2XTLA

Structure of the major pilus backbone protein from streptococcus agalactiae
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
449
structure length
449
Chain Sequence
ETKPQVDKNFADKELDYANNKKDKGTVSASVGDVKKYHVGTKILKGSDYKKLIWTDSMTKGLTFNNDIAVTLDGATLDATNYKLVADDQGFRLVLTDKGLEAVAKAAKTKDVEIKITYSATLNGSAVVEVLETNDVKLDYGNNPTIENEPKEGIPVDKKITVNKTWAVDGNEVNKADETVDAVFTLQVKDGDKWVNVDSAKATAATSFKHTFENLDNAKTYRVIERVSGYAPEYVSFVNGVVTIKNNKDSNEPTPINPSEPKVVTYGRKFVKTNKDGKERLAGATFLVKKDGKYLARKSGVATDAEKAAVDSTKSALDAAVKAYNDLTKEKQEGQDGKSALATVSEKQKAYNDAFVKANYSYEWVEDKNAKNVVKLISNDKGQFEITGLTEGQYSLEETQAPTGYAKLSGDVSFNVNATSYSKGSAQDIEYTQGSKTKDAQQVINKKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Approach to Rationally Design a Chimeric Protein for an Effective Vaccine Against Group B Streptococcus Infections.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Structural protein
molecule keywords CELL WALL SURFACE ANCHOR FAMILY PROTEIN
total genus 135
structure length 449
sequence length 449
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xtlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xtlA03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xtlA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 2xtlA02
1DE4A 1D5XA 4JZJB 3V4UH 3N1PC 4O5LL 5D6DA 3DRTA 3ZE2F 4OLYL 4XNQB 4MCYB 2C5JA 3T4YB 4IGBB 4OGAC 4WUKL 5D5ME 4Z7OF 1C16B 2F19L 3EYFB 2O5XH 1RJYA 2XOTA 3FAWA 1KENL 4ZS7H 3BGFC 2LABA 4P9ML 3UYPA 3O8XD 1A6ZB 5CGMA 4PJFF 4KJPC 5ESVB 1A6VH 3STZA 3FFCA 3V7AE 1C5BL 1Q94A 2IPUG 4NKIL 3WN5B 4F7TB 3T77B 4FA8A 4Z7UB 2CO6B 3CVRA 3L6FB 2UZIL 3ARBD 1R3IH 2DDQH 2F5AL 3CUPB 5D1ZC 2RCSL 1NLBH 4GLRH 3PQYD 4KRPB 4CMMB 5I8OH 3OMZA 1I8LA 4ODUB 1ONQA 2XY1A 1K6QH 1LVEA 1PKOA 1VHPA 5KJRH 3N5LA 4CAGA 2Y5EA 5E94A 4EI6B 3T0AA 1GRWA 3ZT5A 4H1LG 5EO9B 2MSPA 3RY6A 3MJ6A 4PUBL 1FL3B 1U8HA 4PP1C 2C1PB 3LD8B 3O9WC 4ZUTA 3QFJB 5IQ9A 4PJHB 1LO5A 3TIEB 1WAAF 2QSVA 4P5KB 2H3NA 1AGBA 2NY6B 3DSNA 1JWMA 4X0KB 4CVZA 4CL7A 3RDTC 3FT4A 2YUVA 1LO4L 1OCWL 5DJAA 4CJ1A 3QCUH 1NCTA 4EVNB 3LPGA 3EYVB 1OP5H 5IVNA 1IGML 4EUPA 4V2CB 1Z9MA 4E42A 1T66C 2C3WA 3WNLA 1YN6B 1QFWL 4LEOB 1WIUA 1YJDC 1VFMA 4LLDA 1WC7A 3PNWB 3FQXB 4M4RA 3NGBB 3PWNA 2O26U 4MAYA 1PG7H 3BPOC 3DVGA 4J6RH 4WTZG 1HNGA 1IGTB 3M17B 3KDMA 3R4DA 4PV9A 5BV7H 4MQXC 2GAZB 2IGFL 5FF6A 1Z5LA 4JQIL 3MXZA 4JRYA 1G0XA 3H9HA 4F15B 3T0ED 3HE7B 1OSPH 3GDBA 3NACH 1I7ZB 2XA3A 1UA6L 1HH9A 3LQMA 5D7JD 4TPRL 1J12A 4HX1A 5I71B 1ORSA 4ZXBB 3REWA 4N0FA 4YBQD 1NJ9A 2DD8L 1KNOB 3EYVA 5DJ2B 3ZE1F 1EBPA 1NGYB 4RGND 3B6SB 5DJ0A 3BWUC 4RZCB 5GS0L 3BH9B 4MB5A 4H5SB 5IHLB 4LSPH 2W0KA 3KPSB 5DQJA 3UO1H 3LRSA 3E3QC 3HMWL 4P2RB 3DI2B 4M9OA 3I3EA 4LKCB 1KN4L 2PO6C 3QUKB 2R2CA 4DGIL 5DJCB 1H15A 4L4TB 5KANI 3EJYC 4GXVH 4L4VA 3HMWH 3CH1B 1FGVH 4FQ1L 3MUY1 1DBAH 4FXKB 2NY5C 4L4TE 2B1HH 5JOPD 3P4OA 4JJ5B 2VH5L 4HZAA 4LSRL 2OJZH 1GIGL 3FN9A 5C2BL 1AGFA 1FL5A 3NABH 2R69H 4QHUA 5D2NA 4YDJB 5EH1A 4ZUUB 3QEQB 3KPRB 1JYXA 5EB9A 1P4BL 4XCNB 5D5MB 5IMMA 1CD8A 2LAAA 1M71A 1S8DB 4ZS7L 3D39D 1L9NA 4OF6A 3EYQC 4LIQL 1ETZA 4XAWL 3OGCB 3O6LH 1FORL 5HDQL 1A3QA 1EGJA 4X4MA 5F7KC 1MCHA 2H2PC 4ELKB 5D7LD 3GKWH 1QPXA 5I76B 2AXHA 1Q9WA 2YPKB 1FNEA 4YGVA 5E9DD 3SQOL 1BFOA 4CRPA 3OHXB 5GIRB 4OI9A 3UTPE 2P1YA 4NQDB 5HHXL 3VXQA 4NPYB 5JHLH 1KFAH 1RVFL 3BDYH 5EORH 2MNUA 5I1KH 3LRGA 1QR4A 2Z0BA 1CCZA 4KROC 4QHLA 1QA9A 4HWBL 3Q2CA 3R1GH 3B9KB 4WWKB 5EC2B 4MSWB 3OB0H 3ARFA 3HMXL 1DQLL 3TA3B 1A7QL 1OAZL 5IM7A 5FV2A 3RWIA 4OZIF 4XCYA 3E2HB 1ZT1B 3F6LA 4LPWA 4J3OC 4WDIB 4PJIE 3MODL 3DIFB 2VZUA 5I1IL 4ODWA 3BVNB 3J8F7 2K7QA 4G9FE 4FQ2L 5IR1A 4H88L 4C57C 1QFWI 2MCPH 4FQJH 4HIIA 4TSAH 3MRBB 5KN5A 4NCC2 5C0BA 1MY7A 3PDDA 4AEEA 1A1NA 1I7RB 1Q0YH 2DL9A 5DK3A 3IU3B 2YWZA 1I3RB 2O5YL 3TVMA 1I9IL 2OK0L 2F53B 2H8PA 4Y4FB 5D2LE 1OGAD 1R5VB 5BRZE 4TVPH 1GAFH 1QA9B 4NC2B 4Y2DC 3K4ZA 1QYGH 4FQXD 2C3VA 4AH2A 1KG0B 3C5JB 2XPGA 3CPLB 1PKQE 5TE6H 5D71H 3RHWF 4K8RC 2Q86A 1JTTA 1SJEA 1U91A 1QLRB 1WQVT 5CP3A 1NC4B 3DURB 1MFNA 3VXSB 5ICZB 2Z93B 1EZVX 4JPKL 3D0VA 1NBZA 1I9JH 1QRKA 1G6RH 4M5YL 4GG8B 5HHVL 4F9PA 3O41B 3LZFH 4Z7NE 1CXEA 3QQ3A 3GRWA 5KSVB 4PRIE 3IU4H 1INDL 3LN5A 1OAUH 5C0GA 5C0IB 2VXSL 4NSKA 4WJ5A 2AJUL 3QULA 1JNLH 1IGJB 5T3XL 1TQBB 1LK2B 2E9IA 3IAPA 4MYWB 4ZXBD 1VEOA 1K9TA 2EE3A 5EBGA 4JPVL 4PJ9B 2X4TB 2DJUA 2OMBA 3I3DA 2UUDK 1T5XB 5F1NA 1QBMH 1J11A 4YGVB 4YGAB 1SJEB 1U91B 2F54E 1PKQB 3EGSA 3DO7A 1E4WL 1ED3B 3MJ9A 3IDXH 5CMAA 4NO2A 1EAPA 4Q6YA 4X8JA 3F5WA 4YH6A 5B39B 3AU1A 5EU6D 5IKCB 2E6JA 1JGEB 3IDYC 1Z9SA 3RWJB 1TLKA 4GG8A 3ZE0F 3ARSA 2JB6B 5ACMA 1CGXA 2IAMA 2Y7QA 2IALB 5TE7L 2GSGA 1SM3L 4ZFGH 3C6SB 3D69B 2I9LA 1KJ3L 4WHDA 4WJ5B 3HZVB 4X6BA 4XMPL 1S9KC 2DLTA 5BW7C 4KUZL 1KLUB 3HRZB 2A6KA 1MPAH 4HPOL 4JFZL 2AEQH 2XTJE 1UM4L 4HEME 4X4ME 4PBXA 5M95B 2QHLA 3L5XL 1A1OA 1D5XB 3LKPA 2GFBA 2W0PA 2DLHA 5MHSD 5E00A 1DN0B 3RKDD 2PTVA 1G9ML 4Q9RL 4O2EA 4GAJL 2F54D 5BVPH 3VGBA 3ZDYF 2BP3A 1I7RA 1A1NB 1CICD 2EYTB 4GRWE 3C60B 5CIPB 1CIUA 5FGCB 4NQED 2CLVA 5DRZB 1MQKH 2QR0A 2R0WL 5DQDH 2GTWA 3BP6B 1ZTXL 2AJZB 1XEDA 2GSGB 3GRWL 5D1ZA 4W81A 1YY9D 4YUEL 2GJZB 2R4SL 5IFJA 1QKZH 5BRZA 5C3TA 