4L0RA

Crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
74
structure length
74
Chain Sequence
GINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of FGF2-interacting protein from Homo sapiens. Northeast Structural Genomics consortium id HR9027A
rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Centrosomal protein of 57 kDa
total genus 34
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06657 Cep57_MT_bd Centrosome microtubule-binding domain of Cep57
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l0rA00
2IC6A 2C5JA 3L3PA 1LRZA 2MBGA 2XTLA 4B6XA 2KWIB 3FXEB 2K48A 3CKDA 3P7IA 1IJ6A 2KWHA 2G0UA 3TKLB 2X9YA 2X9WA 4FI5A 1IJ5A 2C5KT 3QK6A 4EYYR 3CVRA 1QSDA 3QUJA 4L0RA 4CQIA 1Z0PA 4DNDA 1ZKEA 2C5IT 3N5LA 3FXDB 3MXZA 4J2CA 2X9XA 3S4UA 1H7CA 2IC9A 2CA5A 1LVFA
chains in the Genus database with same CATH superfamily
4AXPA 1LRZA 1D1CA 2D0UA 2FJDA 2VVNA 3RGLA 3AECA 2BG9A 3BK9A 3HKCE 5CA1E 5AQVB 2VKJA 4LF5T 1X79A 2WAUA 3LFMA 4QH4A 3UULA 2A9UA 3CK6A 2LHRA 2Q9QC 3KV5A 1NEKA 3N2GE 4MALA 3RYIE 1IBKT 1R8IA 4IREA 4AQGA 2FBWA 3PU3A 5L4HA 5L3EB 4YHHT 5FXXA 1L0VA 3MACA 4NPPA 2XQ4A 3NRYA 5IHYA 5LGUB 2LOPA 3D0TA 4HEAA 4HWHA 4WZXA 2VL0A 4DNDA 3PUVF 4UVBB 4U72A 4KP3C 4DO0A 4PK6A 1HG2A 2L3LA 3UU8A 4DV4T 2Q9QD 4GYSA 4O8SA 1MMAA 3ZN1B 5ABEA 2NW7A 5C8YE 2CHOA 3ETUA 3K3NA 3N9OA 4JI8T 2XQ3A 2CBJA 2C5JA 4HE8A 4YHJA 3VKGA 3I9YA 1ZHCA 2DLRA 3EHZA 3UFEA 3ZYMA 5HWXA 4UV9B 4BA9A 1KF6A 3SFEA 1IZNB 2QVAA 2UUAT 2UXCT 3OVUA 4B3ST 3FXEB 3C4WA 4E7SA 5AQKB 4JI2T 2K3WA 2V7KA 3E0ZA 3CQGB 3P7IA 3AE5A 3N2KE 3CQCB 4YTPA 1WRDA 2WSSV 3GWHA 1G73A 4CZZB 4TUYE 4I4TE 5FXWA 2V6XA 2DWKA 4A5XA 2J62A 3JC6D 2X9YA 3C4ZA 4X1IE 4ASKA 4N78D 3AAEB 4KI0F 4O4LE 5F8PA 3UU3A 4YSXA 4X62T 1VRBA 3FBZA 3PJAJ 1SA0E 2LRLA 3Q5WA 5AQSB 1HNXT 3NVOA 3P50A 5BR8T 3V5SA 2ES0A 4AISA 3G06A 5LOVE 3O1IA 5TAOA 1UX4A 5JRCB 4HWFA 1XWMA 3MA9A 2N2NA 4Z90A 2YINA 1LKXA 2BKPA 2IHR1 3PUQA 3J7Yq 4NIQA 4DBRA 4TWDA 2KINB 3CMLA 5EK2A 2C0SA 4O2AE 2LSJA 3N2OA 3AEDA 2FJEA 2XM2A 1Z8UA 3KBUA 1B7TA 2A2FX 3MK7C 1XDPA 3NKZA 4ILUA 2E8IA 4CI2B 4U2ZA 1HNWT 4DR7T 3UFGA 4CN6A 3AXJA 2EHOA 3DJBA 3RHWA 4LMLA 2QRXA 2C5KT 4IDZA 5HEUA 3QK6A 4EV6A 4JV5T 3QUJA 4A56A 2VKDA 5L47A 3PUXF 2CLYC 3EUHA 2J4GA 2XM1A 4H63H 2LSGA 2V7MA 4O2BE 3LBXB 2XQAA 4OFZA 2W2UA 3V5UA 4OX9T 3WI3A 5LHHB 5IWAT 1YXRA 3ZEFB 5DQWA 2YKSA 3ONLC 3L09A 2HHHT 2ACXA 1SUMB 3OJAA 2ZLYA 1M7KA 4IDOA 3PDYA 4HFHA 2IIUA 3N9LA 4DMVA 4B3TT 4LF4T 1W0BA 3LBXA 5LHGB 5LMNT 4DUZT 3LK3B 1WYBA 2XTLA 3L39A 5LGTB 1YKHB 3PJAA 3PUSA 2BS4A 5AQUB 1D1AA 3A5XA 2YK0A 5CJ5A 5KXJA 5LNKA 4XBFB 3BQIA 4UV8B 2V6YB 4HFEA 4JLEA 5HCJA 4DV2T 1O3XA 2Y6XA 3O4XE 3TKLB 3X1DA 2BBHA 4E7ZA 1HG5A 4AKHA 4V1Av 1D1BA 2NTYA 2NR4A 3TLVA 4F6RC 2LKGA 4B3RT 4UVAB 5HAXA 3R6NA 5HEOA 5ETWA 5HYAA 1HF8A 2CBIA 3ZJ1A 3RYHE 3T8OA 4J2CA 4BJNA 2VB6A 1UX5A 4GIWA 4YFSA 4PAGA 4QHOA 5FNVE 3M3ZB 5FYMA 2GK9A 2WQYA 4AKLA 1HR0T 4X1YE 2WDQA 4ISTA 4UF0A 2IC6A 2LT3A 3JAFA 2X0YA 4MFRA 2M6IA 3NZQA 4QXCB 2YU1A 2RA1A 3I0OA 3N9QA 5FP3A 3UU6A 4IT4A 3AVRA 2W00A 3ZSTA 3Q2MA 3CKDA 4PK4A 2IMLA 2BBJA 2QGSA 2WDVA 2LJLA 3JADA 3OKQA 3ZT7A 2CMRA 2X51A 2AXDS 4GOUA 4EXTA 2Y48B 3MJXA 5FY1A 3LJCA 4EZHA 2OLTA 4HGAA 3EVYA 2BKOA 1HX8A 3HKEE 4O4JE 3CVRA 2XAJB 4IDQA 1HCIA 2CWOA 3E22E 1T7SA 2XY8B 3LK42 2ZM2A 3PURA 3VRAA 1GQEA 4DV7T 4YSYA 4NXNT 4JI1T 5LA6E 4ISSA 4YJ3E 5FL1A 4HFIA 5IYZE 2JRKA 3SRZA 3ZYKA 4PFOA 5HCMA 3UUXB 3OTOT 4XAXB 3A7MA 3A8YC 5LJNA 1KNZA 2WZHA 1LVFA 4KBMB 5C2TA 4HKAA 4CXYA 2NWBA 4I50E 3I1AA 4I0UA 1N36T 1D0XA 5J2TE 2W63A 3JC6C 4YSZA 4LF7T 4ZI3D 3KV6A 3IBPA 2ODUA 1E1HB 3PE0A 4ZI2C 2HN2A 2PTFA 5JRCA 4U31A 3ZKRA 1LVKA 5HEJA 1HX1B 3P4QA 1HTJF 2NW9A 2LSYA 2WB5A 3BQLA 3KVBA 4MHCA 2XZEA 3JAEA 4UF0B 1MMDA 2A72A 1V9DA 3TLWA 4DUYT 2CE7A 5L4EA 4EIWA 2QYWA 4PFPA 4DIDB 2MAWA 2LKHA 4L0RA 4QXHB 3ANWB 2W67A 2XUEA 3AXJB 4PJMA 3AE9A 3H37A 4K0UA 1YW0A 3HA4A 5AQTB 3RX6A 4HTEA 5LGNB 2H3RA 4HFVA 3CX7B 3K8PC 1N32T 1BR0A 2CEAA 2I6HA 5JDFA 4OHFA 5AQNB 3I9WA 4ZS2A 4LF9T 3NZPA 4DBQA 5JDLA 2YDSA 2B1EA 4HWCA 4ZZBA 2XQ7A 2VASA 2J47A 3C50A 4P1NA 4YTNA 3QB5A 2CRBA 2KWIB 2N9DA 2WY2A 3P4RA 4U33A 2X68A 5AQGB 1XMOT 2VK9A 2BVMA 4JI4T 2UXBT 3AE8A 3U78A 2BS2A 5EZYE 4LF8T 5HXHA 2WBLA 1FIOA 3ZJ2A 4WBOA 3HR0A 3AA0B 2D9DA 3ZCIA 2V5DA 2LEHA 3N9MA 1MNEA 4PJLA 3KDSE 2LE8A 2VKHA 4AQFC 3N5LA 2WM9A 3UTKA 