4L0RA

Crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
74
structure length
74
Chain Sequence
GINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrosomal protein of 57 kDa
publication title Crystal structure of FGF2-interacting protein from Homo sapiens. Northeast Structural Genomics consortium id HR9027A
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 34
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06657 Cep57_MT_bd Centrosome microtubule-binding domain of Cep57
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l0rA00
2C5KT 3L3PA 2X9XA 3CKDA 2KWHA 3N5LA 2C5IT 1Z0PA 2IC9A 1H7CA 1IJ5A 3CVRA 3FXDB 3TKLB 2CA5A 2G0UA 3P7IA 4DNDA 2IC6A 2XTLA 3QK6A 1LRZA 1IJ6A 1QSDA 2KWIB 1LVFA 2X9WA 2MBGA 2X9YA 3MXZA 4B6XA 1ZKEA 3S4UA 2C5JA 3FXEB 3QUJA 4EYYR 4FI5A 4CQIA 4J2CA 4L0RA 2K48A
chains in the Genus database with same CATH superfamily
1I6ZA 5FL1A 4WNKA 3I9WA 2ZM0A 3LBXA 2RP4A 2YDSA 3R6NA 1MNEA 4HN9A 5HEGA 3HKCE 3JC6C 4F6RC 3A5XA 1XZYA 4DV4T 2XQ8A 2C0SA 2WM9A 4XBFB 4O4HE 5LBMA 5JQGE 5LYJE 2K9AA 1D0XA 2BKNA 2ODVA 1WCRA 2W63A 3OBVE 3HL6A 3CIRA 2PTFA 2V5CA 2QVAA 5HYAA 4U33A 2VQFT 1D0YA 2VB6A 4DR7T 4AQFC 1XDOA 4O4IE 4PAGA 3ANWB 2BG9C 2AXDS 5F3JA 3P8CD 3BQLA 5JTGA 5L47A 5FYMA 3RLFF 3CQGB 3MK7C 2HPLA 2IUBA 3ZYMA 1QUUA 3HA4A 1AJ3A 3O9XA 4IHJE 3GA8A 2VKDA 3LK42 4EXTA 4JI6T 2IMLA 4JYAT 3GN5B 3C51A 2YU1A 1M7KA 3PDYA 5C2TA 3ONXA 3EAMA 2YKSA 4B6XA 3ZEFB 5DABA 4TUYE 5LXTE 3C98B 2XUEA 2E2AA 5JDQA 2JRKA 2CEAA 4ZXLA 4L0RA 2XAJB 2KSRA 1UCUA 3JAEA 2DWGA 2XAGB 4UR9A 5FY7A 3PE0A 5LMUT 5BMVE 3B57A 4AKRB 3SRZA 4U7YA 1OEDC 3RIUA 1ZKEA 2CE7A 2K3WA 4CXWA 4KHZF 3ZLIA 4HWHA 3ZYLA 3PUAA 5CFBA 4IE7A 5LJMA 4YFSA 2Q9QC 2E9XA 3PUXF 5AQTB 3KVAA 3W15B 4AKHA 5L3CB 4DV2T 4BAYB 4CN6A 4HFVA 1H7CA 4ZZBA 5A1LA 2VKHA 5HAXA 2BS2A 4JI3T 2J4GA 1QSDA 3I9YA 4OYKA 3VRBA 2PBIA 4YLHA 4H9SE 5ABHA 5JDLA 1KEYA 3RHWA 4IDPA 3C64A 5CGMA 4AKLA 4CI3B 3ESLA 3HI2A 2ZM8A 4LFAT 3ZCIA 3LBXB 4X66T 5BR8T 4NUVA 4WZXA 4CXYA 3AVRA 1XWMA 2J1DG 3ABVA 3FHNA 3PUQA 2JQKA 3P7IA 1LRZA 4ADZA 5HEJA 5JDNA 3RPUA 4MHCA 2FUPA 5GONE 3ETUA 4JI2T 4X1KE 2L3LA 1D1CA 3C4XA 3ZYKA 4N78D 3UQ7A 4AI6A 