4L0RA

Crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
74
structure length
74
Chain Sequence
GINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of FGF2-interacting protein from Homo sapiens. Northeast Structural Genomics consortium id HR9027A
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Centrosomal protein of 57 kDa
total genus 34
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06657 Cep57_MT_bd Centrosome microtubule-binding domain of Cep57
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l0rA00
2MBGA 4FI5A 2X9XA 1Z0PA 1H7CA 2IC6A 4J2CA 4EYYR 3FXDB 1LVFA 2C5IT 3L3PA 3TKLB 2KWIB 2X9WA 3P7IA 3MXZA 1QSDA 2XTLA 4DNDA 3QUJA 3S4UA 2K48A 2X9YA 2IC9A 3QK6A 4CQIA 4L0RA 1IJ5A 3N5LA 1IJ6A 3CVRA 2CA5A 4B6XA 2C5KT 2KWHA 1ZKEA 1LRZA 3FXEB 2C5JA 3CKDA 2G0UA
chains in the Genus database with same CATH superfamily
2I59A 3KBTA 2RP4A 4UIGA 2WDVA 3EABA 4IL4A 4TUYE 3RGLA 5HWXA 4B3ST 2JMHA 1G73A 2CXDA 3E08A 3K8PC 4YJ2E 2LT3A 2PBIA 3RH3A 5J2TE 3J7Yq 3O9XA 1OEDE 1BR4A 1D1BA 2LE8A 2XAGB 3AEDA 3IF8B 4K0KT 2JQ9A 5AQTB 4AKLA 2V1DB 5AQNB 3AE1A 2WWVA 3RIAA 3SRZA 2CHNA 1VCSA 5HXCA 4OFZA 5L3CB 5LGUB 3UUMA 2BZBA 4DR1T 2KNDA 2K24A 3PUGA 3PJAJ 3ZN1B 4E7SA 1XNRT 3KV4A 1YXRA 3ZSSA 5LBQB 4A97A 4DV0T 3OPCA 3HKBE 4XZCA 3UUBA 3MZKB 3UU4A 4OX9T 2B76A 3C50A 3FHNA 1US7B 2XAJB 1NENA 1WFDA 2HH7A 3B13A 4AQFC 5ADXL 4DBRA 4DV4T 2G0UA 5EK3A 2V6XA 4ADZA 2Y6XA 3KVAA 3ZMVB 3QOFA 4NXNT 2WZIA 3UUNA 2LJLA 4KI0F 1Y64B 5F8PA 1MIYA 2N9DA 2BS3A 4Z91A 5KDMC 4EYYR 1AJ3A 3MKDA 3KBUA 3GN5B 4GK0E 4QHOA 4MALA 1BR1A 2E9XD 3RC3A 2PJQA 3N2OA 3NRXA 4ZZBA 4QXHB 3L09A 1N34T 3LK3B 2JRKA 5AQJB 4V1Av 5IYZE 2M6IA 2OLTA 4JI1T 2XTLA 2ZM6T 2DI4A 5FY1A 1HS7A 3IHRA 4JI6T 4TV9E 4I50E 1KNPA 2NR4A 4LF7T 2X66A 1B7TA 3Q9DA 3RX6A 4O4IE 2W61A 3X1DA 2XAFB 3CVRA 4DV7T 4IDQA 4YSYA 4DMVA 4X20E 4IIJE 4DR6T 2X0YA 5AQSB 4HFVA 3RQWA 2LSIA 5AQOB 4LMJA 2NOXA 1QLBA 4HFEA 5AQRB 4O8SA 2GK9A 1BR0A 4DV6T 3RKOA 2WS3A 1T72A 2FJBA 2Y8DA 3M65A 4NIQA 4F8HA 2JQHA 4Q25A 5CFBA 4DO0A 3T1HT 4JI3T 1XNQT 4AKGA 5LCYA 3AE8A 3EVYA 4PAGA 3BK9A 3AEAA 2HPLA 2CE7A 3RI5A 1HFAA 2AE9A 2YOEA 1ZV4X 4ZI3D 4ILAA 3L39A 4O2AE 3AA6B 4ZS2A 2QYWA 1N33T 3ZT7A 3ONXA 4GYRA 5FL0A 3LSVA 4UEMA 4X5TA 3QUJA 2Y48B 5ABHA 5JR9B 1XMQT 2VL0A 4JI8T 4QWNB 3CWZB 1IJ5A 3PUSA 5LGNB 5LB7B 2FJEA 3EUHA 4OK0A 3RQUA 2BKPA 1KK7A 1WR0A 3N9NA 2KLQA 1BR2A 1D1CA 3AAEB 4WZXA 3ZMUB 2Q9QD 3UQ7A 2E2AA 4HWIB 3OKQA 3RYCE 5LJNA 3ZSTA 1T98A 1NWMX 1XMOT 1T8BA 5AQUB 2W4XA 4HFCA 4IE5A 5EK4A 1UCUA 5CB4E 3RHWA 3RRCA 2UXXB 3RYFE 3UU5A 5L3FB 4IL9A 3FXDB 3GA8A 3I9YA 3KV9A 4UF0B 5M4YA 3ZKRA 4ERRA 3PTRB 1LKXA 4GOUA 2Z6EA 4ANJA 2YDSA 3P4RA 1XDOA 4AIUA 1YKHB 5C8YE 3C4ZA 3Q5DA 1T7SA 1QUUA 3HKCE 4PK4A 2EHOD 3EAMA 3EI0A 4TZ4C 3LK42 2X9HA 2MAWA 2IC9A 1X79A 2XAHB 2K5BB 4X1IE 4E7ZA 3CX6B 3MACA 1IBLT 3ANWB 4H63V 4HKAA 5JDHA 2YK0A 4HTEA 2LEHA 2CA5A 2LHNA 3L8RA 2QRXA 4YSXA 4ZI7E 3CK6A 1N32T 4IDZA 2MTQA 2XQ7A 3CPZA 5BMVE 2XM1A 3K3QC 1HNZT 3AE9A 3CQXC 3Q2MA 3CKDA 4I43B 4TN7B 5DABA 4H9NC 1EZ3A 2CWYA 2WBLA 3AA7B 3ZYMA 2UXCT 1HNXT 1Z0PA 2E5VA 5JR9A 4EZHA 5F3JA 4B3TT 3L3PA 5HEJA 2UUCT 3K3OA 5FY7A 3ZMTB 5KX5E 3HA4A 2V7LA 4G63A 2IUBA 2P9BA 3ABVA 1E1HB 2YN6A 3P4QA 4HGAA 4KMCA 3CIRA 3LJCA 2KXPB 4HFDA 2C0SA 4X1YE 5JDGA 5BR8T 4MLKA 3AEBA 2CEAA 4YFSA 2WP9A 3ZC1A 5FVKA 4C90A 1W9RA 3MJXA 2PTFA 2NW8A 2XQ3A 1KNRA 4MBQA 2BKOA 4UF0A 2Q9QC 5HCJA 3JAEA 1IJ6A 2XUEA 4B3MT 4FJOA 2CWOA 5LYJE 4YT0A 3JC6D 4O2BE 2N1GA 2K3WA 4QH5A 1J5ET 2VWAA 2ZM0A 4IDPA 1W0AA 3C4XA 3CX8B 3M3ZB 1LRZA 4TWFA 4DIDB 4HWFA 2QVAA 3WAJA 1W09A 4A5XA 3PUQA 3FZMB 3PE0A 3VRBA 3PUXF 3J9X1 5LHHB 1M7KA 3F31A 1FMVA 5FVLA 4F6RC 4CXYA 3Q5XA 4H9PC 2V6YB 3ANWA 4X66T 2E9XB 2WWUA 2WU5A 2ZM2A 5HEGA 2ZM8A 3EHZA 5JR9C 3AAAB 4ZZCA 2MYSA 4ZHQE 2JQKA 3NWIA 1YD8G 2LSJA 2H89A 2YKSA 3GMIA 2M6BA 4JI4T 1E2AA 2DHRA 1YQ3A 4WNKA 2J1DG 4JI2T 2YEVC 3T8OA 3NBXX 4WYVA 1M62A 3ETUA 5FP3A 4LF4T 3N9LA 2B1EA 4EV6A 3PUAA 1WLXA 2W2UA 2D2SA 1MNDA 3ZN0B 3MA9A 1R8IA 2JMKA 2V7KA 3AE5A 2N2NA 1V9DA 2YU2A 3EDVA 1UK5A 3PJAA 1HF8A 3AXJB 4FI5A 3SFDA 5JDMA 2WDRA 2XQ4A 4DR4T 2YDQA 1WR6A 3U78A 5JQGE 3FZHB 2W63A 3OTOT 4DR5T 2BVLA 2XQ9A 3EDUA 5LHIB 3AE6A 4I4TE 1MIWA 2X0LB 3ZMZB 4UVAB 4IE0A 1NAFA 2UU9T 2LKHA 2PG8A 1U4QA 4YHHT 3NZQA 3P7IA 2KMFA 3GWHA 1OEDC 3PURA 3P4PA 3BQIA 2NP9A 3Q5EA 3VU7H 4DR7T 3FZLB 4GK5E 