2XTLA

Structure of the major pilus backbone protein from streptococcus agalactiae
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
449
structure length
449
Chain Sequence
b'ETKPQVDKNFADKELDYANNKKDKGTVSASVGDVKKYHVGTKILKGSDYKKLIWTDSMTKGLTFNNDIAVTLDGATLDATNYKLVADDQGFRLVLTDKGLEAVAKAAKTKDVEIKITYSATLNGSAVVEVLETNDVKLDYGNNPTIENEPKEGIPVDKKITVNKTWAVDGNEVNKADETVDAVFTLQVKDGDKWVNVDSAKATAATSFKHTFENLDNAKTYRVIERVSGYAPEYVSFVNGVVTIKNNKDSNEPTPINPSEPKVVTYGRKFVKTNKDGKERLAGATFLVKKDGKYLARKSGVATDAEKAAVDSTKSALDAAVKAYNDLTKEKQEGQDGKSALATVSEKQKAYNDAFVKANYSYEWVEDKNAKNVVKLISNDKGQFEITGLTEGQYSLEETQAPTGYAKLSGDVSFNVNATSYSKGSAQDIEYTQGSKTKDAQQVINKKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL WALL SURFACE ANCHOR FAMILY PROTEIN
publication title Structure-Based Approach to Rationally Design a Chimeric Protein for an Effective Vaccine Against Group B Streptococcus Infections.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Structural protein
total genus 135
structure length 449
sequence length 449
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xtlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xtlA03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xtlA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 2xtlA02
5TF1L 3RPIA 3SY0B 3GMOA 1A8JH 2YZ1A 1RU9L 3QCTH 1MLBA 1CIUA 2M2DA 3OAUL 1HHIA 2XZAL 3WFCL 4KJYB 2CKBB 4YDLC 3BW9A 4FS0A 5B38A 3O0RH 4QHNA 3GBML 1NEZB 4JRYA 5EO0B 1RZGB 2H32H 4POZD 1XGQA 2R4RL 1OGAD 4OLWH 3MJ9A 1MCOH 1SMOA 1AD9B 1FPTL 4KK8C 1KG0A 1AD0B 2VJXA 2XZQH 2IQAB 1D9KA 5SX5H 2CO7B 5L6YH 4GQPH 5C0BE 1L7IL 2LQRA 3DUSB 3S88H 2V2XB 3JBG7 4F8TA 4UTBH 4HT1L 1LQSR 3BZ4A 5EU3B 5DUBA 4GW5B 2PXYC 1S9YB 2V17L 3KPQA 3Q3GA 1P4BL 2EH7H 4LPVA 1QRNE 1NFDE 2HKHH 2G2RB 3QEGH 3ES6B 4F7PA 2R1XB 3IFPA 2OZ4A 3WNPA 3VFVA 3QRGH 2VMFA 3NCJL 4D8PA 2DQCH 4HKJB 2Q6WB 3HG1B 2KDGA 2NXYD 3HE6B 4X8JB 1LD9A 4FQ1L 3P11L 1LE5A 4UB0L 1SYVB 1CT8A 3ECBB 1MFBL 2UZYB 1PLGH 3UC0H 4PY7A 1T7YA 2NZIA 3MCLL 2X4PB 3ZE0E 4RFNC 2VYRE 4KI5C 1BZQK 4EZMA 3EJZD 1V5JA 2BSED 1J11A 5E8DH 3ZYIA 1A6UH 3O41B 1TITA 3OKMA 2FBOJ 1YJDL 2UVFA 4L3CB 2VAJA 5LXGH 1TZIB 3VD3A 1INQB 2CLVA 1TQBB 3MYJA 4Z7WA 3MROA 3DRQB 2FL5B 5IEKB 4KTDH 1A14H 3TBTB 1C7TA 3UBXI 1Y6MR 1BJ1J 1T5XA 3SPVA 4GO6B 1Q72L 1JF5A 1CE1L 3K8LA 5IG7A 2VR9A 3ARWA 1KN4H 4OKVB 3SDYL 4N1EA 5HHOA 3TZVC 2WV3A 1KT2B 1IAIL 1AR1D 3BKCH 4MAYD 4YHIB 5AEAA 5BXFB 3PP4L 5FB8A 4NQDA 2QBWA 4AENA 4CVXA 2AV1A 4LLUB 5FYLD 3VRJB 1M7XA 1KB9K 2PW2B 4X7EC 2IAMD 1B2WH 2MKWA 2MNUA 3IB4A 4YHOH 1X9QA 2XNAA 3HUJE 3MBXH 3MFFB 4UIMB 1RZ7L 3VXRD 5DUML 2A6JA 4K3JL 1QUNA 4CU8A 4NZUH 5DQ9B 1GL4B 4J3VA 1CG9B 4DZBA 1OGTA 3DX9B 2HH0H 5DJDB 4JHWH 4DWHA 3SJVE 3IU4L 3ULUF 4PB9L 1EFXD 1UC6A 2UVEA 2CGRL 1K6QH 4P2QE 5J13C 5MEQA 3QCUH 5IW1A 4JVPA 3IAQA 2ATPA 1OOAA 1DTUA 3U7YH 4KKAD 3RDTA 5J12B 2EEDA 4JY5H 1ZKEA 3C60C 1EUTA 1E4XI 3R0MA 5FCUH 3MXWH 3IDNB 4R0LC 2NY0C 4K8RD 2OP4H 3QZWA 5TFSH 4J7RA 5JOFB 5I76B 3JWOH 3VWJA 4KAQH 1I8KB 3FQRA 1ZLUK 4OIIH 1BD2E 1AQKH 2HT4C 2NY6D 1B0GA 1D5BB 1EVTC 4PJCE 3QCVL 3F6LA 4X9IA 4CMHC 4BUHA 3T8XB 1GZPA 3WCYA 1FNGB 5CIPB 2NY3B 3D48R 2MBGA 4L1HA 2FGWL 3N1FC 1AGDB 3AB0B 4IIQA 4YDIL 4WW2F 4U49A 4P5TA 3S96B 1MCDA 3GI8H 4JY4A 2JJVA 1JZ8A 1G7IB 2EE6A 4MA1B 2HVJA 3VXUA 5TE4H 5E99H 3V7AE 3QUMH 4QT5A 3OB8A 4HX1B 4QTHA 4R96A 4JN2B 1D5XA 3TVMB 5AD0B 4PGCB 4Q74A 3R0NA 5GSVA 2JCCF 4GSDH 3L3OB 4QXWA 1HXMA 5E9DA 4MVBC 3IVKA 5SWSB 3K1DA 2WINA 4IDJH 5ALBH 5I1HH 1I1CA 4HUVB 4MB4A 2WK2A 1D6EA 1IM9D 1JNLL 3TFKD 3NACH 4NC1C 3B9KC 4KY1H 4LU5H 3SDDB 3EBAA 2VDRH 1IRAY 3DARA 3D3VE 2RGSA 3MLRH 3RWGB 1FNAA 4J6RH 5DMIH 1D5MB 1HH6A 2QQQA 1AGBB 1BHGA 1G7HB 1XGTA 1ZT4B 3G5VB 4E42A 1U0QA 3RX5A 4AL8L 3GK8L 4Z7UF 4CUCA 2NXZD 1YEEL 1S7VA 3L3IB 3BH9A 3WS6A 5IFJA 1CBVH 1U6AL 5E56A 3VGAC 5J11C 1LEIA 2Z91A 2YUVA 3UROR 1SJHB 1LO0L 4YHPB 5GGSY 4ZTPL 3RWFB 4X7SL 1I9EA 1RJLB 4HFWB 5CFHA 3V6BR 3QWRD 4ZFOB 4R4NC 4JAMB 2X4SB 1NUFA 5HDBF 4TUJA 1H3PH 5BVJB 3KHQA 5E1AA 1NGYA 2XXMB 5D72L 2DM7A 4QRSB 1T0NB 3OKEB 4G8GA 1DQDL 2VXQL 3FFDB 5HI3C 2WUBH 2UV3A 1F11B 2WBKA 1ZANH 1AP2B 1ZA3A 4EOWL 5IB2A 6CGTA 1YEHL 2ZOLA 4WHCA 3HPLB 1EHXA 3N85L 4NQTA 5C86A 5MENA 1SJEA 2KZ1B 1G6RL 4N8CL 3GIVB 1JGLH 3K8KA 3FQXA 4P57B 5L2KE 2ZKHL 4ZUSA 4LSRL 2X41A 4P99A 4F37K 3GB7A 1HYSD 1EHLH 4ONHB 2IWGA 2DQDL 3VI3E 3FKUS 3MBEA 5IP4A 4OCSH 4BSVB 3RX7A 1T6VN 4JZNB 1IAII 3SGKA 1F90L 4P2RA 3MRMA 3RWEA 1A6VH 4YUEH 5ESVB 4PRDB 4NM4H 5AZEL 5KS9A 5T33L 2H3NB 3UXFA 3KLAA 5F1NA 3LIZH 1ZLSH 1RVFH 3MJ9H 5EUOF 1OP5H 1MFDH 1BQHB 1KLFA 2GTWA 2ZPKH 3D2UD 4BQ8A 2J12B 2Y5EA 2IH1B 4U6TA 4OGAD 3U6RA 4G6KL 5M95B 1NGXA 3O45A 1JPFA 4FQQB 4EDWH 3CDYA 2HJKA 3WNMA 3RL2B 1DBBL 1TZGH 4OM1L 5C0JB 5E08H 1S8DA 4FQHA 2FNBA 1F42A 5E5UB 5BW7A 3ARBC 3VFNA 5JW4N 4IGBD 4JFDE 4FQLL 2E7HA 3L3HA 2GITB 2OZ4H 1I85A 1IGTB 3X11A 2R0LL 5JXAH 2HFEA 3OBAA 1F3JB 1Q9WB 3L6FB 1P4LB 2F74B 4TNVK 5CP7B 2VZ1A 4QRUA 5DK0A 5I73C 4KROB 1TFHA 3BP6B 3G5XB 4ENEC 4OFKA 4XVTL 4YDKH 4RWYH 3ET9F 1YUHA 4MB3A 3HTLX 5A40E 2IEPA 5F9JA 3BQUA 4GH7B 4HGKC 2A6DA 3GSNH 3TNNA 3Q1SH 4I0KA 4J1UB 3ARRA 5DTFB 5C08A 3S36H 2ZOKA 1OM3L 1AHWB 5IBUB 3SKNB 1RURL 