4QWNB 4LF7T 3EUHA 2W4XA 4JLEA 5LA6E 1ZP0A 4GK5E 3FBZA 4JBWF 4Z91A 2WP9A 2UXDT 4LF5T 4L9IA 3H3MA 4GKKT 2X51A 3E22E 3VKGA 4P1NA 3UU4A 4IE6A 5JR9A 3N9NA 3B13A 2IC9A 3CX7B 2UXXB 5AQMB 1Y64B 2FJDA 5L3EB 1YD8G 3PUVF 5HWYA 4DMVA 4NIQA 3T8OA 4JI5T 2KNDA 2D0TA 1YQ4A 4PFPA 5FY1A 3ZJ1A 4B3MT 2WMNA 4JI4T 4TNVA 2YDQA 2DLRA 5TAOA 5LGNB 3UQ4A 4U74A 2NW8A 4U72A 2VVNA 2A2FX 4DR2T 2XQ4A 2LOPA 4DR1T 3RKGA 1L0VA 3LJCA 2BZBA 2E9XB 4P0AA 3ZN0B 1YXRA 4ZOLE 5C8YE 1LVKA 5LOVE 4OK0A 5EK2A 3B5MA 4DUZT 2HH7A 3AE2A 1WR0A 1FEWA 2V8SV 2XZEA 4C90A 3E0ZA 2WCAA 1GQEA 4GOUA 5HXSA 4ZEYA 1Z8UA 2XJ7A 3MKDA 2B1EA 5H6RB 2LT3A 4P0BA 4DV3T 2Z6EA 2KXPB 3D0TA 1MIWA 2G0UA 2I59A 2DNXA 5LGUB 3UT5E 3EDVA 1IJ6A 2CHNA 4U31A 4GYRA 2N2NA 1X9BA 4U7IA 4ZI2D 5FXVA 2W67A 4EZHA 3RI5A 3P4QA 2ZM6T 4H9PC 2X67A 2VASA 3ZC1A 3ZJ2A 4HTEA 2V7JA 4GIWA 5EK3A 2MBGA 4YTNA 4DBQA 4Z90A 4IDOA 4B3TT 1MMGA 3UUNA 2V7MA 2L8KA 3VU7H 2D0UA 3H3AA 2XQ7A 2E9XD 2XQYA 3Q9DA 4I4TE 2K5BB 2NW9A 5HXCA 1KNPA 4B3RT 4ILUA 3VR8A 4J2CA 1JNZA 2X0LB 2E5LT 3T1YT 2LM2A 3O4XE 3AECA 5JR9B 1MIYA 2Y6XA 3V5UA 5HXHA 2MYSA 3FZMB 2VQET 4TZ4C 3ZSSA 1CHUA 3L8RA 4AKIA 5LMNT 3ZT5A 3RC3A 2UUBT 2EHOD 3N2KE 3ONLC 2DWKA 3OPCA 4X20E 4AKGA 4COFA 1ZHCA 3PUWF 1T98A 3N9OA 3T1HT 3AEGA 3EI0A 2C5JA 4X1YE 1M62A 3QUJA 4E7ZA 4TV8E 2YDRA 2UU9T 2MAWA 2ODUA 3QOFA 5JDMA 2I6HA 4DV6T 4PW8A 3RIFA 5DJQC 4XZCA 2ZLYA 2ACXA 4DR5T 4G63A 4ILCA 1VRBA 3QK6A 3X1DA 2CBJA 4BA9A 5LG4A 2JQQA 3AA6B 2GK9A 3A8YC 4YTMA 1N36T 3QB5A 4KMCA 4DV7T 3CMLA 1O3XA 3QC9A 2WB5A 3O1IA 4ASKA 2DHRA 2A3DA 2UXBT 2H7OA 4K0KT 4UVBB 1S94A 2LSGA 1D1BA 3FXEB 4LFBT 5L3BB 4U3CA 3CX8B 3AA7B 2ACZA 3N5LA 4LMLA 5ABFA 2LEHA 2YOEA 2RPAA 5JRCA 3IF8B 4UVAB 1VOMA 2UXCT 3RRCA 4KX6A 1W0BA 2CLYB 3LFMA 1MMDA 1HS7A 4ZI3D 3G06A 2D5UA 5AQRB 3K3QC 5AQHB 3L39A 5FY0A 3J9X1 4UIGA 3PTRB 3ZSTA 5IWAT 3Q5DA 3TLSA 4H63H 1HNXT 4HFDA 2DCFA 5ADXL 5H6QB 4EYYR 4CZZB 5L4EA 3QNUA 2BBJA 3KBUA 4KI0F 3M65A 4HFIA 5LHGB 4AQGA 1YKHB 3NRYA 2NOXA 1NAFA 4YTPA 2KZ7B 1U4QA 4ILBA 4JI8T 2KINB 1HTJF 3P50A 3RQUA 3NZQA 2CBIA 2WBLA 3IEEA 5KXJA 4HFBA 2LE8A 4EAHA 4KUMB 3LG7A 4DVDA 4DBRA 4EEDA 3EABA 3UU8A 3UFEA 1ZEEA 1IBLT 3KVBA 5IYZE 4EV6A 