2XTLA

Structure of the major pilus backbone protein from streptococcus agalactiae
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
449
structure length
449
Chain Sequence
ETKPQVDKNFADKELDYANNKKDKGTVSASVGDVKKYHVGTKILKGSDYKKLIWTDSMTKGLTFNNDIAVTLDGATLDATNYKLVADDQGFRLVLTDKGLEAVAKAAKTKDVEIKITYSATLNGSAVVEVLETNDVKLDYGNNPTIENEPKEGIPVDKKITVNKTWAVDGNEVNKADETVDAVFTLQVKDGDKWVNVDSAKATAATSFKHTFENLDNAKTYRVIERVSGYAPEYVSFVNGVVTIKNNKDSNEPTPINPSEPKVVTYGRKFVKTNKDGKERLAGATFLVKKDGKYLARKSGVATDAEKAAVDSTKSALDAAVKAYNDLTKEKQEGQDGKSALATVSEKQKAYNDAFVKANYSYEWVEDKNAKNVVKLISNDKGQFEITGLTEGQYSLEETQAPTGYAKLSGDVSFNVNATSYSKGSAQDIEYTQGSKTKDAQQVINKKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords CELL WALL SURFACE ANCHOR FAMILY PROTEIN
publication title Structure-Based Approach to Rationally Design a Chimeric Protein for an Effective Vaccine Against Group B Streptococcus Infections.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 135
structure length 449
sequence length 449
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xtlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xtlA03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xtlA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 2xtlA02
4JG1H 3HZVA 4HZLA 3U7YH 1DVFA 4ZPVA 4Z7UA 3JTSB 4Q6IC 5FO8A 1KXQE 4KHTL 4PJFB 4MAYA 1G7HA 4YPJA 1JHTB 4HPOL 3MBXL 2YZ8A 3DO3A 2R2BB 5H8DA 2E6PA 4K94H 1MI5A 3BIBX 1OTTC 3MRQA 4ELME 2JLLA 1XGUA 3UDWC 1A6VH 5J8OA 3BIAX 1HEZB 5IFJA 1LVFA 3BD5A 5GS0H 3WS3B 1K8DA 1OSZA 1AH1A 2ZCKL 5FM4A 1B0GB 1L9MA 4QRRD 1SY6L 3CX5J 1T0MA 3P7IA 2DJUA 5D70L 1YEIH 2CUHA 3MV7A 4X7TA 1VFBB 3FL7A 1MNUH 4LCCA 4FZEL 3TIDA 1RUPH 5DHVA 1NMCB 1LO4L 5B39A 4RAHA 1AGFA 3FQWB 5HHOD 3UBXB 2J8OA 3IDGA 3WNPA 2XPGB 3LOWA 2FJGA 1GGBL 3AB0B 5MEPA 3BWAA 4NOBA 3BO8B 5IFAH 1UH3A 4PV9B 4PLKC 2FO4B 2D7QA 2DM2A 5E08H 2F74B 1UADC 3QIBC 4HW6A 1NGXA 5KAQG 4QCIB 3I85A 2JCCB 1JTTA 3EBAA 1MJ7H 1IQWL 5EZJA 3LEXB 4YHIB 1KCVH 1XR9A 2R23B 5GRUL 5MENE 4JZOB 4G9FB 1WFUA 3MCLL 3OV6A 4M3KB 2HTLD 4JVUA 4GKZA 3VFNB 4XNMA 1BAFH 4LEXH 2X4SA 2BNQD 2P49B 5F97E 3NIFE 5C70A 2APFA 2JF1A 2DI7A 3HTLX 3T0EC 1CL7H 2E8ZA 5BOPA 1UXWB 4HUNB 1QSFA 4FQXA 5IMLB 2IQ9L 1O5DT 5CEXB 3NPSC 3SDAB 4G42A 5DHXB 4OAWA 3PWNB 32C2B 4JFPB 1R3JA 1CGVA 4ERSH 4WUKL 2DF3A 3OX8A 2C26A 2Z8SA 4NIKB 1PZ5B 2NW3A 4MCZA 3RAJL 3QDMB 4NWTH 4WUUB 4ODUA 3U9PL 1S7WA 4U1SA 4ODVL 3ECBA 4N0YH 5IHUL 4L9DA 1NLBL 4DWHA 1U92B 1SM3H 3W82A 2K48A 1QFPA 3SE9L 4QGYA 5I1EL 5FHAH 1UA6L 5AUMA 3RIFK 1LEIA 4IOFD 5C08A 5FHBH 1OGTB 5IVXB 4ZXBA 5EU3B 1Z9SA 5HHNA 4EUPH 3PQYB 5KJRH 5E00A 1WZ1H 1WISA 1KNOA 2VLLA 1BLNB 5DJCB 3T1FA 4KMTL 5DFTA 5DRZA 2V9QA 1TTUA 2HTKC 4OKVA 3CVHA 4U1JB 4XWOD 3WFEL 4LIQE 4K07A 3UMTA 3WBDA 1Q9LB 3R8BB 4WWID 5IWLC 4X6EA 1K3IA 3VXMB 1R3LB 4K8RL 1I7RA 4FFYH 2BHYA 4X9IA 1M1SA 3WFDL 3HZVB 4HZLB 1RFDL 4EI6A 1DVFB 4PGZA 1HNFA 4N0UA 4ZPVB 1G6RL 5TDNA 4Z7UB 5FIEA 4I9WD 3PWUA 1DANT 3EOBA 5FO8B 5D6CA 1NCDL 3T08A 1XGQA 1YZZA 4MAYB 1G7HB 1YEEH 1TQCB 3H3PH 3MRNA 3WFHA 2R56L 1DFBH 3DROA 3DO7A 4ZODA 1MI5B 1ZA3A 3MRQB 1XGUB 4UNVA 1Y6KR 2NZ9D 1A6WH 5GS1C 1TETL 3DBXA 4QHKJ 1P2CA 5GSRA 5I8CA 5IFJB 5L2KA 1K8DB 2EDHA 3CXHJ 1Y18A 4LSQH 1OSZB 2OQJA 4HUXB 4ZUTA 5CD5D 4RWYL 5F71A 1T0MB 1KCUL 2NNAA 3MV7B 4X7TB 4JFDA 4TTGA 4PB0L 4NCC2 2L7UA 4LCCB 3TIDB 5DHVB 2VR5A 4PRPD 5B39B 5F8RC 1FYTA 1AGFB 4ZMAT 2B1AL 3V4UL 3IDGB 2NY5C 1CWVA 5AYUL 5DRXA 2FJGB 5E6IA 5MEPB 3RWJA 4KK9D 5FV1L 1OWRM 3JWDH 2H41A 1MCEA 3O6LL 1E28A 1NGXB 3OAYK 5IROA 5C0CE 5EZJB 2BHZA 4MDIA 3UJJH 4KJPD 1NCAH 5MEND 1XR9B 3NACL 3TYFA 3C2SA 3RVXD 4OCNC 1RJZA 3B3IA 2XQYK 2FIRT 3WKML 1NCBL 4XBPA 4LAQL 4GKZB 4XNMB 5E9DE 1G9NH 1QLEH 2X4SB 2WUCL 2H9GA 5F7EL 2CGRL 3R0NA 5T1LA 4YXHH 1QSFB 4FQXB 5D7KE 4N8VA 5DSCA 3OAUL 1CF8H 5H37H 2BJMH 1H3GA 3BP4A 4G42B 4OAWB 1C5CL 1R3JB 3KR3H 4U6HA 3OX8B 1T89A 4YDIH 2NW3B 3QIWC 4MCZB 4NBZB 3HLAA 2H45A 4O2FA 1A7QH 4U1SB 5HYQA 4KVNL 3WHXA 3ECBB 1A0QL 4Y1AA 1JHKH 1FC1A 1H3PL 4PJCF 2E27H 4KRPB 1RK1A 5AUMB 1LEIB 1R3IH 4OM0L 5C08B 2HKHL 4ZXBB 1VPOH 2D7MA 5HHNB 5E00B 2WIMA 3S6CA 5C7XL 5GRVL 4G8IA 1KNOB 2VLLB 3W0WA 4UBDC 4KVCH 4R26L 2FX7L 2J6EH 1KB5B 3T1FB 3T2QA 4X4XA 5DRZB 1OQOA 1TJHL 2IPTH 4KI1A 4OKVB 2V5YA 1JHLH 1JZ6A 2J3SA 2UV3A 2Z4QA 5I8EA 4XH2A 5CBAA 4X6EB 3SEPA 3G6JE 4IRSC 5D1QC 2Y4SA 4LFHD 4UT7L 4PB9L 1DDHA 4UAOC 5F7DA 2DDQL 4ZO9A 4PIRF 3HE7D 1I7RB 3OF6A 3RY4A 5I1HH 5K33A 4F15C 1JMXA 3C5ZC 4G8GD 4WWKD 4XP9L 4EI6B 5TDNB 4N0UB 5DJDA 2MCPL 3AY4C 3PWUB 3EOBB 1CLOL 5D6CB 5HHQA 3CVHL 1INEL 4OFYA 2O5XH 5JHLL 4OZHF 1XGQB 5GJSH 4LSRL 2IH1A 4RGMB 4FZ8H 5ICXA 3K0WA 3MRNB 2C5JA 3WFHB 1JWSA 1PDKA 3DROB 3DO7B 4HLZG 2X9ZA 1ZA3B 4YHMH 4CW1A 4DTGH 5B4MC 1F2XK 2X05A 3EJYD 2VO5A 3IRPX 3DBXB 1P2CB 1UB6A 5GSRB 5DR5H 5I8CB 4FABH 5L2KB 1SEBA 2A38A 4OCXH 5ITBL 1Y18B 3PABA 3LEVL 2Z1PA 2OQJB 4RGOL 5LAXA 1PFCA 4K3EH 1X44A 1OY3B 1WT5C 3KPSE 4ZUTB 1W0YT 2Z8WC 5CEYA 3WS6A 5GZOD 2NNAB 5MEQA 1AC0A 4JFDB 3VFVA 1F4WL 5JLZB 3QFDA 1KFAH 1QQDA 2H1PL 2OMNA 4QHKI 1KTRL 3DSNA 4WRLA 1HXMA 1FYTB 1PEWA 1PG7H 1KLFA 3RBGA 4J2CA 4X7FC 4DQOL 1B2WH 5DWUL 3T0EE 4NWUL 3RWFA 5DRXB 5E6IB 5F7LB 3VWKD 3BVNA 4IIQA 