1HHHB 3OF6A 4N0UB 4JDZA 3BKYL 2V2TA 3BXNB 4AG4L 1JTOA 2AKRB 1C08B 2EXWD 1C12A 2NY4C 4XP6L 1CQKA 4BH7B 2VL4A 3ETBF 5JHLL 4U2ZA 1QSVA 4H20L 4KZEL 1P1ZB 4JFFD 3MLWL 3RGHA 2LTQB 1KCRH 2D9CA 1KIQB 2Z31B 1JHKL 4LQ1A 2J8HA 1HH9B 1QPXA 5ID0B 3MRQA 2VDMH 1ZGLP 5FYLL 2Y36L 4HKXB 4W4OA 1MFAH 1UJ3A 2IMNA 5FUZL 1R5WA 3CXDH 3UPRA 5B8CA 35C8H 3BAEH 1OAYL 5DMYA 1CLYH 1R24A 1FSKC 1HIML 5KVGL 4KJPD 4G9DA 1UH2A 3C9NB 5EPMB 2IFFL 1FVEB 5JDSB 4OGYL 4FXGA 1I9RH 1BIHA 3LKQB 4PRAA 3KS0J 4GXUN 1OB1A 4HDIA 4O5LH 3QUZC 1QA9A 5F96L 1YPZA 3JWDC 1BREA 5DJ6B 2VAAA 5BMFL 5IJVB 3KYOA 1ZXQA 1UQSB 2P49B 4JHAH 3MO1B 3I02B 2Y7QA 5CEXB 2GJZA 3FFCE 3D0VB 4M7ZC 4BQCA 3BP4A 3DBXA 2ESVA 3T77B 5CZVL 2VISA 3U2SA 4K8RL 3FOLA 1KJ2L 1RJYA 4PLJC 1QHOA 3CFDA 2AJUH 5I1KH 5IVZB 5IMMA 4OFVA 3RZCD 1OF2B 2BDNH 1BZ7B 5FYLE 1NCWH 1FIGL 1S9VA 5BO1L 3ZMRA 2DQUH 4I5BA 1CDCA 1LEGA 1T21A 2MQCA 2Q8AH 3FN3A 2Q8BL 1A3LH 4IRJB 1EJ6A 4AT6B 2DM2A 3DV4A 2BC4B 2YXFA 3VXRE 3KPSE 3FOMA 3C5JB 4QRPA 1T66D 5CD5D 4W6YB 5J1TC 3P0VL 5FGBC 3KLHC 3TKLB 1KULA 4O9HH 2Q86A 3X3GL 4IHOA 1EIBA 4PJFB 1JV5A 3RKPA 3O8XD 5DVOA 3BIKA 3QIUC 4PB0L 5DQJA 3P73B 3O3DA 2X9YA 1JPSH 1MJ8L 3HHRB 1QSFA 4TQEL 2MJWA 3G9AB 3TV3H 3RVVD 5IGXH 2MKLC 4ZOEA 2YZ8A 4X4YB 2HLFC 1KENL 5JZ7C 3PL6C 4WUUD 4K7FB 1ODAA 4NPYB 2QSVA 2JB5H 1WV7T 1A22B 3DO3A 3V79C 1CK0L 2G9HB 1OTSD 2VUOA 3RGVD 1E6OH 4X83A 4KHTL 5C9JA 2DQJL 3CFCH 4P46D 1AXIB 2E7LA 4S1QL 4JDTL 1QLEL 3FONA 1U2HA 5DJ2A 5DD5H 3ZDXE 3WLBA 5FF6A 4XC3L 1QBML 4NDMB 1CIDA 2APFA 5DRZA 4NN5B 5LAXB 2UWEB 4Y4FD 3WFEL 2ILLA 2BVOB 1G9EA 5EBLB 1IQDA 1TJGL 4GAGH 1G1YA 1RIUH 3D1MC 3HLAA 5GS0C 4L4JA 5I74C 3SDXF 4RDQG 4Y88A 3TT3H 5CINL 1P7QA 1I9JL 2XN9D 4OQ1A 1A7PL 1SJVA 4KJQD 5D1XA 5CJOL 1XF1A 2BCKA 4HJJL 2VUYA 1GPOL 5D70H 4U6XB 1W2KT 4Y16D 3A67L 4DGVH 4CGTA 1R3KB 4JCMA 2VZ3A 4TVPL 5CEYB 1CGSH 3C08L 2ITCB 1XGYH 3W0WE 1RJCA 3GNML 4WU7B 1T0MB 1H7CA 4LHUD 4XRCA 1DE4A 3O4LA 1R3HA 1OSZB 4ZFGH 3X14B 2JJSA 4O02L 2R0ZL 1RZJL 1KTRL 3QEQB 2J5LC 1J8HD 4POUB 3B5TA 1IFHH 5L7XL 3WNOA 4N1CA 1M6OB 1N4XL 3P30L 2GTZA 4NKDB 1PG7W 3BP5A 4XPBH 3RVTD 2PCPB 3OJDB 1NDMB 4I3RH 3QRFM 2IADB 3VGFA 4XNZC 2EDTA 1C5CL 3OAYK 3H7BB 2GUOB 1KB9J 1RHFA 3THMH 2BSSA 3UCRA 1RI8A 2CMRL 4EVNA 3CFEA 4ALAL 5A43C 4LPCA 5D2NB 4IS6B 1BWMA 4XMLL 3UBXA 1M1SA 3TPKA 2H2SD 5GS1A 2VWEE 1RIHL 1YMMA 2AERT 2RFXA 5MI0C 3BZFB 1MHPL 3GM0A 1NMBL 3DX7B 4TVPE 2VLMD 4HGWA 3CX5K 4Z7QE 4YDLB 5E8EB 5HHNA 3EFFB 4HLJA 3SBWA 1RZFH 4GUPA 1FNSL 5JXEA 3SDCA 5C0CB 5IMLA 5TH2B 5HTSA 4M7JH 2NY1C 3GMLB 2CIKA 2F9BT 1NGWA 4EN3A 3VXMB 3DI2B 4Q9QH 3S97C 3RNKA 4R3SA 2CD0A 5B39B 4MHHG 1AGEB 3D39B 1FORH 1Q0YL 3ZDZF 5C0AD 2RB8A 1L7TH 5DHXB 5T3ZD 2GI7A 4UIKH 5KVFL 3K0WA 3ARED 4MNHA 2XFXB 3SDAA 1TIUA 2DD8H 3HE6D 3MV8D 1UM6H 1MWAA 4JFED 1FE8L 2FD6L 4NHCH 2FLRT 4OD3L 2O61A 4Z7NE 4HH9A 2M1KA 2O5ZL 1L9MA 1BQHG 2IPKB 5IHUL 1A9EB 3HNSL 4HZLB 2B4CL 3GLEA 1I7RA 2XACC 4J23A 5EFIB 4FG6C 4OZHF 5KTEH 3QDJA 3RX8A 3E3QC 1VCAA 2BERA 3PQYA 4ODSL 1MJUH 2FX8H 5J1AA 1A1MA 1CLOL 4R7NB 2YK1H 4JB9L 7CGTA 2NYYD 3K2UL 1J7VR 3SE9H 2J8UE 4D9RD 2CJUH 4XVUD 3C8KA 1QRNA 4UDUA 1NFDA 1CGYA 3LMJL 2VDPL 4HG4K 5KSVA 1I8IB 1UB5B 5IHLB 5FECA 1YEFH 1Z5LA 2QV2A 4MS8D 3EYUL 4HIIA 2DIJA 2IC9A 5D7JA 4KK6C 4M7LT 5IUSA 1Q94A 1INDH 4GLRI 1R6VA 1MPAH 2EE9A 4I3GA 4TPRH 1I1RA 1A3QA 2NX5D 3DJ9A 3QFDA 3G6DL 4NYLA 3T1FA 4UU9A 3TZVB 2MHAB 3PHQA 3AMKA 1KOAA 3CC5A 1G0YR 3QDMD 1U58B 4PGEB 3T0AA 2K9UA 2FYYA 3K8MA 1EPFA 4QXUH 2EYSA 4HS8L 1U8IB 4HBCH 4QGYA 3FT3B 3H9SD 2C3HA 5IESH 1PQZB 4WO4C 5EZOH 3FT2A 3KG5A 3QFJE 4CU7A 2OQJA 5JHDD 1V7MH 4XZUA 2P42B 4PUBL 1FO0A 4F7CB 5DHVA 3ELAT 5D5MA 2HG5B 5EU7C 4BSWA 1RJZA 1UYWL 5FA3A 3EOBB 3BGMA 3OKDA 4WTZA 2M8XA 4GW1B 5KSBF 3QUXC 5F70A 2QHRH 2NY7H 4K9EC 3QIWA 3MRCA 2R2EA 2VLJE 2VDLL 1DLFL 5J13B 3HR6A 3EOAA 3O9WC 1XR9A 4OCNC 3GSWA 5C0FB 3C60B 4OUUB 4Q6IC 4R0LB 3P9MA 4X9FA 2NY0B 5FYJU 4WCYH 3IFOA 4GBXA 3BP7B 4LPUA 1U95A 4LSVH 5FM4A 4H8WH 1CU4H 2C1OA 1BM3L 1PKOA 5DQDL 5IMKA 43CAA 3TJEH 4K94C 4E0RB 2Q7YB 5KAQF 1ZV5A 4JQXC 1MFEL 3HI6H 4DCQA 1N7MH 3BZEB 1NCAH 2XZZA 3W9DA 3BKJL 4FZEH 5GJTL 1MCFA 3TO4B 3SJVA 1MNUL 4XH2B 4N0FB 4WW2C 4RISH 3I50L 1G7JB 2H26A 5KG9B 5DMKB 1JE6A 3GMRB 1NBYA 4K7PH 4YPJA 3MGTB 2MQ3A 2BY3A 1XT5A 1WWCA 4LASH 4LSPL 5IFAH 4PJHB 3NVQA 5EIIB 1WAAE 1WIOA 3HAEG 4ODVL 5DD6A 1UA6L 3HI1B 43C9A 2J2ZA 5JIPA 3LQZB 2N56A 3I2CH 4L5FH 5MEOA 3O6KH 1CICD 5AAMA 4LLWB 5I2IA 1Q9LB 3T2NL 4YFEA 4PRHA 2QQNH 4JR9L 2APVA 1J1PL 3EJYC 1H15A 4D3CL 2AQ1A 4A2LA 3NIDF 5JO5B 5KSAC 5D7SL 3I6GB 4G9FB 1BBJA 4QCIA 1MCRA 2DF3A 2V5RA 5GHWL 2AEQL 1S3KH 1BQLL 4U6YB 3IKCB 2IC2A 2W1NA 3V4UL 3B9KB 4CVZB 3IJSA 5ITBL 3L1OL 1OAQH 1AO7A 4DEPB 2FX9L 3WDIA 4WUUE 5HGHB 5DRNA 1I1FA 3MLZL 4A2MA 2VLLB 3WDHA 4GG8A 4HQQL 3VXPA 1ZMYA 5IR1A 2ICCA 1WISA 1RUAH 1OCWH 1U36A 4HF5L 3VGAB 3ZE1E 5ILTH 5J11B 2A73B 3BGFC 5CMAA 2XZCL 5BOPA 3QBTB 1HN1A 4EI5D 1IAOA 3C6LA 4MX7B 2P8MB 4J8RA 5GJSL 4WHTB 1BBDL 4XHJD 1I8LC 1RUPL 2PTTA 3JZ7A 5LKNA 4XP1L 3TBYA 5F3BA 5IROA 4P5KB 5MEPB 5E1HB 3CK0H 5I1JH 4U31A 2OR9H 4NHUB 4Z7WF 2X89D 3QP3A 5CGYD 3VFWA 15C8L 3VFTB 1A21A 2JIXA 3D3VA 3ROLA 3NBNA 3GSUB 2BRRL 3WEXA 3DSFL 3BPNC 2XN9E 1R3IH 