3AE1A 4TX5A 3NBXX 3RKOA 5LGTB 2UUAT 3WAJA 3FZKB 3RQWA 1XNRT 3UU6A 2M6IA 3AE7A 5L3FB 2Q9QD 3ZKRA 4JV5T 2J47A 2HHHT 2W0GA 5L3DB 3AE9A 4PJJA 4P09A 4DNDA 4I50E 1HFAA 3ZC0A 2W62A 2MOZA 4YJ3E 5LB7B 3UULA 4GKJT 2RA1A 2WAUA 1T8BA 4E7SA 2EHOA 5CB4E 1ZV4X 2Y48B 2CWYA 2CM0A 2XQ5A 2E5VA 2IHR1 1HCIA 2V1DB 3ZT6A 2N1GA 5L2LA 1G73A 2LSYA 3KV9A 5AQNB 4CXXA 1UX4A 1W09A 5AQKB 4HWCA 4ANJA 3PV0F 1KK7A 2LJLA 2VKJA 5J2TE 5ABFB 1HNWT 5E0OA 1D0ZA 5JRCB 4A98A 3C4WA 2OLTA 4QH1A 4EEBA 2QYWA 4CI1B 2WDQA 5LCYA 2CXFA 3CVRA 4ZS2A 5JDFA 3PURA 3UUMA 3ZMUB 3TLWA 4H9QC 3ZT7A 3P4WA 4IE5A 3LK3B 1QLBA 1XMOT 3WAKA 4PK6A 4YHJA 5HCMA 3IA3A 2XAQB 2XHEB 4U2ZA 2NR4A 1KNRA 4H63V 4WW0A 4XAXB 2AE9A 4YHHT 2OV9A 5ETWA 3OYXA 3PUYF 2IDOB 5FXXA 3N2OA 4EZ4A 4PNIA 3SOLA 2DI4A 3KINB 2YK0A 3K8PC 2B76A 2LRKA 1VCSA 3MXZA 3EHZA 3KBTA 3FB2A 1SHZC 3PUGA 4ISTA 4LF9T 4UVCB 2WDVA 4OFZA 2H88A 1X79A 2MTQA 2XM2A 4DR3T 4NXNT 3K3OA 4FJOA 4AQFA 1HG5A 2XTLA 1MMNA 5JDGA 3PU8A 3JCFA 2BG9A 4O2BE 4K0UA 2XY8B 3VKHA 4PFOA 3KDSE 2CXLA 4CI2B 2JMHA 2LSJA 4QH5A 5AQFB 5FXZA 2LOSA 3GWHA 1E2AA 3NWIA 4YSXA 2NW7A 2CMRA 1OXZA 2M67A 2BKOA 3E08A 2WWUA 4ZI7E 1IZNB 2OA5A 4L5GA 3RX6A 3FXDB 2JQHA 4JEHB 2EHOB 1WRDA 4IIJE 4I55E 2LHNA 2QA7A 2LSIA 2YEVC 3AB3B 2VVSA 4O8SA 4QXCB 2A9UA 3ZCJA 1US7B 3SFEA 3K3NA 1OEDA 3KV4A 3TKLB 4ZI2C 2JPFA 2W61A 4O4JE 5KMGP 4IL9A 4CN4A 2XQAA 3NZPA 1YW0A 2BKPA 5LNKA 3MZKB 4AIUA 2Q9QA 3RYFE 2PFVA 3VR9A 1JNRA 3RIUC 1UURA 4X64T 3CX6B 3N9MA 2WQYA 3MACA 3ANWA 4O4LE 5LBQB 3ZMTB 4DO0A 2HN2A 3DP7A 3NVOA 2I0MA 4X1IE 3NKZA 2NTXA 3KFWX 2E9XC 4Q25A 4UELA 2VL0A 1E1HB 3JAFA 1UK5A 3J7Yq 3Q5EA 4TN7B 5L4HA 2A72A 3AE8A 1E7PA 2D9DA 2WZHA 1W0AA 4HWIB 1IBKT 2BS3A 2C5KT 3U3IA 4PK4A 4WBNE 4V1Av 1J5WA 3F57A 4MALA 4HWFA 1KFYA 2V6XA 2LLYA 3ZMSB 1W9RA 3AEDA 4ILAA 2V26A 5JDHA 1UX5A 5FL0A 2YINA 5FVLA 2V7KA 2X68A 3OYZA 2XASB 4QX7B 1WYCA 4HGAA 4YT0A 2XPKA 3CPZA 2BG9B 1XMQT 2KLQA 3R84B 5FNVE 2SPCA 4LF8T 3N9PA 2ES0A 5F8PA 3EVYA 2WU5A 2L9QA 3AEAA 2LM9A 5AQVB 2HN1A 5AQJB 3FZLB 3GMIA 1DU2A 1R8IA 2X9YA 2XAHB 2UUCT 3VRAA 2XQ3A 1FJGT 5AQOB 2DL1A 4Z8XA 2HPJA 1J1JA 4X65T 3EDUA 4OX9T 3ZPOA 1FMWA 3QB5K 4U2YA 4LMJA 5FKYA 5JR9C 2FJEA 