2WCAA 4I55E 5DABA 4ZS3A 1FMWA 2V1DB 2DNXA 2KMFA 2HH7A 4A97A 4DV5T 2IC9A 3ZMSB 4HN9A 5L3BB 5KMGP 1IAPA 4P0AA 3O1HA 3P4PA 4H9RC 4U7IA 1MMGA 4HWIB 2DCFA 2DL1A 4PNIA 3EDUA 2MBGA 4AQFA 5FXZA 3ZPOA 3VHLA 1BR2A 3K3QC 3Q5XA 3FZKB 1UCUA 3RQWA 2SPCA 1CHUA 1ZOYA 3OYXA 4IE7A 2UXDT 4TV8E 5LG3A 4Z8XA 2VQFT 4CN1A 5H6QB 2V7IA 3Q9DA 4JEHB 4NXMT 2YDQA 3MKDA 3OBVE 3IEEA 3ANWA 3ZN0B 4AIUA 3KINB 3AAIA 4QH5A 1HNZT 2X66A 4FI5A 4KX6A 2VL8A 3UU5A 1QLBA 2ZM0A 4PK5A 3ZLIA 4DR6T 3PUWF 1ZKEA 2WU2A 3RIAA 4WBNE 1NENA 1N33T 4IL4A 1N34T 5AQHB 3S4UA 4G63A 1FMVA 2XAFB 2LM9A 4QXBB 5J1GA 4EAHA 3AB3B 3AE6A 2E5VA 3AEGA 3ESLA 4UELA 4XZCA 1IBLT 4H9NC 3SS1A 2YN6A 3ZC1A 2JQ9A 4QH1A 4A98A 3O9XA 3ABVA 4EGWA 3N9PA 1ZV4X 4MBQA 3UUMA 5C3JA 5JR9C 1SHZC 2V7LA 3O1JA 2F4VT 2NP9A 4ADZA 2EHOC 1MNDA 2WS3A 4IIJE 2X0HA 4QX8B 5AQOB 3TLSA 3ZT6A 4LF6T 4G2AA 4B3MT 2I0MA 1W0AA 4YTMA 4TWHA 3QC9A 4JI5T 4O4HE 5LMUT 5LBMA 2E2AA 4GK5E 4IE5A 1Y01A 3M65A 4JBWF 5FY0A 1U5PA 5FY7A 5JVDE 2OV9A 4BAYB 4ZI7E 2BZBA 2X9WA 3K1SA 4JI7T 2N1GA 5GONE 4HWDA 1OEDE 1M62A 3T1HT 3TLUA 2I59A 3RC3A 4CI3B 2XQ5A 1KNPA 1OEDB 4EZ4A 4YT0A 5CGMA 4CN4A 4QKNA 4TZ4C 2IAKA 1ZP0A 1WR6A 3VR9A 2L9QA 2EHOD 1MIVA 1XNRT 1OWAA 2FJAA 3AA1B 3B13A 5ABFA 2ZM6T 4DR4T 3UQ7A 3CWZB 2W62A 4JI0T 5AQFB 5L3CB 2CCQA 2ZMAA 1YQ4A 3SFDA 3AE4A 4GKKT 2X67A 2L8KA 3EI0A 2JPFA 1IJ6A 3FHNA 3GMIA 2YU2A 3P4SA 1D0ZA 3Q5EA 1WYCA 4EEBA 4P0BA 4C91A 3KV4A 2YOEA 2BG9E 2W4XA 4PJNA 1IJ5A 4P09A 1X9BA 4YLHA 2V26A 2WWUA 2XQ9A 4ZI3C 2V6YA 3ONJA 3L8RA 3EDVA 2E9XC 3CPZA 3GA8A 3LSVA 4TWFA 2HN1A 4U74A 3OPCA 4ZZCA 2XSAA 5M4YA 2JQQA 1T8BA 1AJ3A 1KK7A 2JMKA 2MYSA 5ABGA 5DQVA 4HFDA 2RP4A 5HXSA 1T72A 2YDRA 3CIRA 4C90A 5JDMA 3H3AA 1US7B 5FMNA 4KHZF 2JIWA 4ERRA 5KDMC 1BR4A 3IA3A 2W0GA 3KV9A 4F8HA 1XMQT 4DMWA 2WP9A 4OYKA 1NAFA 2VVSA 2VKOA 3ZYLA 1KNRA 1S94A 2FUPA 4H9SE 3H3MA 3RIUC 3UU4A 2UU9T 2W61A 3RRWA 4IL9A 3RRCA 2CXLA 5JH7E 1WCRA 2DI4A 2X0LB 2EHOB 2X9HA 3FB2A 3W15B 2BG9B 4ANJA 4HFBA 2UUBT 1QSDA 3ZC0A 2LHNA 2NW8A 4ILBA 3PUYF 3T1YT 2C5IT 3BQKA 4ZHQE 1DU2A 5LXTE 4NUUA 2MPKA 3ZMUB 4UR9A 1EZ3A 4I43B 5CA0E 2YEVC 1VCTA 5L3GB 4DV1T 2OA5A 3PTRB 4AQYT 4EOZB 1MIWA 2D2SA 2H7VC 3SWHA 2PFVA 1UURA 2IW5B 5L2LA 5JDHA 3AEAA 3RYFE 3RYCE 2CM0A 2XJ7A 1ZEEA 4QX7B 1YQ3A 3GN5A 1UGOA 3C64A 2H89A 3B5MA 2BG9C 1JNZA 2W66A 2IDOB 4H9QC 3UUBA 1OXZA 5JTGA 5F5WA 4DV6T 2E9XD 1NWMX 2JJ9A 2LLYA 3I0QA 5JDQA 2G0UA 3NRXA 1IBMT 3QOFA 3CX8B 4GYRA 2H7OA 3RI5A 3ZT5A 3IHRA 2MOZA 4HFCA 3F57A 3NBXX 2JQKA 2DHRA 3QB5K 4ZXLA 2CWYA 5KX5E 5LYJE 3RKOA 5JREA 4GK0E 3RQUA 4U3CA 1E7PA 2BS3A 2LM2A 2X9XA 3IF8B 4MLKA 3PUZF 2WWVA 3RLFF 2KNDA 2H88A 4QWNB 5E0OA 5FKYA 2VURA 2V7JA 1G8XA 3LDQB 1FEWA 3AA6B 3PV0F 1WFDA 4IGUA 4OK0A 4WW0A 1WR0A 2RPAA 4AKRB 4B6XA 3RIUA 5JR9B 1UK5A 3AEBA 4YY3T 2PBIA 3AA7B 3FZHB 5J0ZA 4DR3T 4LFCT 4YJ2E 2K48A 4DV0T 2WDRA 1YD8G 5HXCA 2B76A 3ETVA 3FZFB 1YKEB 3DTOA 2KWHA 3VKHA 4M1PA 2BVLA 4IE6A 2P9BA 1MIYA 3NWIA 4X64T 3PUAA 4IDPA 4L9IA 2HPJA 3E08A 4AKIA 2VQET 4BJMA 2XASB 5FVKA 4X5TA 2XQ6A 5HEHA 2BKNA 1J5ET 4DVDA 1OEDC 5CFBA 2KT9A 3F31A 3LK2B 4X20E 2PJQA 5AQMB 2CA5A 2VWAA 1Z0PA 3K3OA 4ILAA 4U2YA 3ZCJA 2NOXA 5JQGE 2LSIA 2WMNA 2Z6EA 3KFWX 5AQIB 1OEDA 5LB7B 4CI1B 4DR1T 5LP6E 4JI6T 1FJGT 5AQRB 4UVCB 1U4QA 2XAGB 3AE3A 1CUNA 2XPKA 3FZMB 2NTXA 4LMKA 4WYVA 3AE2A 4X66T 2ODVA 3EABA 2WU5A 5EK3A 3RIFA 3KVAA 5FXVA 2CPTA 2BDEA 2M6BA 4OYJA 5AQQB 2XSBA 3HKDE 3J9X1 2CHNA 3TLTA 4IE4A 2LSKA 4UEMA 3P8CD 4ILCA 2KXPB 3C4XA 3ZSSA 4ZEYA 1QUUA 2KLQA 2Q9QB 4TNWA 4KHPT 3VU7H 5L3DB 4GKJT 4LMJA 2MTQA 2XQ8A 3AVSA 5LCYA 4IHJE 2CXDA 1WLXA 2R6GF 4JEUB 4X1KE 4Z91A 5HXRA 2XAQB 4KUMB 4CXWA 4UXNB 4YXDA 4PW8A 5EK4A 2PG8A 2E9XA 3MXZA 4H63V 3B57A 3LG7A 4IE0A 2UXNB 5LJMA 1Y64B 4PJJA 1UUSA 3U3IA 3RC8A 1XDOA 4AI6A 2K24A 4JYAT 3RH3A 2UXXB 2XHEB 4EB6E 1T98A 1SE7A 2K9AA 3L3PA 2CXFA 4O4IE 3SOLA 1KEYA 1MMNA 5HXEA 3HKBE 3UUNA 2XQYA 3AEFA 4ZOLE 3VR8A 5JDGA 1J5WA 2Q9QA 5CB4E 4TX5A 5BMVE 5A1LA 3PUGA 3F2EA 5LG4A 2CLYB 5AQPB 4DR2T 3CQXC 1J1JA 1HFAA 3FBLA 4TV9E 4LFBT 3R84B 1I6ZA 2IUBA 2M67A 2ACZA 4KMCA 5JR9A 3CX6B 2JQHA 3KBTA 4CQIA 3N9NA 4IDNA 3AE7A 5HWYA 3C51A 4NUVA 2V8SV 1VCSA 3ZMTB 3FZLB 3FXDB 5FVLA 3MZKB 5F3JA 2AE9A 5JDNA 2Y8DA 2DWGA 3HL6A 3Q5DA 4K0KT 4EEDA 4AKGA 4TN7B 3P4WA 3EAMA 3JCFA 3PU8A 2LRKA 4CXXA 3C98B 2UUCT 1XNQT 4ZI2D 1KFYA 4LFAT 3VRBA 3AAAB 1BR1A 2KZ7B 2WZIA 4L5GA 4Q25A 2A3DA 4WNKA 5ADXL 2HPLA 1D0YA 1XZYA 2XAHB 3RKGA 3AE1A 5ABFB 2E5LT 3ZMZB 3RF1A 5LHIB 2E9XB 4X65T 3ZMVB 2LOSA 3GN5B 5IUXA 2K5BB 3DP7A 3UQ4A 3ONXA 4DV3T 2JMHA 4FJOA 3WAKA 5L3FB 1E2AA 1JNRA 5FL0A 2D0TA 2FJBA 5AQLB 3RPUA 4DR5T 5AQJB 1S35A 3UT5E 2V5CA 1W09A 4EYUA 2WMOA 1VOMA 5DJQC 4EYYR 5H6RB 3OYZA 3HI2A 3QNUA 2J1DG 3WAJA 5HEGA 4U7YA 4TNVA 4UIGA 2ZM8A 4H9PC 4H9OC 5AFUL 4COFA 5ABHA 2D5UA 2QA7A 1I94T 4JI3T 1H7CA 3AEEA 5J2UE 2KSRA 1W9RA 4JUYA 5LBQB 1HS7A