3AE4A 3AEFA 3N2GE 3UFGA 1MMNA 3C64A 3K3NA 3ZC0A 4HFBA 3V5UA 4M1PA 2W62A 4IDOA 2V6YA 2X0HA 4Z8XA 4YJ3E 4EXTA 2BS2A 3P50A 5LXTE 2UUAT 4DBQA 2KINB 4CXXA 1HR0T 2C5KT 3A8YC 2V7MA 3TLWA 3ZT5A 3FXEB 4UELA 1HX8A 3AEEA 3CQGB 2WDQA 4U3CA 3UU3A 3ZMSB 3AA0B 4QH4A 3TLSA 1OEDB 1HX1B 1S94A 3QB5K 5F5WA 4ZEYA 3TLUA 4NUVA 1FIOA 2CBIA 4EIWA 1JNZA 2VQFT 5AFUL 4TWHA 4NPPA 5J0ZA 3VR8A 5HWYA 1VCTA 1WCRA 2LSYA 4L9IA 2H7VC 3NVOA 2IMLA 4A98A 3DTOA 2LSGA 3JCFA 2WU2A 1SA0E 3H3AA 4JV5T 3QC9A 4PK5A 4UR9A 4ASKA 3OYZA 1CHUA 5L2LA 2I0MA 2CM0A 5L3GB 5AQIB 3UULA 1XZYA 2VKDA 2J47A 4Z90A 4GKJT 1KF6A 3VKGA 5EZYE 2HPJA 1G8XA 5TAOA 4DUZT 5HXRA 4QX7B 2NW9A 4JEHB 5AQQB 3V5SA 3AE3A 3AB3B 3N9PA 2MPKA 2ACZA 1IAPA 2VKOA 3HI2A 3IBPA 4ISTA 3ZLIA 3F2EA 5HYAA 4JI7T 3I0QA 4CI1B 4AKHA 4JUYA 5IWAT 2CLYB 4JLEA 5AQLB 3UFEA 2V7IA 1LVKA 3PUYF 5A1LA 1HNWT 1KEYA 2BBJA 3TKLB 4QX8B 2WZHA 5HEUA 2ZMAA 3H37A 2H88A 1UX5A 2I6HA 4YTPA 3OYXA 2UUBT 4WW0A 4MHCA 2KSRA 5AQHB 2AXDS 2IHR1 4LF6T 2D9DA 5KXJA 2H3RA 3KV5A 3N2KE 3NZPA 4WBOA 4ZS3A 2VURA 3KV6A 4TWDA 2LOSA 3P8CD 5H6RB 1YQ4A 2XAQB 4L0RA 4XAXB 5FXWA 2V7JA 3E0ZA 3N5LA 4BA9A 2HN2A 2LOPA 4I55E 4BAYB 2Q9QA 2ZLYA 1O3XA 2W67A 4U72A 5LMUT 1HG5A 2R6GF 4DR2T 4KX6A 1IBKT 3WAKA 3JC6C 2UXBT 1OWAA 2WQYA 5HAXA 3O4XE 2UXDT 3VKHA 2XPKA 2IAKA 2OV9A 4JI5T 3RIFA 5LJMA 2CXFA 3AAIA 4H9SE 4IHJE 4QXCB 3ZJ1A 4HN9A 1HCIA 3SFEA 4ILCA 5AQGB 4QH1A 5HXHA 2X9XA 5JRCB 3O1HA 3CX7B 3ZPOA 4H63H 2W0GA 4U31A 2XQ8A 3RYIE 3ZYLA 5IHYA 3I1AA 4TNWA 4UV8B 5DQVA 3PUVF 1UX4A 1D0ZA 2J62A 1MNEA 2H7OA 2V8SV 3JAFA 4KP3C 5L3BB 5LOVE 2CPTA 5HXSA 2HHHT 1FJGT 5FMNA 3UU8A 4TNVA 3HL6A 2ODVA 5C2TA 1XWMA 4IGUA 2EHOB 2IDOB 3LG7A 1MMGA 2XQ6A 4ISSA 4U33A 5CA1E 1KFYA 2D0UA 3ESLA 3RLFF 3NKZA 2LHRA 2WM9A 2WSSV 3FZFB 3SS1A 4YXDA 1IZNB 2VKHA 5LA6E 3ONJA 2MBGA 3N9OA 4JBWF 1D1AA 2RA1A 2NWBA 2EHOC 2BKNA 1SUMB 3KDSE 2YINA 3BQKA 4PJLA 3RYHE 4JEUB 4WBNE 1GQEA 4X65T 4X64T 3OJAA 3UQ4A 5LMNT 3IEEA 3W15B 2BG9A 4ZI2C 2X9WA 4IE7A 4AI6A 3RC8A 5DQWA 1OEDA 1J1JA 2WMNA 4C91A 2NW7A 5ABFB 3FBZA 3HKEE 3S4UA 2W66A 3ZT6A 5EK2A 4DV5T 4AQYT 1IBMT 5JRCA 5FXVA 5ABGA 1N36T 4IDNA 2DCFA 2HN1A 2LSKA 4HWDA 4PJJA 4DMWA 2A9UA 3PV0F 4PFOA 3RRWA 2KWHA 2FUPA 3A5XA 4IT4A 4TX5A 5FNVE 2ACXA 2XQ5A 1YKEB 2FBWA 3C98B 3OVUA 5JDLA 1OXZA 4P1NA 4O4JE 2XASB 2E8IA 4OYKA 2EHOA 3LBXA 1LVFA 3P4SA 3RIUC 4CN6A 4NXMT 4UVBB 3ZCJA 3AVSA 5FXZA 5JVDE 4U74A 5LBMA 3A7MA 4ZI3C 4YTNA 4YY3T 4HWCA 5LHGB 4DVDA 4LFBT 4ILBA 1E7PA 4U7IA 3C4WA 2V26A 2W00A 3N9QA 4AXPA 2VL8A 3LBXB 3P4WA 2X67A 4XBFB 2LRLA 2L9QA 3PDYA 3IA3A 4HFHA 2CLYC 4PJNA 3KVBA 3ETVA 5AQVB 3VHLA 4CQIA 5JDNA 5L3EB 1W0BA 3RKGA 1YW0A 2BG9B 5C3JA 5FXXA 3KINB 4LF8T 4BJMA 3I9WA 3T1YT 4EB6E 3UUXB 4EEDA 4L5GA 1SE7A 4PNIA 4UVCB 2VB6A 5HCMA 4G2AA 2K9AA 2NTYA 5LNKA 4PW8A 4HEAA 1UGOA 2DLRA 2LM2A 4OYJA 1I94T 1H7CA 4J2CA 5HEOA 4EAHA 3AVRA 5ABFA 3ZCIA 4KUMB 3JADA 5L4EA 3HKDE 3MK7C 1UURA 2XSBA 2DWGA 4LMLA 4H9RC 2E9XC 1FEWA 5FY0A 5ETWA 4COFA 4LFAT 2JJ9A 3QNUA 3ZYKA 4ZOLE 3E22E 4IE4A 5JDFA 3NRYA 4CN1A 5L4HA 2BG9E 2XM2A 4IE6A 4PK6A 3I0OA 3AXJA 4GYSA 4PFPA 4GKKT 4GIWA 1WYBA 3GN5A 3VRAA 4LF9T 4X62T 3AE7A 2BVMA 3R6NA 2E9XA 2CHOA 2X68A 3C51A 2DL1A 4ILUA 5AQMB 4EZ4A 1HTJF 3CQCB 4P09A 5CJ5A 2WCAA 1XDPA 2L8KA 4DV1T 3LDQB 1NEKA 3RF1A 4YHJA 2VVSA 4KHZF 3BQLA 5ABEA 5JTGA 2BS4A 4H9OC 4N78D 2LRKA 2CCQA 4YLHA 2D0TA 2XQYA 3QB5A 4YTMA 4CI2B 2IIUA 4CN4A 3UU6A 2M67A 4AQGA 4DV2T 1VRBA 2ODUA 4B3RT 2D5UA 2KWIB 1D0XA 1JNRA 3F57A 1MMAA 2ES0A 3AE2A 2MOZA 1ZP0A 4CXWA 4EEBA 4ZI2D 5GONE 1UUSA 2KT9A 2WAUA 3Q5WA 3DJBA 4QKNA 2V5DA 5DJQC 2RPAA 2XSAA 3PUWF 4HE8A 4AKRB 5FL1A 4UXNB 1DU2A 3FZKB 4DNDA 1U5PA 2KZ7B 1I6ZA 3ZJ2A 2LLYA 3QK6A 3PUZF 1HG2A 2BDEA 2OA5A 2JIWA 3OBVE 1WRDA 3AECA 3LFMA 1S35A 2XZEA 2DWKA 3H3MA 1CUNA 2A72A 2FJDA 3LK2B 5H6QB 2IW5B 4U2YA 4LF5T 2F4VT 4CZZB 5KMGP 4H9QC 4BJNA 1X9BA 2C5JA 5JREA 2XQAA 2XHEB 3G06A 4EOZB 4NUUA 2A2FX 2L3LA 2VKJA 3HR0A 1SHZC 1ZHCA 3SOLA 2CRBA 2FJAA 5CA0E 4PJMA 2V5CA 3CMLA 4AKIA 4HFIA 2IC6A 3TLTA 4QXBB 2X51A 1ZEEA 2LM9A 4LFCT 2DNXA 2JPFA 4KHPT 4AQFA 1J5WA 2BBHA 2CXLA 4MFRA 5E0OA 2CMRA 2BG9C 4O4LE 5FYMA 2WMOA 4DR3T 4P0AA 2E5LT 3ZEFB 1D0YA 3AEGA 3TLVA 2XY8B 2YU1A 3VR9A 2X9YA 5CGMA 4UV9B 5LGTB 2VASA 1ZOYA 3ONLC 3D0TA 3SWHA 3DP7A 1WYCA 2WY2A 3B5MA 4P0BA 1Z8UA 2WB5A 4EYUA 5JH7E 5LG3A 3KFWX 4OHFA 4DV3T 4HWHA 2CBJA 2JQQA 5J1GA 5L3DB 3UTKA 3PU3A 4U2ZA 2J4GA 4KBMB 2VQET 1L0VA 4DUYT 2Q9QB 2SPCA 1VOMA 3O1IA 4CI3B 3RPUA 5JDQA 2QA7A 4YSZA 2C5IT 4X1KE 5HXEA 3B57A 5IUXA 3RIUA 5AQPB 2VVNA 3WI3A 4O4HE 3UT5E 4EGWA 3AA1B 2PFVA 5AQFB 5HEHA 3MXZA 1QSDA 2NTXA 2LKGA 4A56A 5L47A 4JI0T 2UXNB 4K0UA 3K1SA 2K48A 4LMKA 1KNZA 4TV8E 4JYAT 2VK9A 2A3DA 3PU8A 3O1JA 4U7YA 5FKYA 5LP6E 3FB2A 1FMWA 3U3IA 5J2UE 3N9MA 5AQKB 3R84B 4IREA 2XJ7A 4I0UA 4B6XA 1MMDA 2YDRA 1ZKEA 1MIVA 4ZXLA 4AISA 5LG4A 3FBLA 1Y01A 2QGSA