1NUNB 1WGOA 3M45A 2FJFB 4CVWA 3ZKQD 1P9MA 1JRHI 1BM3H 2OJZL 3NIFE 5E99H 2WBJB 4UV7L 3SE3A 5FOJA 4LBEA 4ZNEE 4K7FA 2E7LC 3BXNA 2GEEA 4JFDD 1F3JA 3EOTL 1Q9KB 2X4NA 4S11A 5CZKA 4YXKL 2Z8SA 4MDJB 5D72H 3RY6C 2R8SH 3WJLC 4XCNA 3MBXL 3OKDB 5EUOB 4BZ1H 3DMMD 4WFED 4HBCL 1IGJA 4KDWA 5DEGA 1PX3A 3U6RB 4LSPL 2X9XA 4HK0B 1UEYA 1EJOH 3EDDA 2X4TA 3OKOB 4NJAH 1V3MA 5BJTA 1MNUH 2FJFA 1G9MH 2YRPA 3MRPB 4NM4H 4X83A 2VC2L 5E9DA 1T2XA 3KPLA 2LTQB 3P0YH 2PTTA 4ORGB 3TCLA 3TZVC 1WFUA 5FHBL 1QFOA 2A6DA 5DHXB 5EZOL 3IDGA 3TT3H 3L3DA 3VFPA 1TVDA 1LO4H 2X1OA 4QRUA 5GGQH 1DSFH 2MHAB 3QIBA 2AV1A 4JZOA 2C7UA 3U2SA 4FFWD 4XPBH 4G42B 1XGRA 1Q0XH 3AS3A 3MLXH 4G8FB 3U6RA 4YBLB 3H3PH 1AGDA 3WIHL 1JF6A 5I1IH 3MRKA 2VQ1A 2YD4A 3STZB 1VPOL 3UPAA 1KJ2B 4HH9A 2EEAA 5AYUH 3RL1B 3QUXB 3L7FA 4PBVC 2X40A 4I3SH 3ZDYE 4NRYB 3THMH 4FQPA 4F33B 1KTRL 4TUOB 3QISA 3C5ZA 3MO1B 3VD7A 4IOIA 2VSCA 3HKFA 1E4WH 4WFHE 4RZCA 1OVZA 3BWAA 1VCAA 1U95B 3CGTA 3QQ9D 3LIZL 4OM1H 5AAMA 2KL6A 4K7PX 1T20A 3K81A 3MROA 1ZXQA 1G1YA 5KS9B 5JLZB 2P24A 4YHPB 3QI9D 3WXVH 4G7YL 1FNSL 3A6OA 1NCCL 4NRZA 1PY9A 4ZFGL 2CXGA 4PRDA 4DZBB 5EU3B 2ITCA 1RUPL 3WUWB 1G7HA 4P23B 2P8LA 4HIEA 4JZJA 4PG9B 4GW4B 2X7LA 1TVHB 2H3NB 1W72L 1EEYA 4YIQB 3IYLW 1RZKC 1HYRC 4Z23A 2DQEL 1L4IA 2WINA 3C5ZB 3MO1A 1I8KB 4PD4K 4CBPA 4LSRH 1YJDL 1B88A 1F8TH 1U8LA 3TT1L 5BV7L 3WSQL 2HLFC 3BUTA 3BZEB 2EYRA 5CJXA 4YO0A 4UBDD 4L8DB 2ZPKH 4QXTB 2XWJA 4D94A 3F12B 4Z7UA 2X4PA 1URLA 3DUUA 4LVHC 3WJJA 3DXAB 1ZWIA 4MXWH 1ZT4B 3S37H 5KOVC 1MI5A 4JY4A 4YHKH 4PJAB 3I6GA 1EAPB 5FYLD 1XIWA 3KLDA 1EV2E 1HH9B 3X3FL 3MRCA 1LRZA 4K94L 4JPKH 3PQYB 4KRPD 1NFKA 3RVTC 2I07B 2A9NL 3PV6B 4M4PA 3SDAB 5BMFH 4PRIA 3C8HA 3I6KB 4PJIA 2ZOKB 1IQWH 3QXDA 1J0IA 4RA0C 1EK3A 5F72S 1IQDB 1BEYL 1J10A 1NL0L 3QPXH 3VRIA 3IRPX 2Z4QA 4OCSL 3LRSB 1WCQA 1CG9B 3KPNB 2YD2A 4Q97A 4P46B 5HJ3B 1VFOA 2NZ9C 3JSSA 5DTFB 1D3CA 1TTFA 1V8HA 3QP3A 2OL3B 2G5BA 2DRUA 1W8OA 5MI0C 2YS4A 1ZWIB 4O4YH 1OAXH 3PABA 1OM3H 1L0YA 5F1IB 2EC8A 1RURH 4LARH 5IB2B 1CDUA 3A0OA 3TLRA 1N59A 1DQJA 1P4BH 1P6FA 4PJDB 2BVOB 4PJAE 5H35B 3SDCD 5I6XB 4EIGB 1U8PB 3RWHB 2I07A 2R69L 1U8HB 2X1PA 3NAAH 2C1OA 4JR9L 3BPCA 4Y4HC 5F96H 4DEPC 4L8CB 4GS7B 4NQXB 2AXFA 2ZUQB 1FFPB 2FB4H 1SJVA 3LVEA 4OIIH 4TNWK 5KTEL 4GRWF 4LNVA 2QKIB 4NNXB 4PV8A 4U6XA 4M9PA 1ETZB 3NA9H 3NFSL 4U6HB 5I1DB 4PJGA 3VXUA 1HHGB 2FATL 3TO2A 3NCEB 3BMWA 2E27L 2P5ED 1M1SA 3A6CH 5DEFA 2FX9L 1K4DB 3MR9A 3UO1L 2Y06H 1BECA 1JHTA 1N4XH 5GRXG 4L8BA 2YN5A 3O6FC 4I5BB 3CZFB 1VEMA 3BRGC 3C08H 1D5ZB 2P5EA 1WCBB 4OF0A 3QPQC 5T3ZH 2WQSA 3BIKB 3VD4A 3MLVL 2AJVL 4DKAA 3VWJD 3VRLF 5HTSA 1TJIL 2PW1A 3ARDB 5J12C 2NW2A 1U8KB 3JV4B 1IJ6A 1GHFH 5IM7B 2DLFH 1ZT4A 4HJGB 5ANMA 5IIEB 3VCLB 1AJ7H 4OGXH 1S9VB 1JGUL 1KENH 4JB9H 5IMLB 5B8CC 3AU1B 3D1MC 5J1AB 5KBNC 4K3EH 5LGHL 2VQUA 2AV1B 3MLXL 2FRGP 4HIJB 4G80B 3QJFA 3K74B 3AB0B 1XGRB 3W11C 3CCHA 4DGYL 5AG8A 2AJYH 3K1DA 3OAZK 1WWBX 1BFSA 3MMEA 5IV2A 4R9HA 1S3KL 5KVEL 3TZVB 5K9KB 3LIZH 3O3AA 4L4VE 5DD5H 4IGBC 1KJ3H 3OGCA 5JR1H 1YMME 2I9TB 5MEQA 4Z1PA 3VFRA 1MLBA 5T1LB 2NLJA 1JPGA 3HTLX 3V0AC 4QRSB 5IBLD 3EZJB 3OWEA 1XGYL 1X5AA 4NN5B 3DV4B 3KPRA 2OZ4A 2PUQT 2VDQH 4Z0BH 1EX0A 1T89A 1ROWA 4NQDD 4PGDA 15C8H 4DZ8B 1RMFH 3E8UH 2IBBA 4FFZL 4KY1L 2C3HA 4NO5B 5F6HJ 5HD8D 3OKKA 5CIPH 4NRZB 1Q0XL 1QVOA 2YA0A 3MA7B 1SEQL 1NLBL 4QLRA 4CN4A 3K0WA 1KOAA 3IGAB 1NAML 1Q9WB 2WUCH 2AJUH 2YPKA 3DOSA 4S2SA 1K5NA 3FXDB 4LRIA 2YK1H 4S1DD 2HJLB 4NPYA 5CEXB 2I9TA 4NFDA 2P7TB 2HAZA 4LDOB 4ODWB 3TBSA 4X6DA 3U0TA 3BHBB 2P44B 2WINB 5E8NA 2NY1B 4JQXA 3KXFA 1S9WA 4UQ2B 3ECBA 4AIXA 2GHWB 3OB0K 2ZPKL 3P11L 2PYFB 2Q8AL 4EXKA 3ARBC 1MFCL 3MA9L 2J8UE 4R8WL 5D1ZD 5DD3H 1HWGB 2CIKB 1YECL 4NO0D 2VDOH 4I4WB 5EZLB 4X5LA 1VB9A 2CK2A 2ESVB 3SKJL 3AAZA 3MRLA 2FJGB 2DMCA 2FDBP 4HQQL 3VXPA 4YC2B 1MLCB 4M7KH 4JFHE 3H7BA 5E2VH 1TENA 1BBJA 2ESVE 4P3CH 3V6OE 1ZGLB 3NZHL 4HJGA 1MI5D 5ABDE 4KHTH 3SKOB 3ULUD 2AI0L 1J87A 5I1AB 5KN5B 4NCDA 1CTNA 4YHYC 1UXWA 2PN5A 3MX0A 4H8WC 4IRSC 4YAQB 2O5ZH 4F58L 1Z0PA 5DRWA 3BISA 1R6VA 1S7VB 2BSSA 3V0VA 1QKZL 3KPRE 3QWQB 3RDTD 3LEXA 4Y5VB 5EBWA 5IW6A 5KSUA 2GTWB 3BP6A 4NNPH 5I1HL 5I1JL 3WHE0 3MCLH 5DHVB 5J8OA 1MVFA 3I75B 3DV6B 3PGDA 4K7PL 3H7BB 3MPCA 1ZHNA 3CFBA 4DTGH 3IVKB 1N2RB 4NHCH 2Q76A 1XF5A 4QHNA 4ZUWA 3BAEH 5DJAB 3K1KC 2R8SL 4OGYH 3ZE2E 1AXTL 2ATKA 3BFOA 1HH6A 2DMKA 5T33H 3FFDB 3CVHB 1KJMB 3L5JA 1R5WB 2X4NB 3FHQA 1J0YA 1JNJA 4AZ8A 5J13C 3FQXA 1H5BB 2YPLD 1GZQA 2E9JA 4H0IA 4Z7NF 3MGOA 4PRBB 1ZA6A 4RWHA 1YEKL 2VB5A 2M8XA 1AGEB 1G6RA 5L0QC 5I73C 1JPFA 1OAUL 1CR9H 2JKXA 5K59F 4Y2DB 5B38G 2NY3B 2J1KA 1L6ZA 4LL9A 1F6LL 3MRGA 1A1OB 4JCMA 5EU7E 3WIIL 1JUFB 4WFGE 3U82B 4DN4L 1LEGA 5IWLA 4F9LC 1TCRA 1MHEA 5GS1C 5T1DL 4WTWA 3ECBB 4X99B 3QK6A 3PHOB 1Y6NR 1CWVA 1HQRA 3MJGX 1X4XA 4JVPA 2DL2A 3LEYL 1KXVC 3U36B 3OR6A 4AG4L 3GSVB 5GJSL 3D85A 1BIIA 1ZGLP 2APVA 5F7YC 3O11A 2YBRB 5JW5B 4XHJD 4C4KO 3C60D 2FJHA 1PY4A 1HIML 1RU9L 3VGAC 1UH3A 3V5KB 5ECJE 3F7YA 3HPLA 2CDFB 4X7TA 3L3KA 2FLBT 5DMJB 4HZLB 5SX4H 3OQ3B 1UB5A 3HNVL 3SDDD 3NZ8B 5C6PB 2BRRL 2FHBA 3X3GH 4I0CC 1S7QB 2B4CC 5E7BA 3ARXA 3OJDB 4XGZB 4IOIB 1B2WL 3LMJL 3MREB 4R0LA 2VXUL 