chains in the Genus database with same CATH topology
4AXPA 1LRZA 1D1CA 2D0UA 3BK9A 3HKCE 5CA1E 2VKJA 1X79A 2WAUA 3LFMA 3UULA 3N2GE 3RYIE 2LHRA 2Q9QC 3KV5A 4MALA 4AQGA 3PU3A 5L3EB 5FXXA 3MACA 5IHYA 3NRYA 5LGUB 2LOPA 3D0TA 4HEAA 4DNDA 4UVBB 4U72A 4KP3C 4DO0A 1HG2A 2L3LA 2Q9QD 4GYSA 4O8SA 1MMAA 3ZN1B 2NW7A 5C8YE 3ETUA 3K3NA 3N9OA 4HE8A 2C5JA 4YHJA 3VKGA 3I9YA 1ZHCA 2DLRA 3ZYMA 3UFEA 5HWXA 4UV9B 4BA9A 1IZNB 3FXEB 3C4WA 4E7SA 2V7KA 3E0ZA 3P7IA 3CQGB 3N2KE 3CQCB 1WRDA 2WSSV 3GWHA 1G73A 4CZZB 4TUYE 4I4TE 5FXWA 2DWKA 3JC6D 3C4ZA 2X9YA 4X1IE 4ASKA 4N78D 3AAEB 4O4LE 5F8PA 1VRBA 3FBZA 1SA0E 3Q5WA 3V5SA 2ES0A 5LOVE 3O1IA 5TAOA 1UX4A 5JRCB 3MA9A 2N2NA 2YINA 1LKXA 3J7Yq 3PUQA 4DBRA 2KINB 3CMLA 5EK2A 2C0SA 4O2AE 2LSJA 3N2OA 3KBUA 1B7TA 2A2FX 3MK7C 4CI2B 4ILUA 2E8IA 3DJBA 2EHOA 2C5KT 4IDZA 3QK6A 3QUJA 4A56A 2VKDA 4H63H 2CLYC 3EUHA 4OFZA 4WNKA 3V5UA 2LSGA 2V7MA 4O2BE 3LBXB 3WI3A 5LHHB 3ZEFB 5DQWA 3L09A 2ACXA 3OJAA 2ZLYA 3PDYA 4DMVA 3N9LA 3LBXA 5LHGB 3LK3B 1WYBA 2XTLA 5LGTB 1YKHB 3PUSA 1D1AA 3A5XA 2YK0A 5LNKA 4XBFB 3BQIA 4UV8B 4JLEA 1O3XA 2Y6XA 3O4XE 3TKLB 4E7ZA 1HG5A 4AKHA 4V1Av 1D1BA 2NTYA 4F6RC 4UVAB 5HAXA 3R6NA 5ETWA 5HYAA 1HF8A 3ZJ1A 5L2LA 3RYHE 3T8OA 4J2CA 4BJNA 2VB6A 1UX5A 4GIWA 4YFSA 4PAGA 4QHOA 5FNVE 5FYMA 4AKLA 2GK9A 4X1YE 4ISTA 4UF0A 2IC6A 2LT3A 4MFRA 3NZQA 4QXCB 2YU1A 2RA1A 3I0OA 3N9QA 5FP3A 3AVRA 2W00A 3Q2MA 3CKDA 4PK4A 2QGSA 2LJLA 3OKQA 2CMRA 2X51A 4GOUA 4EXTA 2Y48B 3MJXA 5FY1A 3LJCA 4EZHA 4HGAA 3EVYA 3HKEE 1HX8A 4PK6A 4O4JE 3CVRA 2XAJB 4PFOA 1HCIA 2CWOA 3E22E 3LK42 2ZM2A 3PURA 5LA6E 4ISSA 4YJ3E 3ZYKA 5IYZE 2JRKA 3SRZA 3UUXB 4XAXB 5LJNA 1KNZA 1LVFA 4KBMB 4HKAA 4CXYA 2NWBA 4I50E 3I1AA 1D0XA 5J2TE 2W63A 3JC6C 4ZI3D 3KV6A 3IBPA 2ODUA 1E1HB 3PE0A 4ZI2C 5JRCA 1LVKA 1HTJF 2NW9A 2LSYA 3BQLA 4MHCA 3KVBA 4UF0B 1MMDA 2A72A 1V9DA 2CE7A 4PFPA 4QXHB 4L0RA 3ANWB 5L3GB 2XUEA 4PJMA 4K0UA 3H37A 3HA4A 1YW0A 3RX6A 4HTEA 5LGNB 2H3RA 4HFVA 3CX7B 3K8PC 1BR0A 2CEAA 5JDFA 4OHFA 3I9WA 4ZS2A 3NZPA 4DBQA 5JDLA 2B1EA 2VASA 3C50A 2KWIB 2N9DA 2X68A 2VK9A 2BVMA 3U78A 5EZYE 5HXHA 2WBLA 1FIOA 3ZJ2A 4WBOA 3HR0A 3AA0B 3ZCIA 2LEHA 3N9MA 1MNEA 4PJLA 3KDSE 2LE8A 2VKHA 4AQFC 3N5LA 2WM9A 3UTKA 4I55E 5DABA 4ZS3A 1FMWA 2KMFA 2DNXA 2V1DB 2HH7A 2IC9A 3ZMSB 4HN9A 5L3BB 5KMGP 1IAPA 4P0AA 3O1HA 4H9RC 1MMGA 2DCFA 4PNIA 2MBGA 3EDUA 4AQFA 5FXZA 3ZPOA 3VHLA 1BR2A 3K3QC 3Q5XA 1UCUA 2SPCA 3OYXA 4IE7A 4TV8E 4Z8XA 5H6QB 2V7IA 3Q9DA 4JEHB 3MKDA 3OBVE 3IEEA 3ANWA 3ZN0B 3KINB 3AAIA 2X66A 4FI5A 2VL8A 2ZM0A 4PK5A 3ZLIA 1ZKEA 4WBNE 3S4UA 4G63A 1FMVA 2XAFB 2LM9A 4QXBB 5J1GA 4EAHA 3AB3B 4UELA 3ESLA 4XZCA 4H9NC 3SS1A 3ZC1A 3O9XA 3N9PA 1ZV4X 4MBQA 3UUMA 5JR9C 1SHZC 2V7LA 3O1JA 2NP9A 4ADZA 2EHOC 1MNDA 4IIJE 4QX8B 4G2AA 3QC9A 4O4HE 5LBMA 4GK5E 4IE5A 3M65A 5FY0A 5FY7A 1U5PA 5JVDE 4BAYB 4ZI7E 2BZBA 2X9WA 2N1GA 5GONE 2I59A 3RC3A 4CI3B 4EZ4A 4QKNA 4TZ4C 2IAKA 1WR6A 2L9QA 2EHOD 1MIVA 1OWAA 3AA1B 3B13A 3CWZB 2W62A 5L3CB 2CCQA 2ZMAA 2X67A 2L8KA 2JPFA 1IJ6A 3FHNA 3GMIA 2YU2A 1D0ZA 1WYCA 4P0BA 4C91A 3KV4A 4PJNA 4YLHA 4ZI3C 1IJ5A 4P09A 4EIWA 2V26A 2WWUA 3EDVA 2E9XC 3CPZA 3GA8A 4U74A 5M4YA 1AJ3A 2JQQA 1KK7A 2JMKA 2MYSA 5DQVA 2RP4A 5HXSA 5JDMA 4C90A 3H3AA 1US7B 5FMNA 4ERRA 5KDMC 1BR4A 2W0GA 3KV9A 4DMWA 4OYKA 1NAFA 3ZYLA 2VKOA 1S94A 4H9SE 2W61A 3RRWA 3RRCA 2CXLA 5JH7E 2X9HA 2DI4A 2X0LB 2EHOB 3FB2A 3W15B 4ANJA 1QSDA 3ZC0A 2LHNA 2NW8A 2C5IT 3BQKA 4ZHQE 5LXTE 4NUUA 3ZMUB 5CA0E 4I43B 1EZ3A 2YEVC 2OA5A 3PTRB 4EOZB 1MIWA 2D2SA 2H7VC 3SWHA 2PFVA 2IW5B 5JDHA 3RYFE 3RYCE 2CM0A 1ZEEA 4QX7B 3GN5A 3C64A 4H9QC 1OXZA 2E9XD 1NWMX 2JJ9A 3I0QA 5JDQA 2G0UA 3NRXA 3CX8B 4GYRA 2H7OA 3IHRA 2MOZA 3F57A 3NBXX 2DHRA 5KX5E 2CWYA 5LYJE 5JREA 3RKOA 4GK0E 2X9XA 3IF8B 4MLKA 2KNDA 4QWNB 5E0OA 2V7JA 1G8XA 4OK0A 1FEWA 3AA6B 4IGUA 5JR9B 4WW0A 4AKRB 4B6XA 2PBIA 4YJ2E 2K48A 1YD8G 5HXCA 3ETVA 1YKEB 3DTOA 2KWHA 3VKHA 4M1PA 