4L5GA

Crystal structure of thermus thermophilus card
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
162
structure length
162
Chain Sequence
EFRPGDKVVLPPYGVGVVAGIAQRSVSGVSRAYYQVDFPGSRSKAYVPVEAPHSVGLRKALAPEEVPVILDLLKNGRMPLPKQWAARHRKTSEILADGNPYRIAQMAGQLRAWEVERGLPDLDRQALRRAIHLLAEEVAQSLEITVQEAKRLFEEAWGEELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CarD
publication title Structure and function of CarD, an essential mycobacterial transcription factor.
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Transcription
total genus 47
structure length 162
sequence length 162
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02559 CarD_CdnL_TRCF CarD-like/TRCF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1290 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l5gA02
2.30.30.840 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 4l5gA01
4MFRA 2LT1A 2EYQA 2LT4A 2LQKA 4L5GA 4XAXB 4KMCA 2LT3A 4ILUA 4KBMB
chains in the Genus database with same CATH superfamily
4ORZA 1ZBXA 1M90U 1E7PA 4KP3C 3P4WA 1M1GA 2VUBA 4FT2A 2HKNA 4UF0A 3UFEA 2YU1A 1FX7A 2P0QA 3A8YC 5FW9A 1SHZC 1KHIA 2ZPHB 3UUMA 3ONLC 3ZC1A 3CCJT 3BFMA 2RHYA 3T8OA 4Z8AA 4EAHA 4D6WA 4BJMA 5LOVE 5AQTB 2YWWA 4JLGA 1JB0E 4Y28E 1G73A 5JDLA 2WDVA 2RI3A 2PVGB 3MP8A 3OSVA 5GANh 4DV7T 2YUOA 3RR6A 3KBTA 3TKLB 1WQWA 3OYGA 3SWHA 2CWYA 4EOZB 3KV6A 4QH1A 3QYGB 4AIUA 3LK2B 4L5GA 4H63H 1EIFA 3SB2A 2E3HA 3VYGA 4WZXA 3J81E 2V7LA 1I4K1 4DMVA 3O1HA 1JNZA 3P4QA 1V9DA 2DBKA 2DXUA 3M54A 4OVAA 1PD1A 5HXSA 4RCCA 2Y90A 5J1GA 3SWNA 5LGUB 3ANWA 1C0MA 3I55T 1WYCA 1YQ3A 4PFZA 2JTFA 2GF7A 2LQKA 5LHGB 2KRSA 4CC2A 3NRXA 2DL4A 2A08A 1LRZA 2V1RA 2ACZA 1WPYA 3CMEA 4JI0T 1WJQA 2LC4A 1N27A 1HG5A 4PAGA 3SRZA 1J5WA 5IYZE 4MZMA 5FU7C 1YJNT 2BZXA 4C5HA 5GANf 4DA4A 5KYXA 4PW8A 2CP3A 5LJ5d 4OMFB 1U8RA 3M0TA 3ZCJA 1QKWA 2H7OA 3CCUT 1UJYA 1NWMX 2BG9C 3A98A 3M0QA 1LJOA 4F7UB 1M1KR 2YDQA 3ZN1B 1N33T 1UFFA 4JYAT 3C95A 3EDUA 1ZX6A 1M5Q1 1JEGA 4ZTJA 3CCRT 5GAN8 4AKRB 6AT1B 2CM0A 3CPWP 3DJBA 2WSSV 4H63V 3H3AA 5F8PA 1IXDA 5LJ5h 3UQ7A 3OY9A 1I0CA 3D7SB 3FJ5A 2NWMA 3VKHA 3A8OB 5LG3A 4OYJA 4JI6T 3NTHA 1WLPB 3EG0A 3RNJA 2BG9A 3PURA 1N8RR 3J7AF 3C12A 4JI8T 3BW1A 4F7UF 4NPPA 4PJOG 3MACA 1M90R 4HCBA 5D6XA 1SPKA 3IBPA 3HI2A 1A0NB 4BE1A 2LRKA 4TWFA 1U1SA 1VIFA 1VQMQ 2OTJQ 3KUFA 2QA4Q 1BIAA 2UUBT 2CSQA 3CPWS 3L09A 2YUQA 4JLIA 3TSZA 4XAXB 3OQ5A 2P84A 3FZFB 1MMDA 2A2FX 3FEOA 4FW1A 3UT5E 2CH4A 3H0FA 2E64A 5AQHB 4O6JA 2XZEA 2VK9A 3EABA 3UUBA 5CIUA 1UECA 2EYQA 3RYFE 2LNHB 3M0SA 2RO0A 3AAIA 2OTLT 2MIOA 4BI8B 2DXTA 1T0JA 3LWHA 1YJ9Q 3SOLA 4PK5A 1KIKA 4HEAA 5GAMe 2GTJA 3NHNA 5EC7A 1WHJA 3TLUA 4JI5T 1YIJT 2V7JA 5LJ5f 1VRBA 1PRMC 3UQ4A 1YITQ 4JJDA 1OPKA 4J6XA 1SEMA 5GAOm 1S72Q 1D1BA 4ILAA 3QJ6A 2VWFA 2LRQA 4O2BE 2AK5A 1BR4A 2X0HA 3RI5A 2KT1A 3CPWA 1YW0A 3OVUA 3FZLB 4M7AB 2CCQA 1YFNA 1VQMA 2OTJA 3ZMSB 1HR0T 4HKEA 1SRLA 2K7AA 3UA7A 1W0BA 2RHZA 1TU0B 4PLIA 1SF9A 2VVNA 4C92E 2XKOC 2KNDA 4YHHT 2QDYB 5JQGE 2X4JA 1NYGA 5C6SA 4QXCB 3EGDB 1KFYA 5CK9A 3JRZA 4DR4T 2IVWA 4Z91A 4FYXB 3EG9B 1YJ9A 1HK9A 1ZUKA 4HFEA 2ZM6T 2FPDA 4EPCA 2DMOA 3HKSA 1HS7A 4M7AF 1KNZA 4ADZA 1M7KA 5DABA 2E12A 2L3SA 2VYTA 3NRYA 1JU5C 5LXTE 3U3IA 3T9NA 5CGMA 4WNKA 3EGXA 1ACMB 3H37A 1PCXA 3LX7A 5AQMB 1VQ6Q 3S6WA 1QMCA 5ABGA 2BTTA 1G2BA 3I5RA 2UUAT 4QWNB 3ZEFB 1WHLA 3G6ET 4IUTA 5DJQC 2XUEA 2CLYB 3I56Q 1HYOA 1WHGA 2XQ3A 2FO0A 4B3ST 4UVCB 5A0GA 4E7JA 1VUBA 3RGLA 2RK2A 1TUGB 5LL6S 3J9X1 4YJ2E 2CXLA 2BBHA 4WW0A 1Q7YC 4OB1B 1SSHA 4M7DB 2FZGB 2V1DB 4B3RT 4ILBA 4J9HA 4RG2A 1G3YA 4R56A 3CBOA 2X3XD 3IF8B 4YTPA 3MEWA 3TVTA 3PUWF 4M78C 3ZKRA 5IXFA 2R58A 3OYKA 1ZA2B 2E6NA 2DLPA 5HXRA 1WHHA 2YSQA 3A8GB 2AHJB 1T3LA 4J8OA 2GCXA 2QGFB 2YDRA 3JCMe 1D0XA 4C0DB 5I2SA 4E7SA 3RKGA 4UEMA 3CCMT 3PTAA 4TZ4C 4OHFA 1F1BB 3PFSA 1NJIC 1VQ6A 5HEJA 5FROA 2FG0A 1WR0A 4LDUA 3EG1A 5JH7E 4M7DF 3CCST 4P0BA 5LHHB 3I56A 1KQSS 2DM1A 1FMVA 3CBPA 2CA5A 1T8BA 4M78A 4OX9T 2EAYA 3HKCE 2RN8A 3QBYA 5IT9E 2K9AA 2VQFT 2V6XA 2NOXA 1KEYA 2HCKA 4E7IA 3DLMA 2D0UA 3T1YT 4AFQC 3CCJQ 2QEXT 4IIJE 4A54A 2CP7A 1YJWT 1K73U 1NBEB 1QVPA 2A37A 5HYAA 3MEUA 4A53A 2NUTB 1YI2T 4RTWA 4TV8E 4IL9A 1J1JA 2VGMA 1VOMA 4XTYA 4AISA 4LDWA 4E7KA 4GIWA 2M6IA 3AEGA 1AZEA 4MDXA 2FJEA 2DXCA 1TUDA 2FJBA 4UF0B 1I5OB 4B3MT 2CUDA 2YT6A 1I07A 4JEUB 4ELYC 1MHNA 2KNBB 2VVKA 2SPCA 3PNWC 3X1DA 5HCKA 3URGA 1LOJA 4J83A 1G8XA 4X65T 4QXBB 5JDNA 2XIDA 1M30A 1MIVA 2OI3A 2LSGA 2CZ1B 1M9SA 4P09A 2J6FA 1BI0A 2XICA 3N9OA 2W4XA 3AE3A 3CIRA 5LB7B 1EFNA 4DV4T 2G6FX 5FXWA 3E9GA 3CC2T 3PE0A 4RKUE 3C51A 3MZKB 4UELA 4M75C 3OPCA 1QVGP 3JCMX 3I35A 1OX9A 5FRNA 5AQIB 1QP2A 2EQIA 1GCPA 2NLUA 3I9YA 3ZBDA 2E4HA 3I9WA 4OP0A 4CN4A 2K9GA 2QYZA 3QWYA 2L8KA 2CS7A 2K6DA 2CXFA 5M4YA 1WJRA 4N4GA 3QUIA 3CMAT 1MMAA 2MI6A 1K8AU 4RTUA 4HT9A 3ANWB 4HFDA 3ZPOA 4J9FA 3CD6Q 4CI3B 3AE9A 2YOEA 1UGOA 2EJGA 2B1EA 1BI1A 2OV9A 1UHFA 2LMJA 3META 1M1KC 2K3YA 3R84B 4AKIA 5L3EB 1XMOT 1UUEA 3VR8A 1VQOQ 4QH4A 4M75A 2GFUA 1SRMA 2DYIA 5CFBA 5AQRB 3OYJA 3U78A 3JB9F 3CCRQ 2UU9T 2KVQG 1KQ1A 2M0OA 5KYXB 4BD3A 4J6WA 2XAFB 2FHDA 5GMKj 4ZS3A 2E65A 1AJ3A 2LCCA 3ZMUB 3N5BB 3RPUA 3GMIA 4PK4A 4TX5A 4O5VA 3A8HB 2NUPA 1N8RC 4M77D 2WQYA 5KH6A 5J26A 3AAAB 1M90C 3N9PA 3NBXX 1BR1A 3M0RA 1BCMA 3CX7B 1ZSZC 2M16A 1W2BP 3LG7A 5LG4A 2D6FA 3CD6A 5FU7B 1RAFB 2IPOB 5HEHA 3ZJ1A 1QVGA 2DA9A 3F2EA 1K73R 2WCAA 5M9OA 5F5WA 5LHIB 2F69A 2KMTA 3M4GA 1VQOA 4EB6E 1IO6A 2NW7A 4NXNT 3HHTB 2BG9B 2EWNA 2DL1A 4PNIA 4DV2T 2XQ6A 5AQFB 2WZHA 4F6RC 1ZLMA 3VS5A 3VU3C 1T72A 2OTLQ 2C06A 4TUYE 2O4XB 2Y4YA 5HEGA 2XQ5A 5AQGB 3VRAA 4RCBA 2LT1A 3UU4A 1ZSZA 3ULRB 5HCMA 3OYXA 2OAUA 2M0YA 2WWVA 4BACA 1GBQA 5CB4E 2MK5A 2LSKA 2CP2A 4CQIA 1K0XA 2X9HA 2ZZDA 3CQTA 1R8OB 2ECZA 4NIQA 3N2OA 3OBYA 3QXEB 3G71Q 3EI0A 2L9QA 4IUQA 2QYWA 2RM4A 4MBQA 5KCHA 5D7UA 2EGCA 1RLQC 2KINB 4M7AC 1B3QA 1SHFA 3BY7A 1HF8A 1UHCA 1YHQA 1QVFS 1H92A 3E9FA 2G0UA 5L23A 4HTEA 2VKOA 1NENA 1OYXA 5HK3A 4M78E 1W2BA 4C8QD 4KT0E 5HWXA 1OOTA 3EFRA 3MO8A 5LJ3j 3RKWA 4FCYA 1K9MU 1BR0A 4U33A 4OB0B 3GP8A 1QCNA 1WIEA 1D0ZA 4JI4T 1UDLA 4O4IE 1VA7A 3RKXA 4EMKB 1LVKA 2D0TA 3G1JA 1UB4A 2CHOA 3V8LA 5FYMA 4M7AA 3M3ZB 1M2VA 4YT0A 1M3BA 2LOSA 2K5FA 2CBJA 4DR1T 2DF6A 5BMVE 1NEBA 3G71A 2MPKA 4HWDA 2ACXA 3G6EQ 1JXOA 4X66T 1XZYA 1PM3A 1WA7A 3ZL7C 1NPPA 2AE9A 3QUJA 1VYTA 4BE0A 2OLTA 3EGXB 4LDYA 2J06A 3GIBA 1SE7A 4KHPT 1N9SA 3BE3A 3KBUA 4CXXA 3RKYA 2V8JA 3C4XA 3FB9A 3EG9A 3FRNA 4IE7A 4JLEA 3B5MA 1VYUA 2DKGA 2EKOA 2JOYA 3KVAA 3P8HA 1VQ9Q 2CH4W 3DLLA 4DBQA 2DE0X 3TSWA 1X6GA 4R0KA 3AEFA 3MP6A 4HCKA 2DK3A 3OYHA 3EGUA 4LUDA 3ZMTB 2DJQA 4HGAA 5GMKl 2PVDB 3KVBA 4ZOLE 2EKHA 2CGHA 4BY6C 3CCVQ 5J0ZA 2W10A 4X1VA 4O8SA 2FZCB 3HKBE 5LGTB 3HFNA 1BKBA 2EYWA 5JDMA 2HQHA 1FJGT 2DCFA 3Q1JA 4HWIB 2MTQA 5L8RE 2X9WA 3OS5A 5GAN6 3MKDA 4AG2C 3VS3A 3VS7A 3FC3A 1XJWB 5HEOA 3CEYA 3OYEA 4M77G 2WP9A 1MMGA 4LF9T 2VWAA 2EJFA 3OYCA 2EQUA 2W00A 3OW2S 4M75E 3RYCE 1VQ5Q 2IUBA 5H6RB 3RIRA 4L59A 1OWAA 4KUMB 2EW3A 3JC6C 3CCQQ 3AEAA 3VRYA 4EZHA 2VXEA 5GAOn 5IHKA 1OX8A 1R77A 4LF5T 4F8HA 1K76A 1GCQC 1WQ7A 5CA0E 2EYZA 5GMKe 1VQ9A 1FWZA 4JI2T 4M78B 3RERA 1IGQA 5JREA 3H0IA 2QQAA 2WSCE 2PZ1A 4AQFA 1XDOA 3CPZA 4H9PC 4GBQA 2H89A 2J6OA 3CCVA 1Q81U 3CBMA 4ERRA 3L3PA 4QHOA 1RLPC 2QQBA 5LGNB 1VQKT 5LJ3h 3RIUC 1K9MR 2HH7A 1KJWA 2VV5A 5AFUL 4MZTA 1GBRA 2XQAA 4O4LE 4E2FB 2H3RA 4UXNB 4F16A 2F2XA 5AQVB 3PV0F 4M77C 2D1XA 3RBBB 2VXFA 2R57A 4MDWA 4IKFA 2LKHA 2XM1A 3OYMA 4JEHB 2MMPA 2DWKA 4JUVA 4OGEA 1PG5B 1N5ZA 1N9RA 4M78F 2DRMA 1VQ5A 2IC6A 2EHOC 2IIMA 2MOZA 3OKQA 3CCQA 4E6RA 3AE4A 1IHVA 4GYSA 4HFHA 3GOXA 4PJMA 3NWIA 3SFDA 1C1AA 2X9YA 4JZ3A 4RTVA 4TNVA 3AE5A 1KC8U 3RIUA 4JDSA 2RHXA 5JR9C 1VQ7T 3O9XA 1I6ZA 4TWDA 2RPAA 3AA7B 3LH0A 3JAME 2V26A 4U3CA 4J6YA 5AQJB 3H41A 1WHMA 4IGUA 3RHWA 1N32T 3HRTA 2QI2A 4C8QG 1Y96B 4YTNA 3INZA 2EHOA 4CC4B 3LJCA 2R5AA 2E8IA 1Y07A 3N2GE 1ZV4X 1NM7A 2V7IA 5AQOB 3OB9A 3HPWA 1X43A 1MV0B 4HVUA 3RC8A 2HNIA 4U7YA 1XMQT 2JMAA 1VQNA 3RX6A 3HFOA 2K48A 5LBQB 4MZPA 2JQKA 5LBMA 3G4SQ 3GA8A 2QK0A 2LKGA 1CKAA 1RAAB 1X6BA 3NTIA 4F04B 3BQLA 4M75B 3PVLA 2P0KA 1NEKA 2LP5A 3NMZC 5CQYA 3L2QA 4JJCA 5LJ3e 5GAMd 4NUUA 5LCYA 4UV8B 2D9TA 2COWA 2DTIA 5FY0A 4ASKA 2FUPA 3CCET 3LK3B 3BQKA 4KGZB 1K73C 4P1NA 2WBLA 2LTOA 2MF2A 1V1CA 3V7RA 1XQHA 2M1HA 5ECAA 4M7AE 3TLSA 1IB8A 2NUPB 2X9XA 1TS9A 2C5IT 3RRWA 5LNKA 1RI0A 2N1GA 5L3BB 2WB5A 2WACA 1IRXA 4KUDK 2OA5A 1YWPA 2KAFA 2R6GF 2GGRA 3WAJA 2GQIA 3ZJ2A 4L0RA 1OQKA 2O01E 3SFMA 2D8JA 5GAMh 2CMRA 4M75F 4GLMA 4II1A 5JDHA 2KWHA 1UGSB 4IDPA 5GAOp 2HQEA 3OJAA 1KF6A 3OYNA 1Q81R 4AFUC 5FLXE 1M62A 3G4SA 4IHJE 2BKDN 2CXDA 4MHCA 4A56A 4AFZC 5GAOq 3M53A 3N9QA 3OYFA 2RPNA 2AKLA 4XTXA 3K3QC 5GAN5 3CWZB 2EPDA 2CPTA 2ZM8A 1VQLT 1ZBJA 4N78D 1QW1A 4IT4A 2X0LB 1N6AA 5J2UE 2V7MA 2GQVA 3X25B 5JDQA 2QRXA 3QZ5B 3RESA 1UGQB 2F2WA 2BVLA 2RJDA 3N9MA 1XNRT 2PBIA 4DUYT 1ZSZB 3TQ7P 2JUFA 3VS4A 2KSSA 4BDZA 4L9IA 3RDVA 2Q9QC 5FWBA 3L2WA 1BU1A 3S3MA 2PVOB 3E1SA 3T1HT 4RG8A 2H3JA 4CC3A 4ISTA 1HXDA 2M6BA 1U1TA 3AE1A 2O4XA 2RQWA 2NP9A 1ZSGA 3M5AA 1NE8A 2V1QA 4HFBA 1VQ4Q 4A4EA 2O9VA 2R5MA 5GAMf 1B7TA 2ZPGB 2A3DA 1X79A 1PRLC 3H0HA 4M4ZA 4N0AC 4VUBA 4M7DE 3DB4A 2H8HA 3L2VA 3BDUA 4X9DA 3O5ZA 1NZ9A 3V8JA 4A63B 1M8VA 1XTDA 2E10A 4WCIA 1QWFA 4L6V5 4IE6A 4LF7T 5CKEA 3NFCA 4TVRA 4J2CA 2BKNA 2IC9A 4ILUA 2DPPB 2GTOA 3CC4Q 2Q9QA 3H3MA 4J9BA 1AWWA 4OK0A 2XSAA 3JCMd 1HD3A 1WI7A 5FKYA 4LF8T 2DL7A 3PT9A 3GF5A 4V2SA 2WWUA 2XDDA 2WMOA 4BE2A 4LMKA 1Q82U 2B76A 4EMKC 4PKCC 2AIRB 1VQ8Q 4LFCT 2W66A 2YRVA 3ZC0A 3CVRA 4J7IA 4N0AA 2E9XD 4PJOC 5J3BA 3K8PC 3PUYF 3EFSA 2JQ9A 3LH5A 2KEAA 3AEEA 4EZ4A 3L2ZA 3FXEB 3Q9DA 1M2VB 4FT4A 5JRCA 5GANg 4FI5A 1XOVA 2QA4A 1E7OA 3R6OA 4AFSC 1VQ4A 2DD4A 3ER0A 3JCMh 4FL6A 2D0NA 5GJWB 2HQXA 1RACB 1SSFA 1D3BA 3C98B 1B34A 1WNLA 1QLYA 4C5GA 2ES0A 1KQ2A 4EMKA 3Q5XA 2DIQA 4XBFB 3HR0A 1NEGA 2XDPA 2ENMA 2A28A 4C91A 2QQ9A 3CC4A 2BKPA 3CCLT 3ABVA 1JJ2S 1UGRB 4PJOA 2C5KT 2CUBA 4ME7A 4COFA 1IBKT 3FBLA 2K24A 4H9SE 2KLQA 4AT1B 2MYSA 1VQ8A 5FMNA 2RK1A 3MHXA 5L3FB 1YITA 2X0YA 1S72A 1BCOA 1UTIA 4JI7T 2JM8A 3DKMA 1Q86U 2YLCA 4NXMT 2K57A 1O75A 3A8MB 1QLBA 3RMSA 4LMLA 3J80E 2KT8A 3CC7Q 3C4SA 2FYKA 2NR4A 2DAQA 3P4SA 5DLOA 2X66A 3H8ZA 1SG5A 2AKKA 4YHJA 3EG3A 3C94A 2NTXA 3JCMf 3OS2A 4IL4A 1NLOC 3RQUA 2W67A 1Z8UA 