1KEML 4QOKB 3MMEB 3R8BB 1TJIH 3S96A 3ARZA 1AR1D 4X4ZA 3HNSL 1EEUA 5IF0A 1HSBB 2AEIT 2J8UB 4HWBH 4WO4B 1D2PA 3H2WA 3O45A 2NXYC 4U0RB 3UJIH 4JFXA 1A22B 4QO1A 1JNLL 5T3XH 2YD3A 5TF0A 4B53A 3OF6A 3QUZC 3RVXC 1G7MB 1FV1A 2DQHL 4KI5C 4DOHE 3O6LL 5HDQH 4CMMA 3BH8B 5EIIB 3ZHLA 1LP9F 4UT9H 1K8DA 2RCSH 4HJJH 4GQPH 2BHYA 4R90H 5F9OL 3GLEA 5J6HA 2QSCH 5A16B 4MD5B 3HC4H 1JZ6A 1I75A 2XQBL 2ZUXA 5A3IC 4ZSOA 5D2NC 1F4WL 4PRBA 1DLHB 5SX5K 3PGFL 4YE4L 5D71L 2EKSA 4QTIL 3TH2T 4B7LA 2UY7A 2ITDB 3TFKC 5ALCH 3SPVA 1KXQE 4G7VL 1OF2B 1NAMB 4OI7A 5INDA 1RI8A 1CZ8L 4HJ0D 2W65B 4Q9QL 2QQKH 5I8CB 1KN2H 3VFWB 2NR6C 4GBXD 5IQ9B 4R2GB 1ZMYA 2HJLA 4YFEA 4A6YB 4PRHD 3VG0L 4N8CL 2UWEA 5JR1L 4G6JH 5DUPL 5AUMA 1PGRB 2QLVB 3KXFD 4Y2DD 3FQTA 3MBED 4GT7A 4YDVB 5A43C 35C8L 3DMMB 5SWQB 4M7JH 2FATH 1IL1A 1D6VL 1UJ3A 2P5WD 4JEGB 1BJ1J 4PP2A 3QUXD 3RVVC 3JTSA 1YN6A 1NUGA 2Q8BH 1UKQA 1FNSH 4GXVL 5E2WH 2EO1A 5EU6B 3AAZB 3MRLB 3GFUA 5ITFA 4GBXB 2FEEI 2Y36L 4XWOC 2R4RL 1QOKA 4N8PA 3HAEH 4NQDE 2YD6A 3VG9C 1LHZA 3QUJA 1T0MA 5CJOH 1GAFL 5C8JA 2GAZA 5DD1H 2EDWA 5AG9A 2X10A 1EHNA 4XXCA 3VFGL 4BFIB 5HDBF 4G43B 3HE7A 1B6UA 3DVNB 4JFFD 1J7VR 4IRJA 3QI9B 4KMTL 1XF2B 3VFWA 3ZKND 4E9LA 1RK0B 4JHBA 4KV5F 4NFCA 4HIJA 4B41A 2UZXB 1FC1A 5E5RB 2FZ3B 4P5MB 3ZDZE 4MNQE 5SWZA 2Z31A 3WJJC 1PEWA 5EZIL 1AE6L 1C12A 1A6PA 2BHUA 4KZDL 4Z76B 4NM8H 3OKMA 3KG5A 5DJ6A 3B9KD 1O7VA 1J5OL 1WSST 1YEIH 4WO4D 4RDQF 1P4LB 5SWZD 4WI8A 1AE6H 2X4PB 3TVMC 3GEWB 3OAUH 1ADQL 4PJ5E 2DYPA 3PDGA 5C08D 3FOMA 1KCUH 1GC1L 2DD8H 1L6XA 4DVRH 2WBWB 1IKFL 1MI5B 1NMBL 3BH8A 2DI8A 4K8RL 1MIML 1CD0A 4NM4L 3PHQB 3IXTA 2Y07L 4JFYA 1W72H 1KB5A 3V5DB 4LDLB 1XGYH 1A64A 1WJ3A 3MR9B 4KK5D 4PJBB 3WFCH 1RUMH 1AH1A 5D6CB 4POYA 3T3PF 1EERB 4POZC 3B2UD 5L7XL 5IJKA 4LNRB 4GQ9L 5AD0A 4FQCL 1JNNH 3DXAA 4JY5L 3GB7B 5D1XD 1QEWB 2NY4B 2VXQL 3MYJB 2KZWA 3UTSB 5ID1A 3DHJA 4TSBL 2V17L 4RISL 2IANE 2NXYB 3FO1A 4U0RC 4RAVB 5ANMB 3FTGA 1P84K 8FABA 2HFGL 3QO0A 4PP2B 5B4MD 4QKXB 4Z6AT 4JO2L 5FO7B 3JWOH 3L3JA 4UIMA 4HHAB 3MRFB 3RRQA 1GL4B 1P9MC 4FQLL 3SDDB 3WLWC 3ULUF 3JWOL 4ZYKB 3RWGB 3FN3A 4ISVB 4O5LH 5HYQA 2A0LC 4Y16A 2CKBA 2HT3D 1RJZB 1NCUA 4JKMA 3RWCA 3WS6C 4KJQD 3UC0L 2PR4H 3JWDL 4MZ3A 1UB5B 1AHWB 4XBGA 1IM3A 2YD9A 3LSOB 5IESL 4R4BB 3O4LA 1Y0LB 4M7ZC 2X2YA 3ZTNL 1I3GH 3PWPB 5T3ZD 3FT3B 2VDNH 4OT1L 4X98B 5AZ2L 4R0LB 1IZKA 2FH6A 4YFLF 2GY5A 2VXTH 3BIBX 4NKIH 5BS0E 5EBMB 1VGKB 5D7LA 2LU4A 3B5TA 4L0RA 1HZHH 3GI9L 1PJ9A 5ILTH 1MRCL 4HUMB 1A6UH 3U4BL 4GKZA 2FX8H 1NAKH 2E3VA 3FOMB 4U1IB 3JUZA 2DBJA 1F58H 4J4PC 3V2AR 1OAKH 4M8VA 2JJVA 2VZTA 1JI2A 5E5UB 1XAUA 3QQ4A 1AHWA 4XBGB 3O6MH 1ZEAH 4K3DL 1QLFB 1L7IL 3HRPA 4QRUB 2ERJB 3IDMB 4Y8DC 3PQYE 5F44A 5FCUH 3SDYL 3HNSH 3KYMA 1TZGL 5D96B 1GOGA 3L3OA 5C07E 3H3BC 5JZ7D 4NQEB 3UJIL 1NEZG 3U9UB 2ITDA 4PV9B 1INDH 1J8HB 1ACYH 3EHBD 3INUH 1EA9C 2FHFA 1DFBL 3IJYA 4LVEA 3LKOB 1HN1A 4MQTB 2H26A 3MLZL 1OP3K 1U9KA 2XN9E 3GMNB 5ID0B 1SMAA 5D7LE 1BHGA 4AJ0A 3VDAA 5SWZE 5I0ZA 1G9EA 4GUPA 4PJFA 4I0KA 1DQML 3CFDA 3WFDL 3PDOB 4JM2C 1NFIB 5DD0L 4PJCB 4HKXB 3MFGB 2E6QA 3A6BH 1RZ8A 4Z7WF 1OTTD 1ZVSA 3D48R 1FZMA 5E70A 5E5MB 1U58B 1M7IB 4V1DB 2KWHA 2X1XR 4X7EC 1D5MA 4BFGA 1T5WB 4MVBD 4P4KC 4BFIA 4U1HB 2DQFB 4WI3A 5CINH 3CVIL 1D9KB 2ZKHH 4MXVE 2E6PA 1A4KA 5C09D 3VXMA 2VE6A 1BWWA 1JGEA 4UBDC 2X4QB 1I1AD 3MFFA 4N8CH 4OLZH 5I16B 1OARL 1B6DA 4E41A 3KPPA 5KAQG 5EFIA 4E5XB 5D5MA 3PIQA 4KJYA 1CGVA 5BVPL 3GO1L 3MCKA 1NGXA 4ZTPL 3H9ZA 5JDJA 2XN9A 1KIRA 2LTQC 1QFWM 1R3LB 5I8KL 4DVBB 2X1WL 3RNQA 2ZSWA 5DWUH 4D0BA 1M7IA 4TRPH 5L7XH 2DLIA 5EU6E 4HD9A 5I76A 5CEZL 1C7SA 4M61A 3TT3L 1CFTB 1TJHL 4MQXD 3LS5H 4MNHA 1AQKL 3GBNL 5GRJL 5I0DA 5HI5D 1DQDL 1RPQA 1YNKH 4JZJC 2BVYA 3PWLA 2OR9H 3P77A 4OUUB 1MCBA 3NFPA 5SWSB 2IPUK 4Y2OA 4RRPA 4YBQC 5EC2A 5FUOH 5TE4H 1IGYB 1SEBB 2AK4A 5DJZA 3IETB 3KPOB 1SY6A 3MA9H 1HE7A 3J7HA 3RTQC 5FM8A 3TGXA 2W38A 3P2TA 5E2UH 4I3GA 5TF1H 3OZ9H 3RGVD 1JZ4A 1DCLA 1M7DB 3EJZD 3SDXA 4NNYA 4JAMA 3IJHB 5E8OB 3CH8A 5E8DL 1UM4H 2B0SH 4QRTA 2DQGH 4MD0B 1UVQA 3RTQB 4M02A 3GSNA 4HEPG 1S7RA 2B4CL 3CC5B 2PR4L 3JWDH 3VH8B 4WVRA 4ZOAA 3MJ9L 3LPFA 2VZOA 4KVCL 4PJCA 3LKSB 3T2PA 3UTPD 1LP9A 1EJOL 4XRCA 4M1GH 3AROA 5TE6L 3MXWL 2FECL 3U1SL 2Z35B 3Q6FB 2WLZA 4JFDA 2JELL 5EU5A 1KEMH 4PJ8C 4I48B 3P40A 5L2KD 4JREC 3AC0A 2HG5B 5SX4I 1NC4A 1QBAA 2PYEA 2EYSA 2P8PB 3VXSA 3ULUL 3EOYG 1GGCH 4YJZL 3P30H 2E7CA 5HHMB 3EYQD 5C71A 4L4TD 2V5YA 1T1YA 4RX4A 5D2NB 5E6IA 3SQOH 2BDNH 4LGSB 4OD1L 1UEMA 1S3KH 2BVTA 2DM2A 43C9B 2PTUA 5HY9B 4RDQG 4OFYA 4LLDB 4LPUA 4OFKA 3ILPA 1D9KC 4PREA 1K4CA 3V6OA 1UWEH 1NSNH 1KUMA 5JNYA 1IAOA 4HH8A 1MWAA 3SDYH 3SGKC 5KVGL 3RGHA 1OAYH 5LCVH 3HI1A 2B0SL 3NPSB 1CGUA 1UCTA 4JRXD 3OKLB 4JHWH 4XVUC 3S88L 4OLUH 1CVRA 1FNAA 4V1DE 2ICWJ 3WFBH 1BFOB 5F7UA 4YHNB 3H9SB 5AZ2H 1JI1A 1T83C 1RMFL 4U7MA 4PJBE 2GJJA 1OP5K 3P77B 5J57B 4JY6B 4RMTA 3U36A 1A6ZA 4IGBD 3LCYA 5IT2H 4DK3A 1T1ZB 3MRJB 4OT1H 2R39A 4KI5E 2PETA 4F7CB 1RSFA 2IFFH 5GS0C 3I2CL 4JCLA 2HTLD 3UPRB 3EDJA 5EU3A 2BVUA 2HFEB 3GUTA 4OBSA 1CDIA 4L4VB 1JPTL 4S0SD 4FQXC 4JM4H 3TH4T 5FK9A 1MRDH 1GH7A 2ZJSH 2R0LL 3PJSB 4PJFB 1MFCH 4UT7L 2YD7A 1KB9J 5T5NF 2GTZA 3VH8A 4ELMF 