2BVLA 4IE6A 2P9BA 1MIYA 3PUAA 4L9IA 2HPJA 3E08A 4AKIA 4BJMA 2XASB 4DVDA 2KT9A 3F31A 3LK2B 4X20E 2PJQA 2CA5A 2VWAA 1Z0PA 3K3OA 5JQGE 3ZCJA 2NOXA 2LSIA 2WMNA 2Z6EA 3KFWX 4CI1B 5LP6E 4UVCB 1U4QA 2XAGB 1CUNA 2NTXA 2ODVA 5EK3A 3KVAA 5FXVA 2BDEA 4OYJA 3HKDE 3J9X1 4IE4A 2LSKA 4UEMA 3P8CD 2KXPB 3C4XA 1QUUA 2KLQA 2Q9QB 3VU7H 5L3DB 2MTQA 3AVSA 5LCYA 4IHJE 2CXDA 1WLXA 4JEUB 5HXRA 4X1KE 4CXWA 2XAQB 4KUMB 4UXNB 4PW8A 5EK4A 2PG8A 2E9XA 3MXZA 4H63V 3B57A 3LG7A 4IE0A 2UXNB 5LJMA 1Y64B 4PJJA 3RC8A 3U3IA 4AI6A 2K24A 3RH3A 2UXXB 2XHEB 4EB6E 1T98A 2K9AA 3L3PA 3SOLA 2CXFA 4O4IE 1MMNA 5HXEA 3HKBE 3UUNA 2XQYA 4ZOLE 5JDGA 2Q9QA 5CB4E 4TX5A 5BMVE 5A1LA 3PUGA 3F2EA 5LG4A 2CLYB 3CQXC 1HFAA 3FBLA 4TV9E 3R84B 2M67A 4KMCA 5JR9A 3CX6B 3KBTA 4CQIA 3N9NA 5HWYA 3C51A 4NUVA 3ZMTB 3FXDB 3MZKB 5F3JA 5JDNA 2Y8DA 2DWGA 3HL6A 4AKGA 4TN7B 4CXXA 3PU8A 3C98B 4ZI2D 3AAAB 1BR1A 2KZ7B 4L5GA 5ADXL 2A3DA 2HPLA 1D0YA 2XAHB 3ZMZB 5LHIB 2E9XB 3ZMVB 2LOSA 3GN5B 2K5BB 3DP7A 3ONXA 2JMHA 4FJOA 3WAKA 5L3FB 2D0TA 3RPUA 1S35A 3UT5E 4EYUA 2WMOA 1VOMA 5DJQC 4EYYR 5H6RB 3OYZA 3HI2A 2J1DG 3WAJA 4UIGA 2ZM8A 4H9PC 4H9OC 5AFUL 2D5UA 2QA7A 1H7CA 5J2UE 3AA7B 4JUYA 5LBQB 1HS7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IC6 A;  2C5J A;  3L3P A;  1LRZ A;  2MBG A;  2XTL A;  4B6X A;  2KWI B;  3FXE B;  2K48 A;  3CKD A;  3P7I A;  1IJ6 A;  2KWH A;  2G0U A;  3TKL B;  2X9Y A;  2X9W A;  4FI5 A;  1IJ5 A;  2C5K T;  3QK6 A;  4EYY R;  3CVR A;  1QSD A;  3QUJ A;  4L0R A;  4CQI A;  1Z0P A;  4DND A;  1ZKE A;  2C5I T;  3N5L A;  3FXD B;  3MXZ A;  4J2C A;  2X9X A;  3S4U A;  1H7C A;  2IC9 A;  2CA5 A;  1LVF A; 
#chains in the Genus database with same CATH topology
 4AXP A;  1LRZ A;  1D1C A;  2D0U A;  2FJD A;  2VVN A;  3RGL A;  3AEC A;  2BG9 A;  3BK9 A;  3HKC E;  5CA1 E;  5AQV B;  2VKJ A;  4LF5 T;  1X79 A;  2WAU A;  3LFM A;  4QH4 A;  3UUL A;  2A9U A;  3CK6 A;  2LHR A;  2Q9Q C;  3KV5 A;  1NEK A;  3N2G E;  4MAL A;  3RYI E;  1IBK T;  1R8I A;  4IRE A;  4AQG A;  2FBW A;  3PU3 A;  5L4H A;  5L3E B;  4YHH T;  5FXX A;  1L0V A;  3MAC A;  4NPP A;  2XQ4 A;  3NRY A;  5IHY A;  5LGU B;  2LOP A;  3D0T A;  4HEA A;  4HWH A;  4WZX A;  2VL0 A;  4DND A;  3PUV F;  4UVB B;  4U72 A;  4KP3 C;  4DO0 A;  4PK6 A;  1HG2 A;  2L3L A;  3UU8 A;  4DV4 T;  2Q9Q D;  4GYS A;  4O8S A;  1MMA A;  3ZN1 B;  5ABE A;  2NW7 A;  5C8Y E;  2CHO A;  3ETU A;  3K3N A;  3N9O A;  4JI8 T;  2XQ3 A;  2CBJ A;  2C5J A;  4HE8 A;  4YHJ A;  3VKG A;  3I9Y A;  1ZHC A;  2DLR A;  3EHZ A;  3UFE A;  3ZYM A;  5HWX A;  4UV9 B;  4BA9 A;  1KF6 A;  3SFE A;  1IZN B;  2QVA A;  2UUA T;  2UXC T;  3OVU A;  4B3S T;  3FXE B;  3C4W A;  4E7S A;  5AQK B;  4JI2 T;  2K3W A;  2V7K A;  3E0Z A;  3CQG B;  3P7I A;  3AE5 A;  3N2K E;  3CQC B;  4YTP A;  1WRD A;  2WSS V;  3GWH A;  1G73 A;  4CZZ B;  4TUY E;  4I4T E;  5FXW A;  2V6X A;  2DWK A;  4A5X A;  2J62 A;  3JC6 D;  2X9Y A;  3C4Z A;  4X1I E;  4ASK A;  4N78 D;  3AAE B;  4KI0 F;  4O4L E;  5F8P A;  3UU3 A;  4YSX A;  4X62 T;  1VRB A;  3FBZ A;  3PJA J;  1SA0 E;  2LRL A;  3Q5W A;  5AQS B;  1HNX T;  3NVO A;  3P50 A;  5BR8 T;  3V5S A;  2ES0 A;  4AIS A;  3G06 A;  5LOV E;  3O1I A;  5TAO A;  1UX4 A;  5JRC B;  4HWF A;  1XWM A;  3MA9 A;  2N2N A;  4Z90 A;  2YIN A;  1LKX A;  2BKP A;  2IHR 1;  3PUQ A;  3J7Y q;  4NIQ A;  4DBR A;  4TWD A;  2KIN B;  3CML A;  5EK2 A;  2C0S A;  4O2A E;  2LSJ A;  3N2O A;  3AED A;  2FJE A;  2XM2 A;  1Z8U A;  3KBU A;  1B7T A;  2A2F X;  3MK7 C;  1XDP A;  3NKZ A;  4ILU A;  2E8I A;  4CI2 B;  4U2Z A;  1HNW T;  4DR7 T;  3UFG A;  4CN6 A;  3AXJ A;  2EHO A;  3DJB A;  3RHW A;  4LML A;  2QRX A;  2C5K T;  4IDZ A;  5HEU A;  3QK6 A;  4EV6 A;  4JV5 T;  3QUJ A;  4A56 A;  2VKD A;  5L47 A;  3PUX F;  2CLY C;  3EUH A;  2J4G A;  2XM1 A;  4H63 H;  2LSG A;  2V7M A;  4O2B E;  3LBX B;  2XQA A;  4OFZ A;  2W2U A;  3V5U A;  4OX9 T;  3WI3 A;  5LHH B;  5IWA T;  1YXR A;  3ZEF B;  5DQW A;  2YKS A;  3ONL C;  3L09 A;  2HHH T;  2ACX A;  1SUM B;  3OJA A;  2ZLY A;  1M7K A;  4IDO A;  3PDY A;  4HFH A;  2IIU A;  3N9L A;  4DMV A;  4B3T T;  4LF4 T;  1W0B A;  3LBX A;  5LHG B;  5LMN T;  4DUZ T;  3LK3 B;  1WYB A;  2XTL A;  3L39 A;  5LGT B;  1YKH B;  3PJA A;  3PUS A;  2BS4 A;  5AQU B;  1D1A A;  3A5X A;  2YK0 A;  5CJ5 A;  5KXJ A;  5LNK A;  4XBF B;  3BQI A;  4UV8 B;  2V6Y B;  4HFE A;  4JLE A;  5HCJ A;  