1XNIA 2HBPA 4J9GA 4Y91A 2XTLA 2K5BB 3O4XE 3TU4K 3PIPA 1X2KA 1GL5A 2L3QA 3EDVA 4DV5T 1KQSP 4ZZBA 5EZYE 1VCSA 3A5ZB 3VUZA 5KYNA 4BAYB 3AEDA 4QQ6A 4O4HE 5IUXA 2N2NA 2ZCFB 4QVDA 1OEDC 2ODVA 2JXBA 3M0UA 4JJNK 4IREA 1K9MC 4K0KT 2P9BA 4BY6B 4X20E 3FJPA 3QNUA 4PK6A 3BK9A 5I11A 4D8KA 3SFEA 5LJ5g 3KDSE 2BVMA 1YNZA 1VQPT 4MFRA 1OZ3A 4HN9A 3CC7A 1OV3A 1IBMT 2L3LA 1BYMA 4ZI7E 4ZI2D 3MP1A 4Z90A 3LWIA 4QH5A 3JCMP 3WVDB 4QQDA 2HHHT 2DWGA 1I94T 1WCRA 3AT1B 2YRDA 5CA1E 2NTYA 1OEDA 3C64A 1EZ3A 1HFAA 4MMKA 1DU2A 3LYIA 2DO3A 4EYYR 2ZM0A 3HRSA 2M02A 1DJ7B 3JCMb 2CP5A 3CQXC 1PD0A 3I0QA 3M57A 4JRIA 4KUIA 2P4RA 3JCMQ 1TOVA 4OF1A 4B3TT 5HCJA 1ZQ1A 4PNOA 1V29B 1OXZA 1M3CA 1RAHB 3IHRA 4KMCA 4J7FA 4CI2B 1WJSA 2DEUA 3RQWA 2MAMA 1KQSA 3AA1B 2ROTA 2BG9E 4OB2B 4U72A 4X64T 1GQEA 1ZHCA 3N2KE 4Y92A 5KE3A 4M77B 1FEWA 4C0ZA 3MXZA 4CI1B 4OMNA 5A0DA 2DTOA 5LP6E 2EHOB 3P8DA 3VUBA 1SUMB 1YD8G 3QB5K 2HDAA 5CKBA 2ED0A 3JCMg 3M58A 1Q86R 3VS6A 2KQWA 3I55Q 1IBLT 2LEHA 2X4YA 1Y57A 4E7HA 3CCJA 4B9WA 4M7DD 2C0OA 2FEIA 5D6WA 1BK2A 1LVFA 1Y96A 4XK8E 2E2AA 1KFZA 5JR9B 1OZ2A 3ZCIA 2PJQA 3L42A 1X75C 3PUXF 3VS1A 1WFDA 4FM4B 2DX1A 4M77F 1ABOA 1YJNQ 2A9UA 5J39A 4F7UG 4RTTA 4A4FA 4M1PA 4A97A 2JN0A 2VASA 2Y8DA 1Q81C 3CCUQ 1PKTA 3VU7H 2CE7A 3ZYLA 2M67A 5BR8T 1G83A 1I1JA 1M8MA 1T98A 3JB9J 2PFVA 3ZMVB 1LPLA 1W1FA 4JPBW 5CQXA 2XQ9A 4GOUA 2P0PA 1V76A 4P5NA 5FWCA 5HY6A 4JRKA 5DLQE 3PJAA 5ADXL 3OYAA 2W61A 2E5QA 3I55A 4FYYB 3AXJA 4AKGA 4FJOA 3D0TA 4O2AE 3RLFF 3CMET 3KXTA 4RTZA 4YTLA 3AVSA 1NYFA 1KK7A 4K0UA 4C92D 4EV6A 3O8VA 3SS1A 2XDBA 4JJBA 1TSFA 3DP7A 4PJOE 1S35A 2ZPIB 3OYYA 3KINB 2XAJB 1K1ZA 2VKNA 4JRPA 3C4WA 1YJNA 4IIMA 4DV3T 1ZP0A 4LMJA 4GKKT 2W2UA 5H6QB 3JB9H 4QXHB 1M4ZA 2LZ6B 4G2AA 2V5DA 2K2MA 3OMCA 3AE2A 3UA6A 3CCUA 5KE2A 1NG2A 3DB3A 4ZN1A 1R0CB 4H9QC 1E1HB 3I9QA 1HNXT 3ZMZB 4PJNA 3BQIA 3VV0A 2KRNA 2K5IA 1UEBA 4I55E 1WGSA 4YSYA 1VCTA 4RMOA 3CCRA 2WS3A 2V6YA 1RAGB 5IHNA 3JSCA 2IW5B 3QKJA 2DVJA 5DQWA 2UXXB 2EIFA 2V8IA 2C0SA 3ZLIA 3ZEHA 2X68A 1H7CA 3ZT7A 2DZ9A 2HN2A 2RQRA 1YIJQ 1QVFP 4V1Av 4AKLA 2C0TA 4BDYA 2XSBA 1RAEB 2X67A 2DNXA 2KT9A 1PWTA 3PU3A 2WU2A 5L4HA 4LDVA 2YUPA 4X1IE 3FIFA 4J9IA 2L89A 2VGNA 1K0SA 1HCIA 2Q9QB 2HN1A 2WY2A 3PDYA 1JRIA 1IZ6A 2ZAEA 3CQGB 4FU6A 3Q2MA 2BKOA 3EUHA 2J7IA 3M55A 3TLWA 2BBJA 2BE9B 1WXBA 3FDRA 2F4VT 4HVWA 2XD0A 1G5VA 3QB5A 5LMUT 1H8KA 1TTHB 2PUOB 2O88A 2I2LA 4F17A 3E22E 2XQ7A 2EVRA 3PU8A 3CX8B 1K8AR 2OTLA 4YLHA 1I81A 4JZ4A 1OEDE 2XG8D 5JRCB 2ZPEB 4DQ2A 3O1JA 1KD1U 1J3TA 3UUXB 1UX4A 3LW5E 4DO0A 5CO7A 3KFWX 1YIJA 3EVYA 2EJ9A 1D3BB 8AT1B 4QKNA 3M4YA 2E5VA 3KV4A 1B34B 1M2OA 4ZGJB 4I50E 3P4RA 4CXYA 2JM9A 2X51A 3B13A 3NZQA 1VIEA 2DJZA 4C0FA 3HA4A 3X20B 2DRKA 4ZNXA 4FYWB 1VQMT 2OTJT 2VB6A 2DFUA 2LLYA 4HFIA 1RABB 5GMKh 3AAEB 4PJOB 4DV6T 2KGTA 5AQPB 2F1LA 3VS2A 2FL7A 5GAN3 5FVLA 2M9UA 2EGAA 1QVFA 4DR2T 4A4KA 1MNEA 2KR3A 3SHWA 3FBZA 2M51A 2DL3A 2EQJA 3MPUB 2FBWA 2LT3A 3CPFA 5CCAA 2LSYA 1IAPA 3P8CD 2COYA 2X4WA 3ZFJA 2LT4A 2NW9A 3M9QA 3PIOA 1YJ9T 4RTYA 3QSUA 2RI2A 4KGVB 1MIYA 1Z9ZA 1IJ6A 3LGLA 4LDXA 2JZ2A 2OX7A 2QGSA 4HXJA 5GMKi 3OW2P 4DV0T 2RP4A 4LFAT 4ZGDB 2HSPA 4PJOF 1BR2A 1AD5A 2LHRA 3RIAA 3CCMQ 1N34T 3UWNA 2QDLA 4AQYT 4HKAA 4P0AA 4LUEA 4IUPA 4ZXLA 3WAKA 3ZN0B 1QWEA 1GXIE 2IG0A 2I59A 2PG8A 2FJAA 3HP9A 3G6EA 3G06A 4YJ3E 4ZZCA 3CCSQ 5GANj 2QTXA 2YU2A 4XTZA 1M1FA 3I5SA 1EX4A 3I1AA 1QUUA 2C0IA 2LX7A 4C92G 2RH2A 5LJMA 4UC4A 4ILCA 5A1LA 2LX9A 4AQGA 1RUWA 3A1PA 3DTOA 4PFOA 2QVAA 4C5IA 2QEXQ 5LJ3d 2H88A 4LN2A 1YJWQ 4AI6A 4HT8A 2YLBA 2XHEB 2L3PA 4NL2A 1WR6A 4XQ3A 1WRDA 2HEQA 1YI2Q 3C50A 3NGPA 4IE0A 5FU6C 1OEDB 1S94A 1ZUYA 3HTRA 1SHGA 4DBHA 4X1YE 3LGFA 5IAYA 4X62T 3CCMA 4KH1B 4J9EA 5GJVB 1VQ6T 5CJ5A 2H3EB 3WVEB 2MPXC 5AQNB 4BUGA 1WXTA 3P7IA 1W4SA 2KY9A 2K4YA 2LCLA 2BE7D 5A2QE 1PNJA 1X2QA 3I56T 3KV9A 5JDGA 1KD1R 4AG1C 1OEBA 2E5KA 2YXYA 2O2OA 3CCSA 4LNPA 1E6GA 2DHRA 2B86A 3OW2A 3AB3B 2HSEB 3ZT6A 1Q86C 4UR9A 4XTUA 4C92C 3L2RA 3EHZA 4MMLA 4TN7B 2YRCA 2K2VA 1GCQA 3GN5B 3Q5DA 3LBXA 3CC2Q 1ARKA 4FSSA 2BS4A 2O31A 4HA8A 4XZCA 2VL0A 5FXVA 1AWJA 2ODUA 1PSEA 2QEXA 3FXDB 2RJEA 5HKCA 1HNZT 2PTFA 2JTMA 1YJWA 3Q5EA 1TUCA 2MWPA 4U31A 2IAKA 2K3WA 3EAEA 4D8DA 1YI2A 3ONXA 4BI4A 3UT1A 3VKGA 3EHRA 1ABQA 3E19A 2DD5A 1NAFA 2JMHA 4IE5A 1HX8A 1W9RA 4J9CA 2K3BA 3CMAQ 3LDQB 5CAIA 1T7SA 2J62A 2LNVA 1IHWA 5LJ5j 5GAOl 4DIDB 3UPUA 4M77A 2CP0A 5AQKB 2X4XA 1OI1A 2LHNA 2EQKA 1PC0A 2N9DA 1S1NA 3IEEA 2MAWA 4GYRA 1N8RU 2RQUA 2XASB 1OPLA 4CXWA 5LJ3f 4NL3A 2LSIA 2OJ2A 4OMPA 3PMTA 1UX5A 3OYDA 3UDCA 4JV5T 3CC2A 3E0ZA 4DV1T 2QAZA 4YTMA 3AE6A 2BZBA 1ZA1B 2WAUA 4ZTFA 2VC8A 3TLVA 1WHKA 3CMEQ 5JR9A 3S3NA 3SWNC 4B6XA 3MJXA 1U5SA 2RD1A 4JRQA 3JCMJ 2AZSA 4XU2A 3OA6A 1QP3A 1FMWA 2CWOA 2CZ0B 2KXCA 3C0CA 4ISSA 3GNGA 3OS1A 2G3RA 2CYZB 2D5UA 2JMCA 2WZIA 3PGGA 4M78D 3CMAA 5AQUB 1IZNB 2XM2A 9ATCB 3AXJB 3UU6A 2RQTA 2F5TX 1YKEB 4KBMB 2H7VC 4C8QC 1MNDA 5HK0A 3MK7C 3S3OA 1U5PA 3TEEA 3ZSTA 3GPLA 3PUGA 4HFVA 4YSXA 1AEYA 3QIIA 3K1SA 4HCZA 3VJPA 3X26B 1PSFA 3THKA 2J1DG 1OU9A 4UVBB 5IXBA 3E08A 1WFWA 2ZGWA 3PJAJ 1N36T 4OGCA 3ZT5A 1YCSB 3TREA 5GMKm 4IIOA 2E9XB 5C0MA 2E70A 1UGVA 2V8SV 5CR2A 4KX6A 3QO3A 2RMOA 2KYBA 4J5YA 4C8QA 2LQWA 1AVZC 3UULA 1QCOA 4KRTA 1BB9A 3AECA 2JS2A 2V6YB 3HKEE 3V8KA 3CD6T 2PQWA 2A7YA 4OMLA 3CMLA 4C0GA 1ZEEA 3N5LA 1VQOT 2JIWA 5KCOA 3JCMW 2VKHA 5DM7R 1JNRA 4NOYA 4WF2A 4BJNA 2CZ6B 7AT1B 3M59A 1K8AC 4H9NC 5GANe 4U74A 5JVDE 1KC8R 5LJ3g 1XWMA 1BI2A 5HXEA 2L5QA 5IN1A 5KX5E 4FW2A 3AHUA 4J9DA 2EFIA 1UGPB 3VR9A 3NTKA 4E7LA 2LSJA 5I22A 2I6HA 2DVEA 2RHUA 1HSQA 2LOPA 2YKSA 1WXUA 5HWYA 2KSRA 3FZMB 1LCKA 2D0QB 4M75D 5KMGP 2NUZA 1HG2A 3NZPA 4WBNE 3OSSC 4EMGA 4JS5A 4XTVA 3TCJA 2HD0A 5AYFA 3WI3A 1W6XA 4U2YA 1AWXA 3JCMV 4A5XA 3UFGA 4PJLA 3L1AA 3C4ZA 2EYXA 2EQMA 1JJ2P 1K4US 2KE9A 4ELZC 3HKDE 1YHQT 2FZKB 3CQCB 2HPJA 3FZHB 1U4QA 5EK2A 3UU8A 3OMGA 2I0MA 3EG2A 1T3SA 3M65A 4A98A 5FY1A 2CDTA 2BIVA 4EIWA 2BS2A 1T0HA 1TH7A 5KYUA 2JS0A 4U7IA 2PTKA 2QG9B 3W15B 2MWOA 5FVKA 4EDUA 2XK0A 5JDFA 1D09B 2HMAA 4IDZA 3VRZA 1LNXA 4BB7A 2UXBT 1U3OA 3QK6A 3R6NA 2A0FB 4JI1T 2L3RA 4IUVA 2YN6A 2DZCA 3G71T 3PUVF 3OBVE 4DOVA 2IHR1 4H9RC 2BZYA 1D0YA 4HWHA 3M0PA 4EXTA 3JV3A 3QG1A 2WSFE 1AOJA 2HKQB 1WLXA 4AMCA 1QQJA 1ZKEA 3UUNA 5LJ5e 4JS4A 4HFCA 3ETVA 3ZYMA 4M77E 2D8HA 5DQVA 3OS0A 3LK42 4I4TE 3IQLA 4WTOB 3AEBA 2DTHA 2KMFA 5FRMA 3OYLA 5CKFA 5AQQB 1H3HA 4DEYA 2PNIA 3RYIE 4YY3T 4M78G 2V7KA 2DLRA 1O9SA 5KYYB 1D1CA 2HAXA 3H9NA 4IDOA 4QVZA 4DR5T 5GAMg 2DL5A 1R8IA 4O4JE 4UV9B 3JCFA 5J2TE 4QT7A 5GAN4 1JJ2A 3J7Yq 2VVSA 1US7B 3REAB 1FMKA 1CHUA 2AT1B 1HTJF 1O3XA 4DR6T 2KWIB 4JI3T 3G7ZA 4Z88A 1AWOA 2XPKA 4I0UA 1GRIA 1KD1C 2YDSA 3RH3A 4DBFA 4EMHA 1W09A 2CBIA 2YINA 2ZM2A 4UIGA 4Z8XA 2CT4A 2L8DA 4XU0A 1Z0PA 1VQKQ 2JT4A 4X34A 4Z89A 4MLKA 2V8KA 3LFMA 4C5EA 2ATCB 2CP6A 2K5LA 2WSEE 2YHTA 2LCSA 3OYBA 1ZHIA 1YKHB 1JQQA 4IDQA 4QKUA 4GKJT 2J6KA 3X24B 5HEUA 1W70A 4DVDA 4DNDA 2AXDS 3L39A 4BA9A 3UU3A 2O9SA 5GAOr 3HSBA 1X69A 3EH2A 3ZSSA 4M7AD 5AT1B 3MCAB 1GFCA 1M27C 1Q82R 3FZKB 1VQ9T 4TWHA 2HL3A 2XHCA 3JADA 3SEMA 4E7ZA 4OMOA 1ZUUA 2QA7A 3EH1A 2LQ8A 3EFOA 4IE4A 4HVVA 2A3LA 5ABFB 1QSDA 2COZA 3LBXB 2DI4A 4CN6A 2MOXA 3CCVT 1VQ7Q 5FU6B 1RI9A 4LD6A 3V7CA 2CHNA 2JRKA 4ZI3D 3B57A 4TNWA 2E3IA 4DUZT 4C8QE 4IDNA 1YN8A 5KYWA 2UXNB 1Y7XA 3A7MA 1VQKA 4ZHQE 4BI3A 2ED1A 5CKHA 4Z02A 2RHIA 1C6VX 2VQET 2FJDA 2ABLA 1UG1A 2IIUA 3GN5A 5ABEA 1AZGB 1QKXA 1RL2A 4HCCA 2LQNA 3PUAA 2QQSA 3KV5A 1VQ5T 4M75G 1YXRA 2JPFA 5IH2A 1TWBA 4U2ZA 4C92B 3CCQT 3P50A 2KYMA 2E41A 2JQHA 2LJLA 2RQVA 2XAHB 4PJJA 3RKOA 4DR7T 4AKHA 4I43B 3S4UA 3L8RA 2DIGA 2FRWA 1HJDA 3ME9A 3QC9A 2VL8A 3JB9I 3A5XA 1WYXA 3OYIA 2J4GA 3PUQA 2RI5A 1MGQA 1VQ7A 3CCEQ 4ZN3A 4E47A 2YEVC 5AQLB 1TG0A 1KNRA 4G63A 4GK5E 4N4HA 2QXFA 3QZ9B 4OMQA 3MEAA 4RUGA 2FB7A 3AA0B 2KZ7B 4X5TA 1UE9A 2C5JA 1LKXA 2SEMA 2LVMA 3VKIA 3JCMc 4CRIA 4C92F 2ESWA 2K79A 2EGEA 1H3ZA 5HAXA 5KDMC 2X3WD 2CEAA 4YSZA 2CKKA 3HL6A 5C8YE 2LJ3A 3HRUA 2JTEA 2J05A 1VQNT 3JAFA 4PLLA 2KRMA 3ETUA 5IHYA 2F2VA 2EYYA 5LJNA 5IHIA 2IMLA 4GK0E 5L3GB 2CSIA 1BIBA 2WMNA 2L2PA 4B9XA 1WZOA 4JUYA 3PUSA 2KXPB 1E2AA 1VQLQ 1OULA 1G3WA 2X35A 1Y01A 3GLXA 1Y64B 1X01A 1RAIB 3SWNB 3JC6D 3PVQA 1MV3A 3PMIA 4KI0F 2E9XC 5KXJA 2QGGA 1NLPC 3M56A 3CCEA 3F57A 1JO8A 1KNPA 1QCFA 5FP3A 5GAN2 2BZ8A 5A0LA 4N4IA 3JAEA 5TAOA 5FNVE 2JMKA 2RB6A 1BBZA 2D2SA 2YK0A 3OBWA 1W0AA 2DERA 4HWCA 4OFZA 3AE7A 1GFDA 4JBWF 5FL1A 1QVGS 3TLTA 2K3XA 5CVIA 3N9NA 3CKDA 1I8FA 1KC8C 2AZVA 5HXHA 3N9LA 2LE8A 4EEBA 5LYJE 3RMQA 4C8QB 4XU3A 3BDLA 1ZOYA 4LF6T 2ZMAA 4KHZF 3U23A 3OTOT 2I0NA 3MEVA 2DL8A 4CZZB 1X27A 4LD9K 3G4ST 1UK5A 2E9XA 3QHSA 1MUZA 4OYKA 2DETA 5L2LA 3ASKA 1R0BG 5EK4A 4CI0C 1VQLA 4AXPA 2E1HA 2EHOD 1Y71A 2KI7A 3SD4A 3CX6B 1L0VA 4MALA 2FVUA 1KG1A 2Y48B 4EGWA 1HNWT 3OYZA 1IREB 3F70A 4F7UA 2XY8B 3RF1A 5EG2A 3UF4A 1B07A 2DILA 4C8QF 2Z0WA 3UTKA 4QX7B 3JB9D 2HL5C 4M7AG 4OMMA 1MMNA 3RRCA 4DBRA 3P8BB 2KBTA 1IJ5A 2CZ7B 2DYBA 1UUSA 2JNGA 4B6MA 4KGXB 1YHQQ 2LDMA 3ESLA 5D6YA 2QTVA 1YP5A 5IWAT 4GLKA 2NWBA 2XAQB 3X28B 4F14A 2BUDA 4ANJA 1X9BA 4EYUA 2WDQA 4LXCA 2MCNA 4PL6A 2W0GA 2QASA 3UATA 1W2BS 2RA1A 4WYVA 1OU8A 5FXZA 1YCYA 2RNAA 3PTRB 1BI3A 3LSVA 2KXDA 3QWXX 1CKBA 2W63A 4A4GA 3SDZA 3VHLA 1XNQT 2WM9A 2CREA 3NVOA 1WX6A 4X1KE 3CCLQ 4ZEYA 2VKDA 8ATCB 2GK9A 1J5ET 1MIWA 1UCUA 2A36A 2JQQA 3GNFB 5KYUB 4ZGEB 5FXXA 4ZI2C 3RUXA 4FIBA 4EIKA 2BS3A 5LA6E 2J47A 5DY9A 3QOFA 1D1AA 3VYHB 2UXDT 2DNUA 4DMWA 1UURA 3VS0A 2VURA 1Q7YU 2QA4T 1VQ4T 1TXQA 4CN1A 2SRCA 5I2MA 1WDXA 2F5KA 2JVVA 3PUZF 4GY5A 2HBWA 1K9AA 3QDFA 4M7DG 2E5LT 2WDRA 3UU5A 3V5SA 2JW4A 4ZI3C 3QDRB 5I21A 3O1IA 4KULA 3REBB 2BDEA 1CUNA 3V7SA 3AA6B 1YBYA 2WU5A 1I5LA 1VYVA 2LM9A 4XU1A 4A4HA 3CC4T 3QYHB 2E6ZA 1RADB 3F31A 1NJIU 5LMNT 2LJ1A 1AT1B 1HX1B 3Q5WA 4OB3B 3CCLA 2XQ8A 2HZYA 3RYHE 2RA2A 3A8LB 4KH0B 1VQ8T 5L4EA 4XTWA 1SA0E 1YITT 2MBGA 1EZZB 1G3SA 2GFAA 4QQGA 1S72T 4FYVB 3FLGA 2HPLA 3LLRA 1G3TA 3H6ZA 4DEXA 5C3JA 3EGDA 2CLYC 1KSWA 2QQRA 3FHNA 1VQPQ 2LRLA 3IA3A 3CXCP 3P4PA 3AVRA 2XQYA 2PUKB 4QW2A 2UUCT 5KYYA 1IGUA 4WBOA 4PFPA 2YUNA 1Q82C 2Q9QD 2OAWA 3ZYKA 2W62A 2ZPFB 3WXMB 1XDPA 4LFBT 3KFVA 2CT3A 3EAMA 2A72A 4M7DC 5EK3A 2B8AA 2DEQA 3I0OA 5CKDA 5ETWA 4Q5WA 3L2UA 2L0AA 5L3DB 2XQ4A 3AE8A 2Y6XA 5F3JA 2P4TA 5E0OA 4NS5A 4TV9E 2UXCT 1M3AA 1PKSA 5GAN7 3EHQA 3ONJA 4HE8A 5ABHA 2D9DA 2GBQA 2V5CA 3RC3A 1YWOA 3K3NA 4X9CA 2JJ9A 2RJFA 1H641 4C0DC 1Q95G 1P92A 5JTGA 2XU8A 4AQFC 2FRYA 3CXCS 3VRBA 5L3CB 3RIFA 1FXXA 4K11A 3E2UA 2Y4XA 1CSKA 1AHJB 4NUVA 1U06A 2EBPA 3EFOB 4ESRA 4M7DA 2RF0A 4H9OC 3FB2A 3CC7T 1VQPA 2LM2A 5FY7A 4C90A 4YFSA 3KBGA 2KDSA 4IUUA 4R55A 5HXCA 5AQSB 2FPFA 4LE9A 3CK6A 1JXMA 4RTXA 4DR3T 2IDOB 4QX8B 3QJYA 3NKZA 5KYWB 1FIOA 4PJOD 4CC7A 5FL0A 4ZS2A 4EEDA 4Q25A 3MA9A 3JB9G 2NW8A 2YDLA 1Y0MA 5GAMj 5ABFA 2KROA 5L47A 2XAGB 1Q7YR 3V5UA 2LJ0A 2NYSA 1M1KU 3CXCA 1KHCA 1PHTA 2XI9A 1E6HA 4YXDA 1SKUB 4DOWA 1UJ0A 2XJ7A 3GWHA 1X6OA 2DXBA 2FPEA 2ROLA 4FSXA 4F7UE 2GNCA 2VKJA 4LF4T 1JBMA 1Z9QA 1NPRA 2W0ZA 2CRBA 2PU9B 1VQNQ 3K3OA 3GBQA 3NPFA 4C92A 2Z6EA 4IURA 4HWFA 1NJIR 4QVCA 4ATOA 2XMFA 3HL8A 3QPHA 2NUTA 2RJCA 2ZPBB 1WYBA 2ZLYA 2DBMA 5C2TA 5GANd 1YQ4A 4UVAB 5GONE 1FYNA 2KK4A
