZPF B;  4Y91 A;  3Q1J A;  2OTJ T;  1VRB A;  2ZM2 A;  5IN1 A;  1JJ2 A;  4OMF B;  5LA6 E;  1JBM A;  4IUP A;  3TRE A;  2XAF B;  3LG7 A;  1YHQ T;  4O4J E;  3WVD B;  2YLC A;  1KD1 C;  4ZHQ E;  1VQ5 A;  2M0O A;  1O9S A;  3UFE A;  3CX8 B;  5LJ5 e;  1D3B A;  1LVF A;  2QQ9 A;  2QA7 A;  1MMN A;  3LYI A;  3OKQ A;  2L5Q A;  3LFM A;  2WSC E;  4YJ3 E;  5M4Y A;  3L2Z A;  3J9X 1;  4V2S A;  1LNX A;  1VQK T;  1KQ1 A;  1KD1 U;  3JCM d;  2LVM A;  5GMK e;  1AHJ B;  4G2A A;  4DO0 A;  1ZHC A;  4IUQ A;  3V7C A;  3MKD A;  4P0B A;  5GAO m;  4M7D G;  2XAS B;  4LDV A;  3H37 A;  1BR1 A;  3O1I A;  5JDF A;  3BDL A;  3OYI A;  4M75 C;  4YJ2 E;  4C8Q A;  2P9B A;  3AVS A;  2XK0 A;  3DB3 A;  1VQ7 A;  3H8Z A;  3OW2 A;  4ZI3 C;  3L2V A;  4M75 F;  3AA7 B;  3HKB E;  2JN0 A;  4O5V A;  2UXN B;  3S3O A;  1IJ6 A;  2QQB A;  5A0G A;  5GAN 2;  1W2B A;  4ZI2 C;  2PBI A;  3JCM e;  3HKC E;  2HD0 A;  3CQC B;  2C0S A;  3OS1 A;  3JC6 D;  2KIN B;  1VQN T;  3QSU A;  1Q82 C;  4E7L A;  4TX5 A;  4PW8 A;  2H3J A;  4ELY C;  2MAM A;  3CMA A;  3FRN A;  2W0G A;  3VHL A;  4ISS A;  4XZC A;  3CBP A;  3QC9 A;  2EJ9 A;  2X4X A;  2ZPB B;  1IJ5 A;  3QZ5 B;  1G8X A;  4IKF A;  2RO0 A;  5FU7 B;  1FX7 A;  2X35 A;  3CCM T;  3RX6 A;  3OBV E;  1BIB A;  5IT9 E;  3AAE B;  4CXY A;  5JDL A;  5GMK m;  3T9N A;  1U8R A;  1U5P A;  1VQ6 T;  3H6Z A;  5LJ5 d;  3CC7 A;  3ZJ2 A;  4CXW A;  3CME T;  2ES0 A;  3AAA B;  2KWI B;  4OB0 B;  5ETW A;  2JTM A;  5CAI A;  5J1G A;  3M5A A;  2N2N A;  2V8I A;  2PU9 B;  3BW1 A;  4F7U B;  4C5E A;  2W00 A;  2EIF A;  1YI2 A;  3GMI A;  1B7T A;  3GN5 A;  1B34 B;  4DOV A;  4KUD K;  4C92 B;  5CKD A;  2VK9 A;  4PJO D;  3ETV A;  3MP6 A;  4EXT A;  2DHR A;  2Q9Q B;  2YHT A;  4M78 G;  3JB9 D;  4BJM A;  4PK4 A;  4EAH A;  5J39 A;  2RI2 A;  3PUG A;  3ESL A;  4M75 D;  2QQA A;  3CCL A;  2M1H A;  3IHR A;  3HP9 A;  2NLU A;  5EK3 A;  2QA4 T;  3RC3 A;  4E7Z A;  4OFZ A;  3S4U A;  1KQS S;  2K5L A;  4IGU A;  2XDB A;  1MGQ A;  4C8Q D;  1HG5 A;  3FXE B;  4B9X A;  1I8F A;  2K57 A;  1NJI C;  4M7A D;  3PUA A;  2QI2 A;  5CQX A;  2YLB A;  2WWU A;  3HSB A;  3G6E T;  3J7Y q;  2V1D B;  3O4X E;  3PIP A;  4DQ2 A;  1VQK A;  1D0Y A;  4L5G A;  3QDR B;  3I0Q A;  2OAU A;  4A4E A;  3Q5W A;  3V5U A;  1X6O A;  4BI3 A;  2GFA A;  4KT0 E;  1WPY A;  4XTW A;  4GLK A;  2X0L B;  4C5G A;  4PFP A;  2EWN A;  2LOP A;  2X9X A;  2XAG B;  1JB0 E;  1VQL T;  1NAF A;  3KDS E;  3OYC A;  5HK0 A;  1I5L A;  4E47 A;  3JCM J;  5L3E B;  1U1S A;  2MF2 A;  2DTH A;  2NTY A;  1FEW A;  1H7C A;  3KV4 A;  1UGR B;  3ANW A;  5A1L A;  1VQ7 T;  3O8V A;  4J2C A;  4QX8 B;  4U74 A;  1NZ9 A;  5L8R E;  4ZOL E;  2QEX A;  3K3N A;  1QVP A;  4XTV A;  2DVE A;  4PFO A;  1QP2 A;  3CXC S;  4EZH