3RRWA 2BS4A 4A56A 5ABEA 1WFDA 1YQ3A 4X5TA 3TLUA 2X66A 2C5IT 3JC6D 3RIAA 2JMKA 4H9OC 3RYIE 4IE4A 1NENA 1OEDB 3BK9A 4BJNA 1BR4A 4DV1T 3AE5A 2V7LA 2ZM2A 3L3PA 4UV9B 2BDEA 2K24A 4ZI3C 2XAFB 2Q9QB 1BR0A 5ABGA 5L3GB 3VHLA 4DIDB 4YSYA 1MIVA 4A97A 4AISA 4IE0A 4DR4T 5CJ5A 5F5WA 1ZOYA 1LKXA 3DJBA 1MMAA 2NWBA 4PJLA 2IAKA 1UUSA 3SS1A 1KNZA 4JUYA 3MA9A 4IDQA 4ERRA 3HKBE 3BQIA 5KDMC 5J0ZA 4QHOA 4YJ2E 2NP9A 5LJNA 3OVUA 2Y8DA 5EK4A 5AFUL 4G2AA 4QXBB 3ZMZB 1WYBA 2E8IA 4O2AE 2JJ9A 4CN1A 4JEUB 2QRXA 4NUUA 1SUMB 3UTKA 4DV0T 1XNQT 2WY2A 3ZN1B 3FBLA 4DR6T 3AE6A 3LK2B 2JIWA 3UUXB 4BJMA 1N33T 3AVSA 3V5SA 3HKEE 5AQSB 5FXWA 4AQYT 2CLYC 2W66A 2IW5B 3S4UA 4IREA 4YXDA 2R6GF 4OYJA 4WBOA 2CCQA 4TNWA 5HXEA 2UXNB 4YSZA 4QX8B 1G8XA 3PUZF 5AQIB 3BQKA 3K1SA 1BR2A 3CQCB 2V5DA 2CXDA 1WLXA 5JH7E 4NPPA 4AXPA 3Q5WA 2MPKA 2XQ9A 3AEFA 2PJQA 3IBPA 4EB6E 4OHFA 3C50A 1HNZT 5HEUA 3AA0B 4NXMT 2XM1A 2WZIA 5AQQB 1NEKA 3JADA 2BBHA 1FMVA 4IDNA 2M6BA 2K48A 1WR6A 2XSBA 3AE4A 5HCJA 4DV5T 1T72A 2YU2A 3LDQB 4IL4A 4UF0A 2FBWA 1FIOA 3AAEB 1N32T 3DTOA 1J5ET 5CA0E 4HE8A 2WSSV 3H37A 3AXJA 2LSKA 4QXHB 3AA1B 5FVKA 3O1HA 5AQPB 1BR1A 3MJXA 4M1PA 2WMOA 2LKHA 3TLVA 4KP3C 3P4RA 5CA1E 2W00A 3LSVA 3P4PA 3F31A 4A5XA 4LF6T 3KV5A 2V7IA 5IUXA 2X0HA 3UUBA 4FI5A 1EZ3A 4EIWA 3ETVA 1HR0T 2LRLA 3FZHB 4TWDA 4I0UA 5AQUB 3C4ZA 5IHYA 2JQ9A 4H9RC 3KV6A 5C3JA 2CHOA 1SE7A 4MBQA 3Q5XA 4DMWA 1N34T 4HFHA 3P4SA 2PG8A 2WWVA 2V6YA 1Y01A 2LKGA 4LF4T 2F4VT 4H9NC 5EZYE 2KWIB 4EGWA 3RF1A 4JI7T 3M3ZB 3PUSA 4QH4A 3UU3A 3PJAA 4IGUA 4IT4A 5J1GA 1OWAA 3AEBA 4HWDA 1I94T 1XDPA 5LP6E 4IDZA 5M4YA 4UXNB 3AAIA 2X9WA 2VURA 2CWOA 2LHRA 3PU3A 2BG9E 3RGLA 1U5PA 4X62T 4EYUA 1V9DA 4JI1T 4ZZCA 2VWAA 3HR0A 3I0QA 2VK9A 2FJBA 3O1JA 1VCTA 4YY3T 3TLTA 1MNDA 3ONJA 1SA0E 3SFDA 2KWHA 1Z0PA 2X0YA 4UEMA 5HEHA 4HKAA 3NRXA 5KX5E 2H7VC 3OJAA 4B3ST 3AAAB 4UF0B 1IAPA 3N2GE 5JREA 1S35A 3CK6A 4WYVA 2WU2A 1YKEB 2WS3A 4TV9E 4KBMB 1HX8A 5LHHB 1LVFA 3AXJB 1HG2A 1OEDE 3A7MA 4QKNA 2D2SA 3CWZB 1HF8A 2FJAA 2X9XA 3CKDA 5DQWA 3AE3A 3FZFB 5FP3A 3ZMVB 4LMKA 5JVDE 3RYHE 4KHPT 5HEOA 4PJMA 4TWHA 1B7TA 3N9QA 4EOZB 3U78A 4HFEA 4CQIA 3RC8A 2WDRA 1D1AA 4ISSA 3GN5A 5FMNA 