1QSEA 2E9JA 1CQKA 2XV6B 1F4HA 2QSVA 3CFBA 4FQJL 1YJDH 1UM6H 1NMAH 5I15H 4LQFL 3VDBA 1E28B 1RVFH 1FDLH 2CDFA 1NCWL 5GJTL 4AYFA 1AY1L 4CDHA 1I3RA 1JYXA 5HGAA 4JHBA 5D7IF 1Q1JL 3R06A 1TTFA 2HFGL 2CMRH 3TYFB 1JP5A 3MLRH 3QXUA 4P0DA 2XKSA 1CDGA 1RJZB 4KAQH 4LSPL 2ZUTA 3B3IB 2QQKH 2FNBA 1J0IA 1KLGA 3SPVA 2O61A 4XBPB 3ARWA 2P44B 4RISH 2ARWA 2DQJH 3S34H 1ZT1A 4BUHA 3ZDZF 2H9GB 3CX2A 2MCG1 2EKJA 2YUWA 3QG6B 5T1LB 5D7KD 2BK8A 1F3JA 1LD9A 2AJYL 4N8VB 5DSCB 1BD2A 1A6UL 3RUGE 2VQUA 1F4YL 1QPXA 5DJ2A 4Y4KC 4L29A 3G6DH 3TBTA 3BP4B 3W5MA 4JG0H 5IMOA 4U6HB 1MCOL 5IHBA 4G6MH 1EO8L 3HLAB 4ZOAA 2NZIA 2P7TA 4O2FB 4LSVL 3PHSA 3ZL4L 5HYQB 3SKJH 3WHXB 1XEDA 2OR9H 4Q0XH 1A14H 1KCVL 4Y1AB 1IC4H 4D0CA 1CDJA 4RZCA 5CZKA 2V6HA 2IAMD 3GZKA 4NZDA 3U82B 1RK1B 1FN4A 4Y4FC 1UM5L 1JRHL 4Z0BL 4LEXL 1LEGA 2RCSH 3DI2B 2A74A 4G8IB 4WI6A 3W0WB 3X3FL 4X4XB 1I7UA 1Q8MA 1SVZA 3HFML 3V0WL 3T3MF 3QHTC 4GRWB 2Z4QB 4ZTPL 5I8EB 4L3CA 4XH2B 5CBAB 4HD9A 4KK8D 2OP4H 1JZ4A 3EFDH 2W07A 1I8MA 1DDHB 5F7DB 2Y36L 2G75B 3D3VA 3TO4C 1AQDA 2Y07L 5EZOH 1J05A 3FFDA 4WI4A 3MBEC 4LKCA 3U7WH 2X44D 3JWOC 1FNSH 4LK4A 2KDGA 3KPTA 3MOBH 2VXVH 5DJDB 1GHFH 1EFXA 3RX7A 4H88L 5HHQB 3BH9A 5BS0A 1P6FA 5T1KD 4P5TD 3SY0A 2IH1B 4WI7A 5F1OB 1P4IH 4DCQA 4X0KA 5ICXB 2YMXL 3S3JA 4HX1A 1JWSB 4M7ZB 2D4FA 1EJOL 4DKEL 1T83C 4TULL 1M6OA 4RFNB 4PLKD 4LCIH 4Z7NF 4JM2A 3T1WA 5AZ2L 1MVFA 4ZNCD 1U8KA 4RMTA 1S7QA 3QIBD 1UB6B 2GHWB 4F7CA 3MLUH 1SEBB 4G6FD 2D3VA 3ILPA 3PABB 1KTDA 1H8SA 4LLAA 4ODTH 4OCWH 5JQHC 5CEYB 1LO3H 3PV6A 3V8OA 5D72H 2DQEH 5MEQB 2NY1B 3VFVB 5DMKA 3NGBB 1INDH 1TQBC 3QFDB 1QQDB 4TQEL 4XAWL 4CKVX 1NKRA 3MLXL 1RZIA 3RGVA 2LU3A 1HXMB 2VLKE 3Q6GH 4POYA 3TC9A 1KUMA 3P11H 2VJXA 3MLVH 3RWFB 4RAUA 3OKYA 1G7QA 2C7UB 3BVNB 4IIQB 3UYRH 9CGTA 3RKDC 1K6QL 2M26A 4MLSA 4NP4H 1QSEB 2BXZA 3CFBB 5IIEA 5BVJA 4LLUA 3KLHD 1UVQA 2WWKT 1KN4L 3DARA 2CDFB 4UB0H 1I3RB 3SDYH 2P5WA 1RUQL 4L0RA 1UKQA 5HGAB 1KV3A 4X6BA 3R06B 2DIJA 5L8JB 3O2DH 3TZVD 1KLGB 3SPVB 2O61B 4E5XA 4JFEA 3EO9L 1FGVH 2XY2A 5D1ZC 1ZT1B 5LXGL 2IG2L 1RD6A 4UIKL 1J88A 5T3XH 3MUHL 2ED9A 4NQUA 1F3JB 3PWPA 1LD9B 1BD2B 4M00A 2IPKA 2MQ0A 2J4WH 2HTKD 3QAZC 3M07A 5DJ2B 2DQCH 4XXCA 1FNGA 2ZPKL 4L29B 3TBTB 1XGYH 1V7MH 3QJFA 4JPVH 4JKKA 5I18H 1R0AL 4ZOCA 3GHEH 5IMOB 5FGBC 5F6IB 3O4OC 1OTUC 1NCCL 2EO1A 4U1IA 3S7GA 4OIBA 1OQXA 4OGZA 2P7TB 3ZT7A 1FNEA 4WTZG 4S1RL 3CFJA 1P1ZB 4OJFL 4D0CB 3LKNA 4RZCB 4JKPH 4BZYA 4LASH 3T3PF 4JGJA 2DD8L 5T33L 4KJWD 4Y19A 5JIHA 3ULVF 3FQNA 4GAJH 1RIUH 3V6FA 3TNNA 1LEGB 5H94A 2BY3A 3TESA 3FRPA 5FKAB 4H5SA 4GG6E 5ERWA 2A74B 4XVTH 5JMRA 1WGOA 1I7UB 3GSQA 2QQLL 1P84J 3IFNH 5EBLB 4F9PA 1KB9K 4JN2A 3G9VA 3HA0A 3VGHA 4L3CB 3QZWB 5IGXL 3VXPA 1N7MH 3DLQR 3L3IA 4HJJH 2XRAL 1B9ZA 5TH2A 1I8MB 4JO3H 1MCWM 3D3VB 1AQDB 1J05B 3FFDB 5JXEC 3IDMA 4LKCB 2EH8L 1JGLH 1UM4H 3QCVH 3TWCH 4TRPL 5LWYL 4M1CD 1GGCH 1EZVY 2GYSA 2DQHL 1KENL 3V10A 2JJSC 1EFXB 1U93A 3BH9B 5BS0B 5HDBF 3SY0B 3NZHL 3MRKA 4WHCA 1IAII 4DCQB 3OKKA 4X0KB 4ESKA 1A6ZA 4HX1B 1J86A 1ZHBA 1ZLWH 5LGKA 4OT1L 1M6OB 3L3HA 4PJGF 5KSAA 2E7CA 5CKAA 2G9HA 4JM2B 3MQIA 4RCAA 1S7QB 3M8OL 4OZFH 1F45A 1DQTA 3ILPB 3BSZH 3IKKA 4OSUH 1KTDB 2Q7YA 3QHFL 5I1HL 3HG1E 3ALXA 3QUMH 3PV6B 1WSST 1NMCC 2R0KL 4JVPA 2A6DA 5DMKB 1GIGL 2HLFD 1M7XA 4JR9L 2YWYA 1TZIA 2WQ8A 4XCCL 4G7YL 3RGVB 1RZIB 3PG2A 2VLKD 5KANG 2WBJA 3HR6A 1K4DA 3F7QA 3VD3A 5HDQL 3KNBA 3A6CH 5HGGS 3ZZ1A 4FMFA 1IKNA 3GRWH 4WTWA 1RULH 3L5JA 4RAUB 3EYUL 1G7QB 2Z92A 1UXSA 4S1DD 1NC4D 2MKLC 5IBUG 3IJSA 5IIEB 5BVJB 4LLUB 1UVQB 2BZDA 4QXGH 3TFKC 1QSZA 3QCTH 2P5WB 3P0VL 3VGBA 1OM3L 4YDJA 4X6BB 2ESVE 2BNRA 2Q8AL 5DJXA 3MOAH 5D9SA 1KEGH 5E03A 3O9WA 1RUML 5F7HA 4N68A 3OHXA 4E5XB 4JFEB 5CFHA 1AGDA 3S35L 1NEZA 5CINH 4MQTB 5C07D 5E2JA 1NANH 2BVEA 2J88H 1CE1L 3IDUA 3SDAC 2NYYC 1G1CA 3PWPB 3QWRA 1OLZA 1EBPA 1PX3A 4LPUA 4ZNEA 5B3JE 4K7PX 3GLDA 2IPKB 3MA7A 1GAFH 5KSBF 5L8LB 1TZHA 3DIFA 4F8QA 3GSNH 1FNGB 1XGPA 3LCYA 1EIBA 3QJFB 2EIDA 1P4BL 5EUOA 1ZLSH 2YD4A 2BY2A 4U1IB 2CH8A 1H0DB 3HKFA 4TSAL 2YRLA 2APBA 3WXVL 2X89A 1A47A 1ODAA 1MAMH 5LGJA 4ZUVA 1FNEB 5ABDE 2CMRL 3CFJB 3EAKA 3LKNB 4O9HL 3LY6A 1W0WA 2VKXA 2UZXB 4KDVA 3PHOA 3QI9A 2DQJL 4Y19B 2YEZA 4JQXC 3FQNB 4NQDD 4KQ3H 2FBJL 3V6FB 3LRHA 5DD1H 4NJ9L 5H94B 3TNNB 4N8PA 4H5SB 3GNMH 5ERWB 1B0WA 1NPUA 4W4NA 2G5BA 1C5BH 3BZ4A 2ERJB 2M2DA 3GSQB 5HPOA 2JB6A 4JN2B 3UP1A 4GRLA 3PDDA 4R6UA 2YUZA 4S1QL 3VXPB 4DKAA 1MJJA 3L3IB 5CCKL 2AJSL 2OTWA 4QLRA 4MQ7A 1KELH 1DVFC 1DANU 1BGXL 3IDMB 3SKJL 5KG9B 3SGEH 2AJUH 4CGTA 1RIHL 5IFHH 3TF7C 2QQNH 4P99A 3QB7C 1TQCC 3IJYA 3PWVA 4JFFA 3VI3E 1HYSC 1U93B 4HFWA 4I0PA 5TFSL 3IU3A 3MRKB 1GOFA 3OKKB 3D48R 4JO1H 4M1DH 1A6ZB 3OG6B 1ZHBB 3QCUL 1WLHA 2I26N 4GAFB 4M62H 2ICEA 1LO2L 3L3HB 4IDJL 3VG0H 4J2XA 5KSAB 5BRZA 2FBOJ 2ZCHH 2NY3B 1J1XL 2W65A 2G9HB 1U3HD 2C5IT 3NA9H 2VDOH 4AZ8A 2YD1A 2P5EA 3G08A 3M1BA 1DSFH 3T0XA 3TCXA 5CJ5A 2ORBL 3HG1D 1BOGA 4LCCC 3DTXA 1QZ1A 5MEOA 3VI4E 5SWSE 3DETD 4P46A 1HHIA 5DTFA 2A6DB 4U31A 4UQ2A 6FABL 3MUJA 5DURB 4U6XA 5FDWA 1TZIB 2WBJB 1K4DB 2DQDH 3MJ7A 2B2XL 3KNBB 1OT2A 4JKWA 4XP4H 3HZMA 1ADQH 2PCPA 3EDJA 4XB8A 4ZQKA 2Z92B 4ZUWA 3GUTB 1UXSB 1AXSA 4Y4KD 4KI5F 3IJSB 