1DBJL 1CGYA 4OCRL 4EDXB 1MSPA 3MRQB 3AXLA 4AM0B 4Y4FA 4S1SL 4YHIB 1T80A 3TBYB 2HFGH 4EZMA 4XWGH 1U58A 1A7PL 1JFQL 3FHAA 4ZTOH 3BKJH 1UYWH 5JDSA 4JN1L 4FFYL 1RIVL 2DQCL 5BV7B 3SOBH 4U49A 1J1PL 4WHYG 1KLFA 4AY0A 4ZXBC 4F58H 4RSVA 1I8MB 3UTZB 2XKSA 3BQUC 5K9JL 1EJ6A 2VAAA 4LP5A 2BSRA 4MDJA 1OCWH 3I6KA 1S5IH 5C0DA 1DLHA 4UT6H 4WTXA 1FG2A 4W68A 5IVXE 3HC0A 3V5DA 1ITBB 1VGKA 1TMCB 3VMPA 3QDGB 5INDB 4NKDB 3C5ZC 2R0KH 3WN5A 2EKJA 3BX7C 1NMAL 3QRGL 4Q2ZB 3MRNB 1S7TB 4UI2A 4PJEB 4LARL 1WBZB 3HCVA 4LKXB 4L3EA 1SBBA 5IHZA 1LEIB 5DXWA 3DIFA 4MXWL 3CSBA 1G7PA 4LSQL 2NY2B 4GW5A 2VABA 2CRZA 1JF1A 3VA2C 4LRIC 4G8GB 2NX5D 1JHTB 7FABL 2AK4D 2CRIA 4MNGB 2DTML 1TTUA 4UNTA 2H8PB 4KQ3L 3CFKB 1BF2A 5BMFL 5IB4B 4G6MH 1HHJB 4LF3B 1D6EB 2R29H 2VZSA 5BS0A 5JIPA 2BC4A 3S5LB 4QXGH 5L6YH 4PJHA 1NGQH 4P2OD 5FUZL 5CD5D 1FJ1B 1TZIA 2HT2D 3G08A 2H26B 5JHLL 1U8QA 4FTVA 4X0KA 1F3RB 4Q9CA 5EC1B 2VDNL 4TUOA 5GGRY 2F19H 1FIGL 2RFXB 3TJHC 4RMUA 4XNMA 4X4YA 3U0WL 3NFNA 2FEDD 3RBSA 4FOMA 4YPGA 2VR5A 3KNBB 1HZHL 4J6RL 2O93L 1VDGA 4WHCA 3FN0H 5KSAD 4L9LB 3L3IB 5JOPE 2GJ6E 4XVTH 3H9SE 2A38A 1EGJH 1GGYA 5HHNA 5IQ7L 3W5MA 5GGSB 3EYUH 1BD2E 3SJVA 3UX9B 1CD1B 3EOAA 4UILH 5L2KE 1U3ZA 4HKJB 3M07A 3ME0A 4XVSH 4WUUE 2NY7H 2ITCB 4XP1L 3C8KA 3VRJB 1EMTH 1U3HB 2APXA 5IIEA 5IHUL 1FP5A 4YE4H 2BY0A 3QG7L 1I7ZA 3MLYH 4J3SA 4Y1AB 2XT1B 2NZIA 5CHNB 1NCWH 3D25A 1N6QL 1YDPB 5IHUH 1N64L 3WSQH 1UB6B 1V3LA 1C8PA 3BEVB 1J0JA 1BVLB 4WW2C 1JN6A 4O51A 4FZEL 4XMKH 3RIFK 4P99A 2CQVA 5KJRL 1A5FH 4H8WL 2COQA 1NGQL 2FYYB 4G8EB 5MHSE 1DBAL 4X6CB 3ZKSD 4QXTA 4ZDHA 3FL7A 3BD5A 2DQDH 4GSDL 2IPKB 3RDTB 3SE4A 2FWOA 3G5ZA 5GGSA 2EC9U 3QEQE 3OKKB 3DUSA 1AKJA 2CRYA 3MXVH 4BSWB 3VG9B 3T0DA 1CD9B 4NO3A 2D3VA 3MRPA 3VXMD 3S3SA 4L9DA 2D0FA 1AC0A 2FSEA 4PRPB 3KYAA 1T0NA 2GKIA 4ZPTB 5K9OA 3ISWA 3CLEH 4NOBA 2ZCKL 1U41A 5L8JB 1A6VL 1QSVA 3O2VL 2C7UB 4TUJA 5DZAA 4Q7DA 5GJTL 3X3GL 1TNNA 4PJIB 2EH7L 3RAJH 3MREA 1R0AH 4JO4L 4DAGH 4ELME 4FABH 3W2DH 3RU8L 1MVUA 5D7LB 1OW0C 1ORQA 4PGEB 5ACLA 1HHJA 3QHZL 4CNIB 1PEZA 2GK2A 5HYEA 1B90A 1HKLH 5FYKE 4XPFH 2F5BH 2G5BB 1NFDA 2D7TH 5DDHB 3ZL4H 5LAXA 5E1HB 5D72L 4M7JL 3DVFA 4M3JA 5ITBL 4G6JL 5DUPH 1S5HA 3T2NH 4KUCD 3BN9D 4NM8L 1ND0B 1KB5L 4NBXB 1KCVL 1H3TA 4GMTL 1T21B 2V2XA 3RIAF 4S1QL 1MLCA 1YQ2A 2PCPB 4MDIB 2EICA 4HC1L 1LEKA 5J4MA 4M1GL 2MQCA 3MRRB 3RGVA 5FGSA 4EI5D 3VRJA 5T1MB 2KWIB 4OZFA 2CIIA 3HC3L 1ZANH 1JYNA 2M26A 2ICWI 5FECA 3RVVD 2P8LB 4MJID 4GO6B 4YZFF 2R0LH 4PJDE 3UTSE 1NFDB 4JM2A 2YZ1A 4Y89A 2ZCLH 2F54A 1MH5B 4MNQD 4X9FA 4EXPX 4PRHE 4NWTH 3FZUD 4PLKD 4JHAL 1MCDA 2PXYA 4Y5XA 1YPZE 3F58L 2PTTB 4ORGA 4RISH 4JGMA 2MOVA 3RUGE 1RV6X 3EOTH 5C0DB 1IL1B 2DN7A 1DTUA 2LQRA 4YFDB 1WICA 5DC4B 5DI8A 3RPIA 3HG1E 5DSCB 1N5AA 1BM3L 1ZA3B 4FFYH 2DDQL 2F5AH 1JWUA 5K93A 5KTEH 1ZLVH 3OG6B 4HGKC 2ZOLA 1DDHB 3ZKNC 4U1GB 4HKZA 5CJ8A 4XHQA 3OSKA 1I9RH 2F8VA 1YMHA 4JFOA 1LGVA 4KFZC 43CAB 4M1DH 2XTLA 4D0DA 4OZFH 1JUFA 5AZEH 2VLLB 3WIIH 4Q58C 4PP1D 2AK1L 3O9WD 4R3SB 1XF3A 4OIAA 1I1FB 4Q6IA 4CDHA 4ONFH 5E6ZA 4LHQB 1ZHBB 5DZNA 4M48L 2B5IB 4HWZB 5JUEH 4PJ7A 4LHJB 2NY0B 4FFVC 3QULB 1NC2D 4KQ4L 1HOCB 3SDCC 1NCBL 4LCYB 2L4OA 4P46A 1F6FB 3ZT6A 4JRXA 2DQFA 1FZJB 4HUUB 1HYSD 2CLZA 3V6BR 1JK8A 1IJ5A 3GUTB 4CKVX 4RFEB 3EYOA 1MLBB 4NRYA 1T2QH 5I15L 4P9HH 1H3PL 4XNUH 5D2LB 3DRTB 1B0RB 4DQOL 4P46D 3T0XA 4POZD 4MNHB 3RY4A 3OX8A 2DAVA 4CGTA 5GS1B 3QZWB 1UT9A 1F90H 1TVHA 3F5WB 4J3TA 4LLQB 4JDTH 5I19L 5KSAA 5D1XC 1WBXB 4OFQA 4R3SA 4P2QB 1QFPA 5I1GL 1OD7A 4MJ4A 5I9QB 1FYTB 1AIFA 3QSKB 5F7FA 4MS8C 2DI9A 1B2WH 3LMJH 2CGRL 1IJ9A 4BKLA 1BQSA 4OD1H 5EO1B 3SHSA 5C0CA 3PE9A 2CRMA 4L8DA 1AP2A 2X1QA 4ZFOA 3HNVH 5T3ZE 2A73A 2JK5B 3WNPA 1WT5C 3VXUB 1JGVH 2CR6A 1L7IH 3Q1SH 4AIZB 4IMKC 3VJ6B 1MAJA 3L95A 5IG7A 4W70A 5HYSG 1K4DA 3DROA 4P5TD 4JFFB 3GMLB 3EOBA 5DC9B 3RL2B 3HAEG 5E08H 5I1EL 3DO3A 5E03A 3ZE0E 4UDTA 1OAZH 1F4YL 2OTWA 3FB6A 5IEHB 2P5EB 4M5YH 3RPIB 5T1DH 4WGWB 3G5XA 2VO5A 3SGDI 1AGDB 1YNKL 3SE8H 1II4E 4FFZH 3BW9B 4X7FC 2R2BB 2P8MA 4P5KA 1FNHA 4YDKL 4DOHB 3W2DL 4N8VG 5HGDB 5LJYH 4HMDA 2GJ6D 4U1LA 4JFDE 5FKPA 5DJYA 1WAAA 5DD5L 5KOMC 3ARGA 4N0YH 4YBLC 3V6FA 4XI5D 2ILLA 1FVDB 2E9WA 3PG2A 2LU3A 4IMLB 4Y88A 4MGXA 4R2GD 2W9EH 3EYFA 1CQYA 1G0DA 3QXDB 3IDYB 5HHMD 1IGTA 1OT1A 2EDYA 4IRZL 4PRDB 4UQ3B 5EU6A 2P5EE 5JNYB 2VXUH 4MWFB 1KCRL 4NBYB 1NL0H 2VXTL 3SKNB 4ETQB 4WW1A 2IH1A 4NQXA 4JFPB 1T83A 1CFQB 1S9XB 4AEIL 4KROD 5C0CE 2B5IC 3LV3B 1DLFH 3UP1A 4NNXA 5LXGL 3DJ9A 3KWWA 5JZ7C 5CJ5A 5E0QA 4XB8A 4LCWA 4FQQA 5J13B 3F7QA 2NX5A 2I5YL 5F88B 3TIDB 1PAMA 2R56H 3QAZB 1UC6A 2C4FT 2HLAB 1JZ5A 3BZEA 5I8KH 4DNDA 1EUTA 3SN6N 3E1F1 3MOQA 2JB6A 1GZQB 5C0EB 1CFVL 1JIBA 4N90E 4OZGA 3KLHC 3T3ME 5CZVL 4LK4A 5EIVA 3S8WA 3DUHA 5D9SA 4LCIH 4Z9KB 1OGTA 2F5BL 5DHVH 3T0WA 2V5MA 3DTXB 2WNGA 4NKDA 4Y2DA 2R0ZH 3EW3B 2D9QB 1N26A 4KDTA 4BZ2H 2IBZY 1H8SA 1JPST 5DD6B 3ARTA 1UWXH 3RP1A 4X6CE 2HMIC 2R15A 4OIIL 5I30L 1ACYL 4LU5L 2OL3H 1CXLA 3K2MC 3LEVL 1OTTC 1JGDA 1LE9A 2VN7A 2FZ3A 1LEIA 5F88A 4WV1A 1TETH 4F7CA 4KQ3H 4ZO7A 5DJXB 1BVKB 3DETD 3GGWB 4PR5A 3N9GL 2OTUB 1ZT7B 3T0BA 3CCHB 4Z18A 1FRGH 1FN4B 5DQ9B 1XMWA 3SQBA 2B1HL 2YEZB 2CUMA 4ZUSA 