3HKDE 2X9HA 1UGOA 1CUNA 2IC6A 3UFGA 3OKQA 2XSAA 2EHOC 2H89A 1HX1B 3I1AA 3OTOT 4GYSA 2YN6A 2W2UA 5LHIB 1KF6A 4MLKA 4LFCT 4F8HA 3WI3A 4I43B 4PJNA 2KT9A 2ZMAA 2NTYA 2J62A 3PJAJ 4TWFA 4ZHQE 3RH3A 2P9BA 4C91A 2V6YB 2IIUA 1T7SA 5HXRA 3L09A 3Q2MA 2CPTA 2CRBA 1IJ5A 3RYCE 2CA5A 4JI0T 5AQLB 2VKOA 4UV8B 5DQVA 2BVMA 4PK5A 5HWXA 5AQGB 4GK0E 2H3RA 1IBMT 5J2UE 2VL8A 3AEEA 2N9DA 4HFCA 3N9LA 4ZS3A 3I0OA 2KMFA 5LG3A 2QGSA 4DUYT 4MFRA 4HEAA 3SWHA 2XQ6A 3CQXC 3IHRA 3F2EA 1NWMX 2BVLA 3UU5A
chains in the Genus database with same CATH topology
4WBOA 4EZ4A 2CCQA 4PNIA 5HXEA 2UXNB 2V7MA 4QX8B 1G8XA 2L8KA 3VU7H 2D0UA 3SOLA 4WNKA 2DI4A 3I9WA 2ZM0A 3LBXA 3H3AA 3BQKA 2E9XD 2RP4A 2XQYA 3R6NA 3KINB 1BR2A 3CQCB 1MNEA 2YK0A 2CXDA 3K8PC 3Q9DA 4HN9A 4I4TE 2K5BB 3HKCE 1WLXA 3MXZA 5HXCA 3JC6C 2NW9A 5JH7E 3KBTA 3FB2A 4AXPA 4F6RC 1SHZC 3A5XA 3Q5WA 3PUGA 4ISTA 4ILUA 2C0SA 2WM9A 2PJQA 3IBPA 4J2CA 4O4HE 2X0LB 4OHFA 4UVCB 3C50A 5LBMA 4OFZA 4EB6E 5JQGE 5LYJE 2K9AA 1X79A 2MTQA 1D0XA 2ODVA 2W63A 3OBVE 3AA0B 3HL6A 3O4XE 3K3OA 4FJOA 4AQFA 5JR9B 1HG5A 2XTLA 1MMNA 5JDGA 1MIYA 3PU8A 2Y6XA 4O2BE 4K0UA 5HYAA 3V5UA 5HXHA 3VKHA 2MYSA 4PFOA 3KDSE 1D0YA 2CXLA 4TZ4C 4CI2B 1FMVA 2VB6A 4AQFC 4O4IE 4PAGA 3ANWB 2JMHA 4AKIA 2LSJA 3RC3A 2K48A 5F3JA 2EHOD 3P8CD 5FXZA 1WR6A 2LOSA 3BQLA 3GWHA 3N2KE 2DWKA 5FYMA 4X20E 4AKGA 2YU2A 3CQGB 3MK7C 1ZHCA 4UF0A 4XBFB 2HPLA 1T98A 2NW7A 3N9OA 1FIOA 2CMRA 1OXZA 3AAEB 3ZYMA 1QUUA 3DTOA 2C5JA 4X1YE 3QUJA 3HA4A 2M67A 4E7ZA 3E08A 2WWUA 4ZI7E 5CA0E 1IZNB 4HE8A 1AJ3A 2WSSV 3H37A 2OA5A 4TV8E 3O9XA 4L5GA 3RX6A 4IHJE 3GA8A 3FXDB 2VKDA 3LK42 4EXTA 2LSKA 3GN5B 3C51A 2YU1A 4QXHB 4JEHB 3AA1B 2EHOB 1WRDA 3O1HA 2ODUA 4IIJE 3PDYA 3ONXA 4I55E 2LHNA 5JDMA 1BR1A 2QA7A 2LSIA 4B6XA 3ZEFB 3MJXA 4M1PA 2YEVC 4PW8A 5DABA 3AB3B 4TUYE 5LXTE 2WMOA 3C98B 2XUEA 5JDQA 2JRKA 2CEAA 4KP3C 4O8SA 4L0RA 2XAJB 4QXCB 3ZCJA 5DJQC 1US7B 3K3NA 5CA1E 4XZCA 1UCUA 2DWGA 2W00A 2ACXA 2XAGB 2ZLYA 3KV4A 5FY7A 3TKLB 4ZI2C 3PE0A 3F31A 2JPFA 4G63A 1VRBA 2W61A 3QK6A 5BMVE 3B57A 4O4JE 4AKRB 4BA9A 3SRZA 3KV5A 5KMGP 5LG4A 3NZPA 1YW0A 2JQQA 1ZKEA 2V7IA 3AA6B 2GK9A 5LNKA 2CE7A 3MZKB 4CXWA 4EIWA 4FI5A 1EZ3A 2Q9QA 