chains in the Genus database with same CATH topology
2I59A 3KBTA 2RP4A 4UIGA 4TUYE 2JMHA 1G73A 2CXDA 3E08A 3K8PC 4YJ2E 2LT3A 2PBIA 3RH3A 5J2TE 3J7Yq 3O9XA 1BR4A 1D1BA 2LE8A 2XAGB 3IF8B 4AKLA 2V1DB 3SRZA 5LGUB 5HXCA 4OFZA 5L3CB 3UUMA 2BZBA 2KNDA 2K24A 3PUGA 4E7SA 3ZN1B 3KV4A 5LBQB 3HKBE 4XZCA 3MZKB 3C50A 3FHNA 1US7B 2XAJB 2HH7A 3B13A 4AQFC 5ADXL 4DBRA 2G0UA 5EK3A 4ADZA 2Y6XA 3KVAA 3ZMVB 2LJLA 5F8PA 1Y64B 1MIYA 2N9DA 4EYYR 1AJ3A 3MKDA 3KBUA 3GN5B 4GK0E 4QHOA 4MALA 1BR1A 2E9XD 3RC3A 2PJQA 3N2OA 3NRXA 4QXHB 3L09A 3LK3B 2JRKA 4V1Av 5IYZE 2XTLA 1HS7A 2DI4A 5FY1A 3IHRA 4TV9E 4I50E 2X66A 1B7TA 3Q9DA 3RX6A 4O4IE 2W61A 2XAFB 3CVRA 4DMVA 4X20E 4IIJE 4HFVA 2LSIA 2NOXA 1BR0A 4O8SA 2GK9A 3RKOA 3M65A 2Y8DA 4DO0A 4AKGA 5LCYA 3EVYA 4PAGA 3BK9A 2HPLA 2CE7A 1HFAA 1ZV4X 4ZI3D 4O2AE 3AA6B 4ZS2A 3ONXA 4GYRA 4UEMA 5JR9B 3QUJA 2Y48B 4QWNB 3CWZB 1IJ5A 3PUSA 5LGNB 3EUHA 4OK0A 1KK7A 3N9NA 2KLQA 1BR2A 1D1CA 3AAEB 3ZMUB 2Q9QD 3RYCE 3OKQA 5LJNA 1T98A 1NWMX 3UUNA 5JDLA 4IE5A 5EK4A 5CB4E 1UCUA 3RRCA 5L3BB 3RYFE 2UXXB 5L3FB 3FXDB 3GA8A 3I9YA 3KV9A 4UF0B 5M4YA 4ERRA 3PTRB 1LKXA 4GOUA 2Z6EA 4ANJA 5C8YE 1YKHB 3C4ZA 1QUUA 3HKCE 4PK4A 2EHOD 3LK42 2X9HA 2IC9A 1X79A 4X1IE 2XAHB 2K5BB 4E7ZA 3CX6B 3MACA 3ANWB 4H63V 4HKAA 5JDHA 2YK0A 4HTEA 2LEHA 2CA5A 2LHNA 4ZI7E 4IDZA 2MTQA 3CPZA 5BMVE 3K3QC 3Q2MA 3CQXC 3CKDA 4I43B 4TN7B 5DABA 4H9NC 1EZ3A 2CWYA 2WBLA 3AA7B 3ZYMA 1Z0PA 5JR9A 4EZHA 5F3JA 3L3PA 3K3OA 5FY7A 3ZMTB 5KX5E 3HA4A 2V7LA 4G63A 2P9BA 4HGAA 1E1HB 4M1PA 4KMCA 5JDGA 3LJCA 2KXPB 4X1YE 2C0SA 4MLKA 4YFSA 2CEAA 3ZC1A 4C90A 3MJXA 2NW8A 4MBQA 4UF0A 2Q9QC 1IJ6A 2XUEA 4FJOA 2CWOA 5LYJE 3JC6D 4O2BE 2N1GA 2VWAA 2ZM0A 5JDMA 3WAJA 3C4XA 3CX8B 1LRZA 3PUQA 3PE0A 5LHHB 3J9X1 3F31A 1FMVA 4F6RC 4CXYA 3Q5XA 4H9PC 3ANWA 2E9XB 2WWUA 2ZM2A 2ZM8A 5JR9C 3AAAB 2MYSA 4ZHQE 1YD8G 2LSJA 3GMIA 2DHRA 4WNKA 2J1DG 2YEVC 3T8OA 3NBXX 3ETUA 5FP3A 3N9LA 2B1EA 3PUAA 1WLXA 2D2SA 1MNDA 3ZN0B 3MA9A 2JMKA 2V7KA 3EDVA 1V9DA 2N2NA 2YU2A 4FI5A 1HF8A 1WR6A 3U78A 5JQGE 2W63A 2BVLA 3EDUA 5LHIB 4I4TE 1MIWA 2X0LB 3ZMZB 4UVAB 4IE0A 1NAFA 2PG8A 1U4QA 3NZQA 3P7IA 2KMFA 3GWHA 3PURA 3BQIA 2NP9A 3VU7H 4GK5E 3N2GE 3ZC0A 1MMNA 3C64A 3K3NA 3V5UA 2W62A 4Z8XA 4YJ3E 4EXTA 5LXTE 4DBQA 2KINB 4CXXA 2C5KT 2V7MA 3FXEB 4UELA 1HX8A 3CQGB 3ZMSB 3AA0B 1S94A 4NUVA 1FIOA 4EIWA 5AFUL 5HWYA 2LSYA 4L9IA 2H7VC 3DTOA 2LSGA 1SA0E 3H3AA 3QC9A 4PK5A 4ASKA 3OYZA 5L2LA 2CM0A 5L3GB 3UULA 2VKDA 3VKGA 5EZYE 2HPJA 1G8XA 5TAOA 5HXRA 4QX7B 2NW9A 4JEHB 3V5SA 3AB3B 3N9PA 3HI2A 1IAPA 2VKOA 3IBPA 3ZLIA 4ISTA 5HYAA 3F2EA 4AKHA 3I0QA 4CI1B 4JUYA 2CLYB 4JLEA 3UFEA 5A1LA 2V7IA 1LVKA 3TKLB 4QX8B 2ZMAA 3H37A 1UX5A 3OYXA 4WW0A 4MHCA 2H3RA 3KV5A 3N2KE 3NZPA 4WBOA 4ZS3A 3KV6A 2LOSA 3P8CD 5H6RB 2XAQB 4L0RA 4XAXB 5FXWA 2V7JA 3E0ZA 3N5LA 4BA9A 2LOPA 4I55E 4BAYB 2Q9QA 2ZLYA 1O3XA 4U72A 1HG5A 3WAKA 3JC6C 1OWAA 3VKHA 5HAXA 3O4XE 2IAKA 5LJMA 2CXFA 3AAIA 4H9SE 4IHJE 4QXCB 3ZJ1A 4HN9A 1HCIA 5HXHA 2X9XA 5JRCB 3O1HA 3CX7B 3ZPOA 4H63H 2W0GA 3RYIE 3ZYLA 5IHYA 3I1AA 4UV8B 5DQVA 1UX4A 1D0ZA 4KP3C 1MNEA 2H7OA 5LOVE 5HXSA 5FMNA 3HL6A 2ODVA 4IGUA 2EHOB 3LG7A 1MMGA 4ISSA 5CA1E 2D0UA 3ESLA 2LHRA 2WM9A 2WSSV 3SS1A 1IZNB 2VKHA 5LA6E 2MBGA 3N9OA 1D1AA 2RA1A 2NWBA 2EHOC 3KDSE 4PJLA 2YINA 3BQKA 4WBNE 3RYHE 4JEUB 3OJAA 3IEEA 3W15B 4ZI2C 2X9WA 4IE7A 4AI6A 3RC8A 5DQWA 2WMNA 4C91A 2NW7A 3FBZA 3HKEE 3S4UA 5EK2A 5JRCA 5FXVA 2DCFA 2LSKA 4PJJA 4DMWA 4PFOA 3RRWA 2KWHA 3A5XA 4TX5A 5FNVE 2ACXA 1YKEB 3C98B 1OXZA 4O4JE 2XASB 2E8IA 4OYKA 2EHOA 3LBXA 1LVFA 4UVBB 3ZCJA 3AVSA 5FXZA 5JVDE 4U74A 5LBMA 4ZI3C 5LHGB 4DVDA 3C4WA 2V26A 2W00A 3N9QA 4AXPA 2VL8A 3LBXB 2X67A 4XBFB 2L9QA 3PDYA 4PJNA 3VHLA 2CLYC 4CQIA 3KVBA 3ETVA 5JDNA 5L3EB 1YW0A 5FXXA 3KINB 4BJMA 3I9WA 4EB6E 3UUXB 4L5GA 4PNIA 4UVCB 2VB6A 4G2AA 2K9AA 2NTYA 5LNKA 4PW8A 4HEAA 2DLRA 4OYJA 1H7CA 4J2CA 4EAHA 3AVRA 3ZCIA 4KUMB 3HKDE 3MK7C 