2XTLA

Structure of the major pilus backbone protein from streptococcus agalactiae
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
449
structure length
449
Chain Sequence
ETKPQVDKNFADKELDYANNKKDKGTVSASVGDVKKYHVGTKILKGSDYKKLIWTDSMTKGLTFNNDIAVTLDGATLDATNYKLVADDQGFRLVLTDKGLEAVAKAAKTKDVEIKITYSATLNGSAVVEVLETNDVKLDYGNNPTIENEPKEGIPVDKKITVNKTWAVDGNEVNKADETVDAVFTLQVKDGDKWVNVDSAKATAATSFKHTFENLDNAKTYRVIERVSGYAPEYVSFVNGVVTIKNNKDSNEPTPINPSEPKVVTYGRKFVKTNKDGKERLAGATFLVKKDGKYLARKSGVATDAEKAAVDSTKSALDAAVKAYNDLTKEKQEGQDGKSALATVSEKQKAYNDAFVKANYSYEWVEDKNAKNVVKLISNDKGQFEITGLTEGQYSLEETQAPTGYAKLSGDVSFNVNATSYSKGSAQDIEYTQGSKTKDAQQVINKKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL WALL SURFACE ANCHOR FAMILY PROTEIN
publication title Structure-Based Approach to Rationally Design a Chimeric Protein for an Effective Vaccine Against Group B Streptococcus Infections.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Structural protein
total genus 135
structure length 449
sequence length 449
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xtlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xtlA03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xtlA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 2xtlA02
1Q9OB 3FRUA 5E9DD 4O4YH 2NY4C 5DQ9B 1W0VA 2DQFA 5CILL 3QI9A 3O11A 3OPZL 1T1WB 5EA0H 3HRZB 1ZHNB 1A2YA 4YXKL 2F54B 1Q0YH 5DHVB 1EMTH 1ES0A 3Q3GA 5B39G 2HTKD 1R3IH 1RZGA 5HDLA 1YPZF 4CVXB 3RHWK 2Q8BL 3X3GH 4CBPA 1EEYB 2IAMD 5KVDH 5DUBB 3QULA 5HYQA 4XCEB 2Y25A 4Q74A 4I3RL 3VFGL 3QJHA 1Q9LB 1IKNA 3GEWB 5GIRB 3V6OE 1E27A 2DQIH 1LGVA 1CL7I 1FIEA 5IMKA 3RX7A 5DD5H 1OARL 1NLBH 3MLVL 3S35L 4B7LA 4F7MA 2OP4L 2K9UA 5KSBF 3QFJA 4R97C 3GSNB 4H1LA 1C5CL 1X44A 3AY4C 5FXCH 3QWRD 3X3GL 3TO4C 3DX8A 5KVDL 1OP9A 1OTUD 1HH9B 1UZ8A 4NN7C 5J6HB 1U93B 1KCSL 1OM3H 5JW3H 2VLRD 4I9WE 4N8VG 3HE6B 1EGJH 1CF8H 3MCG1 3PL6A 1RUAH 3F8UB 3LKNB 4JZNB 1IM9B 2A9NL 1G7IA 3PNWA 2R9HC 1AGCA 3WDIA 1H3TA 1NMCB 3LSOB 4E42A 4ALAH 2DWEA 4NZRH 5C0BE 3RIAK 3CPLA 3L3JB 1NFIB 3V52L 1QFWH 1N0XL 2HVKB 4U1IB 3QZWG 1DLHB 4J3TA 2EDQA 2PKDA 2O5YL 3T0AA 1I1AD 3QEQA 5GGTA 1O5DT 5ISZE 5IJKC 2KQNA 2N4IA 1BQHB 3BT2H 3UX9B 1GGCH 5D7JB 4NJ9H 1KN2H 1NLDH 2XXMB 1N5YH 5JA9A 4K3GA 2OMNA 4U4BA 5DS8A 2B2XL 5TPWH 4S0SD 4WHTB 5JR1L 3MLWH 3W5MA 3L3GA 4M1CD 2BP3A 2ZUQC 4J4PA 3UTQB 1FRGH 3LB6C 2YD5A 1WIPA 4M7LT 4ALAL 1K8IA 1PZUB 1U0QA 1HILB 2P5EE 4GO6B 5CMAA 1J8HA 2C4FU 1DQDH 4KHTH 4UIMA 1UB6A 3FOMA 1JYXA 1H3GA 4GRLA 4H25A 1AGFA 5A16A 5DJZA 4Q9QL 2ZJSH 3QISA 1KN2L 1NCCH 4WFFD 1NLDL 2FGZA 1N5YL 1KULA 1U3HD 3VH8A 4U1NA 4NKOA 4XCCL 5TPWL 4ZTPH 3SJVE 4IHOB 4L8DA 3MLWL 3BJ91 4Y4FA 3NTCL 3CAFA 2EDHA 3D3VB 1M4KA 1FRGL 1LHZA 1FYTA 2WBKA 2GHWB 4F7TA 4EI5A 5E1AB 4F8TA 4MJ4A 3VWJB 1W0WB 4JRYA 3HNVL 4KKBD 3IFNL 1BEYL 1DE4B 5JHDB 2ORBL 3KPSA 4J3XA 1DQDL 1P1ZA 1KTDB 5ID1B 1GOHA 1NAKL 5IM7B 2BVOA 5JHLH 3VXRE 2FBJL 2FJGB 2ZCLL 4ZTOL 4ZAKC 2Z31A 3K4AA 3LRSA 2VDKH 2PW2A 4ZPTB 3ZTNH 4TTGA 1FH5H 5DRWB 4WI3A 4HUXB 4HKXA 4ZTPL 1M7DA 1OGTA 3GMLB 2Q76A 1RY7B 4PY8J 3PGCA 4ODTH 4F33A 4PTUA 3HCVA 3MV8D 3ARZA 5HYJD 2X2YA 4KTDH 3V7AG 3DUHA 3HE7B 4UV7H 1S8DA 4M48H 5TDPB 5F88B 1D2OA 2Z8VC 2ZSVB 3GDBA 5T5NF 1SY6H 1S7UB 4MXWH 1IEBA 4YEEA 5HHOE 3VWKB 5SV3A 3KLAB 1AXSA 2J8OA 2VDML 4PJ5B 1LE5B 5FYLD 4KV5F 3EDDA 4PBWD 2H41A 1T0MA 3HAEH 1DQJB 1DQMH 2YUWA 4XCYA 4R2GD 5KVMC 3DROA 4OD2B 1N2RA 2JCCA 1OAUH 5DUMH 3VD4A 3KYAA 5ITBH 3A0OA 3MRRB 4O2EA 4UV7L 2N7BA 5E8OA 3G08B 2YC1B 3D5OF 5IWLA 1SY6L 3DGCR 5MP6H 5IKCA 3QIWB 4U0RB 1FC1A 2ZKHL 1B9ZA 1G7JA 5JIIA 2PF6A 1ZLVK 5HDOA 1SEQH 3OKLB 2DD8H 3ULVH 5CKGA 4QHMB 4JJHA 4PJXF 2OR9L 2HH0H 5I75C 3VGAB 2IAMA 1T6VN 3MLRL 4KI1A 4NUJA 1AHWA 3LKQB 4OGAD 4XPTH 1OAUL 2QHLA 5DUML 2PW1B 3BKCL 2EE2A 3OAYH 3QXTA 4OLUH 1F90H 5GJSH 3HAEB 2XA3A 1IL1B 3BWAA 3B3IA 3RKDD 4PFEA 4J1UA 4W6XB 5A1AA 2YPLA 2VQ1A 4L4VB 4P9MH 3RPIA 3R06B 1YPZA 3GSWA 2NLJA 3QEGH 1QFPA 2JJTA 2F53D 2DQDH 5LGKA 3ULVL 2AV1B 5HGAB 5FHBH 3S3SA 4X8JA 3HI1B 4NO5A 2OI9C 3DUSA 3TH4T 32C2A 1CXLA 5JHDE 5B38B 4OLYH 4WUUB 1MELA 1Q9KB 4K3EL 1AI1L 4N9GB 2WQSA 2MMXA 1KJ3L 3Q6GL 3U79A 2AXJA 4BFIA 1IJ5A 4RSVA 1J1XH 1FO0B 5D2NC 3S96B 2VLRA 3LD8B 2GIYA 3C6LD 1EEQA 4OLUL 1F90L 1IGYB 2P5WB 4CL7A 2X9YA 3PE9A 1J5OL 2E7HA 4RRPG 5GS0C 3L6FA 3OB0K 2A83B 4FOMA 2DQDL 2R2HB 4S11A 4D9QE 2E9BA 1A7BA 2Z93B 4D0DA 1OGAE 2PO6B 1RIHH 5I1GL 1CU4L 1RSFA 1FL3B 2H9GB 4OFIA 2DDQH 1KPUB 3UJJH 1KELL 1VFUA 2EO9A 4MQSB 3GBMH 4OLYL 1ZT7A 5F7NC 3FB8B 5CJQL 3WS3A 1MCIA 3BE1H 3CZJA 4LU5H 4WWKB 3T1FA 2OQJB 1J1XL 4RQQB 4LVHB 1EBAA 4TYUA 3OR7B 1W0YT 2NNAB 4TNWK 5GRZA 1UKQA 3UZQA 5KSAC 2PNDA 2H32A 5CD5C 4UT9L 1ZS8A 4B53A 4P5KB 5C0FA 1GGBH 4IOFC 5E5MA 3OGCA 5DJXA 4UMGA 5CZXC 2XTJB 4MJID 1W8OA 3LEXB 2VERN 3MA7B 3NPSC 3QYCA 1JBJA 1AIFB 3V6ZA 3QG7L 1JIBA 1TPXB 3IS1X 3RU8H 4WU7B 1EH9A 4XAWL 2O5XL 3VDAA 3BE1L 4XXCC 5B39B 1U3HA 3HC4H 1C5DA 3QA3A 1W72H 1HKLL 4D9RD 1IAKA 5FCUL 3O4OB 1NH6A 1ZTXH 1R5WA 1QSEB 1LO2H 2RCSH 2GFBB 5GHWL 1JGDB 2X9XA 4PJHF 5T1KB 5EC1A 2HJFB 1GGBL 2WBJD 3UTZA 3EBAA 4KGLA 1CCZA 4ZUWA 2FZ3A 1RZKH 4OI7A 4JY6B 3GGWB 4JQXA 3GJEA 5FF6A 1KXTB 5EUKA 2Y6SC 3KYKH 