3QUZA 2DYPA 1D5IH 3T4AA 4BQ9A 3O4LA 3O6ML 3MLUL 2ESVD 4YBQD 4JKMA 3GMQA 4YDJB 5BZDA 1N6UA 2BNRB 2XG4A 2EECA 1RURH 5DJXB 5D9SB 4OF6A 5GIRA 4NM8L 3O9WB 2GTZA 5C6TH 3OHXB 3I84A 5MI0B 2WIIA 1LDPL 1IGMH 5DMGC 3X13A 2HYMA 4FQXC 1AGDB 3OJMB 1NEZB 3CH8A 4JHWH 2APVA 2UWEE 1ORSA 4G6JL 4OTXL 1RZJL 4X5XA 3MNVA 1UJTA 2LTQB 2BFVH 3MA7B 2FDBP 1TZHB 3CVRA 3DIFB 4PGJA 2D7OA 1XGPB 3MLWL 5F3BA 5EUOB 2OLDA 3NIDF 2EDRA 2O93L 1BMGA 4M4PA 4CL7A 3DV6A 1T2XA 4QTIH 4YPGA 5LGJB 4KRPC 4ZUVB 2V7NB 2PF6A 4YGVA 3TVMA 3MV8A 4ZXBC 3MNZA 1HI6A 4DN4L 1RUKL 1W0WB 1I9IH 5FM8A 3PHOB 1FAKT 3LPGA 3QFJA 3QI9B 1UZ6E 2OK0L 3LN9A 1FGVL 2YEZB 3X3GH 5JTWA 3ETBF 5C0RH 4E42A 5JW5A 3KYAA 5SV3A 2G5BB 2R4SH 4D0BA 2D31A 4WDIA 3BZ4B 1VFAA 4HK3J 4XC3H 2JB6B 5HI4C 4GRLB 3ARBC 5I18L 1MJJB 3GHEL 2OTWB 4MQ7B 4WV1A 1RZ8A 3CAFA 3GSXA 1AR1C 4HBCH 5JIKA 5GISL 3CKDA 4C55A 3BX7C 1L0XA 2BOCA 4Z7OF 4RGMC 2A1WL 1X5HA 2NY7H 4V2BA 3IJYB 3PWVB 3DYOA 4JFFB 5E2UH 5KANI 3OXSA 2IADA 4HFWB 4I0PB 3U1SH 3EHBD 1A7RH 3SE4A 1JNNL 3BGMA 3IU3B 5I74B 3SDDD 3OKEA 3GKWH 4QNPE 3OG4B 1U42A 2ICEB 5DUML 5BRZB 1HDMA 2W65B 5C0AA 2JCCE 4N1CA 4W81A 4LARH 2V2TA 1VCAA 1FZJA 5DD5H 4AIXA 2Q3ZA 2H26A 4OF8A 3N1PC 2P5EB 3G08B 4G9FE 4O00A 3M1BB 4F37F 3TIEB 3LV3A 1BOGB 4YHNA 5SWSD 3DTXB 1DQDL 1U8LA 2RB8A 5MEOB 1W0VA 2FH6A 1JN6A 3P9WB 4P46B 1HHIB 5DTFB 4OZFB 1ZTXL 5FECA 4UQ2B 2APTA 5FDWB 4S1SH 5E6IC 1N26A 3SQBA 1EO7A 5GGSY 3PHQA 1XF3A 4M6NL 3MJ7B 5SX5K 1WV7T 2XKNA 2R9HC 1G7PA 4PJ5D 5D6DA 4CU6A 4R2GB 3HZMB 3EJZD 2PCPB 1R5WA 4ZUWB 4ZQKB 1AXSB 5AAWA 3KJ6H 2W9EL 1A7PL 1AD0A 4NGHL 1T4KA 3QDME 3QUZB 4WUUE 2DYPB 5E56A 1DBKL 2X4RA 4Z7WE 1TPXB 3T4AB 3O4LB 1ADQA 3GGWA 2HJKA 3GMQB 1YEKH 5BZDB 5JW4R 1MJ8L 5DZNA 4HS3A 5GIRB 1NSNL 1U8OB 2GTZB 5GGTH 5ISZE 3DUHA 2NY2C 1NFDA 1EH9A 3PQYE 2WIIB 2DQIH 5ALCL 3X13B 1NMBH 3AM8A 2FJFA 3S5LG 2FX8H 4XP5L 2YD8A 2DLEA 1ORSB 2NY6D 4DVRL 3MNVB 3EUUA 5D5MA 3ESVF 1T89C 3BN3B 3Q1SH 1K3ZA 1V7NH 1EV2E 3VXME 1EEYA 3NA4A 5F3BB 3SCMA 1BJ8A 2DQUH 4LLQA 5IF0A 3GI8L 5INCA 3RIAF 5SV4A 3DV6B 5GGSA 4Y16A 4YPGB 1CGSL 5I30L 5LKNA 5JXED 4B7LA 4YGVB 1LILA 3AUVA 3TVMB 4AMKH 3MV8B 4Z7UE 3SHSA 3WIHL 3MNZB 3NTCH 1HI6B 3VRJA 5C2UB 5LGHH 4NDMA 4HWEH 5IKCA 3QFJB 1EHLL 1T0PB 3KPLA 2B0SL 5I19H 5CJXC 1FH5H 2DOCA 3C87A 1YNTA 4E42B 4NZRL 1MI5E 5JW5B 3INUH 4D0BB 4P3CL 1QRNA 4ZOEA 2D31B 4WDIB 5CGMA 1VFAB 1CZ8H 5FV2A 2W9DH 5EU6A 1L7TH 2VXTH 3GBML 1DL7H 3BW9A 2AABL 4WW1A 4JY5H 4HUKB 2KL6A 4P9HL 4WV1B 3DMMA 1RZ8B 3GSXB 3BZEA 3MRDA 4LPTA 3V7AE 3MV7E 3VGEA 2PO6D 2J8UB 5J3HD 2BOCB 4NN7B 4EDWH 5HYJD 4YHOH 1G0YR 1X5FA 2B1HH 4I3RL 4OLXL 3UBXG 3DYPA 4ONGL 2EE2A 1UWXH 3OXSB 2IADB 3AMLA 4M7ZC 1MELA 2M8XA 4N0FA 4JRYE 2Z31D 5A3ID 3BGMB 5K9OA 4RFNC 4YXKL 4HEPG 3OKEB 5JDSA 2VN4A 1H5BA 4APQA 3GBNH 1OAKL 4KMLB 1RU9H 1RHHA 4X98A 3AS3A 5EPMA 1HDMB 8CGTA 4NQCD 5C0AB 1BJ1J 1FO0H 2GQHA 2V2TB 4YDKL 1FZJB 3MLZH 1A1NB 2H26B 2V5RA 3WS6C 1X5JA 3DX7A 4G9FD 5I1JL 4M48H 2NY1C 4JO4L 4KKCD 4QRPA 3HC3L 3I3DA 3LV3B 4YHNB 3WHE1 3NGBC 5HYSG 1U8LB 1QYGH 1W0VB 5I1IL 1HQ4A 1JN6B 1QHPA 5FECB 4LRIA 2G5RA 3IB4A 5T1MA 3CK0H 1QSFE 2QQQA 3I6LE 4KK5D 4LSSH 4BZ1H 1PLGL 4IIQC 1IRAY 4PRNA 1SMOA 1XF3B 2V9RA 3PHQB 5E7FA 3I2CL 2JK5A 2XKNB 3SDAD 1G7PB 3TA3D 3W81A 4L8CA 4ISVA 4FRWA 2FEDD 2NTFA 1R5WB 2WWMC 3MRPA 3G5ZA 1FAIH 2X4TA 1AD0B 1T4KB 2X4RB 3JWDC 1V3LA 5BQ7A 1AMXA 3V4VH 1KCLA 3GGWB 2HJKB 3ZTNH 3ZT6A 1QBLH 1FP5A 1IEHA 4HS3B 1X6NA 1FHGA 2G0UA 4K8RD 5ISZD 1UWEH 5C08E 3PQYD 1U2CA 1NFDB 4LLYA 3K2UH 5HHVH 3F7YA 1LK3L 2OTPA 1PGRB 2FCBA 4YE4L 4OZIA 4UQ3A 3DX6B 2FJFB 5JOFA 2BMKA 4F7MA 1G9NC 1KJ3H 5GGTA 5D5MB 5F6IC 5TE4H 5FDYA 4X4ZA 3VXMD 5LVEA 4MB3A 2FD6H 1EEYB 5DGQA 1WEJL 3ARVA 4LLQB 5IF0B 5INCB 3IKCA 4DKFH 4WO4A 2PYEA 3ZDXF 4POZD 4XNUL 1MFBL 5GGSB 4HQQL 1DVFD 4Y16B 3ARGA 4NM4H 2W92A 3A6BH 4N0UE 4MJIA 1NL0H 2CDGA 2HP4A 4I1NB 3MXWL 5EOQL 3VRJB 1TTGA 2VXQL 5EORH 3B9AA 5IBLC 1T5XA 3CFIC 2P8LA 4NDMB 4MAYD 5IKCB 2VWEC 4ZFGH 2VC2H 5C86A 4M7KL 1AE6H 3KPLB 3TM6A 3KYOA 5L88H 1MI5D 1YNTB 2UVFA 1QRNB 4KZEH 1EHNA 4K23H 3ARDA 3ZHLA 2AJZA 1QFWI 2XNAA 2BSRA 3GHBL 3JXAA 5EU6B 1FBIL 3V7AG 3BW9B 1LE5A 4WW1B 4UTAH 4M43H 3VXRE 1ED3A 2I60H 4I4WA 5KVFL 3DMMB 2DI8A 3MRDB 3BZEB 1P7KA 4HKBA 5B39G 1GSMA 2VB5A 3FN0H 3I50H 1KTLA 4OQTH 4R90L 3O3EA 1F90L 4UT9H 1T7ZA 4KXZI 5I17A 1FYTE 3DRTA 3B5HA 4NRYA 2X70A 4JRYD 3VD9A 2XY1A 4N0FB 5K9OB 5JDSB 3GMRB 3U0WH 4APQB 1H5BB 5T1DL 2BSSA 2XZQL 4QRRA 5ADOL 1OT1A 2R4SL 3EYSH 4WEBH 5D71L 4X98B 5EPMB 2V17H 1DQQA 1FZKA 1HKLH 3BPNB 4LVEA 3DHJA 3QNZA 3DX7B 2XYCA 4OGXH 4YWGL 3OJVC 5FEBA 4QRPB 4LAJH 4BUGA 2WUBL 2GFBA 4K9EH 3RGVC 3SKMB 1HQ4B 1Q72L 2VL5A 1IMHC 4PYGA 2MHAA 3TO2A 5KSVB 5DMGD 3I6LD 4XCNA 5T1MB 3D1MC 1A3RL 1ZHLB 3RDTD 1I3VA 2DBJA 5KS9A 5K9QI 1MF2H 4PRNB 5J6GA 2FGWH 5DJ0A 2DIBA 1IC5H 2JK5B 1IAKA 3NABH 1BJMA 4L8CB 4ISVB 5SWQA 4PJXE 2NTFB 1M4KA 1RZ7H 3C6LA 4Q97A 3U7AA 2VXSL 2AS5M 5DS8A 5HGDA 5DC9B 3MRPB 1U95A 5DUPH 1AQKH 3G5ZB 1UCBH 2X4TB 4H0IA 4GXVL 2YD7A 4XGZA 5DEGA 2LU4A 3NCYP 2JIXA 3PGDA 5BQ7B 1YJDC 4G6KH 3X14A 1MRFH 4NC0B 4Y1AE 4XVSL 5EFIA 4B41A 2VLRD 4KRPD 3UZVB 3VA2C 2BRRH 5EO1B 4ZXBD 5DF0A 1Z0NA 5EOCL 3BP7A 2F5BH 4LLYB 1DQLH 3F7YB 3I3BA 5E8DL 1KJMA 