1G9MC 5JPMB 5K9QG 2CO6B 5E8OA 1AQDA 4GMTL 1JWUA 1DN0B 2F19H 4MJ6B 1B4JL 3QIBC 5D7LE 4RQQA 4X6CE 5TPWH 5FCSH 2VH5L 4DOHE 2CPCA 4PS4L 2UY6A 3ZE2E 4L8CA 4JRXA 2D7TL 2O26U 5B3JF 3OR6A 4JZJB 3VCLA 5DI8B 4ELMA 4RZCA 4XVSH 1J8HE 4I3SH 4MZ2A 5GRJH 3ARXA 1ZLWK 2YPKA 1XZ0B 3V7MA 1SEBB 1FLRH 4U1NB 3FO2B 1KCSL 3WMSA 4MA8H 4QHMB 3X17A 5E8PB 4L8SA 3DROA 4G80B 5T3ZL 2GSGA 4KK5C 2IAND 1N2RA 5SX4I 4P9HH 4UAOC 2NMSA 3LB6D 5C2BL 4ETQB 4OCWL 2PF6A 4ZQKB 5F7UA 3WS3B 3IDGB 4ODBD 4X0KB 1KPVA 2W0FB 4FQXC 2G60L 4YHNA 4Z5RA 5FGSA 3N50A 1CR9H 2EDXA 1K8DA 2FO1A 2VN7A 4JM2A 5FKPB 3AS0A 4EYYR 1MWAH 2YPLA 1A4KB 1OT1A 4K23H 1E4XH 4RMQA 3LHPL 4DFIA 3KPOA 4KRMB 5I73B 4FZ8L 3V6FB 4LCWB 1IEHA 4BA8A 1ES0B 3WXVL 1XCQB 4GAFB 5EO9B 2DWEA 3QXVA 4GRMA 4OZ4A 5AYQA 4M1CD 5JW3L 5GRXG 4FQIH 5JORA 5ESQA 5C07A 1J86A 3LEVL 1IT9H 1H3XA 1FLTX 4QHUB 3WKNA 4QLRA 5CUSL 3NIFE 4RIRB 1U92B 5BVPL 1CGXA 1H3TA 1I7ZA 1ZGLA 4LP4A 3I9GH 4FQCL 1JHLL 4PJ7B 2D0GA 5C0AE 5B39G 4Y5VA 5T3ZE 5I19H 5E95B 3BUYB 2WWMC 5AUMB 2X1XR 2NY4B 3V0VA 4XP4H 1TCRA 3ZTJH 3LN9A 4RMTA 4MMZC 5TF1H 1KLGA 1KEMH 4GW4A 2FZ3A 3M17B 5F9OL 4MA3A 5HGBA 3ULVL 1RU9H 3L3JB 1IARB 1OGAA 2YRZA 5DVMA 3OAUH 5C0GA 4JANB 2XZAH 1OPGL 3MREB 3LKSA 5EN2B 2R2CA 2EZ0C 3GBMH 4LKXA 3VFGL 2BXYA 1Q9OB 2R4RH 5FUCC 2GT9A 5DZOA 5TE7L 4U7MA 2CDGA 4M9OA 3V4VL 1A0QL 5ELIA 1L7IH 1FSKB 2CRYA 2EXYD 1K3ZA 4UT7H 4UBDD 4C4KT 2FSEB 1HSBB 2P4AB 3L3GA 4BK4A 2V17H 3QUZB 5DT1L 1FO0H 5DHVH 2HTLD 3HAEA 1RK1A 3GMNA 4XNUL 4ZS7H 4NQEB 4X5WB 1F2XK 1N6QL 3GJFA 1N3NB 1MCPL 5HDLA 3VRIB 4DKDC 1IGFL 4M7ZB 3NCJH 3T4YA 3EO1B 3GO1L 5D4QA 2YRPA 2C26A 1FL3A 4P3DB 4FQ1H 3ULVE 3QULA 3QEHA 3QDME 3TESA 1MFBH 1MH5B 4X80H 3TM6A 5DFVD 5EBWB 5HYSB 4WEBL 5J56B 4ZUVA 4XVJL 1FZMA 4P5MA 5JPNA 3VE0B 3MCLH 1VFUA 1K9TA 1S7SA 4AQ1B 3LV3A 2NR6C 1A7RH 3TBSB 3DURA 3Q0HA 3GBLA 3NPSC 4NSKB 1YJDH 1MVUB 3OV6A 2VLRB 3E6FA 5DS8B 5BV7B 2Q87A 2JE8A 4KKCD 1CFBA 4JO4L 5AG8A 1S9KC 4LOUD 3QI9C 3IETB 4TOYL 2AV7B 3WUWB 4XBPB 4Y5XA 3RKDC 5F88B 4WGVB 3QK6A 5KS9F 3HC0A 3QIUB 5JLZA 3UMTA 2OK0H 5GGUB 2VRAA 4KDTC 4MAYA 1Q72H 1CE1H 3V4PL 1T22A 4M3JA 3EYQD 4JZOB 3SDYH 1OQOA 3U9UB 5C1MB 3K3QA 3CCHA 1KN2L 3KNBB 3KPLA 3FT4A 1J1OL 5IF0B 2IAMA 3PL6B 1DBKH 4MJ2A 3VD4A 3PP4H 5E8NB 3U0PA 2UUDH 3KPRB 3VXRA 2A83A 3T0XA 5CD3A 1WIPA 3MV7D 2P5EB 2D0HA 1WCQA 1KJVB 3QT2A 2X4RB 3I3BA 3E6HB 5F89B 1WFTA 3BPCA 1ZK9A 1I3RB 2G75A 1LVFA 1A1OA 1FVDA 3KPPA 5FUOL 1EFXA 3CIQA 4O4YL 1RZ7H 5DUMH 3ZZ1A 4K3JH 3NIGE 2AK4B 2C5IT 1S5IL 1JK8A 4HWBL 1QR1B 1YYML 3MTRA 1QG3A 4Y89A 1DEEB 2WBJB 3VFMA 3RWHA 3MCKB 1JFQL 1QFPA 2OS7A 4PB9H 5JW5A 1MLCB 4ZFOL 4Y7MA 1KJ2A 1NDGA 4F7TA 1DBAL 1VENA 1CQYA 5I74B 1MIML 1U3JA 3IFLL 4ZPVB 5IQ9A 3R1GL 3BWAA 1A1NA 3MRKA 4GKOA 5TQ0L 2YUWA 3UO1L 2C7UA 5SWSE 3OXSB 5HHPA 4X4XA 5CBAB 2IPTL 5D1ZC 3QNZB 3G5YA 1YC7A 3MNVA 3FXEB 2CR6A 3JTTB 3PHOB 5FO7B 4M7KL 3QCVH 4NZDA 4UQ3B 4MQ7B 4YBQD 4DKEL 4C56B 4HG4J 4CN4A 5L8JB 5ETUB 3UTQB 3FQWB 1MUJA 4U6HB 2YN3A 2HTKD 1EEZA 1MCBA 3DECA 4YDIH 3N1MC 4UOW0 3CZFA 3VFOA 4KV5F 1HEZB 1W72L 2GY7B 2J5LB 3HA0A 3W9EA 4CDHA 5DD1L 2VDOL 2CK0L 1ZS8A 4OI8A 1U42A 1MQKL 3DMMD 1ZVSA 3JVGC 4IEFB 5GZOC 5I30L 3L7EB 1VFBB 3RTQC 2CA5A 4DKFL 4QXTA 2P44B 4P2OC 1U8QA 1A6WL 3I3DA 2Z92B 1BF2A 1FC2D 3T65B 1YPZF 2WLYA 1HCFX 4PJEE 4OI9A 1FN4B 3UEZA 4NO2A 1U3HC 2AEPL 4F58L 1JNLH 3V52L 3VWKC 4BSJA 5MI0B 2E6JA 4U6VL 3CD4A 1N59A 2W60B 3MLTA 4X6EB 5K9JL 2BOCB 2BSRB 3D0LB 5MERB 3RI5F 1MSPA 3GBNL 4AL8H 3GK8H 4PJ9C 1AY1L 2B39A 3H3KA 1YQVL 5IM7B 2YSSB 1YEEH 3QWRA 3FTGB 2NY1B 3GSVA 1YNTB 3PWPD 4PG2A 4I18C 4OD1L 4LFHD 3LKPA 3SQOH 2OXGA 2OJZL 1JPTL 4R2GD 1LO0H 4ZTPH 2ICEB 4LARL 3MRBA 3W39B 4X7SH 2ZZUT 1A6ZA 5DFWH 3UJTH 2E8ZA 3IAPA 4C58B 3DO7B 3JWOC 4Z78B 3QUKB 3HC4L 1VACB 5CJXA 3QNXB 1A9BA 3CAFA 3AM8A 5ICXA 4LLQB 3O2VL 2Z8RA 4TTDC 5E6ID 3QQ4B 4BH8B 3T0ED 5D72H 4QGTA 5C3LD 5E0QA 3BGAA 5DSCA 1DQDH 2VXQH 3FQTB 2I9LB 5BS0D 4LLDB 2D9QB 5F71A 1FH5L 2ZUTA 4EOWH 4FABL 2CLZB 2JKXA 3UZQA 2PO6B 2IANE 1BJ1H 1XMWA 1J0HA 2CDFA 3H6JA 4NZRH 5EOQL 4YO0A 4Z1PA 4N8CH 3HZYA 3RJQB 4LRIC 4NC2B 4ZOAA 3NAAL 1S9WA 4JKKA 4ODWA 5E2WL 1MREH 3CSPA 3HI5L 2ZKHH 4LHJB 1LHZA 1YEKL 1HK6A 4Z9KB 1JNHA 1OD7A 1R5VA 2FWOB 4D9LH 2XWBB 5IKCA 2NLJB 1S7UA 3MRPB 5FK9B 3P4OA 2DQDH 5J4MA 3IJYB 4Q7DA 4OFYD 4PY8J 3F7YB 3ALWA 3ESUF 1F90H 3Q5YA 1R0AL 2IH3A 4YDJB 4NO5A 3QJFB 5DJYB 1B0RA 5IBLD 4APQC 3EDEA 3HRZA 5GISL 5I8KL 1FFPB 1ACZA 1M4KA 1WBXA 3D2UA 5AZEH 1EA9C 5T33H 5KN5B 3PG2A 1FRGL 3MA9L 1KB5B 5B4MC 2NW2B 3CFJB 4LCYB 4N0CD 4N0UE 5HGDA 1A02N 3IS1X 2G5RA 1IAIM 3QA3B 1C5DA 2FJFB 2NCMA 2I27N 4IGBA 2V9QA 3KPMB 2C4FT 4G6KH 4IRSC 3BYYA 2NY5L 3MRRB 5C9KA 4JDVB 3HS0A 3PGCA 4DN3L 1QBLH 3ME0A 1ZHBA 3RVWD 3T2QA 3V6OE 5I16A 1DBBH 1I3GL 1NBVL 3HAEH 4OM1H 5EBMB 4JO3L 1T83A 4WO4B 5GGSB 2XKNB 4ISVA 3GJFH 4L3EA 1JUFA 3QH3A 4HJGA 4HMCA 3RHWF 2NY2C 1E4KC 2R0LH 1BX2B 3LRSA 1H5BC 3SCMD 2R2HA 1BMGA 1AIFB 4LLYB 4R26L 2ZUWA 1WWAX 1MJ7L 2FHFA 3QUXB 2YWZA 5INCA 4XVTH 4YIQA 1KIPA 2OXHA 3WBDA 32C2A 2XWJB 1NCTA 1BVLB 4AEFA 3PV6B 1U8OA 3O9WB 3O3BB 1KJMA 1OL0A 2NY0D 1OM3H 2VQTA 3MRJB 1I9IH 4CQIA 2VN4A 1YDPB 3LN4B 4Q6IB 3V8OA 3JSSA 2X4NA 4JFFA 3BKYH 3MLVL 4AG4H 1J0ZA 1GHFL 2ATKA 