1T89A 5C70A 5CGTA 5GS1C 4L4VE 4S1SL 1FSKC 3QDAA 4MA1C 1Q9WB 4QXGH 3P11H 5EPMA 2CDEB 4Y16D 5CKAA 2IH1A 3QPQC 3HC4L 5IT2H 5F9DC 1TENA 5KAQG 3NIDF 5J3HC 3X11B 3PWJA 1LO2L 4KXZI 3CFCH 3K3QA 2BSRB 3NFSL 4I5BA 1PD6A 4MAYD 2APFA 3KYNA 4Z0BH 5EOQH 1BF2A 4N0RA 5C9JB 4JG1H 3U0PA 4K9EL 2GJZB 3IJSB 1DN0B 3SBWA 5C86A 1G0YR 2P5WE 3KYKL 5F1KC 5FYJH 5D1XA 4W4NA 1WC7B 1AH1A 1VKXA 1AO7D 4X98B 4OF3A 5CIPA 1YUHA 3OAZK 3BGFC 2Y7QB 1KBGH 4PJEB 1YEGH 3QZWB 3UDWA 3CLEH 4HC1H 5IFJA 3AM8C 1L7IH 4I0PC 1T04A 1OP5K 4XXDB 4EQ3A 4KK8D 2KPNA 2ADGB 5I9QB 4F9LC 4FQIH 5F6IB 5MENB 4KJWD 4HIIA 4YGAB 1EEZA 2KDGA 4L9LC 5TE6L 1Y18A 1F4XH 3VI3F 1TJGH 1XF3A 4KK6C 3EJYD 3EYOA 3MGTB 4G8GB 4EXKA 5FYJL 3D39B 4IRJA 1MUJA 3IU4L 1S7SB 4D0BB 1QRKA 2BDNL 1SBBA 1ZA6B 4NQCB 3SDDD 1F5WA 4MCZB 4ETQA 2EYTA 1KBGL 1MVFA 5DJAA 4G7YH 4TTDC 4IS6B 3QDGB 5C0CE 4BSVB 2MPAH 1F6AA 2BVQA 3QXDB 4JN2B 2FX8L 1BQUA 1RZ8B 4FQIL 4OF7A 3B2UC 2CLRA 4JDZB 5I19H 5IB5A 1A3RH 2XOTA 1I75A 2BSTA 3KDMB 4L8SC 5E8PB 4PV8B 3BMWA 2APVA 3L5XL 5IW1A 3AREB 2P24A 3MREB 1I7UA 3FQNA 4ZYKB 2JIXD 4PJXA 5JDSB 2OTPA 3DETC 4FQLH 5T1LD 3BPCA 4GAYB 1UJ3B 4X5XA 5FYKL 4PJBF 3WSQH 1UZ8B 2QQNH 1I8LC 4GKNA 1TZHA 2HRPH 3PIQB 3QJFB 4QXUH 3AMKA 3VFPA 4QLRA 6FABH 1GCFA 3GKZA 2NY4D 3DSFH 3C6LA 4PRBA 3A6BL 3GUTB 1IFHH 2VLJB 1LO5B 1Q0XH 4XBGA 3D0LA 2OZ4H 3DMMA 2CO7B 1TVBA 5T3XE 5DRZB 1J0ZA 2MSPA 1LDPH 1KB5H 2B1AH 5I1IL 4ISVB 3RWGA 3V4VH 4CAGA 4HAFA 5HYSG 1UEYA 4ZUSB 1QLRA 1T2QH 1V3LA 3QCTH 3EGSA 4EVNA 3GLEA 1U42A 3S34L 3L9RB 5BQ7A 2AEQL 3R1GH 4M7JH 4HPOL 4NP4H 1JHTB 3B9EA 3SEPA 4RAVB 2XZQH 2QQNL 1GZQA 3TPKA 4U33A 3B4NA 3OXSB 5I2IB 4OF0A 1YEDB 3GNMH 5IF0B 4ZFFA 5DS8B 2I9LA 1BFVH 3F7QA 4DKEH 4X6CF 4G3YL 1YEHL 4YHZL 4L5FH 4W68A 3ARSA 5BXFA 4HG4K 1BBDL 4LSVH 3MYZA 1MJUH 4UT6L 3WIIH 1IM3A 3L7EB 1F58L 4WU5A 3CX2A 4KTEL 3TO4D 5D1ZB 3ALXA 1DJSA 3O2DA 2EIZB 4LLWA 1QTYT 4K3JH 5C0GA 2ICES 2GK0A 3HZVB 3R1GL 4M7JL 4NP4L 1CVRA 3QXVA 1UB5A 3F58L 4XNMA 3P0VL 4P5MA 4AH2B 4G6KL 5F3BB 3MRCB 5FA3B 2R9HD 3BZFB 1H8SA 1AXTH 2VITB 3CXHJ 5DJDB 1JTOA 5ACZB 3MRNA 4X7CC 4QCIB 4XPAL 2VN4A 4L5FL 3OR6B 3QDGE 4F7TB 1MJ8H 1DZBA 2DBJA 5CSZA 4GKSB 4ELMF 4OZHB 2XV6B 3GMMB 1E6OL 4M5YH 1MJUL 3WIIL 2C7UA 2WBJA 3PP3K 3QIBC 1LP9B 2BNUB 2P49B 4AYFA 1EVTC 5I1KL 3AXLB 5L0QB 3MRHB 4JRXB 4AJ0A 4FXKA 2DWDB 4R7NA 5EIIB 1CDUA 1KCUL 3F5WA 2Q7NA 2O61A 3RY5A 4N0CC 4Y16A 3MLPA 2D0HA 3ZHDA 2NY0C 4PJHA 3LB6D 2JKXA 4JJ5A 2RHEA 1CFVL 5DQDH 3RWFA 3ULVC 5E08H 1BZ9A 3DURA 2C1PA 3DECA 1AQDB 2J88H 4M5YL 3MRGA 2CIKB 4JANA 4KZDH 4M43H 2VLJE 4KKLC 2SEBB 5DMJB 3C8HA 3CMOH 4XP6L 1QRNA 3IETB 4LFHD 4TUKL 4P3CL 2C3WA 4Y4KA 1MQ8A 1AO7A 4TSCH 4OGZA 4PJFA 1NCDL 2DN7A 3MTRA 4XMPH 3RHWF 2Y1VA 3IDNA 4XCYB 4QRRA 3QEQE 3NGBC 3RVWC 1IARB 2JCCB 4F7EB 2NY6B 2Z4QB 1YYLL 2YD4A 1T7VA 3WUWA 4Z95H 1U8PA 2UY6A 3QUYA 3QWQB 5K59F 1T03L 1OCWL 4P2QB 5J1AB 4KDTA 2CRYA 5E2VH 3BUTA 5CZVH 5D93C 3OKNA 5F9OH 4X7TA 4LLQB 2EH7L 4S1QH 1YY8B 2UWEF 1QFUH 2V2WA 2UZIL 4ZAKD 3NPZB 3O3EB 4DOHB 3KGRA 3CH1B 2HTLC 3P30H 4K71B 4X6EA 4MHHG 4U1SA 1J8HE 4LLUB 4TSCL 3VJ6B 4P9HH 3SDDA 5E6ID 3VFTA 4EUPH 4YC2B 4JPVL 2E5EA 1DUYB 5TF0A 3T2NH 3W9DA 3I6KB 3MACH 5ACLA 2YZ1A 2CKBH 4Z95L 2AXFB 2MKLC 1WBZB 4IRZL 2X4OA 2VOTA 1YEEH 2VE6B 4ZOEA 2AJXH 4JZJB 2AK4A 4JDVA 2YPLB 1ZHLA 4X0KB 1JFQH 1FYTE 2VXSH 3T04D 1FZOB 3T4AB 4C4KT 5C3LD 3B2MA 2RFXA 4L3EB 5IR1B 2PXYB 4FQXC 4JRYE 5FKPA 3FJTA 4P9HL 3KPSE 2W65A 1LP9E 3GIVA 3BEWA 3C5ZA 5BRZB 2A38A 4NNPH 5GRWA 2HT3C 2EDFA 2F8VA 1NFDB 5D7SL 3VXOA 3X17A 3PWUA 5FYJU 1BZ7B 3H9YA 4PJIF 2C9AA 4HIHB 4QOKD 4QTHA 2EXYC 3VCLA 2JE8A 3JTSB 5KSBB 4CGTA 2AJXL 1JUFB 5DRNB 3EKCA 5F1NA 4IGBB 5JDJA 4UNUA 1IAOA 2CKBB 3FT4A 1WTGT 3SQOL 1ZVSB 1CDIA 3ARFC 3DRQB 4PJBA 2NXYC 3KXFD 4HIXL 3H9SB 4MX7A 1A1NA 4ZXBA 3QUMA 3IDGB 4FTVB 4WNQB 4NNXB 1N5AA 5H8DA 4DVRL 4NNPL 4K9EC 2BRRH 1Q94B 3O8XA 4ENEC 3D9AH 4GW1B 3VXSA 3EDKA 4WV1B 5IQ9A 5DD3H 5EU7E 1NCWH 5I71B 5AD0A 3N5LA 4MDJA 4WCYL 3SE3C 4JO4L 3W2DL 5EU4A 5FYKU 3STZA 4OGYH 5IIEB 3VGFA 4I18B 2JCCE 1T21B 1CFSA 4P2QE 4RZCB 2VABA 2CGRL 5FO7A 3U83A 4MJ6B 5C0EA 4U1KA 8CGTA 5IMOB 1SJHB 2IQAA 2D0GA 3O2WH 2Y07H 2IADA 3O4LB 5KZCB 3ZT6A 5EO1A 5FEBA 2YMXL 4X6CA 4DOHE 1XT5A 4NDMB 3ARDA 5L88H 4FHBD 3O41A 2VLLA 1P7QB 2AJZA 5SX5K 3MNVB 3V7MA 5GS0D 5E94B 4K2UL 1K4CA 4MQTB 4P46B 5IB3A 3M17B 4LIQH 4BH8B 1JWSB 2EH8H 3VGGA 4DKAA 1E0OB 3LHPH 3O6FA 5TQ2H 1A4KA 3HNSH 4TNVK 4OLVH 3UTTD 2VAAB 3QUZB 1A6ZA 3EOBA 3CU1A 4HDIB 3BDYH 4L8BB 1FL5B 3U46B 2BOBA 2CUHA 3GJEB 1CT8A 5K9JH 5F6HI 1T6WA 4LBEB 4M03A 2YPLE 1YPZE 3O2WL 2X89A 3GIZH 4XB7A 1YMHA 1DQLL 5H35B 4U6HB 5D9SA 2ENYA 3EO0B 4XWOD 2EDLA 4P23C 3F12A 2BHYA 4X99B 5CD5D 4NKMA 4HKZB 5HHPB 1WTLA 4ELMA 2GJ6B 4IOFD 4LIQL 1BFTA 4KQ3L 1CICB 1JN6A 5ITFA 5CZXD 3RX8A 5TQ2L 3MV7B 3HNSL 5LAXA 1FJ1A 3FFCB 4YX2H 1TQBC 5JUEH 3E0GA 5MHSD 5LWYL 1DBBH 1TTFA 4GG6F 1N3NA 2HFGH 4F7PB 4UUJB 5BS0A 5L8LB 1R24A 4OT1L 4Y4HC 2EE6A 5KSBE 5HY9A 5K9JL 4QRPB 5EZJA 5D1XB 5CJBA 5F1IB 1RJZA 1KNOA 4L1HA 5BZDB 3B5TA 5HYSB 4NZDA 1LO0H 1FC2D 4TVPE 3WMSA 1ND0B 3MNZB 4FTVE 4OZFA 2XN9D 1FLTX 3H3BC 1IC7L 3GJFA 1HN1A 1YEIH 1MHCA 2WQ8A 4U1LB 3A6CH 3ULSB 1HQ4B 2IGFH 1L0XA 1IGCH 4CVUA 2X4RA 3ZYIA 