3ETVA 4KMCA 3RYFE 2PFVA 3ZLIA 3CMLA 1O3XA 3C4ZA 3ZYLA 3PUAA 3QC9A 4IE7A 5LJMA 5IHYA 3O1IA 4ASKA 2DHRA 3CX6B 2A3DA 3N9MA 4YFSA 2Q9QC 2E9XA 3MACA 2H7OA 3ANWA 4UVBB 4O4LE 4H9RC 1S94A 3KV6A 5LBQB 2LSGA 3ZMTB 3KVAA 4MBQA 4DO0A 3Q5XA 3W15B 4DMWA 3DP7A 1D1BA 3FXEB 4AKHA 5L3BB 4X1IE 2NTXA 3KFWX 2E9XC 4UELA 3CX8B 3AA7B 5L3CB 2PG8A 4BAYB 3N5LA 4HFVA 1H7CA 1E1HB 5A1LA 2LEHA 2VKHA 5HAXA 5JRCA 3IF8B 4H9NC 4UVAB 1VOMA 5EZYE 3RRCA 3J7Yq 4TN7B 2CLYB 3LFMA 1QSDA 2KWIB 3I9YA 4OYKA 1MMDA 1HS7A 4ZI3D 2A72A 2PBIA 4YLHA 4H9SE 2D5UA 3K3QC 3PUSA 2C5KT 3U3IA 4PK4A 5JDLA 4WBNE 5FY0A 3J9X1 4UIGA 3PTRB 4IGUA 3C64A 1OWAA 4V1Av 5J1GA 3F57A 4MALA 4AKLA 5LP6E 4CI3B 4IDZA 3ZMSB 3ESLA 4H63H 5M4YA 3HI2A 2ZM8A 4UXNB 3AAIA 2X9WA 2V26A 3ZCIA 3LBXB 2CWOA 5JDHA 2DCFA 2LHRA 5ADXL 1UX5A 4NUVA 5H6QB 2YINA 4EYYR 3PU3A 4CZZB 2V7KA 4CXYA 3AVRA 2J1DG 3FHNA 3KBUA 1U5PA 3M65A 2X68A 4EYUA 1V9DA 3PUQA 3OYZA 2XASB 4QX7B 5LHGB 3P7IA 2VWAA 3HR0A 4AQGA 3I0QA 2VK9A 1WYCA 1LRZA 1YKHB 3NRYA 4HGAA 4ADZA 2NOXA 1NAFA 5JDNA 3O1JA 3RPUA 4MHCA 3CPZA 5GONE 3ETUA 4X1KE 2KZ7B 1MNDA 2L3LA 1D1CA 3C4XA 2KLQA 3ZYKA 3R84B 1U4QA 5FNVE 1SA0E 4N78D 2SPCA 2KINB 1HTJF 3N9PA 2KWHA 4AI6A 4QWNB 1Z0PA 3EUHA 3NZQA 4JLEA 2ES0A 5LA6E 4GK5E 5F8PA 3EVYA 4UEMA 4HKAA 2L9QA 2WBLA 3FBZA 3NRXA 3IEEA 5KX5E 2LM9A 2LE8A 4EAHA 2H7VC 3GMIA 3OJAA 2X9YA 2XAHB 4KUMB 3LG7A 4L9IA 4DVDA 4DBRA 2X51A 3E22E 3VKGA 4Z8XA 3AAAB 2HPJA 4UF0B 1IAPA 3N2GE 3UFEA 1S35A 4IE6A 1ZEEA 5JREA 5JR9A 3N9NA 3EDUA 3KVBA 3ZPOA 3B13A 2IC9A 3CX7B 5IYZE 1FMWA 2UXXB 1YKEB 4TV9E 4TX5A 3NBXX 3RKOA 5LGTB 1Y64B 4KBMB 5JR9C 1HX8A 3RRWA 5L3EB 5LHHB 1YD8G 1LVFA 3WAJA 1HG2A 5HWYA 4QKNA 2D2SA 4DMVA 4A56A 3CWZB 5L3FB 2Q9QD 1HF8A 3T8OA 2KNDA 2X9XA 2X66A 2D0TA 2W0GA 3CKDA 5L3DB 5DQWA 2C5IT 3JC6D 4PFPA 4PJJA 5FY1A 5FP3A 4P09A 4DNDA 2JMKA 4H9OC 4I50E 3ZMVB 1HFAA 3ZC0A 3RYIE 3ZJ1A 2W62A 5JVDE 2MOZA 4IE4A 3BK9A 3RYHE 2WMNA 4YJ3E 3UULA 4PJMA 2RA1A 1B7TA 4BJNA 3N9QA 4EOZB 2WAUA 2DLRA 1BR4A 3U78A 4CQIA 3RC8A 5TAOA 2V7LA 2ZM2A 5LGNB 3L3PA 1D1AA 4ISSA 3GN5A 4U74A 4E7SA 2NW8A 4UV9B 2EHOA 4U72A 2BDEA 2K24A 4ZI3C 2XAFB 2Q9QB 1BR0A 5L3GB 5FMNA 2A2FX 5CB4E 1ZV4X 3HKDE 3VHLA 