2EDKA 1DP0A 2HT4D 1MCWM 2BNRB 1CXLA 7FABL 3FN0L 2R0KH 4IOFD 3P9LB 4KWUA 5JHLH 4QRRB 3DETC 4HIJB 4KZEH 1ZHKA 1UZ6F 3MLWH 3TO4D 4LBEA 5FYJD 3IXAB 2F8OA 5DO2D 1G7PB 2EIZA 2C3GA 2WM0A 5D6CA 2BP3A 5HD8C 1DUYA 2H9GB 1T3FB 3HNTL 4KVCH 4WW2B 3UTPE 2O5XL 5IVXA 1QP1A 2IJ0C 3C87A 3L5XH 2GY5A 1SHMA 5FYLH 4F3FB 4U33A 1QYGL 4JO1L 1KSRA 4PIRF 4U1LA 1OAYH 5JTWA 4PR5A 2GJ6D 4QNPE 1D9KC 1EZVY 1HIMH 5KVGH 3PWJB 2WLZA 4OGYH 4Y19D 3CUPB 3FQNB 4G5ZL 2WW8A 3T08A 4F33A 2JCCB 2X4OA 1JN6A 2AI0L 1XGUA 4Y0GA 5IIEB 2RIKA 4G9FD 5BMFH 1GIGH 3MQIA 4U1HA 1U8JA 4JFOB 5KSAB 1Y18B 4PPTA 4WTWA 4YR6B 3STZA 2ZUUA 1OTTD 5HSFA 1GGBL 3RZCA 1Q38A 3G04A 3VFPB 4K8RH 2A6KA 4MNGB 3UTSD 1KJ2H 4YPGB 2Y06L 4JG0H 2VZUA 5ADOL 4G7YL 1NC2B 3ARTA 3SOBL 3L9RA 3RIAK 1EVUA 4Z7UB 4M1GL 2CIIB 1S5HA 4QRTA 1FIGH 4ZXBD 3EIFA 4L9LA 5J6HA 4FXKA 4Z76B 3BGFB 1HHKA 2E27H 4EIZC 1IGYB 3HE7D 3VG0L 1MHHA 2BSTA 1IAKB 1WC7B 3O8XA 3V6ZA 2CDEB 3FMGL 2UWEE 3L95B 1NFDF 3IDUA 1UWXK 4RBPH 4YWGL 1PY4A 3P0VH 5DURB 1X4YA 2B7DT 5HI3D 3X3GH 4JFQB 4OLUL 1W0VA 2YD2A 2HT2D 2AQ3A 4DGYL 4F7MA 4QTIL 4WUUA 5ACZA 2V7HA 1HKFA 4EI6B 3BPNB 4HAFA 2DTML 4X7CC 1MJ8H 3RU8L 2FIKB 1HOCB 1KENH 1ED3B 3RGVA 3MJ6A 5E2UL 3F7VA 3RWJA 3BT2L 1F02I 4P46A 5EC2A 5HDOA 5J3HD 3BN9C 4HS6B 3MLXL 3QIBB 3NABL 3MUJA 4PJ8D 1CK0H 1SJXA 4NM8L 3MUZ1 4GLRH 4JEGB 3HC3L 4Y4FA 2OL3B 3QDHA 1KLUB 2RJMA 4KHTH 2DQJH 4XBGB 1R3JB 2DS4A 4S1QH 4JDTH 5IFHL 1UB6A 1S7WB 3QEQE 3IU3A 1FNEA 5D1QD 1DQTA 4R8WL 1DDHA 1QBMH 4XC3H 1HXYB 5D5MF 3ZT6A 4PRNB 1Z3GL 3WFEH 3U1SL 5T1DL 5FYKD 2GW5A 3MRLA 1TJGH 2XN9A 5EUOB 2ZSVB 2DYPB 1TXKA 3F58L 1KPRB 4PD4J 4Y2DD 4AIZB 2W65A 3RDTC 1I9JH 4FN0A 2I26N 4Y16A 5D2NE 4RSVA 1H8NA 2DLHA 3BIBX 1INEL 4UAOB 5CILL 5EZJA 5CJOH 4Z7OE 2C3VA 5I17B 3ZSSA 1A2YA 1CTOA 1GPOH 4MCZA 3S4UA 3SKMB 3VWJC 1LO5B 1S7TB 4YDVA 4ZTOL 4WRLA 3OB0H 3TBVA 4LHUA 2P47B 1XEDA 2X9XA 4L4VB 5T1LB 5I1GL 3M8OL 3INUL 5BRZD 2V5SA 1J8HA 4BFIB 3GNMH 4QHKJ 1TNNA 1AGFA 3ARQA 4IIQC 3VDBA 1EUUA 5C0CE 3LKRB 4MZ3A 4O02H 1ZLVK 3VFRA 1M05B 2R0ZH 4M4PA 4FNLL 1NGZB 1RZJH 2QR0B 4P5TC 4XPAL 5CLTA 3VXME 5I8CA 3WIIH 4YK4C 1UADC 3WLWD 2DJUA 4JPWL 3P30H 3ARFC 4U7KA 1CF8L 3D39E 4M9PA 2VZOA 1MCEA 1DBML 3D85D 1U8HA 2ADFL 4UINL 2ZP0T 4OZFB 4X4ME 2AABL 1TVHB 2P24B 4HIXL 5GSRA 4LVNC 2CMRH 2AW2A 3KS0H 1NPUA 2K7QA 2A1WL 4OFPA 3WJLA 1FDLL 3DRTB 2D31B 1RIHH 1CDJA 4HJ0D 4YHZL 4QEGA 3DVIA 1MHPH 4MJ4A 4Z8FL 3MZGB 1EGJL 3RRQA 3UZEA 4OF5A 2B0SL 4PP1D 3B9DA 5IK3A 2CXKA 1F6LL 1FNSH 1YEDB 4U1MA 5FEBA 3L5HA 5BJTB 2C3XA 1E28B 1EBPA 1NLBL 3MJ8B 2XOTA 5D9SB 5C0AA 1ND0B 2V2WA 3K2MC 3WS6C 1YN7A 2G2RA 1UVQA 5DJ8A 5H94A 2R1XA 3PWUB 5IB1B 3V5HB 4OSUL 3MXVL 2XA8L 4D0CB 3AREA 3V2AR 1Q0YH 3MV8A 4JFEA 1F13A 4PJBA 3AAZB 4HH8A 1OWWA 5HI4D 1NAMB 4NQED 3F12B 3Q6FB 5DJZB 1NL0L 3STLB 3H7LA 3TPUB 5EDXA 4HCRL 3MV9B 3OXRB 2V5TA 3TJHD 4OD3H 1FE8H 2FD6H 3PWVA 3FRUB 5DJ0A 5IHUH 2B4CH 3S36X 4ACPA 1TZIA 3TA3D 1INQA 4PY8I 5HJ3A 2JK5B 3BEWB 5FIEA 3S9DB 1S78D 4Y1AD 5FYJL 3ARPA 4OFQA 1CLOH 5LCVL 4PTTB 2EDJA 4NNYA 3K2UH 3NPSB 4YE4L 3WFHB 4KK9D 2AQ2A 1FL5B 3MBEC 4WHYG 1ZSDA 2PYED 4OKVA 2NX5A 3SGKC 1XF5B 2BZDA 5DA4A 3QI9B 1UM5L 2YXMA 3EYUH 2VXTL 3QIUD 1JGEA 2B1AL 5GRVK 4ELMF 5BXFA 1FFQA 3QDMA 3RWIB 4YNYA 4YGAB 4LLUA 3T3PF 3G6DH 1WK0A 3CPLB 2EYTB 3PL6D 1LNUB 3KWWA 2XQYK 3H9SA 2H32B 4U1IA 5ESAB 2N1KA 4CW1B 1HHGA 5JHDA 1W0YT 4QWWD 5F7YC 5FDWA 1NGQL 4HS8H 1P5UA 3KYMA 2A77L 3C5SB 3VI3F 5FYJE 3BRFA 4WNQA 3MRHB 1PKQA 2ICWJ 5BW7C 3BISA 3MR9A 1KJ3L 3WIHA 4D0BA 3JV4B 1KIRA 2AK4D 4N5UA 1K5NA 3N1PC 1SY6L 3CDCA 4KRPC 4ZUUB 3QG7L 4DFHA 1I85C 4PUBH 4CJ0A 1YY9D 1U91A 4JM2F 2VKWA 2WBJD 4KU1A 1UYWH 4EUPB 5SX4H 2BNQD 5CCKH 3IDNA 1CFSA 2C4FU 3JV6A 5GGRB 4PJHE 3OX8A 4AYFA 2X70A 4X9GA 5EU6B 3ZHDA 2HN7B 3UTZB 2IGFH 1QVOB 2VDLH 3WL9A 3BQUC 2FO4B 3GJEA 3SDXB 3CSBA 3EYFB 4OQTA 1JPST 4PJGA 1MHCA 3DWTA 5HGAB 4OT1H 1MJJB 1MCSA 1SYSB 3CSYB 3VRLE 4MJID 3H2WA 1BM3H 5D1ZB 4MQXD 4G9FE 5DQDH 3QAZC 2L0DA 2H6PB 3S96A 1MFEH 2DLFL 4TUKL 5M94B 3O11A 3TIDB 1T04B 3R8BB 3BKJH 3LN5B 3SGDI 3H9HB 4U1SB 5GJTH 5FFLA 4MXQC 3QQ9C 3T3ME 3OG4B 2EIBA 5DR5L 3V5KA 2QADC 3I50H 5KOMC 5HYJB 4JN2A 4C59B 2BOBA 4O2CA 3RWDA 1T1WA 2HJLA 2ARWA 2VL5B 1XH3A 4W4OC 25C8L 1CICA 1UJ3C 3BVNA 3V5DA 2A9ML 1NEUA 3PXHA 5C0RL 4RFOH 4ODVH 3PABA 4QYOA 5A3ID 1TMCB 3WD5L 1QFWH 3RTQB 1WSST 5FYKL 5E2VL 4JFPB 4JQIL 2R2BB 4RAUA 3MYZA 3T2NH 1T5WA 3HR5B 4JR9H 1WBYA 1MELA 1J1PH 3G08B 1FV1B 1HQ4A 1PEZA 1Z0MA 4D3CH 3T0DA 1BZ9A 1D5MA 1G7HA 3OKKA 4NQCD 5D7SH 3G5VA 4QF1A 4RX4D 2AEQH 5GHWH 1U3HB 2DLEA 3VFSA 1QSEB 2FEEL 3L3DA 3AS1A 3A0OA 3FRPG 3V4UH 4HWBA 3VWKB 5DK3A 5DFTA 5EU4A 2HP4A 1I7TA 2PYFB 4OLYL 1I4FA 5ITBH 4YZFE 3KXFB 1QKZH 2FX9H 1AKJB 1YECL 4X7TA 4EI5A 1CLCA 4PJFF 3W82A 2UY7A 3MLZH 4ZSOA 1T1ZB 4HQQH 5A16A 1JRHL 4MCYB 2HLAA 3EYVA 5BVJA 1UACL 4I18B 3EOTL 2XRAL 2XZCH 2X89A 2BMKA 4CVUA 4X6BA 3OKEA 3DVGB 1RUPH 1PZUB 4NWTL 2OI9C 4PJDE 5ANMB 4XP1H 1ZEAH 4H8WC 4JFZH 3ZT7A 1AP2A 4PJEA 4L4TB 4UUJA 3SE3A 3WXWH 5E24E 5DD0L 1JF1A 2VDKH 1LVEA 1ONQA 15C8H 4R7DA 3VXSD 2AJYL 2PO6D 3AROA 4Z7VF 3G6AA 4FG6D 1W8NA 2XG5A 1VEPA 3DSFH 4NRYB 4OZHB 4UV4L 3F7QA 2R23A 4U0RC 4J4PD 4FFVD 5D2LA 2A6IB 3AGVA 1W72A 4BSVA 3MV11 3PGDB 1B4JH 