3K7UA 3JV4B 1C5BL 4J6RL 3EYOB 1CXEA 4WTXA 3DX6A 3O6KH 2E7BA 1T80A 4G6ML 4RFEB 2WWMD 3QPQD 3FOLA 4ZO9A 5DD0H 3ARBA 1OAYH 4X80H 2W60B 1ZEAH 4R3SB 1BFOB 5D5MF 5J3HD 4WEBL 5E6IA 5F9JA 3MOBL 3K8MA 1VERA 1B3JA 4JHAH 4M93B 2BVQB 3D85B 3HUJF 5DJCB 3MXWL 3DARA 3BP5B 1MCQA 2EYSB 4QYOA 3OKKB 3BUYA 4OZIF 5EU5B 4PS4H 3VMNA 5BV7B 3QH3A 1UCBH 5FDWA 1JZ3A 3SO5A 4KKAC 3QDJB 1MJJB 4H5SB 5IBUG 4DK3A 3WJJA 4X6FB 3E3QC 1UZ6F 5K9OA 4K07A 1PW3A 2W92A 3IF1A 1TCRB 3WS6C 4NN5C 1T4KB 3BZ4B 1OAYL 3IFPA 1ZEAL 1WT5A 2XFXA 3OKYA 2JB6A 3PWNA 4I0PD 4XI5D 4BYHA 3EYSL 4O2CB 4GKNB 4ODHH 3QO0A 3EFDL 3JV6A 5C0IB 4NPYA 1INQB 2NYYC 2P42B 5BMFH 4N5EC 3WN5C 2DMKA 3GSVB 4KK6D 3KPQB 4PS4L 4BK4A 3VXMB 2PYEA 1FG2A 1ACYL 3KPLB 1T2XA 4PJGB 3MQIA 4TNWF 5DI8A 2VXVH 2GJ6E 1HHGB 4NO2A 1XGUA 1JPFB 2W0PA 1DVFB 1G9ML 1ADQH 2P8PB 3MV7E 5TQ0H 5I73C 1VB9A 4NFCA 4ACPA 5IFHL 1I3GH 1UH2A 3CCHB 4PB9L 4TTDD 4UDUB 4NHUA 4NWUH 4ODHL 4QRUA 1CIUA 1FFNB 4KZEH 1LEGA 3B2UD 5DHYA 5J57B 3W82A 1NBQA 1A7PH 5F3HA 4IDLA 1CGVA 2H3NB 5BXFB 2VXVL 4R7DA 3BQUC 1ZWIA 3MO1A 1GZPB 3WKMH 1VGEL 1BJ1H 1MREL 1TVDA 3DYMA 5I6XC 1U91A 1MQKL 1I3GL 1UA6L 2R2EB 3OF6A 1QP1A 5LG1A 1ZSDA 4XPBH 4XPFL 3V4PH 4KV5E 5H2BA 5KSVB 1KOAA 3GSNL 3WE6B 3MLUH 2V9RA 2BFVH 4KUCD 4J3WA 1E4XL 1BD2B 4P99A 2XKUA 4YHLH 3E6HA 3INUH 5D7LD 4R0LB 1HIMH 4YHPA 1EAJA 1N6QH 4AL8L 3D2UA 2Z8RA 4NKQB 1MVUA 3C8KB 5D4QA 3KR3H 1RD6A 3MBXH 5E24E 3RWIA 2F6AA 1Q72L 3MBEC 1MAMH 1XGRA 2V9QA 4XPBL 5DO2C 3ZSSA 1F02I 3EFFA 3U2SA 4JEGB 3MLUL 3F5WB 4PJXE 4MNQD 3PABA 1DFBH 4YK4C 4DNDA 4HS6B 4M4PA 1UENA 4LCYA 2RGSA 1NMBL 1OLLA 1T2JA 3IXAA 1PZ5A 1X6LA 3ZLQC 5FECA 1FNGB 5HI5C 4LAJH 4FXLA 4IIQA 4S10A 1IE5A 5TFSH 2IWGA 1NBZA 4P9HC 1WAAF 3RWCA 4M9OA 4XBPB 2A6KB 4X4XB 1XGTA 1CYGA 4LHUA 4MXQC 2J6EH 4P5TC 3BP7A 5FK9B 3BD3A 1MAML 4AG4H 3GFUA 3VA6A 3EIFA 1CD8A 5DJ6A 3TO2A 3EJZC 5LBSH 3THMH 4O2FA 4K23L 4M4RA 3FB7B 2BNRA 3V6FB 4N90E 1U8LB 3IS0X 4PD4K 3CVHH 1IVLA 2IG2H 1IGTA 1M71A 2BERA 5J12C 1JPGA 4HCRH 3LKOA 2XN9A 3MLSH 2FX9H 5TFSL 4OB5L 4GG6A 3QIBD 4HH9B 5H94A 3T0VA 4ZOCA 2XQBH 5AAWA 5DJ2B 4YXHL 4MA8H 4PP1D 4MNGA 1KLUB 1MHPL 4OLWH 5IJVA 1CXFA 5E4EC 4LSRL 5KSUB 5FA4A 4AG4L 2WZAA 1JK8A 1ORSA 2F5BL 1F45A 5LBSL 4N0CD 2XIDA 3C5SB 2NY0D 3ME0A 5EIVA 1BGXL 3O9WA 2LU3A 1CGUA 1GRWA 2GUOB 5I66B 1DBKH 2GITA 1QFWM 4FZEL 5BVPH 1B0RA 1WSST 3KPPB 3MLSL 2YBRA 1SJEB 1OP3H 1ITCA 4RBPK 1OAXH 2BY1A 4XPHL 4ZFOB 3E2HB 2MQ3A 1YNKH 2ZOLB 4KKLD 4PJAB 1E4WH 5I16B 4PTTA 1KJ2A 2XQBL 3RWHA 1N59A 4RMUA 1FE8H 4ZUTA 1PKQB 2CH8A 4OLWL 4Y8AA 3V5DB 2E3VA 4U1HA 5JLZA 5C0DA 5D5MA 5E03A 1BVLB 2NY3B 3MRBA 4JCLA 2RFXB 4PRAB 4HKJB 5T33H 5CEXB 1I3RB 1KXQE 1JNLL 4XBEH 5EO0A 1TTUA 3HUJA 3BZEB 3RVWD 3UP1A 1M6OA 1JPST 4Y2DC 3FRPG 1DBKL 4ZG1A 1VDGA 1XR9B 5BVPL 4OZIA 2I60L 4F9LA 3M1BA 1KJVA 1Z0NA 1A9BB 4UIKH 1FFOA 2XA8H 3PWPA 4LGSB 4RGNB 3VCLB 3L7FA 1U9KA 5E6YA 4KJYB 1Z9LA 4IRSA 4PJHE 1EHAA 5C9KA 2HTLD 1QO3B 5L2JB 4DJMA 2QADC 3NZHH 4LCWD 3FL7A 2YOCA 1NGXA 3KLDA 2R0KL 1OHQA 4HLZG 2YRLA 4Q6IB 5E99L 3LEYL 1U8QA 1OAZL 1QRNE 2B8OT 4FQ1H 3V2AR 3JV5A 4Z7OF 1HYRC 1QBMH 5JW4Q 3RZCA 5DEGB 4QY8A 3ZKSD 3B5GA 4G8IB 3TZVC 1T22B 3NIDE 4Z7WA 5E2WH 5HGHB 1YMMB 1GOFA 3MCKB 3K8LA 3BVNB 5EOTB 4QRRE 5GJTH 5J9PA 5BZWB 3PGDA 2Z91A 1CXIA 2NX5A 3LKSB 4MNHA 4FQXD 2AEPL 4PRPB 5TDOA 4KMQA 3TA3C 1A7OL 5DYOA 3HHRB 3V6OC 2R69H 2W59A 1Z5LA 4TRPH 3QIUD 2HT3D 1T66C 4S1RL 4R8WH 1EJOL 2MJWA 3CC5A 4EN3B 3O0RL 1RUQH 4FQ1L 4MSWA 4OZ4B 3U9PH 1JGEA 1QBML 1LO4L 1A6TB 2EXYD 4JREC 4OGXH 4LLYB 4L4TB 3AS1A 4C55A 4LCCC 2ZUXA 5D7IF 3BPNB 3G6DL 3WXVH 2W0FB 1BX2B 1XF4B 1ONQB 3ARFD 2Z8WC 4HFWA 5MEPB 2NXYD 5DEFA 1NANH 3WNOA 5E8DH 1L6XA 4N1EA 4QXWA 4JM2B 3VI3E 3MLZL 4OQTL 2AK4E 2OCFD 4ENED 1T1ZB 5DMGC 1B2WL 5H37G 5IBUB 4HWBH 5AZEH 3TN0C 3U9PL 1IEHA 3VRLF 1MFNA 1D7FA 3GMRB 3UMTA 4M7ZC 2FYYA 1SHMA 2VDLH 1JCKA 4HWNA 2HKFH 4EEEA 4WTZA 1ZHBA 1KFAH 1WUNT 1A21A 3TT3H 2Y06L 1B4JH 4QHKJ 1GXEA 3GRWH 2EEBA 3QRGL 5MI0C 3L5JA 4PRHB 4UILH 5DHXB 1RK0A 1QQDB 4OSUL 5SWZB 4FFZH 5HY9B 2Z35B 3MRJB 4TUOB 2D7TH 1QACA 2BK8A 3W9EB 5D71L 3QNYA 4HWBL 1IGJB 1FDLL 3U4BL 3BN9C 4PJBE 5FYJD 3HMWL 1NGWB 3HZYB 1U8IB 1YDPA 1JRHH 4YBLC 3RVXC 1G6RH 1FNEB 5EU6B 4YO0B 3KYMB 3REVB 3ZE0F 2VDLL 1G9MC 5K9KA 3TCLB 1S7QA 1AKJD 2HKFL 2N1KA 1WAAA 1P9MC 4W4OC 3U30C 3FB5A 3GJFB 4WUKL 4APQA 5JNYB 3TT3L 1QBLL 1DDHB 2WUBL 3HPJA 1I8MA 3VXSE 1WK0A 3MV9B 3HFMH 3BZDA 3KYOA 1SMAA 4JQVC 2Z92A 1TJIH 4CADA 2GAZB 1WJ3A 4ODSH 1C08B 1O0VA 2CMRH 1B4RA 4BZ2H 4OLZH 1SMOA 2YK1H 1R5IA 5FCSH 4P23D 1E4KA 2D7PA 4AQ1B 4PRPE 1HSBB 1I1FB 3TYFA 3ZKNC 3RAJL 1JRHL 4DCQA 2BVPA 3CFBB 4NIKB 1G7QA 1EHXA 1EO7A 1J0YA 4LSUL 5FYKD 3SDXF 3TBWB 4PGEA 1QSFD 3EOTH 2J5LC 4P57B 2NY2C 4X6CE 5B4MC 4ZPVA 3BUYB 4RDQF 2UWEB 4JR9H 3AROA 1G6RB 4Y4HD 5T3XL 3BH9B 5CJOL 1WF5A 4L4TE 4WFHD 5FDWB 1TJIL 2HRLA 4XPGL 4ODSL 5E7BA 3OKDA 4D3CL 3TJHC 1V3JA 4Z18A 2CMRL 5E1HB 2CRIA 4NRZB 2GSIA 3TBTA 4WFGD 5DSCB 2IH3B 1GSMA 1MCRA 4M6MH 4GRWF 3G5VB 3HG1D 1KLGA 3J7HA 4HWEH 1T1XB 3IVKB 4LP5A 1CBVL 1AGDB 3GSQA 4HXBH 4HT1H 4ZOBA 4QRQB 3H42H 2VO5A 1IKFH 5C6PB 5DR5L 1C8PA 2MHAB 1T7YA 4O9HH 5DZAA 1N0LA 2BMKB 3RUGB 1X7QB 3UZVB 3OZ9H 1PJ9A 2D03L 4ELME 5SV4A 5C0AB 1A9EA 