1JMZA 1MI5E 2EH8H 3LN4A 2ZZUT 3PABB 4WI7A 4X5WB 4Z7QE 2ESVD 5FF6B 4FQCH 5CILH 1WIOA 2WQ8A 1A7QH 3AGVA 2XRAL 4JHAH 1G6RL 1RZ7H 4TOYH 1H3WM 2R1XA 3ES6B 1KJ2H 2V9RA 4X6EA 3ULUE 3REWB 3IFLH 3K2UH 1IAKB 2Z8WC 3QXUA 5F1OB 5B22A 1A6TA 1DVFC 2M2DA 1GPOL 4UDUA 4LCCB 2LAGB 4XC3H 5JW4N 3OAYK 3KHOA 1TJGH 4TQEH 3VWJA 2G2RA 4PIRF 3QDGE 2H9GA 1UCBL 5L2JB 3ULVC 1KIRB 4JKPH 4YHOH 4F3FB 1R0AL 1B4JH 2XQYK 4XP6L 4P2CG 3SY0B 2WZPD 4P49A 4D0BB 3BGFB 3MA7A 1U8NA 3O6ML 5BZDA 1F13A 1I8LC 2YKLL 2WSKA 3O6FB 1KPVA 2VDML 3TBTB 1U3HA 3K8KA 4L1DA 4PJAA 1B0GB 4X5XA 2VZ3A 2D7TL 3BPLC 1MJ7H 1A6AA 1QFUL 4OZHB 2CO7B 5CJQH 5D7SH 5TJWK 1IAKA 5EU4B 1NANH 1U93A 5D93B 2XZCL 4B0MM 4KKLD 3RGVC 1Z0MA 2JCCB 2QQKL 4TTGA 2KH2B 4NBZB 5D70L 3PWUB 1S7XB 5JXED 2CIKA 1NDMB 1LEKB 4PJEA 1CG9A 2J8OA 3KPNA 4X6FA 3QH3A 3WFEH 4S2SB 2VQ1B 4Z8FL 4ONGL 2ZSVA 1I7TA 1EHLL 4WUKH 1MCEA 3LRHA 2Y72A 3HLAB 5ACZB 4HFWA 4OCXH 2DQEH 1C08A 3C87A 4YEFA 2F54B 2YRZA 4X6DB 3U0TB 4C83A 2J6EH 3O2WH 4RBPH 4DCQB 4N68A 2V17H 4LSSL 4JPWH 2OP4L 1DQJB 2ZNXA 4DJMA 2QADC 4F37F 1YEHH 3OJVC 3N1GC 3U48A 4WV1B 4FQXA 4MNGA 2IFFL 5T1KB 4ZFFB 1BZQK 3L3IA 5GGVH 1BFTA 4OM0H 1G7LB 4G7VH 5HYFA 5ITFB 3QDAA 4M6NH 5HHPA 3Q5YA 4PJ9A 4WWKA 4FZ8L 3UTTD 3GSWB 1OT2A 1XGTA 2GJ6A 1HXMB 3ARUA 5FO8B 3QH3B 2E27H 2MWCA 5ALCL 2ED7A 1N64H 3D2UD 1I7TB 5TDPA 1QFUH 1ZVHA 2X7LB 3UZEA 2NXYD 2DWEB 3V9FA 3GSOA 2D4DA 5HGAA 2XWTA 4YNYB 5GRUH 3QUZD 3RVXD 4XGZA 2PXYC 2HT4C 1I85C 4J1UA 1PG7W 3BP4A 3LHPL 1WCBA 2BNUA 2FBJH 4XNZC 1RZFH 4O2CA 1A7OH 1AHWC 1OLLA 3B83A 1EBAA 1S7UB 3UAJD 4FS0A 4IIQA 1ZA6B 3QEHA 1U2HA 3P0YL 3OKEB 1AXSB 4JFPA 1CFNA 3QHTC 3VFVB 5HXMA 3PGCA 3KWWB 4ZS6D 1NMAH 4EBQH 4HJ0C 3O9WA 1MJJB 3CK0L 3O81A 2DQIL 2IC9A 2WBJD 1YEDA 4JRXE 5GS0D 1KJ2L 2HTLC 4ZUVA 3QXTA 4YHKL 5IGXH 4EBQL 4JO1H 2PXYB 1N6UA 2BCKA 3WIHH 4OZIB 2W0FA 5MERB 2BY3A 2A6JA 3KJ6H 1FHGA 2H2SC 5J56B 1OGTB 1LP9E 4JPIB 1QZ1A 5IJKC 3S37L 1LK2A 1ZAGA 4BJLA 5EBLB 5A2JH 4HUXA 5CUSL 4HIHB 3GK8L 4YFLI 3IXAA 2I5YH 2H1PH 1X6NA 4HFUH 4YC2C 1YEEH 2WZAA 4LSVH 5KSBB 4J3UA 5I8EB 5DO2D 5HHOE 1IT9L 2BVOA 1AD9B 2VH5H 4ZFOL 4FRWA 3GI8L 4OF3A 5C9KA 1BPVA 5C0CD 3UXFA 5T5NG 5I17B 1IGFL 3FB8A 3JWNC 2C1OB 2WV3A 4DVBA 1JPSH 3GLDA 4PS4L 1HCVA 2XZCH 3BQUD 3GSWA 1U2CA 2VLRA 3IDIB 1CLZL 5C08B 2EIZA 3DRQA 2MKLC 5HGDA 3CU1A 5DLMH 4HGMA 4P2OB 3RWCB 4QRPD 5D7JB 3TIEA 3BQUA 4P5TA 2HLFD 3NZ8A 1MH5A 4Z7VE 1RK0A 2MPAL 1NCAH 3FT4B 4Y1AE 5IVXA 4OGZA 2XN9D 3ARPA 5EIIA 1X7QA 4QRRA 5KG9B 1T3FB 2XFXB 5DFVC 3O8XA 4GMSH 1S7RB 3CVHL 4MJ5A 4D9QE 5T33L 5FO9B 4HMCA 1CGTA 3FFCD 4DGVL 4WGVB 5DYOB 2XKNA 1JHLH 3CX5J 1P7QD 5DSCA 1I9RL 2HVJA 1OSZB 5DJ6B 4WO4A 4O02H 2GJZA 4KVNL 3TEUA 3SKNA 4ETQA 2YZ8A 5D70H 1YQVH 1BQLL 2P5WE 1M7DA 3LB6D 1U3HD 5GGTA 3UTOA 4JN2A 4ZAKA 1VFBB 3BZFB 4K94H 4OLVH 4PB0L 1TCRB 5CMAB 5IHZB 3HUJF 4QRQA 4HWNA 1N0LA 2B39A 2XRAH 3T0EC 3ZDXF 3ZKXB 4I9WD 4PY7B 3GSNH 4U1KB 1ORSB 4ZXBA 3QNXA 3MUGA 1TJHH 3VFMB 2BVQA 3QNZA 3WDHA 3SGJA 1KCSL 3QDMB 2NZ9D 1I9JL 4GAGL 4PJXE 5DRNB 1F5WA 4GRWB 1T4KB 4DKFL 4AEHH 5EZOH 1YPZF 5IJVB 1CF8H 1XF1A 2I9LB 3LKQB 5JO5B 2XACC 5JXAL 5DUML 1MCSA 3KPRD 1O0VA 5DLML 2XTJD 2MQ3A 4NHUA 3TJHD 5C6TL 4GRLB 3P9MA 3GMPA 2FEDC 1IARB 3HPLB 2CLZB 3C09B 5DK2B 3D9AH 1WV7T 4UTAL 3WN5C 3FQUB 5F7EL 1NJ9B 3QIWA 5C07B 1YY8B 3P4MA 5E8PA 4ODUA 5E8EB 4M6OH 1MAMH 2H32H 2F8XC 3VFPB 2E5EA 5EA0H 5F8QC 1BQUA 2DS4A 2IEPA 3GJFA 3HG1A 5I66B 1YZZA 3O2DH 4Z7QF 3MUHL 4YO0B 4BFBD 1D5BB 1NBQA 1CI5A 3DHMA 4JRXB 2LVEA 3MV9B 4P4KB 4PJXF 3O3DB 5EA0L 1H15B 5IB5A 1XCQB 2YEZA 3JZ7A 3OG4B 3NCYP 4I0PB 4R96A 4PRHA 5D1QC 3DBXA 1FC2D 1B3JA 5ITBH 2V2WB 5BVJB 4G43A 1WFNA 4TSAL 2MCPL 1SVCP 1FE8H 3NCCB 3VMNA 1YC7A 2VDRH 1Y0LA 4HF5L 3ULVF 1ZANL 2H2PD 3DX8B 3L3GB 3LQAL 3KPSE 4PJ5B 3BD3A 1HHIB 3NPZB 2VRAA 4ERSL 2J8UF 4Q0XL 4X6CF 3VI4E 4Z7WA 1FZOB 4P5MA 3CK0H 2OTWB 5SWZB 3SCMD 1J1OL 1CFSA 3CDGA 3D5OF 4L4VD 4I2XB 3SGDH 5CEZH 4OZGB 4F3FA 2FHCA 3VXSE 4YHMH 4OFPA 1HNFA 3VFVA 4YDIH 5GGTL 4K23L 2X70A 4KKBC 4UAOC 2DJ4A 3IF1A 1WBYB 4KUZH 3D0LB 5GIRA 1CDJA 3Q6GL 1N59B 3ARGB 25C8H 4J3WA 4HUVA 4ZG1A 4PY7A 4NQUA 1JCKA 2YSSB 4YAQA 1Y18B 1QRNE 5E4EC 3ZE1E 3GHBL 4BH8B 2Y4SA 4OGYL 4B5EA 3BGMB 5DFTA 3OKNA 1U93B 2VLRE 2BXZA 1M05A 5BO1L 3TESA 1FZOA 3BW9A 2DKUA 3T2QA 3B9KA 1SEBA 4PRAA 4RMSA 5JIIA 1SVZA 3TM6A 3MLWH 4ZPVB 1FL3A 3RVUC 1UM6H 4BSVB 4PLNC 3ARYA 4LEXH 1ZT7A 4JG0L 3GMPB 3MV01 4U6XB 1MJUH 3SKMA 2IQAB 3PXJA 5D7IA 1KN4H 1MCWW 1I8MA 4HFWB 4WCYL 3JVGA 2IF7A 4BH7A 4JAMB 4RAUA 5CSZB 4C59B 4MVBC 1PZUB 4PLOB 4U31A 3GSNB 4LCWB 1XIWB 1R5IB 3BKMH 3WEXA 1OAXL 1A6WL 5EPMA 4P2QE 2GIYA 4S1DC 3MV9A 1T1XB 4WEBL 1YNTB 2VLRB 5CCKH 1EVUA 1DANT 3G6JB 4V1DA 4PLKC 4YWGL 3WL9B 1CLOL 4TVPL 2UUDH 3IB4A 1RUQL 1HHHA 3MV9D 1NCWL 4XXDA 5I74B 2FGWH 1WZ1H 3M1BB 4U1JA 1KCKA 3S37X 3EKCA 2WIIB 4UUJB 1MCJA 5EC1A 4I3SL 1ADQH 4NRXA 3HE6A 1WEJL 4DN3H 5HGAB 3IT8D 4EDWL 5E4IA 3DSFH 1W8NA 2XFXA 5I1LA 1IKFH 3V4UL 1N6VA 5E6IC 1NBVL 1QACA 5IKCA 1IC4H 5C0IA 5GRUL 3MXVL 1NGXB 1HEZA 2W9DL 4BQ8A 4P2QD 2LFGA 3B8YA 5ID1B 1F3DH 4OIBA 5C0RH 1VFAA 1TZHB 3CU7A 4HCRH 2A83A 4ZO8A 1KLUA 1VFBA 1FPTH 1KTLA 3BZFA 1FH5H 3B5HA 4PV8B 5FDWA 2OSLA 3TC9A 3QCTL 3RTQD 3MV7B 3P4OB 4JJ5A 4I18C 