2DWGA 4H9RC 2E9XC 1FEWA 5FY0A 5ETWA 2JJ9A 3ZYKA 4ZOLE 3E22E 4IE4A 5JDFA 3NRYA 4IE6A 4PK6A 3I0OA 4PFPA 4GYSA 4GIWA 1WYBA 3GN5A 2BVMA 3R6NA 2E9XA 2X68A 3C51A 4ILUA 4EZ4A 1HTJF 3CQCB 4P09A 2L8KA 4YHJA 3BQLA 4H9OC 4N78D 4YLHA 2CCQA 2D0TA 2XQYA 4CI2B 2M67A 4AQGA 1VRBA 2ODUA 2D5UA 2KWIB 1D0XA 3F57A 1MMAA 2ES0A 4ZI2D 2MOZA 4CXWA 5GONE 2KT9A 2WAUA 3Q5WA 3DJBA 4QKNA 4AKRB 5DJQC 5HWXA 4HE8A 4UXNB 4DNDA 1U5PA 2KZ7B 3ZJ2A 3QK6A 1HG2A 2BDEA 2OA5A 4TZ4C 3OBVE 1WRDA 3LFMA 5HXEA 1S35A 5KDMC 2DWKA 3LK2B 1CUNA 2A72A 2IW5B 5H6QB 4CZZB 5KMGP 4H9QC 4BJNA 2C5JA 5JREA 4EOZB 2XHEB 4NUUA 2A2FX 2L3LA 2VKJA 3HR0A 1SHZC 1ZHCA 3SOLA 5CA0E 4PJMA 3CMLA 4AKIA 2IC6A 4QXBB 2X51A 1ZEEA 2LM9A 2DNXA 2JPFA 4AQFA 2CXLA 5FYMA 5E0OA 4MFRA 2CMRA 4O4LE 2WMOA 4P0AA 3ZEFB 1D0YA 2YU1A 2X9YA 4UV9B 5LGTB 2VASA 3D0TA 3SWHA 3DP7A 1WYCA 4P0BA 5JH7E 4EYUA 3KFWX 4OHFA 2JQQA 5J1GA 5L3DB 3UTKA 3PU3A 4KBMB 2Q9QB 2SPCA 1VOMA 3O1IA 4CI3B 3RPUA 5JDQA 2QA7A 2C5IT 4X1KE 3B57A 3WI3A 4O4HE 3UT5E 3AA1B 2PFVA 3MXZA 1QSDA 2NTXA 4A56A 2UXNB 4K0UA 2K48A 1KNZA 4TV8E 2VK9A 2A3DA 3PU8A 3O1JA 5LP6E 3FB2A 1FMWA 3U3IA 5J2UE 3N9MA 3R84B 4B6XA 1MMDA 1ZKEA 1MIVA 5LG4A 3FBLA 2QGSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MBG A;  4FI5 A;  2X9X A;  1Z0P A;  1H7C A;  2IC6 A;  4J2C A;  4EYY R;  3FXD B;  1LVF A;  2C5I T;  3L3P A;  3TKL B;  2KWI B;  2X9W A;  3P7I A;  3MXZ A;  1QSD A;  2XTL A;  4DND A;  3QUJ A;  3S4U A;  2K48 A;  2X9Y A;  2IC9 A;  3QK6 A;  4CQI A;  4L0R A;  1IJ5 A;  3N5L A;  1IJ6 A;  3CVR A;  2CA5 A;  4B6X A;  2C5K T;  2KWH A;  1ZKE A;  1LRZ A;  3FXE B;  2C5J A;  3CKD A;  2G0U A; 
#chains in the Genus database with same CATH topology
 2I59 A;  3KBT A;  2RP4 A;  4UIG A;  2WDV A;  3EAB A;  4IL4 A;  4TUY E;  3RGL A;  5HWX A;  4B3S T;  2JMH A;  1G73 A;  2CXD A;  3E08 A;  3K8P C;  4YJ2 E;  2LT3 A;  2PBI A;  3RH3 A;  5J2T E;  3J7Y q;  3O9X A;  1OED E;  1BR4 A;  1D1B A;  2LE8 A;  2XAG B;  3AED A;  3IF8 B;  4K0K T;  2JQ9 A;  5AQT B;  4AKL A;  2V1D B;  5AQN B;  3AE1 A;  2WWV A;  3RIA A;  3SRZ A;  2CHN A;  1VCS A;  5HXC A;  4OFZ A;  5L3C B;  5LGU B;  3UUM A;  2BZB A;  4DR1 T;  2KND A;  2K24 A;  3PUG A;  3PJA J;  3ZN1 B;  4E7S A;  1XNR T;  3KV4 A;  1YXR A;  3ZSS A;  5LBQ B;  4A97 A;  4DV0 T;  3OPC A;  3HKB E;  4XZC A;  3UUB A;  3MZK B;  3UU4 A;  4OX9 T;  2B76 A;  3C50 A;  3FHN A;  1US7 B;  2XAJ B;  1NEN A;  1WFD A;  2HH7 A;  3B13 A;  4AQF C;  5ADX L;  4DBR A;  4DV4 T;  2G0U A;  5EK3 A;  2V6X A;  4ADZ A;  2Y6X A;  3KVA A;  3ZMV B;  3QOF A;  4NXN T;  2WZI A;  3UUN A;  2LJL A;  4KI0 F;  1Y64 B;  5F8P A;  1MIY A;  2N9D A;  2BS3 A;  4Z91 A;  5KDM C;  4EYY R;  1AJ3 A;  3MKD A;  3KBU A;  3GN5 B;  4GK0 E;  4QHO A;  4MAL A;  1BR1 A;  2E9X D;  3RC3 A;  2PJQ A;  3N2O A;  3NRX A;  4ZZB A;  4QXH B;  3L09 A;  1N34 T;  3LK3 B;  2JRK A;  5AQJ B;  4V1A v;  5IYZ E;  2M6I A;  2OLT A;  4JI1 T;  2XTL A;  2ZM6 T;  2DI4 A;  5FY1 A;  1HS7 A;  3IHR A;  4JI6 T;  4TV9 E;  4I50 E;  1KNP A;  2NR4 A;  4LF7 T;  2X66 A;  1B7T A;  3Q9D A;  3RX6 A;  4O4I E;  2W61 A;  3X1D A;  2XAF B;  3CVR A;  4DV7 T;  4IDQ A;  4YSY A;  4DMV A;  4X20 E;  4IIJ E;  4DR6 T;  2X0Y A;  5AQS B;  4HFV A;  3RQW A;  2LSI A;  5AQO B;  4LMJ A;  2NOX A;  1QLB A;  4HFE A;  5AQR B;  4O8S A;  2GK9 A;  1BR0 A;  4DV6 T;  3RKO A;  2WS3 A;  1T72 A;  2FJB A;  2Y8D A;  3M65 A;  4NIQ A;  4F8H A;  2JQH A;  4Q25 A;  5CFB A;  4DO0 A;  3T1H T;  4JI3 T;  1XNQ T;  4AKG A;  5LCY A;  3AE8 A;  3EVY A;  4PAG A;  3BK9 A;  3AEA A;  2HPL A;  2CE7 A;  3RI5 A;  1HFA A;  2AE9 A;  2YOE A;  1ZV4 X;  4ZI3 D;  4ILA A;  3L39 A;  4O2A E;  3AA6 B;  4ZS2 A;  2QYW A;  1N33 T;  3ZT7 A;  3ONX A;  4GYR A;  5FL0 A;  3LSV A;  4UEM A;  4X5T A;  3QUJ A;  2Y48 B;  5ABH A;  5JR9 B;  1XMQ T;  2VL0 A;  4JI8 T;  4QWN B;  3CWZ B;  1IJ5 A;  3PUS A;  5LGN B;  5LB7 B;  2FJE A;  3EUH A;  4OK0 A;  3RQU A;  2BKP A;  1KK7 A;  1WR0 A;  3N9N A;  2KLQ A;  1BR2 A;  1D1C A;  3AAE B;  4WZX A;  3ZMU B;  2Q9Q D;  3UQ7 A;  2E2A A;  4HWI B;  3OKQ A;  3RYC E;  5LJN A;  3ZST A;  1T98 A;  1NWM X;  1XMO T;  1T8B A;  5AQU B;  2W4X A;  4HFC A;  4IE5 A;  5EK4 A;  1UCU A;  5CB4 E;  3RHW A;  3RRC A;  2UXX B;  3RYF E;  3UU5 A;  5L3F B;  4IL9 A;  3FXD B;  3GA8 A;  3I9Y A;  3KV9 A;  4UF0 B;  5M4Y A;  3ZKR A;  4ERR A;  3PTR B;  1LKX A;  4GOU A;  