1UH3A 1LWRA 1J05B 1YEKL 2R15A 3B9KC 2AJUH 2UYLB 4PG9A 5CSGA 4LCWA 1KCVL 5D7JC 1XCTB 1QPPA 4M6ML 4KHXH 4G6FD 3TVMB 1MCPL 5BS0E 5CBAA 4O51B 5IB4A 1UM6H 5SWZE 3VE0A 5GGRA 3QEHA 2DQHH 1T0NB 4H1LH 2APBA 3TJEH 4PJIB 4Z1PA 4QHUB 1M05A 3HRPA 2OTWA 4LF3A 1Z3GL 3TFKC 1FBIL 5M94B 3VXTA 1I8IA 3VFWA 4YR6A 1N64H 4KKAD 1FV1B 3OZ9L 4JY4B 5C07B 4PG2A 4P59L 4F9PC 1ZLWK 1KEMH 1KG0B 4BFBD 2P8LB 1JPSL 3O6LL 4CU7A 3T65A 3GSOB 1WFUA 4MCYA 4XP9H 1CD1A 4HV8A 3UO1H 3QIUA 4C59B 3ARGA 1MPAH 1UCTA 1CFTA 2NYYD 1HEZA 1RJLA 2ITCA 1A3LH 4IMLB 4N5ED 4GBXB 3GI8H 4CMHB 4WJ5A 3QHZL 5GGTH 3OAYK 1SQ2N 4AQOA 2NXZC 4R4FL 3QG6B 1JTTA 2FLBT 5DMKA 2YPVH 3IFLL 1N64L 4YUEH 4E0RB 4XC1H 1DQTA 5K59E 3MLXH 4NO0A 3WO4B 1KEML 1U58B 2ZUTA 3ARVA 3MRQB 4BZ1H 4EXPX 3RWIB 1QLFB 1OW0A 2MCG1 5BO1L 1A5FL 3Q6FA 5CP7B 3FKUS 2UWEE 3HMXA 2H26B 3SDCB 4HLZH 3UO1L 3LRHA 2DI8A 1BIIB 4WEUD 5I8EB 2PR4H 4ONFL 2V5MA 1QHPA 5D7IA 2EC9T 4LSSH 2LTQB 3VXUB 2DTSA 3EYUH 3I02A 2P47B 3RGVC 3PQYA 1H15A 3BIBX 1KXVC 2FD6H 5ANMA 3VD7A 1O7SA 4FFVD 4V2CB 2CA5A 4Y5YA 1NC2B 3OXRB 3SGJA 5ILTL 4MWFB 1AY1H 3NCMA 5IBTH 4MA7H 3ORJA 2PYEE 2GW5A 3REWB 1X9QA 1KB9K 2XWBA 3TIDB 5C0AE 3QUXD 3QXAA 3RJQB 1T1YB 2VR5A 3ULUF 2NZIA 3ALWA 5JO5B 4M02A 1CLCA 4XRCB 1ZMYA 1JHKH 4GKZA 4J23A 2FGWH 3LIZL 2HG5B 3EYUL 1OAQL 4RCAA 1AKJA 4BKLB 3K1KC 3QIWC 4U0RC 4EDXB 3CVRA 4PRIB 4PJIE 3MBED 2W91A 4KKNA 1YECH 3N0PB 4XNUH 5M7QA 4X6DF 5INDA 4DN4L 5J11C 1X5IA 3MJ7B 1GVIA 4LKXA 5IBTL 25C8H 3LZFH 3E8UL 4RA0C 5DO2D 1NL0L 4V1DD 5CBEA 3AGVA 1CGSL 5BJTB 3VRJA 3DV4B 5IVOA 3HN3A 5D2LB 3LPFA 2EDWA 3BAEH 4HUUA 3AU1A 2V2TA 1NGYA 4P2CG 4D94A 5HI5D 4MA3B 1HCFX 2FGWL 1UVQB 5IB1A 1KYOK 1G7LB 3OB0H 4AT6A 3BKJH 3ARYA 2V5SA 5GPRA 3UROR 1AGBA 4YHML 4HMDA 4P5TD 1I7RB 4JFHE 1MJ7L 4XNUL 3BHBB 1PSKL 3S88H 1LO3H 4YAQA 3G04B 3UTSB 3BJLA 25C8L 3LZFL 3KPRA 3EJZD 1MWAA 5GRUH 3DI3B 3JUZA 4I3GA 1WBYB 3KPMB 3RPKA 4XHJC 2FO4B 2CDFB 1QD0A 4LL9A 4XP5H 3RNQB 3VFMB 1VFAB 2VMFA 5C09D 2R0WH 3MLYH 4JFYB 4KGJA 2B0SL 1YNLH 3SDXA 1G7MA 43C9B 5E2JA 1HI6A 3JSSA 4E5XA 1CVSC 4YH6A 1QEWB 3MR9A 4Y5VB 3S4SG 2XWJB 2IBBA 1LK3L 2FL5B 2UY7A 1WBXB 1FP5A 5DMIH 4IRSB 3S88L 5GSVA 1LO3L 4WGWB 3T0EB 3IJYA 3VXUE 5LXGH 4PJCF 3NZ8A 2A73A 4QGTA 2FJHB 4LASH 4NQEA 2CRZA 1IGFH 4U1JB 1NEZA 1JF1B 1VFBB 4I48B 5FUZL 1RPQA 3MRIB 3DIFA 3ZDZF 3SKOA 1NDGB 2IC2A 3B2VH 2NQCA 1U8QB 5L2KA 1X5GA 3CGTA 5E9DB 4HKBA 3HNTL 2HT2C 1TIUA 4PV9A 1AXIB 4ODUA 1UQSA 2BNRE 1DEDA 3Q1SH 1FN4A 1G6VK 3SE9H 1WCQA 4UI2A 2R4SH 1VPOL 3WL9B 3DLQR 2GSGA 4GG6E 1IGFL 1XF2B 5CINL 5TDOB 2EIDA 3WDJA 1XZ0B 4D8PB 5ECJE 4Y2DD 1F8TH 1U8OB 3L3KA 3B2VL 4MNGE 4JFFD 3IDXL 3CFDB 1DUZA 5HYFA 4PY7A 4YDVB 1JHLH 1UWXH 1G7PB 1MIEH 1MF2L 1HHJA 4L0RA 1FGNH 3F7PC 2EECA 2AW2A 3JXAA 5IESL 5CJXC 2DKUA 1B0GB 5DK0B 4RFOL 3RQ3A 2Y36H 1IEAB 1LNUA 3SE9L 1TZIA 4PJ9C 2QADD 1D5ZA 3CUPA 2JJVA 5F7KC 3DVIA 4I1NB 3CVIH 1N7ML 3NFNA 3V6BR 2QHRH 1P4IH 1SYSA 4F8QA 1F8TL 4A2MA 1QSVA 3PDDA 3WFZA 3LKRA 4L4JA 4DTGL 1JHLL 3QR2A 1FCCA 5D5ME 3TZVD 4GRMA 4FMKA 3CFJA 1MIEL 4HS3B 4TVPL 2J2ZA 2UZYB 2I26N 4JFQB 4KUZH 5ID0B 3HUJE 2JJWA 3EYQC 4Z0XA 5TDNB 4G5ZH 5ICZB 3H9HB 3RDTC 2Y36L 4J3OC 5JPMB 3D69A 1BAFH 3H3KA 3S36H 1K85A 5ENWA 4OZIE 1NAMH 4JO2H 3DX9A 3CVIL 3FQRB 5EWIL 4ZMAT 2H8PB 5GISH 4NT6B 3PWPE 1RURL 3BFOA 3FXDB 4UOW0 4X5LA 1T66D 4L8CB 2E27L 3EJJX 1P4IL 5T1DH 1H9VA 4Y5XB 4YPGB 3CIQA 2O93L 1UZ6E 2G2RB 2DQTH 2OJZH 4WO4B 2FB4L 3QUXA 3UC0L 4X4YB 4GLRI 4AEEA 5I9QC 3NIGF 1RZIB 5K9KB 3L95B 4G80B 3QI9C 3VFRA 4APQB 1EO8H 4LLDA 4XC3L 3IAGC 2LQRA 1P4BH 4I9WD 4OV5B 5EB9A 3DVGA 4EI6B 4OCRL 2W9LA 2WIIA 3GSXB 2R8SH 5I1EL 2OJEA 4KY1H 5T1DL 2GKIA 4GS7C 1TZGH 3X14B 1KIQA 5DMGD 4AIXA 3IKCA 4NBYB 3TN0D 4V1DA 1NAMB 4WW2F 5HHQA 2CRMA 4U3HA 2NX5E 1I9EA 5C0BD 2D7MA 3ILQD 4KROC 1AGEA 1MRCH 1P84K 4U7SA 3U4EA 4NJAH 3LQZB 2HVJA 5FB8A 1X5FA 2ATKA 1C12A 1IKNC 3ARPA 2AV7B 4RMSA 3VD5A 3VW3H 1JYWA 4XT1C 5CCKL 4OUUB 2G0UA 5ISZD 2ZWLT 3GMQA 5IB2B 5CIPH 3LPWA 3NCCB 2WWKO 4X6DA 1EFXD 3W5NA 5F89B 1JF5A 3VRIA 2PYFA 1KEGH 1ZT4B 2G60L 5C2BL 3ZE2F 1SJVA 3HR6A 4F2MB 4KY1L 4Q9CA 4JPIA 2P8MA 1CN4A 2VKWA 3OKEA 2NY7L 1I4FB 2GSIB 3SKNB 5JMOC 3KPOB 1SEBA 3BN9D 4JLRA 1SM3H 1JNNL 4HK3N 4NQDA 2P5ED 1S7VA 3RVXD 3SCMA 1KTKE 3MV8B 5HYJB 4YNYA 2V2XB 1NC4D 1MCOH 5D72H 2HT4C 2FWOB 2CUIA 5F6HJ 3WLWC 3PL6C 5J4MA 5KOVC 3U6RA 3TM6A 1VACB 3OTTA 4YGVB 2XZCL 43CAB 2AJYH 4D0CA 1XF5B 3DTXA 5DFVC 4LLVA 1MH5B 1RZ7H 1D9KA 4YFLF 1ULVA 3GI9H 3I6LE 4LQFL 3SJVD 2W9EL 4K3DH 1MOEA 4CRPA 3LMJL 4AIZA 5E8EA 1CE6B 3MROB 1A9EB 4I3SL 1UT9A 5J13B 3PWVB 1MLBA 3FQXA 3HPLA 5B8CB 1SJXA 5FGCB 1RUKH 2XRAL 3ARTA 1H5BA 3ZKND 2VLKB 4R2GB 1RJYB 4I2XB 3N85H 4L29A 1MCOL 4KVNL 5GGRB 1AR1D 3QEHB 2DAVA 3LN5B 3DX7A 1QYGH 2I07A 5C8JB 1LD9A 3B83A 5FO9A 2NY2D 2AJYL 3HC0A 5B4MD 4J4PC 3VXRD 3QEUA 3I9GH 3STLA 1K8DA 1WITA 1BOGB 2CIIB 3QNXA 4WY7H 4XCFH 1RZ7L 2BY2A 5F44A 5JA8B 4H26B 5TH2A 1ETZB 5HJ3B 3TJHD 4K3DL 4UB0H 4KRNA 2VH5H 1WAAE 1U8HA 2V5RA 1K9TA 5IV2A 2X9ZA 4HHAB 4GRLC 1LEIB 3CLFL 5C0RH 5BV7L 1URLA 3O3UN 1Y0LB 4K7FB 2QR0B 5D70H 5HHOD 1K3IA 2QKIA 3N85L 2WSKA 5DFTA 4NYLB 1PAMA 5K9QG 3ZL4H 4Y4FC 5IMMB 2JJUA 3AAZA 3C09B 1LK2A 1HH6B 2GTWA 1XGQA 3OKOA 1YZZA 5ADOL 4EI5C 4Y19A 