2I07A 4UQ2B 4L0RA 5T1KB 3QUMB 5HI5D 4FFZL 4LVHB 3QDGD 3UZVB 4MNQB 2VH5H 3S5LB 1JPGB 2KKQA 4N90D 4LCWE 3EZJB 2OSLB 1HHJA 2D7TH 3GFUA 2E7LC 4RMRA 4APQB 2IH1A 2P1YA 3IXTB 1SBSH 1YNKH 1FFOB 4FTVB 3O2WH 4EQ2A 2IANA 5C0DB 1OY3B 3K80A 4FQQA 4MXWL 4JREC 3TN0D 3EAKA 4I2XB 5BCAA 1NH6A 4G3YH 1QQDB 4PJ7E 1KCSH 3STBA 5T3ZH 2F53D 4RA3A 3U0WH 2RBLA 3GZKA 2GITA 1EJOH 1Q9KA 1RUKL 2EDHA 3VXQA 1UKSA 4IRSB 3ROOB 2DJSA 1WTLA 5LGHL 1ZHNB 4QHKI 4OCWH 1F3JA 3L6FA 3DYMA 1LEKB 5D1XC 4IOIA 3SO3C 2MFNA 4WHDA 1J0YA 2QL1A 3B2VL 4WO4D 3QG6A 2G60H 3JV0A 4QOKD 4B7IA 1T6WA 5GGVL 5DMGD 2GIYA 1A3RL 1ZA6B 4HXBL 4O00A 2ARJQ 4I13B 5FXCH 2NY2B 3TNMA 4J1UA 3L5IA 1H5BB 4JFXB 4UV7L 4P4KD 4KQ3H 3LHPH 3ULUD 1K4CA 5KSBB 4FZ8H 1HHHA 2RHEA 4N0UA 2XKSA 3BXNA 2JJSC 3X13B 5BV7L 1JZ4A 4EEEA 1MFNA 1BF8A 4JGJA 4OV5A 1A6PA 4NFDA 4BH7A 4DN4L 1HQRB 1M7DA 3LEVH 2YMXL 3FB6B 2R1YB 5CUSH 2G5BB 4WW1B 1TTFA 3V6OA 1BLNA 4OCLC 1OLLA 4FQCH 4NN6C 1JHLH 2M26A 4PYHA 4H25B 3NN8B 5DHYB 2V9TA 3I84A 4NQEE 3BH8B 5DD3H 2FLBT 2FB4L 4J3UA 4HWZB 4ORZC 5AG9A 2AJVL 3RPIB 1X4ZA 3GMOB 5GS1C 2Z0BA 5I1CL 5L8LB 5F1KC 1EMTH 3U36A 1MF2H 1MLBB 1OPGH 3C9NA 3QPQD 1CFNA 1HHIB 5JDSA 1JBJA 3BW9B 5B38B 4QHNB 3LKQA 3AXLA 4JRYB 4JKWA 2IALA 2CUHA 3SBWC 2OMBA 4WEUD 1XGQB 1LO2L 2GK2A 5TE7H 3SDCC 4HUXA 1KG0B 4JY6A 3V4VH 2VLRE 5IJVA 4M6NL 1D9KB 2FEEI 3MO1A 2VOTA 4XC1L 2WOYA 4EN3C 4YLQT 4H88L 3LKNA 4M7LL 4OCRL 4M8VA 4P9HC 3WIHH 5AAWA 3BZ4B 3P9WB 4KXZI 3B2UC 5GS0L 5DT1H 3KPQB 1DSFL 3Q3GB 1J87A 1T2QL 5EA0L 1JRHI 1VGEL 4XNUH 3W2DL 5C8JA 1N6QH 3SDAC 4F7PB 4E41D 3IFPB 1IGFH 4G43A 4DAGL 1D5IL 3VFVB 3C09C 5ID1A 4D8PB 3B9AA 4OQTH 4AH2A 2F5BH 5D7IA 1LD9B 1L0YA 1LE5B 5K59E 1FZJA 2BC4A 3KPRE 1CT8B 4WEBH 2VR4A 2P5EE 5BOZG 4PY7B 5EWIL 1RQ5A 4XI5C 3T1WA 1AXTL 1CDBA 1IC1A 3X3FL 1XF2A 1AR2A 4XP5L 4XAWH 2AK4E 1CGTA 1F5WA 3OKMB 2LAGB 5CP3A 2FIRT 5KANG 2CLVB 3RL1A 3MYJB 4JO4H 4KC3B 2BNQE 1MEXL 4Z7WB 3MROB 1RZIA 3CX2A 4GS7C 5D7JC 1I1YA 4K7PX 5C0IB 2X1WL 4Z95L 4LGRB 5I1IL 5CZXC 1GGCH 2DQGL 5JIHA 3V4PH 4BZ2L 3SPVB 1TZHB 4P9MH 4ZUTA 5IG7B 3MV7A 4G8IA 4XWOD 3P4NA 4XGZA 5HHOB 5I1LA 1LDPL 3FN9A 4RMVA 4NQDB 4AENB 4ZO7A 1IVLA 3GMQA 2CRZA 1MRFL 4HWEL 5DYOA 3CVIL 3IT8D 3QEUA 2I60H 4Q9BA 3HFML 4GG6A 5FUOH 2XNAB 1MAJA 2FJGA 2XQBL 4O4YH 4WEMB 1S5IH 4HWBH 2A6JB 1YYMH 3L5WB 3OKNA 1CXHA 3BMVA 2W9DL 4DZBB 3B2MA 1OGTB 2DYPD 4PV9A 2WQ8A 1JFQH 2H1PL 4FOMA 5H2BA 1MCIA 3QIWC 3ZKNC 1ADQL 3IF1B 4O2FA 1DBAH 5MEQB 1MIMH 4JPVL 2ATPB 1OAXL 4EXKA 3R1GH 3EOYG 3RDTB 2IG2L 4FHBD 5TQ0H 3UO1H 1CDIA 3UX9B 2IPTH 4GBXC 1JHTA 4ZAKD 5HHMB 3VWJB 1DCLA 3FQRB 3UAJC 4GQ9L 3X14A 4M7KH 4L4VD 3QHFL 1B0GB 4MWFA 4DKEH 1YJDC 1GZPB 5C09A 1MAML 4QXGL 2X1PA 3QJHB 4PJAA 3TT1L 2BVPA 4ORGA 3RVXD 4NKDA 1CDUA 3U9PL 3U48A 4IIQB 1NDMA 2HJFA 1P7KA 4XTRD 1Q0XL 3EHBC 3DMMA 1SMAA 5IVXF 1X5JA 4P5TB 1Z9SA 3BEVA 3TBWA 1W72H 3K81A 1W0WB 2R4SH 1ZKAA 4HIHA 2P5WD 5DD1H 1FG2B 2VDOH 2CK0H 3ARFB 2HVJB 2YD7A 3AY4A 4NJAH 3VXUB 3VDAA 1MQKH 4PLNC 4QT5B 4NZTL 4Q0XL 4ZNCD 5I30H 3LVEA 3ARGC 5LGJA 4R96B 1YY8A 1KB5L 4DKFH 5DRWA 2BY0A 1CZ8L 2JB6B 4LVNB 1A6WH 1KEGL 5GSVB 4E5XA 1EEQA 5E9DB 1U8LA 4PJXA 3EFFA 3IVKB 1A4JA 3UYOD 4ZD3L 3BYTA 2WINB 4RGND 2FR4A 1G84A 1ZVHA 2Y5TA 2AEPH 2APTA 5TH2A 4F58H 4WHYH 4JVUA 3V52H 1D6EB 1UG9A 2AS5M 2DKMA 3GMLA 5EH1A 4LSSL 3E3QE 3VW3L 3WJJA 3PWPA 5K9JH 4LRNH 2H45A 4CAGA 3OR7A 1GVIA 4X9BA 3EDDA 1P6AB 1HH6B 3GBNH 3H0TA 4E42B 1XGTB 4YX2L 1AY1H 5A2JH 4OZGF 2XTJB 2LU4A 1YQVH 4M5YL 1S7VB 4OD1H 1NLDH 2GJJA 5DEZA 5IFJB 4O51A 3DVFA 1JPTH 3ULUL 1LEIB 2Z91B 3IDIA 3C6LC 4N90E 5E6IA 1IQWL 3T0EA 2NZ9C 1XIWD 5BS0A 1A9EA 5GRUL 5IROC 4HZLA 2I5YL 1OP5K 2WZAA 3CFBA 3HC4H 5JR1H 4ZODA 5SWZB 2HA1A 2OM5A 3O2VH 4BUGA 5C0BD 4N5ED 2X05A 1IL1A 5E1AB 1C16A 4G6JL 4M1DL 4JPIA 3REVB 4HXAL 2NNAA 4V1DB 1FH5H 4MD5B 5LBSL 1QLFA 4AEIL 1A64A 2WAHA 1ZA3B 3ZKSD 4Q9RL 2ZOLB 1F4HA 4HUWA 1WUNT 5MENB 1SJEB 3DUUA 5EULV 5IB4B 3NAAH 3ZE1F 1UB5A 3HI5H 3FQXB 4OFYA 4DQOL 1JI1A 4WV1A 1YEKH 2HRPH 4KKNA 1L0XA 3UDWA 4MQSB 2HWZL 4LLAA 5EU7E 4ZS6C 3GB7B 5SWQA 5EB9A 1HKLL 3QI9D 3MBEB 3ULUE 1R0AH 1O5DT 4KMTL 3WO3B 3VI4F 2XYCA 5GISH 4S1SL 5I8KH 3CVHB 4P2RB 3MRMB 3RWEB 2X4UB 4X7DC 5ENWA 5KS9B 3IDXL 4ZO8A 3I6KA 3BPOB 5DUPH 5F1NB 3HZMA 4CJ1A 1ZHLA 1S7QA 2SEBA 5JMOC 2GTWB 1EGJA 1LP9F 2X4TA 2BNRE 4L8SC 4JFHD 2QEJA 4IJ3C 3WKMH 2ZUQC 3U6RB 2XIDA 4OCYL 5CSGA 4DN3H 1V8HA 3EOBA 3O45B 1JPFB 4XXCA 4TSCL 3SCMA 5A2IH 1I3GH 4TSAL 1NBVH 3NCCB 2HJKB 1VPOH 4DK3A 4JO3H 4HUNB 4FQHB 4LLVA 3ZE2F 3U0TA 2V5YA 3PJSA 5EUKA 3L3HB 2QQKL 1VGKA 4WFED 4KRPB 2QSCL 4JM2C 3X11B 2HFEB 1IM3A 3MRNA 1CXEA 4YXLL 1MJ7H 2H2PC 4OUUA 1H0DA 1JWSA 1AI1L 1CXIA 1EAPB 4HCRA 5B38G 4QRUB 5DK0B 5GRVL 4MDJB 1BFVL 5JIKA 1YUHB 3MRGA 1DBJL 5F9JB 3BQUB 3UPAA 1BWWA 3FCTA 2A6DB 4FFWC 3TNNB 3IDYC 2JCCE 3QUYD 4KH2A 4OAWA 1SM3L 1X6LA 3AS2A 1TJIH 5HHVH 2EE3A 1YYLL 5KBNC 3Q48A 3V10A 2Z35A 3TO4A 4JDZB 5CP3H 1GHFH 2V2TB 4XH2A 4Y5VC 2VSDA 3M07A 7FABH 3PWLB 4P2QD 3FN0H 1C12B 3QAZB 5KG9A 3IDMA 3SKOA 4GKNB 1RFDL 3HB3C 12E8H 2DOCA 4MNGE 4E41E 3MGTA 2ED8A 5AWNL 5E2TL 4POZC 3HNTH 4Z7UE 2QADB 1K85A 2O5XH 4F9LA 5I66A 1P53A 2GJ6A 2VNCA 1HILB 1BD2D 3MRQB 1IKFL 2CUMA 2P43B 1QYGH 2MMXA 4LLWA 4Y19A 4PTUA 