2Z6E A;  4ANJ A;  2YDS A;  3P4R A;  1XDO A;  4AIU A;  1YKH B;  5C8Y E;  3C4Z A;  3Q5D A;  1T7S A;  1QUU A;  3HKC E;  4PK4 A;  2EHO D;  3EAM A;  3EI0 A;  4TZ4 C;  3LK4 2;  2X9H A;  2MAW A;  2IC9 A;  1X79 A;  2XAH B;  2K5B B;  4X1I E;  4E7Z A;  3CX6 B;  3MAC A;  1IBL T;  3ANW B;  4H63 V;  4HKA A;  5JDH A;  2YK0 A;  4HTE A;  2LEH A;  2CA5 A;  2LHN A;  3L8R A;  2QRX A;  4YSX A;  4ZI7 E;  3CK6 A;  1N32 T;  4IDZ A;  2MTQ A;  2XQ7 A;  3CPZ A;  5BMV E;  2XM1 A;  3K3Q C;  1HNZ T;  3AE9 A;  3CQX C;  3Q2M A;  3CKD A;  4I43 B;  4TN7 B;  5DAB A;  4H9N C;  1EZ3 A;  2CWY A;  2WBL A;  3AA7 B;  3ZYM A;  2UXC T;  1HNX T;  1Z0P A;  2E5V A;  5JR9 A;  4EZH A;  5F3J A;  4B3T T;  3L3P A;  5HEJ A;  2UUC T;  3K3O A;  5FY7 A;  3ZMT B;  5KX5 E;  3HA4 A;  2V7L A;  4G63 A;  2IUB A;  2P9B A;  3ABV A;  1E1H B;  2YN6 A;  3P4Q A;  4HGA A;  4KMC A;  3CIR A;  3LJC A;  2KXP B;  4HFD A;  2C0S A;  4X1Y E;  5JDG A;  5BR8 T;  4MLK A;  3AEB A;  2CEA A;  4YFS A;  2WP9 A;  3ZC1 A;  5FVK A;  4C90 A;  1W9R A;  3MJX A;  2PTF A;  2NW8 A;  2XQ3 A;  1KNR A;  4MBQ A;  2BKO A;  4UF0 A;  2Q9Q C;  5HCJ A;  3JAE A;  1IJ6 A;  2XUE A;  4B3M T;  4FJO A;  2CWO A;  5LYJ E;  4YT0 A;  3JC6 D;  4O2B E;  2N1G A;  2K3W A;  4QH5 A;  1J5E T;  2VWA A;  2ZM0 A;  4IDP A;  1W0A A;  3C4X A;  3CX8 B;  3M3Z B;  1LRZ A;  4TWF A;  4DID B;  4HWF A;  2QVA A;  3WAJ A;  1W09 A;  4A5X A;  3PUQ A;  3FZM B;  3PE0 A;  3VRB A;  3PUX F;  3J9X 1;  5LHH B;  1M7K A;  3F31 A;  1FMV A;  5FVL A;  4F6R C;  4CXY A;  3Q5X A;  4H9P C;  2V6Y B;  3ANW A;  4X66 T;  2E9X B;  2WWU A;  2WU5 A;  2ZM2 A;  5HEG A;  2ZM8 A;  3EHZ A;  5JR9 C;  3AAA B;  4ZZC A;  2MYS A;  4ZHQ E;  2JQK A;  3NWI A;  1YD8 G;  2LSJ A;  2H89 A;  2YKS A;  3GMI A;  2M6B A;  4JI4 T;  1E2A A;  2DHR A;  1YQ3 A;  4WNK A;  2J1D G;  4JI2 T;  2YEV C;  3T8O A;  3NBX X;  4WYV A;  1M62 A;  3ETU A;  5FP3 A;  4LF4 T;  3N9L A;  2B1E A;  4EV6 A;  3PUA A;  1WLX A;  2W2U A;  2D2S A;  1MND A;  3ZN0 B;  3MA9 A;  1R8I A;  2JMK A;  2V7K A;  3AE5 A;  2N2N A;  1V9D A;  2YU2 A;  3EDV A;  1UK5 A;  3PJA A;  1HF8 A;  3AXJ B;  4FI5 A;  3SFD A;  5JDM A;  2WDR A;  2XQ4 A;  4DR4 T;  2YDQ A;  1WR6 A;  3U78 A;  5JQG E;  3FZH B;  2W63 A;  3OTO T;  4DR5 T;  2BVL A;  2XQ9 A;  3EDU A;  5LHI B;  3AE6 A;  4I4T E;  1MIW A;  2X0L B;  3ZMZ B;  4UVA B;  4IE0 A;  1NAF A;  2UU9 T;  2LKH A;  2PG8 A;  1U4Q A;  4YHH T;  3NZQ A;  3P7I A;  2KMF A;  3GWH A;  1OED C;  3PUR A;  3P4P A;  3BQI A;  2NP9 A;  3Q5E A;  3VU7 H;  4DR7 T;  3FZL B;  4GK5 E;  3AE4 A;  3AEF A;  3N2G E;  3UFG A;  1MMN A;  3C64 A;  3K3N A;  3ZC0 A;  4HFB A;  3V5U A;  4M1P A;  2W62 A;  4IDO A;  2V6Y A;  2X0H A;  4Z8X A;  4YJ3 E;  4EXT A;  2BS2 A;  3P50 A;  5LXT E;  2UUA T;  4DBQ A;  2KIN B;  4CXX A;  1HR0 T;  2C5K T;  3A8Y C;  2V7M A;  3TLW A;  3ZT5 A;  3FXE B;  4UEL A;  1HX8 A;  3AEE A;  3CQG B;  2WDQ A;  4U3C A;  3UU3 A;  3ZMS B;  3AA0 B;  4QH4 A;  3TLS A;  1OED B;  1HX1 B;  1S94 A;  3QB5 K;  5F5W A;  4ZEY A;  3TLU A;  4NUV A;  1FIO A;  2CBI A;  4EIW A;  1JNZ A;  2VQF T;  5AFU L;  4TWH A;  4NPP A;  5J0Z A;  3VR8 A;  5HWY A;  1VCT A;  1WCR A;  2LSY A;  4L9I A;  2H7V C;  3NVO A;  2IML A;  4A98 A;  3DTO A;  2LSG A;  3JCF A;  2WU2 A;  1SA0 E;  3H3A A;  4JV5 T;  3QC9 A;  4PK5 A;  4UR9 A;  4ASK A;  3OYZ A;  1CHU A;  5L2L A;  2I0M A;  2CM0 A;  5L3G B;  5AQI B;  3UUL A;  1XZY A;  2VKD A;  2J47 A;  4Z90 A;  4GKJ T;  1KF6 A;  3VKG A;  5EZY E;  2HPJ A;  1G8X A;  5TAO A;  4DUZ T;  5HXR A;  4QX7 B;  2NW9 A;  4JEH B;  5AQQ B;  3V5S A;  3AE3 A;  3AB3 B;  3N9P A;  2MPK A;  2ACZ A;  1IAP A;  2VKO A;  3HI2 A;  3IBP A;  4IST A;  3ZLI A;  3F2E A;  5HYA A;  4JI7 T;  3I0Q A;  4CI1 B;  4AKH A;  4JUY A;  5IWA T;  2CLY B;  4JLE A;  5AQL B;  3UFE A;  2V7I A;  1LVK A;  3PUY F;  5A1L A;  1HNW T;  1KEY A;  2BBJ A;  3TKL B;  4QX8 B;  2WZH A;  5HEU A;  2ZMA A;  3H37 A;  2H88 A;  1UX5 A;  2I6H A;  4YTP A;  3OYX A;  2UUB T;  4WW0 A;  4MHC A;  2KSR A;  5AQH B;  2AXD S;  2IHR 1;  4LF6 T;  2D9D A;  5KXJ A;  2H3R A;  3KV5 A;  3N2K E;  3NZP A;  4WBO A;  4ZS3 A;  2VUR A;  3KV6 A;  4TWD A;  2LOS A;  3P8C D;  5H6R B;  1YQ4 A;  2XAQ B;  4L0R A;  4XAX B;  5FXW A;  2V7J A;  3E0Z A;  3N5L A;  4BA9 A;  2HN2 A;  2LOP A;  4I55 E;  4BAY B;  2Q9Q A;  2ZLY A;  1O3X A;  2W67 A;  4U72 A;  5LMU T;  1HG5 A;  