2XTLA

Structure of the major pilus backbone protein from streptococcus agalactiae
Total Genus 135
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
135
sequence length
449
structure length
449
Chain Sequence
ETKPQVDKNFADKELDYANNKKDKGTVSASVGDVKKYHVGTKILKGSDYKKLIWTDSMTKGLTFNNDIAVTLDGATLDATNYKLVADDQGFRLVLTDKGLEAVAKAAKTKDVEIKITYSATLNGSAVVEVLETNDVKLDYGNNPTIENEPKEGIPVDKKITVNKTWAVDGNEVNKADETVDAVFTLQVKDGDKWVNVDSAKATAATSFKHTFENLDNAKTYRVIERVSGYAPEYVSFVNGVVTIKNNKDSNEPTPINPSEPKVVTYGRKFVKTNKDGKERLAGATFLVKKDGKYLARKSGVATDAEKAAVDSTKSALDAAVKAYNDLTKEKQEGQDGKSALATVSEKQKAYNDAFVKANYSYEWVEDKNAKNVVKLISNDKGQFEITGLTEGQYSLEETQAPTGYAKLSGDVSFNVNATSYSKGSAQDIEYTQGSKTKDAQQVINKKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-Based Approach to Rationally Design a Chimeric Protein for an Effective Vaccine Against Group B Streptococcus Infections.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Structural protein
molecule keywords CELL WALL SURFACE ANCHOR FAMILY PROTEIN
total genus 135
structure length 449
sequence length 449
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xtlA04
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xtlA03
2.60.40.740 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2xtlA01
2.60.40.1140 Mainly Beta Sandwich Immunoglobulin-like Collagen-binding surface protein Cna, B-type domain 2xtlA02
4NZUH 2IAMB 4NQDD 2HRPH 4K7PH 2R0WL 5C0BB 1T4KB 3EKCA 2NY7L 3NACL 3TJEL 3ARFD 4ZDHB 1X7QB 3DRQA 5KS9A 5ESVA 3U4EA 3WNPA 1HILB 1QBBA 4GKSA 3VDBA 1XCTA 4YBLC 2ZPKH 5I1JL 5LBSH 1NCWL 3ECBA 1INQB 3L1OH 3KPQB 5F7EL 4HUUA 1JK8A 2R1WA 5GJTL 4TOYL 3STZA 1A14H 4NN6C 1MVUB 3DV6A 4DJMA 2XWBB 1AO7B 2AQ2A 1IC7L 1PG7L 1UEMA 5BXFA 4OF6A 3HR5A 5EU4A 1C16A 2WBWB 5D5MF 3BMWA 2XN9D 3SDXE 3AFLA 2R8SL 2MKWA 1BX2B 2GYSA 2MNUA 2N4IA 3QG6B 1MHEB 3QQ9D 2AV7B 4AT6A 3B5HA 3QIWB 2GFBB 5EZOL 2PW2A 3UTTA 2HYMA 3CFDB 4NWUL 4YPJA 5HHPA 3HRZA 1K8DA 3FB8A 1X4YA 3IETB 3VI3E 1P6AB 2K3TA 5FCUH 3P30L 1JNNL 2XN9A 5D70L 1GZQA 4F2MB 4MZ2A 4OTXH 1E0OB 5LCVH 1XGPB 3WFDH 1IL1A 1OCWH 1NUGA 3OBAA 4LCWB 4MAUL 5HGBB 3DHJA 3QQ3B 1OSPH 3MSPA 4I5BB 1EFQA 1SEBA 4MJ6A 4U05A 5TDOA 3B2UD 4G43A 5JQ6H 3VXOB 2GAZB 1HIML 4DGYH 5MEND 5F7FA 4TYUA 2E6PA 4Z77A 1T1ZB 5I74C 3TO4C 1EMTL 3ULVC 4JG1L 1PZUB 1T6VN 4W81A 3HE6C 4PG9B 3LIZL 3P2TA 2P8LB 5ALCH 5BJTB 3CXDH 3LKQB 3SN6N 4K7FA 3TO2B 2VO5A 1T5XA 3NMEA 4QRPE 3BKML 3EO0A 4TUJB 1TCRA 4WI2A 4D9QE 2DQHH 4HXAH 3VGGA 3MCG1 5CLWA 2Y5TB 5L88L 4FN0A 1KJMA 1T2QH 3MNZA 4MS8D 5K9JH 1RHHB 4QHLA 2HFEA 3L9RA 3D48R 1G7MB 1BOYA 4JM4L 4K23L 1JHKH 4XXDB 5HYIA 1MCJA 1EUUA 4L8BB 2YBRA 4R7NB 3U7WL 3TM6A 3J8F7 1E4JA 1H15A 4CVXA 1ZGLB 4LRNL 2VIRA 5JW4R 5IVXA 1INEL 1LMKA 5I15H 1A4KA 4JM2B 1F5WA 7FABH 3PWVA 3FMGL 1BECA 2XWTB 3MLVH 2HA1A 1JRHH 1NGQH 3BGMB 3O6ML 4JY5H 2H6PA 2W9EL 6FABH 4FMKA 1ZTXH 5EZJB 3WS3B 1BIIB 4PJ8A 3W2DL 2VB5A 4Y16D 2NYYC 2PTTB 2AJXH 4TUOA 1NCCH 1DFBH 4XC3L 1OPGL 3LPWA 2W65A 5GGRY 3MRGA 5JNYB 2CMRL 4JVUA 1YEFL 3TZVB 3BHBB 2Y7QA 1OTUD 2DLFH 3QNZA 2OK0L 2Q20A 2Z91B 4Z7NF 3JWDC 4QNPE 1A1OB 1H3VA 5JIKA 5KVMC 1SJHB 2VTFA 3BP5A 3BWAA 1MRFH 4K71C 2X2YA 1ZLVH 3EDJA 3E3QC 4TPRH 3RI5F 3T0ED 3IDIB 3DX7B 4GMSL 1CFSA 1YQ2A 1U92B 3OKEA 3CSYB 1F3JB 4P48A 5CEXB 4R0LC 4HWZB 4P2OA 4L8SC 2AJVH 1XF4B 3P11L 2DQIL 4L3ED 4OIBA 5DC4B 3C60B 4YHLH 1KLGB 5EOCL 5CJ8A 4IRJD 4B50A 3QO0B 3EO9H 4PJFA 3WFHA 2VZ1A 2VLLB 5M7QA 4Z7UB 5DJZA 1OW0C 3ZE2E 4LAQH 2AJZA 4RQQB 5B22A 3SDAD 1U58A 2CIIB 2JJVA 4Z7UA 5DJZB 2NY4C 1R5WB 5DEZA 3UBXG 2HAZA 1QLEL 4JFDA 1AGFB 5JHDE 3T8XB 4MVBC 1HN1A 4ZUWA 3VGFA 4RA0C 3MX0A 2FIKB 4R3SB 4ZOCA 3SO5A 5IVOA 3EYSL 2FO1A 3NFNB 1U8NB 4OZGE 4WHYG 1D6VL 5F7LB 5F88A 3MUY1 3VXRA 3H0TA 3QUMH 3S37L 4YBQD 4L9LA 5DLMH 4Z7WB 1WISA 1FNEA 4KAQH 3MXZA 2XFXA 5FK9B 2P1YA 1KJ2B 5IB1A 5DK0B 1JTTA 4JPWH 4TRPL 3HCVB 3T0EC 4MCYB 1UB6B 4U1NB 3DYMA 4CN4A 2F54D 1KJMB 3WNOA 1GJIA 2JJTC 5CJ5A 4HIJB 2G75B 2ZUQC 4U1IB 5DWUH 2F5AL 1F11A 3ULVH 2BOBB 3VGDA 1TQCB 5T5NG 4X4ZA 1MAML 5D7SL 1A64A 1EDQA 3PF2A 5C9JB 2JJWA 4K9EH 4HG4K 5C1MB 4FQCH 2P5WE 2RHEA 5C0JB 1SJEB 3KDMB 5IW6B 1B4JH 3GO1H 4HK0A 1FZJA 2N56A 4F7TA 1BJ1H 4ODSH 2DI9A 4EI5A 2NY1B 4KMTH 4JQXC 3VFNB 1JGEA 4LU5H 2AJSL 3DXAD 5DYOA 1A6VL 5J06A 4UOW0 1ZHLB 3BMVA 3MV7D 3N5LA 2D0FA 4LLMA 4KZDH 1KENL 1UM4H 3CCHA 4OSUL 1WIUA 5MENB 4UAOC 4GQPH 3CLFH 3IDNB 1T0MA 1X5AA 4KK9C 3I84A 1RUML 3QUML 3S37H 2E27L 3L3DA 1ETZA 3L3IB 1MRDH 5DTFA 5MEOB 3HC0A 1G7QB 4NDMB 2X6MA 3GBML 4HIXL 1Q72H 3BP4B 4K7FB 3H42H 3LN5B 3W2DH 3ZTNH 2NY6C 5B4MD 3BDYH 1OTSD 1U93B 3EOTH 5GGSB 3BQUC 4E0RB 3TH2T 1R0AH 2Z92A 4ZFOB 5BO1H 1EH9A 5D96C 4AK1A 3BKCH 4KTDH 4OGYH 4XP9H 2NY4B 3DV6B 2VDKH 4WI7A 4L9LB 1Y6KR 3GMNA 4I0PA 4LFHD 3STZB 2IPKA 5EG6C 5IGXH 1QBLH 3PWUA 1IGYB 4BQCA 2Z1PA 5D1ZB 1IBGL 1PFCA 1SYSA 1RULH 1L7TH 1U8PB 5J6GA 4HS6A 2O5ZL 2X05A 4HEPG 1AFVH 4XPHH 3S6CA 2P5EA 2ZNXA 2IAMA 1HXMA 5CEZH 1FFRA 4Y88A 5I1LA 2ZOLB 3I6GA 4JREC 2XKUA 4OCNC 1CU4L 3S96B 5T1KA 3PGFL 1XGYL 3T0EB 4MDIB 1KNOB 4XB8A 3W9EB 2VKWA 1TJGH 1H3GA 3PQYD 2DS4A 4WU7B 1TJHH 3MLXH 2DLTA 2DTSA 5C0BE 3B8SA 2ZJSL 4K94H 5J11B 3EUUA 1IMHC 3LKRA 3ZTJH 3P0VH 5HDBE 2D7QA 2JELL 3GJEB 3AREC 2A6IB 