2LOPA 2X9HA 2Y48B 2IC6A 1CUNA 2CWYA 2CM0A 1MIVA 3OKQA 3LJCA 2EHOC 2BZBA 1HCIA 4IE0A 2E9XB 3I1AA 2V1DB 2N1GA 5L2LA 1LKXA 3DJBA 4P0AA 3ZN0B 1G73A 4GYSA 1MMAA 2LSYA 2NWBA 4PJLA 3KV9A 4ZOLE 5C8YE 5LHIB 4MLKA 1LVKA 4CXXA 2IAKA 1UX4A 3WI3A 4I43B 3SS1A 1KNZA 5LOVE 4PJNA 4OK0A 2KT9A 2ZMAA 4JUYA 5EK2A 2NTYA 3MA9A 4ANJA 4ZHQE 2HH7A 1KK7A 3RH3A 2LJLA 2VKJA 1FEWA 4ERRA 2P9BA 4C91A 5J2TE 4C90A 3HKBE 3E0ZA 3BQIA 5E0OA 5HXRA 1D0ZA 5JRCB 4GOUA 3C4WA 5KDMC 5HXSA 3L09A 3Q2MA 3MKDA 4QHOA 4CI1B 2B1EA 5H6RB 4YJ2E 5LCYA 2LT3A 2NP9A 4P0BA 5LJNA 2Y8DA 2Z6EA 2KXPB 5EK4A 3D0TA 4G2AA 4QXBB 5AFUL 3ZMZB 1MIWA 1IJ5A 1WYBA 3RYCE 2CXFA 3CVRA 2CA5A 2G0UA 2I59A 4ZS2A 5JDFA 2DNXA 2E8IA 2VKOA 4O2AE 5LGUB 3UT5E 3EDVA 1IJ6A 3PURA 2JJ9A 4UV8B 3UUMA 4GYRA 2N2NA 5DQVA 2BVMA 4JEUB 3ZMUB 4PK5A 5HWXA 4GK0E 4ZI2D 4H9QC 4NUUA 5FXVA 4EZHA 3UTKA 2H3RA 4IE5A 5J2UE 2VL8A 3LK3B 3ZN1B 3FBLA 4H9PC 3WAKA 2N9DA 2X67A 3LK2B 4PK6A 4YHJA 3UUXB 4BJMA 3AVSA 2VASA 3N9LA 3V5SA 4ZS3A 3HKEE 3ZC1A 3ZJ2A 4HTEA 3I0OA 2XAQB 2V7JA 2KMFA 2XHEB 2QGSA 4GIWA 5EK3A 2MBGA 5FXWA 2CLYC 4H63V 4MFRA 4WW0A 4HEAA 4XAXB 2IW5B 4DBQA 3S4UA 3SWHA 5ETWA 3OYXA 3CQXC 3IHRA 1MMGA 3F2EA 5FXXA 1NWMX 4OYJA 3N2OA 2BVLA 3UUNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C5K T;  3L3P A;  2X9X A;  3CKD A;  2KWH A;  3N5L A;  2C5I T;  1Z0P A;  2IC9 A;  1H7C A;  1IJ5 A;  3CVR A;  3FXD B;  3TKL B;  2CA5 A;  2G0U A;  3P7I A;  4DND A;  2IC6 A;  2XTL A;  3QK6 A;  1LRZ A;  1IJ6 A;  1QSD A;  2KWI B;  1LVF A;  2X9W A;  2MBG A;  2X9Y A;  3MXZ A;  4B6X A;  1ZKE A;  3S4U A;  2C5J A;  3FXE B;  3QUJ A;  4EYY R;  4FI5 A;  4CQI A;  4J2C A;  4L0R A;  2K48 A; 
#chains in the Genus database with same CATH topology
 1I6Z A;  5FL1 A;  4WNK A;  3I9W A;  2ZM0 A;  3LBX A;  2RP4 A;  2YDS A;  3R6N A;  1MNE A;  4HN9 A;  5HEG A;  3HKC E;  3JC6 C;  4F6R C;  3A5X A;  1XZY A;  4DV4 T;  2XQ8 A;  2C0S A;  2WM9 A;  4XBF B;  4O4H E;  5LBM A;  5JQG E;  5LYJ E;  2K9A A;  1D0X A;  2BKN A;  2ODV A;  1WCR A;  2W63 A;  3OBV E;  3HL6 A;  3CIR A;  2PTF A;  2V5C A;  2QVA A;  5HYA A;  4U33 A;  2VQF T;  1D0Y A;  2VB6 A;  4DR7 T;  4AQF C;  1XDO A;  4O4I E;  