chains in the Genus database with same CATH topology
1ZBXA 1M90U 1M1GA 4KP3C 2VUBA 4FT2A 4UF0A 3UFEA 2YU1A 1FX7A 2P0QA 1SHZC 1KHIA 2ZPHB 3UUMA 3ZC1A 3CCJT 3BFMA 2RHYA 3T8OA 4EAHA 4D6WA 4BJMA 5LOVE 4JLGA 1JB0E 4Y28E 1G73A 5JDLA 2RI3A 2PVGB 3MP8A 3OSVA 5GANh 3KBTA 3TKLB 1WQWA 3OYGA 3SWHA 2CWYA 4EOZB 3KV6A 3QYGB 3LK2B 4L5GA 4H63H 1EIFA 3SB2A 3VYGA 3J81E 2V7LA 1I4K1 4DMVA 3O1HA 1V9DA 2DXUA 3M54A 4OVAA 5HXSA 4RCCA 2Y90A 5J1GA 3SWNA 5LGUB 3ANWA 3I55T 1WYCA 2JTFA 2GF7A 2LQKA 5LHGB 3NRXA 1LRZA 1WPYA 3CMEA 1WJQA 2LC4A 1N27A 1HG5A 4PAGA 3SRZA 5IYZE 4MZMA 5FU7C 1YJNT 4C5HA 5GANf 4DA4A 4PW8A 5LJ5d 4OMFB 1U8RA 3ZCJA 2H7OA 3CCUT 1NWMX 4F7UB 1LJOA 3ZN1B 3C95A 3EDUA 1M5Q1 4ZTJA 3CCRT 5GAN8 4AKRB 2CM0A 3DJBA 2WSSV 4H63V 3H3AA 5F8PA 5LJ5h 3OY9A 3VKHA 3A8OB 4OYJA 3NTHA 3PURA 3J7AF 3C12A 3BW1A 4F7UF 4PJOG 3MACA 4HCBA 5D6XA 3IBPA 3HI2A 4BE1A 1U1SA 1VIFA 3KUFA 1BIAA 3CPWS 3L09A 4JLIA 4XAXB 3OQ5A 1MMDA 2A2FX 3FEOA 3UT5E 2E64A 4O6JA 2VK9A 5CIUA 2EYQA 3RYFE 2RO0A 3AAIA 2OTLT 4BI8B 2DXTA 3LWHA 3SOLA 4PK5A 4HEAA 5GAMe 1YIJT 2V7JA 5LJ5f 1VRBA 4J6XA 5GAOm 1D1BA 3QJ6A 2LRQA 4O2BE 1BR4A 3CPWA 1YW0A 4M7AB 2CCQA 1VQMA 2OTJA 3ZMSB 4HKEA 2RHZA 4PLIA 4C92E 2XKOC 2KNDA 2QDYB 5JQGE 2X4JA 5C6SA 4QXCB 5CK9A 3JRZA 2IVWA 1YJ9A 1HK9A 4EPCA 3HKSA 1HS7A 4M7AF 1KNZA 4ADZA 5DABA 2E12A 2VYTA 3NRYA 5LXTE 3U3IA 3T9NA 4WNKA 3H37A 3LX7A 3S6WA 4QWNB 3ZEFB 3G6ET 4IUTA 5DJQC 2XUEA 2CLYB 4UVCB 5A0GA 4E7JA 1VUBA 2RK2A 5LL6S 3J9X1 4YJ2E 2CXLA 4WW0A 1Q7YC 4OB1B 4M7DB 2V1DB 4RG2A 1G3YA 4R56A 3CBOA 3IF8B 3MEWA 4M78C 2R58A 3OYKA 2E6NA 5HXRA 3A8GB 2AHJB 4J8OA 2GCXA 3JCMe 1D0XA 4C0DB 5I2SA 4E7SA 3CCMT 4UEMA 3PTAA 4TZ4C 4OHFA 3PFSA 1NJIC 1VQ6A 5FROA 4LDUA 5JH7E 4M7DF 3CCST 4P0BA 5LHHB 3I56A 1KQSS 1FMVA 3CBPA 2CA5A 4M78A 2EAYA 3HKCE 3QBYA 5IT9E 2K9AA 2NOXA 4E7IA 3DLMA 2D0UA 2QEXT 4IIJE 4A54A 1K73U 1YJWT 1QVPA 5HYAA 3MEUA 4A53A 1YI2T 4TV8E 2VGMA 1VOMA 4XTYA 4LDWA 4E7KA 4GIWA 4MDXA 2DXCA 4UF0B 4JEUB 4ELYC 1MHNA 2SPCA 3PNWC 3URGA 1LOJA 4J83A 1G8XA 4QXBB 5JDNA 2XIDA 1MIVA 2LSGA 2CZ1B 1M9SA 4P09A 1BI0A 2XICA 3N9OA 5FXWA 3E9GA 3CC2T 3PE0A 4RKUE 3C51A 3MZKB 4UELA 4M75C 3JCMX 5FRNA 1QP2A 2NLUA 3ZBDA 3I9YA 3I9WA 4OP0A 2L8KA 2CS7A 2CXFA 5M4YA 1WJRA 4N4GA 3QUIA 3CMAT 1MMAA 2MI6A 1K8AU 4HT9A 3ANWB 3ZPOA 4CI3B 2EJGA 2B1EA 1BI1A 3META 1M1KC 2K3YA 3R84B 4AKIA 5L3EB 4M75A 2GFUA 3OYJA 3U78A 3JB9F 2KVQG 1KQ1A 2M0OA 4BD3A 4J6WA 2XAFB 2FHDA 5GMKj 4ZS3A 2E65A 1AJ3A 2LCCA 3ZMUB 3N5BB 3RPUA 3GMIA 4PK4A 4TX5A 4O5VA 3A8HB 1N8RC 4M77D 5KH6A 5J26A 3AAAB 1M90C 3N9PA 3NBXX 1BR1A 3CX7B 2M16A 3LG7A 5LG4A 2D6FA 3CD6A 5FU7B 3ZJ1A 1QVGA 3F2EA 5M9OA 2KMTA 5LHIB 2F69A 3M4GA 1VQOA 4EB6E 2NW7A 3HHTB 2EWNA 4PNIA 4F6RC 3VU3C 2C06A 4TUYE 2O4XB 2Y4YA 4RCBA 2LT1A 3OYXA 2OAUA 4BACA 5CB4E 2LSKA 4CQIA 2X9HA 2ZZDA 1R8OB 3N2OA 3OBYA 3QXEB 2L9QA 4IUQA 2RM4A 4MBQA 5KCHA 2KINB 4M7AC 3BY7A 1HF8A 1YHQA 1QVFS 3E9FA 2G0UA 4HTEA 2VKOA 1OYXA 5HK3A 1W2BA 4M78E 4C8QD 4KT0E 5HWXA 3EFRA 3MO8A 5LJ3j 3RKWA 1K9MU 1BR0A 4OB0B 3GP8A 1D0ZA 4O4IE 3RKXA 4EMKB 1LVKA 2D0TA 1UB4A 3V8LA 5FYMA 4M7AA 2LOSA 2K5FA 5BMVE 3G71A 2ACXA 1NPPA 3QUJA 4BE0A 4LDYA 3GIBA 1N9SA 3KBUA 4CXXA 3RKYA 2V8JA 3C4XA 3FB9A 3FRNA 4IE7A 4JLEA 2DKGA 2EKOA 2JOYA 3KVAA 3P8HA 3DLLA 4DBQA 3MP6A 2DK3A 3OYHA 3ZMTB 4HGAA 5GMKl 2PVDB 3KVBA 4ZOLE 2CGHA 4BY6C 4O8SA 3HKBE 5LGTB 3HFNA 1BKBA 5JDMA 2DCFA 3Q1JA 2MTQA 5L8RE 2X9WA 3OS5A 5GAN6 3MKDA 3FC3A 3CEYA 3OYEA 4M77G 1MMGA 2VWAA 2EJFA 3OYCA 2EQUA 2W00A 3OW2S 4M75E 3RYCE 5H6RB 3RIRA 4L59A 1OWAA 4KUMB 3JC6C 4EZHA 2VXEA 5GAOn 1WQ7A 5CA0E 1VQ9A 5GMKe 1FWZA 4M78B 3RERA 5JREA 2QQAA 2WSCE 4AQFA 3CPZA 4H9PC 3CCVA 1Q81U 3CBMA 4ERRA 3L3PA 4QHOA 2QQBA 5LGNB 1VQKT 5LJ3h 2HH7A 2VV5A 5AFUL 4MZTA 4O4LE 2H3RA 4UXNB 4M77C 4IKFA 2VXFA 2R57A 4MDWA 3OYMA 4JEHB 2MMPA 2DWKA 4JUVA 4OGEA 1N9RA 4M78F 1VQ5A 2IC6A 2EHOC 2MOZA 3OKQA 3CCQA 4GYSA 3GOXA 4PJMA 2X9YA 1KC8U 4JDSA 2RHXA 5JR9C 1VQ7T 3O9XA 3JAME 3AA7B 3LH0A 2V26A 4J6YA 4IGUA 3HRTA 2QI2A 4C8QG 1Y96B 3INZA 2EHOA 3LJCA 2R5AA 2E8IA 1Y07A 3N2GE 1ZV4X 2V7IA 3OB9A 3HPWA 3RC8A 2HNIA 1VQNA 3RX6A 3HFOA 2K48A 5LBQB 4MZPA 5LBMA 3GA8A 3NTIA 3BQLA 4M75B 2P0KA 5CQYA 3L2QA 5LJ3e 5GAMd 4NUUA 5LCYA 4UV8B 2D9TA 2DTIA 5FY0A 4ASKA 3CCET 3LK3B 3BQKA 1K73C 2WBLA 2LTOA 2MF2A 3V7RA 1XQHA 2M1HA 4M7AE 2X9XA 2C5IT 3RRWA 5LNKA 1RI0A 2N1GA 5L3BB 2WACA 4KUDK 2OA5A 2KAFA 3WAJA 3ZJ2A 4L0RA 2O01E 3SFMA 5GAMh 2CMRA 4M75F 4II1A 5JDHA 2KWHA 1UGSB 5GAOp 2HQEA 3OJAA 3OYNA 5FLXE 3G4SA 4IHJE 2BKDN 2CXDA 4MHCA 4A56A 5GAOq 3M53A 3N9QA 3OYFA 4XTXA 3K3QC 5GAN5 3CWZB 1VQLT 2ZM8A 4N78D 1QW1A 2X0LB 1N6AA 5J2UE 2V7MA 2GQVA 3X25B 5JDQA 3QZ5B 3RESA 1UGQB 2RJDA 2BVLA 3N9MA 2PBIA 2JUFA 4BDZA 2KSSA 4L9IA 2Q9QC 3L2WA 3S3MA 2PVOB 3E1SA 4RG8A 2H3JA 4ISTA 1HXDA 1U1TA 2O4XA 2NP9A 3M5AA 1NE8A 4A4EA 2R5MA 5GAMf 1B7TA 2ZPGB 2A3DA 1X79A 4VUBA 4N0AC 4M7DE 3DB4A 3L2VA 3BDUA 4X9DA 1NZ9A 3V8JA 1M8VA 1XTDA 2E10A 4L6V5 4IE6A 5CKEA 3NFCA 4TVRA 4J2CA 2IC9A 4ILUA 2DPPB 2Q9QA 4OK0A 3JCMd 3PT9A 3GF5A 4V2SA 2WWUA 2XDDA 2WMOA 4BE2A 1Q82U 4EMKC 4PKCC 2YRVA 3ZC0A 3CVRA 4J7IA 4N0AA 2E9XD 4PJOC 5J3BA 3K8PC 3EFSA 4EZ4A 3L2ZA 3FXEB 3Q9DA 4FT4A 5JRCA 5GANg 4FI5A 1XOVA 2QA4A 3R6OA 1VQ4A 2DD4A 3ER0A 3JCMh 4FL6A 2HQXA 1SSFA 1D3BA 3C98B 1B34A 1WNLA 4C5GA 1KQ2A 2ES0A 4EMKA 3Q5XA 2DIQA 4XBFB 3HR0A 2XDPA 4C91A 2QQ9A 3CC4A 3CCLT 1JJ2S 1UGRB 4PJOA 2C5KT 4ME7A 3FBLA 2K24A 4H9SE 2KLQA 2MYSA 1VQ8A 5FMNA 2RK1A 3MHXA 5L3FB 1YITA 1S72A 3DKMA 1Q86U 2YLCA 2K57A 1O75A 3A8MB 3RMSA 3J80E 3C4SA 2FYKA 2DAQA 5DLOA 2X66A 3H8ZA 4YHJA 3C94A 2NTXA 3JCMf 3OS2A 1XNIA 2HBPA 4Y91A 2XTLA 2K5BB 3O4XE 3TU4K 3PIPA 3EDVA 5EZYE 3A5ZB 3VUZA 4BAYB 4QQ6A 4O4HE 2N2NA 2ZCFB 4QVDA 2ODVA 4JJNK 1K9MC 2P9BA 4BY6B 4X20E 3FJPA 4PK6A 3BK9A 5LJ5g 3KDSE 2BVMA 1VQPT 4MFRA 1OZ3A 4HN9A 3CC7A 2L3LA 1BYMA 4ZI7E 4ZI2D 3MP1A 3LWIA 3JCMP 3WVDB 4QQDA 2DWGA 2NTYA 5CA1E 3C64A 1EZ3A 1HFAA 4MMKA 3LYIA 2DO3A 4EYYR 2ZM0A 3HRSA 1DJ7B 3JCMb 3CQXC 3I0QA 3M57A 4JRIA 4KUIA 3JCMQ 4OF1A 1ZQ1A 4PNOA 1V29B 1OXZA 3IHRA 4KMCA 4J7FA 4CI2B 1WJSA 2MAMA 1KQSA 3AA1B 4OB2B 4U72A 1ZHCA 3N2KE 5KE3A 4M77B 1FEWA 4C0ZA 3MXZA 4CI1B 5A0DA 2DTOA 5LP6E 2EHOB 3P8DA 3VUBA 1YD8G 5CKBA 3JCMg 3M58A 2KQWA 2LEHA 2X4YA 4E7HA 3CCJA 4B9WA 4M7DD 5D6WA 1LVFA 1Y96A 4XK8E 5JR9B 1OZ2A 3ZCIA 2PJQA 3L42A 1X75C 4FM4B 4M77F 5J39A 4F7UG 4A4FA 4M1PA 2JN0A 2VASA 2Y8DA 1Q81C 3VU7H 2CE7A 3ZYLA 2M67A 1T98A 3JB9J 2PFVA 3ZMVB 5CQXA 4GOUA 2P0PA 4P5NA 5HY6A 4JRKA 5DLQE 5ADXL 3OYAA 2W61A 2E5QA 3I55A 4AKGA 4FJOA 3D0TA 4O2AE 3CMET 3KXTA 4YTLA 3AVSA 4C92D 1KK7A 4K0UA 3O8VA 3SS1A 2XDBA 3DP7A 4PJOE 1S35A 2ZPIB 3OYYA 3KINB 2XAJB 4JRPA 3C4WA 1YJNA 5H6QB 3JB9H 4QXHB 1M4ZA 4G2AA 3OMCA 3CCUA 5KE2A 3DB3A 4ZN1A 4H9QC 1E1HB 3ZMZB 4PJNA 3BQIA 3VV0A 2K5IA 1UEBA 4I55E 1WGSA 4RMOA 3CCRA 3JSCA 2IW5B 3QKJA 5DQWA 2UXXB 2EIFA 2V8IA 2C0SA 3ZLIA 3ZEHA 2X68A 1H7CA 2DZ9A 4V1Av 4AKLA 4BDYA 2X67A 2DNXA 2KT9A 3PU3A 4LDVA 4X1IE 3FIFA 2L89A 2VGNA 1HCIA 2Q9QB 3PDYA 1JRIA 1IZ6A 4FU6A 3CQGB 3Q2MA 3EUHA 3M55A 3FDRA 2XD0A 1G5VA 2PUOB 2I2LA 3E22E 3PU8A 3CX8B 2OTLA 4YLHA 1I81A 2XG8D 5JRCB 2ZPEB 4DQ2A 3O1JA 1KD1U 3UUXB 1UX4A 3LW5E 4DO0A 5CO7A 3KFWX 1YIJA 3EVYA 2EJ9A 1D3BB 4QKNA 3M4YA 4ZGJB 3KV4A 1B34B 4I50E 4CXYA 2X51A 3B13A 3NZQA 1VIEA 2DJZA 4C0FA 3HA4A 3X20B 1VQMT 2OTJT 2VB6A 4PJOB 5GMKh 3AAEB 2FL7A 5GAN3 2M9UA 1QVFA 4A4KA 1MNEA 3FBZA 2EQJA 2LT3A 3CPFA 5CCAA 2LSYA 1IAPA 3P8CD 2X4WA 3ZFJA 2LT4A 2NW9A 3M9QA 3PIOA 1YJ9T 3QSUA 2RI2A 1MIYA 1IJ6A 3LGLA 4LDXA 2JZ2A 2QGSA 5GMKi 2RP4A 4ZGDB 4PJOF 1BR2A 2LHRA 3UWNA 4HKAA 4P0AA 4IUPA 3WAKA 3ZN0B 1GXIE 2IG0A 2I59A 2PG8A 3HP9A 3G6EA 4YJ3E 5GANj 2QTXA 2YU2A 4XTZA 1M1FA 3I1AA 1QUUA 4C92G 2RH2A 5LJMA 4UC4A 5A1LA 2LX9A 4AQGA 3DTOA 4PFOA 4C5IA 5LJ3d 4AI6A 4HT8A 2YLBA 2XHEB 4XQ3A 4NL2A 1WR6A 1WRDA 3C50A 4IE0A 5FU6C 1S94A 4X1YE 3LGFA 5IAYA 3CCMA 1VQ6T 3WVEB 4BUGA 3P7IA 1W4SA 2KY9A 2K4YA 2LCLA 5A2QE 3I56T 3KV9A 5JDGA 3CCSA 2DHRA 3OW2A 3AB3B 1Q86C 4XTUA 4C92C 3L2RA 4MMLA 4TN7B 2K2VA 3GN5B 3LBXA 4HA8A 4XZCA 5FXVA 2ODUA 1PSEA 2QEXA 3FXDB 2RJEA 5HKCA 2JTMA 1YJWA 2MWPA 2IAKA 3EAEA 1YI2A 3ONXA 4BI4A 3UT1A 3VKGA 3E19A 2DD5A 1NAFA 2JMHA 4IE5A 1HX8A 5CAIA 2LNVA 5LJ5j 5GAOl 3UPUA 4M77A 2X4XA 1OI1A 2LHNA 2EQKA 2N9DA 3IEEA 4GYRA 1N8RU 2XASB 4CXWA 5LJ3f 4NL3A 2LSIA 3PMTA 1UX5A 3OYDA 3UDCA 3CC2A 3E0ZA 2BZBA 4ZTFA 2WAUA 2VC8A 5JR9A 3S3NA 3SWNC 4B6XA 3MJXA 3JCMJ 2RD1A 4JRQA 3OA6A 4XU2A 1QP3A 2CZ0B 1FMWA 2CWOA 4ISSA 3GNGA 3OS1A 2G3RA 2CYZB 2D5UA 3PGGA 4M78D 3CMAA 1IZNB 2F5TX 1YKEB 4KBMB 2H7VC 4C8QC 1MNDA 5HK0A 3MK7C 3S3OA 1U5PA 3TEEA 3GPLA 3PUGA 4HFVA 3QIIA 3VJPA 4HCZA 3X26B 1PSFA 2J1DG 4UVBB 3E08A 2ZGWA 4OGCA 3TREA 5GMKm 2E9XB 5C0MA 2E70A 5CR2A 3QO3A 4J5YA 4C8QA 3UULA 3HKEE 3V8KA 3CD6T 2PQWA 2A7YA 3CMLA 4C0GA 1ZEEA 3N5LA 1VQOT 5KCOA 3JCMW 2VKHA 5DM7R 4NOYA 4WF2A 4BJNA 2CZ6B 3M59A 1K8AC 4H9NC 5GANe 4U74A 5JVDE 5LJ3g 1BI2A 5HXEA 2L5QA 5IN1A 5KX5E 3AHUA 2EFIA 1UGPB 3NTKA 4E7LA 2LSJA 2DVEA 2RHUA 2LOPA 5HWYA 2D0QB 4M75D 5KMGP 3OSSC 1HG2A 3NZPA 4WBNE 4EMGA 4JS5A 4XTVA 3TCJA 2HD0A 5AYFA 3WI3A 3JCMV 4PJLA 3L1AA 3C4ZA 2EQMA 4ELZC 3HKDE 1YHQT 3CQCB 2HPJA 1U4QA 5EK2A 3OMGA 3M65A 5FY1A 2BIVA 4EIWA 1TH7A 3W15B 2MWOA 4EDUA 2XK0A 5JDFA 4IDZA 1LNXA 4BB7A 3QK6A 3R6NA 2L3RA 4IUVA 2DZCA 3G71T 3OBVE 4DOVA 4H9RC 1D0YA 4EXTA 3QG1A 2WSFE 1WLXA 1ZKEA 3UUNA 5LJ5e 4JS4A 3ETVA 3ZYMA 4M77E 5DQVA 3OS0A 3LK42 4I4TE 2DTHA 2KMFA 5FRMA 3OYLA 5CKFA 3RYIE 4M78G 2V7KA 2DLRA 1O9SA 1D1CA 2HAXA 4QVZA 