3QG7H 5IW1A 4PIRF 4JFEB 1BWMA 4LSVH 1TZGL 4I8DA 5FOBA 2VZUA 4BH8A 3MV8A 3TBYA 3ULUH 5BV7B 3PP4H 3SDXB 1T7VA 1V3LA 5AG9A 2VLRB 1IAII 1A6WL 1S9VB 4Z0BL 4PP2B 5HHQB 2YSSB 1TJIL 3MA9L 4UV4H 1CZ8L 4XP6L 4NKMB 3SGJC 5D7JB 2D3VA 5IF0B 1BQSA 4HLJA 1HQRB 4XWGH 3WFCH 3OKYA 5D2NA 2BNQA 1WWAX 2D7PA 2BY1A 3C8DA 1CICC 4U7KA 2FBJL 3HE7A 1J1XH 1CDUA 4U6TA 2LFGA 2CGRH 5DURD 2KUTA 1JGDA 4WV1A 2CLVB 1YEGL 3RDTD 2O5ZH 3SJVA 2FSEA 3B9VA 2IADB 3G6DL 2ATPB 3MRLB 1L7TL 3HAEG 1HZHH 1MWAB 2VXQL 5HI4D 1D2PA 4DZBA 5HD8C 5E4EC 3LRSB 2PYEB 2VLJB 2BOBA 3JUYA 1ZAGA 3WIFA 1IM9B 1OAKH 4JFDB 3QDMA 1QBLL 4CJ0A 3UAJD 1U8IA 3ALXA 4OQTH 3MLYL 5KSBF 5FYLH 1TDQA 4S11A 1OTSC 5B4MC 2ZZUT 4I18C 1MJUH 5D1XA 2JB5L 1NPUA 5BO1L 4WW2F 2I25N 3KYKL 4P46C 5I66A 5EU6E 3EOTL 5E8EA 2ZG3A 3DUSB 2W59A 2DJUA 1NGZA 1PD6A 2AV1A 2DIAA 2ZSWB 4JZJA 2FBOJ 4NCC1 1JPFB 1AH1A 4ODUB 4YR6A 4RFEB 4PJHE 3SDCC 3TN0D 3WJLA 4WUKL 3GRWH 4OFVA 5F7YC 2CRIA 1JL8A 3CLFL 5ISZB 4N8CL 4MD5A 5DR5H 1RUQH 5HYSG 5IMLB 1KV3A 3CPLB 3HE6B 2YEZA 1UKQA 4Z77B 1YEIH 2CRYA 1WWBX 2D7OA 4QOKD 3CXHJ 2HJFB 2AJSH 4BKLB 4GRMA 2NXZC 3NBNA 4XWOD 4D0DA 3DJ9A 1I1CA 1PEWA 1YNTB 1S7RA 1RUPL 1FG2A 1J05A 2VZOA 1UB5B 4WEBL 1V3MA 5H35A 5IJKA 3E6HB 4KGJA 1UVQB 5B21A 3JV0A 4XNMB 5I1IL 4UMGA 2V9QA 2XQBL 3CFDA 2NX5D 1U8KB 1W8NA 4PJCF 2D9CA 1FJ1B 1QSFB 3TFKD 3M07A 3IKKA 2BFVL 4GMTL 4IRJC 5DD3L 5EN2A 4K7PY 5E6IC 4WEUD 3AMLA 4ZOBA 1X4XA 3BPOC 4N8VB 4XVSH 5F96L 5TF1L 1ZLWH 3KXFD 4JQIH 4CL7A 2B39A 1S78D 4PRDB 4RISH 3S88L 3N1FC 4L4VD 4EDXB 4JM2A 3IFPB 3IDIA 1CR9L 3GKZA 5GGTL 4MNQE 1WT5C 1NCDL 4Z18A 2BX5A 4IRSA 4KK5C 1OD7A 4WFGD 2ICCA 4C4KO 4E5XB 4WFGE 2OR9H 4XXDA 3S4SB 1Q0XL 3T0WA 4OCXL 4IHOA 4W4OA 3FFCB 3RUGE 2Z8WC 3QNXB 4ODVL 3MTRA 1LWRA 4P2RB 1DE4B 3C2AH 3WXVH 3MOQA 3S4UA 2EYSB 1J12A 3OJDA 4R4NC 3SE3A 1C8PA 1OTUC 4Z7VB 1VFOA 5CAYB 2EO9A 1N7ML 4UQ3B 2VLKB 1MI5A 4JPVL 1N8ZB 1QHPA 4PY8J 2Z93B 3BZ4A 4FQXA 1CD1A 5KN5B 4FXKA 2CIKB 3NH7H 1UZ6E 3GLEA 4LIQL 1NGPH 2NYYD 3WJJC 1ZHKA 2BOCB 5TGBB 2J5LC 2JCCA 4MHHG 2XTJD 5C3LD 4R0LB 2EIBA 2Y36L 4UTBH 3ZDXE 3IDYB 5EUKA 3S36H 5E2WL 1KCUL 4RDQG 5J12B 1MFEL 5EZLB 3RWFB 3RP1A 4XP1H 2RCSH 1LP9B 3OR6A 2FJGB 1WF5A 1ZVSB 2X4RB 3VRLF 5I71C 4L3CB 2B4CL 2NX5B 4YAQB 3DLQR 5CJOL 4FXGB 3GMOB 5TE7L 3B9KC 1XF1A 3ARUA 3O9WA 4BSVA 5FHBL 5DZLA 5DRZA 4AEHL 3INUL 4DKFL 4OZHA 1VGEL 5EO0B 3KLHD 4NN6B 5D1QD 1FIEA 1BIHA 2AEWA 4X6BA 4LCYB 3MZGB 2VXTH 4MXWL 5B38G 3ISWA 2VNCA 4XVSL 3T2NL 1U2HA 3AXLA 4NRXB 4P0DA 5DJDA 4XPFH 3SDDD 1JHTB 1R3HA 2W38A 3MFFA 4FZ8H 5AZEH 4PG9A 3FT2A 2XQBH 1SY6L 2O61A 2PUQT 1QSZA 1M7IA 4YUEL 1IEAB 3UTPD 2E7CA 4WUUE 5E5RB 1F4YL 4WI6A 3G5ZA 3PWPE 3LN9A 2KH2B 5EU5A 1L6ZA 2CDFB 5EUOE 2OZ4L 5I16B 1VPOH 3ESVF 1JGVL 3BUTA 5L2KB 5EOQL 1OP3K 1LEKB 5K9QI 2ESVE 5TPWL 2WNGA 4YHPB 4PJDB 1JZ6A 3V6FB 3DYPA 3MGOA 4KUZL 4BSVB 5DT1H 4LCIL 4XP4H 5KSVA 4ZAKA 12E8H 1J05B 4XPGH 3TO4B 3Q6FA 4P99A 4IMKA 4WWID 1QFHA 3VGEA 5EZLA 3RWFA 4PGBB 4LSDA 2CPCA 4JY6B 5CKGA 4PJBB 4Y2OA 3F7YB 2JJUA 3PQYE 3C9NB 1U8HB 1T5WB 5E4IA 3RVUC 4KZEL 5DRXA 5DVNA 3OTTA 1MRCH 4R0LA 3GSXA 4XRCA 1WAAF 2X44D 3GSNH 5C9JA 3MLWH 2YK1L 4HV8A 4HK3J 5AEAA 1CFSB 5KG9B 3L5HA 5IHZA 1IGCH 4J2CA 2VZSA 1L4IA 4X98B 3ARDD 4YXHH 1Q0YH 2F54A 4ZO7A 3IDYC 2VZVA 3FFCA 4NO3A 1FL3A 5J12C 2Z31D 2V7HB 4X9BA 3DO7A 4PJDE 4AEIH 4NN5B 4LK4A 1DUYB 4UQ2B 4Q2ZA 2X4NA 4PJEB 5JPMB 1AQKL 3CGTA 2I9LA 5JA9A 1D5XB 1M4KA 1S5IL 1KEMH 1EAPA 4YWGL 4L9LC 4JO2L 4Z0BH 3RKDD 1HK6A 3QQ9C 1FRGL 4D3CL 2F9BT 3ZE1E 4XPAH 4LVNC 5D1ZC 1QKZH 3H9ZA 4EN3B 5LGKA 4Y4KA 1R5WA 3LRGA 1U8QB 4ZFOL 5B38A 4PJ7F 3ARRA 3FOMA 1MHPL 1OQOA 5IEKB 3CVIH 2VWEE 1ADQH 1IC4L 4RGMC 4JN2A 3VH8B 1QEWA 4XP4L 1G0YR 4JLRA 4KUZH 3BYTA 4O58L 4FABH 4LLYA 2DTMH 1KLGA 2XV6B 5I2IA 2H8PB 3UYRL 5BCAA 5IMMB 1LO2H 2HVKA 1CE1L 1CE6B 2OZ4H 4KI5C 1NAKL 1ZVHA 3NN8B 3C60C 3BVNB 2OR7A 4J8RB 15C8H 2D0HA 4X8JA 3QH3B 5IQ7H 4AEHH 5HYJA 1TETL 4X4XA 3BD5A 1INDH 5JW4N 2UY7A 3GIVB 5CEYB 4CMHB 2B4CH 1YDPB 4LCWD 1A1NB 2BVPA 1NBVH 2J8UF 4XP1L 2QLVB 3LPGA 1YEKL 1E28B 1M6OA 3DX9A 4K07A 1KYOJ 3TNNA 2ZCKL 2VDRH 3WLBA 3I3EA 2VXVH 3M17B 1GAFL 2VXTL 4MXWH 3CZFA 4OFPA 3C5SB 3SKMB 4M02A 5C2UB 3AU1B 5DQDL 1W0WB 4P9ML 3E1F1 3EFFA 3CFCL 3G6JB 1HE7A 3GNMH 3MV7B 1MCIA 3RIFF 5DQJB 3VFPA 4APQC 4QNPF 1ONQB 3V0AC 3KYAA 4RA3A 1JWSA 3C2AL 4N9GA 5AG8A 1WBZA 3G04A 2BSRA 3V6ZB 1MF2L 4MJIE 2R2EB 4LPYA 1A5FH 3VD3A 4IS6B 2Q7YB 3CX5K 2Z92B 4QTHB 1BP3B 4YPGA 5L6YH 3QCUH 1HNGA 3O3EA 4FFWD 2L7UA 1BPVA 3C5ZD 1H8SA 3U9UB 3HC0B 4GFTB 2UYLB 3I02A 1DTUA 3ME0A 3T0AA 2AKRB 2QR0A 2IAMC 3FTGB 3I85A 3W9DA 3VA6A 2H3NA 4YHKH 5I8CB 4Q74A 2IMMA 2YPLB 4U2YA 2AEPH 4X80L 5J56B 1V05A 3RUGF 5IHZB 3UJTH 1A7RL 4XBEL 5FYJL 3G9VA 3SDCB 1KG0B 3DXAA 4ZXBC 1C1EH 2WWKT 3JV6A 3BKJL 2I24N 1CBVH 1I3RA 3S88H 3VRLE 4ETQB 1LNUB 3ALPA 4RDQF 4U1HB 5EU6A 1N26A 1WVZA 3ARYA 2FJHB 2IANA 3ZTJG 3ZT5A 3S96A 4PRNB 5GS0C 4I5BA 1DANU 3NH7L 1CLOL 1FFPB 3HMXH 4XMKL 2A1WH 3H2WA 3VWKC 1YMMD 3FONB 5JMOC 1AJ7L 2CLZA 3B2UC 2VYRE 2GJZA 2IWGA 3RIFK 1MFBH 5MHSD 2ADIB 3SBWA 3DX6A 1J8HB 1ZKEA 3G08A 3SDAB 1RUPH 4HMEA 3KPPA 5E8OB 2JIXA 2G5BB 5JW4Q 1MFDH 3P0YL 2FNBA 5C0CE 1NCDH 4IRJB 3F7VA 2ICEA 5GGQH 3FCTA 2A38A 2DQFA 4HHAB 4QHMB 4CVWA 