4OM1H 4UQ3B 4OZIB 3MV11 2CK0L 2CQVA 4K3JH 4MVBC 4ELKA 3BEVA 3W0WE 5JOFB 3T0VA 2BMKB 4RFOL 4S1SL 3FO0H 4F7MB 3L6FA 4XXCC 3SDXA 1D6VL 4RRPA 4GRWE 3LVEA 3FHQA 5EA0H 4U1NA 3HRZA 4FQ2L 3RA7L 4EIZC 4Z77A 2ZUYA 1JFQL 1U8QA 1QFUH 2HJLA 3IKCB 4GO6B 1L4IA 3TH4T 4WO4B 2PYEB 3P30L 1AR1D 3BZFA 3JWNC 1OP5K 3ARGB 1XT5A 1JVKA 3DGCR 5FGSA 3UBXI 4MJIB 4U4BA 2CDGB 3PWJA 1QO3A 3QG7H 5CUSL 1T5XB 2P8LB 4NJAL 1S3KL 1Z9OA 2ERJC 2YK1H 3KYOB 4Y5YC 3LS5L 5EDXA 3VGFA 4NZTH 2JB5H 4DGIL 1MFAL 3ARDB 2AJZB 2NXYD 2XNAB 5EIVA 4OLUH 3ZE1F 2BSRB 2RGSA 3MLSH 4H25A 3QXDA 25C8L 4Y2OA 1CD1A 3VXRD 4HLZH 1LE5B 2AW2A 3DOSA 5B38A 1ED3B 1GOHA 4I4WB 4D8PA 1P7KB 5FYJL 4HKBB 4Z7VF 1MVUA 2AXFB 4HPYH 2NY0D 4DGVH 1IT9H 2AGJL 3O3EB 3OAZH 4ODHL 4HXAL 4PJEF 5I17B 5HVFB 3DRTB 3EJJX 1FG9C 4QRSB 4NRYB 5M95B 1FFRA 3TGXA 2V2WA 3MREA 5KSAC 4OQTA 2NY3C 5AWNH 2L0DA 1QSEE 2BSSB 2ADFL 1SQ2N 2B4CL 4QRRB 4RGNB 3TT3H 3E3QC 4E41A 4IRZL 3S37H 1DQQB 1FZKB 4HWUA 4J7RA 4PRPA 3QNZB 1IAIH 3BPCA 4HJGA 2EH7H 5E0QA 3LRSA 4ZD3L 5K93A 5IW3A 4X9FA 1X5YA 5DJAA 3CSBA 1GZQA 4P5MB 1DBJL 3VFWA 2GFBB 3UJIH 2YPLA 4KUZL 2WBJC 2VL5B 1A6PA 1KCSL 3QPXL 4YHOL 5ICYA 2MHAB 3TO2B 1IKNC 4XCNB 1JZ5A 4PGCA 5KS9B 3LN4A 5BVPH 2Q3AA 5J6GB 4L3EA 1TCMA 5FCSH 1IAKB 1KC5H 3C8HA 4Y7MA 4OUUA 1RZJC 5SWQB 1FJ1A 3SBWA 4FOMA 3VGGA 5DS8B 4MCYA 5HGDB 1U95B 2HLAA 2YR3A 2DQGL 2EYTA 4NKMA 2H2PD 4P23D 2WWKO 4XGZB 5DEGB 3PGDB 1J10A 2VZTA 4Y1AD 2RIKA 3M45A 3X14B 5C6WH 3GI9H 3CXDH 5EU7C 5EFIB 3BKJL 1UWGL 2E9WA 5MI0C 2OBGA 4CADA 1EEQA 3HAEH 2YD5A 1CYGA 4ZYKA 3JBG7 3FT4A 4NNYA 3BP7B 5F6HJ 1KJMB 3C2AH 1IARB 3W0WD 1TCRA 4ELKB 4KDTA 2W9LA 4B53A 2VYRE 3BEVB 1BF8A 3L6FB 3SDXB 4CBPA 4YDLB 1BFSA 3GMOA 2VDNL 1YYLH 4YFLI 4U1NB 3HRZB 4OCYL 2XA3A 2UUDK 4DUVA 3GEWB 2ZNXA 2F53A 4Z77B 4YHZH 1NJ9A 4J3XA 3OF6D 3D3VE 1U8QB 2HJLB 1CFTA 4PJIF 2CKNA 4JM4L 3S88H 2CA5A 3BZFB 5GRYA 3ZKSD 4AH2A 3QI9C 1Q38A 1P7HL 4OFYD 1NGPH 3VH8A 3PWJB 3PXHA 1QO3B 4MX7A 3TN0A 5L2JA 3WNLA 1ZHNA 5EWIL 2MPAL 5DJYA 3K8LA 4GRLC 1T2QH 3VA6A 3LEYL 1A64A 5IQ7H 1MIML 4HGWA 4S11A 1BBDL 1I1YB 4G8GA 4YAQA 3QDGA 4YH6A 4H25B 3H2WA 3QXDB 1X5KA 1CD1B 3OZ9L 5B38B 1RZFL 1MWAL 1KIRA 5BZWA 4EVNA 4GH7B 4D8PB 1ZWIA 4O02L 1WCBA 4FTVD 5DD0L 1MVUB 3K8MA 3ISWA 4I0PC 2VDQH 4XHJD 5E6ZA 2YD6A 2DN7A 3JVGC 4WW2A 1ERNA 1EVTC 1QBML 2CR6A 5I74C 4JY6A 2EZ0C 4Z18A 3QBTB 3D0VA 5GXBB 2VC2L 4PJ7A 2V2WB 4P4RA 3MREB 2YXMA 1JI2A 5FYLL 1F13A 1QSED 1J8HE 4XZUA 2DJSA 2YD9A 4OB5L 4O4YH 2CDEA 4AT6A 4E41B 3U4BL 4FN0A 3DUUA 4PRPB 1G7JA 1I85A 2WW8A 3BPCB 2HMID 4FQ1L 4HJGB 5JIIA 3SOBH 2HFEB 3LRSB 4P46C 4L4JA 3N5LA 4F57H 5DJAB 1GZQB 1T80A 3NAAL 3MFFA 3KDMA 1NGWA 3VWKA 1QR1A 1EPFA 3VFWB 1RK0A 1HOCA 3VGDA 4PLOB 4ZTOH 1XGRA 2WANA 2YPLB 1RUAL 3U79A 4OZGF 5ICYB 2I9TA 4NPYA 3NFSL 4HHAA 4PGCB 3PWPE 3LN4B 3EOTH 2HH0H 4PJFF 4XP1H 4FQLH 1CTNA 4OLEA 3T04D 1BM3L 2EXWC 4OUUB 3QUZC 3U0WL 5GGRY 3B2VH 1JNHA 1FJ1B 3OJ2C 3VXTA 1CLZH 4MCYB 5BCAA 2HLAB 1MPAH 2EYTB 4NKMB 2VUOA 4X6DE 4NNXA 3KYKL 1X9QA 4KTYA 4TVPL 2C5DC 1E4JA 5JW3H 4UILH 1JNLH 5HI5D 4CADB 4OI7A 4Z1PA 1FL5A 1MFNA 5F21B 3LMJH 3HNSL 3N1MC 4EBQL 4ZYKB 2UZYB 2FZ3A 4XVJL 2QSTA 3FT4B 4K9EL 4NNYB 4Z9KB 4J4PC 4EOWH 5DI8A 1IGTA 2YKLH 3ULSA 4FG6C 1TCRB 1ZLUH 4N5EC 3HAEA 5BV7H 1JBJA 1OOAA 4NCC1 1UKSA 2X9XA 1EDQA 2OCFD 1Z5LA 3GMOB 1JWMA 1U8JB 3RTQA 3SE8H 2XA8L 1RZ7L 2IAMA 4LPXA 4LSTL 5F6HI 4Q9QH 1MHPH 1ZEAH 3H0TA 3D3VD 5FYJU 5ADPH 1NJ9B 1QBAA 1T2JA 5TF1L 1CDIA 1CFTB 3TVMC 3KVQA 1LO5A 3V2AR 2PN5A 3B2MA 1MAJA 4LVNB 4PRIA 3ULUL 4XT1C 4AH2B 2X41A 3TT1H 1Y6NR 3DI3B 2DLTA 2WINA 5EUKA 5GGRA 3VH8B 4LP5A 2EYRA 5L6YH 4MX7B 1XF4A 2ARJQ 1DQML 3G6JA 4X7SL 3TN0B 2F5BL 1NBVH 5L2JB 4IJ3B 4XPGH 1IE5A 4GKSA 4DFHA 5D1XD 1ZHNB 5F72S 3FT3A 3GSRA 3GM8A 1GGIH 5BOZG 5DJYB 3ZKMD 4HGWB 1G7LA 1N4XL 3P77A 4JM2D 5BO1H 3W5NA 1FNLA 3LIZH 1XF5A 4G8GB 1K85A 4YAQB 4OGAC 1UACH 3E3QE 4WV1C 3WE6A 5HD8C 5KTEL 3QDGB 5GZND 4GLRI 2ATKA 2WK2A 3ZHDA 4NN7C 4W68A 2IPUG 4LOUC 1KIRB 4M1GL 4LRNH 5BZWB 3QO0A 4AK1A 4EVNB 1ZWIB 2VDLL 1WCBB 5KVEH 3WDIA 2EDYA 4L4VD 3QEQA 1TITA 2AK1H 4Y89A 3RGVD 1QPPA 3SE4C 4F37K 4WW2B 1JRHI 3QG7L 4JY6B 3H7BA 4XTRC 3EGSA 3D0VB 1EMTH 5IVXF 4PJ7B 1NKOA 5GHWH 5BMFH 4P4RB 2EC9T 1J8HD 4JHAH 4X8JA 3ZDYE 1UH2A 4XZUB 2A73A 4YHKL 1JF1A 3C08H 3HNTL 4NNPH 2CDEB 3VMOA 4AT6B 1A3LL 3L5WA 1IGYA 3KLAA 3W9EA 1NBQA 4XPHL 3VW3L 4MDJB 3DUUB 3L3JB 3BHBA 1G7JB 1JV5A 4H0HB 3VXOA 4GXUN 5J1AA 1CIDA 2B8OT 4MS8D 4ALAH 1MFDL 2DM3A 4L9LA 3KDMB 3MFFB 1NGWB 3VWKB 1HOCB 1OSPH 4U3XA 5TQ0L 1XGRB 3BMVA 5JZ7C 2XG5A 2I9TB 1XCTA 1MFEH 4NPYB 5C09E 3PWPD 5D6DC 3MJ8A 4MVBD 15C8H 5E1HB 3LHPH 4KKLC 1DBAL 4ZNEE 4PJHA 1HE7A 1A5FL 4R9HA 1Q0YH 3OB0H 1FFOA 4TN9A 1JNHB 3TZVA 5EUOE 3VXTB 3V52L 5T3XE 3I75A 4X80L 1MQKH 4NNXB 4RBPK 4PP2B 5FO9B 4PG2A 2E5EA 2XZAL 1UJ3A 4O2EA 4UU9A 3RUGA 4LDLB 5CKGA 1FL5B 3RIAK 3FRPG 4KTDL 3AM8C 1BVKA 2FZ3B 5E2WH 5J06A 3OR7A 4H8WL 1T3FA 4KKBC 4ONOA 5LQBH 4HIHA 1T6WA 5DI8B 1IGTB 3ULSB 5F9OH 4YX2H 2IBZX 5E5UB 3TJEH 1QFOA 3HAEB 4NC2B 4IGBA 3P9LA 3MJ9L 2MTPA 1Z5LB 3QUJA 4JHZA 1JWMB 3RTQB 4TNVF 4HAFA 3VFGL 3MGOA 4UNTA 4PRAA 3E6FA 2IAMB 5E99H 4X6CF 3CLFH 4LCYA 2V5MA 4RNRA 4X5LA 3H0TB 4Y16C 2HRPH 3QNYA 3N50A 1CI5A 1LO5B 2H32H 