4DV2 T;  1O3X A;  2Y6X A;  3O4X E;  3TKL B;  3X1D A;  2BBH A;  4E7Z A;  1HG5 A;  4AKH A;  4V1A v;  1D1B A;  2NTY A;  2NR4 A;  3TLV A;  4F6R C;  2LKG A;  4B3R T;  4UVA B;  5HAX A;  3R6N A;  5HEO A;  5ETW A;  5HYA A;  1HF8 A;  2CBI A;  3ZJ1 A;  3RYH E;  3T8O A;  4J2C A;  4BJN A;  2VB6 A;  1UX5 A;  4GIW A;  4YFS A;  4PAG A;  4QHO A;  5FNV E;  3M3Z B;  5FYM A;  2GK9 A;  2WQY A;  4AKL A;  1HR0 T;  4X1Y E;  2WDQ A;  4IST A;  4UF0 A;  2IC6 A;  2LT3 A;  3JAF A;  2X0Y A;  4MFR A;  2M6I A;  3NZQ A;  4QXC B;  2YU1 A;  2RA1 A;  3I0O A;  3N9Q A;  5FP3 A;  3UU6 A;  4IT4 A;  3AVR A;  2W00 A;  3ZST A;  3Q2M A;  3CKD A;  4PK4 A;  2IML A;  2BBJ A;  2QGS A;  2WDV A;  2LJL A;  3JAD A;  3OKQ A;  3ZT7 A;  2CMR A;  2X51 A;  2AXD S;  4GOU A;  4EXT A;  2Y48 B;  3MJX A;  5FY1 A;  3LJC A;  4EZH A;  2OLT A;  4HGA A;  3EVY A;  2BKO A;  1HX8 A;  3HKE E;  4O4J E;  3CVR A;  2XAJ B;  4IDQ A;  1HCI A;  2CWO A;  3E22 E;  1T7S A;  2XY8 B;  3LK4 2;  2ZM2 A;  3PUR A;  3VRA A;  1GQE A;  4DV7 T;  4YSY A;  4NXN T;  4JI1 T;  5LA6 E;  4ISS A;  4YJ3 E;  5FL1 A;  4HFI A;  5IYZ E;  2JRK A;  3SRZ A;  3ZYK A;  4PFO A;  5HCM A;  3UUX B;  3OTO T;  4XAX B;  3A7M A;  3A8Y C;  5LJN A;  1KNZ A;  2WZH A;  1LVF A;  4KBM B;  5C2T A;  4HKA A;  4CXY A;  2NWB A;  4I50 E;  3I1A A;  4I0U A;  1N36 T;  1D0X A;  5J2T E;  2W63 A;  3JC6 C;  4YSZ A;  4LF7 T;  4ZI3 D;  3KV6 A;  3IBP A;  2ODU A;  1E1H B;  3PE0 A;  4ZI2 C;  2HN2 A;  2PTF A;  5JRC A;  4U31 A;  3ZKR A;  1LVK A;  5HEJ A;  1HX1 B;  3P4Q A;  1HTJ F;  2NW9 A;  2LSY A;  2WB5 A;  3BQL A;  3KVB A;  4MHC A;  2XZE A;  3JAE A;  4UF0 B;  1MMD A;  2A72 A;  1V9D A;  3TLW A;  4DUY T;  2CE7 A;  5L4E A;  4EIW A;  2QYW A;  4PFP A;  4DID B;  2MAW A;  2LKH A;  4L0R A;  4QXH B;  3ANW B;  2W67 A;  2XUE A;  3AXJ B;  4PJM A;  3AE9 A;  3H37 A;  4K0U A;  1YW0 A;  3HA4 A;  5AQT B;  3RX6 A;  4HTE A;  5LGN B;  2H3R A;  4HFV A;  3CX7 B;  3K8P C;  1N32 T;  1BR0 A;  2CEA A;  2I6H A;  5JDF A;  4OHF A;  5AQN B;  3I9W A;  4ZS2 A;  4LF9 T;  3NZP A;  4DBQ A;  5JDL A;  2YDS A;  2B1E A;  4HWC A;  4ZZB A;  2XQ7 A;  2VAS A;  2J47 A;  3C50 A;  4P1N A;  4YTN A;  3QB5 A;  2CRB A;  2KWI B;  2N9D A;  2WY2 A;  3P4R A;  4U33 A;  2X68 A;  5AQG B;  1XMO T;  2VK9 A;  2BVM A;  4JI4 T;  2UXB T;  3AE8 A;  3U78 A;  2BS2 A;  5EZY E;  4LF8 T;  5HXH A;  2WBL A;  1FIO A;  3ZJ2 A;  4WBO A;  3HR0 A;  3AA0 B;  2D9D A;  3ZCI A;  2V5D A;  2LEH A;  3N9M A;  1MNE A;  4PJL A;  3KDS E;  2LE8 A;  2VKH A;  4AQF C;  3N5L A;  2WM9 A;  3UTK A;  2WCA A;  4I55 E;  5DAB A;  4ZS3 A;  1FMW A;  2V1D B;  2DNX A;  2KMF A;  2HH7 A;  4A97 A;  4DV5 T;  2IC9 A;  3ZMS B;  4HN9 A;  5L3B B;  5KMG P;  1IAP A;  4P0A A;  3O1H A;  3P4P A;  4H9R C;  4U7I A;  1MMG A;  4HWI B;  2DCF A;  2DL1 A;  4PNI A;  3EDU A;  2MBG A;  4AQF A;  5FXZ A;  3ZPO A;  3VHL A;  1BR2 A;  3K3Q C;  3Q5X A;  3FZK B;  1UCU A;  3RQW A;  2SPC A;  1CHU A;  1ZOY A;  3OYX A;  4IE7 A;  2UXD T;  4TV8 E;  5LG3 A;  4Z8X A;  2VQF T;  4CN1 A;  5H6Q B;  2V7I A;  3Q9D A;  4JEH B;  4NXM T;  2YDQ A;  3MKD A;  3OBV E;  3IEE A;  3ANW A;  3ZN0 B;  4AIU A;  3KIN B;  3AAI A;  4QH5 A;  1HNZ T;  2X66 A;  4FI5 A;  4KX6 A;  2VL8 A;  3UU5 A;  1QLB A;  2ZM0 A;  4PK5 A;  3ZLI A;  4DR6 T;  3PUW F;  1ZKE A;  2WU2 A;  3RIA A;  4WBN E;  1NEN A;  1N33 T;  4IL4 A;  1N34 T;  5AQH B;  3S4U A;  4G63 A;  1FMV A;  2XAF B;  2LM9 A;  4QXB B;  5J1G A;  4EAH A;  3AB3 B;  3AE6 A;  2E5V A;  3AEG A;  3ESL A;  4UEL A;  4XZC A;  1IBL T;  4H9N C;  3SS1 A;  2YN6 A;  3ZC1 A;  2JQ9 A;  4QH1 A;  4A98 A;  3O9X A;  3ABV A;  4EGW A;  3N9P A;  1ZV4 X;  4MBQ A;  3UUM A;  5C3J A;  5JR9 C;  1SHZ C;  2V7L A;  3O1J A;  2F4V T;  2NP9 A;  4ADZ A;  2EHO C;  1MND A;  2WS3 A;  4IIJ E;  2X0H A;  4QX8 B;  5AQO B;  3TLS A;  3ZT6 A;  4LF6 T;  4G2A A;  4B3M T;  2I0M A;  1W0A A;  4YTM A;  4TWH A;  3QC9 A;  4JI5 T;  4O4H E;  5LMU T;  5LBM A;  2E2A A;  4GK5 E;  4IE5 A;  1Y01 A;  3M65 A;  4JBW F;  5FY0 A;  1U5P A;  5FY7 A;  5JVD E;  2OV9 A;  4BAY B;  4ZI7 E;  2BZB A;  2X9W A;  3K1S A;  4JI7 T;  2N1G A;  5GON E;  4HWD A;  1OED E;  1M62 A;  3T1H T;  3TLU A;  2I59 A;  3RC3 A;  4CI3 B;  2XQ5 A;  1KNP A;  1OED B;  4EZ4 A;  4YT0 A;  5CGM A;  4CN4 A;  4QKN A;  4TZ4 C;  2IAK A;  1ZP0 A;  1WR6 A;  3VR9 A;  2L9Q A;  2EHO D;  1MIV A;  1XNR T;  1OWA A;  