2R6G F;  4DR2 T;  4KX6 A;  1IBK T;  3WAK A;  3JC6 C;  2UXB T;  1OWA A;  2WQY A;  5HAX A;  3O4X E;  2UXD T;  3VKH A;  2XPK A;  2IAK A;  2OV9 A;  4JI5 T;  3RIF A;  5LJM A;  2CXF A;  3AAI A;  4H9S E;  4IHJ E;  4QXC B;  3ZJ1 A;  4HN9 A;  1HCI A;  3SFE A;  4ILC A;  5AQG B;  4QH1 A;  5HXH A;  2X9X A;  5JRC B;  3O1H A;  3CX7 B;  3ZPO A;  4H63 H;  2W0G A;  4U31 A;  2XQ8 A;  3RYI E;  3ZYL A;  5IHY A;  3I1A A;  4TNW A;  4UV8 B;  5DQV A;  3PUV F;  1UX4 A;  1D0Z A;  2J62 A;  1MNE A;  2H7O A;  2V8S V;  3JAF A;  4KP3 C;  5L3B B;  5LOV E;  2CPT A;  5HXS A;  2HHH T;  1FJG T;  5FMN A;  3UU8 A;  4TNV A;  3HL6 A;  2ODV A;  5C2T A;  1XWM A;  4IGU A;  2EHO B;  2IDO B;  3LG7 A;  1MMG A;  2XQ6 A;  4ISS A;  4U33 A;  5CA1 E;  1KFY A;  2D0U A;  3ESL A;  3RLF F;  3NKZ A;  2LHR A;  2WM9 A;  2WSS V;  3FZF B;  3SS1 A;  4YXD A;  1IZN B;  2VKH A;  5LA6 E;  3ONJ A;  2MBG A;  3N9O A;  4JBW F;  1D1A A;  2RA1 A;  2NWB A;  2EHO C;  2BKN A;  1SUM B;  3KDS E;  2YIN A;  3BQK A;  4PJL A;  3RYH E;  4JEU B;  4WBN E;  1GQE A;  4X65 T;  4X64 T;  3OJA A;  3UQ4 A;  5LMN T;  3IEE A;  3W15 B;  2BG9 A;  4ZI2 C;  2X9W A;  4IE7 A;  4AI6 A;  3RC8 A;  5DQW A;  1OED A;  1J1J A;  2WMN A;  4C91 A;  2NW7 A;  5ABF B;  3FBZ A;  3HKE E;  3S4U A;  2W66 A;  3ZT6 A;  5EK2 A;  4DV5 T;  4AQY T;  1IBM T;  5JRC A;  5FXV A;  5ABG A;  1N36 T;  4IDN A;  2DCF A;  2HN1 A;  2LSK A;  4HWD A;  4PJJ A;  4DMW A;  2A9U A;  3PV0 F;  4PFO A;  3RRW A;  2KWH A;  2FUP A;  3A5X A;  4IT4 A;  4TX5 A;  5FNV E;  2ACX A;  2XQ5 A;  1YKE B;  2FBW A;  3C98 B;  3OVU A;  5JDL A;  1OXZ A;  4P1N A;  4O4J E;  2XAS B;  2E8I A;  4OYK A;  2EHO A;  3LBX A;  1LVF A;  3P4S A;  3RIU C;  4CN6 A;  4NXM T;  4UVB B;  3ZCJ A;  3AVS A;  5FXZ A;  5JVD E;  4U74 A;  5LBM A;  3A7M A;  4ZI3 C;  4YTN A;  4YY3 T;  4HWC A;  5LHG B;  4DVD A;  4LFB T;  4ILB A;  1E7P A;  4U7I A;  3C4W A;  2V26 A;  2W00 A;  3N9Q A;  4AXP A;  2VL8 A;  3LBX B;  3P4W A;  2X67 A;  4XBF B;  2LRL A;  2L9Q A;  3PDY A;  3IA3 A;  4HFH A;  2CLY C;  4PJN A;  3KVB A;  3ETV A;  5AQV B;  3VHL A;  4CQI A;  5JDN A;  5L3E B;  1W0B A;  3RKG A;  1YW0 A;  2BG9 B;  5C3J A;  5FXX A;  3KIN B;  4LF8 T;  4BJM A;  3I9W A;  3T1Y T;  4EB6 E;  3UUX B;  4EED A;  4L5G A;  1SE7 A;  4PNI A;  4UVC B;  2VB6 A;  5HCM A;  4G2A A;  2K9A A;  2NTY A;  5LNK A;  4PW8 A;  4HEA A;  1UGO A;  2DLR A;  2LM2 A;  4OYJ A;  1I94 T;  1H7C A;  4J2C A;  5HEO A;  4EAH A;  3AVR A;  5ABF A;  3ZCI A;  4KUM B;  3JAD A;  5L4E A;  3HKD E;  3MK7 C;  1UUR A;  2XSB A;  2DWG A;  4LML A;  4H9R C;  2E9X C;  1FEW A;  5FY0 A;  5ETW A;  4COF A;  4LFA T;  2JJ9 A;  3QNU A;  3ZYK A;  4ZOL E;  3E22 E;  4IE4 A;  5JDF A;  3NRY A;  4CN1 A;  5L4H A;  2BG9 E;  2XM2 A;  4IE6 A;  4PK6 A;  3I0O A;  3AXJ A;  4GYS A;  4PFP A;  4GKK T;  4GIW A;  1WYB A;  3GN5 A;  3VRA A;  4LF9 T;  4X62 T;  3AE7 A;  2BVM A;  3R6N A;  2E9X A;  2CHO A;  2X68 A;  3C51 A;  2DL1 A;  4ILU A;  5AQM B;  4EZ4 A;  1HTJ F;  3CQC B;  4P09 A;  5CJ5 A;  2WCA A;  1XDP A;  2L8K A;  4DV1 T;  3LDQ B;  1NEK A;  3RF1 A;  4YHJ A;  2VVS A;  4KHZ F;  3BQL A;  5ABE A;  5JTG A;  2BS4 A;  4H9O C;  4N78 D;  2LRK A;  2CCQ A;  4YLH A;  2D0T A;  2XQY A;  3QB5 A;  4YTM A;  4CI2 B;  2IIU A;  4CN4 A;  3UU6 A;  2M67 A;  4AQG A;  4DV2 T;  1VRB A;  2ODU A;  4B3R T;  2D5U A;  2KWI B;  1D0X A;  1JNR A;  3F57 A;  1MMA A;  2ES0 A;  3AE2 A;  2MOZ A;  1ZP0 A;  4CXW A;  4EEB A;  4ZI2 D;  5GON E;  1UUS A;  2KT9 A;  2WAU A;  3Q5W A;  3DJB A;  4QKN A;  2V5D A;  5DJQ C;  2RPA A;  2XSA A;  3PUW F;  4HE8 A;  4AKR B;  5FL1 A;  4UXN B;  1DU2 A;  3FZK B;  4DND A;  1U5P A;  2KZ7 B;  1I6Z A;  3ZJ2 A;  2LLY A;  3QK6 A;  3PUZ F;  1HG2 A;  2BDE A;  2OA5 A;  2JIW A;  3OBV E;  1WRD A;  3AEC A;  3LFM A;  1S35 A;  2XZE A;  2DWK A;  3H3M A;  1CUN A;  2A72 A;  2FJD A;  3LK2 B;  5H6Q B;  2IW5 B;  4U2Y A;  4LF5 T;  2F4V T;  4CZZ B;  5KMG P;  4H9Q C;  4BJN A;  1X9B A;  2C5J A;  5JRE A;  2XQA A;  2XHE B;  3G06 A;  4EOZ B;  4NUU A;  2A2F X;  2L3L A;  2VKJ A;  3HR0 A;  1SHZ C;  1ZHC A;  3SOL A;  2CRB A;  2FJA A;  5CA0 E;  4PJM A;  2V5C A;  3CML A;  4AKI A;  4HFI A;  2IC6 A;  3TLT A;  4QXB B;  2X51 A;  1ZEE A;  2LM9 A;  4LFC T;  2DNX A;  2JPF A;  4KHP T;  4AQF A;  1J5W A;  2BBH A;  2CXL A;  4MFR A;  5E0O A;  2CMR A;  2BG9 C;  4O4L E;  5FYM A;  2WMO A;  