5F7NC 5C0DB 1TTUA 1E6JL 2JB6B 5E8NB 1XR9A 4XNXL 1FSKB 5BMFH 5E2VL 2BSRB 5GGVH 2X10A 4J8RA 1GGCL 5I71B 5TFSH 4TQEH 1XGRB 2KL6A 4C56B 2NY4D 4ODUA 4YR6B 2DTML 5BW7C 5I1KH 3D0VA 4LHUD 5DMGD 4KVCL 2DQIH 2ZUTA 1E27B 2WWKO 5BQ7B 4BSJA 3QUZD 3UC0H 1YEDB 1U58B 4EZMA 2NX5A 2ARJB 5JQHC 4DGIL 1FNFA 4FQPA 5DYOB 4PR5A 3MUJA 3QIBC 3FT4B 4PGDB 5HI4C 3MRIB 4P2CG 4U6VL 2OXHA 4KHTL 2Q7YA 4POUB 3O4LB 1FBIH 2QTEA 5K9KA 2YRLA 1D5MA 3KDMA 1ZLUH 4X7DC 4DN3L 5IW6A 3MNVB 4M3JA 3SE4A 2IJ0C 5ACLA 4R4BA 1PYWA 5KSBA 1CL7I 1D6EB 2ZSVA 1Z2KA 1MCBA 2R2CA 2EYRA 4OLXH 2YD3A 1WBYB 3QG7L 4LLUA 4KK6C 1OP5H 3D9AH 1T03L 2G60L 1NCCL 2H8PA 1S7QA 5D2LF 4WFHE 2YKLH 5L8KB 4NJ9H 4M6OL 1CT8B 1CXFA 3PWJB 4K94L 2EDLA 3U0WH 3HZVA 5D2NC 3BH8B 4G6AD 5ANME 1GYAA 5DJ0B 1UWXH 3L6FB 1CXKA 4LMQE 2F54B 4K3JH 2XPGB 4RMTA 4KKBD 4Q6YA 4EDWL 1IGCL 5FK9A 5C08B 5I9QC 3QR2A 2M26A 4HXBL 4O2FB 5AZ2H 1CS6A 1LVEA 1N2RB 1NAMH 5EU7E 2COQA 4WFED 5KSAD 5J3HD 4K71B 1OP3H 1MRCL 1YEGH 4YHYB 3QCTH 4IDJL 5F89B 2UWEB 3TWCH 4DK6A 1JP5A 5DS8B 2I9LB 1RULL 4PJIE 3WUZA 2OMNA 3U4BL 1JFQL 3Q1SL 3RWGB 3KLAA 3QUMA 2EIDA 1SYVA 4U31A 1S7UA 3WFCL 1DUZB 5DMJB 1T7XA 3O2VH 1CZ8H 2WBJA 1F6FB 1MUJA 4GBXB 4C58B 5BOZG 3DVFA 3LIZH 4HJ0C 1LD9A 1HHHA 2CKBA 1A6AB 1ZANH 1MUJB 4GXVH 2O93L 4WGWB 3PUCA 4CDHA 5B38B 2E9JA 3ULUL 4JRXD 3MZTA 1OAYH 3HPLA 4U4BA 5FKPA 4GRMB 4RBPH 1FGVL 1NGWB 4J6RH 4D9LL 5I1DB 1M7DA 4TUJA 2EE9A 3W39B 3UBXA 3VFSB 3DVGA 3MPCA 5CJQH 4TQEL 5ISZA 3HKFA 3X14B 4PLKC 1IAKA 1Y6MR 3QDJE 3QBTB 4EN3C 1MFAL 4PJEA 4RFEA 2JB6A 1NEZA 3DMMA 4Y0GA 2PYFA 2DAVA 2WZPD 3F7PC 1QSEA 4CN1A 1KIQB 1OAQH 4QWWC 4NQTA 4CW1A 3MRHA 3P0YH 1WUNT 4JANA 3QIUC 3RZCC 4UTAL 5HYFA 1HYRC 1P84K 5F93C 3WE6B 4YHZH 1RPQA 4ZAKB 4LNRB 5C8JB 1RU9H 1M1SA 4XI5C 4J1UB 3V5DA 1YEDA 1FLTX 3QB7C 5DHVB 1WIPA 1U8JA 3B9AA 3VI4E 1UADC 4M62H 1JCKA 1EBAA 4MNQA 1H5BB 3GRWA 4LVHB 5C0IB 1BBJA 2FJFB 3IGAB 5JIHA 3KLAB 1ZHLA 3D0VB 1KIRA 3L1OL 4NPYA 5I1KL 2ZSVB 4YXLH 1BVLA 4ZNEA 5DMGC 4CMHC 5E08H 1DQDL 3VE0B 1HHKB 1RUAH 4P9HH 5EDXA 3FQWA 5MEPB 1OGAB 1R3JA 5EULV 8CGTA 1AHWA 3X3FH 4PJBA 1UQSA 2VXUL 1N0LA 3WNKA 4D0CA 1K6QL 1V3KA 1V5JA 3QJFB 2I5YH 4QEGA 3ZSSA 5DURB 3OWEA 4ZFGH 3SGEI 3GSQB 4OCXH 1A2YB 3P3YA 4UNUA 4PJHF 3DO3A 2J5LB 3MLTA 3MNZB 1KXTB 2AKRA 2AW2A 5FUCC 4RFOL 2JTDA 3MLSL 4Y5XA 1L6XA 2UYLA 3I02B 3LEYH 4HFUH 3TCLB 2WBKA 3B6SB 5DC0A 1I85A 3GMQB 4LLUB 3ZYIA 2MHAA 3BDXA 4KMTL 4JRXE 3MOBH 1ZV5A 4GG6B 3PL6C 2VSDA 3O45A 3S5LB 5T3XE 4AL8L 3VE0A 1OAXL 5FAAA 5INDA 3B9KB 4GW4B 3GMLB 2C1OA 3IVKB 2PXYD 1I7ZB 5DD1H 1NKRA 4XBEH 5FYJH 1F3DJ 3WIIH 2WUCL 3RAJL 4L4TD 1I1AB 4DWHA 5BRZE 5BW7A 5CP3A 1WC7B 1EX0A 3OKMA 1OP5K 4YXLL 3LKSA 4CNIB 1DBJH 4NOBA 5IFAH 4C57C 1ZA3B 4LARH 1YJDH 1UJTA 1YNKH 2QQKL 3LY6A 5HYJD 3DROB 2VABB 2QHLA 3NZHH 5JZ7C 1OW0A 1TZIB 1DZBA 4M61B 3M8OL 1XR9B 3MYJB 4YHZL 2OR8A 2PO6C 2A6KA 4ODTL 1G7PA 1JK8B 4HLZH 1CD1B 5JPNA 5KVDL 1IGFL 4TPRL 3KS0H 5HGHB 2GJ6D 5GRXG 4OCYL 4ZUWB 4GXVL 4D2NA 2W60A 1NGQL 2NZ9C 1JMXA 4KHXH 1JYVA 1UYWH 4EXKA 5T33H 2B0SH 1OD9A 5SWSD 3VXME 4YFDB 1E4XI 4IRZL 2NW3B 4GRWB 1NGXB 3FB6A 5JNYA 2GSIA 3WLBB 4P5MB 4MD4A 2DQDH 4GAGL 4ZFFB 3HS0B 4NKOB 1H3XA 4QRPB 2FJHA 2IANB 2E6JA 3C60A 1BIIA 1XFPA 2R9HC 3PNWB 3A6BH 3V6ZA 3KPRE 2AJVL 4ELMF 1KTDA 2WSKA 3RWIB 3DXAB 5HVGB 5KW9L 4X6CF 5IVXF 3O2DA 1O5DT 1JNLL 2EC9U 5DQJA 2CK0H 2CD0A 4HW6A 3DX7A 2HH0H 1OHQA 3VD7A 1F02I 2MKLC 4UQ2A 1Q9WA 4J3UA 1MRFL 4K3EL 3QI9D 4DVBA 2C26A 3RX8A 5SV3A 1J0HA 3ZDXF 2EH7H 1UXSB 4OGXH 3UJJL 5FV2A 1T04A 3QUKB 4F3FA 1AGDA 4OF3A 1H0DA 1B0RA 9CGTA 4O4YL 3V5KA 3FQXB 1VEOA 3SDXA 3BHBA 3D0LB 3EYQD 1LE5A 2FDBP 4IRSB 3WLWD 4BKLA 3TT3L 4OLXL 3P0VL 4HKBA 1S5HA 5F1OB 3K1KC 4M5ZL 2A6IA 1HCVA 5C6WH 5I19L 4O51B 5GGRB 4OLUH 2BVQA 4HKJA 4YDJB 1GC1C 4OJFL 4UNTA 3RA7H 4KK6D 1P7KA 1G6RB 4FTVD 4HFWB 4NQVB 4GRWF 2LU4A 2NNAA 2VLRD 1YMHB 4YGAB 4LQ1A 1F4XL 5FB8B 4G43B 5I1HH 5A2IH 1JZ7A 3REVB 1F90L 1KLFA 3TN0A 3U36A 1T03H 4HZAA 4XAKE 1AGFA 2BNUB 3T8XA 5D2NB 3ARGA 1HDMB 5C6TL 3T77B 3TEUA 4YFLI 2EDRA 5H35B 2YC1A 3BISA 1ES0B 1ZT7A 4N68A 3FHAA 5KVFH 1K5NB 3IFNL 1Q0YL 5GJTH 1S7VB 3BFOA 1U91B 1FBIL 4YDIH 2WZAA 1YQVL 3JSSA 5F70A 3PQYB 1KTKE 2VDPH 5LGJA 1NFDE 4HCRH 3BP7B 3O0RH 1QPXA 1ZK9A 2K9UA 3T3MF 3UTTE 4JGJA 5DUML 4WHCA 5C08D 3MCKA 5ALCL 3BRDA 1CFQB 5C09E 2VMFA 4OKVB 4NNPL 4ORZC 3V7MA 1CFVH 2AXFB 2ZUYA 3H42L 4I48B 1XR8B 4XVUD 3SHSA 1JHTA 3IJYB 3VI3F 4FNLH 5EBWA 2BSSA 3RVUD 1XEDA 4NUJA 2J3SA 5H37H 2ZOLA 4ELME 4R90L 1P1ZA 1VHPA 4OV5A 1LK3H 4X6DB 1MLCA 3F5WB 4JO1L 4QF1B 5C0ND 1NDMA 4OI7A 1KENH 2ADGA 3G5YB 1P69B 1MCFA 5TE7H 1S9KC 3QHZH 1C5BH 4OCSH 4B7IA 1K4CB 3KWWB 5D7LA 3ULSB 3NFSL 4JFHE 1MNUH 4A6YB 1IC5L 3D85D 4NWTH 3TH3T 4MX7A 5H2BB 3VXRE 1A9EA 3MRDA 4WWKA 1B0GB 1QD0A 2EKSA 1U95A 4FQCL 4M6MH 5F1KC 4NKIL 1B88A 5EWIH 3NTCL 3SGKA 5I8OL 3SE8L 3WN5B 4H25B 3HNSL 2BNRE 5EC2A 3LQMA 3WBDA 1MLBA 4XVTH 1YC7A 3RDTA 1J87A 1HNFA 3SJVD 4E42B 4PGEA 4E0RA 1CWVA 4FA8A 5GSRB 5DWUL 4TTGA 3PJSA 3RVVD 1NBZA 5T5FH 4JFQB 4ALAH 4IEFB 4C4KT 3SDDC 1LEGB 1HXYA 5DK3A 3FTGA 1VGEH 3DRQB 1DEEB 2FHCA 4PGJA 3V6FA 5IVZA 3L5XL 5GS1B 1SYSB 2X9YA 2F58H 3IAGC 4OLYH 3MRCB 2MQ3A 1AGCB 1IM3A 5L6YL 2J6EH 4UUJA 3KLHC 3HI6L 5DRWB 3OXSB 4ZO9A 1R3LA 