2FHFA 4PJ8B 3I75A 5DJYB 2AK1H 2F53B 1QPXA 4B7IA 3MXZA 5DWUL 3QCUL 3NCFB 5MEQA 4R4BB 4PJ7F 4RGOL 5F97E 1WWAX 4OLXH 5D7JD 1LRZA 3MUGA 1J7VR 4MZ2A 4X6BA 1LE9A 2Z31C 3BO8A 2BSSA 5F9AC 4HQQH 3HI5L 5KS9B 1A6UL 1I9RH 1PLGL 2XNAA 1P4LB 3O2DH 2NW2B 2A9MH 3TFKD 3TZVA 1JZ7A 3MFGB 2A77H 5E0QA 4FI5A 1U8KA 5JQ6L 4D9LH 3OBAA 3F7VA 2DMBA 3FCTB 4PB0H 2Y4SA 2AXGB 2NTFA 2BRQA 2DM4A 3ZTJG 1MFEH 4NQSB 2HMIC 2I9TA 1HHHA 2XI9A 3MGAA 4N0YH 4OLXL 3S4SB 3VXPB 5I76A 2A74A 4LKCA 4RGMC 5I8CB 1FQ9C 4NRXA 5HHXH 2AJ3A 2JJSC 3BESR 4OFYD 1S7WA 1H3UA 3F7YB 1J87A 1YNTB 3U36B 4ZS7H 5IBLC 2OKMA 1XH3A 3O2DL 4JFXB 3V0VA 5IHLB 2E7LA 2OK0L 3MXVL 2NXZD 5DRXB 2VLKE 5ESQA 2C1OB 1U6AH 5INCA 5JHDD 1D5IL 4I2XE 4D9LL 5DT1H 5C2UB 4P2OA 4PB0L 5IWLC 2WINB 3QPXH 1GPOL 2VC2H 4M1GH 4MJIB 4GUPA 4HF5H 1HXYB 4Z5RA 3WFCH 5AG9A 3MFFB 4JFDB 5T3ZE 1ZK9A 3N1QC 2C5DC 2OX5A 2ATPB 2HTKC 5HHXL 4YHYC 1C7TA 3LOWA 5IMLB 5KVEH 3WIHA 4F7CA 4Q2ZB 3E1F1 3G5ZB 2IAMC 1K5NA 5GGVL 4PLNC 1HOCB 1A6AB 1L6ZA 1AHWC 5BW7A 3GBNL 3VDBA 4D9QD 3EOAA 2F15A 4XCNA 1OGAD 5L9DH 2YSSA 3L3OB 1CE1H 3UYRL 4QRTB 1G0DA 4PRDA 4Q97A 1M7XA 3RGVD 4Z7OE 1T5XA 4KC3B 4RISL 5DT1L 2ARJB 2B1HL 3UYPA 1KIPB 3LVEA 3QPXL 4M1GL 4HF5L 3WFCL 4PGJA 5C0JA 4ONHB 4FABL 1H0DB 4XWGH 2JJTC 4OKVA 4H88L 2FEEL 3DO7B 4Y2OA 4OKDA 1G1YA 2V17L 4S2SA 3BRGC 2OTUB 3DHMA 4WW2A 5AYUH 5CSBA 3UBXG 1FAIL 3MZTA 2GTZA 5D1QA 4CMMB 4K8RH 5CLTA 4GXUN 3WCYA 5ESAA 3LS5H 1LQSR 1OSPH 2V7HB 2P5EA 3ARQA 5L9DL 2RB8A 2XPGB 1Q9OA 4OCSL 1OB1B 1AJ7L 1AC6A 5DQ9A 3QIWD 5GGRY 4MAYB 5F70A 1T1WA 3HRZA 3T3PF 5JOFB 4WI8A 3U7WH 1ZHNA 3C2AH 2F54A 1CFBA 5DHVA 5D7IE 3ZT7A 4MVBC 4CVXA 2EEAA 3G9AB 3SPVB 4HFUH 4YXLL 1EEYA 2V7NB 5DUBA 4U1MB 1S3KH 1L7TH 3OKMB 3PQYE 5KVGL 4XCEA 3T0BA 1A7NH 5CAYB 4K8RL 4YE4H 3PXJA 4UAOC 1Q9LA 4YDIH 2F8OA 1OD7A 2P1YA 3TPUB 1JPTH 3ULVF 5F7FA 5SX5H 1J1OH 5GIRA 1FORH 2APWA 4Y1AA 1BECA 2YEZB 1JMZA 3NCEB 2ZSWB 3GBLA 4L4VD 3VRLE 5I71C 5I15H 3U7WL 4M6AA 3C2AL 4ODBD 1G7HB 3KLHD 5EUOB 4TPRL 1IQWH 4M9PA 3GSNA 2C5JA 1F3JB 1IAII 4HFUL 3QQ9C 2CLZB 2X1PA 1WZ1H 4XHJD 1HH9A 5J6HA 1F4HA 1S3KL 4FZ8H 1L7TL 3BIKB 1U93A 4BQ8A 5DVLA 3ROLB 2J8UF 3CK0L 4YE4L 4JFDE 1RVFL 3EDEA 3HE6A 4OLEA 4NBXB 3WXWL 1S5IH 4UDTA 2AJVL 2P5WD 3LKNA 4JZNA 4NZUL 1IM9A 2NY1C 3V79C 2DRUA 3IXTB 4LPVA 4DFHA 5I0DA 4QO1A 2RQ8A 2WOYA 2AP2A 3LSOA 1AD0B 2Y5EA 1MLCB 3ZE0E 3L3JA 2PO6D 1NFIA 3NACH 1IQWL 1TETH 3VMPA 2KQMA 1MNUH 2CJUH 2HVKA 3C6SB 4POZC 1DLHA 2JIXB 4JQXC 1D5XB 4WEMB 5GRXG 1W2KT 2VUOA 5T1LB 4FZ8L 1BQHA 4JPWH 2DQGL 4WWKD 3OQ3B 5D7JA 5CEYB 2X4UB 2ED7A 5CEZE 3DGGB 2A1WL 4WHTA 3KJ6L 4YHNB 3KPRE 4OI8A 3NCJL 2NY4B 4M8VA 4TQEH 4GMSH 3UTQA 3UJIH 3QUML 1EGJA 1HILA 1UM5L 4TSBH 4AM0B 3WNMA 3NACL 1WZMA 1TETL 3SDXE 1U8MB 4UZGA 3KS0J 5EBMB 5C0CD 3IDIB 4DN3L 5A3IC 5F7EH 4H8WH 3QRFM 3I84A 2K7QA 2A6IB 5D1XC 4JPWL 1D6VH 3HC3H 4HUKB 3ET9F 3EOYG 2R1YB 4NKDB 2J1KA 3T4YB 1MFBL 1A6WH 3X12A 2KWHA 5DDHB 4DGIL 4OFYA 4IHOA 1GIGL 4U6VH 1MRFH 4OCNC 3X3FH 2DQCH 4G8FB 4WW1B 3UDWC 3D3VA 1J0KA 4GMSL 5T1KD 4GRWE 4NQEE 2VXTH 3BP4B 2F58L 5FKAB 1QKZL 2OM5A 1QVOB 2OSLB 5E1AA 3VWJA 1W0WA 4R97B 4TSBL 1DE4A 4A6YB 4PJ9D 5JHDA 2VDOL 4UTAH 2VZUA 5L2KE 3H9ZA 1KTDA 2OL3B 3TO4B 3VFRB 4O58H 5ID1A 3HKFA 5IM7A 4H8WL 3PP4L 1GGTA 1U8JB 4JM4H 1OQXA 1D6VL 2FJGA 1WZLA 4IRJC 3HC3L 5JTWA 3L1OL 1RZFH 4DAGL 5EUOE 4ZPTA 4OF6A 4MHHI 5FM5M 3OJVC 5DRWA 4HUXA 2AI0H 5T3XD 3N06B 4NWTL 4U6VL 1ACZA 3GMLA 3X3FL 4M62L 2EE3A 4PJEF 4I77H 3P73A 4UINH 3HE7A 4UTBH 2R4RL 1C12B 1OF2B 1UACL 4JZOB 1A64A 5TDPA 1I9IH 5F88A 2ZSVA 3I2CH 3RDTD 1S7UA 3ILPB 3QQ4B 2L4OA 4FFYH 4DFIA 3QWOB 3VWKA 2VWEE 3KLAA 4PJ5A 4E41A 1LE5A 4EDWH 4OZFH 4OJFH 1KJMB 2C3HA 5IGXL 1J8KA 2K7PA 5ESVB 1DQJA 3VFUB 4CVZB 3Q2CA 4JLRB 4GQPH 4OD2A 4YHOH 4C4KO 4I77L 1CL7H 4Q6YA 1JV5B 2BNQA 2YUZA 4QHLB 4UTBL 4OCYL 3MRRA 1VFMA 3CNKA 1VSCA 1ODAA 4NZTH 5CJ5A 3G08A 3P4MB 2YC1A 3I2CL 2QTEA 1DQQB 4JO1H 3QI9D 4DVBA 3QIWA 3JWOL 4CKVX 1RIVL 2D9QB 5D6DA 3DMMC 4Z76B 4LMQE 3OKLA 2BHUA 4LHQB 2VAJA 2HFTA 3PDGA 2ZUVA 4FNLH 1X5AA 4QHMA 1Z2KA 3V0WH 3FT2B 4EIZC 5I8KH 2EDEA 2MCPH 3QDGD 4KROD 4JHWL 5MEOB 1FLRL 1LEKB 3LKQA 4XB8A 1OD9A 1CL7L 4XVTH 5IHUL 1UWEL 2PW1A 4I13B 4M8QB 4PGDB 3HAEA 1MIML 1IL1A 3M8OH 4FQJH 1ROWA 5GRVL 1EXUB 3NCYS 4L4VA 3ARED 3NIFF 3R06A 4XNXH 4UQ2B 5EC2B 2PTTB 4F3FB 2AV1A 4PJCB 5HGAA 1J1PH 4ZAKB 1X5KA 3HI1A 2VDQL 4NUGL 3V0WL 3BDXA 5B38A 1HZHH 1U8HB 1K6QH 4WUUA 4DUWA 2JB5L 1Q9KA 3G5XB 3BD4A 3ES6B 4N9GA 3SOBL 4OCWL 3UCRA 4UNVA 1C16B 2AABL 2HT4D 2KH2B 1FO0A 3WLWD 4XVTL 4ZO8A 3S96A 2QKIB 4GAJL 1HHKB 1UEMA 2VLJD 1IGYA 2P5WA 5DFVD 3M8OL 4FQJL 5IQ7L 1EPFA 1AE6L 5JW5B 3ULUE 4KK5C 4MAUH 2A83A 4OZGF 3D1MC 1JGUH 2DLFL 3H3PH 1OP3K 2R2HA 1EJ6A 1FFQA 2HWZL 3I75B 1OQOA 2Z93A 2PO6A 3IJHB 2WBJC 2DI7A 1DTUA 1FL3A 2H9GA 3U1SL 3TESA 3QEQD 1KPUA 4C57C 1SVZA 2J8UA 4PGZA 1K6QL 1EVUA 3BWUC 3FB8A 2ZPKH 4X6DE 2LAAA 4H20L 4WWKA 3JWDL 2OQJA 4RQQA 4Z7UB 2XT1B 2Q7YB 3OR7A 4J4PD 3UBXB 2ENSA 4QOKB 5TE4L 4GT7A 4P5KA 3OJDB 4RNRB 2BVUA 3TBYB 4NQDE 5IEHB 2YD9A 1J10A 1J8HD 1JMXA 3OX8B 3LEXA 3LY6A 1ZV5A 3MA7A 2AQ2A 4OZHF 3S35X 2WAHA 3CU7A 5ICXB 4RWYL 1AIFA 1FL6B 1BM3L 4RIRA 5C6WH 4GRLD 3SQBA 1OOAA 2VYRE 4WU7A 4XH2B 5GS0H 4NRXB 4LHJB 