4DR3 T;  4P0A A;  2E5L T;  3ZEF B;  1D0Y A;  3AEG A;  3TLV A;  2XY8 B;  2YU1 A;  3VR9 A;  2X9Y A;  5CGM A;  4UV9 B;  5LGT B;  2VAS A;  1ZOY A;  3ONL C;  3D0T A;  3SWH A;  3DP7 A;  1WYC A;  2WY2 A;  3B5M A;  4P0B A;  1Z8U A;  2WB5 A;  4EYU A;  5JH7 E;  5LG3 A;  3KFW X;  4OHF A;  4DV3 T;  4HWH A;  2CBJ A;  2JQQ A;  5J1G A;  5L3D B;  3UTK A;  3PU3 A;  4U2Z A;  2J4G A;  4KBM B;  2VQE T;  1L0V A;  4DUY T;  2Q9Q B;  2SPC A;  1VOM A;  3O1I A;  4CI3 B;  3RPU A;  5JDQ A;  2QA7 A;  4YSZ A;  2C5I T;  4X1K E;  5HXE A;  3B57 A;  5IUX A;  3RIU A;  5AQP B;  2VVN A;  3WI3 A;  4O4H E;  3UT5 E;  4EGW A;  3AA1 B;  2PFV A;  5AQF B;  5HEH A;  3MXZ A;  1QSD A;  2NTX A;  2LKG A;  4A56 A;  5L47 A;  4JI0 T;  2UXN B;  4K0U A;  3K1S A;  2K48 A;  4LMK A;  1KNZ A;  4TV8 E;  4JYA T;  2VK9 A;  2A3D A;  3PU8 A;  3O1J A;  4U7Y A;  5FKY A;  5LP6 E;  3FB2 A;  1FMW A;  3U3I A;  5J2U E;  3N9M A;  5AQK B;  3R84 B;  4IRE A;  2XJ7 A;  4I0U A;  4B6X A;  1MMD A;  2YDR A;  1ZKE A;  1MIV A;  4ZXL A;  4AIS A;  5LG4 A;  3FBL A;  1Y01 A;  2QGS A; 
#chains in the Genus database with same CATH homology
 2I59 A;  3KBT A;  2RP4 A;  4UIG A;  4TUY E;  2JMH A;  1G73 A;  2CXD A;  3E08 A;  3K8P C;  4YJ2 E;  2LT3 A;  2PBI A;  3RH3 A;  5J2T E;  3J7Y q;  3O9X A;  1BR4 A;  1D1B A;  2LE8 A;  2XAG B;  3IF8 B;  4AKL A;  2V1D B;  3SRZ A;  5LGU B;  5HXC A;  4OFZ A;  5L3C B;  3UUM A;  2BZB A;  2KND A;  2K24 A;  3PUG A;  4E7S A;  3ZN1 B;  3KV4 A;  5LBQ B;  3HKB E;  4XZC A;  3MZK B;  3C50 A;  3FHN A;  1US7 B;  2XAJ B;  2HH7 A;  3B13 A;  4AQF C;  5ADX L;  4DBR A;  2G0U A;  5EK3 A;  4ADZ A;  2Y6X A;  3KVA A;  3ZMV B;  2LJL A;  5F8P A;  1Y64 B;  1MIY A;  2N9D A;  4EYY R;  1AJ3 A;  3MKD A;  3KBU A;  3GN5 B;  4GK0 E;  4QHO A;  4MAL A;  1BR1 A;  2E9X D;  3RC3 A;  2PJQ A;  3N2O A;  3NRX A;  4QXH B;  3L09 A;  3LK3 B;  2JRK A;  4V1A v;  5IYZ E;  2XTL A;  1HS7 A;  2DI4 A;  5FY1 A;  3IHR A;  4TV9 E;  4I50 E;  2X66 A;  1B7T A;  3Q9D A;  3RX6 A;  4O4I E;  2W61 A;  2XAF B;  3CVR A;  4DMV A;  4X20 E;  4IIJ E;  4HFV A;  2LSI A;  2NOX A;  1BR0 A;  4O8S A;  2GK9 A;  3RKO A;  3M65 A;  2Y8D A;  4DO0 A;  4AKG A;  5LCY A;  3EVY A;  4PAG A;  3BK9 A;  2HPL A;  2CE7 A;  1HFA A;  1ZV4 X;  4ZI3 D;  4O2A E;  3AA6 B;  4ZS2 A;  3ONX A;  4GYR A;  4UEM A;  5JR9 B;  3QUJ A;  2Y48 B;  4QWN B;  3CWZ B;  1IJ5 A;  3PUS A;  5LGN B;  3EUH A;  4OK0 A;  1KK7 A;  3N9N A;  2KLQ A;  1BR2 A;  1D1C A;  3AAE B;  3ZMU B;  2Q9Q D;  3RYC E;  3OKQ A;  5LJN A;  1T98 A;  1NWM X;  3UUN A;  5JDL A;  4IE5 A;  5EK4 A;  5CB4 E;  1UCU A;  3RRC A;  5L3B B;  3RYF E;  2UXX B;  5L3F B;  3FXD B;  3GA8 A;  3I9Y A;  3KV9 A;  4UF0 B;  5M4Y A;  4ERR A;  3PTR B;  1LKX A;  4GOU A;  2Z6E A;  4ANJ A;  5C8Y E;  1YKH B;  3C4Z A;  1QUU A;  3HKC E;  4PK4 A;  2EHO D;  3LK4 2;  2X9H A;  2IC9 A;  1X79 A;  4X1I E;  2XAH B;  2K5B B;  4E7Z A;  3CX6 B;  3MAC A;  3ANW B;  4H63 V;  4HKA A;  5JDH A;  2YK0 A;  4HTE A;  2LEH A;  2CA5 A;  2LHN A;  4ZI7 E;  4IDZ A;  2MTQ A;  3CPZ A;  5BMV E;  3K3Q C;  3Q2M A;  3CQX C;  3CKD A;  4I43 B;  4TN7 B;  5DAB A;  4H9N C;  1EZ3 A;  2CWY A;  2WBL A;  3AA7 B;  3ZYM A;  1Z0P A;  5JR9 A;  4EZH A;  5F3J A;  3L3P A;  3K3O A;  5FY7 A;  3ZMT B;  5KX5 E;  3HA4 A;  2V7L A;  4G63 A;  2P9B A;  4HGA A;  1E1H B;  4M1P A;  4KMC A;  5JDG A;  3LJC A;  2KXP B;  4X1Y E;  2C0S A;  4MLK A;  4YFS A;  2CEA A;  3ZC1 A;  4C90 A;  3MJX A;  2NW8 A;  4MBQ A;  4UF0 A;  2Q9Q C;  1IJ6 A;  2XUE A;  4FJO A;  2CWO A;  5LYJ E;  3JC6 D;  4O2B E;  2N1G A;  2VWA A;  2ZM0 A;  5JDM A;  3WAJ A;  3C4X A;  3CX8 B;  1LRZ A;  3PUQ A;  3PE0 A;  5LHH B;  3J9X 1;  3F31 A;  1FMV A;  4F6R C;  4CXY A;  3Q5X A;  4H9P C;  3ANW A;  2E9X B;  2WWU A;  2ZM2 A;  2ZM8 A;  5JR9 C;  3AAA B;  2MYS A;  4ZHQ E;  1YD8 G;  2LSJ A;  3GMI A;  2DHR A;  4WNK A;  2J1D G;  2YEV C;  3T8O A;  3NBX X;  3ETU A;  5FP3 A;  3N9L A;  2B1E A;  3PUA A;  1WLX A;  2D2S A;  1MND A;  3ZN0 B;  3MA9 A;  2JMK A;  2V7K A;  3EDV A;  1V9D A;  2N2N A;  2YU2 A;  4FI5 A;  1HF8 A;  1WR6 A;  3U78 A;  5JQG E;  2W63 A;  2BVL A;  3EDU A;  5LHI B;  4I4T E;  1MIW A;  2X0L B;  3ZMZ B;  4UVA B;  4IE0 A;  1NAF A;  2PG8 A;  1U4Q A;  3NZQ A;  3P7I A;  2KMF A;  3GWH A;  3PUR A;  3BQI A;  2NP9 A;  3VU7 H;  4GK5 E;  3N2G E;  3ZC0 A;  1MMN A;  3C64 A;  3K3N A;  3V5U A;  