1XAUA 3A0OA 1BEYH 4QY8B 3TZVC 5ITBH 4JHWL 4I4WB 2Y5EA 3BKYH 1KSRA 3VWKB 3P4OB 1D9KC 2NY3B 3TNMB 2A83A 3SOBH 4UINH 4ZFOA 4XCYA 3TV3H 2DQCL 1L0YA 1JF1A 4X9HA 4QXWA 1UC6A 1FFNB 1LILA 3QDMD 4JDTH 1S9WA 4UBDD 2V2WA 2ZUUA 4PJ7E 3AAZA 3AREA 2M2DA 3RL2A 2IPTL 4P9MH 3SDAC 3V0WL 5ICXB 4BH7B 3PE9A 1KPRB 2XKSA 1MQKL 1ZA6A 5T3ZH 1GZQB 3BJLA 4L8SB 5F9WC 3BKJH 1UJ3C 3L7FB 5AWNL 2VDRL 3UTOA 1IAIL 2DYPB 5HY9B 4Y19E 3RVWC 1ZKAA 3PL6B 4AG4H 4NN5C 1RZKH 2ITDA 4M7LL 4Y19B 5FO8B 4MA3B 3PWNA 3SCMA 5EU4B 3CKDA 4NO5B 5CP3H 3IS1X 5F71A 4FI5A 5IR1A 3MYZA 4XBPB 4I3SL 3BAEL 3J7HA 5T5FL 1INQA 1BJ1J 3W39A 2FATH 3BZ4B 5DRWA 4XH2B 5IFJB 4O58H 1B9ZA 4J3XA 5A3IC 4JFZL 4HIJA 5D7KD 5TDNB 2OK0H 1KOAA 1GGIL 1CFVL 4L29B 4ZTOH 1A1MA 1DBMH 1EZVX 1X6NA 1HWGB 4K7PX 4FOMA 1NL0L 4L4JA 3QDAA 4UBDC 5L2KD 5IOPA 2H1PH 5DC9B 5E24E 1U8IB 4PJHB 3DGGB 1R5VB 1MEXL 3ARDC 3BGFC 4X6CA 4F7PB 4P2OC 1IGJA 1OM3H 1UM6H 4FFZH 5HHMD 2DOCA 1JPGA 1NLBL 4AQOA 4G7YH 3DNKA 1KEML 1GSMA 4N8CH 4N8VA 4MX7B 5E70A 5H2BA 3HLAB 1KULA 2KZWA 4N0YH 4UILH 4KK5D 4OD3H 2R56H 1VDGA 5J1TC 5K9QG 4B5EA 3VFWB 2HKFH 3SDXF 2BNQE 2DI8A 4Z7VA 1FO0H 4MAYA 5D1QB 4HKZA 1MJ7H 3G6JE 5DJ8B 3L5WB 4JDVA 1TETH 5JXEC 2HN7B 3BZFB 5DJ0A 4EJ1C 3WNMA 4D9RD 2ADFH 4JJHA 4UZGA 4R8WH 2HN7A 3O9WD 4X5LA 3P77A 3Q2CA 1UA6L 5D7LE 4HJGA 4CW1B 1BF2A 3KJ6L 4HAGA 3UYRH 1OAKL 4EUPB 4U1KA 3CXDL 1CXIA 1EERB 1EXUB 3GI8H 5DHVH 1JWMA 2E9BA 3FO1A 3HG1E 1HSBB 2ZKHH 4ZPTB 1XIWC 4UAOB 3ULUF 3IDXH 3BIKB 2B1HL 5HYJB 5HD8D 1ADQA 3CVIL 2WBJD 4HH9B 5C2BL 4DGYL 2YUZA 3KPSB 3QEUB 4NKDB 5AD0B 1IC1A 2VL4A 4Y5VB 5FHAH 1EGJL 3VU2A 1S7XA 3T0EA 2VLKD 3O0RL 3NIFF 5FYKU 3S3SA 1X5IA 4JY6A 3HG1A 5GRWA 4RAVB 5GSVB 2E9IA 5ADPL 4OI9A 5EPMA 2CK0L 5I1LB 3ZMRA 2A77H 4HPYL 2PTUA 4OJFH 3NCFB 4A2MA 2YC1B 2EDQA 3V8CA 1I9IL 2H26B 3VXMA 5IB2B 4TUOB 4WTXA 1X5ZA 1EZVY 2XKNA 4HWUA 43CAB 3NPSC 2XA3A 5ADOL 3T4AA 3EO0B 1A7NH 4IGBA 2EH8H 1JZ8A 2AJUH 5FDYA 4PD4K 4F57L 3BD3A 1HI6B 1AIFB 3UROR 3GUTB 3QZWB 1KXVC 1X5LA 1YN6B 2IBZY 1FZKB 2APXA 1EO5A 2BSTA 4ZAKC 4XPFL 4LDEB 1JNHB 2UWEF 3BSZH 5D6CB 2XWJA 3ARDB 3V6OC 1TZHB 4OF5A 3UO1L 2EXWD 4WRLA 1N5AA 1R3IL 1H9VA 4R9HA 3VDAA 1ACYL 1IM3B 3TT3H 1CD0A 2GSGB 3FQRA 4OZ4A 3OKNB 3O6FB 1G84A 3JVGC 5SWSA 1I8MB 1HXMB 1MRDL 3ZE0F 2OJEB 4JE4B 4U1JA 4BZ2L 4C83B 1CCZA 3PG2A 4X6FA 4YHMH 5IJVB 3M8OH 3LH2L 3MBXL 5GGTA 4F2MA 4KZEH 4XNUH 1HEZB 2QEJA 4GRLB 5B3JF 2P24B 4YAQA 1U8PA 5J6GB 5SWQB 3QEQB 4HMDA 3W0WB 1IBGH 2R56L 1H3WM 2AXGB 3QIWA 4KY1H 3BRFA 1A3LH 5T5NF 4LU5L 2H32A 1AXSA 1EPFA 3K2UL 2EYTA 3NCYS 5AYUL 1D5ZA 3G5XA 5JXAL 4PJ5A 1FSKC 2IH3B 4DKFH 3RUGB 1UM6L 4ZXBB 4FRWA 2VAAA 3H9SD 4P2QA 1MEXH 5GZND 4R96B 4JAMB 4GKNA 2XTLA 2PR4L 1EAJA 2RCSL 3LN5A 1QO3B 1BD2D 3V4VL 4Y5XC 1ZT1B 2HTKD 1QRKA 3FB5B 1FAIH 3H9HB 1OAZL 5HPMB 3T1FB 2K1MA 2QL1A 5TDNA 5I1CH 1P1ZB 3IB4A 1UACL 1BQHB 1XCQB 3GMMA 4IM8A 3ZKSD 5D1ZA 4QRQB 4N0RA 4M6NL 3CFBB 1VESA 3Q6GL 4Z7NE 4HWNA 2A6KB 5DHYA 1T7ZA 2C1PA 4I48A 2MCPL 3TV3L 1C08A 5CHNB 1J8KA 4LLAA 1V7ML 3IKCB 3G6JF 1C08B 5CHNA 3VA2C 4L4TA 2HTLC 2ZOKB 3AS2A 4QXUL 2QKIB 4FQ1H 4JRXB 4B0MM 2AJ3B 5FUOL 3U7YL 3WIIL 2J6EL 3W0WA 5IKCB 3FQNA 4LCWA 4LARL 1S78C 2MJWA 2RB8A 3D5OF 1P4IL 3E2HC 4P2RE 5E6ID 1DEDA 3P73A 2IPUK 2O5YL 4NO0D 4NSKB 3E6FA 2CXGA 2DM3A 4JQIL 4P59L 4JFQA 4ALAL 2LU7A 3QWOA 1SHMA 3DV4B 4GW5B 2A74B 3EO9L 4GKNB 3QUXD 4OCLC 1D9KB 4XVTL 2NY3C 3O6FC 1U3HA 4JDZB 1LP9E 4KKCD 5I1IH 3SE8H 2BVTA 2AXFA 1IGML 1U8OA 3TIDB 4LBEA 2EIEA 4GRLC 3TCXA 4NWTL 2CIKA 1KF9B 4YBQC 1IRAY 1BD2B 3P9MA 3Q6GH 3T4AB 2F58L 4EUPA 3BPOB 5GGTH 4JY4A 4APQA 4PJ7B 5B39B 5IIEB 3FB7A 3MACL 4HFUL 4RMVA 2HFFA 4B7LA 2B20A 3WV0A 1ED3A 1SVCP 4PY7A 1YUHB 3OKNA 3QEQD 1I8IA 5GS1C 5HI3D 5T1LB 4QXGH 2P8PA 3B3IB 2MQ0A 4YQXL 5IVNA 3EGSB 4UOW1 1LDSA 4LCUB 4P2QB 5CUSH 2PR4H 1U8LA 4AYFA 2NNAB 1NMAL 4N0FB 2ATPA 3MRLA 1T6WA 1XT5A 1X5KA 3AY4A 3VXUB 3GSWB 1EAPB 5EBMA 2YD2A 3C5ZA 4GKOA 3K2UH 4NRYB 4Q6IA 2XKNB 2DJ4A 3D25B 3O3AA 2XXMB 4TSCH 1RIVH 1A7QH 5E5UB 4X7CC 4XNQB 1SJHA 2NW2A 4CMMB 3IFNH 3CVHL 2CK2A 1II4E 3I50H 3NCEB 4Q9RL 4IDJH 3DETC 1MELA 5F9DC 4E41D 3MBXH 3GJFH 4JM2C 1JHKL 2BY0A 2XN9E 4OZ4B 1U36A 4GBXC 5J57B 3RPKA 1FDLH 5DJ8A 5JUEH 3TN0B 5AUMA 2Y25A 3BPCA 4OGAD 1H5BC 1NC2D 2BHYA 4D9LH 5D6CA 3P9MB 3UP1A 4YH6A 1F42A 3BKMH 4EDWH 1KCRH 4G80A 4J3WA 3RA7L 3NIGF 3IXTB 3OKKA 1IAKB 1ZANL 1RJZB 4NQED 1MY7A 4X7FC 2GITA 5DRNB 3DURB 2BCKA 1NDGB 4LLVA 1A7PH 1FYTA 2CKNA 2OX5A 2VDPL 1NGYA 4HKBB 5KANI 1J8HD 1ZXQA 4HKXA 4I9WE 4RNRB 5C0GA 2EIZB 3CFKB 1CDJA 1DL7L 1VGKA 3WNNA 5KVFL 2XG4A 5HGBA 3H9SE 1F58H 4LHUA 1XGTB 2XRAH 1ZT7B 3QDJB 5ITFB 4U6XB 3O81A 3DMMD 3OZ9L 1ZEAH 5J9PB 4KWUA 5JIIA 2UVFA 1NMCB 3SKNB 4CAGA 2NY0C 2CLRA 3OKLB 3RNQA 4NRYA 4H5SA 3PDOB 3ES6A 4RZCB 4XP6H 5CEZL 2D4FA 3HZMA 1DBAL 2WANA 3GM0A 4QGTA 4XP9L 2CJUL 1JPTH 2VN4A 1N59B 2HJLA 4XNZC 3DI3B 2X1XR 3O45B 3S5LA 2ADJB 1CK0H 3U6RA 4G6AC 4EVNB 1Q72L 3QXTA 3UTZA 3MV9A 3D69A 1KFAH 3BPCB 1JZ5A 4JQVA 4MA8L 4QRQA 2IQ9H 3FJTA 4R7NA 4F80A 4PJEF 4NOFA 3JWOL 4WFFD 2LABA 3BQUD 4Q9RH 2X4OA 3ARXA 4ZNCD 4L8DA 2W60B 3ROLA 4XZUB 3H9SB 3T3ME 1NC4D 5HHVH 2AABL 2BC4A 3LDBB 4JG0L 4JFFE 2V2TB 4GT7A 1AGBB 2W0PA 3L5JA 3OR6B 1EFXA 2OSLA 3OJ2C 4HMCA 4XTRC 3O4OC 