5GAMg 4O4JE 4UV9B 5J2TE 5GAN4 1JJ2A 3J7Yq 1US7B 1HTJF 1O3XA 2KWIB 3G7ZA 1KD1C 3RH3A 4EMHA 4Z8XA 2YINA 2ZM2A 4UIGA 4XU0A 2L8DA 1Z0PA 4X34A 4MLKA 2V8KA 3LFMA 4C5EA 2WSEE 2K5LA 2YHTA 3OYBA 1ZHIA 1YKHB 3X24B 4DVDA 4DNDA 5GAOr 4BA9A 3HSBA 4M7AD 3MCAB 1VQ9T 2XHCA 4E7ZA 2QA7A 2LQ8A 4IE4A 2A3LA 1QSDA 3CCVT 3LBXB 2DI4A 5FU6B 4LD6A 3V7CA 2JRKA 4ZI3D 3B57A 4C8QE 2UXNB 1Y7XA 1VQKA 4ZHQE 4BI3A 5CKHA 4Z02A 2RHIA 3GN5A 1RL2A 4HCCA 3PUAA 2QQSA 3KV5A 1VQ5T 4M75G 2JPFA 4C92B 3CCQT 2E41A 2LJLA 2XAHB 4PJJA 3RKOA 4AKHA 4I43B 3S4UA 2DIGA 3ME9A 3QC9A 2VL8A 3JB9I 3A5XA 3OYIA 3PUQA 2RI5A 1MGQA 1VQ7A 4ZN3A 4E47A 2YEVC 4G63A 4GK5E 4N4HA 2QXFA 3QZ9B 3MEAA 2FB7A 3AA0B 2KZ7B 2C5JA 1LKXA 2LVMA 3VKIA 3JCMc 4CRIA 4C92F 1H3ZA 5HAXA 5KDMC 2CEAA 2CKKA 3HL6A 5C8YE 3HRUA 1VQNT 4PLLA 3ETUA 5IHYA 5LJNA 4GK0E 5L3GB 1BIBA 2WMNA 4B9XA 4JUYA 3PUSA 2KXPB 1G3WA 2X35A 3GLXA 3SWNB 1Y64B 1X01A 3JC6D 3PMIA 2E9XC 3M56A 3CCEA 3F57A 5FP3A 5GAN2 5A0LA 4N4IA 5TAOA 5FNVE 2JMKA 2RB6A 2D2SA 2YK0A 3OBWA 4OFZA 1QVGS 2K3XA 5CVIA 3N9NA 3CKDA 1I8FA 1KC8C 5HXHA 3N9LA 2LE8A 5LYJE 3RMQA 4C8QB 4XU3A 3BDLA 2ZMAA 3MEVA 4CZZB 4LD9K 3G4ST 2E9XA 3QHSA 4OYKA 5L2LA 3ASKA 5EK4A 4CI0C 1VQLA 4AXPA 2E1HA 2EHOD 1Y71A 3SD4A 3CX6B 4MALA 2FVUA 1KG1A 2Y48B 3OYZA 1IREB 3F70A 4F7UA 5EG2A 4C8QF 3UTKA 4QX7B 3JB9D 4M7AG 1MMNA 3RRCA 4DBRA 3P8BB 1IJ5A 2CZ7B 2JNGA 2LDMA 3ESLA 5D6YA 4GLKA 2NWBA 2XAQB 3X28B 2BUDA 4ANJA 4EYUA 4PL6A 2W0GA 1W2BS 2RA1A 5FXZA 1YCYA 3PTRB 1BI3A 2W63A 4A4GA 3SDZA 3VHLA 2WM9A 4X1KE 2VKDA 2GK9A 1MIWA 1UCUA 2JQQA 3GNFB 4ZGEB 5FXXA 4ZI2C 3RUXA 4FIBA 5LA6E 5DY9A 1D1AA 3VYHB 4DMWA 1Q7YU 2QA4T 1VQ4T 5I2MA 2F5KA 2JVVA 4GY5A 4M7DG 3QDRB 3V5SA 5I21A 4ZI3C 3O1IA 4KULA 2BDEA 1CUNA 3V7SA 3AA6B 1YBYA 1I5LA 2LM9A 4XU1A 4A4HA 3CC4T 3QYHB 2E6ZA 3F31A 1NJIU 3Q5WA 4OB3B 3CCLA 3A8LB 3RYHE 2RA2A 1VQ8T 4XTWA 1SA0E 1YITT 2MBGA 1G3SA 2GFAA 4QQGA 1S72T 3FLGA 2HPLA 3LLRA 1G3TA 3H6ZA 2CLYC 2QQRA 3FHNA 3AVRA 2XQYA 2PUKB 4QW2A 4WBOA 4PFPA 1Q82C 2Q9QD 3ZYKA 2W62A 2ZPFB 3WXMB 2A72A 4M7DC 5EK3A 2B8AA 2DEQA 3I0OA 5CKDA 5ETWA 4Q5WA 3L2UA 5L3DB 2P4TA 2Y6XA 5F3JA 5E0OA 4NS5A 4TV9E 5GAN7 4HE8A 3RC3A 3K3NA 4X9CA 2JJ9A 2RJFA 1H641 4C0DC 1P92A 2XU8A 4AQFC 3CXCS 5L3CB 1FXXA 2Y4XA 1AHJB 4NUVA 4M7DA 4H9OC 3FB2A 3CC7T 1VQPA 5FY7A 4C90A 4YFSA 3KBGA 2KDSA 4IUUA 4R55A 5HXCA 4QX8B 3QJYA 1FIOA 4PJOD 4ZS2A 3MA9A 3JB9G 2NW8A 5GAMj 2XAGB 3V5UA 1M1KU 3CXCA 1KHCA 2XI9A 4DOWA 1X6OA 3GWHA 2DXBA 4FSXA 4F7UE 2VKJA 1JBMA 1NPRA 2PU9B 3K3OA 4C92A 2Z6EA 4IURA 4QVCA 4ATOA 3HL8A 3QPHA 2RJCA 2ZPBB 1WYBA 2ZLYA 5GANd 5GONE 4UVAB 2KK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFR A;  2LT1 A;  2EYQ A;  2LT4 A;  2LQK A;  4L5G A;  4XAX B;  4KMC A;  2LT3 A;  4ILU A;  4KBM B; 
#chains in the Genus database with same CATH topology
 4ORZ A;  1ZBX A;  1M90 U;  1E7P A;  4KP3 C;  3P4W A;  1M1G A;  2VUB A;  4FT2 A;  2HKN A;  4UF0 A;  3UFE A;  2YU1 A;  1FX7 A;  2P0Q A;  3A8Y C;  5FW9 A;  1SHZ C;  1KHI A;  2ZPH B;  3UUM A;  3ONL C;  3ZC1 A;  3CCJ T;  3BFM A;  2RHY A;  3T8O A;  4Z8A A;  4EAH A;  4D6W A;  4BJM A;  5LOV E;  5AQT B;  2YWW A;  4JLG A;  1JB0 E;  4Y28 E;  1G73 A;  5JDL A;  2WDV A;  2RI3 A;  2PVG B;  3MP8 A;  3OSV A;  5GAN h;  4DV7 T;  2YUO A;  3RR6 A;  3KBT A;  3TKL B;  1WQW A;  3OYG A;  3SWH A;  2CWY A;  4EOZ B;  3KV6 A;  4QH1 A;  3QYG B;  4AIU A;  3LK2 B;  4L5G A;  4H63 H;  1EIF A;  3SB2 A;  2E3H A;  3VYG A;  4WZX A;  3J81 E;  2V7L A;  1I4K 1;  4DMV A;  3O1H A;  1JNZ A;  3P4Q A;  1V9D A;  2DBK A;  2DXU A;  3M54 A;  4OVA A;  1PD1 A;  5HXS A;  4RCC A;  2Y90 A;  5J1G A;  3SWN A;  5LGU B;  3ANW A;  1C0M A;  3I55 T;  1WYC A;  1YQ3 A;  4PFZ A;  2JTF A;  2GF7 A;  2LQK A;  5LHG B;  2KRS A;  4CC2 A;  3NRX A;  2DL4 A;  2A08 A;  1LRZ A;  2V1R A;  2ACZ A;  1WPY A;  3CME A;  4JI0 T;  1WJQ A;  2LC4 A;  1N27 A;  1HG5 A;  4PAG A;  3SRZ A;  1J5W A;  5IYZ E;  4MZM A;  5FU7 C;  1YJN T;  2BZX A;  4C5H A;  5GAN f;  4DA4 A;  5KYX A;  4PW8 A;  2CP3 A;  5LJ5 d;  4OMF B;  1U8R A;  3M0T A;  3ZCJ A;  1QKW A;  2H7O A;  3CCU T;  1UJY A;  1NWM X;  2BG9 C;  3A98 A;  3M0Q A;  1LJO A;  4F7U B;  1M1K R;  2YDQ A;  3ZN1 B;  1N33 T;  1UFF A;  4JYA T;  3C95 A;  3EDU A;  1ZX6 A;  1M5Q 1;  1JEG A;  4ZTJ A;  3CCR T;  5GAN 8;  4AKR B;  6AT1 B;  2CM0 A;  3CPW P;  3DJB A;  2WSS V;  4H63 V;  3H3A A;  5F8P A;  1IXD A;  5LJ5 h;  3UQ7 A;  3OY9 A;  1I0C A;  3D7S B;  3FJ5 A;  2NWM A;  3VKH A;  3A8O B;  5LG3 A;  4OYJ A;  4JI6 T;  3NTH A;  1WLP B;  3EG0 A;  3RNJ A;  2BG9 A;  3PUR A;  1N8R R;  3J7A F;  3C12 A;  4JI8 T;  3BW1 A;  4F7U F;  4NPP A;  4PJO G;  3MAC A;  1M90 R;  4HCB A;  5D6X A;  1SPK A;  3IBP A;  3HI2 A;  1A0N B;  4BE1 A;  2LRK A;  4TWF A;  1U1S A;  1VIF A;  1VQM Q;  2OTJ Q;  3KUF A;  2QA4 Q;  1BIA A;  2UUB T;  2CSQ A;  3CPW S;  3L09 A;  2YUQ A;  4JLI A;  3TSZ A;  4XAX B;  3OQ5 A;  2P84 A;  3FZF B;  1MMD A;  2A2F X;  3FEO A;  4FW1 A;  3UT5 E;  2CH4 A;  3H0F A;  2E64 A;  5AQH B;  4O6J A;  2XZE A;  2VK9 A;  3EAB A;  3UUB A;  5CIU A;  1UEC A;  2EYQ A;  3RYF E;  2LNH B;  3M0S A;  2RO0 A;  3AAI A;  2OTL T;  2MIO A;  4BI8 B;  2DXT A;  1T0J A;  3LWH A;  1YJ9 Q;  3SOL A;  4PK5 A;  1KIK A;  4HEA A;  5GAM e;  2GTJ A;  3NHN A;  5EC7 A;  1WHJ A;  3TLU A;  4JI5 T;  1YIJ T;  2V7J A;  5LJ5 f;  1VRB A;  1PRM C;  3UQ4 A;  1YIT Q;  4JJD A;  1OPK A;  4J6X A;  1SEM A;  5GAO m;  1S72 Q;  1D1B A;  4ILA A;  3QJ6 A;  2VWF A;  2LRQ A;  4O2B E;  2AK5 A;  1BR4 A;  2X0H A;  3RI5 A;  2KT1 A;  3CPW A;  1YW0 A;  3OVU A;  3FZL B;  4M7A B;  2CCQ A;  1YFN A;  1VQM A;  2OTJ A;  3ZMS B;  1HR0 T;  4HKE A;  1SRL A;  2K7A A;  3UA7 A;  1W0B A;  2RHZ A;  1TU0 B;  4PLI A;  1SF9 A;  2VVN A;  4C92 E;  2XKO C;  2KND A;  4YHH T;  2QDY B;  5JQG E;  2X4J A;  1NYG A;  5C6S A;  4QXC B;  3EGD B;  1KFY A;  5CK9 A;  3JRZ A;  4DR4 T;  2IVW A;  4Z91 A;  4FYX B;  3EG9 B;  1YJ9 A;  1HK9 A;  1ZUK A;  4HFE A;  2ZM6 T;  2FPD A;  4EPC A;  2DMO A;  3HKS A;  1HS7 A;  4M7A F;  1KNZ A;  4ADZ A;  1M7K A;  5DAB A;  2E12 A;  2L3S A;  2VYT A;  3NRY A;  1JU5 C;  5LXT E;  3U3I A;  3T9N A;  5CGM A;  4WNK A;  3EGX A;  1ACM B;  3H37 A;  1PCX A;  3LX7 A;  5AQM B;  1VQ6 Q;  3S6W A;  1QMC A;  5ABG A;  2BTT A;  1G2B A;  3I5R A;  2UUA T;  4QWN B;  3ZEF B;  1WHL A;  3G6E T;  4IUT A;  5DJQ C;  2XUE A;  2CLY B;  3I56 Q;  1HYO A;  1WHG A;  2XQ3 A;  2FO0 A;  4B3S T;  4UVC B;  5A0G A;  4E7J A;  1VUB A;  3RGL A;  2RK2 A;  1TUG B;  5LL6 S;  3J9X 1;  4YJ2 E;  2CXL A;  2BBH A;  4WW0 A;  1Q7Y C;  4OB1 B;  1SSH A;  4M7D B;  2FZG B;  2V1D B;  4B3R T;  4ILB A;  4J9H A;  4RG2 A;  1G3Y A;  4R56 A;  3CBO A;  2X3X D;  3IF8 B;  4YTP A;  3MEW A;  3TVT A;  3PUW F;  4M78 C;  3ZKR A;  5IXF A;  2R58 A;  3OYK A;  1ZA2 B;  2E6N A;  2DLP A;  5HXR A;  1WHH A;  2YSQ A;  3A8G B;  2AHJ B;  1T3L A;  4J8O A;  2GCX A;  2QGF B;  2YDR A;  3JCM e;  1D0X A;  4C0D B;  5I2S A;  4E7S A;  3RKG A;  4UEM A;  3CCM T;  3PTA A;  4TZ4 C;  4OHF A;  1F1B B;  3PFS A;  1NJI C;  1VQ6 A;  5HEJ A;  5FRO A;  2FG0 A;  1WR0 A;  4LDU A;  3EG1 A;  5JH7 E;  4M7D F;  3CCS T;  4P0B A;  5LHH B;  3I56 A;  1KQS S;  2DM1 A;  1FMV A;  3CBP A;  2CA5 A;  1T8B A;  4M78 A;  4OX9 T;  2EAY A;  3HKC E;  2RN8 A;  3QBY A;  5IT9 E;  2K9A A;  2VQF T;  2V6X A;  2NOX A;  1KEY A;  2HCK A;  4E7I A;  3DLM A;  2D0U A;  3T1Y T;  4AFQ C;  3CCJ Q;  2QEX T;  4IIJ E;  4A54 A;  2CP7 A;  1YJW T;  1K73 U;  1NBE B;  1QVP A;  2A37 A;  5HYA A;  3MEU A;  4A53 A;  2NUT B;  1YI2 T;  4RTW A;  4TV8 E;  4IL9 A;  1J1J A;  2VGM A;  1VOM A;  4XTY A;  4AIS A;  4LDW A;  4E7K A;  4GIW A;  2M6I A;  3AEG A;  1AZE A;  4MDX A;  2FJE A;  2DXC A;  1TUD A;  2FJB A;  4UF0 B;  1I5O B;  4B3M T;  2CUD A;  2YT6 A;  1I07 A;  4JEU B;  4ELY C;  1MHN A;  2KNB B;  2VVK A;  2SPC A;  3PNW C;  3X1D A;  5HCK A;  3URG A;  1LOJ A;  4J83 A;  1G8X A;  4X65 T;  4QXB B;  5JDN A;  2XID A;  1M30 A;  1MIV A;  2OI3 A;  2LSG A;  2CZ1 B;  1M9S A;  4P09 A;  2J6F A;  1BI0 A;  2XIC A;  3N9O A;  2W4X A;  3AE3 A;  3CIR A;  5LB7 B;  1EFN A;  4DV4 T;  2G6F X;  5FXW A;  3E9G A;  3CC2 T;  3PE0 A;  4RKU E;  3C51 A;  3MZK B;  4UEL A;  4M75 C;  3OPC A;  1QVG P;  3JCM X;  3I35 A;  1OX9 A;  5FRN A;  5AQI B;  1QP2 A;  2EQI A;  1GCP A;  2NLU A;  3I9Y A;  3ZBD A;  2E4H A;  3I9W A;  4OP0 A;  4CN4 A;  2K9G A;  2QYZ A;  3QWY A;  2L8K A;  2CS7 A;  2K6D A;  2CXF A;  5M4Y A;  1WJR A;  4N4G A;  3QUI A;  3CMA T;  1MMA A;  2MI6 A;  1K8A U;  4RTU A;  4HT9 A;  3ANW B;  4HFD A;  3ZPO A;  4J9F A;  3CD6 Q;  4CI3 B;  3AE9 A;  2YOE A;  1UGO A;  2EJG A;  2B1E A;  1BI1 A;  2OV9 A;  1UHF A;  2LMJ A;  3MET A;  1M1K C;  2K3Y A;  3R84 B;  4AKI A;  5L3E B;  1XMO T;  1UUE A;  3VR8 A;  1VQO Q;  4QH4 A;  4M75 A;  2GFU A;  1SRM A;  2DYI A;  5CFB A;  5AQR B;  3OYJ A;  3U78 A;  3JB9 F;  3CCR Q;  2UU9 T;  2KVQ G;  1KQ1 A;  2M0O A;  5KYX B;  4BD3 A;  4J6W A;  2XAF B;  2FHD A;  5GMK j;  4ZS3 A;  2E65 A;  1AJ3 A;  2LCC A;  3ZMU B;  3N5B B;  3RPU A;  3GMI A;  4PK4 A;  4TX5 A;  4O5V A;  3A8H B;  2NUP A;  1N8R C;  4M77 D;  2WQY A;  5KH6 A;  5J26 A;  3AAA B;  1M90 C;  3N9P A;  3NBX X;  1BR1 A;  3M0R A;  1BCM A;  3CX7 B;  1ZSZ C;  2M16 A;  1W2B P;  3LG7 A;  5LG4 A;  2D6F A;  3CD6 A;  5FU7 B;  1RAF B;  2IPO B;  5HEH A;  3ZJ1 A;  1QVG A;  2DA9 A;  3F2E A;  1K73 R;  2WCA A;  5M9O A;  5F5W A;  5LHI B;  2F69 A;  2KMT A;  3M4G A;  1VQO A;  4EB6 E;  1IO6 A;  2NW7 A;  4NXN T;  3HHT B;  2BG9 B;  2EWN A;  2DL1 A;  4PNI A;  4DV2 T;  2XQ6 A;  5AQF B;  2WZH A;  4F6R C;  1ZLM A;  3VS5 A;  3VU3 C;  1T72 A;  2OTL Q;  2C06 A;  4TUY E;  2O4X B;  2Y4Y A;  5HEG A;  2XQ5 A;  5AQG B;  3VRA A;  4RCB A;  2LT1 A;  3UU4 A;  1ZSZ A;  3ULR B;  5HCM A;  3OYX A;  2OAU A;  2M0Y A;  2WWV A;  4BAC A;  1GBQ A;  5CB4 E;  2MK5 A;  2LSK A;  2CP2 A;  4CQI A;  1K0X A;  2X9H A;  2ZZD A;  3CQT A;  1R8O B;  2ECZ A;  4NIQ A;  3N2O A;  3OBY A;  3QXE B;  3G71 Q;  3EI0 A;  2L9Q A;  4IUQ A;  2QYW A;  2RM4 A;  4MBQ A;  5KCH A;  5D7U A;  2EGC A;  1RLQ C;  2KIN B;  4M7A C;  1B3Q A;  1SHF A;  3BY7 A;  1HF8 A;  1UHC A;  1YHQ A;  1QVF S;  1H92 A;  3E9F A;  2G0U A;  5L23 A;  4HTE A;  2VKO A;  1NEN A;  1OYX A;  5HK3 A;  4M78 E;  1W2B A;  4C8Q D;  4KT0 E;  5HWX A;  1OOT A;  3EFR A;  3MO8 A;  5LJ3 j;  3RKW A;  4FCY A;  1K9M U;  1BR0 