2BY1A 4LIQH 4JO1H 1CXKA 4PRIB 1X5GA 1UJ3B 3JWNC 1JTPA 1R5WB 5ABDE 3UPRB 4NO3B 5E03A 1I1AD 1R24B 3I6GA 4G9FA 4G9DB 2FEDD 4G5ZH 5FGRA 5FA4A 2AI0H 1NFIA 4PRAB 4Q9CA 4LL9A 1U8KA 1OB1B 4HDIB 5E6ZA 1R5IB 1QA9B 1YPZB 3UTSA 4PJBF 2BHZA 2NXYC 2VAAB 4I77L 3KYOB 1QACA 8CGTA 2AJSL 3VWKD 4JCLA 1FYTD 1PG7X 1GGBH 3RQ3A 1KCVL 3BP4B 3DBXB 2ESVB 2VISB 4M6AA 1AKJD 2Y06H 3U2SB 3FOLB 3D25A 3RNQA 1RJYB 4ZXBA 3CFDB 3EJZC 5ADOH 4G7YH 3TP4A 3SOBH 4MLSA 5IMMB 3HE7A 4M1GH 5CWSA 5MEPA 3HCVA 1EERB 2YR3A 4JN1L 3HRPA 3OL2A 2FHCA 2X4QA 4MGXA 2CRIA 1S9VB 3C2SA 4C57C 4I5BB 1G7LA 1T21B 3VG0H 3LD8C 1BAFL 5J0BA 2OI9B 3GSUA 2WUCL 4NT6A 3DV4B 4JKPH 3FMGH 3FOMB 4QRPB 2DQFA 4YWGH 3OGCA 2DLGA 3DTXA 2BJML 1YEIL 1SVCP 1T20A 2Q86B 4OLUH 3KPNB 4IHOB 1F2QA 4Y5XC 1JV5B 4DGYH 4X99A 3PUCA 4QTIH 2DBLH 1AR1C 4RAHA 4MAYC 5FM8A 1JGDA 3N9GL 3K46A 4TNVF 2DTMH 5DQJB 3O3DB 4U0RB 4PJ8A 4ZYKA 4NKOA 1F6FB 1QLRA 4KJWD 1VFAA 5E2UH 2IAMC 3CMOH 5F1OB 3QZWG 4EDXA 4L4VE 1N5YH 4JZJA 4PJDA 3VXOA 3MLXH 3NABH 5DI8A 2IBZY 5D1QA 3SE8L 5KJRL 2ARJA 3KR3L 4NM8H 5IT2L 4XMPL 4LVOC 3T2PA 3HC3H 5JW4R 2X7LA 4OM0H 8FABB 1EEYA 3MLYL 2R1WB 3RIFK 4Z23A 5IFHH 4K2UL 4LNVA 5I8OH 5L2KD 3B9EA 5DJ2B 4R8WH 3WLBB 5FF6B 4Y2DA 1Z3GH 5DRZB 5T1DH 4KKAC 4WUKL 1JJUA 4JREB 3GEWB 1NAML 2A38A 4NRXA 4K8RC 2V7NB 2W0FA 3T2OA 3HLAB 1RUML 2AXHA 4AZ8A 3S4SG 2ZJSH 1JYVA 3P4MA 1BVKA 1P7QB 2NY6C 4PJGF 3D9AL 5C6TL 5CILH 1GC1L 5D1XB 3QWOB 4M5ZL 4NO0B 4LEXL 5BRZA 3SO3B 5HHQB 4Y4HD 1BVZA 2J88H 5GGQL 4WGWB 1ZT1A 5ISZA 2CR3A 4RGNE 4P48A 2NY2D 1A7QL 1B6DA 5L88L 3J7HA 2EH8L 1DANT 5EO9A 2YA2A 4FQJL 4O58H 4HMEA 4CVWA 5I1GH 3MGAA 3O6FC 3INUH 4NKMA 4HD9A 3L5JA 5D7KD 5FUCE 1T0PB 1N8ZA 2OTWB 2FH8A 4RIRA 4XRCB 1DE4B 5C0ND 1R3HB 1K4DB 3O6MH 3EGSA 3RP1A 3D85A 3DVNA 4FNLH 1T1XA 4BQ6A 2VXVL 4JFDD 3GGWA 2B2XL 5DLML 1G7QA 4JPWH 1M71A 3B8SA 1CF8H 3M17A 2GTZB 3K4DA 4P2CG 1DBMH 3BP5B 3SGDH 1JZ6A 2ADFH 4OTXL 4JPKH 4UINH 4NN6B 5IVNA 2AABH 4HIXH 1CCZA 2BSSB 4NNXA 3NTCL 2GAZA 5EO1B 4EVNB 3CFEB 3TFKC 1UGNA 5DVLA 4G7VH 3TLRA 2A1WH 4WI3A 3UBXB 1JF6A 4QY8A 1FDLH 3NFPA 4N8VG 5HD8D 5GS1B 1ACYH 2OTUA 2ICWA 4YHZH 4MSWA 4HHAA 1X5IA 4HFUL 1F97A 3TH3T 4DJMA 5L6YL 2VQUA 4Z8FH 2RFXB 2NXZC 1TNMA 3QR2A 4MYWB 4X5XA 4HGWB 1EGJH 1HSBA 3EYOA 4UTBL 1AE6L 2B0SH 3KLSA 1ERNA 3B4NA 3B5GA 3SDCB 2Q3AA 3DYOA 1NLBH 4ZO9A 5CBEA 3MACL 5IMLB 1BIIA 3ILPA 3SE4A 2EH7L 2EDWA 4NQEA 1F6AB 4PG2C 2CIKB 1NGWB 4EN3B 3QEGL 4XCNA 4OSUH 2XA8H 4R3SB 3GSNA 3ZL4L 1E4JA 4HPYL 2Y9RT 1NUGA 4P3DA 4HUKB 4PJEF 4LSTH 2C4XA 5CJXC 5EBWA 3AM8C 3VMPA 4HCRH 5IJKA 4MNHB 3SDAB 5DMJB 2ZNXA 3M45A 3TA3A 1YC8A 4BFEA 3FL7A 1MWAB 3C09B 1VKXB 4Y1AA 2O61B 4HH9B 4K55A 5ICYA 1A6UL 4NSKA 4JFHE 2KPNA 1WZ1L 4HV8A 2Z4QA 4N9GB 3TCXA 2XY2A 5LXGL 1HYSC 1RZJC 1UCBL 3QDJB 3T09A 3V95A 5D2LF 3WHE0 3PQYB 5FYJH 3FFCD 1KFAH 5F7DA 3IETA 4TYUA 2GK0A 3WUWA 5J1AB 2PYEA 4K3DL 2X09A 4U1JA 3NMEA 3G6JA 3EO9L 4YE4H 5HVFB 3RI5K 5C2UB 4WFEE 3ZLQC 1FCCA 5GGUA 3C8KB 2ZCHL 3O3UN 1NFDB 4UDUB 4H26A 3J8F7 1QO3A 5EU6E 1WZLA 3U9UA 5GRWA 4YHYC 5KSVB 1OVZA 5KVMC 2F8VA 5FECB 1UM5H 1Z5LB 2VXTH 3JXAA 2Y4SA 3SDXE 3PL6A 4GS7B 4HIIB 2B1AH 5D7JB 1CN4A 4QO1A 4ESKA 1Q94B 4BFBD 4BKLA 3KPSD 3QFDB 1KJVA 3T1FB 2X4RA 4UU9B 5F89A 3PHQB 3MUGB 1B2WL 4PV8A 3CC5B 5KVDH 3BN9D 4IGBC 3VG9C 1PG7L 4NQDD 3GSRA 4FQ2L 4GRWE 1H3GA 1QR1A 2FYYB 5CAYB 3MMEA 3VXNB 4FA8A 1DEEA 1NGQH 2WBJA 2A77H 3QQ3A 1K8IA 2HH0L 3KAAA 3MCKA 2BNQA 1MLCA 1KJ3H 5EC1A 3FT2B 1CVSC 1SY6H 3LS4L 4LKCB 4XZUB 1FO0B 5DHVB 5D5MB 3U7YL 4BSWB 1RJZB 2Z93A 5DF0A 5FA3B 3BGMB 3OKDB 4NFCA 3MXWL 3EO0A 3OXSA 1IEBB 1HSAA 1WFNA 4P23D 1MQ8A 3HMXL 2OP4L 1I7UA 3B43A 1NCCH 3MRCB 1DQMH 2R2EB 4KAQL 4MJIA 4OIIL 2EXWC 6FABL 1KGCD 3EOAB 3QUJA 1XR9B 1FC1A 3GSWB 1RK0A 5AZ2L 4MD0B 5HHMD 3P9MB 2CUIA 5TJWK 4MD4A 3VWJD 3IFOB 4GBXB 5TDPA 1U95B 1U3ZA 2C1OB 3CXHJ 3VD7A 5IMKB 1RIVL 4GRLD 3S4SA 43CAB 1QSEE 5IB3A 1FYTE 1HINL 2DLFH 4TUKH 4DCQB 5E6YA 3GI8L 3W9DB 3H3PL 3T4AA 4LAJH 1PFCA 3KXFE 4NCDA 2EDRA 1P7HL 4LNRA 3BESR 4NRZA 1TJHH 5D6DA 5DR5H 3QUML 1LGVA 3LS5L 4X6DF 3L7EA 3LKOA 1X5AA 4JG1L 5MHSE 2H26B 1KBGH 4KJPC 3RHWK 5KZCB 4OZIE 25C8H 4PG9A 1NBYB 3ARFD 4GSDL 4HK0B 1UWEL 3FB5A 2XPGA 2Z92A 3BPLC 3W0WD 1QFUH 3T65A 4M6OL 5C0RH 3F8UB 5ANME 3ZDZE 4DNDA 3D18A 4IDJL 5DD6B 2MTPA 4L4TE 3ARGB 4WENB 2YN5A 5I18L 4NQCA 4G8EA 5MEOB 1EO7A 5FYKH 5E2VH 1M7IA 4I0PD 1CXFA 4RX4A 3UJJL 3MOQA 4ZFZA 4OLXL 4CMMA 1JZ7A 5I2IB 3B6SA 4PRHB 2W60A 3WNLA 1H15B 4UNTA 5FM5O 1IGJB 2JF1A 4PJ5B 4ZO6A 4R6UA 1J8KA 4JKMA 4OZHE 5GRZA 1BBJB 5IM7A 4QCIB 1OTUD 2Y6SD 3RZCC 2EKJA 3LEXA 1JVKA 1P2CA 4XNYH 1AO7B 4KXZH 4H5SB 5D7IF 4N8VA 4I9WD 2XTJD 1A7OL 5DRNB 1ADQA 2DM4A 4M62L 3QUKA 3VXPB 4C4KO 4UT6H 3LQAL 1FZOA 4MNQE 1JRHH 1NFKA 1G9NL 1IZKA 5A2FA 4LLQA 1UACH 4LSDA 3EOTH 3ORJA 4JLRA 4L9LC 4TVPD 1T66C 4ODXA 1TETL 1WZKA 3ARDD 5CD5C 5CMAB 3UJIL 2I9LA 1IAOB 3C6LB 3OJMB 4LLDA 4J8RB 4NWTH 3RA7L 2PTTB 4I4WB 4FTVE 2EDQA 3O8XC 3TBYB 3F6IA 5SWZD 2CLZA 3VXSA 2YC1A 2PO6A 4XB7A 5J1SC 4LGSB 4HEME 5DD0H 4I2XE 1ZT7B 4J4PA 4ETYA 3VFWB 4V1DD 3RVVC 1JGLL 5B21A 1QFOA 2JIXB 3ROLB 2AJYH 4GKZA 2AJXL 3QDAA 1IAMA 1P6FA 3WEXB 4UV4H 1DVFB 1EHLL 3MRPA 1PX3A 4V2BA 3QDGA 5FOJA 3H9YA 5E8OB 1AQDB 3RGVC 4OCSL 