3VFNA 2EICA 1RJYB 3BQUA 5JUEL 4EI5B 4KPHL 1RZJH 5CINH 3KPOA 1IQDA 4XPHL 2DIBA 3Q48A 4X9GA 3CSBA 3LQAC 3LB6C 2VABA 1OLZA 5MHSE 2GTWA 2R15A 4JO3H 4UT9H 4Y5VC 1FNGB 3QAZB 4HUVB 4DN3H 4X6CB 4F7PA 4YQXH 3QO1B 1IAIM 1T21A 2XZQL 4ODXB 3GLDA 4WDIB 5FA3A 5IFAL 1SJVA 1U9KA 5KSVB 2OLDA 3PHSA 3QUYA 3HG1D 4ZPVB 3TBTA 4DGIH 4I77L 4HF5L 1B4JL 3GO1L 2Y1VA 4P2RA 2BSED 4XNXH 4L8DB 4TRPH 5INCB 2K7QA 2X4UB 3GSQA 4OCYH 5ECJE 4WFEE 1YEEH 1B4RA 3AVEA 4YJZL 5GRJH 4IOFC 3MRFB 4NUJB 3QIBA 4KAQL 2CRZA 1AC6A 1XGRA 3NCCB 4D0CB 4PYGA 2P46B 2BRQA 1OVZA 4JRYA 1DBKH 5F3HA 3VXUE 4G8GD 2RAMA 1F45A 5DFVD 3MYJA 1N64L 1IEAA 1RI8A 1V7MH 2X70B 4QCIB 3S35X 3GSNA 2C1PB 1LO5B 3MV7E 4I13B 3QIBD 3TVMD 2W0FA 1U8NA 1ZWIA 3IFLL 5EOTB 3JWDL 3LN4A 4OFDA 1KIRB 1G7QA 4L9DA 5H37G 3WHE0 2D2OA 4M43H 4AG4L 4Z78B 5IP4A 5FKPB 4PJAE 3NA9H 3MO1B 4HQQL 4K8RL 5KOVC 4ZS6C 4HUMB 1P53A 5MENA 2OMBA 3WIHH 1DQJA 4MSWA 3HMWL 2ED7A 1IJ5A 4YE4L 1ZVSA 4X4YB 3L3PA 1FL6A 5C09D 5L7XL 4NQCA 4IGBD 2W9DL 1RK0A 5DD0L 4YNYB 3RWGA 1HOCA 1QLEH 1FGNL 1QQDB 3BEVA 4HEME 3SY0B 5C9KA 3D87B 2O5YH 1BQHG 2OJZH 3QPQD 2MCPH 4LLDA 3P4LA 1GXEA 1UJ3A 1FHGA 3CSYA 3IS0X 1UH2A 3IXTA 5GJSL 2ZCKH 4JKWA 3NN8A 4TUKL 2XZAL 3QDHA 4UIKL 4FXLA 3UDWA 4TNVK 1VENA 4M62L 1HINH 1PEZA 5I8CA 5IMOB 4GG6F 4Y5XB 3RHWK 3CVHA 2NY5L 3EJJX 1PLGL 4GW1B 1INDL 1MLCB 4P3DA 2A6JA 4X7TA 1SMAA 4R2GB 5H94A 3UX9B 1I7TA 3RNKA 1C5DB 2AI0H 2FGWL 1ZT1A 2X4TA 3V4VH 2CDEB 3KYNB 1J9CT 3QIWD 4U3HA 3RWCB 5E8DL 1NAKH 2CR6A 4KMQA 4JPIB 3VXNA 1C5CH 1VEMA 4RSVA 3OKDA 1I4FA 2QSTA 3X3FL 3LZFH 4FQHB 4FP8H 4MQXD 1BZ7A 3VMOA 4RMSA 4DZBB 3VFOB 1W0YT 2JKXA 4GLRI 1AO7D 3RUGA 1J0YA 2WWMD 2AK4B 2Z31A 3JWOH 4FG6D 3MRDB 3SKOA 4NHUB 3VJ6A 4CVZA 1IC4H 5ANMA 1BBDL 4LVEA 2HWZH 3V52H 1KN2L 5K9KB 2FH8A 1IGJB 1FGVH 4ELMA 2PXYA 3PV6A 2AAVA 3P9WB 1HHIA 3IDGB 4OZIA 1I9IH 3MJ9H 4KJPC 5CP7A 3L6FA 4WJ5B 3UTSD 4MJIB 5JHDB 2NTFA 2VSCA 2X4PB 5DO2C 1I7TB 3RNKB 3MR9B 5HBBA 1MCWM 1QRNE 3MCLL 1FL5A 4U1MA 3QO0A 2FEEI 3PWPA 4ELKA 1OAQL 5C0FA 3T4YB 3TLRA 1PKQB 5AAWA 1KELL 5K59E 5EORL 1J18A 4L0RA 3IRPX 5A2KH 2UWEA 1WCBA 1QFUL 2G9HB 1YEHL 3U0TA 4PJ9A 1QYGL 2FX8H 5E7FA 4PTUB 2QQNL 3HMXA 1QLFA 4X5XB 4XCEB 1BJ8A 3WN5C 1ACYH 4YFLF 5ACZA 3L3OA 4G8FA 3F7VB 4XCCL 4M7ZB 4M93B 3FN3A 5TDOB 2EXYC 3W11C 4L4VE 4JR9H 4PGBA 2QSQA 5I8EB 3CUPB 1ZTXL 5CZXD 2R1XB 4YZFE 1FL6B 3ORJA 5E9DD 1KCKA 3O6MH 3VH8A 3A6CH 2XYCA 4V1DE 1NCUA 1NCNA 4X6EB 5DVLA 5IBLC 3FMGH 1OSZA 2NPLX 1I1AA 3UCRA 1S7TA 2PO6A 5EBGA 2EEAA 3HG1B 4OAWB 1I85C 4GUPB 3D9AL 4MJID 5ERWB 3EOAA 3LRSA 5ADOH 4P5TC 3RVTC 2R8SH 1WGOA 5FM4A 1QR4A 3KPNB 1F90H 3U7WH 1PG7W 4RMRA 4N0YL 4JGMA 4J3VA 2C3WA 2BDNH 3DIFB 3O3BA 5FCUL 2CKBL 3VWKA 3ZLQC 1A7QL 1S5IH 1I9JH 1EXUA 3VXTB 2FR4B 3GJFK 5D71L 2P44B 4BYHA 4RIRA 2IBGA 2G5RA 1UA6H 1GVIA 5KVEH 4DVRH 2XPGA 5B39G 1UT9A 4G9FE 4N9OB 1EGJH 4UDUA 3QXAA 3WKML 1FFOB 3H9YA 1XZ0B 4LDOB 2M8XA 3TBVA 4G6FD 5SWZE 2A6JB 2FX8L 3PGDA 2NX5E 4L29A 1I7RB 5F7WC 4F7CB 3FQTA 5F9WB 1E6OL 1YEHH 2GCYA 4ENEC 3SDDB 3ROOB 5E8PA 5C3TA 5C70A 5IT2L 1PQZA 3OJVC 4ZXBD 1A3QA 5I1JH 2IAND 2Z8VC 4N8VG 3B83A 5E2TH 4ONFH 3ILQD 2WIIB 2E3VA 3HNVL 3FN0L 1OGAA 4JFXA 3MCLH 4OTXL 4W4OC 3QI9C 4B41A 4ERSL 2I60L 5HJ3B 1GPOH 3PWNB 3U1SH 3EDFA 3NACH 4FFZL 1U95B 5BS0A 1U3HB 4P5TD 3RVTD 3KPOB 3OF6D 2GJJA 5C07B 3O41A 4Z7VE 4O00A 4AEFA 3V79C 3RIAF 1NANI 5D7LB 4WU5A 2JIXD 1RZJC 4IIQB 1Q9KA 4NFDA 4F15C 3O6FD 4NBZB 3V4PH 4RGNC 3S36L 2XN9B 3GSUB 2V6HA 3PGDB 3VD5A 1ZVYA 3T0XA 1NC2A 3LRHA 4HJJL 2NY0B 1WFTA 1A22B 2LTQC 2IPTH 4JKKA 3OKOB 4HZLA 4BQ8A 3VXPA 3ZDYE 5BVPL 3MBEB 1VFUA 3Q5TA 1CL7H 4GO6B 5IUSA 2GUOA 2FGWH 2X4SB 4XMLH 1X5HA 3R0MA 5D7IB 4JKMA 1T3FB 3ZHLA 4JRYB 1IAMA 3ARFB 5JHLL 2R0LH 3NZHL 4NZUL 3BJ91 1YZZA 1IKNC 3U7YH 1KCVL 4P2QE 4K8RD 3UJTL 5IM7B 2FIKA 4Q7DA 5CKAA 1YJDL 4QXUH 4NYLA 1CGTA 4Z7UF 4WW2A 4U7MA 4IMLB 4OAWA 4XNMA 2I9TA 3DOSA 5KTEH 1EA9C 2C5JA 3B2VH 1VSCA 4WUUA 3LDBC 3KPRD 4HGMA 1EJOL 2IFFL 3QDGB 2I07A 3QIUB 3HC4L 3RZCB 3DUUA 1FORH 3O4OB 4PGEB 3RDTB 4EN3A 3L3JA 1P9MC 4XPBL 5IHLB 5ISZE 3RWDB 1JTOA 4M7LT 2FECI 1XF4A 5SWSE 3DYOA 3WIHL 1U8MA 4APQD 4P2OB 4R4ND 4M6AA 1VKXA 3VFRA 5F1NA 1PAMA 1UKSA 1QSFE 3MJ6A 5FA4B 2Q8BH 3K46A 3FQUB 3QHZL 3MGAA 3U79A 5F9OL 1G9NL 4R97C 4IMKC 4U1NA 1FC1A 2FHBA 3R0NA 5F9AC 4X7EC 3HNVH 2BVYA 3WFEL 5I6XB 1N64H 2F74A 1G1CA 3RKDC 4R90H 3VFGL 4ONFL 2DM2A 4KU1A 1JF5A 2DBJA 3JV4B 3QJFA 4OLVL 4U1SA 2OTUA 4J4PD 1NANH 4NZTL 4RIRB 5GHWL 4F9LC 2DMBA 1I7UA 2V7NB 3QPQC 4JM2F 5FYJE 1BFTA 4LSTL 1W8OA 1FZMB 1PX3A 2HFGL 4R4BB 3VXUA 1FV1A 2ED8A 5TQ2L 3S34L 3BH9A 4UT6H 4IOFD 2KPNA 1MAKA 1A9EB 1CL7L 3D3VA 1FZMA 3K0WA 1KUMA 3QEQE 3ZHDA 2EKJA 4G9FD 5KVEL 1ZGLP 4N0FA 3U4AA 4S2SB 3GNML 4NQDA 5I1DA 4H1LH 5CGYD 4HX1A 4HD9A 3DGGA 5JW5B 4X4YA 3RWHB 3OL2A 5F6HJ 1IEHA 4M48L 1S9VA 3P7IA 3BH8A 3RTQA 3SQOH 3D3VE 3TGXA 2L0DA 2C3VB 5FGBC 4ZS7L 4ZUUA 1QSEB 2DKUA 3RBSA 4UTAH 1TCRB 3JWNC 1F4XH 3GIZL 3C5JB 4UU9A 2D7MA 2ZNWA 4X5XA 3HRPA 4BK4A 5HDLA 1I1AC 3QIUD 4GXUM 3RZCD 2J6EA 1FVEB 4WWKC 2DL9A 5F3BB 3IDJB 2G9HA 1D5XA 5DR5L 4CRPA 3PP4L 4I2XE 5JORA 2GUOB 4BQBA 1QTYT 5C07E 3RJQB 5ID0B 3VXPB 4AEIL 1NMCC 3MROB 4HUNB 3QQ3A 1AXIB 1QOKA 2QJDA 4KQ4L 4R2GC 1DQJB 3OG6B 4MSWB 3UJIH 5DJYA 