5TQ2H 4YQXL 5ACZA 4XPAH 2ATPB 3CX5K 3WKNA 2ZP0T 3ARGD 4YPJA 4JFFE 3TCXA 3OPZL 4AENB 4OM0L 4KTDL 4RWYL 4DCQA 1AO7A 4HCRA 4TQEL 4PGDB 1I7UA 4ONOA 3EJZC 1JGUH 1C5DB 4UIMB 5I1LB 1NCAL 1Z0NA 3KYMB 5DMGC 5C86A 5IEKA 4YXHH 2W0FB 4PJGE 1K8IA 2NPLX 4XVSL 3CX2A 4KRLB 3EJJX 4FP8L 2IH3B 2L0DA 4HC1A 5F9WC 3ZKMC 1TZGH 2X5PA 3MV8D 2QSQA 4IEFB 5FV1L 5HHPB 4PJ7F 1VENA 1R3HA 5HHXH 3OAZH 1KG0A 1E27B 3MGTA 3NCFB 3IXAB 1ZEAL 3X13A 3DYPA 2UVFA 1QUNA 3DSFL 4NQVA 1KPVB 3TBTA 1DN0A 1OARH 3T08A 3RZCD 5F1IA 3KPMB 3X17A 5KVFL 2ARJQ 3DURA 4IHOB 4LPVA 4HG4K 1JV5B 4NP4L 1NH6A 2PYFA 5IVOA 3QZWG 3DGGB 1WBXA 5FUCE 4LSVL 5L8KB 5FAAA 1AY1L 1KCRH 4TUJB 5ESQB 1DBMH 3OTTA 3FB8B 3U7WL 2XZQL 2X9WA 3HC4L 2AXFB 2FO4B 3QDME 5L2KA 1TITA 4MHHI 3BOVA 4UOW0 1F4WH 1RZIA 3SDAC 2IPTL 1JZ3A 5I1DA 1IGCL 2P46B 3SKOA 5JMRA 3OKOA 4N5UA 2ZJSL 1IBGH 2C3XA 2AXGA 4XP6H 3V0WH 4ZPTA 1CFNB 3MNZB 3ABZA 5FCSH 3GM0A 3QBTB 2HH0L 1OB1B 3DYOA 3VH8G 5IVXB 3CSYB 1J05B 1OHQA 4TPRH 4WU5B 4WI2A 3CXHK 4NN6B 3P73B 3HAEB 1J0ZA 4XZUA 3IKKA 3TBVB 3BSZL 3LN9A 4URTB 5JA9A 1K4CB 5JW3H 3VXUD 2IALA 4JE4B 1ZLUK 4L9LC 3OAUL 3IDNB 4PRPE 2PCPA 4HBCH 4M3KB 3FMGH 5BJTB 3C5SB 1HXMA 5F96L 4S1QH 1NDGA 1FE8L 4I1NB 4YHLL 2UWEF 1OD9A 4R2GC 4OF7A 3GHBH 2L7JA 3L5WA 1F42A 4C54A 4XPGH 1A3RH 2XA8H 5CLWA 3P4NA 3QEUA 4OLWL 1AR1C 2UZYB 5T1KA 2XXCB 3IJSB 3QJFB 4NZRL 4V2BA 3IDUA 4KTYA 5D8JL 1I3UA 3BPNB 5EBMA 3IETA 4G8FA 4HUWA 3GJEA 3RWDB 5JHDB 1QQDA 4JKWA 2VLKA 2IQ9H 1DZBA 5T3XD 3MNVA 4U33A 2BNQA 5HHOB 3QXWA 4LASL 1R3HB 1TJGL 5TH2A 3QEGH 5B21A 1B0WA 2LE9A 4QWWD 2JF1A 3VFRB 3QI9C 5CS7A 4ETYA 2DYPB 3FRUA 4KWUA 3RJDA 1A9BB 4YWGH 5CSZA 1WZKA 3PJSA 1TCMA 2XQBH 1EO8L 1C16A 1SBSL 3TFKD 4CU7A 3OXSA 3S36L 2AAVA 5DURB 4EDXA 1V7NH 4DZ8A 2W07A 1A8JH 1ZHBA 3BZ4B 1AI1H 3UBXB 4U6YB 43C9A 2OK0H 1AXSA 2OJEB 5EOQH 5D9SB 3Q5TA 3MBEC 5JXEA 3O2DL 5IW6B 4BQ9A 4I0PA 1FBIL 1MJ8H 4XNXH 2KUTA 3L3KB 1MJUL 2SEBB 4KZEH 3HE6D 1ZVYA 5F3BB 1FVCA 1KPRB 4I18B 4WCYH 4XWOD 1CXHA 4Y4KA 2HFFA 3ALPA 5EOTB 1DQLH 1ZLWH 2D03H 4U1KA 3KXFE 1BGXH 4Z7UF 5C6TH 1M6OA 4HCRL 5DRXB 5I19H 2AQ1A 4N0UA 4KRPC 4I2XA 1IEBB 1IAOB 2FWOB 5F7DB 1FAKT 5C09B 4WWKD 1LMKA 4W6WB 3PL6B 4Y19A 3HI1B 1MFDL 3QUMB 2QQLH 3FONA 4TTDD 1FSKC 3RNKB 1FV1B 1WBZA 1DVFD 4JFED 4M62H 4HH9B 5C09E 4FMFA 6CGTA 4YHML 2VNCA 5HGGS 1A7RL 1A4KB 1WLHA 4BUHA 4YHZL 2QQLL 5GGTH 3FO0H 4XVJL 4XAKD 5F3BA 1FYHB 1HDMB 3B9KC 4LEOA 2FEEL 3D3VB 5I74C 1C5DA 4NGHL 2Z1PA 4PJDF 4WO4C 1NPUA 2AK4E 1T1ZA 4LCCA 5LWYL 4PJHF 4CMHB 4OV5A 4HS8H 5EU5B 1MNUL 3EFFB 4Q9BA 4ONHB 2XYCA 5IK3A 3M8OL 3RQ3A 1INQA 4XC1H 4E0RA 1IEBA 1QTYT 3EDFA 2DIAA 5JLZA 5J6GB 2MQ0A 2NY1D 3IFNH 3UYRL 2AKRA 4HXBL 3MV7D 3O6KH 2A6IB 4PTUB 2AV7A 2QKIA 5LKNA 4IIQC 1BAFL 3ELAT 1DSFL 1T2JA 1DQTA 3QEQD 4QEGA 3IU4L 2B7DT 1IC7L 2FIKA 1CIDA 3HZMA 3F65A 2MCG1 1G7JB 1ACZA 5M7QA 3PWJA 4KHXH 3ULSB 3RWHA 4OZHE 3VWKC 4LQFH 3SKUD 4H20H 4JDTL 1EHXA 2WUCL 1BZ7A 4OLXH 1P4IH 4QT5B 2KPNA 4TULH 2P43B 2X4OA 3B5GA 3I84A 3KS0H 3GJFK 1G9NC 1ULVA 1KF9B 1DN2A 2P42B 4HT1L 3T1FB 2ZCLL 5E9DB 5C8JB 4ODTL 5HVHC 1Z2KA 1YECH 3EBAA 3GRWH 5H37H 4L3CB 3RX8A 3VFSB 5IVXF 1CL7I 2APBA 5B39G 4Z7OE 3VWJC 2W92A 4EJ1C 1T7ZA 3VXNB 1MPAL 4HPOH 1KACB 1FL5B 1NLDH 2VKWA 3S4UA 3PP3K 5DVMA 4ZSOE 5FB8B 4R97C 3BWAB 3VGGA 2VLKE 3LKSA 5ETUA 5CKAA 4LHUD 1MWAL 3AVEA 3V10A 1KT2A 5IV2B 4ELKA 4MA1B 2ADGB 1D5MB 2W65A 1RD6A 4R0LC 3LV3A 1KTLB 1IGMH 3V79C 4HPYH 5F9DC 4LHUA 4XBPA 1KCLA 4QF1A 5DTFA 1G9MC 1DQDH 3MBEB 5F7WC 5HDBE 2N7AA 1T1YB 2NXZD 1JZ2A 1T04B 2DLFL 3MZTA 3PXHA 1G7PB 3D9AL 5J1AA 2IBGA 3RIFF 5TPWH 3W9EA 1AJ7L 4OGXL 2ZKHL 5GGUB 3NTCL 5TE4L 5SWQA 5DJ0B 5IBLC 4JKKA 5GRJH 5HI3D 3GMRA 3I02A 4ZOCA 4UILL 2FX7H 4YLQT 1H0DB 2H32B 3GSQB 5JDSB 5EDXA 3BN9C 5T3XE 3DTXA 4U6VL 4FTVE 3UCRA 5BVJA 2WBJC 2I60H 4IOSD 3QWOB 4GW4A 5F1NB 5D2LA 2JJTC 4O9HL 5T1LA 1Z3GH 4XCEB 3LKNA 3BE1L 4PJCF 2EDHA 1QLEH 1N5YL 4EI5C 2G60L 2G75B 2Y5TA 4KKNA 4IHOA 3HC3H 2H2SD 2FIKB 1WWAX 1YQVL 2VDPH 3MRCB 1FYTE 4DKEL 4JVUA 2DM3A 4IBLT 1F00I 3KPSA 5A16A 4G9FA 1MIEL 4O02L 1IEHA 2R29L 1IT9H 3INUL 5K9QI 5GZNC 2HJFB 4XTRD 3QUYA 2BHZA 1J0HA 3T1FA 4OB5L 4WWID 3IGAA 4KDVA 1HEZB 4HS3A 5T3ZL 5GQBA 3QA3B 2X44D 4JM2D 3ARVA 5EULV 4CN6A 1NAMH 3WYRA 4ODVH 1K85A 3JWOC 4NN7B 1BLNA 5ICXB 4O2EB 4MA3A 5I1CH 1BQHB 1A6TB 4G6FB 4UTAH 5E7FA 2PYED 4KKAC 4OZHA 5MP6L 4P4KD 3EO1A 2BOBA 5DI8B 2IC2A 4AM0A 4PJ9C 3OGOE 4LSTH 2ESVA 3WO4C 2BOCB 1FNGA 3HZYB 2ADIA 1BJMA 2BRQA 2D7OA 3KJ4B 5F7DA 2RR3A 2NY2C 2QTEA 4JFDB 1LNUB 5LBSL 3KHQA 2IH3A 4GKZB 1P4IL 1ZLUH 4M5ZL 2FR4B 4XVJH 2ADJB 5DFVD 3QB7C 1LO3L 4L29A 4XBPB 2CK0L 4LBEB 2AP2A 4JQVC 4KKCC 4QXGL 5EUKB 3R8QA 2BJMH 2EIDA 3BJ91 4XAKE 3BRFA 1HYSC 3HE6B 4Y4HB 4DEPB 5I15H 3DXAE 2YUWA 3IDMA 3U7YL 4N0RA 4PGBA 2EXYD 4P46C 2Q3AA 2R0KL 5GISH 3JV5A 1MRCH 1S7XA 3SE9H 4QRPB 3SCMA 2DM7A 5GJTH 2OX5A 4M7LL 2ZCHH 3NH7L 1JF5A 4X80H 5J6GA 1LO5B 3C2SA 3DV6A 3PGDB 2ZNWA 3X11A 3RVWC 4FI5A 1JPFB 3O3EB 4IRJC 4R7NA 3TNNA 4N9OB 5T5FH 3B4NA 2BZDA 1SHMA 2Q87A 5GS2H 4GFTB 4OSUL 1MFBL 3MRBA 2OZ4L 3JV6A 4N0CD 3VE0B 3PP4L 3HI5L 5ANME 4YHZH 1EFXB 3QNXB 1KELL 2QR0B 3STLB 4FZ8H 5DRNA 5KVEH 1REIA 3HI5H 1O5DT 3BZ4A 3W82A 1ZVSB 5FYLH 1PVHA 2K1MA 3NIFF 2DQCH 1E4XL 