A;  4U33 A;  4OB0 B;  3GP8 A;  1QCN A;  1WIE A;  1D0Z A;  4JI4 T;  1UDL A;  4O4I E;  1VA7 A;  3RKX A;  4EMK B;  1LVK A;  2D0T A;  3G1J A;  1UB4 A;  2CHO A;  3V8L A;  5FYM A;  4M7A A;  3M3Z B;  1M2V A;  4YT0 A;  1M3B A;  2LOS A;  2K5F A;  2CBJ A;  4DR1 T;  2DF6 A;  5BMV E;  1NEB A;  3G71 A;  2MPK A;  4HWD A;  2ACX A;  3G6E Q;  1JXO A;  4X66 T;  1XZY A;  1PM3 A;  1WA7 A;  3ZL7 C;  1NPP A;  2AE9 A;  3QUJ A;  1VYT A;  4BE0 A;  2OLT A;  3EGX B;  4LDY A;  2J06 A;  3GIB A;  1SE7 A;  4KHP T;  1N9S A;  3BE3 A;  3KBU A;  4CXX A;  3RKY A;  2V8J A;  3C4X A;  3FB9 A;  3EG9 A;  3FRN A;  4IE7 A;  4JLE A;  3B5M A;  1VYU A;  2DKG A;  2EKO A;  2JOY A;  3KVA A;  3P8H A;  1VQ9 Q;  2CH4 W;  3DLL A;  4DBQ A;  2DE0 X;  3TSW A;  1X6G A;  4R0K A;  3AEF A;  3MP6 A;  4HCK A;  2DK3 A;  3OYH A;  3EGU A;  4LUD A;  3ZMT B;  2DJQ A;  4HGA A;  5GMK l;  2PVD B;  3KVB A;  4ZOL E;  2EKH A;  2CGH A;  4BY6 C;  3CCV Q;  5J0Z A;  2W10 A;  4X1V A;  4O8S A;  2FZC B;  3HKB E;  5LGT B;  3HFN A;  1BKB A;  2EYW A;  5JDM A;  2HQH A;  1FJG T;  2DCF A;  3Q1J A;  4HWI B;  2MTQ A;  5L8R E;  2X9W A;  3OS5 A;  5GAN 6;  3MKD A;  4AG2 C;  3VS3 A;  3VS7 A;  3FC3 A;  1XJW B;  5HEO A;  3CEY A;  3OYE A;  4M77 G;  2WP9 A;  1MMG A;  4LF9 T;  2VWA A;  2EJF A;  3OYC A;  2EQU A;  2W00 A;  3OW2 S;  4M75 E;  3RYC E;  1VQ5 Q;  2IUB A;  5H6R B;  3RIR A;  4L59 A;  1OWA A;  4KUM B;  2EW3 A;  3JC6 C;  3CCQ Q;  3AEA A;  3VRY A;  4EZH A;  2VXE A;  5GAO n;  5IHK A;  1OX8 A;  1R77 A;  4LF5 T;  4F8H A;  1K76 A;  1GCQ C;  1WQ7 A;  5CA0 E;  2EYZ A;  5GMK e;  1VQ9 A;  1FWZ A;  4JI2 T;  4M78 B;  3RER A;  1IGQ A;  5JRE A;  3H0I A;  2QQA A;  2WSC E;  2PZ1 A;  4AQF A;  1XDO A;  3CPZ A;  4H9P C;  4GBQ A;  2H89 A;  2J6O A;  3CCV A;  1Q81 U;  3CBM A;  4ERR A;  3L3P A;  4QHO A;  1RLP C;  2QQB A;  5LGN B;  1VQK T;  5LJ3 h;  3RIU C;  1K9M R;  2HH7 A;  1KJW A;  2VV5 A;  5AFU L;  4MZT A;  1GBR A;  2XQA A;  4O4L E;  4E2F B;  2H3R A;  4UXN B;  4F16 A;  2F2X A;  5AQV B;  3PV0 F;  4M77 C;  2D1X A;  3RBB B;  2VXF A;  2R57 A;  4MDW A;  4IKF A;  2LKH A;  2XM1 A;  3OYM A;  4JEH B;  2MMP A;  2DWK A;  4JUV A;  4OGE A;  1PG5 B;  1N5Z A;  1N9R A;  4M78 F;  2DRM A;  1VQ5 A;  2IC6 A;  2EHO C;  2IIM A;  2MOZ A;  3OKQ A;  3CCQ A;  4E6R A;  3AE4 A;  1IHV A;  4GYS A;  4HFH A;  3GOX A;  4PJM A;  3NWI A;  3SFD A;  1C1A A;  2X9Y A;  4JZ3 A;  4RTV A;  4TNV A;  3AE5 A;  1KC8 U;  3RIU A;  4JDS A;  2RHX A;  5JR9 C;  1VQ7 T;  3O9X A;  1I6Z A;  4TWD A;  2RPA A;  3AA7 B;  3LH0 A;  3JAM E;  2V26 A;  4U3C A;  4J6Y A;  5AQJ B;  3H41 A;  1WHM A;  4IGU A;  3RHW A;  1N32 T;  3HRT A;  2QI2 A;  4C8Q G;  1Y96 B;  4YTN A;  3INZ A;  2EHO A;  4CC4 B;  3LJC A;  2R5A A;  2E8I A;  1Y07 A;  3N2G E;  1ZV4 X;  1NM7 A;  2V7I A;  5AQO B;  3OB9 A;  3HPW A;  1X43 A;  1MV0 B;  4HVU A;  3RC8 A;  2HNI A;  4U7Y A;  1XMQ T;  2JMA A;  1VQN A;  3RX6 A;  3HFO A;  2K48 A;  5LBQ B;  4MZP A;  2JQK A;  5LBM A;  3G4S Q;  3GA8 A;  2QK0 A;  2LKG A;  1CKA A;  1RAA B;  1X6B A;  3NTI A;  4F04 B;  3BQL A;  4M75 B;  3PVL A;  2P0K A;  1NEK A;  2LP5 A;  3NMZ C;  5CQY A;  3L2Q A;  4JJC A;  5LJ3 e;  5GAM d;  4NUU A;  5LCY A;  4UV8 B;  2D9T A;  2COW A;  2DTI A;  5FY0 A;  4ASK A;  2FUP A;  3CCE T;  3LK3 B;  3BQK A;  4KGZ B;  1K73 C;  4P1N A;  2WBL A;  2LTO A;  2MF2 A;  1V1C A;  3V7R A;  1XQH A;  2M1H A;  5ECA A;  4M7A E;  3TLS A;  1IB8 A;  2NUP B;  2X9X A;  1TS9 A;  2C5I T;  3RRW A;  5LNK A;  1RI0 A;  2N1G A;  5L3B B;  2WB5 A;  2WAC A;  1IRX A;  4KUD K;  2OA5 A;  1YWP A;  2KAF A;  2R6G F;  2GGR A;  3WAJ A;  2GQI A;  3ZJ2 A;  4L0R A;  1OQK A;  2O01 E;  3SFM A;  2D8J A;  5GAM h;  2CMR A;  4M75 F;  4GLM A;  4II1 A;  5JDH A;  2KWH A;  1UGS B;  4IDP A;  5GAO p;  2HQE A;  3OJA A;  1KF6 A;  3OYN A;  1Q81 R;  4AFU C;  5FLX E;  1M62 A;  3G4S A;  4IHJ E;  2BKD N;  2CXD A;  4MHC A;  4A56 A;  4AFZ C;  5GAO q;  3M53 A;  3N9Q A;  3OYF A;  2RPN A;  2AKL A;  4XTX A;  3K3Q C;  5GAN 5;  3CWZ B;  2EPD A;  2CPT A;  2ZM8 A;  1VQL T;  1ZBJ A;  4N78 D;  1QW1 A;  4IT4 A;  2X0L B;  1N6A A;  5J2U E;  2V7M A;  2GQV A;  3X25 B;  5JDQ A;  2QRX A;  3QZ5 B;  3RES A;  1UGQ B;  2F2W A;  2BVL A;  2RJD A;  3N9M A;  1XNR T;  2PBI A;  4DUY T;  1ZSZ B;  3TQ7 P;  2JUF A;  3VS4 A;  2KSS A;  4BDZ A;  4L9I A;  3RDV A;  2Q9Q C;  5FWB A;  3L2W A;  1BU1 A;  3S3M A;  2PVO B;  3E1S A;  3T1H T;  4RG8 A;  2H3J A;  4CC3 A;  4IST A;  1HXD A;  2M6B A;  1U1T A;  3AE1 A;  2O4X A;  2RQW A;  2NP9 A;  1ZSG A;  3M5A A;  1NE8 A;  2V1Q A;  4HFB A;  1VQ4 Q;  4A4E A;  2O9V A;  2R5M A;  5GAM f;  1B7T A;  2ZPG B;  2A3D A;  1X79 A;  1PRL C;  3H0H A;  4M4Z A;  4N0A C;  4VUB A;  4M7D E;  3DB4 A;  2H8H A;  3L2V A;  3BDU A;  4X9D A;  3O5Z A;  1NZ9 A;  3V8J A;  4A63 B;  1M8V A;  1XTD A;  2E10 A;  4WCI A;  1QWF A;  4L6V 5;  4IE6 A;  4LF7 T;  5CKE A;  3NFC A;  4TVR A;  4J2C A;  2BKN A;  2IC9 A;  4ILU A;  2DPP B;  2GTO A;  3CC4 Q;  2Q9Q A;  3H3M A;  4J9B A;  1AWW A;  4OK0 A;  2XSA A;  3JCM d;  1HD3 A;  1WI7 A;  5FKY A;  4LF8 T;  2DL7 A;  3PT9 A;  3GF5 A;  4V2S A;  2WWU A;  2XDD A;  2WMO A;  4BE2 A;  4LMK A;  1Q82 U;  2B76 A;  4EMK C;  4PKC C;  2AIR B;  1VQ8 Q;  4LFC T;  2W66 A;  2YRV A;  3ZC0 A;  3CVR A;  4J7I A;  4N0A A;  2E9X D;  4PJO C;  5J3B A;  3K8P C;  3PUY F;  3EFS A;  2JQ9 A;  3LH5 A;  2KEA A;  3AEE A;  4EZ4 A;  3L2Z A;  3FXE B;  3Q9D A;  1M2V B;  4FT4 A;  5JRC A;  5GAN g;  4FI5 A;  1XOV A;  2QA4 A;  1E7O A;  3R6O A;  4AFS C;  1VQ4 A;  2DD4 A;  3ER0 A;  3JCM h;  4FL6 A;  2D0N A;  5GJW B;  2HQX A;  1RAC B;  1SSF A;  1D3B A;  3C98 B;  1B34 A;  1WNL A;  1QLY A;  4C5G A;  2ES0 A;  1KQ2 A;  4EMK A;  3Q5X A;  2DIQ A;  4XBF B;  3HR0 A;  1NEG A;  2XDP A;  2ENM A;  2A28 A;  4C91 A;  2QQ9 A;  3CC4 A;  2BKP A;  3CCL T;  3ABV A;  1JJ2 S;  1UGR B;  4PJO A;  2C5K T;  2CUB A;  4ME7 A;  4COF A;  1IBK T;  3FBL A;  2K24 A;  4H9S E;  2KLQ A;  4AT1 B;  2MYS A;  1VQ8 A;  5FMN A;  2RK1 A;  3MHX A;  5L3F B;  1YIT A;  2X0Y A;  1S72 A;  1BCO A;  1UTI A;  4JI7 T;  2JM8 A;  3DKM A;  1Q86 U;  2YLC A;  4NXM T;  2K57 A;  1O75 A;  3A8M B;  1QLB A;  3RMS A;  4LML A;  3J80 E;  2KT8 A;  3CC7 Q;  3C4S A;  2FYK A;  2NR4 A;  2DAQ A;  3P4S A;  5DLO A;  2X66 A;  3H8Z A;  1SG5 A;  2AKK A;  4YHJ A;  3EG3 A;  3C94 A;  2NTX A;  3JCM f;  3OS2 A;  4IL4 A;  1NLO C;  3RQU A;  2W67 A;  1Z8U A;  1XNI A;  2HBP A;  4J9G A;  4Y91 A;  2XTL A;  2K5B B;  3O4X E;  3TU4 K;  3PIP A;  1X2K A;  1GL5 A;  2L3Q A;  3EDV A;  4DV5 T;  1KQS P;  4ZZB A;  5EZY E;  1VCS A;  3A5Z B;  3VUZ A;  5KYN A;  4BAY B;  3AED A;  4QQ6 A;  4O4H E;  5IUX A;  2N2N A;  2ZCF B;  4QVD A;  1OED C;  2ODV A;  2JXB A;  3M0U A;  4JJN K;  4IRE A;  1K9M C;  4K0K T;  2P9B A;  4BY6 B;  4X20 E;  3FJP A;  3QNU A;  4PK6 A;  3BK9 A;  5I11 A;  4D8K A;  3SFE A;  5LJ5 g;  3KDS E;  2BVM A;  1YNZ A;  1VQP T;  4MFR A;  1OZ3 A;  4HN9 A;  3CC7 A;  1OV3 A;  1IBM T;  2L3L A;  1BYM A;  4ZI7 E;  4ZI2 D;  3MP1 A;  4Z90 A;  3LWI A;  4QH5 A;  3JCM P;  3WVD B;  4QQD A;  2HHH T;  2DWG A;  1I94 T;  1WCR A;  3AT1 B;  2YRD A;  5CA1 E;  2NTY A;  1OED A;  3C64 A;  1EZ3 A;  1HFA A;  4MMK A;  1DU2 A;  3LYI A;  2DO3 A;  4EYY R;  2ZM0 A;  3HRS A;  2M02 A;  1DJ7 B;  3JCM b;  2CP5 A;  3CQX C;  1PD0 A;  3I0Q A;  3M57 A;  4JRI A;  4KUI A;  2P4R A;  3JCM Q;  1TOV A;  4OF1 A;  4B3T T;  5HCJ A;  1ZQ1 A;  4PNO A;  1V29 B;  1OXZ A;  1M3C A;  1RAH B;  3IHR A;  4KMC A;  4J7F A;  4CI2 B;  1WJS A;  2DEU A;  3RQW A;  2MAM A;  1KQS A;  3AA1 B;  2ROT A;  2BG9 E;  4OB2 B;  4U72 A;  4X64 T;  1GQE A;  1ZHC A;  3N2K E;  4Y92 A;  5KE3 A;  4M77 B;  1FEW A;  4C0Z A;  3MXZ A;  4CI1 B;  4OMN A;  5A0D A;  2DTO A;  5LP6 E;  2EHO B;  3P8D A;  3VUB A;  1SUM B;  1YD8 G;  3QB5 K;  2HDA A;  5CKB A;  2ED0 A;  3JCM g;  3M58 A;  1Q86 R;  3VS6 A;  2KQW A;  3I55 Q;  1IBL T;  2LEH A;  2X4Y A;  1Y57 A;  4E7H A;  3CCJ A;  4B9W A;  4M7D D;  2C0O A;  2FEI A;  5D6W A;  1BK2 A;  1LVF A;  1Y96 A;  4XK8 E;  2E2A A;  1KFZ A;  5JR9 B;  1OZ2 A;  3ZCI A;  2PJQ A;  3L42 A;  1X75 C;  3PUX F;  3VS1 A;  1WFD A;  4FM4 B;  2DX1 A;  4M77 F;  1ABO A;  1YJN Q;  2A9U A;  5J39 A;  4F7U G;  4RTT A;  4A4F A;  4M1P A;  4A97 A;  2JN0 A;  2VAS A;  2Y8D A;  1Q81 C;  3CCU Q;  1PKT A;  3VU7 H;  2CE7 A;  3ZYL A;  2M67 A;  5BR8 T;  1G83 A;  1I1J A;  1M8M A;  1T98 A;  3JB9 J;  2PFV A;  3ZMV B;  1LPL A;  1W1F A;  4JPB W;  5CQX A;  2XQ9 A;  4GOU A;  2P0P A;  1V76 A;  4P5N A;  5FWC A;  5HY6 A;  4JRK A;  5DLQ E;  3PJA A;  5ADX L;  3OYA A;  2W61 A;  2E5Q A;  3I55 A;  4FYY B;  3AXJ A;  4AKG A;  4FJO A;  3D0T A;  4O2A E;  3RLF F;  3CME T;  3KXT A;  4RTZ A;  4YTL A;  3AVS A;  1NYF A;  1KK7 A;  4K0U A;  4C92 D;  4EV6 A;  3O8V A;  3SS1 A;  2XDB A;  4JJB A;  1TSF A;  3DP7 A;  4PJO E;  1S35 A;  2ZPI B;  3OYY A;  3KIN B;  2XAJ B;  1K1Z A;  2VKN A;  4JRP A;  3C4W A;  1YJN A;  4IIM A;  4DV3 T;  1ZP0 A;  4LMJ A;  4GKK T;  2W2U A;  5H6Q B;  3JB9 H;  4QXH B;  1M4Z A;  2LZ6 B;  4G2A A;  2V5D A;  2K2M A;  3OMC A;  3AE2 A;  3UA6 A;  3CCU A;  5KE2 A;  1NG2 A;  3DB3 A;  4ZN1 A;  1R0C B;  4H9Q C;  1E1H B;  3I9Q A;  1HNX T;  3ZMZ B;  4PJN A;  3BQI A;  3VV0 A;  2KRN A;  2K5I A;  1UEB A;  4I55 E;  1WGS A;  4YSY A;  1VCT A;  4RMO A;  3CCR A;  2WS3 A;  2V6Y A;  1RAG B;  5IHN A;  3JSC A;  2IW5 B;  3QKJ A;  2DVJ A;  5DQW A;  2UXX B;  2EIF A;  2V8I A;  2C0S A;  3ZLI A;  3ZEH A;  2X68 A;  1H7C A;  3ZT7 A;  2DZ9 A;  2HN2 A;  2RQR A;  1YIJ Q;  1QVF P;  4V1A v;  4AKL A;  2C0T A;  4BDY A;  2XSB A;  1RAE B;  2X67 A;  2DNX A;  2KT9 A;  1PWT A;  3PU3 A;  2WU2 A;  5L4H A;  4LDV A;  2YUP A;  4X1I E;  3FIF A;  4J9I A;  2L89 A;  2VGN A;  1K0S A;  1HCI A;  2Q9Q B;  2HN1 A;  2WY2 A;  3PDY A;  1JRI A;  1IZ6 A;  2ZAE A;  3CQG B;  4FU6 A;  3Q2M A;  2BKO A;  3EUH A;  2J7I A;  3M55 A;  3TLW A;  2BBJ A;  2BE9 B;  1WXB A;  3FDR A;  2F4V T;  4HVW A;  2XD0 A;  1G5V A;  3QB5 A;  5LMU T;  1H8K A;  1TTH B;  2PUO B;  2O88 A;  2I2L A;  4F17 A;  3E22 E;  2XQ7 A;  2EVR A;  3PU8 A;  3CX8 B;  1K8A R;  2OTL A;  4YLH A;  1I81 A;  4JZ4 A;  1OED E;  2XG8 D;  5JRC B;  2ZPE B;  4DQ2 A;  3O1J A;  1KD1 U;  1J3T A;  3UUX B;  1UX4 A;  3LW5 E;  4DO0 A;  5CO7 A;  3KFW X;  1YIJ A;  3EVY A;  2EJ9 A;  1D3B B;  8AT1 B;  4QKN A;  3M4Y A;  2E5V A;  