A;  2RHU A;  1FMW A;  2DWK A;  5CR2 A;  3AA0 B;  3PT9 A;  2VKD A;  1G73 A;  5FU6 C;  5FXV A;  4M1P A;  5LNK A;  4NOY A;  1YJN T;  2CYZ B;  3MET A;  4TZ4 C;  5J26 A;  3CCQ T;  4QQG A;  3JB9 J;  5CKH A;  3G4S A;  2HPL A;  3UTK A;  2LOS A;  2HAX A;  3PTA A;  3NRY A;  4C92 G;  4GOU A;  5LHI B;  2LT1 A;  5FXW A;  2CWY A;  4J5Y A;  4GYR A;  5LBM A;  2M67 A;  2VL8 A;  1NJI U;  3JRZ A;  1Y71 A;  3ZC1 A;  5JR9 B;  1MHN A;  3FBZ A;  4XK8 E;  3SWN A;  3UUN A;  2PG8 A;  2E64 A;  4ZI7 E;  1Y96 B;  4O8S A;  2IW5 B;  1D1A A;  3EDV A;  4Z8X A;  2Y4Y A;  3PUR A;  4FIB A;  2LE8 A;  3NBX X;  2V7K A;  2K5B B;  2GF7 A;  2I2L A;  5GAO p;  4N4I A;  1VQ5 T;  2E5Q A;  4OF1 A;  3L2U A;  1KC8 C;  3ER0 A;  3SB2 A;  2D0U A;  3AA6 B;  3LK4 2;  2R5M A;  2QXF A;  3QJY A;  1D0X A;  2KDS A;  3ZYM A;  4IDZ A;  5H6R B;  3SWN C;  3VYG A;  2XHC A;  3KV6 A;  3RYI E;  2RM4 A;  4BE0 A;  4OYJ A;  4O4L E;  3ONX A;  3OYF A;  5FYM A;  3VJP A;  5KDM C;  2NW7 A;  5LGT B;  2F5T X;  5CB4 E;  3M59 A;  1YKH B;  3OW2 S;  5L3F B;  3CC2 A;  2M16 A;  3CCL T;  5L3D B;  1IAP A;  2QA4 A;  4OB1 B;  3GPL A;  1VQ4 A;  1ZQ1 A;  4KP3 C;  2X4W A;  3ZC0 A;  2CXF A;  1Q82 U;  5GAN d;  2KK4 A;  3AA1 B;  2DXU A;  3OQ5 A;  3ZFJ A;  5GAO n;  5HYA A;  5JRC B;  3E1S A;  3MEV A;  4LDY A;  4C0G A;  4II1 A;  1BR4 A;  2RD1 A;  4FSX A;  2VKO A;  2LRQ A;  2ZPE B;  4EB6 E;  4DBR A;  1WGS A;  4J6Y A;  5GAM j;  1WRD A;  5I2M A;  2LSY A;  5TAO A;  4JUY A;  3GNG A;  3C95 A;  4P0A A;  3V5S A;  3JCM g;  2LQK A;  4MMK A;  1VQL A;  3K3O A;  4IE6 A;  3CBO A;  3QBY A;  4HA8 A;  2DNX A;  4NUV A;  2L89 A;  3HPW A;  4M75 B;  2RA2 A;  4EYY R;  3PUS A;  5D6W A;  5GAN 4;  4EPC A;  5J2T E;  2X9Y A;  4PLL A;  2B1E A;  3RPU A;  4I55 E;  5DLO A;  4JRQ A;  2W62 A;  1N8R U;  4ZGD B;  3SFM A;  4JUV A;  2V7L A;  1JRI A;  5GAM h;  4BE1 A;  4QQ6 A;  1XTD A;  4JRK A;  2DWG A;  3TEE A;  4O4H E;  1QVF A;  5LG4 A;  2ZZD A;  3PTR B;  2LNV A;  2DPP B;  2E9X B;  4N0A C;  5LGN B;  5CK9 A;  3CQX C;  4C0F A;  3OY9 A;  4HKE A;  1QVG A;  5GAO l;  3WI3 A;  5HXH A;  3PE0 A;  2XHE B;  5I2S A;  5FRM A;  4IE4 A;  3QO3 A;  4XAX B;  1S94 A;  4BE2 A;  1YHQ A;  1YJW A;  4EZ4 A;  2XAJ B;  4E7I A;  4L9I A;  5M9O A;  3E08 A;  4J6W A;  2CZ7 B;  5LJ3 j;  3UUL A;  1N9S A;  5LJ5 j;  1NPP A;  2EAY A;  4H9N C;  5GAM g;  4N4H A;  2V8K A;  2LSK A;  2LTO A;  4H9O C;  3CC4 T;  4FJO A;  2RJE A;  3LH0 A;  3R6N A;  3MEA A;  3M4Y A;  2E10 A;  2XDP A;  1BIA A;  2VB6 A;  4IHJ E;  1RL2 A;  2E6N A;  2L3R A;  2WAU A;  5BMV E;  3CX7 B;  4MDW A;  5LHG B;  5GMK l;  1WJQ A;  1LRZ A;  5JQG E;  4GIW A;  3ZMS B;  1MIY A;  4PK5 A;  4M77 F;  3ZMZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...