1MREL 1RIVH 4PRIB 4XNXL 4YHLH 4JFFE 2WINB 5GGRB 2EYRB 4PLJC 1XF4B 3G6JB 1FVDA 4GKSB 3QWOA 3ILQD 1EO5A 3FT3B 3MRLA 3QRGL 3GSRB 2EXYC 1DLFH 4DAGL 5INDA 4HK0A 2NY3D 4M5ZH 4QGTA 1G7LB 3P77B 1WWBX 3ARFA 4NOFA 5DZOA 1TVBA 1XF5B 4GMSH 1RHFA 4XP6L 3WE6B 3DMMC 4OD1H 2MKWA 4AL8H 3QA3A 2P5EE 2ATKB 1CDYA 1EA9C 4NKIH 4CU7A 1RZKL 1NLDL 1SVCP 2N4IA 2JJVA 3QO0B 3K8KA 5DURD 4TSCL 1OAQL 1UKTA 2HT2C 1ZA6B 5DMIL 3QEQB 3FB5A 1CFVL 4OBSA 2WV3A 2DL9A 2V2XA 1FGNL 1VESA 2CLRA 3H7BB 2HKFL 4WGVB 3EGSB 2QSCL 4APQC 1H5BC 3O3AA 4FQCH 1YNKL 3RU8H 3O45A 3BIKA 1BECA 3CGTA 5C0NC 3O0RH 3UPRA 4X8JB 2H2SC 4KKAD 2A73B 3BPNC 1JF1B 1X4XA 5B8CA 3IVKA 4J3VA 4TYUA 3G5YA 1OAXH 3L5WB 1IGYB 3RVUD 3KLAB 1CFBA 3W9EB 3O4LE 1CU4L 3BHBB 1JV5B 4HULB 2OYPA 5IB1A 1J87A 2Y6SC 4G43A 3VXOB 1DTUA 5J1AB 3O9WD 2F5AH 1HCVA 3R1GL 4LRIC 1NEZG 2A83A 4LVOB 1WWWX 1OVZA 4L9LB 4LDEB 3W2DL 4R4FH 2B5IB 4G9DA 4K3DL 1OTSD 2IMMA 4HWNA 5C09D 2BDNH 3WN5A 1A1MA 4LL9A 1JGDB 1XCTB 3MJ8B 4KROD 2XI9A 4ZG1A 1WZKA 4PJHB 1DBML 5ALBL 1FFOB 4XHQA 4MAUL 3TZVB 1IGFL 4EXKA 4GSDL 1W72L 3I75B 4F33A 5I8OL 2X89D 1OB1A 2YA2A 4EN3D 1YEJL 1TNNA 2XTLA 4R97B 5C07A 2IFFH 4LU5H 3UPCA 2VR4A 1UJ3B 4O2EB 5FYKL 1T7XA 4UU9B 1RQ5A 3RUGB 5IVOA 3QFJE 1BVKB 2ADJA 3OR7B 4OZHA 4TTDD 1HHJA 1T3FB 5LBSH 1J1PL 4HIHB 1UGNA 4BQCA 4G3YH 1N64L 3NBNA 1YNLH 4YEFA 3EOTL 2A9MH 3P9LB 4GRLD 4N90E 2C9AA 3QO1A 4PD4K 3CFDA 3MGOB 3OXRA 2W0KA 3ORJA 4PRAB 4DZ8A 3E6FB 4WO4C 4V2CB 1F6AA 4LCYB 4RNRB 7CGTA 1OCWH 3DSFH 4JFHE 5BV7B 3ARGC 4NUGL 4NQDA 1G9ML 3L7FA 3QNYB 3E2HB 3IDJA 2CK2A 3BKCL 3D39D 3VRLF 2KWHA 2Q6WA 4MXVE 1IC7H 2CKBH 4HKZA 5JW3L 1OP3K 2IGFH 3OKDA 5E4EC 1X5LA 3QH3A 2ZUQB 4XPTL 3IETA 4I0PD 1PJ9A 4NSKA 2H32A 3FCTA 1FVDB 3VXSD 3PGCA 3ARYA 3QWOB 5FXCH 3FO1A 3ARDC 3MRLB 3P4NA 4TSBH 43C9A 5DQDL 4OLVH 3LQAH 5INDB 4EQ3A 1X4YA 4HK0B 1IL1A 4WJ5A 4FFZH 1A7NL 4GW4A 1TVBB 3UAJD 5FUOL 4AIZA 2AAVA 1UH4A 3QIUD 5ACZA 4RMSA 3QA3B 5D7IA 1TNMA 2VZOA 4JQIL 4DK6A 2AQ2A 3NH7L 5GRJH 3K81A 1QFWH 4P46D 1SEQL 5CGYD 3PP3H 1B6UA 2MJWA 4P3DA 3NCJL 3TPKA 3FB5B 2V2XB 1K2DA 2CLRB 1U3HA 2Q76A 1E4XI 1ZHKA 1G84A 3RQ3A 5A2FA 3BJ91 4R2GD 3O3AB 4XPAH 1BEYL 2VDKL 1N0XL 2VZ3A 3O45B 3BIKB 3SQOH 3HC4H 2HT3D 4DEPB 3UPRB 4MXWL 3HG1A 5D8JH 5D7SH 4MA1B 5B8CB 3IVKB 2DYPD 3CDYA 4KXZH 3G5YB 4KY1H 4M7JL 1EHAA 2BNUA 3O4LD 5A16A 1T1WA 5IB4A 2XQBH 5IB1B 4G43B 5D7LA 1KXVC 2LAGB 4J3WA 1S9YA 2P47B 4MWFA 2VZ1A 5DHYA 2QADD 3BT2H 2A83B 1NFDE 4JPKL 4JRXA 4QXUL 1L9NA 3QR2A 4G9DB 3A67H 2VDPL 4IHOA 3MC0A 1ACYL 3WN5B 1A1MB 3VMNA 1L7IL 3QJHA 4Z5RA 3GK8H 3PWLA 3W11D 2D7PA 4N5ED 2FYYA 2X1PA 3HR5A 2BX5A 1P9MA 2HTLC 1DUYA 2NR6C 3AROA 4WFHE 4JPIA 1C16A 1IZKA 4M93B 4UTBL 4KHTH 1RJYA 1BJ1H 2ENSA 2OL3A 4F33B 4HPOH 3MBXH 2DTSA 4X9HA 2Y06L 3KYNA 5C07B 3TVMD 3DUSA 4J1UA 3LD8B 1CFNA 1FYHB 3QFJD 1EJ6A 5IJVA 1FIEA 3TH3T 2ADJB 3LH2L 4OZHB 2R0WL 1HHJB 3UTZA 4WHDA 2ZCKH 3RWIA 1ZVYA 4KH2A 1MSPA 1SY6H 1BQLL 4KMQA 1PW3A 1MCNA 2ZSWA 5D70H 1QRNE 2LAAA 4N90D 4JB9L 2FRGP 3WNMA 3B6SA 4FZEH 4YXLL 4H1LH 3QO1B 2VDML 4LEOA 5C0DA 4U6YA 1LO4H 1F58L 3CFDB 4C83A 3OXRB 4PG9A 3N06B 1YEGL 4DZ8B 1F6AB 2A2QT 2C4XA 3FQXA 4JFHD 4TOYL 3MR9A 3RJDA 4NQDB 1GGBH 3L7FB 2UYLA 2VXUL 4NQEA 3IDJB 2AEPL 3HC0A 5HHME 2Q6WB 4XMPL 4HKZB 1CGUA 3OKDB 1I3UA 4ORZC 4S10A 1IC1A 3QH3B 3IETB 1WITA 1I1AD 1IQWH 2P46B 2VIRA 4NSKB 2H32B 3FCTB 4XTRD 3PGCB 5GRUH 2CKBA 3REWA 3FO1B 3HN3A 3MCLH 3P4NB 3MYJA 5D2NE 4HSQA 43C9B 4ENED 4NHCL 1RSFA 5HVHB 1XF2A 1IL1B 4WJ5B 4J6RL 4GW4B 3ZMRA 1IGCL 3KAAA 3DRQB 4AIZB 1DN2A 5I75B 3ARQA 2P45B 5ACZB 5D7IB 4PPTA 3MV9D 1OF2A 2IQ9H 4ZS7L 4I77L 1CICD 1EERB 2BCKA 3SDDA 2NZ9C 4WUKH 2YD3A 1I9JH 3QE5A 4P3DB 5JHDE 4WI2A 3RAJH 1K2DB 4HFUL 3U9PH 5FO7A 1U3HB 2Q76B 2R2EA 1ZHKB 3CH1A 1BZQK 3OQ3B 4ODVH 3OR6A 5IHUH 1NLBH 1WC7A 5J56B 2FATL 3SE9H 5I1EH 1YUHA 3WSQL 1UA6H 4PRHA 2Q8BL 2V5TA 5I8KL 3HG1B 4NO5A 2DS4A 4P57A 5SWSA 1G1YA 1KG0B 1I75A 2BNUB 3C9NA 3EKCA 5A16B 1T1WB 3D9AL 5FYKU 1Y6MR 4GUPA 4PFEA 3WLBA 4KMTH 5IB4B 4C56D 1EGJL 2Y1VA 3WFEH 2AP2A 5JW4N 3GMLA 2D4DA 1S9YB 4KK9C 4MWFB 2UUDH 5DHYB 5KVGL 4NN5B 4PJ5A 3S3SA 4JRXB 3GJFK 4M3JA 1M71A 5ETUA 4OZIE 4IHOB 5DK3A 4HJ0C 1S7XA 3MRBA 3LSOA 4K8RH 4K9EC 4X99A 1TJIH 5CILL 4WI5A 2VLJD 1MHCA 3QJHB 3ZKND 4AEFA 1CD0A 3L95A 3PWLB 3RVXC 3WFDH 3SBWC 4Y8AA 1RFDH 2FYYB 3WNOA 1DUYB 1G6RH 2F9BT 2X10A 1EEZA 4JPIB 1NCDH 3SCMD 1C16B 1J12A 1RJYB 3NCCB 2P43B 1JPSL 2OL3B 4JDTL 1FCCA 2Q86A 2R56H 4J12A 4NO2A 3KYNB 1YQVL 2HN7A 3VDCA 3DUSB 4J1UB 1CT8A 5CIPH 3RWCA 3V0VA 5CBEA 3HUJF 4MJIE 1CFNB 1QRKA 1F42A 1TETH 5C71A 4XNQB 5EZIL 5IJVB 5FYJE 1I8LA 4PLJD 1H3VA 3UTZB 3RWIB 4RWYH 4MMXC 1QRND 1KCUH 2EDLA 4HMCA 2ZSWB 2OL3L 3THML 5K59E 3GLEA 1D7FA 4PB0H 3C60D 3B6SB 5F44A 5DD6A 3NIGF 4HUMB 2X9YA 4LEOB 4X7CC 5C0DB 4U6YB 2R15A 4C83B 4PG9B 1BHGA 1SY6A 4MMZC 3FQXB 5JQ6L 3DMMD 1QNZL 1JL8A 2B1AH 5ESVA 3V4UH 4LVNC 1CBVL 5AYUH 2DAVA 3MR9B 5HHMD 2UYLB 4NQEB 4UOW1 1D6EA 4H1LA 3HC0B 4PBXA 4JCLA 1PQZA 4OLZL 1DBBL 3TN0C 4IJ3C 5E8EA 2O26U 3TPUA 1UQSA 4URTB 2VIRB 2ZZUT 2D2OA 3AGVA 4DJMA 3L9RA 4Q6YA 1E6OL 5LBSL 3NACH 2CKBB 2JTDA 3REWB 3RVTD 1MCDA 3MYJB 2XQYG 3WKMH 1NCBH 4QRRE 4RGNE 1XF2B 4GQ9L 1KGCE 2A6IA 2PO6A 3CSYA 3U83A 3FB7A 