3KV4 A;  1B34 B;  1M2O A;  4ZGJ B;  4I50 E;  3P4R A;  4CXY A;  2JM9 A;  2X51 A;  3B13 A;  3NZQ A;  1VIE A;  2DJZ A;  4C0F A;  3HA4 A;  3X20 B;  2DRK A;  4ZNX A;  4FYW B;  1VQM T;  2OTJ T;  2VB6 A;  2DFU A;  2LLY A;  4HFI A;  1RAB B;  5GMK h;  3AAE B;  4PJO B;  4DV6 T;  2KGT A;  5AQP B;  2F1L A;  3VS2 A;  2FL7 A;  5GAN 3;  5FVL A;  2M9U A;  2EGA A;  1QVF A;  4DR2 T;  4A4K A;  1MNE A;  2KR3 A;  3SHW A;  3FBZ A;  2M51 A;  2DL3 A;  2EQJ A;  3MPU B;  2FBW A;  2LT3 A;  3CPF A;  5CCA A;  2LSY A;  1IAP A;  3P8C D;  2COY A;  2X4W A;  3ZFJ A;  2LT4 A;  2NW9 A;  3M9Q A;  3PIO A;  1YJ9 T;  4RTY A;  3QSU A;  2RI2 A;  4KGV B;  1MIY A;  1Z9Z A;  1IJ6 A;  3LGL A;  4LDX A;  2JZ2 A;  2OX7 A;  2QGS A;  4HXJ A;  5GMK i;  3OW2 P;  4DV0 T;  2RP4 A;  4LFA T;  4ZGD B;  2HSP A;  4PJO F;  1BR2 A;  1AD5 A;  2LHR A;  3RIA A;  3CCM Q;  1N34 T;  3UWN A;  2QDL A;  4AQY T;  4HKA A;  4P0A A;  4LUE A;  4IUP A;  4ZXL A;  3WAK A;  3ZN0 B;  1QWE A;  1GXI E;  2IG0 A;  2I59 A;  2PG8 A;  2FJA A;  3HP9 A;  3G6E A;  3G06 A;  4YJ3 E;  4ZZC A;  3CCS Q;  5GAN j;  2QTX A;  2YU2 A;  4XTZ A;  1M1F A;  3I5S A;  1EX4 A;  3I1A A;  1QUU A;  2C0I A;  2LX7 A;  4C92 G;  2RH2 A;  5LJM A;  4UC4 A;  4ILC A;  5A1L A;  2LX9 A;  4AQG A;  1RUW A;  3A1P A;  3DTO A;  4PFO A;  2QVA A;  4C5I A;  2QEX Q;  5LJ3 d;  2H88 A;  4LN2 A;  1YJW Q;  4AI6 A;  4HT8 A;  2YLB A;  2XHE B;  2L3P A;  4NL2 A;  1WR6 A;  4XQ3 A;  1WRD A;  2HEQ A;  1YI2 Q;  3C50 A;  3NGP A;  4IE0 A;  5FU6 C;  1OED B;  1S94 A;  1ZUY A;  3HTR A;  1SHG A;  4DBH A;  4X1Y E;  3LGF A;  5IAY A;  4X62 T;  3CCM A;  4KH1 B;  4J9E A;  5GJV B;  1VQ6 T;  5CJ5 A;  2H3E B;  3WVE B;  2MPX C;  5AQN B;  4BUG A;  1WXT A;  3P7I A;  1W4S A;  2KY9 A;  2K4Y A;  2LCL A;  2BE7 D;  5A2Q E;  1PNJ A;  1X2Q A;  3I56 T;  3KV9 A;  5JDG A;  1KD1 R;  4AG1 C;  1OEB A;  2E5K A;  2YXY A;  2O2O A;  3CCS A;  4LNP A;  1E6G A;  2DHR A;  2B86 A;  3OW2 A;  3AB3 B;  2HSE B;  3ZT6 A;  1Q86 C;  4UR9 A;  4XTU A;  4C92 C;  3L2R A;  3EHZ A;  4MML A;  4TN7 B;  2YRC A;  2K2V A;  1GCQ A;  3GN5 B;  3Q5D A;  3LBX A;  3CC2 Q;  1ARK A;  4FSS A;  2BS4 A;  2O31 A;  4HA8 A;  4XZC A;  2VL0 A;  5FXV A;  1AWJ A;  2ODU A;  1PSE A;  2QEX A;  3FXD B;  2RJE A;  5HKC A;  1HNZ T;  2PTF A;  2JTM A;  1YJW A;  3Q5E A;  1TUC A;  2MWP A;  4U31 A;  2IAK A;  2K3W A;  3EAE A;  4D8D A;  1YI2 A;  3ONX A;  4BI4 A;  3UT1 A;  3VKG A;  3EHR A;  1ABQ A;  3E19 A;  2DD5 A;  1NAF A;  2JMH A;  4IE5 A;  1HX8 A;  1W9R A;  4J9C A;  2K3B A;  3CMA Q;  3LDQ B;  5CAI A;  1T7S A;  2J62 A;  2LNV A;  1IHW A;  5LJ5 j;  5GAO l;  4DID B;  3UPU A;  4M77 A;  2CP0 A;  5AQK B;  2X4X A;  1OI1 A;  2LHN A;  2EQK A;  1PC0 A;  2N9D A;  1S1N A;  3IEE A;  2MAW A;  4GYR A;  1N8R U;  2RQU A;  2XAS B;  1OPL A;  4CXW A;  5LJ3 f;  4NL3 A;  2LSI A;  2OJ2 A;  4OMP A;  3PMT A;  1UX5 A;  3OYD A;  3UDC A;  4JV5 T;  3CC2 A;  3E0Z A;  4DV1 T;  2QAZ A;  4YTM A;  3AE6 A;  2BZB A;  1ZA1 B;  2WAU A;  4ZTF A;  2VC8 A;  3TLV A;  1WHK A;  3CME Q;  5JR9 A;  3S3N A;  3SWN C;  4B6X A;  3MJX A;  1U5S A;  2RD1 A;  4JRQ A;  3JCM J;  2AZS A;  4XU2 A;  3OA6 A;  1QP3 A;  1FMW A;  2CWO A;  2CZ0 B;  2KXC A;  3C0C A;  4ISS A;  3GNG A;  3OS1 A;  2G3R A;  2CYZ B;  2D5U A;  2JMC A;  2WZI A;  3PGG A;  4M78 D;  3CMA A;  5AQU B;  1IZN B;  2XM2 A;  9ATC B;  3AXJ B;  3UU6 A;  2RQT A;  2F5T X;  1YKE B;  4KBM B;  2H7V C;  4C8Q C;  1MND A;  5HK0 A;  3MK7 C;  3S3O A;  1U5P A;  3TEE A;  3ZST A;  3GPL A;  3PUG A;  4HFV A;  4YSX A;  1AEY A;  3QII A;  3K1S A;  4HCZ A;  3VJP A;  3X26 B;  1PSF A;  3THK A;  2J1D G;  1OU9 A;  4UVB B;  5IXB A;  3E08 A;  1WFW A;  2ZGW A;  3PJA J;  1N36 T;  4OGC A;  3ZT5 A;  1YCS B;  3TRE A;  5GMK m;  4IIO A;  2E9X B;  5C0M A;  2E70 A;  1UGV A;  2V8S V;  5CR2 A;  4KX6 A;  3QO3 A;  2RMO A;  2KYB A;  4J5Y A;  4C8Q A;  2LQW A;  1AVZ C;  3UUL A;  1QCO A;  4KRT A;  1BB9 A;  3AEC A;  2JS2 A;  2V6Y B;  3HKE E;  3V8K A;  3CD6 T;  2PQW A;  2A7Y A;  4OML A;  3CML A;  4C0G A;  1ZEE A;  3N5L A;  1VQO T;  2JIW A;  5KCO A;  3JCM W;  2VKH A;  5DM7 R;  1JNR A;  4NOY A;  4WF2 A;  4BJN A;  2CZ6 B;  7AT1 B;  3M59 A;  1K8A C;  4H9N C;  5GAN e;  4U74 A;  5JVD E;  1KC8 R;  5LJ3 g;  1XWM A;  1BI2 A;  5HXE A;  2L5Q A;  5IN1 A;  5KX5 E;  4FW2 A;  3AHU A;  4J9D A;  2EFI A;  1UGP B;  3VR9 A;  3NTK A;  4E7L A;  2LSJ A;  5I22 A;  2I6H A;  2DVE A;  2RHU A;  1HSQ A;  2LOP A;  2YKS A;  1WXU A;  5HWY A;  2KSR A;  3FZM B;  1LCK A;  2D0Q B;  4M75 D;  5KMG P;  2NUZ A;  1HG2 A;  3NZP A;  4WBN E;  3OSS C;  4EMG A;  4JS5 A;  4XTV A;  3TCJ A;  2HD0 A;  5AYF A;  3WI3 A;  1W6X A;  4U2Y A;  1AWX A;  3JCM V;  4A5X A;  3UFG A;  4PJL A;  3L1A A;  3C4Z A;  2EYX A;  2EQM A;  1JJ2 P;  1K4U S;  2KE9 A;  4ELZ C;  3HKD E;  1YHQ T;  2FZK B;  3CQC B;  2HPJ A;  3FZH B;  1U4Q A;  5EK2 A;  3UU8 A;  3OMG A;  2I0M A;  3EG2 A;  1T3S A;  3M65 A;  4A98 A;  5FY1 A;  2CDT A;  2BIV A;  4EIW A;  2BS2 A;  1T0H A;  1TH7 A;  5KYU A;  2JS0 A;  4U7I A;  2PTK A;  2QG9 B;  3W15 B;  2MWO A;  5FVK A;  4EDU A;  2XK0 A;  5JDF A;  1D09 B;  2HMA A;  4IDZ A;  3VRZ A;  1LNX A;  4BB7 A;  2UXB T;  1U3O A;  3QK6 A;  3R6N A;  2A0F B;  4JI1 T;  2L3R A;  4IUV A;  2YN6 A;  2DZC A;  3G71 T;  3PUV F;  3OBV E;  4DOV A;  2IHR 1;  4H9R C;  2BZY A;  1D0Y A;  4HWH A;  3M0P A;  4EXT A;  3JV3 A;  3QG1 A;  2WSF E;  1AOJ A;  2HKQ B;  1WLX A;  4AMC A;  1QQJ A;  1ZKE A;  3UUN A;  5LJ5 e;  4JS4 A;  4HFC A;  3ETV A;  3ZYM A;  4M77 E;  2D8H A;  5DQV A;  3OS0 A;  3LK4 2;  4I4T E;  3IQL A;  4WTO B;  3AEB A;  2DTH A;  2KMF A;  5FRM A;  3OYL A;  5CKF A;  5AQQ B;  1H3H A;  4DEY A;  2PNI A;  3RYI E;  4YY3 T;  4M78 G;  2V7K A;  2DLR A;  1O9S A;  5KYY B;  1D1C A;  2HAX A;  3H9N A;  4IDO A;  4QVZ A;  4DR5 T;  5GAM g;  2DL5 A;  1R8I A;  4O4J E;  4UV9 B;  3JCF A;  5J2T E;  4QT7 A;  5GAN 4;  1JJ2 A;  3J7Y q;  2VVS A;  1US7 B;  3REA B;  1FMK A;  1CHU A;  2AT1 B;  1HTJ F;  1O3X A;  4DR6 T;  2KWI B;  4JI3 T;  3G7Z A;  4Z88 A;  1AWO A;  2XPK A;  4I0U A;  1GRI A;  1KD1 C;  2YDS A;  3RH3 A;  4DBF A;  4EMH A;  1W09 A;  2CBI A;  2YIN A;  2ZM2 A;  4UIG A;  4Z8X A;  2CT4 A;  2L8D A;  4XU0 A;  1Z0P A;  1VQK Q;  2JT4 A;  4X34 A;  4Z89 A;  4MLK A;  2V8K A;  3LFM A;  4C5E A;  2ATC B;  2CP6 A;  2K5L A;  2WSE E;  2YHT A;  2LCS A;  3OYB A;  1ZHI A;  1YKH B;  1JQQ A;  4IDQ A;  4QKU A;  4GKJ T;  2J6K A;  3X24 B;  5HEU A;  1W70 A;  4DVD A;  4DND A;  2AXD S;  3L39 A;  4BA9 A;  3UU3 A;  2O9S A;  5GAO r;  3HSB A;  1X69 A;  3EH2 A;  3ZSS A;  4M7A D;  5AT1 B;  3MCA B;  1GFC A;  1M27 C;  1Q82 R;  3FZK B;  1VQ9 T;  4TWH A;  2HL3 A;  2XHC A;  3JAD A;  3SEM A;  4E7Z A;  4OMO A;  1ZUU A;  2QA7 A;  3EH1 A;  2LQ8 A;  3EFO A;  4IE4 A;  4HVV A;  2A3L A;  5ABF B;  1QSD A;  2COZ A;  3LBX B;  2DI4 A;  4CN6 A;  2MOX A;  3CCV T;  1VQ7 Q;  5FU6 B;  1RI9 A;  4LD6 A;  3V7C A;  2CHN A;  2JRK A;  4ZI3 D;  3B57 A;  4TNW A;  2E3I A;  4DUZ T;  4C8Q E;  4IDN A;  1YN8 A;  5KYW A;  2UXN B;  1Y7X A;  3A7M A;  1VQK A;  4ZHQ E;  4BI3 A;  2ED1 A;  5CKH A;  4Z02 A;  2RHI A;  1C6V X;  2VQE T;  2FJD A;  2ABL A;  1UG1 A;  2IIU A;  3GN5 A;  5ABE A;  1AZG B;  1QKX A;  1RL2 A;  4HCC A;  2LQN A;  3PUA A;  2QQS A;  3KV5 A;  1VQ5 T;  4M75 G;  1YXR A;  2JPF A;  5IH2 A;  1TWB A;  4U2Z A;  4C92 B;  3CCQ T;  3P50 A;  2KYM A;  2E41 A;  2JQH A;  2LJL A;  2RQV A;  2XAH B;  4PJJ A;  3RKO A;  4DR7 T;  4AKH A;  4I43 B;  3S4U A;  3L8R A;  2DIG A;  2FRW A;  1HJD A;  3ME9 A;  3QC9 A;  2VL8 A;  3JB9 I;  3A5X A;  1WYX A;  3OYI A;  2J4G A;  3PUQ A;  2RI5 A;  1MGQ A;  1VQ7 A;  3CCE Q;  4ZN3 A;  4E47 A;  2YEV C;  5AQL B;  1TG0 A;  1KNR A;  4G63 A;  4GK5 E;  4N4H A;  2QXF A;  3QZ9 B;  4OMQ A;  3MEA A;  4RUG A;  2FB7 A;  3AA0 B;  2KZ7 B;  4X5T A;  1UE9 A;  2C5J A;  1LKX A;  2SEM A;  2LVM A;  3VKI A;  3JCM c;  4CRI A;  4C92 F;  2ESW A;  2K79 A;  2EGE A;  1H3Z A;  5HAX A;  5KDM C;  2X3W D;  2CEA A;  4YSZ A;  2CKK A;  3HL6 A;  5C8Y E;  2LJ3 A;  3HRU A;  2JTE A;  2J05 A;  1VQN T;  3JAF A;  4PLL A;  2KRM A;  3ETU A;  5IHY A;  2F2V A;  2EYY A;  5LJN A;  5IHI A;  2IML A;  4GK0 E;  5L3G B;  2CSI A;  1BIB A;  2WMN A;  2L2P A;  4B9X A;  1WZO A;  4JUY A;  3PUS A;  2KXP B;  1E2A A;  1VQL Q;  1OUL A;  1G3W A;  2X35 A;  1Y01 A;  3GLX A;  1Y64 B;  1X01 A;  1RAI B;  3SWN B;  3JC6 D;  3PVQ A;  1MV3 A;  3PMI A;  4KI0 F;  2E9X C;  5KXJ A;  2QGG A;  1NLP C;  3M56 A;  3CCE A;  3F57 A;  1JO8 A;  1KNP A;  1QCF A;  5FP3 A;  5GAN 2;  2BZ8 A;  5A0L A;  4N4I A;  3JAE A;  5TAO A;  5FNV E;  2JMK A;  2RB6 A;  1BBZ A;  2D2S A;  2YK0 A;  3OBW A;  1W0A A;  2DER A;  4HWC A;  4OFZ A;  3AE7 A;  1GFD A;  4JBW F;  5FL1 A;  1QVG S;  3TLT A;  2K3X A;  5CVI A;  3N9N A;  3CKD A;  1I8F A;  1KC8 C;  2AZV A;  5HXH A;  3N9L A;  2LE8 A;  4EEB A;  5LYJ E;  3RMQ A;  4C8Q B;  4XU3 A;  3BDL A;  1ZOY A;  4LF6 T;  2ZMA A;  4KHZ F;  3U23 A;  3OTO T;  2I0N A;  3MEV A;  2DL8 A;  4CZZ B;  1X27 A;  4LD9 K;  3G4S T;  1UK5 A;  2E9X A;  3QHS A;  1MUZ A;  4OYK A;  2DET A;  5L2L A;  3ASK A;  1R0B G;  5EK4 A;  4CI0 C;  1VQL A;  4AXP A;  2E1H A;  2EHO D;  1Y71 A;  2KI7 A;  3SD4 A;  3CX6 B;  1L0V A;  4MAL A;  2FVU A;  1KG1 A;  2Y48 B;  4EGW A;  1HNW T;  3OYZ A;  1IRE B;  3F70 A;  4F7U A;  2XY8 B;  3RF1 A;  5EG2 A;  3UF4 A;  1B07 A;  2DIL A;  4C8Q F;  2Z0W A;  3UTK A;  4QX7 B;  3JB9 D;  2HL5 C;  4M7A G;  4OMM A;  1MMN A;  3RRC A;  4DBR A;  3P8B B;  2KBT A;  1IJ5 A;  2CZ7 B;  2DYB A;  1UUS A;  2JNG A;  4B6M A;  4KGX B;  1YHQ Q;  2LDM A;  3ESL A;  5D6Y A;  2QTV A;  1YP5 A;  5IWA T;  4GLK A;  2NWB A;  2XAQ B;  3X28 B;  4F14 A;  2BUD A;  4ANJ A;  1X9B A;  4EYU A;  2WDQ A;  4LXC A;  2MCN A;  4PL6 A;  2W0G A;  2QAS A;  3UAT A;  1W2B S;  2RA1 A;  4WYV A;  1OU8 A;  5FXZ A;  1YCY A;  2RNA A;  3PTR B;  1BI3 A;  3LSV A;  2KXD A;  3QWX X;  1CKB A;  2W63 A;  4A4G A;  3SDZ A;  3VHL A;  1XNQ T;  2WM9 A;  2CRE A;  3NVO A;  1WX6 A;  4X1K E;  3CCL Q;  4ZEY A;  2VKD A;  8ATC B;  2GK9 A;  1J5E T;  1MIW A;  1UCU A;  2A36 A;  2JQQ A;  3GNF B;  5KYU B;  4ZGE B;  5FXX A;  4ZI2 C;  3RUX A;  4FIB A;  4EIK A;  2BS3 A;  5LA6 E;  2J47 A;  5DY9 A;  3QOF A;  1D1A A;  3VYH B;  2UXD T;  2DNU A;  4DMW A;  1UUR A;  3VS0 A;  2VUR A;  1Q7Y U;  2QA4 T;  1VQ4 T;  1TXQ A;  