5C09A 2CGRL 4QHUA 2FEEL 1QA9A 1HDMA 2FBJH 4FXGA 5EU3A 1SQ2N 1S7UB 3RU8H 2HTLD 3QK6A 3RZWA 3D25A 3MGTA 3QJHA 4MCZB 2P43B 4LRIC 5JLZB 4OM1H 4XPAL 1MCHA 1ZHBA 3SCMD 4BJLA 4D3CH 3I2CL 2V2WB 4HV8B 5DXWA 4UV4L 5C0CD 2D7TL 1KIPB 2C4XA 1MJJA 5I1EL 1O0VA 3FHQA 4HIIB 1H8OA 4D9RE 5C92A 1KPUB 3OZ9H 4XMPH 3TBWA 3GMNB 3C6SB 4LPVA 4M93C 3QCTL 1RZGB 5EUOA 4ZFFA 2H9GB 2ZG1A 3VWJA 4D8PA 5F7DB 3MV01 5TDPA 2R23B 2PYEE 2VLJE 3OKOA 5IOPB 5DVMA 2A9NL 4MXQC 1ITCA 3ZO0A 5J6HA 4FQXD 3DXAE 5C71A 3H9SA 5FUCE 2WLZA 4WTWA 1ZLUK 1YN7A 4KRPC 4P5TB 2IFGA 4AQ1B 4Y4HD 4JJ5B 1OM3L 3MRMB 3QNYA 3BEWB 1UGNA 4KDTC 4K3EH 5D2NE 4H26B 2IANE 3P40A 5L8LB 2FL5A 1BD2A 3MUHL 3AB0B 2YKLL 2DWEB 1QRND 1IGFH 3SEPA 1JNLH 3QAZC 4QYOB 4YPGB 4JAMA 3IDMB 3UBXI 1ZS8A 1NL0H 3MJ7B 4PY8I 2NQCA 2B7DT 1NAMB 4HIHA 1RUMH 1MCNA 4EDXA 1CICD 4HUWA 4AENB 1HYSD 3BGAA 1P2CA 5HHOE 4EOWL 2CUMA 5CBAA 5IV2A 1RZ8B 1HOCB 4Y8DC 4GAGH 4NKOA 4QRPA 1OL0A 1HYSC 4M7ZC 4NQSA 1QR1B 5FUZL 2VISA 1A6VH 3ZE1F 1M7XA 4M9OA 4M03A 5HY9A 4WI8A 2Z8RA 2I27N 2Z9TA 1M05A 1BGXL 1LQSR 3I75A 3P73B 5KBNC 1UYWL 2VDKL 4PJIF 1CXEA 3BKCL 4KTDL 4JKLA 1BAFH 2ZWLT 2DD8H 2R0KL 4NZDA 1F8TH 1TITA 1Q9KB 5JW3H 5IK3B 4O5LL 4ZUSA 3E2HB 3LKPA 5IWLA 3VRIA 1CGSH 2Z35B 4MLSA 1FAKT 2EO1A 4KFZC 4NM4H 3ARBB 1TZHA 4KQ3H 3EZ8A 1Z0NA 3LAFA 4OD1H 1KCUH 4PJDF 4QCIA 3HNTH 5TFSL 4NUGH 4RX4A 2BCKB 3GHBH 3C09C 4X4ME 2UZYB 3STLA 1DQLH 4ZQKA 3MA7B 4KK9D 4JHAL 5D5MB 4JPWL 1TVBB 2DMCA 4OFYD 3BP4A 3BPLB 4Q97A 2BNRA 3IFLH 5EZIL 1KB5B 3CSPA 4RGNB 4RRPG 4NZJA 5I1AA 5E8PB 2HT2C 1H3UA 2UUDK 1UVQA 2P7TB 1QP1A 3QHFL 4HPOL 4OZFA 3VFMB 2CIIA 2CKBB 4PJGB 1FFOA 3BE1L 4MA7H 4OSUH 1NBZB 1HHIB 3IDGA 1K2DA 5FV1L 4BFIA 3T77A 5DD1L 4HC1L 2MOVA 1G7IB 4ZSOB 3BIBX 3TN0C 1PGRB 2VXUH 4KK8C 3P9LA 5EC2B 1CLOH 3S5LG 2NZ9D 5E2WH 1N6UA 5HHXH 4NC2B 4G3YH 5JHDD 4ODSL 3VWKD 3K8MA 4KRPB 5I18L 2L4OA 4HWZA 1TIUA 1CF8L 3VD9A 2YD4A 3OKEB 5TH2A 3O9WC 4JEGB 5DD0H 4UT7H 3TIEB 1N5YL 2VDLL 4MNQB 2UV3A 2ICWB 3AMKA 4LQFL 4RFOH 4NKIH 3DO7B 3MLTB 4J23A 1UB6A 4OV6F 1ZLWK 3QHFH 1WITA 3O6FA 4ONGH 4DUWA 1D6VH 1CD8A 4XBGB 2HFFB 1WZ1L 2W91A 4Z7VF 4M43L 4U1GB 3ARQA 4ONHA 4F7MB 3C08L 5FO9A 3G5VA 1H3PH 2DB8A 3GFUA 4AIOA 5KS9F 1IM9A 5C0AB 4NQCE 5J13C 1JNHA 3QDGE 2IALB 3MBEC 2J1KA 1QLFB 4Y4FA 4GKZA 2Y72A 4S2SA 1HHGB 5E08L 2J2ZA 3D39A 1CTOA 1FV1B 1QSVA 3NFNA 2EE6A 3SGEH 1KIPA 4GMTH 3IU3B 1CE6A 1QSFA 3VFOA 4G8IA 1U8HA 3RL1B 3B43A 4KUCD 2GIYA 1BBJB 2FJFA 3IGAA 4YHLL 3QJHB 4MCZA 2OZ4A 1QBML 5IB2A 5EU3B 2PKDA 2WINB 1S7TB 3PL6D 5F7MC 3BI9X 1CGVA 4JRYE 4PD4J 4FQLL 3HUJE 4PJCB 3QEHA 1MIMH 2PN5A 4J4PC 2XA8H 3MLYH 3TNNB 1RHHA 4QHLB 1A8JH 4QHKI 4HWEH 1S3KL 4YHYC 1W72A 2V2XA 4Z76A 4TNWK 4M4RA 2PYFB 3GIZH 5IFHL 1FYTB 3KPLA 4Q58C 1NEZG 4EI5C 4PV8A 2GY7B 5LGHL 4XNUL 1UJ3B 2RQ8A 3GSNB 5D93B 3I3BA 3OKKB 2D03H 2X70A 1J1OL 4WEMB 1HSBA 1S9YA 4AH2B 3KHOA 4LSQH 1MOEA 3G5VB 1OAYL 4X6CE 5C08A 5JMRA 3HPLB 3MRKB 2VUYA 1ZA3A 1CYGA 1RUKL 4R97B 2LAGB 4S1RL 1T1WB 3T65A 3EO1B 4FABL 2F68X 4PFEA 3KPRA 1JRHL 3S35H 3S9DB 3WLWC 2GJZB 1KN4L 2EDTA 1M05B 3I75B 2CLZB 1S7WB 2YZ8A 4LMQI 4WW2B 1Y0LB 2X40A 1OPGH 1ZT4A 3L3GB 4FQXC 1RURH 4H8WL 1QKZL 5KSBB 3TWCL 4MAUH 3SDYL 3VCLA 3GSXB 3IYLW 4XRCB 2VDOL 1X5GA 2UY6A 3OAYH 4XMPL 2CJUH 3MNVA 5TE4H 4OGXL 3UJJH 4PV9A 5K9JL 5AZ2L 4PRPE 4LEXL 4D9QD 3W5NA 3MQIA 4HXBH 1I8LC 3L3JB 5GS2H 3GGWA 4NWUH 1G9ML 4HT1H 1A4JB 4G9FA 2X1WL 5D7JA 2PW1B 2X1OA 7CGTA 4EI6B 4JZOB 4H26A 3SCMC 3QDME 4U3CA 3L3HA 1J10A 4G42A 5C2BH 1H8NA 5IIEA 1X5XA 3V9FA 2EXWC 5T1LD 3ULVD 3FQRB 3ZDZF 4JRWA 5DJXA 1OSPL 2FJGA 2ZPKL 3BPNB 4HJ0D 4F37K 1NC4B 3ARFA 1Z3GL 3BYYA 1FYHB 3FT3B 5FYKD 1M7IB 1QFWI 5DI8B 1XF3A 3QA3A 3VFTB 3PGCB 3H0TB 4V1DB 4Z9KB 1D5ZB 4K55A 1A47A 1RK0B 4NRXA 1F2XK 2G60H 3MRBA 1ZT4B 4FMFA 3QWOB 5CSZB 1AGBA 2UUDH 1J8HA 3T0DA 3CH8A 2FO4B 4QRRE 5F9JB 1IGMH 3CFEA 3ARWA 5BOPA 1MFBL 3AB0C 4F33B 2J88H 4QGYA 4IHOB 3UZQA 1U41A 1RVFH 2GFBA 4PTTB 3NIGE 3ARZA 1OF2A 1M6OB 3DX9B 1RQ5A 1JGVH 2NY5C 4DEPC 4KKNA 4OT1H 5CGYC 3DMMB 4PREA 2ZUWA 1ULVA 1MIML 1IKFH 5JORB 4FQLH 3HUJA 1P4IH 4MD5B 2NY7H 1R0AL 4ZUTA 4NJAH 1RJZA 1PX4A 4KJQC 3VGHA 1U92A 1Q9LA 4WW2C 1CDIA 3NPSB 5KSBE 4FQXB 1MCRA 3ULUC 3GJFB 4OIIL 1CFTA 1NFDA 2X42A 4PJFE 4P2YA 3NABH 4X80H 1HHJB 2X1QA 2ZUXA 1ZMYA 4F7CA 3QWRA 2KWIB 2H26A 2VDMH 4OZIE 3Q3GA 5GGVL 5KANG 1OSZB 1LEGA 3CLEH 4LPTA 4JN1H 5D1XB 2FB4L 3QDJA 5ITFA 1CLZH 1JUFB 4GBXA 4XMKH 4XVJL 3ZKMC 2XTJB 5EPMB 4Y4HA 1IKNA 4A6YH 4DN4H 4G6KH 3QO1A 4QRTB 3LEYL 1UZ8B 3B9KD 3MLSH 1TPXC 1Z9MA 3QCVL 3R06A 5HJ3A 2EDEA 3WFZA 3EYSH 2XICA 4PRID 4HUXA 1BD2E 4LEOB 4PJ8C 3WEXA 1FORL 5I6XC 3HC4H 2Z93A 3VDCA 3QXUA 1Q38A 2C5KT 4JPIA 5AUMB 3EDDA 1I9JL 4S0TD 4LKCB 2GHWB 5TE6H 3F8UB 3QNXA 3MR9A 1FL3B 4G3YL 1E4XL 3QUYD 2VRAA 4X7TB 5DZAA 3FB7B 3VXUD 4U6YA 1G9EA 4NQXB 4KGLA 5DK2B 1LO4H 4GRLD 3RWEA 4DAGL 4ZODA 1WSST 1RJCA 4EVNA 3BE1H 4MA7L 4OLYL 3LEXB 1P7HL 5ENWB 1ZLSL 4YHML 4LP5A 5EBMB 4HPOH 5IQ7L 1HWHB 1A7OH 2AK4A 2AVGA 3VFUB 4AMKH 1ONQA 5KZCD 5TF1H 2ENSA 1LO2L 3JVGA 5I2IB 4NC1E 1I9EA 5EC1B 3OAYK 4ELKB 2YXMA 1WFUA 1UACH 3OKDB 5E8EB 4OFYA 4R7DB 4X7SH 5I1CL 1K2DB 3OX8B 3SPVB 1UWXK 3QQ4B 4G8EB 4PB9L 3UYOD 2ERJC 3NTCH 1DQQB 4LAQL 4X0KB 3GZKA 2QQNH 1FPTL 4LHUB 