4Z23A 3BFOA 2WUCH 5HYJA 2F6AA 5F7EH 2CGRH 4ONFL 2WLYA 1KEML 3RY6A 1MCIA 3OAUH 3WJJA 3MLTA 3SGJA 1OF2B 4IMKA 2Y6SD 3GMPA 4DW2L 2Z31A 1ZSDA 4KDWA 3NPZB 5DVNA 4WW2C 2BCKB 1C5CH 1CE6A 3SDDB 1S5IL 5JHDD 3WV0A 1OAUL 2W0FA 4F3FA 4D3CL 2MBGA 4I3SL 4YQXL 2EC9U 1IBGH 5A43C 2VNCA 2J1KA 4NQCA 5FO7B 2W60A 3CH1B 4KVNH 3V4PL 3OR6B 1A0QH 1U41A 4P4KA 1CFQA 1WC7B 5GZOC 1II4E 1H3PH 2R1XA 1TIUA 1YUHB 4N1HB 4PRHB 1PKQA 3JZ7A 4NO5B 4OM0H 3QEUA 4P57B 5SWSB 2HKHH 2R2HB 2KH2B 5CJQL 1I85C 4X8XA 2ZUUA 2QHRL 1JNJA 3C9NB 5C7XH 4M8QA 4GUPB 2FX7H 3WLBB 1YEFL 5CD3A 4MQXC 3UJTL 1S7UA 1TJHH 3FOMA 4YDVA 3VWKC 3GMLB 3IAPA 2P8MA 2A9NL 4PJ5B 2F8XC 3TA3A 1XGTA 2DLFL 4QO1A 5DJ6A 1M71B 2OR8A 3BYTA 4UT7H 5ETUB 3ET9F 4PB9H 4D9RE 2DDQH 5IMKA 1S7XB 3MRBB 3LSOB 4H8WC 4X99B 4Z7WA 3QXWA 3R0MA 4HLJA 3DX8A 1MHCB 3L95B 3SDXE 3HNVL 4XP9H 4MJ5A 4NKDA 4HF5L 4OLWL 2MCPH 5D2LF 4AJ0A 2VDRL 1S9VA 1EEZB 1CLOH 4B7IA 3CVHH 1INEH 5JHLH 5ISZA 4LSRH 2AEQL 3N85L 4WO4D 1IAIM 5M94B 3ZYIA 2Q86B 1G6RA 3ARGD 4NO2B 3ULVL 2HN7B 3DJ9A 3RWCB 3U6RA 3V0VB 2VABA 2OS7A 2O5YL 5CBEB 5DDHA 2NY6B 3S5LB 1ZGLA 1AFVL 1HYRC 4U7SA 1L0QA 4FQIL 3IDNA 5FYJD 4R7DA 4IOSD 4WCYL 5ITBH 3IDXL 3LEVH 1F4XL 5CIPA 1UC6A 4RGOH 4UDUA 5T3ZL 1YN6A 3CZJA 4WFED 1P7QA 2I9LA 3RTQC 35C8L 5FUZL 1F4WH 2IAMC 5TE7L 5DD6B 5EOCJ 2H1PH 4I9WE 5FYLE 2ICCA 4X83A 3CZFA 4RA3A 4DQOH 4YFEA 2VLME 5ESVB 5DWUH 4NWUH 5IB5A 3MLPA 4JPWL 3B9EA 1D6EB 5GGVL 4H1LB 4PJAF 4GMTL 2BERA 1PQZB 4HUWA 4FQJH 3ZSTA 4LQFH 5E8EB 4KK8C 3TPUB 1ORQA 1UQSB 2VQTA 3VFTA 1NCWH 1MOEA 5GJTH 1AY1H 1HIML 4KK6D 4F7PB 3PP4L 3RWHA 4EZMA 3M17A 3OPZL 3L9RB 1Q1JH 2DWDA 2HFGH 5DZAA 1IJ5A 4NQXA 4LSPH 5C0GA 3PJSA 4RGND 2C3GA 1KGCD 3KLDA 2A6IB 4E41E 3X11A 3K1KC 1VSCA 3VMPA 3FXEB 2PO6B 3CSYB 4UT6L 3FB7B 2GITA 5HYJB 4P5TC 5IT2L 4PRPE 1LP9F 1EEUA 4XI5D 2GJZA 3MZTA 5EUOF 2AJYH 4U6VL 3MLTB 1A6UH 1X5IA 4JRYA 1F4YH 3O11A 3GMPB 2Z31B 1ZSDB 4HKJA 1CE6B 4GFTB 1CXIA 3PXJA 2YPLE 4P9ML 1MCOH 3RL2A 2W0FB 1EO8H 4F3FB 4MJ2A 5J4MA 4GLRH 4NQCB 3UO1L 4LSVH 3QNXA 3ZL4H 2W60B 5MERA 1WZMA 4L3EE 3SKUD 3ROOA 2KUTA 4C54A 4BA8A 4P4KB 1CFQB 1O0VA 5DRWA 3VXNA 4LLWA 2X5PA 2R1XB 3C6LD 2FR4A 3FB6A 1CGXA 1PKQB 2NR6D 3QEUB 5IG7A 1UM5H 1JRHH 4Z0BH 2IAND 3T09A 2X7LA 2JIXD 5HYSB 2CJUL 4M8QB 3WJLA 3HE6A 4PJ9A 3X3FH 3EDFA 4PJ8D 5CD3B 1GC1L 4YIQA 4LVOC 1S7UB 3RDTA 4G8FA 1UENA 3FOMB 1MRCL 3HFMH 4L9LC 4YDVB 3V0WH 2F58L 5SWZA 5FA4A 2B5IC 3MMEA 4DK3A 4ZTPH 3GMMA 2R4RL 2P8MB 4BFGA 1ZXQA 2R69H 3TA3B 1XGTB 3QUXD 3H9YA 3QHZL 5DJ6B 3KLHC 4NO0D 4PUBL 5J89A 4D9RD 1I9JL 5IESL 3ULUE 4XBEL 4RRPG 5GGUB 2LVCA 2Y36H 5IMKB 2Y07H 2IC6A 4Z7WB 3QXTA 4NQTA 3DX8B 3IFLH 3QSKB 4AENA 1LE9A 3TZVC 4MJ5B 4NKDB 4Q9RL 1EBAA 4QRQA 2VLRA 4QT5B 5KOVC 3ZHKA 4H88H 4NO3A 2V5SA 5ILTL 4PG2C 2F53E 1AD9A 5ISZB 3HMXL 4GRWH 2Z91A 4R97C 2HJFA 1GZPA 5CHNA 2YMXH 1UJ3C 4P2CG 5DVLA 1G6RB 1EJOH 1MY7A 4TNVK 4DKEH 3RZCA 4TULH 3WFCL 4Z95L 3U6RB 2VABB 3V5HA 5DDHB 2BVTA 1ZGLB 4BFIA 5AZ2H 3CMOL 3L1OL 3SDCA 4OCSL 3G5XA 2QR0B 3IDNB 4R7DB 4CNIA 1YPZF 2YZ1A 3NFPA 4OLYL 5CIPB 1YN6B 1JPTL 3FMGL 3FQTA 1P7QB 1TJIL 4M9PA 2I9LB 3ALWA 4XCEA 4KQ4L 5ID1A 4FS0A 2R29L 4U1KA 3O2VL 5GGQL 2FB4L 2IJ0C 5F7UA 4YUEL 4F7EA 4G8GE 4ZFOL 1GGUA 2CXGA 5J13B 5B38G 1BVLA 4TQEH 4XAWH 4KJWC 5FYLD 4BSVA 3J7HA 5BV7C 3QDGE 3MLXH 1V8HA 1FORL 3ALPA 3E2HC 4OCMC 3CZFB 2VLMD 3BDXA 4OCRH 4RMVA 5I1CL 4ZPTA 1F6LL 5IB5B 1RZGA 2Y72A 4RA0C 2ZUQC 5HJ3A 1K6QH 5CZVL 1R3HA 4LMQI 3P4LA 4HUWB 5FKPA 3AS1A 1KN4H 4XBGA 1A7OL 1B88A 1ORQB 3VFTB 3RWHB 1RUQH 3M17B 2JJUA 1AHWA 4PJ7E 1J0HA 4UV4L 2DWDB 4MLIA 2A6JA 1NDGA 4NQXB 3VXRA 1NAMA 5C0GB 3PJSB 4M1CC 4E41D 3EO9H 3X11B 5LXGH 2GITB 3UYPA 2IG2H 4UIKH 2FHBA 4RMUA 3OKOA 3UDWA 1MCKA 3VWJD 2GJZB 4F58L 4XPFL 2VTFA 4QHNA 4JRYB 4HUVA 3O6FA 2ZPKH 2G2RA 5BXFA 3BWAB 2YPLD 4HKJB 4KV5E 1MCFA 1R0AH 4TVPD 3MA9L 1ZT4A 2DM7A 4J8RA 2YS4A 5E2VL 5IVNA 1NCCH 3RL2B 4JN1L 4UMGA 4EJ1C 2ILLA 4AEHL 4HJ0D 4DEPC 4L3ED 3QNXB 4PS4L 5MERB 4LIQL 4S1RH 3ROOB 4MA1C 4OJFH 5DRWB 3VXNB 4OGYL 4LLWB 5B8CC 4BK5A 1YMHA 2RQ8A 4YHYC 2FR4B 3FB6B 4TUOA 3LS4L 2HLFC 2DD8H 2XOTA 5F7KC 5T33H 5MP6L 5KW9L 5EU4A 5IG7B 3ARED 1FNHA 3DVGA 2X7LB 1D2OA 1WAAA 2WNGA 3HE6B 3VD7A 4PJ9B 4YIQB 5ANMA 3RDTB 1E6JL 4G8FB 2QQLH 2BOBA 5KBNC 4LSUL 5SWZB 1VHPA 5FA4B 3QDHA 3MMEB 1UYWL 1MJUL 4S1DC 3OKLA 1FRGL 5IGXH 4PJXA 2C3HA 3WN5C 1D5ZA 4BFBD 2ZG2A 1FFPA 5I9QB 5HPMA 4R96A 2LQRA 2J8UF 2XRAH 4IEFB 4IOIA 3ULUD 3BDBA 1NQBA 5E4IA 4POUB 1KCRH 1IBGL 3OB8A 4ODUB 4P23A 4AENB 2EH8H 1S7WB 1Y0LA 3T2PA 4X4MA 2E3VA 4TRPH 5LWYH 1LE9B 2EO9A 4R8WL 4M93C 4GKOA 2NX5D 4FMKA 1IKFL 2DQHH 1KENH 4QRQB 2I27N 2VLRB 2DKUA 2YPVL 3V9FA 2F53D 4NO3B 4M02A 5FUCE 1AD9B 2Z91B 2NY4D 4XNYL 4WTXA 2HJFB 3NZHH 2K7PA 3S98A 1GZPB 3LD8C 2XACC 5CHNB 5EG6C 3VH8G 1L6XA 4PRIE 3RZCB 4OT1H 1DE4A 3CVHB 5HGHA 3V5HB 4XCFL 4BFIB 3TN0D 4QF1A 1MCRA 3SDCB 2GW5A 2B20A 4LFHG 3M8OH 1EXUA 3G5XB 1TZGL 4CNIB 4YLQT 3FQTB 1JMZA 3OKMA 3QHFH 3MXVL 3PDOA 1JYNA 4XCEB 5ID1B 2R0KH 4U1KB 4K7PY 4MA7L 4H20L 4F7EB 1GIGH 1CFSA 3RX5A 2E7LC 5I71C 4BZ2L 1PAMA 4JR9H 3QDGD 1BVLB 1I1FA 2CO7B 4BSVB 4XCCH 4G7YH 3QUYD 3UTQA 5HDQH 4JY4A 3BH8A 2PYFA 4ZPTB 5L9DL 5TPWL 1RZGB 3EYUH 1F8TL 5HJ3B 1R3HB 4HEME 5E24E 3V5DA 