4Y4KC 4FG6C 5B39A 3ZKXC 2YA2A 1ZGLM 5KBNC 1DANT 1QSDA 1A0QL 2V5YA 4Y4FD 4EBQL 3S98A 5C08B 2A6DB 1QSEA 1V3MA 5I1HL 1FYTD 2GFBA 1JGDA 1WWCA 5T1KA 2HJFA 4LGPB 4JRYD 1AD9B 5ESQB 3QUYC 5AZ2L 5DK2A 3WHE0 1PEWA 4QWWC 3KPSD 2VL5B 3ECBB 4KDTC 4JY6A 3GGWA 3AMLA 4K8RC 2OI9B 1WICA 3SDAA 4LVNC 4XP4H 5HHNB 1QFHA 4HGKC 4OD1H 4Z8FH 2YKLH 2Z31D 1Q9WA 1M7IB 5C6TH 4DW2L 4ZO7A 2CDEA 4EKXA 1CDYA 3SDYH 1OLZA 4PJCE 1JNJA 5D2NB 5F8RC 1KENL 3SDDC 1NKOA 4F57H 3X11A 4BQCA 4KQ4H 1UYWH 5BOPA 3ZDZE 4HZLB 2WLZA 4P3DB 2BSRA 4AEIH 1W72A 2PCPB 3CSYB 4N8VA 2GJZA 5CILH 3IJSA 1DN0A 2FHCA 4LAQL 1QOKA 2YPKB 4YXKH 4OD1L 5IHBA 3SKMB 1WC7A 4WVRA 4LCUB 4X98A 2Q8BH 5IVNA 2NY3C 1DEEB 5C6TL 4PREB 4Y19E 1A4JB 3SDYL 4WW2B 2Y7QA 2Q1EA 4PJEA 2QQLL 5IBLD 3QZWA 2XKSA 3C5ZC 1QA9B 2MQ0A 1BQLL 3MUHL 1UYWL 4KQ4L 4XXDA 5DZLA 3VFGH 5KSAB 2ADGA 2Z0BA 2I5YL 4PP2B 4DEPC 4P2QD 5MENA 1IGMH 4P4KB 3DHJA 3IKKA 2VTFA 4HJJH 3NFPB 1OWRM 4OFVA 2C5IT 2HN7B 1OARH 3MLVH 3O2VL 2O5ZL 3NPSB 5EFIB 3S35H 5D8JH 1EZVX 3MGTA 3QNZB 3CFEB 5FFLA 2OP4H 4HBCL 4G8GA 4M3KB 4X5WB 3D39A 2DL2A 1S7SA 3DXAB 4D0BA 4MS8C 1C5CH 1LDSA 4G8EB 1JVKA 2NR6C 4WWID 3WD5L 1ZA6A 4NQCA 1KIUA 4MCZA 3QCVL 5IEKB 4ZXBC 4JN1L 5K33A 3MRFB 2PETA 1KCSH 4IS6A 3QDGA 3NBNA 5F9WB 4BSVA 4AMKL 4ELKB 1KJ2H 4IOIB 3U48A 3QXDA 2IBGA 2NY5L 3O8XC 5CLWA 4JN2A 1A6VL 4Q0XH 4XGZB 12E8H 1RZ8A 1NFDF 1IGML 4JDZA 3EZ8A 4NC2B 4HJJL 2A9NH 4Y1AB 1SBSL 5IOPB 3DO3A 3KDMA 4HC1A 3IDJB 2YPLD 4PV8A 5E8PA 2ERJB 5C08E 5D8JL 3AREA 3MREA 3V8CA 5GS1B 3CKDA 1YEFL 5KAQF 5JDSA 4ZYKA 1FSKB 3V52H 1UGNA 1N0XH 2FR4B 4MA1B 5DTFB 2LU4A 4P2RB 4XTRC 2O5YH 4GAYA 1UJ3A 3P9LB 2D4DA 3WV0A 1KPRB 3SY0B 1PVHA 2VIRB 3H0TB 4ZFZA 4KVCH 4P49A 2M8XA 3QJFA 3PIQA 4EN3C 3CSPA 1KJ2L 3OAUL 1V7ML 5CUSL 1P5UA 5HDQL 1GHFL 2X1QA 4XZUB 4G6JL 2B2XH 3ARDC 4Q0XL 12E8L 3FO9B 4UDTB 5JR1H 3GUTA 4H8WC 5D2NE 2VLJA 1LO5A 1Z0MA 1Y6MR 2EZ0C 5DRZA 1EUTA 1I3VA 3NIGE 4ISVA 4MVBD 3O6FC 3ZZ1A 1E4JA 3H6JA 4ZUSA 1G84A 2LV4A 3VD9A 3V5HB 4OFPA 5EN2B 4TVPD 2CDGB 3G5YB 5ERWB 3CFKB 4FTVD 2X41A 3L9RA 5TF1H 1JHTA 5FUCE 2VXQH 4RAVA 3OJ2C 4KVCL 3P0YH 3V5KB 4Q9QH 4I0PB 5E2UL 5GXBB 3ZDXF 1JNHB 1OSZB 3OXSA 5I2IA 3VG9C 1Y6KR 1YEDA 5IF0A 2BC4B 4XCCH 1MCJA 5KW9L 2CO6B 1NBYB 3HZMB 3VXNB 3NTCH 4L9LB 2Q3AA 1KIRB 2ADIB 5KVFL 1F4AA 4YWGH 2EDTA 4MYWB 5TE7H 3L7EA 3HNVH 3IFNH 3O6ML 3QQ9D 1BEYH 1ZAGA 5D1ZA 2ORBH 4PJ7B 2EIZA 5FGBC 2MNUA 3GB7B 1NAKH 3G9VA 3QAZB 4KAQH 1ORQB 5TF1L 3HZVA 1CDJA 3FQWB 3MNWB 4N8CH 5KZCD 2VXQL 2FBJH 2ZCLH 3U4AA 4RMVA 3P0YL 4ZTOH 3ZE2E 2F54E 3IGAB 2BJMH 4KXZH 4HS8H 3DXAE 4AH2A 3I6GB 5F3BA 3MRCA 2NY1D 3I50L 5FA3A 3X12B 3BZFA 2DIBA 2VITA 4P46D 3GHEL 4HMCA 5DJDA 3QXUA 4X4MA 5ACZA 2AXHA 4NO3B 1KPVA 2EE9A 4QCIA 4L8SB 3OR6A 4YWGL 4CNIB 4GKSA 4OZHA 5TE7L 1FZJA 4R96B 3GMMA 4POZD 2HFEB 1MHHA 3MZGB 1LP9A 1XFPA 2BNUA 4NHCH 3N1GC 5DVNA 4Y1AE 3AXLA 1QBAA 2HJLB 3W11C 3MRHA 4JRXA 4KAQL 1EUUA 2DWDA 2VDMH 2C3VB 4N8CL 4HIEB 1XR8B 5EIIA 1JZ2A 3O45B 1OVZA 2BJML 2X4QB 5I0ZA 3ARBC 4HS8L 3SE8L 1N4XL 3C87A 3W39B 2ESVB 1CFNB 5DF0A 4P2RE 1U3YA 3A67L 5E6IC 1Z6JT 2GJ6D 1UKSA 1AQDA 2FLRT 3BYYA 4XHQA 5D7LB 3P73B 5BOZG 3MV7D 3BGAA 1IGIH 1YN7B 4BQ6A 1YYMH 3SGEH 3K0WA 5FOBB 4HWZB 1CLZH 4DZ8B 5A3ID 4U6TA 4NHCL 2CIKA 3UJTL 3QHFH 2ZKHH 2SEBA 1HKFA 1TNMA 5D1XD 4OBSA 2YS4A 3IETA 4RRPA 2JK5B 4TUJB 2Y5TB 4BQBA 3WJJC 4E41B 4HJ0D 2K48A 1T7XA 3F65A 4M61B 2JJSA 4XNYL 5EZOL 2OR9H 1MEXH 1HINL 1WT5C 3MLRH 1YY9C 4H0IA 1RU9L 4MNQB 4F7EA 2Z4QA 2X4TB 4R90L 3FT3B 2BNQB 4OM1H 3SGDI 3BKCH 1IGIL 4QTIL 4P2QA 1YQ2A 5J1AA 1YYML 1XGYL 1BBJB 4NOFA 5IHZB 1CLZL 1F2QA 4DVBB 4LLQA 1YY8A 3QHFL 1MY7A 3JWDC 1ZLWH 4LGRB 1WCBB 4IRJD 3T2QA 3O3EA 1U95B 3AVEA 1D5MA 3CH1A 1J0JA 3EYFB 3E6FB 2GT9B 4CVWA 4LLUA 3VJ6A 3D25B 1MEXL 2N56A 4LVOC 4PJ7E 4DKDC 5SWQB 4FQ2L 4K3EH 1AI1H 1PQZA 5HHVL 3RNKB 4CU6A 1NCAL 5CWSB 1DUYA 1KJ3H 3Q6GH 3DVNB 3I6KA 4N0FB 1QLEL 2ARWA 2WWKT 3WHXB 3VFNB 4OM1L 2AXFA 3LQAL 1WBZA 3HLAB 3BSZH 2VE6A 1J5OH 3QIBB 4JZJA 35C8L 5HVFB 4Y88A 3D3VE 4X0KA 1FZOA 3T4AA 5F7UA 3RY6A 4PJGF 4HUNB 4L3EA 5IR1A 2PXYA 4Z77B 5I1GH 1CU4H 5LJYH 4NM8L 1MFCL 2IC9A 1ZLUH 1JF6A 1KELH 3BKYL 5HVWA 2NY0B 4GH7B 4QRSB 5CJQH 4P48A 5BRZA 5GSRB 2OLDA 1NJ9B 1NFDA 3OHXB 4F58H 1WWBX 1BZ7A 4HIHA 1MRDH 2A6JB 3MA9L 3BSZL 1X6NA 4G9DB 2ESVE 3DMMD 3JTSA 5KSBA 1E6JL 1JUFA 4UT9H 3TIEA 2IPUG 5DRNA 4UQ3B 4IGBA 4OIAA 5D96C 4HD9A 4MZ3A 4JGUA 4QF1B 5DJ0B 1KACB 2CKBA 4YZFF 3RA7L 1ZVSA 1T3FB 4GAGL 3DRQA 4N90D 3H9SA 4G43A 3IDGA 5JIPA 3QG7H 5T3ZH 4KI5F 2J8UB 4FTVA 3WKNA 4WNQA 4NNXA 4XAWH 3EAKA 4O02H 2O5XH 2X1OA 3FQTB 3NGBB 1Q94A 4PJ5E 4E41E 5E8NB 4F58L 2QSQA 4GW1A 4NQXB 4WV1A 3QHTC 1HKLH 5I1JL 3ARWA 5LGJB 5FCUH 1PY4A 4X8XA 1MRDL 4XWOC 1WIOA 5D93B 3ARRA 4ZQKB 5GHWH 3VG0L 4FQCL 4BSWB 2ZCKL 5IROA 4HBQA 2DKSA 3PWLB 5IIEA 4IIQC 4I18A 1K2DB 1T21A 2BNQE 3BEVB 2FNBA 4G7VH 4RZCA 3MRPB 5ICYB 2XQYK 5F96H 4MJ6A 4RIRB 3LQMA 5T3ZL 4AEHH 5IMOA 1SJHA 4S1SH 3BXNB 2X44D 2F9BT 2KZWA 3J8F7 4O02L 3O4LA 1D5BB 1EZVY 2GCYB 4NDMA 4YFEA 2Y72A 5F93C 1CDBA 3JUYA 1P7QA 1RUPL 1MCDA 3MNVA 2VSCA 1FFPB 3GMOB 5E94A 1YN6B 4P46A 4KK5D 3M17A 4BH8A 1JWSA 5C0NC 2VZVA 3NFSH 2VAAA 3QUZA 3LV3B 3WFDH 1XGPB 5DK2B 4HDIA 4K9EH 4L8BA 3ELAT 5EBWB 1FL5A 