5ISZD 4M1CC 1ZHNB 4ZD3H 4RGNE 1RIUH 2IQAB 4UV7L 5C0BD 2X4QB 4JY4B 4J6RL 5CSGA 1M71A 3O8XD 1PZ5A 3AAZB 4Z23A 2BJML 4LLWA 4XCFH 4HH9A 3WL9B 5ALBH 3CU7A 3QH3A 4XBPA 4RGOL 2MBGA 15C8L 3VXSE 1JGDB 4WV1B 3VXMD 3SGKC 4X99A 4U7SA 4Y1AD 3PHOB 1JWMB 3AM8C 3FO1B 4MQ7A 5DHYB 4XHJC 2ZCHH 2R1WB 1JFQH 3A6OA 2GJ6E 2KZ1B 4RAUB 5C0FB 5IVXE 5I17A 5E00B 5J3HC 5HPOA 4CQIA 1IILE 5D72H 4NQCB 4IIQC 3PWLB 5E2UL 3QNZB 1JI2A 1F4WL 2G2RB 1KN2H 4PJGE 4Y8AA 4OZHB 4OCRH 4L8SA 4ZDHA 5SWZA 1FIGH 3CFEB 2X41A 4ZUVA 2DQHL 2V5YA 1Q8MA 3FONA 5IBUG 5HHME 3RY4A 5D71H 2SEBB 3GSRA 1LP9A 5KJRH 4F9LA 4FFYH 2W9EH 4E42A 3FXDB 2R4RL 2YK1H 2WQ8A 1WZ1H 1IJ9A 1NSNH 1I3RB 2DKMA 1QFWL 1AO7A 1GOGA 5I15L 4NNXA 1A0QL 1HIMH 1FO0L 1WWCA 5F7KC 3ARFC 3PV7A 3EOBB 2R69L 1SEBB 2CSPA 1U93A 4KKAC 3HB3D 4HUUB 4UDTA 1IZJA 4G7VH 5DEGB 1U3HC 4DAGH 3Q6FB 5IESH 3BX7C 1N8ZA 1A6ZB 1G1YA 4GQ9L 4KKAD 1YUHA 4XCNB 5A43C 1HEZA 4P5TA 1NLBH 3VRJA 1UCBH 5GRYA 4HPYH 3SBWC 4F15B 4W70A 2X9ZA 2HT3C 4PG2A 4PJGF 1FQ9C 3KXFB 1BX2A 1KLUA 4HAFA 4QT5A 3IJYA 2Y23A 5HHNA 1F4YH 4M8QA 5HHOB 1F4AA 3U46B 4KKLC 3VFVA 1T1ZA 2YMXL 2IH3A 1BQLH 5J8OA 1AIFA 1T5WA 5E1HB 1SY6H 3DX8A 1U3YA 2JJTA 3H6JA 4YNYA 3MCKB 3CAFA 5EN2B 4C54A 3PIQA 4G5ZL 1JTPA 4PLJD 1YECH 2H32B 4R3SA 2ZCHL 3EYUL 3ZSTA 2J4WL 2SEBA 3T2NH 1CU4H 5C08E 4ODHH 1ETZB 2VLME 4K2UH 3NIFE 3LS4L 2X4QA 1P7QD 2X4UA 4NSKA 5LQBH 5E2VH 2R2BA 4OLEA 2E5EA 3ARBC 3GSNL 4S1DD 1U3HD 3H9HA 4L3AA 1DQLL 2BJMH 3A67L 5ELIA 4RWYH 5CJOH 5IB4A 1N4XH 4M7LH 3NFPA 5I0DA 1H7CA 3ULUE 4KJQD 4KJPD 4NM4L 3LOWA 1CFNB 3L3OB 1FNSH 2ZCLL 5INDB 4NIKB 3S7GA 1AGEB 1EO7A 1GC1L 5BXFB 1XGUA 4DNDA 2BSTB 4PB9H 3VFVB 5T33L 1AD0B 3GM8A 3SE4C 4Y4KC 3U2SB 4PRHE 2EXYD 4HKJB 4PS4L 4HGKC 3W11D 1YNLH 1Z6JT 2CH8A 3WL9A 1LGVA 5SX5H 1WZMA 5T1KD 3LZFL 4FP8L 5I8KL 5ILTL 3C5JA 4UUJB 1C5CL 1UM5L 1ORQA 1PZ5B 4N0UE 4P4KC 1LVFA 2DWDA 4MQXC 3X11A 2NY1D 5I75C 4HWBH 1CI5A 2Y9RT 4KTEL 5DD6A 3U0PB 4XNZB 2D9QB 2FYYB 5DVOA 3BKYL 2X7LB 4JN2B 5ITBL 4JZOA 5C7XL 3UEZA 1AO7E 1BEYL 3KPSD 4G8EA 4L3CA 5IROC 4DEPB 4KJWC 1A3RH 1EHAA 1RZJL 1KJ2A 3DMMC 2KQNA 4UIKH 3D85A 3P0GB 4HX1B 4PBVC 3O3AB 2WQRA 2XIDA 1EO8L 1FNGA 4HUVA 3ULVE 1XIWA 1CR9H 2BVEA 4B53A 1YPZA 3X3GH 1JWUB 1WBZB 4LKXB 1KT2A 3L3KA 4WWKB 2DM7A 4HIIA 1NFKA 2VR9A 3VXQA 1URLA 1N0XH 3QISA 3MRNB 1DLFL 1GCFA 3IT8D 3V5HB 5BZWB 1EEYB 3LKOA 2APFA 5D7SH 3RX5A 1SBSH 5SWQA 1QSEE 1TQBC 4PJHA 3OJDB 1GZPB 4WHTB 3E6HA 3JTSA 3BGFB 2YSSA 1CK0L 1YMMA 1EHXA 5JOFA 3SE9H 4PY7B 4AIXA 1A1MB 4H0HB 4XPBH 5A40E 4GW1A 4JANB 1A21A 1OY3B 4DCQB 4OZIF 4BELD 2YD9A 4L1HA 4QHNB 2XXCB 1CLZL 1AI1L 4XH2A 5HHMB 5IFJA 5DQDH 4GSDH 2ARJQ 1UXWB 5EIVA 4LLVB 3RTQD 3BGMA 3OF6A 3RWIA 4KROD 4V1DD 1QUNA 3RVWD 1MHHA 2FX9H 1HKLH 1YYMH 3R06B 1W72H 3MXWL 1FJ1A 4UB0L 4PRHD 1K8IB 1NBVL 3RNQB 3MRIA 5CIPA 3DARA 3HI6H 1D5IH 3DUUB 1KCSL 1R5VA 2QHRL 35C8L 4X5WB 1H15B 1ZGLA 2VDNL 3P77B 2KWHA 5IEHB 5J9PA 5DUPL 1KN4H 2R29H 4U6XA 4WEBH 4FTVE 1NCAL 3MV8E 4BZ1L 3FOMB 1REIA 4XX1E 2R2BB 2WUBH 1GGUA 3PV6B 4OLWH 4GAJH 5D7IF 1YQVH 5LWYH 3CDGB 4B6XA 4GBXD 1S7XB 4KH2A 5HGDA 1T5XB 5EIQA 3QG6A 4HJJH 4HUXB 3ARVA 4NKDA 3EBAA 1JGUL 2Q86A 5IMLA 3OSKA 3DURA 3GMLA 1VADA 2Q7NA 2QSCH 2H2SC 3Q5OA 4LKXA 4CADB 4Z95L 4Y16B 2XWBA 1FO0A 4LLQA 3HE7B 4OF8A 2WMPA 5HHOA 2O61B 3O2DL 3U9PL 2V17H 4QTIL 1P4BH 4JB9L 1NC4A 1YC8A 1VA9A 3SDCD 3ARBA 5IFHH 3P4NB 5GGUA 3KXFA 4KV5F 4U6YB 2W0LA 1P9MA 3HN3A 3KPPB 1TJIH 1IQWH 1MH5A 3FRPG 4XTRD 2NY3D 4HWEL 1I3UA 2AEQH 3L7EB 3QDJD 5HYQB 5JOFB 2EC8A 5I0ZA 3U0PA 1G7LB 1LK3L 2E8YA 1WIOA 4L5FH 4W6YB 5FECA 4IRSD 4EBQL 3WDHA 3OXRA 4FQJL 4EN3D 2YUXA 1NMAH 3WIFB 4L8CB 2YPVL 2NXYB 3GSVA 4XX1G 1KCSH 3UAJC 1HZHL 2VXQH 5MERA 3PIQB 3GB7B 2QBWA 4QXGL 4LLDB 2R0ZH 4NT6B 1QG3A 4PLOB 2JB5H 5IV2B 2VOTA 3SCMB 2GTZA 3QE5A 1J1XL 5DUMH 3JV6B 3VCLB 1MVUA 5T1KB 5J7CC 4GSDL 4YHNB 1JBJA 2CRMA 1FVCA 4S10A 4YDIL 5DMKA 4KDWA 1F13A 2YBRB 2P24A 4GS7C 5TE4L 3PP3K 3IJHB 3BPNC 3CC5A 3RQ3A 4RMUA 3SJVE 3L9RB 4Y89A 2NZIA 4J4PA 3VRJB 4U1JB 4C83A 5C6PB 4H8WH 5AAMA 1XZ0A 1KCLA 4XCNA 3PWLA 4JFEA 2AGJL 1KB5A 1VB9A 1FNLA 2K7PA 5GZOD 2HLAA 4JRXA 3P4NA 1F6LL 2IFFH 3O8XA 3RRQA 4AIZA 3F12A 3IXAA 1DLHA 5HGAB 1D7FA 2WUBL 1A6WH 4M61A 4WV1C 2VH5H 4HH8A 3FXEB 1OT1A 1SVZA 4L3EA 2KQMA 2DQFB 1DDHA 4PRAA 5DUPH 4YDKH 4FFVD 1EO8H 3C09B 5CMAA 3I6GB 3N1PC 4NDMA 3DV4A 1ZHBB 4QOKA 1KYOK 2JE8A 2IC9A 3TYFA 5IVZB 2OI9B 4F33A 1ZHNA 4KTYA 1K5NA 5F44A 3FB5A 1SM3H 5C0BA 3C6LA 3RY6A 1A6ZA 4XNYH 2MWCA 2DBLH 2DQJH 3MRBB 5IG7B 4G9FB 3CUPA 4KC3B 3N06B 1MCEA 5J13B 4NC1C 3WN5A 1KTLA 1T0NB 4PV9B 4NQVA 2YEZB 1PW3A 1DLHB 1GIGH 2GITB 3GUTA 4M1GH 5CEXA 3QWRD 1KG0A 2Z8SA 1MFNA 1FVEA 1PKQE 2IG2H 1MAMH 4Q9BA 3CFJB 4M7JH 1AR1C 3KG5A 2DQDL 2ENYA 4KKBC 3KPLB 1RZ7L 1BQHA 1XCQA 3GMMB 2F5AH 1FC2D 1S9XA 2XNAA 2XTJC 5HGGS 3FOLA 4KRLB 5JDSB 5DK2A 2FWOB 2YOCA 3F5WA 3WO3B 1TPXB 3FO2B 4N0CC 3V5KB 1LO3H 4LSPH 1MPAH 4OGYL 4Z0XA 1BREA 2GSGA 3TZVA 5D2LA 5DMYA 1KACB 2AK1L 5E00A 4HKZB 3C08H 3DECA 2J4WH 4HIXH 5EUOB 1YECL 4Q6IB 1G6RL 5EO9A 4IS6A 4PJ8B 2VAAB 4KDTA 4Z7WA 5FGSA 3C5ZB 4ODTH 4EIZC 4POZD 2ITCA 1MCPL 4I0PC 4PRPA 2QADC 4LL9A 4PV8B 5DMIH 2GKIA 1G0XA 4LOUC 1YPZB 3AM8A 1MCOL 2CQVA 3WKMH 4Q2ZB 3GSVB 4IBLT 4UT7L 3OKLA 1B90A 