3QEQE 1NUNB 5LJYH 3KPMA 5FKPB 3P2TA 2NXYB 4XBGB 5F3HA 5CMAA 5CEZL 5T5FL 3P0VH 1AHWB 2ZOLA 1H8OA 1OM3H 5HVHC 2EDQA 4FXKA 1UZ8A 3IAGC 2Q8AH 5F7MC 2A6JB 1NDGB 3VXRB 3O8XD 1KB9J 4L1DA 3FXDB 1RUMH 2I07A 2EIEA 1R3KA 2DLGA 4FTVA 4OD3L 3S35H 5D5MF 2NY0B 2DWEA 3UCRA 3GIZL 1CE1H 3OKOB 1NC2D 3KYMA 5I1KL 4J3OC 2GJJA 4MQXD 4QHNB 5FGRA 4AM0A 2AEWA 4HUVB 4KUCD 5IHZA 1YYML 1I4FA 1FL3A 3O6FB 4IRJA 3RWJB 5BXFB 2KWIB 5D93B 1P4BH 3MCKA 1ZT4B 4QWWD 4F8TA 1U3HC 1NAML 2KKQA 3QQ9C 4WEMB 3AMKA 3B43A 4TSAH 2ZJSH 4UOJA 5FYKE 2X1XR 3WXVH 1NCNA 4LCWA 5BW7A 1U8HA 2VE6A 4MDIB 1WFOA 4PGDA 4PJHE 1VENA 1VACA 1WFNA 4CJ1A 4O9HH 4A6YA 1YMHB 3DETC 3WDJA 2D03L 4TUOB 4UIMA 5EU4B 2JJTA 4HUUA 2FBJH 1H15A 3DVGB 3LKRA 2ZCLL 1C08A 1RJLA 1E4XH 4NJ9H 4OD2A 4YFDB 5J9PA 4JREB 3TBYA 4ZUSA 2UVEA 3WIIL 1MCHA 5IV2A 4NN5C 1BZ9A 5ANMB 4HCRL 4HDIA 6CGTA 5FM5O 1FE8L 3KPQA 2C1OA 3OKLB 4UINL 3F65A 4L4TA 4PJXB 2IWGA 4S1QH 1D5ZB 5CCKH 4R96B 2AJSH 3HAEG 4IOIB 1X5GA 3DXAE 1HZHL 12E8L 2HA1A 1MCPL 1P9MC 4YBQC 3P9MA 1BGXH 4P23B 1XCQA 1Y0LB 2IFGA 3RTQD 1RIHH 4HWBL 4MB5A 4NN6B 5E7BA 1SBSL 1TFHA 3GB7A 1IILE 2YUXA 3JUZA 2AQ1A 2EDBA 5TFSH 1YECL 3NPSB 4OBRA 1IFHL 4PRID 3QCUH 1WIPA 3BDYL 1DE4B 3RVWC 1LO2H 2FH8A 4IDJH 3W39A 5HGHB 1J1XH 4JRWA 5K9JL 4HMDA 4QF1B 2R69L 3RJQB 1EXUB 1J7VR 3RRQA 5JXAL 5B3NA 1KBGL 4K3HA 3LB6D 3RHWF 1KOAA 3CFKA 2ORBH 4CU8A 1QFHA 3BKYL 5ESAA 4XMKH 3OKMB 3PDOB 3U9UA 3IFLL 1IQDA 1CGWA 1V3JA 1YEHL 6FABH 3GIVA 4PRDA 2HFTA 3O6KL 1I1FB 3UTQB 1BREA 2B2XH 4JY4B 2PTUA 3BH8B 4PJBA 2JELL 1SJEA 2PYFB 3FO9A 2FL5A 2QSQA 2ITCA 4H26A 4N0CD 4NKQB 5D1XA 2IC9A 2GJ6D 4JVWA 1X4ZA 1N8ZA 2D0HA 3QEQD 4WNQA 3V5DB 4CW1B 1MFCL 3KPMB 3CVIL 1UCTA 2DBLH 2FGZA 1LWRA 2DKMA 3O6MH 5F3HB 5CMAB 2ZOLB 1E4KA 4FXKB 5TDPA 1UZ8B 4U1MA 2CIKA 5LAXB 1BBJA 2YBRA 4RDQF 4NM8H 2I07B 2LFGA 4ZO8A 4HGKC 1LDPH 1YQ2A 4FTVB 4OIIL 4A2MA 1NAKL 3LQAC 4L4VA 3S96A 5IJKA 3EHBC 1VFMA 2DWEB 5EC1A 5HVWA 3U0PA 3KYMB 2OZ4A 4G6JH 4OTXH 1RZJH 3SDDC 3DURA 4OCRL 4PJCE 4AM0B 1C1EL 2BVPA 5IHZB 1I4FB 1FL3B 4IRJB 1J8HA 1AXTL 3MLWH 4HXBL 1X6LA 4C59B 3MCKB 5FYKD 2N7BA 3BUTA 4NRXA 1REIA 3QPQC 4GBXD 1CG9A 4LCWB 1U8HB 4JZNA 1WTGT 2VE6B 1VKXA 2PR4L 4PGDB 1D9KA 3CCHA 1VACB 2OKMA 2FHCA 1CD8A 1E4WL 4DN4H 3O2WL 1RUKH 5DD3L 5C9JA 1B90A 4UIMB 3UTSA 2OK0H 5AAMA 1BQSA 4HUUB 3N0PB 1V3MA 1H15B 2RHEA 3LKRB 4OD2B 1C08B 1RJLB 3BZDA 3Q2CA 5J9PB 4CUCA 3B2UD 4K7PL 3TBYB 4X7DC 4ZUSB 1OHQA 5C07E 5DZ9A 2AERT 4LGPB 3RI5F 5IV2B 1BZ9B 1QFWM 4PP1D 4XC1L 5DFVD 3EJZC 4OQ1A 3OL2A 5C0BA 4PRBA 5AZEL 4HDIB 3T2NL 3IXTA 3GKZA 3KPQB 2C1OB 4MD5A 2HVKA 1AR2A 3AS0A 4L4TB 4OZHE 2B39A 4Y8DC 4D9LL 3MODL 3DXAD 1A1OA 3CNKA 4A6YL 4X6DA 2QJDA 3TYGL 4IGBD 5GISH 1XCQB 2AXGA 2DLIA 4FHBD 1O7SA 4YR6A 3L5XL 5HXMA 3CU1A 5DJ8A 2X40A 2A1WH 4Z7QF 4PJDF 3GB7B 1Z6JT 1MRDL 1NUDA 1FN4B 1EUUA 1JNNH 4NQDE 3HRPA 3UTTE 3UEZA 1IJ6A 2NY6C 4OI9A 5FGCB 2IBBA 4Z7VA 1G9EA 5FOJA 4CVWA 1ROWA 5DUMH 1J9CT 4BQ8A 3W39B 3N9GL 1I8LC 3ZKXB 4NZUL 5F1KC 4PJEA 4WY7L 3G04A 3MLYL 1IEBA 1JF6A 1MCBA 3S8WA 4UOW0 3CFKB 1KCRL 5ESAB 4JKLA 1DQDH 2EICA 5EULV 3ARFD 1IQDB 1GVIA 5KS9F 5DEFA 1ZTXH 5KAQF 3GIVB 4PRDB 2VAJA 2A0LD 2WOYA 4OUOA 2FLBT 1BIIA 5D7IE 4M6NH 5F9JA 4PJBB 4ETYA 1SJEB 2FL5B 4HC1A 2ITCB 4H26B 4R7NA 5D1XB 2EDDA 1KTKE 1N8ZB 1N3NA 2YRPA 3QDJE 4MXQC 4WNQB 1CR9L 5JMOC 2W9EH 1P5UA 1A7PH 4NGHH 3Q5YA 3ZDZE 1DBKH 4U49A 1U8KB 3MBEA 4F7CB 2CIIA 4UDTA 5TDPB 1MJ8H 4U1MB 2CIKB 1T1ZA 4FP8L 4I5BA 4V1DE 1BBJB 2YBRB 2PO6C 1NSNH 5DQ9A 4WVRA 5J3HC 3ZE0F 1U8MA 2D7TL 3ZE2F 1JGEA 3SDXF 4W4OA 5ALCH 3RY6C 4L4VB 3S96B 3SGJC 1T83A 4IMKC 4XP5H 3GJFA 3U0PB 2Z31C 3AB0C 4DFIA 5A3IC 2XZCL 5D7LE 4DVRH 3DURB 5E5MA 2YWZA 1EFQA 5HI3D 2ZUWA 5ICZA 4HG4K 2BVPB 4RFEA 4JRXE 3G6AA 2OI9B 1J8HB 1GPOL 4JGMA 3T77A 4QRTA 3GI8H 3VXUA 4NRXB 4O51A 4P4KC 1CG9B 3QK6A 1HINL 3BEWA 4JZNB 1JE6A 4XX1E 3U2SA 3DWTA 1CGSH 1J0JA 5AG9A 1VKXB 5I30H 4KKCC 2ZP0T 1D9KB 3CCHB 3T3ME 3K3QA 3WIHH 2IQAA 2UZIL 4GAGL 3CIQA 4GG8A 3VGAB 4A2LA 2OZ4L 2CUIA 2D0GA 5JW4Q 1M7IA 1B4JL 5C9JB 1EHLH 3UTSB 4Y4HD 1R5IA 2HFFA 3MCG1 2B0SH 5J7CC 4KK5C 3V5KA 1KN2L 4NZRH 5C09A 3ZYJA 4N0RA 1I3GL 5DUBA 4P3CH 3KXFA 4NC1E 3TA3C 2FEDC 4CN4A 2ICWJ 4PRBB 4WEUD 5C0BB 5ACLA 5F9WB 3IXTB 1G0DA 2WSKA 4MD5B 2HVKB 3GBMH 2AABH 4ELMF 1A1OB 4P9HH 4X6DB 2ZJSL 1LEKA 4EN3A 2AXGB 4K8RC 3IFOA 4YR6B 2FX9L 2R0LL 3N1QC 4U3HA 4Z7NE 4I3RH 4OLXH 5DJ8B 4ONGH 1NGYA 5J1SC 4CMHB 1YY8A 1QG3A 4XWGL 4X9GA 4XB7A 1WQVT 3UTTD 1KXTB 4FFVD 1FFNA 1E4XL 4NQEE 1VGKA 1X5ZA 4JGUA 4YXKH 1A6AA 1I8KA 1HWHB 1OAKH 1AGEA 4GQPH 1TMCB 1QKZH 4YDKH 4PJEB 3G04B 1JCKA 4O5LL 4YC2B 3B8YA 1IEBB 5C2BL 5TH2B 1WWAX 1Z9LA 5I1JH 4POZC 5IUSA 4JO4H 5IB2A 3HC3H 3WXWL 1IM9D 5J13C 3S9DB 4HWZA 3JV6A 3D39A 4W6XB 5I1IH 4PGBA 5DEFB 1LNUA 3QULA 4MAYC 1ZGLM 5T5NG 2BY0A 5L0QB 2VITA 1PLGH 5F8QC 3BN9D 1BIIB 1HCFX 3WEXA 3I2CH 1DLHA 5F9JB 5IK3A 3VXSA 4R7NB 3NIFF 3QDJD 1N3NB 4ODWA 1MHHA 3GSOA 4OZGA 4NCDA 3QQ9D 3MBEB 3GSUA 2PXYA 3CFEA 2CIIB 1GOGA 4UDTB 1GXEA 3QIUA 4V1DD 5F96L 3TLRA 1T1ZB 4I5BB 4PRHE 1AC6A 4KI5C 4XMKL 5DQ9B 2Q7YB 7FABL 1U8MB 1A21A 4MD4A 2CLZA 4HC1L 1LK3H 1JGEB 2NQCA 4L1HA 4YE4H 4AQ1B 4K2UL 5HHXL 5D7LD 3T0BA 4DN3L 1T03L 3LPWA 1FG2A 1JGUL 4Z78A 5E5MB 5ICZB 