2FJA A;  3AA1 B;  3B13 A;  5ABF A;  2ZM6 T;  4DR4 T;  3UQ7 A;  3CWZ B;  2W62 A;  4JI0 T;  5AQF B;  5L3C B;  2CCQ A;  2ZMA A;  1YQ4 A;  3SFD A;  3AE4 A;  4GKK T;  2X67 A;  2L8K A;  3EI0 A;  2JPF A;  1IJ6 A;  3FHN A;  3GMI A;  2YU2 A;  3P4S A;  1D0Z A;  3Q5E A;  1WYC A;  4EEB A;  4P0B A;  4C91 A;  3KV4 A;  2YOE A;  2BG9 E;  2W4X A;  4PJN A;  1IJ5 A;  4P09 A;  1X9B A;  4YLH A;  2V26 A;  2WWU A;  2XQ9 A;  4ZI3 C;  2V6Y A;  3ONJ A;  3L8R A;  3EDV A;  2E9X C;  3CPZ A;  3GA8 A;  3LSV A;  4TWF A;  2HN1 A;  4U74 A;  3OPC A;  4ZZC A;  2XSA A;  5M4Y A;  2JQQ A;  1T8B A;  1AJ3 A;  1KK7 A;  2JMK A;  2MYS A;  5ABG A;  5DQV A;  4HFD A;  2RP4 A;  5HXS A;  1T72 A;  2YDR A;  3CIR A;  4C90 A;  5JDM A;  3H3A A;  1US7 B;  5FMN A;  4KHZ F;  2JIW A;  4ERR A;  5KDM C;  1BR4 A;  3IA3 A;  2W0G A;  3KV9 A;  4F8H A;  1XMQ T;  4DMW A;  2WP9 A;  4OYK A;  1NAF A;  2VVS A;  2VKO A;  3ZYL A;  1KNR A;  1S94 A;  2FUP A;  4H9S E;  3H3M A;  3RIU C;  3UU4 A;  2UU9 T;  2W61 A;  3RRW A;  4IL9 A;  3RRC A;  2CXL A;  5JH7 E;  1WCR A;  2DI4 A;  2X0L B;  2EHO B;  2X9H A;  3FB2 A;  3W15 B;  2BG9 B;  4ANJ A;  4HFB A;  2UUB T;  1QSD A;  3ZC0 A;  2LHN A;  2NW8 A;  4ILB A;  3PUY F;  3T1Y T;  2C5I T;  3BQK A;  4ZHQ E;  1DU2 A;  5LXT E;  4NUU A;  2MPK A;  3ZMU B;  4UR9 A;  1EZ3 A;  4I43 B;  5CA0 E;  2YEV C;  1VCT A;  5L3G B;  4DV1 T;  2OA5 A;  3PTR B;  4AQY T;  4EOZ B;  1MIW A;  2D2S A;  2H7V C;  3SWH A;  2PFV A;  1UUR A;  2IW5 B;  5L2L A;  5JDH A;  3AEA A;  3RYF E;  3RYC E;  2CM0 A;  2XJ7 A;  1ZEE A;  4QX7 B;  1YQ3 A;  3GN5 A;  1UGO A;  3C64 A;  2H89 A;  3B5M A;  2BG9 C;  1JNZ A;  2W66 A;  2IDO B;  4H9Q C;  3UUB A;  1OXZ A;  5JTG A;  5F5W A;  4DV6 T;  2E9X D;  1NWM X;  2JJ9 A;  2LLY A;  3I0Q A;  5JDQ A;  2G0U A;  3NRX A;  1IBM T;  3QOF A;  3CX8 B;  4GYR A;  2H7O A;  3RI5 A;  3ZT5 A;  3IHR A;  2MOZ A;  4HFC A;  3F57 A;  3NBX X;  2JQK A;  2DHR A;  3QB5 K;  4ZXL A;  2CWY A;  5KX5 E;  5LYJ E;  3RKO A;  5JRE A;  4GK0 E;  3RQU A;  4U3C A;  1E7P A;  2BS3 A;  2LM2 A;  2X9X A;  3IF8 B;  4MLK A;  3PUZ F;  2WWV A;  3RLF F;  2KND A;  2H88 A;  4QWN B;  5E0O A;  5FKY A;  2VUR A;  2V7J A;  1G8X A;  3LDQ B;  1FEW A;  3AA6 B;  3PV0 F;  1WFD A;  4IGU A;  4OK0 A;  4WW0 A;  1WR0 A;  2RPA A;  4AKR B;  4B6X A;  3RIU A;  5JR9 B;  1UK5 A;  3AEB A;  4YY3 T;  2PBI A;  3AA7 B;  3FZH B;  5J0Z A;  4DR3 T;  4LFC T;  4YJ2 E;  2K48 A;  4DV0 T;  2WDR A;  1YD8 G;  5HXC A;  2B76 A;  3ETV A;  3FZF B;  1YKE B;  3DTO A;  2KWH A;  3VKH A;  4M1P A;  2BVL A;  4IE6 A;  2P9B A;  1MIY A;  3NWI A;  4X64 T;  3PUA A;  4IDP A;  4L9I A;  2HPJ A;  3E08 A;  4AKI A;  2VQE T;  4BJM A;  2XAS B;  5FVK A;  4X5T A;  2XQ6 A;  5HEH A;  2BKN A;  1J5E T;  4DVD A;  1OED C;  5CFB A;  2KT9 A;  3F31 A;  3LK2 B;  4X20 E;  2PJQ A;  5AQM B;  2CA5 A;  2VWA A;  1Z0P A;  3K3O A;  4ILA A;  4U2Y A;  3ZCJ A;  2NOX A;  5JQG E;  2LSI A;  2WMN A;  2Z6E A;  3KFW X;  5AQI B;  1OED A;  5LB7 B;  4CI1 B;  4DR1 T;  5LP6 E;  4JI6 T;  1FJG T;  5AQR B;  4UVC B;  1U4Q A;  2XAG B;  3AE3 A;  1CUN A;  2XPK A;  3FZM B;  2NTX A;  4LMK A;  4WYV A;  3AE2 A;  4X66 T;  2ODV A;  3EAB A;  2WU5 A;  5EK3 A;  3RIF A;  3KVA A;  5FXV A;  2CPT A;  2BDE A;  2M6B A;  4OYJ A;  5AQQ B;  2XSB A;  3HKD E;  3J9X 1;  2CHN A;  3TLT A;  4IE4 A;  2LSK A;  4UEM A;  3P8C D;  4ILC A;  2KXP B;  3C4X A;  3ZSS A;  4ZEY A;  1QUU A;  2KLQ A;  2Q9Q B;  4TNW A;  4KHP T;  3VU7 H;  5L3D B;  4GKJ T;  4LMJ A;  2MTQ A;  2XQ8 A;  3AVS A;  5LCY A;  4IHJ E;  2CXD A;  1WLX A;  2R6G F;  4JEU B;  4X1K E;  4Z91 A;  5HXR A;  2XAQ B;  4KUM B;  4CXW A;  4UXN B;  4YXD A;  4PW8 A;  5EK4 A;  2PG8 A;  2E9X A;  3MXZ A;  4H63 V;  3B57 A;  3LG7 A;  4IE0 A;  2UXN B;  5LJM A;  1Y64 B;  4PJJ A;  1UUS A;  3U3I A;  3RC8 A;  1XDO A;  4AI6 A;  2K24 A;  4JYA T;  3RH3 A;  2UXX B;  2XHE B;  4EB6 E;  1T98 A;  1SE7 A;  2K9A A;  3L3P A;  2CXF A;  4O4I E;  3SOL A;  1KEY A;  1MMN A;  5HXE A;  3HKB E;  3UUN A;  2XQY A;  3AEF A;  4ZOL E;  3VR8 A;  5JDG A;  1J5W A;  2Q9Q A;  5CB4 E;  4TX5 A;  5BMV E;  5A1L A;  3PUG A;  3F2E A;  5LG4 A;  2CLY B;  5AQP B;  4DR2 T;  3CQX C;  1J1J A;  1HFA A;  3FBL A;  4TV9 E;  4LFB T;  3R84 B;  1I6Z A;  2IUB A;  2M67 A;  2ACZ A;  4KMC A;  5JR9 A;  3CX6 B;  2JQH A;  3KBT A;  4CQI A;  3N9N A;  4IDN A;  3AE7 A;  5HWY A;  3C51 A;  