4XVSL 3U46A 5CFHA 4G7VL 4FQXB 3T3PE 4BELD 4LQ1A 3SDAB 2NY5C 5F96L 4LBEA 4AEHL 1EBPA 3LS4H 1BVKB 1C1EH 1JGVL 1A02N 4EUPG 4M3JA 2W38A 2WWMC 3LH2L 5H35A 4U6HA 4DZBB 3EO0A 5JXAL 4ZSOB 1IZJA 1KTLB 3MUJA 3FO0L 4M7LL 1BIHA 3O9WC 5CZKA 4X99A 4HKZA 5HHPA 5EU3B 1AP2B 4WUUE 4NN6B 2GJ6A 1X5ZA 1CICA 3ULVE 3HMXL 1UWXK 3S4UA 3HB3C 3MV7A 1R3KB 3FFCA 2X7LB 1W72B 2HLAB 3K46A 3WFDL 5TE6H 4N8VB 3ARFB 4X7DC 4HJGB 4F7PA 1IJ9A 4UUJA 1QRND 4NFDA 4QRPA 2LE9A 1DSFL 4H0HB 3IU4H 3LS4L 4Y4KD 4FG6D 5F7LB 1UWGL 1EERB 1S9XB 1C1EL 2BDNH 4P0DA 5F1IA 3TGXA 5BZDA 5HYSA 1T83A 3O3DB 2B5IC 4QRRD 1ND0A 4C56B 3MNZA 3MMEB 2J8UE 4XI5C 1CQYA 3G6AB 2RR3A 3FN3A 3QUYD 2FX8H 3D0VB 4JFZH 2OYPA 4QWWD 4DQOL 3WNKA 2I25N 4U1LA 4FQQB 4K8RD 3EZJB 1HQ4A 3ULSA 3F62A 3JV4A 3L5XH 2ITDB 4IRSC 2IANB 5CP3A 4PJAF 1YC7A 4RFEA 2AAVA 1CLYL 3GK8L 2XTJE 4IDJL 2W60A 4R3SA 2YD2A 4MXVF 1BFOA 5FYKH 4K7PL 4MJ5B 4MGXA 4CU8A 3D85A 5DJCA 2F19L 4MD0B 4JFZL 3BP5A 3RZCC 1V5JA 2EYSA 1FCGA 3S3JA 3A6BH 1J88A 1NMAH 3OKKA 2J4WH 1FHGA 5EU5A 3ARXA 2AK4D 3QDMB 3T77B 2ZUWA 4HK0B 3LPGA 3BGMB 3I3BA 1QSEE 1K3ZA 4G9FB 5I1IH 3QDJA 1MJJA 1MSPA 4H5SA 5DVMA 1A6PA 2NY3D 4X6FA 1P7HL 4YDJB 4M6OL 1TCRA 1UXSB 1T4KA 2O26U 3BZ4A 1TCMA 4FXGB 3S34H 3TH2T 1ZA3B 1DLFH 2AEQH 3C5ZD 1V3KA 4LOUC 4P23B 1HQRB 1RMFL 3GKWH 4HPOH 4ZFZB 5CEZL 4O2CA 3KWWB 1SYVB 4AEFA 2FX7H 1S7TB 5C0IA 1INQA 3SE4C 4IMKA 1QSFB 1TQBB 1MWAL 3BPOC 4RX4A 4G3YH 1NMAL 2J4WL 1YEHH 3GSVA 3P4NB 4YHZH 3KPQA 2QSCL 4U2YA 3VXMA 4FA8A 1MI5B 2X4SB 1BREA 1BBDH 4Y4HB 5EO9B 3KPLA 4PJGA 3LN4B 1T7ZA 3P77B 1HHGA 4MS8D 2NR6D 4UT6H 5CHNB 1JPFA 1F58H 1DVFA 4KTEH 1DCLA 5HSFA 2P8PA 3K80A 3CXHK 5K93A 4ZXBD 1I85A 2B7DT 3CCHA 1NCUA 1DLFL 1D6EB 3GKWL 3HG1B 4UDUA 3KJ4C 4CQIA 1YC8A 3F58H 4ZNCD 4LARL 3MX0A 3O8XD 2C4FT 2FX7L 3P0VH 2Z1PA 1FFNA 3OWEA 4XNZC 3QO1B 3VXSD 1NUGA 4G6KH 3K2UH 5E6ZA 3BP6B 2XG5A 3CXDH 1OTSD 1J86A 2ZCHH 4PJEE 4OZGB 4R26L 4XPAH 3VFVB 4C56E 2H3NA 3SKUD 3IAPA 4OTXL 1E6OH 1GZPA 2EEDA 4PLKC 4PRPD 4XTRD 5MENE 5E95B 3RVUC 4UV4H 5I1KH 1EO5A 3EYVB 4JM2F 2KKQA 2R2EA 1KB5B 1MCEA 4EN3D 1WZKA 2IANE 2VDRL 5IFAL 3PJSB 1WIUA 4G8GE 5KSVA 1ADQA 1KCUH 4WO4C 3ARDD 3D39E 3WE6A 1CDGA 1BD2A 3K2UL 4Z7VF 1FZMB 3CXDL 4L4TD 2EZ0D 4NQCE 1QUNA 1CFVH 1FNHA 4R0LA 2ZCHL 2K1MA 1KPVB 3PV7A 1G9EA 1HSAB 3O6FD 3TV3H 1CDHA 4NQVB 4HULB 3FONB 3C8KA 4APQC 1FZJB 5I8OH 1ED3B 3MRLB 3PHOB 1MHHB 3NMEA 1YA5A 2J12B 3WNLA 3BRFA 4I4WB 1GC1H 1X3DA 4NN5B 4UV4L 3QDME 2DTML 4XP6H 3WLBB 2ZUUA 2A0LC 1ZKEA 3O3BB 4PP1C 2B4CL 4JY5L 4P3CH 4TUKH 2X89D 3LQAC 4GXVL 4G9FE 4JCMA 4MDIB 4MD5B 2DLGA 5CD3B 2EICA 1ZT1B 4PBXA 1E4KC 3C08L 5F71A 1NCDH 3PDOB 4HS6A 1IC1A 3D18B 2EDDA 3WN5B 3NAAH 1F11B 2VZTA 1FNGA 5IVXF 1YYLH 3TV3L 1MCFA 5KANI 5C71A 3DRTB 1T03H 1BF8A 1OCWH 4AIOA 5I8OL 2P4AB 4YIQB 5ETUA 5BS0D 2JF1A 3MGOB 4XBPA 2A6KA 4X4XA 2X4PB 5SWZD 2EH7H 5I73B 1A22B 1GC1L 1CG9B 1NDMB 5FK9A 3NIFE 1FNFA 3NCYP 1MI5E 2UZIH 3RWJA 4C54A 1CGXA 3Q5OA 1M1SA 2AEIT 1DBMH 1XIWA 1OL0A 3WEXB 3V7AE 3FB7A 3VXQB 1OY3B 4WHDA 3V6FA 1U8LA 1T5WB 2R23B 3S5LG 4JPVH 5FV2A 2J3SA 4ZS6C 2EDRA 3NAAL 5IK3B 4WRLA 2YUXA 1PYWB 3BQUB 4XP1L 4IRZH 4HH9A 4F15C 5I6XB 3W11D 3N1MC 5DJ2A 5TJWK 1KLUA 2FCBA 4OZGE 5KSUA 5DQJB 2BY3A 4W6YB 1KLFA 1DBML 1D5MB 3ARBD 5A43C 1N8ZB 2AVGA 3C5SA 3CX5J 1W8NA 2J6EA 4FQPA 2X9WA 1PQZB 1PG7L 2GK2A 2GUOA 2R1XB 5I66A 3RFZC 2YWYA 5D7SH 1TNNA 5DMYA 3KPPA 5DZNA 3T08A 2DM2A 5BVJB 1SJEA 1HE7A 1HXMB 5FOJA 3RTQB 4ZFOA 2YN3A 2ZOLA 3CVHA 4YDKL 4PJAA 5I16A 5DZ9A 3ULUL 2JELH 3MBEB 1BP3B 4HCRA 2EDYA 4U31A 4X4ME 1PKQA 3RUGF 5EZLB 3TH3T 3V5DA 4PJDB 4PG2C 3SQOH 1BVLA 4OZHE 3TT1L 4PRAA 4HIXH 4HKJA 4KRMB 3NOIA 3U82B 3RIAF 5CEXA 1I3RA 1AFVL 1YY9D 4YK4B 1TXKA 1FVCB 3BZEA 1CGWA 1P5VA 4N0UB 4DVRH 3QIUC 4JRXE 3ARGC 3JTTB 2RAMA 2LVEA 1XR9A 4EQ2A 4JAMB 4M1DL 1V7NH 3O81A 5HHMB 1MCSA 1A9BA 1RHHB 3GHBL 1JWUB 4EUPB 3FO2B 2PYED 4Q58C 2JELL 4KJYA 4J3SA 3TIEB 4PJ8C 4WCYH 4XMLH 5DEZA 4P5TB 4JO4H 4WIQA 3W2DH 1CD0A 5C0AD 3VU2A 1QO3A 5L2JA 1X5YA 4UU9B 3S37L 1OW0C 1B6DA 4G43B 2CGRH 4Q6IA 4Z6AT 2YD6A 4K94L 3JV0A 5EZIL 2V9TA 5C09B 3WO3B 5T5FL 3V4UL 2VJXA 2YMXH 4LNRB 1FVEB 1V7NL 2X70A 5DEGA 1V05A 2VDPH 2R2BB 4EYYR 3BYTA 4G8IA 3HS0B 1T22A 3HZKB 4HPYL 5HGHA 1U8NB 1YMMA 4K2UH 5GS2D 2Q86B 4B50A 4AK1A 3MCKA 3BVNA 2P43B 4XMLL 3GO1L 5EOTA 3PUCA 4U1GC 5DGQA 5E4EB 4GG8B 5BZWA 3CZFB 1KGCE 3NVQA 4KDVA 3LKSA 3QFDB 4Y5YC 4PRPA 3SGJC 1P7KB 3IFOB 5HI3C 5EIQA 1DN2A 5LVEA 1HDMB 3OF6D 2LVCA 3FMGL 4QKXB 5ALCL 4ZO6A 1OPGL 4EN3A 1S7RB 3MLTB 4LRNH 4OZ4A 4GSDH 1DQLH 2EXWC 4GBXD 2BOCB 5EBGA 4JFHD 1A6TA 5GZOC 2KWIB 1IBGH 1VHPA 2VDPL 5ALBL 1MFDH 5A2IH 4QHNB 2FBOJ 1S9VB 1NCBL 4L4TA 4LLYA 4BJLA 4ODWB 5A40E 4WTWA 3D2UD 4PYGA 4KQ3H 2W0FA 1BX2A 1XF4A 4RMTA 1ONQA 3MJ9A 2W0KA 4ODVH 3IDMB 5MEPA 3KNBB 5FV1L 4KDWA 3WFEL 4KRPC 5LWYH 1DBAL 2YR3A 1DP0A 2AKRB 4JM2A 4OT1H 3SDCD 2E7MA 3FN0L 5EORL 3WUZA 1T1ZA 4Y2DB 3T8XB 4LRNL 5JIHA 2MWCA 3B6SB 4GSDL 4JFFB 3GMPB 3HR5B 3HI6H 5JPNB 3BI9X 4L3EE 2CK2A 5DC0A 1IBGL 3GMRA 1MFDL 3RWEB 5JMRA 1CFQB 2MQCA 3LKPA 2GJJA 4X7SL 2Q8AL 3VXUD 2ICEB 4JFOB 4GJTB 4JGJA 4N0UE 3I3EA 1IC7H 5BRZE 1NFDE 4ODVL 1NC2D 1X4ZA 5HHME 5D7KE 1GAFH 4LHUD 4KJPC 4N5UA 4PRHA 5FGBA 1RJCA 1QQDA 5SWZA 1C5BH 