3SGEI 4YDJA 1FAIH 1JWUB 3CLEL 3FB7B 5DJYA 2K48A 2Y23A 4ODTH 4P46C 4B53A 3MLSH 1IEAA 1A6VL 1RV6X 2OJEA 4FFZH 5T3XD 4RQQB 1UXSA 4TULH 3CFJA 5D7KE 5KSBE 3AMLA 1RVFL 5DJXA 5HDQL 3TN0A 4GG6F 4JRXB 3OR6B 1JP5A 4WY7L 4ELMB 2F53A 2AK1L 4KTEL 1SEQL 4PJIA 1QNZH 2EYRA 4MXWH 2ERJC 3T04D 1DQJA 4KJQC 4NQVA 3P2TA 4M93C 5EBMA 3CFKA 4W4NA 1TZGL 1ROWA 5ERWA 5E08L 2D4FA 4P2YA 5GGSA 2EKSB 4L8SB 3DROB 4QOKA 5T5FH 2JJUA 4IJ3B 1RUKH 4YAQA 2GSGB 3X12B 1N2RB 2OZ4L 2ZUQB 5FO8A 5LGHH 3N5LA 2E9BA 1CLZL 3B2VH 2ADGA 2YS4A 4P4KA 1KPVB 1XGRA 3UBXG 5GGVH 1A3RH 4YHNB 1TTGA 4Z5RB 1FG9C 2EDNA 5I75C 4HXBH 1K8DB 3PV6A 1PVHA 4JM2B 4UV7H 4JRYE 3Q1SL 2YPLB 4F57L 4PJAF 3WFDL 5K9OA 1TVBA 3KPOB 4PP2A 3WN5C 5BV7H 2OLDA 3RVTC 1JYXA 3QFJD 1MCNA 3V0WL 1X5HA 4DN4H 4GRMB 1N26A 1IKNA 4AEEA 3IDYB 4JQXA 3NH7L 2YMXH 5JORB 4M48L 5ESQB 5C07B 4HIJA 1S7XB 1DANU 3IJHA 5T5NG 3SO5A 4PGDA 1I7ZB 1ZGLB 2BVQB 4WWKD 2H2SC 3ILQD 2H9GA 4Y5VB 3V9FA 3U4BL 2FB4H 2VLJD 2EDFA 1C1EL 4F2MA 3V0VB 2VDML 1TCRB 3FB8A 4F3FA 3DUHA 4P3CL 2AJVH 4HK3N 1KLGB 4PJXF 4LLMA 2FZ3B 4D0DA 4I8DA 4LK4A 3WJLC 5I1CH 3MRIB 1LE9A 3CXDL 1PGRB 4MA3B 35C8L 5HGBB 5DZ9A 2APWA 3T0VA 1OGAB 4W81A 5C0GB 5IOPA 2E9WA 1LMKA 1ORQA 3PWJA 1FNLA 3LKSB 1KYOJ 4PRID 5JDJA 4LKXB 2JCCA 4GAYA 3VXTA 2I9TA 5IHBA 4LVEA 1RZ8A 4TTGA 2GT9B 1LO2H 1QSDA 5C7XH 3WIFA 2HFTA 2CDGB 1Z9OA 2FJHA 4JFOA 5F7EL 4XC1H 1JYWA 3P7IA 1UM4L 4Z7WE 4H88H 1QEWB 4OCRH 1D6VL 2XV6B 3AREC 4E41A 3L3GB 2W07A 3LEYH 2ZUXA 3NCYS 1DSFH 3O6LL 3ZTJG 2AJUL 1T2QH 5CGMA 3HAEB 2D4DA 1RK1B 2NXYB 3W2DH 1JYNA 3MRFA 1CD1A 5E5MA 4Z7UA 5F21B 4GXVL 3GJFB 1Q1JL 4L8BA 4XNMA 2KQMA 4Y8AA 1D5IH 2X40A 3BKMH 5HHOE 4YQXL 3CZJA 3T4YB 4U3HA 4JQVC 3EW3B 2WIIA 1GOHA 1IGYA 1QR4A 5CSZA 3QULB 4K07A 5BZDB 1I8LA 3QEHB 3VGHA 2F6AA 4U7SA 4NQDE 2NYYC 5IMOB 2CDEA 1H3UA 5EWIH 3RUGA 5JPNB 1FZMB 4P5MB 2Z9TA 3QWQB 4XVUC 1S7SB 1AXTH 2ZUSA 4RFEB 3X3FH 5DZAA 1MI5D 4UNVA 3LV3B 2DQHL 4XP5H 2IC6A 5GZND 3DURB 5B3JE 4MS8C 3LD8B 4MA7L 3VGBA 2PNDA 4N9OB 2DLIA 2DIBA 4YFLF 4L29B 1MEXH 2P7TA 2CSPA 2GFBA 1KXTB 4UILL 4WTZG 2BFVH 4JO2L 2EDOA 2L7JA 3NFSL 4Y5XB 4IM8A 4Z95H 4U3XA 5I1IH 2D3VA 4HS6A 4Z7VB 2DQGH 1TQCC 2LVCA 5JLZB 1KGCE 4MAYB 4BZ2H 4LCUA 5F9AC 1F8TL 5I8EA 1T22B 5HHME 2DWDA 3CCHB 3KPLB 3BE1L 1E6OL 4YHLL 1JGUL 1RZKL 5J9PB 3MOBH 4QRQA 4WIQA 1NC4D 1LDSA 4WFHD 5DD5L 3LSOA 2PKDA 2A83B 5CD3B 3MNZA 5CJQL 5EORH 4NUGL 5GS2D 4LVOB 3CVIH 1RIUL 3HFMH 4PREA 1N0LA 3JV5A 1KPRA 3BPCB 3CMGA 3KPPB 1A1OB 1FVDB 1UWXH 1EFXB 2D7PA 4MAUH 2HMIC 4YXKL 1FAKT 4J3OC 1P9MA 4J3TA 2W9DH 5D7LD 4TN9A 1NGPL 1FJ1A 3ZSTA 5JW4M 2H1PH 3RWHB 4MDIB 4J3WA 3QXDA 3H42L 1ADQH 3SKMA 1LO5A 5D70L 1S7TA 4ZAKA 1KJ2B 3KYKH 1NDGB 4JPVH 4G6FD 5ICZB 5LWYL 2IG2H 4L4VA 1A1NB 2NY6B 3S35L 1CGSL 1Y0LA 2C7UB 2HFGH 4NO0D 3FHAA 4BFIA 4X4XB 4YC2C 2O93L 4Y4KD 2ED9A 4P59L 1KTLB 1WT5A 3G5YB 4GQ9H 1M05A 3QHFH 2IPUG 3R06A 5A2LH 3TEUA 4L8DA 3UTTA 1EK3A 1MAMH 2W91A 4RGMC 3O6FB 1B6UA 1MUJB 3TWCH 4Z6AT 5IB5B 5I1DA 5SV4A 2W92A 3U9PH 1EEZB 2P5WA 3P77A 4XPBL 4I9WE 2XTJE 2UYLA 3A6BL 3CZFB 2FX7L 5ALCL 2AXFA 4LCCA 5T3XL 3V7AG 5IHZA 1X7QA 3VFOB 1JZ2A 1CICC 2ZG1A 1DQQA 3W9EB 2YD6A 2P46B 2EIEA 4IMKA 3CVHL 1ZS8B 4CN6A 4HPOH 5I9QC 4NZTH 4Q0XH 1GOGA 2LV4A 4J2CA 2GCYA 5SWZE 4QXTB 1KEGH 1U8QB 4ODUA 4A6YA 3GLDA 3FQUA 3KJ6L 4DZ8A 4ZD3H 3UTOA 3DOSA 2V6HA 4V1DE 4D9QE 2EDYA 4KMQA 1TLKA 5BJTA 3U79A 1E28A 2PXYB 4NO2B 2YEZA 1OLZA 4K3HA 5I15H 3EFDH 5MENE 3VW3H 3VFUB 2NXZB 4QHLA 4BJLA 1DZBA 3C5ZA 1ZLVH 5GGRY 5EOTB 4HS3A 3KYNB 3KDMA 3MLTB 3OKOA 3HG1D 5KSUA 4HKBA 5CJBA 1AGCA 4EI5C 3WHXA 4OGXH 5D8JL 1FORL 4YX2H 1NAMA 4XHJC 1XIWA 4M5YH 1U3YA 2R15A 3FO0L 2XICA 3U83A 5T3XE 1IC5L 4UIKL 3GSVB 4C83A 1TVDA 3ULUH 3OXRA 4PRPB 3QXWA 5C0BA 3O2DA 5CGYC 5H8DA 1UM6L 5DJCA 4M03A 1AXSA 3MRBB 4P2RE 1G7MA 3PP3H 5GRUH 2I5YH 4RFNB 1NUNB 5KS9E 4GAJL 3SE3C 1CD8A 1N64L 4HW6A 3SDAD 5ADPL 1A9BB 3MLUL 3BEWA 4NBXB 3O3AA 3GIZL 2PR4L 1MJUL 4G6JH 4M1DH 5C6WH 4HXAH 5FDYA 4PTTA 4ELKA 2DI8A 3NA9L 1KXQE 3F5WB 2C5JA 1JGVL 1A5FL 3SE9L 1ITBB 4Q9RH 3PQYD 5DEGB 2CDFB 1NCUA 1FL5A 5JOPD 4YO0B 3HZYB 3GJFK 4PYGA 4ODWB 1XF5A 3QI9A 4DQOH 3QSKB 2QKIA 1YEFL 2HT3D 4PJDF 1BQUA 1NCDL 2L4OA 3ULVD 2HFFA 5ECJE 3RWIA 1S7UB 2ITDA 4KDTA 1MPAL 2VR5A 3P4OB 3Q6GL 4KMTH 2EYTA 4YHYB 2AEIT 2IH3B 2OMNA 4S1SH 3ZHKA 5K9KA 1B0RB 1LK3L 1JWMA 3HRZB 5CHNB 5F1SA 1FFNA 3IDXH 1XF4A 2D7NA 2AJ3A 4QXUL 3LB6C 1NBZA 5HGDB 3BO8B 4K3EL 4G6AD 3JV4A 3OTTA 5EZOL 4GKSB 4MXVE 2KQNA 4AY0A 3HZVA 3GRWL 3VG9B 4OCYH 4GT7A 4OLZH 4IMLA 4EUPA 1MRCH 4F80A 3HS0B 2R9HD 3PGCB 4NCC2 4TSCH 5F72S 1CDYA 1UEYA 2R69L 5KW9L 5I16B 2YKLH 2A9NL 3QXAA 2HN7A 2QHRL 3UTZA 3GMPA 4ISVB 4H1LA 4L3EB 1JUFB 3SDXA 4HJGB 1FFRA 4KV5E 3LRSB 1KPUA 3PWNA 2R2HB 3HUJA 4KI1A 4YXLH 4PRIE 4NOBA 1RUQH 3E2HC 4M1CC 4BFGA 1AI1H 4XCFL 5DVKA 4CMHB 3QUYA 2NY3D 5INCB 1BFVH 4YIQB 3SKUD 1KIPB 2DJ4A 1T80A 1CU4L 4H8WL 5L9DH 3RZWA 3TJEL 4LGPB 4P2QA 1U8OB 2I24N 1KJMB 1MY7A 1U9KA 3FZUC 4Y5YA 4GBXD 1FZKA 1YYLH 4LSUH 4JGUA 5K93A 1YPZE 1NMCC 1WCBA 2X4NB 4JFFB 4XBEL 2C1PA 4P3WA 1VEOA 2CLRA 2ATKB 3F7PC 1H3WM 5DC0A 2WP3T 1GSMA 3UYRH 4RAVA 4G8FB 3TVMD 2ESVE 1BD2A 1BFTA 3OPZH 5EZLA 4LSQL 1ZHKB 4HLZH 4LBEB 4PJCA 5E2TH 5SWSD 5CJ5A 2EIZB 5D6CB 2XTLA 