2W62 A;  4Z8X A;  4YJ3 E;  4EXT A;  5LXT E;  4DBQ A;  2KIN B;  4CXX A;  2C5K T;  2V7M A;  3FXE B;  4UEL A;  1HX8 A;  3CQG B;  3ZMS B;  3AA0 B;  1S94 A;  4NUV A;  1FIO A;  4EIW A;  5AFU L;  5HWY A;  2LSY A;  4L9I A;  2H7V C;  3DTO A;  2LSG A;  1SA0 E;  3H3A A;  3QC9 A;  4PK5 A;  4ASK A;  3OYZ A;  5L2L A;  2CM0 A;  5L3G B;  3UUL A;  2VKD A;  3VKG A;  5EZY E;  2HPJ A;  1G8X A;  5TAO A;  5HXR A;  4QX7 B;  2NW9 A;  4JEH B;  3V5S A;  3AB3 B;  3N9P A;  3HI2 A;  1IAP A;  2VKO A;  3IBP A;  3ZLI A;  4IST A;  5HYA A;  3F2E A;  4AKH A;  3I0Q A;  4CI1 B;  4JUY A;  2CLY B;  4JLE A;  3UFE A;  5A1L A;  2V7I A;  1LVK A;  3TKL B;  4QX8 B;  2ZMA A;  3H37 A;  1UX5 A;  3OYX A;  4WW0 A;  4MHC A;  2H3R A;  3KV5 A;  3N2K E;  3NZP A;  4WBO A;  4ZS3 A;  3KV6 A;  2LOS A;  3P8C D;  5H6R B;  2XAQ B;  4L0R A;  4XAX B;  5FXW A;  2V7J A;  3E0Z A;  3N5L A;  4BA9 A;  2LOP A;  4I55 E;  4BAY B;  2Q9Q A;  2ZLY A;  1O3X A;  4U72 A;  1HG5 A;  3WAK A;  3JC6 C;  1OWA A;  3VKH A;  5HAX A;  3O4X E;  2IAK A;  5LJM A;  2CXF A;  3AAI A;  4H9S E;  4IHJ E;  4QXC B;  3ZJ1 A;  4HN9 A;  1HCI A;  5HXH A;  2X9X A;  5JRC B;  3O1H A;  3CX7 B;  3ZPO A;  4H63 H;  2W0G A;  3RYI E;  3ZYL A;  5IHY A;  3I1A A;  4UV8 B;  5DQV A;  1UX4 A;  1D0Z A;  4KP3 C;  1MNE A;  2H7O A;  5LOV E;  5HXS A;  5FMN A;  3HL6 A;  2ODV A;  4IGU A;  2EHO B;  3LG7 A;  1MMG A;  4ISS A;  5CA1 E;  2D0U A;  3ESL A;  2LHR A;  2WM9 A;  2WSS V;  3SS1 A;  1IZN B;  2VKH A;  5LA6 E;  2MBG A;  3N9O A;  1D1A A;  2RA1 A;  2NWB A;  2EHO C;  3KDS E;  4PJL A;  2YIN A;  3BQK A;  4WBN E;  3RYH E;  4JEU B;  3OJA A;  3IEE A;  3W15 B;  4ZI2 C;  2X9W A;  4IE7 A;  4AI6 A;  3RC8 A;  5DQW A;  2WMN A;  4C91 A;  2NW7 A;  3FBZ A;  3HKE E;  3S4U A;  5EK2 A;  5JRC A;  5FXV A;  2DCF A;  2LSK A;  4PJJ A;  4DMW A;  4PFO A;  3RRW A;  2KWH A;  3A5X A;  4TX5 A;  5FNV E;  2ACX A;  1YKE B;  3C98 B;  1OXZ A;  4O4J E;  2XAS B;  2E8I A;  4OYK A;  2EHO A;  3LBX A;  1LVF A;  4UVB B;  3ZCJ A;  3AVS A;  5FXZ A;  5JVD E;  4U74 A;  5LBM A;  4ZI3 C;  5LHG B;  4DVD A;  3C4W A;  2V26 A;  2W00 A;  3N9Q A;  4AXP A;  2VL8 A;  3LBX B;  2X67 A;  4XBF B;  2L9Q A;  3PDY A;  4PJN A;  3VHL A;  2CLY C;  4CQI A;  3KVB A;  3ETV A;  5JDN A;  5L3E B;  1YW0 A;  5FXX A;  3KIN B;  4BJM A;  3I9W A;  4EB6 E;  3UUX B;  4L5G A;  4PNI A;  4UVC B;  2VB6 A;  4G2A A;  2K9A A;  2NTY A;  5LNK A;  4PW8 A;  4HEA A;  2DLR A;  4OYJ A;  1H7C A;  4J2C A;  4EAH A;  3AVR A;  3ZCI A;  4KUM B;  3HKD E;  3MK7 C;  2DWG A;  4H9R C;  2E9X C;  1FEW A;  5FY0 A;  5ETW A;  2JJ9 A;  3ZYK A;  4ZOL E;  3E22 E;  4IE4 A;  5JDF A;  3NRY A;  4IE6 A;  4PK6 A;  3I0O A;  4PFP A;  4GYS A;  4GIW A;  1WYB A;  3GN5 A;  2BVM A;  3R6N A;  2E9X A;  2X68 A;  3C51 A;  4ILU A;  4EZ4 A;  1HTJ F;  3CQC B;  4P09 A;  2L8K A;  4YHJ A;  3BQL A;  4H9O C;  4N78 D;  4YLH A;  2CCQ A;  2D0T A;  2XQY A;  4CI2 B;  2M67 A;  4AQG A;  1VRB A;  2ODU A;  2D5U A;  2KWI B;  1D0X A;  3F57 A;  1MMA A;  2ES0 A;  4ZI2 D;  2MOZ A;  4CXW A;  5GON E;  2KT9 A;  2WAU A;  3Q5W A;  3DJB A;  4QKN A;  4AKR B;  5DJQ C;  5HWX A;  4HE8 A;  4UXN B;  4DND A;  1U5P A;  2KZ7 B;  3ZJ2 A;  3QK6 A;  1HG2 A;  2BDE A;  2OA5 A;  4TZ4 C;  3OBV E;  1WRD A;  3LFM A;  5HXE A;  1S35 A;  5KDM C;  2DWK A;  3LK2 B;  1CUN A;  2A72 A;  2IW5 B;  5H6Q B;  4CZZ B;  5KMG P;  4H9Q C;  4BJN A;  2C5J A;  5JRE A;  4EOZ B;  2XHE B;  4NUU A;  2A2F X;  2L3L A;  2VKJ A;  3HR0 A;  1SHZ C;  1ZHC A;  3SOL A;  5CA0 E;  4PJM A;  3CML A;  4AKI A;  2IC6 A;  4QXB B;  2X51 A;  1ZEE A;  2LM9 A;  2DNX A;  2JPF A;  4AQF A;  2CXL A;  5FYM A;  5E0O A;  4MFR A;  2CMR A;  4O4L E;  2WMO A;  4P0A A;  3ZEF B;  1D0Y A;  2YU1 A;  2X9Y A;  4UV9 B;  5LGT B;  2VAS A;  3D0T A;  3SWH A;  3DP7 A;  1WYC A;  4P0B A;  5JH7 E;  4EYU A;  3KFW X;  4OHF A;  2JQQ A;  5J1G A;  5L3D B;  3UTK A;  3PU3 A;  4KBM B;  2Q9Q B;  2SPC A;  1VOM A;  3O1I A;  4CI3 B;  3RPU A;  5JDQ A;  2QA7 A;  2C5I T;  4X1K E;  3B57 A;  3WI3 A;  4O4H E;  3UT5 E;  3AA1 B;  2PFV A;  3MXZ A;  1QSD A;  2NTX A;  4A56 A;  2UXN B;  4K0U A;  2K48 A;  1KNZ A;  4TV8 E;  2VK9 A;  2A3D A;  3PU8 A;  3O1J A;  5LP6 E;  3FB2 A;  1FMW A;  3U3I A;  5J2U E;  3N9M A;  3R84 B;  4B6X A;  1MMD A;  1ZKE A;  1MIV A;  5LG4 A;  3FBL A;  2QGS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...