4J6RH 3FO1B 1BMGA 1NSNL 4JRWA 2Z35A 3MRJA 4G6MH 4TUOA 4KWUA 2ZOKB 3R8BB 3IRPX 1RZJL 4LMQI 3W9EA 3BW9B 2IPKA 1IGJA 2BNRD 4AENB 3HI6L 1NGWA 3HZYA 1U8IA 5B21A 4WEBH 3H9SE 4JQIL 3MOBH 5D2LF 4LVEA 1HYSC 2V6HA 1FNEA 5EU6A 4YO0A 3KYMA 5C0ND 3REVA 2B39A 3TCLA 1S9YB 1NKRA 2WW8A 3MXWH 3FB6B 4U7MA 1UFUA 5JNYA 1DDHA 2MOVA 2D31B 4CDGC 3MV9A 1GAFL 4PRNB 4YDLC 2VISB 2YA0A 3TA3B 3PV6B 1P6AB 1NGZB 2GAZA 1C08A 2HJKB 1S5HB 5E56A 4LK4A 4JPKL 1HHIB 2HFFB 3GRWA 3O3AB 4ONGL 4NC1C 3KS0H 3O9WD 4D2NA 1HSBA 3SO3C 1I1FA 4JREB 1VGKB 3CFBA 3EYSH 3VDCA 3L3HB 3ZDXE 4LCCB 3EFDH 2AJSL 3HB3D 3TBWA 1BFSA 3EO1B 3RL1B 3O4LE 4P57A 3WIHL 2G9HB 3DBXB 4LCIL 4OQ1A 3Q48A 2UWEA 1G6RA 1TFHA 3BH9A 4HEPG 1ACYH 2DJUA 1VCAA 1BJMA 3GSUB 5AWNL 5LQBH 2EYRB 1G9MH 4NRZA 2XKNB 5DSCA 1CXHA 2IH3A 4PGCB 3OG6B 4F37K 3TN0B 5IFHH 3G5VA 3IVKA 4PB9H 4ZFGH 1T1XA 3CMGA 5C0BB 1R0AL 1AGDA 2H2PC 3B9DA 4M7ZB 4KFZC 2DLEA 4QRQA 3U7YL 2VWEC 4U0QB 4YHIB 5M95B 2Y23A 3MYJB 2MHAA 3PWPD 1T7WA 4KTYA 5ISZB 4PLJC 5ABDE 2BMKA 2B4CC 3PF2A 3T2PA 3RUGA 1X7QA 4IRSD 1EFXB 4M6NL 5MI0B 3CDGB 3P9MB 2WBWB 1RIUH 1GGIH 3KPNA 2R29H 5C0AA 4HLJA 3RL2B 5LQBL 1J05A 1IILE 4KMLB 5FM5O 1VGEH 1MREH 2UYLA 3FTGA 3FFCE 3K2MC 5I30L 1MQKH 1XCTA 1UA6H 3MRKB 3L3DB 4ZFGL 1VFOA 2OBGA 3TVMA 5L8JB 4O51A 1E28B 5J7CC 4LIQE 4XPFH 4QRPE 5D6CB 4LEXL 1T0NA 3GSNH 1NC4B 4PPTA 3UPRB 1ZOXA 5E00B 4PJIA 3RZCD 4URTB 4QHUA 1GC1C 3U30B 1E4XH 3C9NB 3MV01 3FFDA 4NNYB 1YQVL 3L5WB 2ZG2A 1JYVA 4P2YA 2X1XR 4AL8H 1FV1A 4JY4A 5C07A 3S5LB 3TNMB 5GRVK 3SJVB 2NX5D 1RIUL 1GGIL 4ODXB 2R29L 4LSQH 4R6UA 2WUCL 5JXEA 2FSEB 2H2SC 1U92B 3WYRA 1NFKA 1KG0A 1Q72H 2VUYA 2P8LA 5HD8C 4LOUD 4FFVC 5I1DB 4ZUUB 3GSOA 1MHEB 2IPTL 1ZKAA 4UOW1 5FO8B 1VEPA 4YJZL 4IMLA 5KG9B 4O4YL 3VFSB 2QSTA 2F74B 1F00I 4GBXA 5SWSB 3QUXC 2J5LB 3S7GA 5HXMA 5EA0L 5FUOH 2NY2B 1RK1B 3VXRB 1NMBH 3GMNB 1Q0YL 1UXWB 3QG6A 1EMTL 3Q5TA 4E0RA 4HUVB 1BHGA 1R3IL 4OAWB 1LVEA 1ZVHA 4PR5A 1N6VA 4OF5A 3T1WA 5TGBB 4LSQL 1U58A 1I1CA 5I17B 5F21B 3MRQA 1QLFA 4L3CB 3ZT5A 2ICWB 5CP7A 2H26A 3SDCA 4ZODA 4P4RB 2XXCB 3QDJE 5HHOB 2DQIL 1BIIA 2R1WB 4HUWB 5I8EA 3ULUC 3MSPA 4K23H 2XICA 3WJLA 3I6LD 5DD5L 1NLBL 4ZOAA 5FUOL 5KOMC 4WFEE 3VXUA 2DJSA 4E9LA 4OB5H 4PLKD 3FRPA 4MMZC 2XWTB 3RVUD 3B9KB 1TVHB 5ETUB 1NC2A 3OXRA 3T0WA 2DLIA 4MWFA 2ZG3A 4YXHH 1OM3L 1MHPH 4LSRH 4I0KA 3VXME 4IEFB 5JW3L 4CN4A 3RWJB 3REWA 3IU3B 2F5BH 1EGJL 2W0LA 1HNGA 1CF8L 4WO4D 3TIDA 4PJGE 1UC6A 1XIWB 3UBXI 1RUAL 3S8WA 5HYEA 5HVGB 1T1YA 1DL7H 1BGXH 4UBDD 4NKIH 4BH7B 4PGBA 5JO5A 3CDCA 3SCMC 4XRCA 2DICA 4NZRL 1EIBA 1FVDA 2HG5A 4FZEH 1A1OA 4APQD 1QFWL 4BKLA 4EDXA 4PRIA 4XPHH 4K94C 3VFOB 4LPCA 4QT5B 2DYPB 1D9KC 2X4NB 2A0LD 3BT2L 1GGCL 3MJ7A 3CSBA 4NJ9L 4ESKA 2FHBA 3FQUB 4YZFE 4LPWA 4G42B 3S97C 3BPLB 5BJTA 3DV4A 3V8OA 5D2LA 1JNLH 1EEUA 1DL7L 1H5BC 4KI5E 4NKIL 2ADJB 2CXKA 4H1LG 2VB5A 5HBBA 4MA3A 4FQHB 1P6FA 1YJDH 3W0WB 2NXZB 4GW5B 1UVQA 1ZHKB 2IF7A 1A1MB 2I60H 3H8NA 1G7LA 2DLTA 4KHTL 3TF7C 2R2CA 4ZNEA 5EULV 4HZAA 5SWSE 1BD2E 1I7RA 4HIJB 3CVHB 3H7BB 3BHBA 1PX3A 5HPMB 4LEOB 3G04A 1KT2B 3UTSA 2ZJSL 2M26A 1CDCA 2RIKA 4XMKH 1NCCL 1FPTH 2EC8A 5I74C 2VLME 1WBYA 3KPMA 2FECL 4S1DC 3MJ8B 5IG7B 5FM4A 2FO4A 2CDFA 3RNQA 4YEFA 2R0KH 3VFMA 4MQ7B 1VFAA 2PTUA 4JFYA 4W6WB 4ZUVB 4ZS6D 5E99H 3LEYH 1OAZH 4OM0H 1K4DB 43C9A 1OGAB 4ORGB 1YJDL 5F1OB 1I8KB 3TBSB 3KPTA 1QEWA 3RGVB 1I1RA 4Y5VA 5AUMB 15C8H 5DFWH 4JFEB 2XWJA 8FABB 3N9GH 2FL5A 1FGVH 1WBXA 5JHLL 2ADFH 5HVHC 3T0EA 5DVKA 3TBVB 4XMKL 5HYIA 1FPTL 2VDKL 4M7KH 2FJHA 3ZTNL 3QP3A 1NUFA 1FH5L 4U1JA 2JTDA 2AEPH 1JF1A 5F7DB 2VLKD 1VFBA 4I48A 1A7OH 4ORZC 4ODTL 3MRIA 1I9JH 1F6LL 4KTDL 4S1RH 1NDGA 1EJOH 4OM0L 1CTOA 3O0RH 3RWDA 4M48L 4RMRA 4KKCC 4KK9C 5E9DA 1LO4H 1PEZA 4MXWL 2YD3A 5T3ZD 4CW1B 3T09A 2X70B 5E5RB 15C8L 5DURD 3N9GL 1FGVL 1RZJC 3OG4B 2ILLA 2NW3B 3VH8G 5J11B 3G6DH 2ADFL 1JYNA 1FO0H 4FFWC 3QSKB 1R3HB 4M7KL 3IDYC 4C83B 3WL9A 4GAFB 3RBSA 5JORB 1XF2A 3MLZH 2OXGA 1DQML 5T1MA 4OQTH 1I9JL 1XZ0A 2VL4A 5EBLB 4D8PA 3ARGD 1U8OA 3QQ3B 5E4IA 5ITBL 3CFDA 1IJ6A 3PHSA 2P7TB 1B2WH 3MV11 4YDVA 4YFLI 3SE4A 2WIMA 1G7PA 5MP6L 3QUJA 1LMKA 5KS9F 4KRLB 3WFHB 2E7LC 5HI4C 2EKSB 4PJ8D 5GZND 3WIFB 1SEQL 3RRQA 1Z9SA 2DD8L 1B0GA 2E9IA 4P2OC 5DK0A 1PGRB 1IEAA 3W0WE 2Y06H 1FO0L 4NO0D 2VQUA 4Z78B 3QWRA 1NUDA 2HH0L 4LRIA 3QRGH 2GY7B 2WQRA 1I7TB 4OSUH 4PJAE 4QHKI 4XPTL 3QUKB 1Z0PA 5IP4A 2G75B 1PKQE 2YWZA 2H6PB 3AB0C 4YQXH 5D71H 4Z7VB 5GJSL 1JGLH 4MXVE 1FDLH 3U4BH 4NSKB 3HMWH 4HS3A 5BW7C 3ILQC 2VNCA 1S9WB 3C5JB 4P9ML 3LKPB 3QEGL 4JFQA 5ID0A 5TDNA 5ICZA 2VXUH 3H9HA 3PQYD 5FHBL 4WUKH 4U6YB 5JPMA 1QBLH 1TQCC 2WUBH 3VGBA 5FUCC 1Z9MA 3FQRA 5HI3D 2H8PA 1I1AA 2CLVB 4JFEE 1R3LB 4NT6A 4J8RB 2B20A 4RGNE 4L8CA 5I1LB 3C2SA 1KN4H 1CGYA 4Y5XA 4YPGA 4WW2C 1SVCP 1XAUA 5HGBB 3W81A 2EXWD 1JWMB 2G2RA 4WO4A 5GZOD 4YQXL 2FJFB 5D1QC 3C60B 2IPKB 1JGLL 4X4YA 4UOJA 2DB8A 3UPAA 3FAWA 3RAJH 5IVXB 1MCKA 1RZIA 4P4KC 4ZDHB 4LSUH 3L95A 2VXUL 4G80A 1RIHL 4BM7A 4KRPD 1X4XA 2DDQL 4JFDD 2E8ZA 3UJJL 5C0CB 3GBML 4OV5A 2XQYG 5T3XH 1QFWI 4EI6A 5CJOH 4LSPH 3GSXA 1YMME 2DBLH 5I1AB 4XPGH 4LU5L 4D3CH 4GKOA 1KN4L 3X14A 2BHZA 2HKHH 2WNGA 1NAMA 4JKWA 2R56H 1A14H 2IALB 3M07A 5F9WC 4Z9KB 4R4NC