4NUV A;  2V8S V;  1VCS A;  3ZMT B;  3FZL B;  3FXD B;  5FVL A;  3MZK B;  5F3J A;  2AE9 A;  5JDN A;  2Y8D A;  2DWG A;  3HL6 A;  3Q5D A;  4K0K T;  4EED A;  4AKG A;  4TN7 B;  3P4W A;  3EAM A;  3JCF A;  3PU8 A;  2LRK A;  4CXX A;  3C98 B;  2UUC T;  1XNQ T;  4ZI2 D;  1KFY A;  4LFA T;  3VRB A;  3AAA B;  1BR1 A;  2KZ7 B;  2WZI A;  4L5G A;  4Q25 A;  2A3D A;  4WNK A;  5ADX L;  2HPL A;  1D0Y A;  1XZY A;  2XAH B;  3RKG A;  3AE1 A;  5ABF B;  2E5L T;  3ZMZ B;  3RF1 A;  5LHI B;  2E9X B;  4X65 T;  3ZMV B;  2LOS A;  3GN5 B;  5IUX A;  2K5B B;  3DP7 A;  3UQ4 A;  3ONX A;  4DV3 T;  2JMH A;  4FJO A;  3WAK A;  5L3F B;  1E2A A;  1JNR A;  5FL0 A;  2D0T A;  2FJB A;  5AQL B;  3RPU A;  4DR5 T;  5AQJ B;  1S35 A;  3UT5 E;  2V5C A;  1W09 A;  4EYU A;  2WMO A;  1VOM A;  5DJQ C;  4EYY R;  5H6R B;  3OYZ A;  3HI2 A;  3QNU A;  2J1D G;  3WAJ A;  5HEG A;  4U7Y A;  4TNV A;  4UIG A;  2ZM8 A;  4H9P C;  4H9O C;  5AFU L;  4COF A;  5ABH A;  2D5U A;  2QA7 A;  1I94 T;  4JI3 T;  1H7C A;  3AEE A;  5J2U E;  2KSR A;  1W9R A;  4JUY A;  5LBQ B;  1HS7 A; 
#chains in the Genus database with same CATH homology
 4AXP A;  1LRZ A;  1D1C A;  2D0U A;  3BK9 A;  3HKC E;  5CA1 E;  2VKJ A;  1X79 A;  2WAU A;  3LFM A;  3UUL A;  3N2G E;  3RYI E;  2LHR A;  2Q9Q C;  3KV5 A;  4MAL A;  4AQG A;  3PU3 A;  5L3E B;  5FXX A;  3MAC A;  5IHY A;  3NRY A;  5LGU B;  2LOP A;  3D0T A;  4HEA A;  4DND A;  4UVB B;  4U72 A;  4KP3 C;  4DO0 A;  1HG2 A;  2L3L A;  2Q9Q D;  4GYS A;  4O8S A;  1MMA A;  3ZN1 B;  2NW7 A;  5C8Y E;  3ETU A;  3K3N A;  3N9O A;  4HE8 A;  2C5J A;  4YHJ A;  3VKG A;  3I9Y A;  1ZHC A;  2DLR A;  3ZYM A;  3UFE A;  5HWX A;  4UV9 B;  4BA9 A;  1IZN B;  3FXE B;  3C4W A;  4E7S A;  2V7K A;  3E0Z A;  3P7I A;  3CQG B;  3N2K E;  3CQC B;  1WRD A;  2WSS V;  3GWH A;  1G73 A;  4CZZ B;  4TUY E;  4I4T E;  5FXW A;  2DWK A;  3JC6 D;  3C4Z A;  2X9Y A;  4X1I E;  4ASK A;  4N78 D;  3AAE B;  4O4L E;  5F8P A;  1VRB A;  3FBZ A;  1SA0 E;  3Q5W A;  3V5S A;  2ES0 A;  5LOV E;  3O1I A;  5TAO A;  1UX4 A;  5JRC B;  3MA9 A;  2N2N A;  2YIN A;  1LKX A;  3J7Y q;  3PUQ A;  4DBR A;  2KIN B;  3CML A;  5EK2 A;  2C0S A;  4O2A E;  2LSJ A;  3N2O A;  3KBU A;  1B7T A;  2A2F X;  3MK7 C;  4CI2 B;  4ILU A;  2E8I A;  3DJB A;  2EHO A;  2C5K T;  4IDZ A;  3QK6 A;  3QUJ A;  4A56 A;  2VKD A;  4H63 H;  2CLY C;  3EUH A;  4OFZ A;  4WNK A;  3V5U A;  2LSG A;  2V7M A;  4O2B E;  3LBX B;  3WI3 A;  5LHH B;  3ZEF B;  5DQW A;  3L09 A;  2ACX A;  3OJA A;  2ZLY A;  3PDY A;  4DMV A;  3N9L A;  3LBX A;  5LHG B;  3LK3 B;  1WYB A;  2XTL A;  5LGT B;  1YKH B;  3PUS A;  1D1A A;  3A5X A;  2YK0 A;  5LNK A;  4XBF B;  3BQI A;  4UV8 B;  4JLE A;  1O3X A;  2Y6X A;  3O4X E;  3TKL B;  4E7Z A;  1HG5 A;  4AKH A;  4V1A v;  1D1B A;  2NTY A;  4F6R C;  4UVA B;  5HAX A;  3R6N A;  5ETW A;  5HYA A;  1HF8 A;  3ZJ1 A;  5L2L A;  3RYH E;  3T8O A;  4J2C A;  4BJN A;  2VB6 A;  1UX5 A;  4GIW A;  4YFS A;  4PAG A;  4QHO A;  5FNV E;  5FYM A;  4AKL A;  2GK9 A;  4X1Y E;  4IST A;  4UF0 A;  2IC6 A;  2LT3 A;  4MFR A;  3NZQ A;  4QXC B;  2YU1 A;  2RA1 A;  3I0O A;  3N9Q A;  5FP3 A;  3AVR A;  2W00 A;  3Q2M A;  3CKD A;  4PK4 A;  2QGS A;  2LJL A;  3OKQ A;  2CMR A;  2X51 A;  4GOU A;  4EXT A;  2Y48 B;  3MJX A;  5FY1 A;  3LJC A;  4EZH A;  4HGA A;  3EVY A;  3HKE E;  1HX8 A;  4PK6 A;  4O4J E;  3CVR A;  2XAJ B;  4PFO A;  1HCI A;  2CWO A;  3E22 E;  3LK4 2;  2ZM2 A;  3PUR A;  5LA6 E;  4ISS A;  4YJ3 E;  3ZYK A;  5IYZ E;  2JRK A;  3SRZ A;  3UUX B;  4XAX B;  5LJN A;  1KNZ A;  1LVF A;  4KBM B;  4HKA A;  4CXY A;  2NWB A;  4I50 E;  3I1A A;  1D0X A;  5J2T E;  2W63 A;  3JC6 C;  4ZI3 D;  3KV6 A;  3IBP A;  2ODU A;  1E1H B;  3PE0 A;  4ZI2 C;  5JRC A;  1LVK A;  1HTJ F;  2NW9 A;  2LSY A;  3BQL A;  4MHC A;  3KVB A;  4UF0 B;  1MMD A;  2A72 A;  1V9D A;  2CE7 A;  4PFP A;  4QXH B;  4L0R A;  3ANW B;  5L3G B;  2XUE A;  4PJM A;  4K0U A;  3H37 A;  3HA4 A;  1YW0 A;  3RX6 A;  4HTE A;  5LGN B;  2H3R A;  4HFV A;  3CX7 B;  3K8P C;  1BR0 A;  2CEA A;  5JDF A;  4OHF A;  3I9W A;  4ZS2 A;  3NZP A;  4DBQ A;  5JDL A;  2B1E A;  2VAS A;  3C50 A;  2KWI B;  2N9D A;  2X68 A;  2VK9 A;  2BVM A;  3U78 A;  5EZY E;  5HXH A;  2WBL A;  1FIO A;  3ZJ2 A;  4WBO A;  3HR0 A;  3AA0 B;  3ZCI A;  2LEH A;  3N9M A;  1MNE A;  4PJL A;  3KDS E;  2LE8 A;  2VKH A;  4AQF C;  3N5L A;  2WM9 A;  3UTK