4CN1 A;  2SRC A;  5I2M A;  1WDX A;  2F5K A;  2JVV A;  3PUZ F;  4GY5 A;  2HBW A;  1K9A A;  3QDF A;  4M7D G;  2E5L T;  2WDR A;  3UU5 A;  3V5S A;  2JW4 A;  4ZI3 C;  3QDR B;  5I21 A;  3O1I A;  4KUL A;  3REB B;  2BDE A;  1CUN A;  3V7S A;  3AA6 B;  1YBY A;  2WU5 A;  1I5L A;  1VYV A;  2LM9 A;  4XU1 A;  4A4H A;  3CC4 T;  3QYH B;  2E6Z A;  1RAD B;  3F31 A;  1NJI U;  5LMN T;  2LJ1 A;  1AT1 B;  1HX1 B;  3Q5W A;  4OB3 B;  3CCL A;  2XQ8 A;  2HZY A;  3RYH E;  2RA2 A;  3A8L B;  4KH0 B;  1VQ8 T;  5L4E A;  4XTW A;  1SA0 E;  1YIT T;  2MBG A;  1EZZ B;  1G3S A;  2GFA A;  4QQG A;  1S72 T;  4FYV B;  3FLG A;  2HPL A;  3LLR A;  1G3T A;  3H6Z A;  4DEX A;  5C3J A;  3EGD A;  2CLY C;  1KSW A;  2QQR A;  3FHN A;  1VQP Q;  2LRL A;  3IA3 A;  3CXC P;  3P4P A;  3AVR A;  2XQY A;  2PUK B;  4QW2 A;  2UUC T;  5KYY A;  1IGU A;  4WBO A;  4PFP A;  2YUN A;  1Q82 C;  2Q9Q D;  2OAW A;  3ZYK A;  2W62 A;  2ZPF B;  3WXM B;  1XDP A;  4LFB T;  3KFV A;  2CT3 A;  3EAM A;  2A72 A;  4M7D C;  5EK3 A;  2B8A A;  2DEQ A;  3I0O A;  5CKD A;  5ETW A;  4Q5W A;  3L2U A;  2L0A A;  5L3D B;  2XQ4 A;  3AE8 A;  2Y6X A;  5F3J A;  2P4T A;  5E0O A;  4NS5 A;  4TV9 E;  2UXC T;  1M3A A;  1PKS A;  5GAN 7;  3EHQ A;  3ONJ A;  4HE8 A;  5ABH A;  2D9D A;  2GBQ A;  2V5C A;  3RC3 A;  1YWO A;  3K3N A;  4X9C A;  2JJ9 A;  2RJF A;  1H64 1;  4C0D C;  1Q95 G;  1P92 A;  5JTG A;  2XU8 A;  4AQF C;  2FRY A;  3CXC S;  3VRB A;  5L3C B;  3RIF A;  1FXX A;  4K11 A;  3E2U A;  2Y4X A;  1CSK A;  1AHJ B;  4NUV A;  1U06 A;  2EBP A;  3EFO B;  4ESR A;  4M7D A;  2RF0 A;  4H9O C;  3FB2 A;  3CC7 T;  1VQP A;  2LM2 A;  5FY7 A;  4C90 A;  4YFS A;  3KBG A;  2KDS A;  4IUU A;  4R55 A;  5HXC A;  5AQS B;  2FPF A;  4LE9 A;  3CK6 A;  1JXM A;  4RTX A;  4DR3 T;  2IDO B;  4QX8 B;  3QJY A;  3NKZ A;  5KYW B;  1FIO A;  4PJO D;  4CC7 A;  5FL0 A;  4ZS2 A;  4EED A;  4Q25 A;  3MA9 A;  3JB9 G;  2NW8 A;  2YDL A;  1Y0M A;  5GAM j;  5ABF A;  2KRO A;  5L47 A;  2XAG B;  1Q7Y R;  3V5U A;  2LJ0 A;  2NYS A;  1M1K U;  3CXC A;  1KHC A;  1PHT A;  2XI9 A;  1E6H A;  4YXD A;  1SKU B;  4DOW A;  1UJ0 A;  2XJ7 A;  3GWH A;  1X6O A;  2DXB A;  2FPE A;  2ROL A;  4FSX A;  4F7U E;  2GNC A;  2VKJ A;  4LF4 T;  1JBM A;  1Z9Q A;  1NPR A;  2W0Z A;  2CRB A;  2PU9 B;  1VQN Q;  3K3O A;  3GBQ A;  3NPF A;  4C92 A;  2Z6E A;  4IUR A;  4HWF A;  1NJI R;  4QVC A;  4ATO A;  2XMF A;  3HL8 A;  3QPH A;  2NUT A;  2RJC A;  2ZPB B;  1WYB A;  2ZLY A;  2DBM A;  5C2T A;  5GAN d;  1YQ4 A;  4UVA B;  5GON E;  1FYN A;  2KK4 A; 
#chains in the Genus database with same CATH homology
 1ZBX A;  1M90 U;  1M1G A;  4KP3 C;  2VUB A;  4FT2 A;  4UF0 A;  3UFE A;  2YU1 A;  1FX7 A;  2P0Q A;  1SHZ C;  1KHI A;  2ZPH B;  3UUM A;  3ZC1 A;  3CCJ T;  3BFM A;  2RHY A;  3T8O A;  4EAH A;  4D6W A;  4BJM A;  5LOV E;  4JLG A;  1JB0 E;  4Y28 E;  1G73 A;  5JDL A;  2RI3 A;  2PVG B;  3MP8 A;  3OSV A;  5GAN h;  3KBT A;  3TKL B;  1WQW A;  3OYG A;  3SWH A;  2CWY A;  4EOZ B;  3KV6 A;  3QYG B;  3LK2 B;  4L5G A;  4H63 H;  1EIF A;  3SB2 A;  3VYG A;  3J81 E;  2V7L A;  1I4K 1;  4DMV A;  3O1H A;  1V9D A;  2DXU A;  3M54 A;  4OVA A;  5HXS A;  4RCC A;  2Y90 A;  5J1G A;  3SWN A;  5LGU B;  3ANW A;  3I55 T;  1WYC A;  2JTF A;  2GF7 A;  2LQK A;  5LHG B;  3NRX A;  1LRZ A;  1WPY A;  3CME A;  1WJQ A;  2LC4 A;  1N27 A;  1HG5 A;  4PAG A;  3SRZ A;  5IYZ E;  4MZM A;  5FU7 C;  1YJN T;  4C5H A;  5GAN f;  4DA4 A;  4PW8 A;  5LJ5 d;  4OMF B;  1U8R A;  3ZCJ A;  2H7O A;  3CCU T;  1NWM X;  4F7U B;  1LJO A;  3ZN1 B;  3C95 A;  3EDU A;  1M5Q 1;  4ZTJ A;  3CCR T;  5GAN 8;  4AKR B;  2CM0 A;  3DJB A;  2WSS V;  4H63 V;  3H3A A;  5F8P A;  5LJ5 h;  3OY9 A;  3VKH A;  3A8O B;  4OYJ A;  3NTH A;  3PUR A;  3J7A F;  3C12 A;  3BW1 A;  4F7U F;  4PJO G;  3MAC A;  4HCB A;  5D6X A;  3IBP A;  3HI2 A;  4BE1 A;  1U1S A;  1VIF A;  3KUF A;  1BIA A;  3CPW S;  3L09 A;  4JLI A;  4XAX B;  3OQ5 A;  1MMD A;  2A2F X;  3FEO A;  3UT5 E;  2E64 A;  4O6J A;  2VK9 A;  5CIU A;  2EYQ A;  3RYF E;  2RO0 A;  3AAI A;  2OTL T;  4BI8 B;  2DXT A;  3LWH A;  3SOL A;  4PK5 A;  4HEA A;  5GAM e;  1YIJ T;  2V7J A;  5LJ5 f;  1VRB A;  4J6X A;  5GAO m;  1D1B A;  3QJ6 A;  2LRQ A;  4O2B E;  1BR4 A;  3CPW A;  1YW0 A;  4M7A B;  2CCQ A;  1VQM A;  2OTJ A;  3ZMS B;  4HKE A;  2RHZ A;  4PLI A;  4C92 E;  2XKO C;  2KND A;  2QDY B;  5JQG E;  2X4J A;  5C6S A;  4QXC B;  5CK9 A;  3JRZ A;  2IVW A;  1YJ9 A;  1HK9 A;  4EPC A;  3HKS A;  1HS7 A;  4M7A F;  1KNZ A;  4ADZ A;  5DAB A;  2E12 A;  2VYT A;  3NRY A;  5LXT E;  3U3I A;  3T9N A;  4WNK A;  3H37 A;  3LX7 A;  3S6W A;  4QWN B;  3ZEF B;  3G6E T;  4IUT A;  5DJQ C;  2XUE A;  2CLY B;  4UVC B;  5A0G A;  4E7J A;  1VUB A;  2RK2 A;  5LL6 S;  3J9X 1;  4YJ2 E;  2CXL A;  4WW0 A;  1Q7Y C;  4OB1 B;  4M7D B;  2V1D B;  4RG2 A;  1G3Y A;  4R56 A;  3CBO A;  3IF8 B;  3MEW A;  4M78 C;  2R58 A;  3OYK A;  2E6N A;  5HXR A;  3A8G B;  2AHJ B;  4J8O A;  2GCX A;  3JCM e;  1D0X A;  4C0D B;  5I2S A;  4E7S A;  3CCM T;  4UEM A;  3PTA A;  4TZ4 C;  4OHF A;  3PFS A;  1NJI C;  1VQ6 A;  5FRO A;  4LDU A;  5JH7 E;  4M7D F;  3CCS T;  4P0B A;  5LHH B;  3I56 A;  1KQS S;  1FMV A;  3CBP A;  2CA5 A;  4M78 A;  2EAY A;  3HKC E;  3QBY A;  5IT9 E;  2K9A A;  2NOX A;  4E7I A;  3DLM A;  2D0U A;  2QEX T;  4IIJ E;  4A54 A;  1K73 U;  1YJW T;  1QVP A;  5HYA A;  3MEU A;  4A53 A;  1YI2 T;  4TV8 E;  2VGM A;  1VOM A;  4XTY A;  4LDW A;  4E7K A;  4GIW A;  4MDX A;  2DXC A;  4UF0 B;  4JEU B;  4ELY C;  1MHN A;  2SPC A;  3PNW C;  3URG A;  1LOJ A;  4J83 A;  1G8X A;  4QXB B;  5JDN A;  2XID A;  1MIV A;  2LSG A;  2CZ1 B;  1M9S A;  4P09 A;  1BI0 A;  2XIC A;  3N9O A;  5FXW A;  3E9G A;  3CC2 T;  3PE0 A;  4RKU E;  3C51 A;  3MZK B;  4UEL A;  4M75 C;  3JCM X;  5FRN A;  1QP2 A;  2NLU A;  3ZBD A;  3I9Y A;  3I9W A;  4OP0 A;  2L8K A;  2CS7 A;  2CXF A;  5M4Y A;  1WJR A;  4N4G A;  3QUI A;  3CMA T;  1MMA A;  2MI6 A;  1K8A U;  4HT9 A;  3ANW B;  3ZPO A;  4CI3 B;  2EJG A;  2B1E A;  1BI1 A;  3MET A;  1M1K C;  2K3Y A;  3R84 B;  4AKI A;  5L3E B;  4M75 A;  2GFU A;  3OYJ A;  3U78 A;  3JB9 F;  2KVQ G;  1KQ1 A;  2M0O A;  4BD3 A;  4J6W A;  2XAF B;  2FHD A;  5GMK j;  4ZS3 A;  2E65 A;  1AJ3 A;  2LCC A;  3ZMU B;  3N5B B;  3RPU A;  3GMI A;  4PK4 A;  4TX5 A;  4O5V A;  3A8H B;  1N8R C;  4M77 D;  5KH6 A;  5J26 A;  3AAA B;  1M90 C;  3N9P A;  3NBX X;  1BR1 A;  3CX7 B;  2M16 A;  3LG7 A;  5LG4 A;  2D6F A;  3CD6 A;  5FU7 B;  3ZJ1 A;  1QVG A;  3F2E A;  5M9O A;  2KMT A;  5LHI B;  2F69 A;  3M4G A;  1VQO A;  4EB6 E;  2NW7 A;  3HHT B;  2EWN A;  4PNI A;  4F6R C;  3VU3 C;  2C06 A;  4TUY E;  2O4X B;  2Y4Y A;  4RCB A;  2LT1 A;  3OYX A;  2OAU A;  4BAC A;  5CB4 E;  2LSK A;  4CQI A;  2X9H A;  2ZZD A;  1R8O B;  3N2O A;  3OBY A;  3QXE B;  2L9Q A;  4IUQ A;  2RM4 A;  4MBQ A;  5KCH A;  2KIN B;  4M7A C;  3BY7 A;  1HF8 A;  1YHQ A;  1QVF S;  3E9F A;  2G0U A;  4HTE A;  2VKO A;  1OYX A;  5HK3 A;  1W2B A;  4M78 E;  4C8Q D;  4KT0 E;  5HWX A;  3EFR A;  3MO8 A;  5LJ3 j;  3RKW A;  1K9M U;  1BR0 A;  4OB0 B;  3GP8 A;  1D0Z A;  4O4I E;  3RKX A;  4EMK B;  1LVK A;  2D0T A;  1UB4 A;  3V8L A;  5FYM A;  4M7A A;  2LOS A;  2K5F A;  5BMV E;  3G71 A;  2ACX A;  1NPP A;  3QUJ A;  4BE0 A;  4LDY A;  3GIB A;  1N9S A;  3KBU A;  4CXX A;  3RKY A;  2V8J A;  3C4X A;  3FB9 A;  3FRN A;  4IE7 A;  4JLE A;  2DKG A;  2EKO A;  2JOY A;  3KVA A;  3P8H A;  3DLL A;  4DBQ A;  3MP6 A;  2DK3 A;  3OYH A;  3ZMT B;  4HGA A;  5GMK l;  2PVD B;  3KVB A;  4ZOL E;  2CGH A;  4BY6 C;  4O8S A;  3HKB E;  5LGT B;  3HFN A;  1BKB A;  5JDM A;  2DCF A;  3Q1J A;  2MTQ A;  5L8R E;  2X9W A;  3OS5 A;  5GAN 6;  3MKD A;  3FC3 A;  3CEY A;  3OYE A;  4M77 G;  1MMG A;  2VWA A;  2EJF A;  3OYC A;  2EQU A;  2W00 A;  3OW2 S;  4M75 E;  3RYC E;  5H6R B;  3RIR A;  4L59 A;  1OWA A;  4KUM B;  3JC6 C;  4EZH A;  2VXE A;  5GAO n;  1WQ7 A;  5CA0 E;  1VQ9 A;  5GMK e;  1FWZ A;  4M78 B;  3RER A;  5JRE A;  2QQA A;  2WSC E;  4AQF A;  3CPZ A;  4H9P C;  3CCV A;  1Q81 U;  3CBM A;  4ERR A;  3L3P A;  4QHO A;  2QQB A;  5LGN B;  1VQK T;  5LJ3 h;  2HH7 A;  2VV5 A;  5AFU L;  4MZT A;  4O4L E;  2H3R A;  4UXN B;  4M77 C;  4IKF A;  2VXF A;  2R57 A;  4MDW A;  3OYM A;  4JEH B;  2MMP A;  2DWK A;  4JUV A;  4OGE A;  1N9R A;  4M78 F;  1VQ5 A;  2IC6 A;  2EHO C;  2MOZ A;  3OKQ A;  3CCQ A;  4GYS A;  3GOX A;  4PJM A;  2X9Y A;  1KC8 U;  4JDS A;  2RHX A;  5JR9 C;  1VQ7 T;  3O9X A;  3JAM E;  3AA7 B;  3LH0 A;  2V26 A;  4J6Y A;  4IGU A;  3HRT A;  2QI2 A;  4C8Q G;  1Y96 B;  3INZ A;  2EHO A;  3LJC A;  2R5A A;  2E8I A;  1Y07 A;  3N2G E;  1ZV4 X;  2V7I A;  3OB9 A;  3HPW A;  3RC8 A;  2HNI A;  1VQN A;  3RX6 A;  3HFO A;  2K48 A;  5LBQ B;  4MZP A;  5LBM A;  3GA8 A;  3NTI A;  3BQL A;  4M75 B;  2P0K A;  5CQY A;  3L2Q A;  5LJ3 e;  5GAM d;  4NUU A;  5LCY A;  4UV8 B;  2D9T A;  2DTI A;  5FY0 A;  4ASK A;  3CCE T;  3LK3 B;  3BQK A;  1K73 C;  2WBL A;  2LTO A;  2MF2 A;  3V7R A;  1XQH A;  2M1H A;  4M7A E;  2X9X A;  2C5I T;  3RRW A;  5LNK A;  1RI0 A;  2N1G A;  5L3B B;  2WAC A;  4KUD K;  2OA5 A;  2KAF A;  3WAJ A;  3ZJ2 A;  4L0R A;  2O01 E;  3SFM A;  5GAM h;  2CMR A;  4M75 F;  4II1 A;  5JDH A;  2KWH A;  1UGS B;  5GAO p;  2HQE A;  3OJA A;  3OYN A;  5FLX E;  3G4S A;  4IHJ E;  2BKD N;  2CXD A;  4MHC A;  4A56 A;  5GAO q;  3M53 A;  3N9Q A;  3OYF A;  4XTX A;  3K3Q C;  5GAN 5;  3CWZ B;  1VQL T;  2ZM8 A;  4N78 D;  1QW1 A;  2X0L B;  1N6A A;  5J2U E;  2V7M A;  2GQV A;  3X25 B;  5JDQ A;  3QZ5 B;  3RES A;  1UGQ B;  2RJD A;  2BVL A;  3N9M A;  2PBI A;  2JUF A;  4BDZ A;  2KSS A;  4L9I A;  2Q9Q C;  3L2W A;  3S3M A;  2PVO B;  3E1S A;  4RG8 A;  2H3J A;  4IST A;  1HXD A;  1U1T A;  2O4X A;  2NP9 A;  3M5A A;  1NE8 A;  4A4E A;  2R5M A;  5GAM f;  1B7T A;  2ZPG B;  2A3D A;  1X79 A;  4VUB A;  4N0A C;  4M7D E;  3DB4 A;  3L2V A;  3BDU A;  4X9D A;  1NZ9 A;  3V8J A;  1M8V A;  1XTD A;  2E10 A;  4L6V 5;  4IE6 A;  5CKE A;  3NFC A;  4TVR A;  4J2C A;  2IC9 A;  4ILU A;  2DPP B;  2Q9Q A;  4OK0 A;  3JCM d;  3PT9 A;  3GF5 A;  4V2S A;  2WWU A;  2XDD A;  2WMO A;  4BE2 A;  1Q82 U;  4EMK C;  4PKC C;  2YRV A;  3ZC0 A;  3CVR A;  4J7I A;  4N0A A;  2E9X D;  4PJO C;  5J3B A;  3K8P C;  3EFS A;  4EZ4 A;  3L2Z A;  3FXE B;  3Q9D A;  4FT4 A;  5JRC A;  5GAN g;  4FI5 A;  1XOV A;  2QA4 A;  3R6O A;  1VQ4 A;  2DD4 A;  3ER0 