4UB0L 2X4UB 4S1SH 5FEBA 1FQ9C 4U3HA 1DL7L 3NMEA 1RJLB 1LILA 5C2UB 2FSEB 1VADA 1OTSD 4S1RL 4C4KT 5A2KH 1T89C 3D18B 3EDEA 4YZFE 5DK0B 4HK3N 1CL7L 3DI3B 2QSCL 4PG2A 4X7TB 1KNOA 2NQCA 3QE5A 2ICCA 1QSZA 1VACB 3MC0A 3P4NB 2AABH 3QO0B 5C0BE 2LVCA 3JVGC 2EEDA 2XTJB 3UTTA 5D1XA 3DVIA 4NSKB 4PJ8D 3SDDC 2KBGA 4XI5C 3KJ4C 4XBEL 1IC5L 3V4PL 4Y4FD 1QP1A 2ZUVA 2ICEA 4JQIH 4U3XA 4HWZA 4G6AD 4QOKA 1KULA 1HCFX 3W5NA 1DDHA 5IB5B 4MB4A 5FYLE 5CZVH 5JOFA 4OF5A 3PL6A 4Y19B 2FH8A 4FXKA 3A6BL 4NQVB 5CP7A 1S7SB 2JCCF 4Y16B 5K33A 1X44A 4BQ6A 4M43L 4P23A 4EUPG 2A1WH 3SCMC 2VXQH 4D0CB 5D6DC 1GPOH 1YEDB 1BJ1H 3I9GL 3O0RL 4RFOH 1G7MA 4LCCC 4OD2B 2DQJL 3W9EB 1NCDL 3T8XB 1WZ1L 1DEDA 3MUJA 5GS1A 1BEYH 1I8IA 2AJ3B 3K7UA 5DJDA 4YHOL 4XT1C 2RGSA 1CLOH 1ZHLA 4KKBD 5FFLA 3PWVB 3TBVA 2VAJA 3EFDL 3TWCL 2A6KB 2D9CA 1JHKL 1P53A 3BYTA 3QHFH 1RZ7L 1MWAH 1I1AB 1FRGL 3GBMH 1KGCD 1XZ0B 3N1MC 5F8RC 2Y6SD 2J8HA 4EI5B 3WS3A 4KU1A 5I1EH 4Y19E 3BKML 1JTPA 3TA3D 3QG6B 4Z7VF 4TNVK 2NR6D 4MZ2A 2V5SA 4Z78A 3ALWA 2V2TB 3O6KL 5FM5O 2UWEB 2GITB 4WI9A 1U8IA 3GMQB 4XRCB 4QHLB 1C5BH 1UCBH 5EUOE 1FLTX 2EDFA 2VR9A 4HWBA 4Z8FH 1BZ7B 4QT5A 3S35L 1SJHA 5BRZB 2HFTA 3KDMB 3CAFA 2XN9B 3NN8A 4JM4L 3DETC 5ESVA 4TULL 2EYSB 2P8PA 2P8MB 4DW2L 4PRNA 3O11B 1CN4A 5ALBH 1DBBL 3S4SG 2HP4A 1N4XL 4KMQA 3WD5L 4NYLA 2W9EL 4KTEL 4RCAA 4GUPB 4ZO9A 2DLEA 4GKNB 4FQXB 3OXSB 4HDIB 1CBVL 4G8GE 2OZ4H 3CFJA 4PPTA 1CLCA 1OGAE 5DZOA 5BRZD 2F53A 1E6OL 5ESAA 1HQ4A 1QHPA 5EBWB 3NFPB 3QUMH 2B4CH 3MGOB 1MHHB 4GAGH 4E41E 3UDWA 2Z31B 2X89A 2YWYA 3NPSC 4AH2B 5DMIL 2QSTA 4KC3B 5IBTL 4HKJA 4P2YA 4L29B 5TFSL 4XPAL 2OI9B 4ZQKA 2KQNA 1IRAY 2J5LB 3ULVD 4U1MA 3MV8B 4XX1G 3V6FB 3UTSD 4PTUA 3OB8A 4OD2A 4NYLB 2MHAA 3HS0A 3KAAA 1H5BA 3HUJA 4NC1C 3S98A 1I8IB 4X99A 4L8BB 3QXAB 3FO9A 5F89A 3BJLA 2AGJH 1AGEA 4NZTL 4BKLB 4MD5A 5F9AC 4CUCA 4Z76A 4MXQD 4NKOA 3MROB 1IAIL 1MUJA 4GKOA 4YDIL 5L2JA 4KK5C 1H3UA 3JXAA 4KJWD 3LQZB 1UZ6E 3SGJC 2Z35A 3Q6FA 1X5LA 3QWOA 1AR2A 1I1AA 2PW1B 4J3XA 2CD0A 5JQ6H 5JW5A 3CDCA 3B2UC 1DANU 3KLAB 2CGRH 3SKJH 1FVCB 1KPRA 4I18A 5DMGD 3DROB 5DHYA 4JREB 1EO5A 5SV3A 1B0GA 2Q8AH 2XZZA 4TVPD 5JIKA 2EDLA 3CVIH 3TF7C 3AREB 1AD0B 3PF2A 5F9JA 1L0QA 1U8MA 4Q6IB 3OJDA 3U79A 1AO7B 5IMOB 4NFBA 4RGMC 1KIQA 2ARJA 2R4RH 4Q9RH 5CD5C 2C3GA 3FO9B 5F89B 2F58H 3E3QE 1UJ3B 5E08L 4CW1A 5CP3H 1KB5H 4R4NC 3RZCC 3T0EB 3ZKXC 4QHKI 2F53E 1X5FA 3AUVA 4NZRH 2E7BA 4EIZC 1B4RA 3C6LD 2WM0A 5C0FA 4X7SL 3F12A 2W0LA 4H25A 2MBGA 3N85H 5FYJL 5GS2D 5KSBE 2JIXD 1ZLSH 2J3SA 1P7HL 1AC6A 3DX7A 5I1GH 1EHAA 3GIVB 1QSFE 1ES0B 2A0LD 1F11A 1RZJL 2EYTA 3QI9A 5D1XB 1G7JA 4ODXA 2XIDA 1UACL 5DRZA 5FO7A 1UQSB 5LGJA 1DQQA 1HKLL 2HWZL 2KZ1B 1ZS8B 3HZYA 5D1QB 1H8NA 1MHCA 1WIPA 1HSAB 3WE6A 2K7PA 3VGEA 2WAHA 4IDJH 3RZCB 2Z92A 3T0EA 1DUYA 4ZPVA 4K9EC 1Q72L 3FXEB 4H1LH 3SO5A 1BD2D 3UAJC 4GAJH 1GGUA 4X4XB 3TYGH 1FNLA 4WUUD 1X5ZA 3WKML 3LKNB 4RNRA 1GOHA 4JZNA 5E95B 5J9PA 5ELIA 4FXLA 5JUEL 4C56B 1IM9B 3U0PB 3D39B 3UBXG 4X9IA 3LDBC 4KVNH 3GJFH 4NQCD 4DUXA 3LOWA 4ONFL 5D7KD 3A67L 4PJBA 4YDKH 3NCJL 3GSUB 4YHIA 1N5AB 1OP9A 3LQZA 1AGCA 3VXRA 2OS7A 4RX4D 5MEOA 3IDNA 3W39A 1GJIA 2UY6A 4NKMB 1BBJB 4NHCL 1T0MB 3RPKA 4NNPL 4U1IA 5E2JA 3WBDA 2DQJH 2QBWA 2Q6WB 3VXRD 1X4YA 3QG6A 3DMMA 1K2DA 1PW3A 1T2QL 3FQNB 3FQRA 1EIBA 1X5IA 5HYJA 5B3NA 1RU9H 2C5DC 1LQSR 3X12A 1FAIH 3QIBB 4JZOB 4F7MB 3V5HA 1KB9K 4JANA 4HMEA 4OZIA 1S7VA 4ELMA 3QIUB 3D39A 4OCYH 4QGTA 4IJ3B 5DQ9A 5HYJD 4L8CA 5GXBB 4O2FA 2EECA 5MENB 1H0DA 4NJAL 3CH1A 1QVOB 5DO2C 2VL5A 2VUOA 2JJSC 3NN8B 4NHUB 2C1PA 3MZGB 4JO2H 4LP4A 1AMXA 2VDOL 1KJ2A 4G5ZH 3UTQB 5HHOA 4XMLL 2C3VB 1JK8B 5F7EH 3MLTA 4P3CL 4XNXL 5CJQL 5CD3B 1EHLH 3QEGL 4KXZH 1PSKL 2HRPL 3HI6H 1JNHB 3QEQA 1L9MA 4E42B 3GMRB 3U7AA 5HYJB 1YPZA 1OWRM 5GPRA 1U6AH 3EO0B 4GW5B 2AEWA 1UQSA 1WITA 3MRIA 3RWFB 5D6CA 1CICB 4HS6A 3QQ3B 2WWKO 1AFVL 3KPPB 3GIZL 2ICEB 5J11B 1KC5H 4HXBH 2VLRD 1DEEB 3LN5B 5E5MA 3O3BB 2JTDA 3WHXB 2BSTA 2CDGA 4XVTL 2QL1A 4R96B 1P2CA 2BC4B 1UM5H 1RULH 4RQQB 5DD6A 5TDPB 1Z6JT 4HWEH 3GMMA 1A6AB 1JMXA 4PFEA 4L3AA 1XGPA 5DT1H 3VWKB 3EYSL 3QQ4B 3B6SA 3TN0D 3NFNB 1CXIA 1FO0B 3V8CA 4NUJA 3P9LB 2RAMA 2A74B 4PLJC 3P0VL 4LDEB 2JJWA 1ORQB 3FMGL 3MRIB 2EYRB 4ALAH 2AERT 1AQDA 1XR9B 3TP4A 3V52H 5D2LF 3WO3B 1A4JA 1FN4A 4HLJA 5FGBC 4MA7H 1DEEA 1JE6A 2H41A 4S10A 2KQMA 1IAII 5H2BB 4P23D 1GYAA 3UMTA 5IESH 3CLEL 2AJSL 1FFRA 3FO1B 4NN5C 2E7LA 4MA3B 2OR7A 1S78C 1H7CA 3V95A 2MJWA 3GBML 4LAQL 4XBEH 3FCTB 3V0WL 3QCUL 1RZFL 2BVQB 3QNZB 1FLRH 4LGPB 1KC5L 4PS4H 3MV8E 1UM6L 3KPQA 3UJTH 4K9EL 3DPBA 3ROOA 2HRLA 5C70A 1IGYA 3QIUD 4OF8A 4K7PH 4OV5B 1EMTL 4OCRH 4R8WH 1IGIL 3UJTL 3BSZH 2BERA 3BEWB 4D3CL 3I9GH 3O0RH 4XH2B 5IFJB 1A02N 1E28B 1XGQA 1N6QH 5AWNL 2OXGA 1F6AA 1MJ7L 5AYQA 3T2NL 3OHXA 1NEZA 3FT3A 1OOAA 4KH2A 3LS4L 1VA9A 4JG1L 5D1QD 2YUXA 3VG0H 1F2XK 4FQQB 1UXWB 4O9HH 1ZOXA 3AMKA 4X9GA 2BJML 5LXGH 1WWCA 1JWSB 4CADB 1E6JH 2NXZB 1CICA 3C2AH 2I60L 4I3RL 3G6JE 3V7MA 5D1QA 5DVOA 3DNKA 5GGRA 5H94A 2AJ3A 4GLRI 1F02I 5GS0H 4QXUL 4GKSB 2CDEA 2VMFA 1GZPA 5EOCJ 3WFCL 15C8L 1L7TL 5C3LD 3T65A 3QPXL 1DBML 4KGJA 3RKPA 1HHHB 1X5HA 3A67H 3I6LE 4YK4B 4DZBA 5DMKB 1BD2A 3K4AA 4WENB 3REVB 3I75A 