A;  4I55 E;  5DAB A;  4ZS3 A;  1FMW A;  2KMF A;  2DNX A;  2V1D B;  2HH7 A;  2IC9 A;  3ZMS B;  4HN9 A;  5L3B B;  5KMG P;  1IAP A;  4P0A A;  3O1H A;  4H9R C;  1MMG A;  2DCF A;  4PNI A;  2MBG A;  3EDU A;  4AQF A;  5FXZ A;  3ZPO A;  3VHL A;  1BR2 A;  3K3Q C;  3Q5X A;  1UCU A;  2SPC A;  3OYX A;  4IE7 A;  4TV8 E;  4Z8X A;  5H6Q B;  2V7I A;  3Q9D A;  4JEH B;  3MKD A;  3OBV E;  3IEE A;  3ANW A;  3ZN0 B;  3KIN B;  3AAI A;  2X66 A;  4FI5 A;  2VL8 A;  2ZM0 A;  4PK5 A;  3ZLI A;  1ZKE A;  4WBN E;  3S4U A;  4G63 A;  1FMV A;  2XAF B;  2LM9 A;  4QXB B;  5J1G A;  4EAH A;  3AB3 B;  4UEL A;  3ESL A;  4XZC A;  4H9N C;  3SS1 A;  3ZC1 A;  3O9X A;  3N9P A;  1ZV4 X;  4MBQ A;  3UUM A;  5JR9 C;  1SHZ C;  2V7L A;  3O1J A;  2NP9 A;  4ADZ A;  2EHO C;  1MND A;  4IIJ E;  4QX8 B;  4G2A A;  3QC9 A;  4O4H E;  5LBM A;  4GK5 E;  4IE5 A;  3M65 A;  5FY0 A;  5FY7 A;  1U5P A;  5JVD E;  4BAY B;  4ZI7 E;  2BZB A;  2X9W A;  2N1G A;  5GON E;  2I59 A;  3RC3 A;  4CI3 B;  4EZ4 A;  4QKN A;  4TZ4 C;  2IAK A;  1WR6 A;  2L9Q A;  2EHO D;  1MIV A;  1OWA A;  3AA1 B;  3B13 A;  3CWZ B;  2W62 A;  5L3C B;  2CCQ A;  2ZMA A;  2X67 A;  2L8K A;  2JPF A;  1IJ6 A;  3FHN A;  3GMI A;  2YU2 A;  1D0Z A;  1WYC A;  4P0B A;  4C91 A;  3KV4 A;  4PJN A;  4YLH A;  4ZI3 C;  1IJ5 A;  4P09 A;  4EIW A;  2V26 A;  2WWU A;  3EDV A;  2E9X C;  3CPZ A;  3GA8 A;  4U74 A;  5M4Y A;  1AJ3 A;  2JQQ A;  1KK7 A;  2JMK A;  2MYS A;  5DQV A;  2RP4 A;  5HXS A;  5JDM A;  4C90 A;  3H3A A;  1US7 B;  5FMN A;  4ERR A;  5KDM C;  1BR4 A;  2W0G A;  3KV9 A;  4DMW A;  4OYK A;  1NAF A;  3ZYL A;  2VKO A;  1S94 A;  4H9S E;  2W61 A;  3RRW A;  3RRC A;  2CXL A;  5JH7 E;  2X9H A;  2DI4 A;  2X0L B;  2EHO B;  3FB2 A;  3W15 B;  4ANJ A;  1QSD A;  3ZC0 A;  2LHN A;  2NW8 A;  2C5I T;  3BQK A;  4ZHQ E;  5LXT E;  4NUU A;  3ZMU B;  5CA0 E;  4I43 B;  1EZ3 A;  2YEV C;  2OA5 A;  3PTR B;  4EOZ B;  1MIW A;  2D2S A;  2H7V C;  3SWH A;  2PFV A;  2IW5 B;  5JDH A;  3RYF E;  3RYC E;  2CM0 A;  1ZEE A;  4QX7 B;  3GN5 A;  3C64 A;  4H9Q C;  1OXZ A;  2E9X D;  1NWM X;  2JJ9 A;  3I0Q A;  5JDQ A;  2G0U A;  3NRX A;  3CX8 B;  4GYR A;  2H7O A;  3IHR A;  2MOZ A;  3F57 A;  3NBX X;  2DHR A;  5KX5 E;  2CWY A;  5LYJ E;  5JRE A;  3RKO A;  4GK0 E;  2X9X A;  3IF8 B;  4MLK A;  2KND A;  4QWN B;  5E0O A;  2V7J A;  1G8X A;  4OK0 A;  1FEW A;  3AA6 B;  4IGU A;  5JR9 B;  4WW0 A;  4AKR B;  4B6X A;  2PBI A;  4YJ2 E;  2K48 A;  1YD8 G;  5HXC A;  3ETV A;  1YKE B;  3DTO A;  2KWH A;  3VKH A;  4M1P A;  2BVL A;  4IE6 A;  2P9B A;  1MIY A;  3PUA A;  4L9I A;  2HPJ A;  3E08 A;  4AKI A;  4BJM A;  2XAS B;  4DVD A;  2KT9 A;  3F31 A;  3LK2 B;  4X20 E;  2PJQ A;  2CA5 A;  2VWA A;  1Z0P A;  3K3O A;  5JQG E;  3ZCJ A;  2NOX A;  2LSI A;  2WMN A;  2Z6E A;  3KFW X;  4CI1 B;  5LP6 E;  4UVC B;  1U4Q A;  2XAG B;  1CUN A;  2NTX A;  2ODV A;  5EK3 A;  3KVA A;  5FXV A;  2BDE A;  4OYJ A;  3HKD E;  3J9X 1;  4IE4 A;  2LSK A;  4UEM A;  3P8C D;  2KXP B;  3C4X A;  1QUU A;  2KLQ A;  2Q9Q B;  3VU7 H;  5L3D B;  2MTQ A;  3AVS A;  5LCY A;  4IHJ E;  2CXD A;  1WLX A;  4JEU B;  5HXR A;  4X1K E;  4CXW A;  2XAQ B;  4KUM B;  4UXN B;  4PW8 A;  5EK4 A;  2PG8 A;  2E9X A;  3MXZ A;  4H63 V;  3B57 A;  3LG7 A;  4IE0 A;  2UXN B;  5LJM A;  1Y64 B;  4PJJ A;  3RC8 A;  3U3I A;  4AI6 A;  2K24 A;  3RH3 A;  2UXX B;  2XHE B;  4EB6 E;  1T98 A;  2K9A A;  3L3P A;  3SOL A;  2CXF A;  4O4I E;  1MMN A;  5HXE A;  3HKB E;  3UUN A;  2XQY A;  4ZOL E;  5JDG A;  2Q9Q A;  5CB4 E;  4TX5 A;  5BMV E;  5A1L A;  3PUG A;  3F2E A;  5LG4 A;  2CLY B;  3CQX C;  1HFA A;  3FBL A;  4TV9 E;  3R84 B;  2M67 A;  4KMC A;  5JR9 A;  3CX6 B;  3KBT A;  4CQI A;  3N9N A;  5HWY A;  3C51 A;  4NUV A;  3ZMT B;  3FXD B;  3MZK B;  5F3J A;  5JDN A;  2Y8D A;  2DWG A;  3HL6 A;  4AKG A;  4TN7 B;  4CXX A;  3PU8 A;  3C98 B;  4ZI2 D;  3AAA B;  1BR1 A;  2KZ7 B;  4L5G A;  5ADX L;  2A3D A;  2HPL A;  1D0Y A;  2XAH B;  3ZMZ B;  5LHI B;  2E9X B;  3ZMV B;  2LOS A;  3GN5 B;  2K5B B;  3DP7 A;  3ONX A;  2JMH A;  4FJO A;  3WAK A;  5L3F B;  2D0T A;  3RPU A;  1S35 A;  3UT5 E;  4EYU A;  2WMO A;  1VOM A;  5DJQ C;  4EYY R;  5H6R B;  3OYZ A;  3HI2 A;  2J1D G;  3WAJ A;  4UIG A;  2ZM8 A;  4H9P C;  4H9O C;  5AFU L;  2D5U A;  2QA7 A;  1H7C A;  5J2U E;  3AA7 B;  4JUY A;  5LBQ B;  1HS7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...