2DRUA 1B0GA 3JWOL 4JRXD 4MNQD 4PJ5E 4RAVA 3T3PE 4RFEB 4P2OD 3G6AB 3B9VA 4F80A 2AQ3A 3MGTA 4N8CL 3T77B 1WEJH 4QRTB 4CN1A 3ULVE 4OFQA 1B0RA 4XX1G 5A2LH 3V0AC 5C8JA 3VXUB 5KVMC 4O51B 3LPFA 2DBLL 4XNUH 1MFBH 3BEWB 1J5OL 4HQQH 3U2SB 1C12A 1CDBA 1G7MA 1N5YL 2IQAB 1JI1A 4GG8B 5T3ZE 3MXWH 5EOQH 2VXQH 2F19L 1LO0L 1M7IB 4Q2ZA 3WJLC 3WFBL 1PVHA 3HE6C 1R5IB 4M7KH 2HFFB 4QTHA 2OSLA 3RDTC 5I2IA 3V5KB 1BFVL 4LPVA 3WIHA 3UX9B 5C09B 5DUBB 3CDGA 1NANI 1NUGA 1W8NA 4KROB 4RSVA 3FN9A 5FCUL 5I9QC 2EIZA 3RVWD 3GHBH 4JZOA 3HI5L 3V8CA 5HDBE 1FBIH 3QYCA 2YN5A 3VE0A 5GRXG 5KVFH 1LEKB 3H42L 4WW2F 3NCEB 1AGBA 4EN3B 2ED8A 2Y7QA 3IFOB 2ICWI 4R90H 2OXHA 1F90H 1NGYB 5CJ8A 3HI6L 5CEXA 4AG4L 2YA1A 2J7LA 4NQED 1A2YA 3HMWL 1FFNB 3BE1H 3LRGA 1VGKB 4U33A 1A6AB 2I5YL 1I8KB 2EKSA 4LPYA 5T1DH 2XZQH 5ADOH 3E8UL 5D71H 1J1OL 4RMRA 1TJGL 1AGEB 3FO2A 3NCMA 2VZVA 3MRCA 3TP4A 3KS0H 4YWGH 5EU3A 4FFWD 3FFCE 4N1EA 5KVDL 5IB2B 4HK3N 2YC1A 2WUBH 3LZFL 3P4OA 4HWZB 1L0YA 3JV6B 4HIXL 3D39B 3OAYH 4L5FL 1Q72H 4PGBB 5TE6L 1LNUB 3QULB 5HYJE 2FO1A 1A3RH 2VITB 4P2QA 1N59A 1I1AA 1OAYL 1KULA 4W6WB 3WEXB 1DLHB 4M6OL 3MV01 5IK3B 2R39A 3VXSB 3X17A 2W91A 4BELD 5I6XB 2NXYC 1BFOA 2VXSH 4ODWB 1MHHB 3QEGL 3GSOB 1AHWC 4GXVH 4OZGB 3PL6D 3DVNA 4NQCE 5FA3A 3GSUB 3C8KA 2PXYB 5JORA 3QPQD 4XVSH 1HHHA 3CFEB 1H7CA 3MACL 1C8PA 3QIUB 5KSBE 3ARZA 4PRHD 4JO2L 3F6IA 5F9AC 3MV9A 1PKQE 5CSZA 3GO1L 2NY0C 4R3SA 5EOCH 4MD4B 1CICA 2CLZB 1Q9WA 5E8DH 4U2ZA 4MQSB 2CK0H 5H2BA 4U6XB 3OJDA 4DGYL 4WENB 1VB9A 4RFOH 2DKSA 1EUTA 1R24A 3O6FC 1FG2B 4Z78B 1D6VH 4LKXA 1FV1A 3OWEA 5D93C 1JTOA 5DLML 3NVQA 4FQ2H 3RA7H 4HUXA 4RAVB 2CSPA 4I2XA 1N6QL 5IROC 3ULVD 1T21A 2DMBA 3MGTB 4H0GA 1B0RB 1JFQH 5C8JB 3REVA 1OL0A 3P30H 3C5SA 1XIWD 3UYOD 3G6JF 1JZ2A 1C12B 1FLRL 2X4NA 4C56A 5T3ZD 1G7MB 1HILA 4P48A 4KZDL 5CUSH 4JREC 4NJAH 2QADB 1S3KH 4Q2ZB 2R0ZH 4X6CA 4C57C 4KJQD 3L5IA 1T0NA 4QTHB 1NCTA 2OSLB 5HHPA 1S78D 5I2IB 4Y88A 3LS5H 1MH5A 3P0YL 2CD0A 2OTUA 2FECL 2QV2A 4DGIH 4X5XB 3CDGB 2VLJA 5K9QG 1MFAH 3H3KA 2EIZB 5TQ2L 1FIGH 3O3UN 4S0SD 4WI3A 4M5YL 3CDCA 2H2PC 25C8H 4P23C 1VA9A 3VE0B 3MROA 1CVSC 1FPTL 4Y5VA 4NFDA 3SO5A 1Z3GL 5FYJH 1AGBB 2BVUA 3FRUA 4NN6C 5L7XL 2Y7QB 4TUKL 2VKWA 1RMFL 5C6PB 5F7NC 2AGJH 1Q0XL 2XICA 4ODHH 4HXAH 2Y5EA 4H1LG 3WD5L 1WWCA 5IW1A 1A2YB 4N9GA 3CFCL 5DO2C 2EKSB 1HSAA 3V95A 2ADFH 2B4CH 3S4UA 3SN6N 4IRZH 3CLEL 3DVIA 1ZT7A 4ZS6D 3FO2B 1NBZA 4MXQD 3U46A 4C58B 2BSTA 3C60A 1VGEL 1OAZL 3MRCB 1UG9A 3FZUD 3FFCD 4NUJA 2D9CA 1W2KT 4M6ML 3U4EA 4ZD3H 5I76A 2WP3T 1YC7A 2YC1B 3LDBB 3O3BA 3P4OB 1DBJH 1KB5A 4FXGA 4QKXB 3BWUC 4KUZH 4KI5E 1KCSH 3QPXH 4PJHF 1Q9OA 3MZGB 3HHRB 3UZEA 1T1YA 3WO4B 4P2QB 4G5ZL 1N59B 1I1AB 3MUY1 4CN6A 4NHUA 1VERA 4HIJA 2EDTA 1A22B 3ARBA 5F7YC 4C4KT 5D2NA 2VH5L 1IGIL 3BGFB 1KJVA 1BFOB 3IU4L 1MEXL 2DQGH 5DQJA 3L3OA 3C5JA 3RUGF 4CVXA 3DVNB 2BVQA 1QKZL 5FA3B 3C8KB 5JORB 4P4KD 1D5MA 1HHHB 3MYZA 3BKJH 1UWGH 4KTEL 4MA8L 3MV9B 2M1KA 5CSZB 3P0GB 4XHJC 1T7WA 4R3SB 3NMEA 1CICB 1Q9WB 3NIDE 4G7VL 5JHDA 1E0OB 5H2BB 3OJDB 1K5NA 1OGAE 2AJXL 1R24B 4IRJC 4LKXB 5SWZE 1FV1B 3LKQA 2VDNH 1XMWA 4OCYH 4I2XB 1T21B 4OF0A 3F7VA 5BW7C 4HT1L 2MQ3A 4Y2DA 3MRFA 1U2HA 1IEAA 1MCCA 3ES6A 3REVB 1MHEA 4LCUA 4DNDA 5JLZA 4JM4H 2HMIC 1MQ8A 3ZT5A 2DQTL 2ATPA 3C5SB 3VFRA 2X4NB 4C56B 4FNLL 1HILB 4I0CC 2JJTC 2VLRE 4BJLA 1KPVA 4AEIL 3PIQA 5JO5A 3PGFL 4X6CB 3S4SA 1QUNA 4U0RB 1MY5A 1T0NB 5EWIH 5HHPB 2MPAH 1MH5B 2AJVL 3PF2A 3PE9A 2XIDA 3LEYH 2OTUB 1KT2A 1MIMH 2VLJB 4Z7OE 1WBXA 3WLWD 1KYOK 1BBDH 4XAKE 2O5ZH 5F1NA 2ADGA 5JUEL 3SCMB 2GTWA 3P73A 1CK0L 3OZ9H 3JTTA 3MROB 1OARL 1P7QD 4Y5VB 1RZFH 5E2TL 2R1WA 5E6YA 1MWAH 3OMZA 4KHXL 3QG6A 4O02H 3FRUB 4LHUA 1AI1L 5I1GL 5FFLA 5DD0H 5HI5C 5CEZE 2HWZL 1FC2D 1PBYA 1P4LA 4O58L 1MIEL 4GW5A 3RHWK 3GM0A 1QBMH 5DA0B 3N1FC 4TPRL 4AQOA 1UEYA 1NDMA 4RWHA 5IW1B 1TVHA 2XN9A 5FYLH 1NGQL 4N9GB 3G5VA 1CLYL 5DT1L 1HSAB 3ZKXC 4OB5H 1QACA 3EW3B 4I18A 1ZT7B 1QHOA 5DGRA 1NBZB 3U46B 2BSTB 3C60B 3U4BH 2F8VA 1WICA 3UC0L 2HG5A 2VISA 4FQ1H 1YMME 3BAEL 1GRWA 1S9XA 4NUJB 2EDJA 2YSSA 1ZANL 3HZYA 3U4EB 2I24N 3DYMA 5I76B 4JZJA 2R1YA 3TV3L 3O3BB 3NAAH 5HHMB 3F7RA 4FXGB 4GXUM 4KI5D 5CJXA 2AXHA 1RUAH 3JSSA 2QEJA 4G6AD 4MD0A 1IJ9A 4OIAA 5F70A 1Q9OB 1CDCA 3TEUA 3BKML 1U6AL 4EUPA 1F00I 3CX5K 5CWSA 3NFSH 1T1YB 4M8VA 2EE6A 5D1XC 1CXFA 1KCKA 3VFMA 5C92A 4NHUB 5JPNA 3F58H 4HIJB 1BM3H 3ARBB 1SYVA 3BE1L 3BQUD 3OTTA 2G75A 4OFIA 3ZKQD 3ZKMC 5D2NB 1KJVB 4JM2C 4DUWA 3RVVD 1RHHB 5DQJB 3B9DA 3QDAA 3KYKH 3L3OB 1E4KC 5GZNC 4HS8L 3C5JB 4CVXB 1KB5L 2BVQB 4TVPH 4XMLL 1D5MB 1J11A 1JGVL 4LP4A 3HNSH 4EBQH 2EE9A 5DZLA 4XVJH 5IJKC 1QSDA 2ITDA 2Z8VC 1UEMA 3S36L 3A0OA 5TF0A 2VRAA 5DJZA 5JHDB 4KGLA 1WAAE 2ZKHL 3HE6D 4YZFE 2F15A 4PJ9D 5JR1L 1OGAD 1PYWA 4Q7DA 1K5NB 2IALA 2QHLA 5ANME 5SWZD 2OI9C 1I9RL 3LKQB 5GQBA 1FSKB 4AIOA 2EE3A 2G60L 2XA8H 4GG6F 3BPLB 2YA0A 4LSTH 3F7VB 3RI5K 4Y2DB 3MRFB 4JG1L 1IEAB 1PKOA 3ES6B 3U7YL 3FT2A 1FLTX 5TF1H 1MHEB 4LCUB 5AD0A 1D9KC 2IANA 5CZXD 5IM7A 3VGAC 3TJHD 2ATPB 4X4ME 3VFSA 1A9BA 4MS8C 3ULUH 4PJ8A 3VFRB 1M7DA 3WUWA 1EAJA 2K1MA 3RPKA 4YBLB 2C7UA 2AK4A 1KPVB 4X7SH 1DQMH 4K94L 3PIQB 5JO5B 3S4SB 3QUXA 1A6VL 1T66D 4NO0A 3QQ4A 3QXAA