4YH6A 2A74A 4NNPH 5DJAA 1DUYB 1I1AA 1VB9A 5IVXB 5CKAA 1IKFH 3I2CL 4UTAL 2R2BA 5F8QC 4M61A 3DXAB 3HR5A 4XPGL 1E6JL 3SDDD 4J3XA 1P5VA 1MI5E 3BPLB 4J12A 3MA7A 1CFVL 3ARGD 4WU5A 2N7AA 4PR5B 3DX8B 1BJ8A 2HTLC 2EEAA 1E27A 3SKJL 1J05A 4QRPE 2Z8VC 1S3KL 3VWKA 1FYTA 4PRHD 1CDGA 3LZFL 4F33B 2X4OB 2PYFA 1TPXC 4XMKL 3U7WH 1XGUB 4PJ5D 1REIA 4I77H 4TSBH 1VADA 2OBGA 2ADIA 4X5LA 1OHQA 1UXWA 2AJSH 4U1HB 1U8JB 1EO8L 4DVBA 3MZTA 3O81A 3EYSH 4TRPL 5DFVC 3AS3A 1CS6A 4OF3A 2VDQL 3RZCB 2JJTA 1RUAL 1OCWL 3G04B 5JQ6H 4OZIA 2A6KB 4MJ5B 4NWUL 2DMBA 4IBLT 4DW2H 3HMXA 4XNQA 2E5EA 2PTVA 1CDHA 3L9RB 4YGVA 4OZGB 4WFHE 4LEOA 4DUVA 4JN1H 1S5HB 4QRTB 2MWCA 2OR9L 3SGJA 4L9LB 5J6HB 4FXKB 3GHEL 4LOUC 1HHKB 4DTGH 2UZIL 3G6JF 1R3LA 2WUCH 4KUCD 3O8XB 3VGDA 4NRYA 1RHHB 2CKBL 3RJDA 4OZHA 3ALPA 4LHQB 4RMWA 5F7LB 3RY6A 2BJMH 1YEIH 5F44A 2KL6A 3EYQC 4LRIA 2F15A 2HRLA 3NCYP 5I1EH 2LVEA 1W0VB 2F19L 5INDB 5EIQA 4OIBA 4F7MB 1DVFD 3QHZL 5ACZB 4RMUA 3NZ8A 4ZG1A 4DGIL 2K7PA 4KKLD 2RQ8A 4L1DA 5C71A 3NCEB 1JPGA 4PGBA 2OSLA 2LU7A 3RGVB 3RWJB 4P46B 5EC2B 4HGMA 4ERSL 1OAKL 4A6YH 1K2DB 5L2KA 4I48A 4OB5L 5KJRH 3KR3H 4S0SD 5HY9A 4XVSL 3I75A 4XMPH 5GRJL 2Q76B 2OKMA 3VJ6A 4ZDHA 1MCJA 3F62A 3MLYH 3U4EA 4K2UH 1FLRL 1UB6B 3KVQA 4MA8L 3IU3B 4Z77A 3QO0A 1DDHB 3L7FA 3ARBB 5BZWA 4WUKH 2BNUB 2D2OA 3MRLB 2XN9B 1XR8A 2ERJB 3DV6A 1NAMH 3KJ4C 4LP5A 4KROD 1LP9B 4M93B 1YNLL 1RUMH 1HWHB 4Y4HA 4DVRH 2Q7NA 5C6TH 4YBQC 3O2DH 1H5BA 3BFOA 1MWAL 1UZ6E 5EZJB 1XCTB 1ZWIA 4XCYA 4KGLA 1GC1H 4K23L 2E7BA 3CH1A 3ARZA 4YHKL 5KSBA 2C3VB 3ZKMD 2HVKB 1HNFA 5H35A 5GGQH 4MCZB 2HTKC 4YDVB 3VH8G 3TBVB 1G6RA 4LHUB 3BD3A 1A7QH 2EH8H 5I75B 1CE6A 1MHEA 2GHWB 3VD5A 4HIEB 5J57B 4NQSB 4JFDA 4XPHL 1BOGA 1J8HB 3FB6A 1IT9L 1AGFB 4NUJA 3HG1E 4KKBD 2Z31D 1CVRA 3WN5B 1ZOXA 5DHYA 3DMMC 2VXVH 2B2XH 4FMFA 5I8CB 4X98A 3ZYZA 2Z1PA 5DLMH 4XP4L 3WFCH 2N4IA 5FGCB 3AY4C 1KEML 5IV2A 4OTXH 1GZQA 1U8MA 1U8HB 5DDHA 3RIAF 1KNOA 4WI8A 2VXSL 1FPTH 3MNWA 3HB3D 3NTCH 4TUOA 5GSRB 3MPCA 2IMMA 1EHNA 1UH4A 4HT1H 4KUZL 1MCHA 1I8MA 2X1OA 3K7UA 5TF0A 2LABA 4HFUH 4S1DD 3QDJE 1P4BH 3PQYE 2AJZA 2QQLL 4UT7L 3WJJC 5JOPE 3TYGL 4R4BA 1WFOA 3TYFA 1AE6H 4HUUA 4R2GC 2J3SA 4S10A 2ZCKL 5IK3B 4U1MB 3B3IA 5ITFA 1FO0L 4EUPH 3ZDYE 3BHBA 3MACH 4PRBA 4ZPTB 3REWA 3VA6A 1T03L 3QHTC 1JL8A 5C0AB 2V2WB 3P11H 1YN7B 4UB0H 4ZS7L 4W70A 1UVQB 3BSZL 2CH8A 5DJ8B 3UTPD 5H94B 3HPJB 3RAJL 1PZ5B 3NOIA 5E6IC 2X6MA 3AREB 3T0EC 4H1LH 1G1CA 1PDKA 4X6FB 3ZL4H 2C9AA 4HPYH 3MV8B 4JFEB 4PJBB 3C2AL 2E9IA 3H8NA 4IRJD 3A6OA 2R56L 4X80L 1UKTA 2LFGA 3PWVB 3FFCA 3BMWA 5DJ0B 1A7RL 5DK2B 4PFEA 3FO9A 4GRWH 4G42B 1WZ1H 5H37H 2B1HL 2EDBA 3CX5J 4KDVA 1UCBH 2AEWA 5HJ3B 2ADJA 4KRLB 4IDLA 4WV1C 5DEFA 4K3DH 4RMSA 3P0YL 4XB8A 1AC6A 3UDWC 3EO9H 4NNYB 5IBLC 5C0IA 2IQ9L 5D5ME 3OHXA 1IAIH 1OSPL 4CADA 2PETA 2OK0L 2ZCHH 4RCAA 1TZHA 1ZSDB 3KPSA 2Y72A 1DUZA 2WMPA 4U1KA 2NX5B 3C6SB 4N0CC 3OQ3B 4NN7C 3SGEH 1DBKL 1JGEB 1NJ9A 4RA0C 4KHXL 2QLVB 3QDMB 1TQCB 4PJIF 4Q58C 4YNYB 5F7NC 4JJ5A 3RVWC 4LAQL 3RVUD 1C5BL 4X9HA 3KWWB 3IU4H 3H9SB 1O0VA 3HKFA 4U1IB 1X5LA 1PG7H 2CGRH 4XWGL 4WI7A 3MCG1 4FQ2H 5FKAA 3U82B 3L5WA 1HHGB 5JHDB 1EO5A 3LRHA 4XXCC 3SCMC 2HKFL 5FDWB 4F9PA 3IRZA 5SV3A 5IW6A 3DIFA 3KYMB 4IRZL 4WNQB 2X10A 3MRDA 1S9XB 1PKQB 3MR9B 4P23A 4D0BB 1O7VA 1WWBX 3IF1A 1KIRB 4LDLB 3U7AA 3LS4H 1K5NB 5GPRA 1U91B 3N0PB 3MC0A 4PLKD 3WE6A 1CFSB 3JV6B 4UDTA 4ZNEE 3OX8B 3HMXH 1UZ8A 2X70B 4Z0XB 2FGWH 1A6TB 1AFVL 3WL9B 3GJEB 6FABH 3O3EA 4GRLA 1H8OA 3QEQD 4PJGB 1MHCB 4IOFC 4WFFE 5AZ2H 3KLDA 4PRHE 2IBGA 3QJHA 4EKXA 3TO4C 1L6ZA 4WDIA 2F54B 4PJ5E 4YC2B 5FHBL 1JCKA 5DO2C 1RIVH 4O2EA 3MUY1 2H8PA 1HINH 3IGAB 3D69A 3AU1A 2FHBA 3O6FD 2P8PA 1N5AA 1W0WA 3O11B 4XNZB 3H3PH 4RGMB 3GUTA 1AO7E 1FG2A 1IM9A 3ARFA 3TCLA 1FL6A 3S34L 1T2XA 3VH8A 3W0WA 3LS5H 3V5KB 1J10A 4F9LC 4JG1H 2VXUL 4CL7A 2BOBB 4O2CB 2JB6A 3RWDB 1T1WB 5FOBB 5FAAA 2HJLB 1UWEH 1XH3B 1CICB 4I0PA 5JNYA 3BVNB 3V5DB 2E7MA 4M6OH 4OD2A 5T1MA 1T7XA 1U41A 5I9QB 3PABB 4KK8D 4QYOB 5C0CD 3CDGB 5I18H 4YBHA 3DPBA 3UJJH 4OLXH 3VXMD 4RAUB 1OTTC 1XF3A 1U6AH 1T5WB 1WBYB 4DEPC 1HQ4B 1BZ9B 4OI7A 3D39D 2PXYD 2ZG2A 3OKKB 1NANI 4QF1B 3VFSB 3NGBC 3L3DB 4BK5A 5EU4B 1DLHA 1QTYT 1I7TB 4S1RL 3SQOL 1I4FB 4ZXBC 3MUHL 1NCNA 1A6AA 1FVCB 3ARDA 1CFQA 1A7OH 4OCXL 2YBRB 4X7TB 4EI5B 3UJTL 3HE7C 3PIQA 4L9DA 4M62H 3H3BC 4N8PA 4ZSOB 3LQAH 4YJZL 5A16B 5LG1A 3RUGF 5E00B 1G9NH 4PRPD 5SWZA 3WSQL 1YEHH 4X8XA 2HLAB 2UZXB 3EYVB 1CTNA 1NQBA 1CGUA 1TETH 3N85H 3UJIH 4JRXE 2XG4A 2BMKB 1G6RH 4X6BB 2GSIB 3REVA 4KI5D 3RA7H 1CD0A 1PEWA 2HT2C 1X5KA 4V1DA 4MD5A 4ELME 1WICA 2AAVA 4PJEB 4LSRH 1MCCA 4UUJB 3IRPX 3T3PE 4LF3A 1JF1B 4NZRL 4KQ4L 3EDJA 1ONQB 5IB4A 1U2CA 4YHML 3C8DA 1MREL 1OP3H 2P8LA 4R7DB 2AJXH 3G6AB 2VC2L 4D9LL 3NFNA 5J3HC 1YA5A 2R23B 1GJIA 3HMWL 4PJ8C 2BHYA 5D2LB 1W72B 5HPOA 4N0YL 3CLEH 1HDMA 3TZVD 3CVHA 4OFDA 2I07B 4DUWA 4JZJC 2X4UA 2VITA 4ONFL 5GIRA 4LHUG 3EUUA 5D1QC 2YPLE 5BQ7A 5HPMB 4XXDA 3DHJA 3JUYA 2J8UA 5F6HJ 4BQ9A 4HWUA 4U1GC 4NGHL 3L3PA 5HDQH 3TO2A 1HHJB 4B0MM 3FHQA 3OKYA 5HYIA 4WY7H 4Y2DC 5GGTL 5TDNA 2AK1H 4KTEH 4FQLH 5CS7A 1SEQH 3GSQA 5C07E 1IE5A 1IJ6A 2IANB 1QBLL 3PGFL 1D2OA 4JJHA 2WWKT 4JM4L 2B5IC 1Y6NR