A;  3JCM h;  4FL6 A;  2HQX A;  1SSF A;  1D3B A;  3C98 B;  1B34 A;  1WNL A;  4C5G A;  1KQ2 A;  2ES0 A;  4EMK A;  3Q5X A;  2DIQ A;  4XBF B;  3HR0 A;  2XDP A;  4C91 A;  2QQ9 A;  3CC4 A;  3CCL T;  1JJ2 S;  1UGR B;  4PJO A;  2C5K T;  4ME7 A;  3FBL A;  2K24 A;  4H9S E;  2KLQ A;  2MYS A;  1VQ8 A;  5FMN A;  2RK1 A;  3MHX A;  5L3F B;  1YIT A;  1S72 A;  3DKM A;  1Q86 U;  2YLC A;  2K57 A;  1O75 A;  3A8M B;  3RMS A;  3J80 E;  3C4S A;  2FYK A;  2DAQ A;  5DLO A;  2X66 A;  3H8Z A;  4YHJ A;  3C94 A;  2NTX A;  3JCM f;  3OS2 A;  1XNI A;  2HBP A;  4Y91 A;  2XTL A;  2K5B B;  3O4X E;  3TU4 K;  3PIP A;  3EDV A;  5EZY E;  3A5Z B;  3VUZ A;  4BAY B;  4QQ6 A;  4O4H E;  2N2N A;  2ZCF B;  4QVD A;  2ODV A;  4JJN K;  1K9M C;  2P9B A;  4BY6 B;  4X20 E;  3FJP A;  4PK6 A;  3BK9 A;  5LJ5 g;  3KDS E;  2BVM A;  1VQP T;  4MFR A;  1OZ3 A;  4HN9 A;  3CC7 A;  2L3L A;  1BYM A;  4ZI7 E;  4ZI2 D;  3MP1 A;  3LWI A;  3JCM P;  3WVD B;  4QQD A;  2DWG A;  2NTY A;  5CA1 E;  3C64 A;  1EZ3 A;  1HFA A;  4MMK A;  3LYI A;  2DO3 A;  4EYY R;  2ZM0 A;  3HRS A;  1DJ7 B;  3JCM b;  3CQX C;  3I0Q A;  3M57 A;  4JRI A;  4KUI A;  3JCM Q;  4OF1 A;  1ZQ1 A;  4PNO A;  1V29 B;  1OXZ A;  3IHR A;  4KMC A;  4J7F A;  4CI2 B;  1WJS A;  2MAM A;  1KQS A;  3AA1 B;  4OB2 B;  4U72 A;  1ZHC A;  3N2K E;  5KE3 A;  4M77 B;  1FEW A;  4C0Z A;  3MXZ A;  4CI1 B;  5A0D A;  2DTO A;  5LP6 E;  2EHO B;  3P8D A;  3VUB A;  1YD8 G;  5CKB A;  3JCM g;  3M58 A;  2KQW A;  2LEH A;  2X4Y A;  4E7H A;  3CCJ A;  4B9W A;  4M7D D;  5D6W A;  1LVF A;  1Y96 A;  4XK8 E;  5JR9 B;  1OZ2 A;  3ZCI A;  2PJQ A;  3L42 A;  1X75 C;  4FM4 B;  4M77 F;  5J39 A;  4F7U G;  4A4F A;  4M1P A;  2JN0 A;  2VAS A;  2Y8D A;  1Q81 C;  3VU7 H;  2CE7 A;  3ZYL A;  2M67 A;  1T98 A;  3JB9 J;  2PFV A;  3ZMV B;  5CQX A;  4GOU A;  2P0P A;  4P5N A;  5HY6 A;  4JRK A;  5DLQ E;  5ADX L;  3OYA A;  2W61 A;  2E5Q A;  3I55 A;  4AKG A;  4FJO A;  3D0T A;  4O2A E;  3CME T;  3KXT A;  4YTL A;  3AVS A;  4C92 D;  1KK7 A;  4K0U A;  3O8V A;  3SS1 A;  2XDB A;  3DP7 A;  4PJO E;  1S35 A;  2ZPI B;  3OYY A;  3KIN B;  2XAJ B;  4JRP A;  3C4W A;  1YJN A;  5H6Q B;  3JB9 H;  4QXH B;  1M4Z A;  4G2A A;  3OMC A;  3CCU A;  5KE2 A;  3DB3 A;  4ZN1 A;  4H9Q C;  1E1H B;  3ZMZ B;  4PJN A;  3BQI A;  3VV0 A;  2K5I A;  1UEB A;  4I55 E;  1WGS A;  4RMO A;  3CCR A;  3JSC A;  2IW5 B;  3QKJ A;  5DQW A;  2UXX B;  2EIF A;  2V8I A;  2C0S A;  3ZLI A;  3ZEH A;  2X68 A;  1H7C A;  2DZ9 A;  4V1A v;  4AKL A;  4BDY A;  2X67 A;  2DNX A;  2KT9 A;  3PU3 A;  4LDV A;  4X1I E;  3FIF A;  2L89 A;  2VGN A;  1HCI A;  2Q9Q B;  3PDY A;  1JRI A;  1IZ6 A;  4FU6 A;  3CQG B;  3Q2M A;  3EUH A;  3M55 A;  3FDR A;  2XD0 A;  1G5V A;  2PUO B;  2I2L A;  3E22 E;  3PU8 A;  3CX8 B;  2OTL A;  4YLH A;  1I81 A;  2XG8 D;  5JRC B;  2ZPE B;  4DQ2 A;  3O1J A;  1KD1 U;  3UUX B;  1UX4 A;  3LW5 E;  4DO0 A;  5CO7 A;  3KFW X;  1YIJ A;  3EVY A;  2EJ9 A;  1D3B B;  4QKN A;  3M4Y A;  4ZGJ B;  3KV4 A;  1B34 B;  4I50 E;  4CXY A;  2X51 A;  3B13 A;  3NZQ A;  1VIE A;  2DJZ A;  4C0F A;  3HA4 A;  3X20 B;  1VQM T;  2OTJ T;  2VB6 A;  4PJO B;  5GMK h;  3AAE B;  2FL7 A;  5GAN 3;  2M9U A;  1QVF A;  4A4K A;  1MNE A;  3FBZ A;  2EQJ A;  2LT3 A;  3CPF A;  5CCA A;  2LSY A;  1IAP A;  3P8C D;  2X4W A;  3ZFJ A;  2LT4 A;  2NW9 A;  3M9Q A;  3PIO A;  1YJ9 T;  3QSU A;  2RI2 A;  1MIY A;  1IJ6 A;  3LGL A;  4LDX A;  2JZ2 A;  2QGS A;  5GMK i;  2RP4 A;  4ZGD B;  4PJO F;  1BR2 A;  2LHR A;  3UWN A;  4HKA A;  4P0A A;  4IUP A;  3WAK A;  3ZN0 B;  1GXI E;  2IG0 A;  2I59 A;  2PG8 A;  3HP9 A;  3G6E A;  4YJ3 E;  5GAN j;  2QTX A;  2YU2 A;  4XTZ A;  1M1F A;  3I1A A;  1QUU A;  4C92 G;  2RH2 A;  5LJM A;  4UC4 A;  5A1L A;  2LX9 A;  4AQG A;  3DTO A;  4PFO A;  4C5I A;  5LJ3 d;  4AI6 A;  4HT8 A;  2YLB A;  2XHE B;  4XQ3 A;  4NL2 A;  1WR6 A;  1WRD A;  3C50 A;  4IE0 A;  5FU6 C;  1S94 A;  4X1Y E;  3LGF A;  5IAY A;  3CCM A;  1VQ6 T;  3WVE B;  4BUG A;  3P7I A;  1W4S A;  2KY9 A;  2K4Y A;  2LCL A;  5A2Q E;  3I56 T;  3KV9 A;  5JDG A;  3CCS A;  2DHR A;  3OW2 A;  3AB3 B;  1Q86 C;  4XTU A;  4C92 C;  3L2R A;  4MML A;  4TN7 B;  2K2V A;  3GN5 B;  3LBX A;  4HA8 A;  4XZC A;  5FXV A;  2ODU A;  1PSE A;  2QEX A;  3FXD B;  2RJE A;  5HKC A;  2JTM A;  1YJW A;  2MWP A;  2IAK A;  3EAE A;  1YI2 A;  3ONX A;  4BI4 A;  3UT1 A;  3VKG A;  3E19 A;  2DD5 A;  1NAF A;  2JMH A;  4IE5 A;  1HX8 A;  5CAI A;  2LNV A;  5LJ5 j;  5GAO l;  3UPU A;  4M77 A;  2X4X A;  1OI1 A;  2LHN A;  2EQK A;  2N9D A;  3IEE A;  4GYR A;  1N8R U;  2XAS B;  4CXW A;  5LJ3 f;  4NL3 A;  2LSI A;  3PMT A;  1UX5 A;  3OYD A;  3UDC A;  3CC2 A;  3E0Z A;  2BZB A;  4ZTF A;  2WAU A;  2VC8 A;  5JR9 A;  3S3N A;  3SWN C;  4B6X A;  3MJX A;  3JCM J;  2RD1 A;  4JRQ A;  3OA6 A;  4XU2 A;  1QP3 A;  2CZ0 B;  1FMW A;  2CWO A;  4ISS A;  3GNG A;  3OS1 A;  2G3R A;  2CYZ B;  2D5U A;  3PGG A;  4M78 D;  3CMA A;  1IZN B;  2F5T X;  1YKE B;  4KBM B;  2H7V C;  4C8Q C;  1MND A;  5HK0 A;  3MK7 C;  3S3O A;  1U5P A;  3TEE A;  3GPL A;  3PUG A;  4HFV A;  3QII A;  3VJP A;  4HCZ A;  3X26 B;  1PSF A;  2J1D G;  4UVB B;  3E08 A;  2ZGW A;  4OGC A;  3TRE A;  5GMK m;  2E9X B;  5C0M A;  2E70 A;  5CR2 A;  3QO3 A;  4J5Y A;  4C8Q A;  3UUL A;  3HKE E;  3V8K A;  3CD6 T;  2PQW A;  2A7Y A;  3CML A;  4C0G A;  1ZEE A;  3N5L A;  1VQO T;  5KCO A;  3JCM W;  2VKH A;  5DM7 R;  4NOY A;  4WF2 A;  4BJN A;  2CZ6 B;  3M59 A;  1K8A C;  4H9N C;  5GAN e;  4U74 A;  5JVD E;  5LJ3 g;  1BI2 A;  5HXE A;  2L5Q A;  5IN1 A;  5KX5 E;  3AHU A;  2EFI A;  1UGP B;  3NTK A;  4E7L A;  2LSJ A;  2DVE A;  2RHU A;  2LOP A;  5HWY A;  2D0Q B;  4M75 D;  5KMG P;  3OSS C;  1HG2 A;  3NZP A;  4WBN E;  4EMG A;  4JS5 A;  4XTV A;  3TCJ A;  2HD0 A;  5AYF A;  3WI3 A;  3JCM V;  4PJL A;  3L1A A;  3C4Z A;  2EQM A;  4ELZ C;  3HKD E;  1YHQ T;  3CQC B;  2HPJ A;  1U4Q A;  5EK2 A;  3OMG A;  3M65 A;  5FY1 A;  2BIV A;  4EIW A;  1TH7 A;  3W15 B;  2MWO A;  4EDU A;  2XK0 A;  5JDF A;  4IDZ A;  1LNX A;  4BB7 A;  3QK6 A;  3R6N A;  2L3R A;  4IUV A;  2DZC A;  3G71 T;  3OBV E;  4DOV A;  4H9R C;  1D0Y A;  4EXT A;  3QG1 A;  2WSF E;  1WLX A;  1ZKE A;  3UUN A;  5LJ5 e;  4JS4 A;  3ETV A;  3ZYM A;  4M77 E;  5DQV A;  3OS0 A;  3LK4 2;  4I4T E;  2DTH A;  2KMF A;  5FRM A;  3OYL A;  5CKF A;  3RYI E;  4M78 G;  2V7K A;  2DLR A;  1O9S A;  1D1C A;  2HAX A;  4QVZ A;  5GAM g;  4O4J E;  4UV9 B;  5J2T E;  5GAN 4;  1JJ2 A;  3J7Y q;  1US7 B;  1HTJ F;  1O3X A;  2KWI B;  3G7Z A;  1KD1 C;  3RH3 A;  4EMH A;  4Z8X A;  2YIN A;  2ZM2 A;  4UIG A;  4XU0 A;  2L8D A;  1Z0P A;  4X34 A;  4MLK A;  2V8K A;  3LFM A;  4C5E A;  2WSE E;  2K5L A;  2YHT A;  3OYB A;  1ZHI A;  1YKH B;  3X24 B;  4DVD A;  4DND A;  5GAO r;  4BA9 A;  3HSB A;  4M7A D;  3MCA B;  1VQ9 T;  2XHC A;  4E7Z A;  2QA7 A;  2LQ8 A;  4IE4 A;  2A3L A;  1QSD A;  3CCV T;  3LBX B;  2DI4 A;  5FU6 B;  4LD6 A;  3V7C A;  2JRK A;  4ZI3 D;  3B57 A;  4C8Q E;  2UXN B;  1Y7X A;  1VQK A;  4ZHQ E;  4BI3 A;  5CKH A;  4Z02 A;  2RHI A;  3GN5 A;  1RL2 A;  4HCC A;  3PUA A;  2QQS A;  3KV5 A;  1VQ5 T;  4M75 G;  2JPF A;  4C92 B;  3CCQ T;  2E41 A;  2LJL A;  2XAH B;  4PJJ A;  3RKO A;  4AKH A;  4I43 B;  3S4U A;  2DIG A;  3ME9 A;  3QC9 A;  2VL8 A;  3JB9 I;  3A5X A;  3OYI A;  3PUQ A;  2RI5 A;  1MGQ A;  1VQ7 A;  4ZN3 A;  4E47 A;  2YEV C;  4G63 A;  4GK5 E;  4N4H A;  2QXF A;  3QZ9 B;  3MEA A;  2FB7 A;  3AA0 B;  2KZ7 B;  2C5J A;  1LKX A;  2LVM A;  3VKI A;  3JCM c;  4CRI A;  4C92 F;  1H3Z A;  5HAX A;  5KDM C;  2CEA A;  2CKK A;  3HL6 A;  5C8Y E;  3HRU A;  1VQN T;  4PLL A;  3ETU A;  5IHY A;  5LJN A;  4GK0 E;  5L3G B;  1BIB A;  2WMN A;  4B9X A;  4JUY A;  3PUS A;  2KXP B;  1G3W A;  2X35 A;  3GLX A;  3SWN B;  1Y64 B;  1X01 A;  3JC6 D;  3PMI A;  2E9X C;  3M56 A;  3CCE A;  3F57 A;  5FP3 A;  5GAN 2;  5A0L A;  4N4I A;  5TAO A;  5FNV E;  2JMK A;  2RB6 A;  2D2S A;  2YK0 A;  3OBW A;  4OFZ A;  1QVG S;  2K3X A;  5CVI A;  3N9N A;  3CKD A;  1I8F A;  1KC8 C;  5HXH A;  3N9L A;  2LE8 A;  5LYJ E;  3RMQ A;  4C8Q B;  4XU3 A;  3BDL A;  2ZMA A;  3MEV A;  4CZZ B;  4LD9 K;  3G4S T;  2E9X A;  3QHS A;  4OYK A;  5L2L A;  3ASK A;  5EK4 A;  4CI0 C;  1VQL A;  4AXP A;  2E1H A;  2EHO D;  1Y71 A;  3SD4 A;  3CX6 B;  4MAL A;  2FVU A;  1KG1 A;  2Y48 B;  3OYZ A;  1IRE B;  3F70 A;  4F7U A;  5EG2 A;  4C8Q F;  3UTK A;  4QX7 B;  3JB9 D;  4M7A G;  1MMN A;  3RRC A;  4DBR A;  3P8B B;  1IJ5 A;  2CZ7 B;  2JNG A;  2LDM A;  3ESL A;  5D6Y A;  4GLK A;  2NWB A;  2XAQ B;  3X28 B;  2BUD A;  4ANJ A;  4EYU A;  4PL6 A;  2W0G A;  1W2B S;  2RA1 A;  5FXZ A;  1YCY A;  3PTR B;  1BI3 A;  2W63 A;  4A4G A;  3SDZ A;  3VHL A;  2WM9 A;  4X1K E;  2VKD A;  2GK9 A;  1MIW A;  1UCU A;  2JQQ A;  3GNF B;  4ZGE B;  5FXX A;  4ZI2 C;  3RUX A;  4FIB A;  5LA6 E;  5DY9 A;  1D1A A;  3VYH B;  4DMW A;  1Q7Y U;  2QA4 T;  1VQ4 T;  5I2M A;  2F5K A;  2JVV A;  4GY5 A;  4M7D G;  3QDR B;  3V5S A;  5I21 A;  4ZI3 C;  3O1I A;  4KUL A;  2BDE A;  1CUN A;  3V7S A;  3AA6 B;  1YBY A;  1I5L A;  2LM9 A;  4XU1 A;  4A4H A;  3CC4 T;  3QYH B;  2E6Z A;  3F31 A;  1NJI U;  3Q5W A;  4OB3 B;  3CCL A;  3A8L B;  3RYH E;  2RA2 A;  1VQ8 T;  4XTW A;  1SA0 E;  1YIT T;  2MBG A;  1G3S A;  2GFA A;  4QQG A;  1S72 T;  3FLG A;  2HPL A;  3LLR A;  1G3T A;  3H6Z A;  2CLY C;  2QQR A;  3FHN A;  3AVR A;  2XQY A;  2PUK B;  4QW2 A;  4WBO A;  4PFP A;  1Q82 C;  2Q9Q D;  3ZYK A;  2W62 A;  2ZPF B;  3WXM B;  2A72 A;  4M7D C;  5EK3 A;  2B8A A;  2DEQ A;  3I0O A;  5CKD A;  5ETW A;  4Q5W A;  3L2U A;  5L3D B;  2P4T A;  2Y6X A;  5F3J A;  5E0O A;  4NS5 A;  4TV9 E;  5GAN 7;  4HE8 A;  3RC3 A;  3K3N A;  4X9C A;  2JJ9 A;  2RJF A;  1H64 1;  4C0D C;  1P92 A;  2XU8 A;  4AQF C;  3CXC S;  5L3C B;  1FXX A;  2Y4X A;  1AHJ B;  4NUV A;  4M7D A;  4H9O C;  3FB2 A;  3CC7 T;  1VQP A;  5FY7 A;  4C90 A;  4YFS A;  3KBG A;  2KDS A;  4IUU A;  4R55 A;  5HXC A;  4QX8 B;  3QJY A;  1FIO A;  4PJO D;  4ZS2 A;  3MA9 A;  3JB9 G;  2NW8 A;  5GAM j;  2XAG B;  3V5U A;  1M1K U;  3CXC A;  1KHC A;  2XI9 A;  4DOW A;  1X6O A;  3GWH A;  2DXB A;  4FSX A;  4F7U E;  2VKJ A;  1JBM A;  1NPR A;  2PU9 B;  3K3O A;  4C92 A;  2Z6E A;  4IUR A;  4QVC A;  4ATO A;  3HL8 A;  3QPH A;  2RJC A;  2ZPB B;  1WYB A;  2ZLY A;  5GAN d;  5GON E;  4UVA B;  2KK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...