1S5HB 5CILH 1R3IH 4PUBH 2HJKA 3KVQA 4V2CB 2YUVA 5FO9B 1MJ8L 1WEJH 3T2QA 2V5MA 3OB0H 4F7EA 3QI9B 3QUXC 4OUUB 4RISL 3QEHB 4N5ED 4X6DA 2X4TB 5DA4A 2CKBH 1AP2A 1T1WA 5FYKE 1BWWA 3WUWB 5L9DL 1J5OH 3MROA 5I17B 3THMH 1HHJA 2P47B 4DVBB 4OB5L 4TVPL 5CD5D 3AY4C 5CEYA 5ACMA 1IGTB 2VQUA 4L4VB 2CO7B 1PY9A 3H8NA 2DF3A 2IC6A 1UWGL 2FHFA 5BRZA 1B3JA 4Y2DD 5FM5M 5BS0E 2IGFH 4EUPH 3TT1L 3MLUL 2UZIL 5L0QB 1UXWA 5IBTL 5GRUH 2OQJB 4KV5E 1TQBB 1AGEA 2ERJB 5DUBA 1D5MB 2H2SD 3W0WD 5E03A 3MNWB 5ABDE 5IMMA 4TTDD 2C3XA 5LQBL 4LFHG 1WLHA 3F7YA 4QLRA 1UZ8A 3HS0A 4IDLA 1ZGLM 2GJ6B 5IG7A 4LSRL 4P2OD 5HI5C 5IB4B 4G6JL 3CX2A 5FO7B 1C12A 2YMXH 3FFCE 2XI9A 2IF7A 4KQ3L 2BK8A 3V95A 4I1NB 3VXRD 1MFCH 1BHGA 5JW5A 4H20L 2CUIA 3IDXL 3VH8G 2I5YL 3U82B 4YHIB 4UOJA 3KAAA 5CSZA 3BN9D 1P5UA 3RL1A 4QOKB 3SGDH 4Z5RB 1CFBA 2OTPA 3MRNA 2A2QT 2C1OB 3KJ6H 1GOHA 2H6PB 4C56A 5A3ID 3MRQB 4XGZA 3QRGH 4BUHA 1L7IH 4I3RL 2C3GA 4L4TE 4AJ0A 2A83B 5FYLL 5HVHB 4UNVA 3DTXB 4OZGB 3HUJB 4Z7QE 1GGYA 5GS2D 2X4NB 1U3ZA 4QY8A 1MJ7L 4QOKE 2V9RA 4GQ9H 5FUZH 3RDTC 2WM0A 4Q0XH 4LF3A 1BZ9A 1G6VK 1VFAA 1I8KB 5FYJU 5F7UA 1I3GH 4GKSB 5LVEA 4Z95H 2L7JA 1A0QH 3LV3B 1DEEA 2Q76B 4YO0A 5GS0L 1DVFD 5JDSA 5B39A 1A6TA 4BH7A 4RAHA 1GHFH 5EU6D 3FRUB 2X4RA 3WUWG 2XTJE 5LWYL 5ESQB 4YLQT 5KJRL 3BSZL 4J12A 3IRZA 2I26N 1D6EA 4JO4H 1QR1A 4Y16C 3HAEA 3HLAA 1TVDA 4BFEA 5E8DH 5IR1B 3MUGA 3VXQB 4ODWA 1BJMA 5BS0B 3BO8B 1TZIA 1FIGL 5CIPH 5KOMC 3SKUD 1ADQL 4HIHB 1R5IB 2VDNH 2AQ3A 4PG2C 4HLZG 1DVFC 4RWHA 5CJXC 1RIHH 4V2BA 4OM0H 4FXKB 1QSFD 5F6HI 4D0BA 1OGAD 4OLZH 3GMQA 4LPWA 4WO4C 3S36X 3VFGH 1MSPA 2H3NB 3T09A 1J86A 5J1AA 3O4LD 3MRRA 1C7TA 2F6AA 2R4SL 1I7RA 2ZUSA 3MLVL 4JKPH 4MCYA 3O2VL 4DK3A 3HZYA 4BQ6A 4KHTH 2X9WA 5J6HB 5F9OH 5GRVK 1NFDB 2NR6C 2OP4L 1FZOA 5D5MA 3G6AB 1KBGH 5H8DA 3KLSA 5GIRA 5HDOA 4TNWF 1RZ8A 4UV7H 5E1AB 4ISVB 2X4SA 5C86A 3EYVA 1IC7H 1PG7H 1Z5LA 1BFVL 5EH1A 2M1KA 1QSDA 4ZG1A 5JR1L 3ULUD 1ZS8B 3DROA 3HE7C 4MXVE 4OGZA 2EKSB 1IZKA 1HSAA 5FF6B 4H8WC 3DVGB 4ETYA 1R6VA 1VERA 4TULL 5LBSL 3NA9L 3PL6A 4YZFF 4KI5F 2DQUH 3V0WH 5LGJB 3EOAB 4JFOA 5D9SB 3X13A 3KPMB 4TSBH 4EXPX 2AQ1A 1BLNB 4DOHB 3OB8A 2C9AA 5LCVL 3WFDL 2B4CC 5ESVB 1D9KD 3U4EB 5HPMA 2WAHA 4JG1H 3P30H 5GRUL 1RZIB 3EHBC 3MRJA 4NRZB 5CD3B 3QFJB 2R0WH 4TTDC 4K7PL 5KTEL 4K8RC 1XGTA 4S1DC 2B8OT 2D31A 5JQ6L 3ZZ1A 3RL2B 2NXYC 2AJYL 4Y4KB 3DVNB 1MHEA 2AV7A 5D1XC 3LEVL 4ODXA 2VITA 3GGWB 1UH4A 4OIIH 5FEBA 3C2SA 2J12B 5E56A 1ERNA 4Y5YC 4HK0B 1C16B 1LO4L 3V4UL 1PSKL 5AD0A 1I1YB 5DJ2A 3L5XH 1ZLVK 32C2A 1ND0B 3MUZ1 1PVHA 2HMID 4OKVA 3GSOB 1UM4L 1JNJA 1CXHA 1A14L 1JNNH 5D70H 5ID1A 5I75B 3SDCA 4KZDL 4I77H 4HC1A 1UFUA 3RI5K 3QEQA 3OXSA 1K4CA 3KWWA 5ILTH 4JZJC 4WIQA 1VPOL 2VL5A 3REWB 1QPPA 1S7WA 2DQEH 1W72B 1WAAE 1AXTL 1Y18A 2FEDC 5DQ9A 3QDGD 4LRIA 4HWBA 5IJVA 4JO3L 1XIWD 1R3KB 5ESAA 1C1EL 1T22B 1GC1H 3GHEH 5T1MB 3MREB 6CGTA 1XH3A 1YA5A 3QUKA 2O5XH 5GGUB 5DZ9A 1KIUA 2VR4A 3MRGB 3EAKA 3QZWG 1WWWX 1OGTA 3HZKA 1NMBL 1MQ8A 3FO9A 1YYLL 1MLBB 4MLIA 4AH2A 2WQSA 4JPKH 4WWKD 5TF0A 1FNEB 3QFDA 1R3JB 2PYEA 2VLJA 1CDGA 5K33A 4EIGB 5I76A 4NZRL 1E4KC 3DRTB 2AXHA 3LKNB 3HI1B 3JBG7 4KXZI 4U6HA 1HI6A 1VKXB 5HHVL 1CFQA 1YMME 3NIDF 4N1CA 5IB3B 4LLWB 5FHBH 4O9HH 3D39B 4U6HB 1PG7X 2BVQB 4IGBB 3QXDB 5D1XD 5HGDB 4D94A 1M71B 2EC9T 4O2FA 1MFDL 5E2TL 1T66C 2W1NA 2QQLH 1MIEH 4GAYA 4JZNA 4YHIA 4LSSH 4MA8H 3GBNL 3LEVH 4KKLD 4QHUB 5FKAA 2VQ1B 1UCTA 1OWWA 2WLYA 4FQQB 2Y36H 1FG9C 4S1QL 5CZVL 1W2KT 2ZG2A 3TF7C 1IAOB 4UIMA 1AGDB 4JFFA 1KEGL 2ID5A 1NQBA 5CLTA 1W0VB 1FYTE 3CFKA 2XY2A 5MEQA 4PJIA 1NGPL 2Y5TA 5CIPB 5F97E 2AP2A 4DQOH 1A1NA 1NCBH 4Z7WE 5CS7A 1FYTD 1KC5L 2R1YA 1TVBA 4J3SA 3WNLA 1P84J 1WTLA 5F3BA 1Z9LA 3QQNA 3F65A 3GSOA 5DFWH 1RZKC 4O51A 5GGRA 2P5WB 3HB3C 4K3DL 3X12B 1ACZA 1PSKH 3V4UH 1HH9B 5DO2D 2R2HB 1A7RH 4NKQB 5E0QA 3BP5B 4OM0L 4YXKL 2JJSA 2P5WD 2I07B 3QIUA 3RZCA 1U91A 2AJYH 3JV5A 4JFPB 4P3WA 4XAWL 1CLCA 2Z91A 3HHRB 1EV2E 1D5BA 4TVSa 3V0VB 3E6FB 4F3FB 1JPSL 4NRZA 3B5TA 4FFVC 2P4AB 1NFIA 1FE8L 3BPLC 2DIJA 4OI8A 4FFYL 1A9BB 2BFVH 5DD3H 1Z3GH 3EFDL 3ELAT 4U0RB 4LEOA 4AT6B 1TNMA 5FYJD 5L0QC 1FFNA 3RVVC 1BQUA 4ZQKB 3B9KA 5IMKB 4I0PB 5EU7C 3TNMA 4QRUB 4LDLB 4BSWB 1MNUL 2ICEB 4JO4L 2H32H 2RGSA 5MP6L 1FRGH 5LKNA 1WZKA 5DF0A 1NGXA 6FABL 5DJXB 2ILLA 5HHQA 3ZKQD 2NXZD 5JXAH 3L3DB 2FYYA 3TZVD 1RUQL 1YN7B 1AQKH 1L7IL 4YGVA 2YZ1A 5DQ9B 3ILPA 2W9LA 3ULVF 3O9WB 3MJ9L 3V7AG 2ATKA 4WHDA 3H3PH 4PRIE 3FO0L 4HG4J 2LQRA 2VWEC 4MYWB 2VE6A 3RPIA 1QBMH 5KG9A 1AMXA 2APTA 3IU4L 5HSFA 4FG6C 2MSPA 2YPLE 4H20H 4R4FL 3IVKA 1CDHA 4MNHA 5CD5C 4BZ2H 3DBXA 4IRZH 2R2EA 1NJ9B 5K59F 5E8NA 1P2CB 4G6ML 2B0SL 5FO8A 4L5FL 2DQTH 1B0GA 4ODWB 1ZHKB 2BOCA 3EFDH 3O3DA 2C7UB 3T3PE 2YR3A 1J7VR 5D5ME 5HDQH 2MCG1 3FAXA 4MWFB 5E5MA 5ERWA 3KNBA 4K9EC 1P4BL 5DHXB 3U9PH 2P5EB 3TT1H 4P57B 1A7BA 4ZYKB 3CX5J 2QR0B 1EBPA 2D03L 4YX2L 1ZLSH 4LP4A 1CIUA 1IT9L 1QFPA 1S7RB 4K3HA 1FFPA 4LQFH 2F8VA 2OL3L 1N5AB 3O41B 1PKOA 1A6PA 5EU5B 3QSKB 4HGWB 4K3DH 3RVXC 1DBJL 5FYLE 5F21B 2G0UA 3TA3C 4EYYR 1VACB 3IKCA 4JO2H 3EW3B 1RK1A 3DBXB 4JFXB 2AEIT 4I4WA 1DQML 1KPUA 3U30B 2OI9C 3W81A 1AQDB 4M5ZH 1DCLA 1TZGH 1LEIA 3OG4B 4ENED 3K4DA 4HBCH 2VE6B 4LCWE 4RZCA 5I30L