2NY0D 3C6LB 2D0GA 1RUKH 1J18A 5L6YL 3QUYC 3IFOA 3H7LA 2O5XL 3B2VH 1EFXA 2IAND 1A9BA 4OUOA 1V3KA 1QO3A 4NQTA 2NCMA 3HS0B 3QXVA 4TOYL 3EZ8A 3NACL 1T3FA 5SWSD 4HIXH 3KVQA 4YXLH 2W9DH 2ZUQC 2ICES 1HKFA 3RIAK 4KK8D 3HHRB 1BVKA 5C0RL 1MCWM 1T6WA 2X89D 4R90L 5F9OH 2CUHA 3BIKA 4GAYA 5SWSA 3VXME 1ERNA 2AEPL 3IJYB 4GG6E 4HIHA 3KYNB 2FGWL 5I6XC 4NKMA 2BNRE 1NC4D 4NO3B 3VXSD 4MD4B 4CDGC 3WIHA 1NBYA 4P3DA 4QXWA 5DUBB 3MRDB 3X14A 1R5WA 4MA1C 3CFDB 5GRZA 3P4LA 5FUZH 3ARBA 4GAFB 3FCTA 1JZ7A 5IOPB 2ICWA 1Q8MA 3RWEB 2EEBA 3V5HB 4JY6A 2GQHA 4RBPK 3U1SH 3IAQA 2Q20A 4G6ML 4Y4KB 3BKCL 1HINL 4JGUA 2EC9T 5F70A 1INEH 4OZGE 4PRAB 2FO1A 1J8HD 2IJ0C 2H32A 3ESVF 4KGLA 4MQSB 3GJFB 3HG1B 5I66A 1NAMA 3K46A 5K9KA 2BFVH 3MUZ1 5HHOD 1IC5H 1YMMD 3S36X 5C0FB 3BUYB 3VFNA 3OKEA 1OAQL 2RHEA 2GY7B 3RUGF 2C26A 1IEAB 1E0OB 2WQRA 1QSDA 4JFOB 2FJHB 4QY8B 4BQBA 3T4AA 3RNKA 3KLHD 5FK9B 4JHZA 3TT1H 1X9QA 5DZLA 5C07A 1CLYH 5EOTA 1AXIB 3MLYL 1T6VN 4JB9L 5EPMB 1G6VK 4MMZC 3BE1H 1MRDL 1KLGB 5E6IB 4AL8H 4Y5YA 3MRHB 4I0PD 1DQQB 3OPUA 3UZQA 1KN2L 2JCCA 3D69A 4CN1A 4BZ2L 1QSFA 3KYKL 2BSTB 2CDGB 1NDMA 4NKOB 4ACPA 3SE3C 25C8L 5IFHH 2VDLH 3C5ZD 3QCVL 4G6KL 1D6VH 3CFEA 3R0NA 5E00B 4U7SA 4CVZB 5KW9L 1EVTC 1XF4A 1MF2L 4JRYD 5CSGA 3QZWA 3D85D 1HHIA 1BQHG 4WU5A 4PYGA 1Y18A 3I2CH 3PWJB 2ADFH 4L8SA 4M8QA 3TYFA 1ZSDA 4PJEF 5IBTH 4HHAA 1I1YB 3O45B 4RRPG 1IQDA 1FZKA 4P9MH 4WU7A 2EKSB 5J0BA 3SDDA 1PZ5B 2WLYA 2VLJB 2G9HB 1U8KA 2A6IA 2YPLE 4M7LH 2EXYC 5BS0B 1MREL 3H3PL 2DWDA 5HYIA 4EVNA 5JPMA 1EZVY 5AEAA 3G6AB 4LOUC 3GNML 4NO0A 4QHKJ 1LDSA 3LH2L 1QR1B 1XF4B 2HT2C 1SYVA 1WC7B 3VDCA 3HUJB 1S9YA 2R1YB 1T20B 5C0EA 1NGYA 3V0VB 3Q3GB 3RVWD 4NJ9L 3FOLB 5AD0B 4HGWA 3OR7B 3HUJE 3MLUH 3BMVA 5EZJB 5HPOA 5IB1B 1HK6A 4JO3H 4KUCF 2V2WA 4ALAL 3BPCB 5CEYA 3FB7B 4PG9A 2VLJA 4JO3L 1T7WA 4ZUWB 1T7YA 3AS1A 3IDJA 4APQB 1PKQA 3EGSB 4NQEE 1UZ8B 3DVNA 3TO4C 4U1JB 4AEHL 1T04A 3MLZH 5CFHA 2YK1L 3MJ7B 4LVOC 1YEEL 4LCIL 4WHYH 1FFNB 1D5IL 2BMKA 4UINH 4MJ6A 4PJ7E 3MRFA 3Q3GA 2IQ9L 1JN6B 4O51B 5HVHB 4GBXA 1T1XA 4OQ1A 2XNAB 3EIFA 4ZUSB 3QDHA 1MREH 1T22A 1ZTXH 4AMKH 4X5WA 4JLRB 2APFA 1CYGA 2D7QA 1RZIB 1WBYA 1QD0A 1IAIH 4QF1B 3W39B 3L7FB 1FAIL 5E99L 4JO1L 4X8XA 3B3IB 4APQA 5ERWB 2Y25A 1UB6A 4M6ML 4NWUH 1TQCB 3V4VL 5FUOL 4J4PA 4PRPA 4PRIB 2EDKA 1T0NB 3CLFL 3D87B 4F7PB 4YX2H 5I30H 3NOIA 2V6HA 5CAYB 3QIWC 3PWNB 4I4WA 1AQDB 1XR9A 1CR9L 1JTOA 2DJSA 5C0BD 2XG5A 4MCZB 4TRPL 1PD6A 2IPKA 3G5ZB 1W0VB 5D8JH 1MVUB 3D2UB 1A5FL 4FNLH 1MCLA 1PDKA 5D7IE 2CDFA 2ED8A 5DWUL 3RUGB 2J6EA 1F3JB 3RBGA 4IRSB 3ARBB 1HDMA 3HR5B 3TPUB 3LKRB 1BLNB 4P2RD 5ICXA 1RFDH 1OP3H 4DTGL 1JGDB 1JPSL 5KG9A 3TBYA 1LE9B 3M8OH 4C56E 2PKDA 5DMIH 5E4EB 2FD6L 5ILTL 4LPCA 4LLMB 2Y6SC 3BDBA 4XP1H 2CLRB 4TVSa 5JA8B 5MEPA 2VLKD 4P2RA 1GHFL 1HIMH 5C7XL 3NIGE 3B43A 4XXCC 5HHNB 3MYJA 4WW1B 4M1DL 3RFZC 3RWGA 4ZMAT 4ZYKA 1BWMA 2I26N 4QY8A 4W6XB 4HLZH 4EN3B 2VAAB 2VN4A 3IS0X 4WHTA 4R7DA 4HW6A 4F57H 4F37K 1CBVH 3LQAC 3DYMA 4H1LB 1FBIH 5ALBL 4J3VA 3BKCH 1HHKA 4IRSA 1MFAH 4DKDC 1L0XA 2Z31C 4N0YL 3BT2H 1KYOK 2NNAB 3GNMH 3PWPA 3PWLB 3P3YA 1QRND 4Z7VA 1I3VA 2EDBA 3FZUC 2ADIB 2OTPA 4UDUB 2BFVL 3DVGB 4X9HA 4O2FB 4XNZB 4ODSH 1LK3H 4U3CA 1JVKA 5IB4A 2EIEA 4HFUL 3VGFA 2X42A 2OL3A 4JDVB 4RFNC 3U7YH 1FLRL 4MAYD 2C4FU 2VABB 4WFEE 1IM9D 1GCFA 4NQDA 4Y5XB 4D9QD 1MFEH 5F1SA 2AGJL 4J1UB 5EFIB 1WFOA 4E5XA 4H5SA 1UWGH 2AQ3A 4YPGB 1IC7H 5CEZD 3GGWA 3S35X 4K3EL 5LGHH 3S3PA 4LIQE 4XAWH 5HVGB 4A6YL 3MCG1 1Q0YL 3S5LA 4QOKE 5FIEA 3U4BH 3ZHDA 3K80A 2DKSA 1YYML 5E6YA 2EE6A 4LFHG 3GJEB 1OM3L 3NIGF 1U36A 4LSTL 3RWDA 3SO3C 6FABL 1LD9B 1DVFA 2XZAL 3LH2H 4JFEA 1LE5A 2X6MA 2Z9TA 1EFXD 2IANA 4WDIA 3L3PA 5FA4A 4M7ZB 3ARDC 1YPZB 2WIIA 4UUJA 5DK0A 4YHLH 4J23A 4F2MA 4AYFA 1PLGH 2HVKA 4P4RA 5HGHB 2YD5A 4PJEE 3N50A 5JOEA 1GC1H 4OUUA 1F97A 4LLQA 4XPTH 1UH4A 3TNMB 4PJXA 1U8LB 3LB6C 4Z0XA 2KDGA 5BCAA 3HZVA 4X6BB 2H9GB 3NIDE 4NQCA 3VXTB 5CEZE 3H6JA 5L2KB 2UZIH 5IVZA 2VLKB 3NZHH 3H9YA 2ORBL 1K5NB 3S4SB 5HPMB 1A2YB 3VWKD 4RQQA 4PJ5D 2FBJL 3GSRA 4BA8A 5H2BA 2GJ6B 4KK9C 2FX9H 2VZ1A 3G6DL 4U0QB 1WT5A 3OKLA 4K2UL 1U0QA 2Q86B 2O5ZL 3IAGC 2GCYB 2X9YA 5DMKA 4EUPH 2F8OA 4EN3D 5HVFB 1CT8B 3VWKA 1DBJH 1RUML 1TQBC 2D03L 2V5RA 2BVEA 5DC0A 3IFOB 5DR5H 4HUVB 2VE6B 2RQ8A 1RUKL 3FAXA 1A3LL 2XTJC 1NFIA 3DX6A 4HUNB 3W9DB 2R9HC 5ISZA 5GS3A 4YNYA 3IDXL 2AJVH 2OL3L 3EOBB 3RL2A 3KPTA 4XWGL 4PUBH 3MLSL 4OLEA 3KPQB 3MLPA 3IS1X 6FABH 4Z0XB 3ZT7A 2YHGA 5CUSH 4HKBA 3HNTH 1IFHH 1RIHL 3FJTA 5BO1H 5JORB 7FABH 5E2WL 4JR9H 5I8CA 3H0TA 3V6OC 3L5WB 2PYEB 4N5ED 2YXMA 1A7BA 1CE1H 3V6ZB 1KTDB 3NFSH 1NEZB 5D7KE 4H0GA 5GRWA 3L5IA 3PHSA 1JRHH 5IB2A 2YN3A 4X8JB 1XCTA 4E41B 4OZGF 2QEJA 1MIMH 5E1AB 3DX6B 3W9DA 2XZQH 3PL6D 5LBSH 4PGEA 4R4FH 3HMXH 3E6FA 1W72A 3QHFL 2CJUL 1ZS8A 3FO2A 2GSIB 5DJ8A 3QDMD 1W0VA 4MDIA 5C09A 3FB5A 4R4FL 3U4AA 5B38B 4WV1C 1LD9A 4UMGA 2ADGA 4V1DD 1I85A 4JGJA 4MMXC 4KZDH 4Z77A 4WNQA 1P7QB 3T09A 3UYOD 4I8DA 5J3HC 2ATKB 5FA4B 1CS6A 4PJGB 4LSQH 1VPOH 5SV4A 4PY8I 1JBJA 1EFQA 5K9QG 2YUZA 3T0EE 5IW1A 3GMQA 4C58B 5GGUA 4FQ2H 3QJHA 1MFEL 1FG2B 1PQZB 1RIHH 4LVHB 1D5ZA 3L3HA 4EDWH 3SCMB 4ODTH 5EZLA 5D93C 4FZEH 4XMKL 2AJYL 4KRMB 1Q1JH