4PAG A;  3ANW B;  2BG9 C;  2AXD S;  5F3J A;  3P8C D;  3BQL A;  5JTG A;  5L47 A;  5FYM A;  3RLF F;  3CQG B;  3MK7 C;  2HPL A;  2IUB A;  3ZYM A;  1QUU A;  3HA4 A;  1AJ3 A;  3O9X A;  4IHJ E;  3GA8 A;  2VKD A;  3LK4 2;  4EXT A;  4JI6 T;  2IML A;  4JYA T;  3GN5 B;  3C51 A;  2YU1 A;  1M7K A;  3PDY A;  5C2T A;  3ONX A;  3EAM A;  2YKS A;  4B6X A;  3ZEF B;  5DAB A;  4TUY E;  5LXT E;  3C98 B;  2XUE A;  2E2A A;  5JDQ A;  2JRK A;  2CEA A;  4ZXL A;  4L0R A;  2XAJ B;  2KSR A;  1UCU A;  3JAE A;  2DWG A;  2XAG B;  4UR9 A;  5FY7 A;  3PE0 A;  5LMU T;  5BMV E;  3B57 A;  4AKR B;  3SRZ A;  4U7Y A;  1OED C;  3RIU A;  1ZKE A;  2CE7 A;  2K3W A;  4CXW A;  4KHZ F;  3ZLI A;  4HWH A;  3ZYL A;  3PUA A;  5CFB A;  4IE7 A;  5LJM A;  4YFS A;  2Q9Q C;  2E9X A;  3PUX F;  5AQT B;  3KVA A;  3W15 B;  4AKH A;  5L3C B;  4DV2 T;  4BAY B;  4CN6 A;  4HFV A;  1H7C A;  4ZZB A;  5A1L A;  2VKH A;  5HAX A;  2BS2 A;  4JI3 T;  2J4G A;  1QSD A;  3I9Y A;  4OYK A;  3VRB A;  2PBI A;  4YLH A;  4H9S E;  5ABH A;  5JDL A;  1KEY A;  3RHW A;  4IDP A;  3C64 A;  5CGM A;  4AKL A;  4CI3 B;  3ESL A;  3HI2 A;  2ZM8 A;  4LFA T;  3ZCI A;  3LBX B;  4X66 T;  5BR8 T;  4NUV A;  4WZX A;  4CXY A;  3AVR A;  1XWM A;  2J1D G;  3ABV A;  3FHN A;  3PUQ A;  2JQK A;  3P7I A;  1LRZ A;  4ADZ A;  5HEJ A;  5JDN A;  3RPU A;  4MHC A;  2FUP A;  5GON E;  3ETU A;  4JI2 T;  4X1K E;  2L3L A;  1D1C A;  3C4X A;  3ZYK A;  4N78 D;  3UQ7 A;  4AI6 A;  4QWN B;  4LF7 T;  3EUH A;  2W4X A;  4JLE A;  5LA6 E;  1ZP0 A;  4GK5 E;  3FBZ A;  4JBW F;  4Z91 A;  2WP9 A;  2UXD T;  4LF5 T;  4L9I A;  3H3M A;  4GKK T;  2X51 A;  3E22 E;  3VKG A;  4P1N A;  3UU4 A;  4IE6 A;  5JR9 A;  3N9N A;  3B13 A;  2IC9 A;  3CX7 B;  2UXX B;  5AQM B;  1Y64 B;  2FJD A;  5L3E B;  1YD8 G;  3PUV F;  5HWY A;  4DMV A;  4NIQ A;  3T8O A;  4JI5 T;  2KND A;  2D0T A;  1YQ4 A;  4PFP A;  5FY1 A;  3ZJ1 A;  4B3M T;  2WMN A;  4JI4 T;  4TNV A;  2YDQ A;  2DLR A;  5TAO A;  5LGN B;  3UQ4 A;  4U74 A;  2NW8 A;  4U72 A;  2VVN A;  2A2F X;  4DR2 T;  2XQ4 A;  2LOP A;  4DR1 T;  3RKG A;  1L0V A;  3LJC A;  2BZB A;  2E9X B;  4P0A A;  3ZN0 B;  1YXR A;  4ZOL E;  5C8Y E;  1LVK A;  5LOV E;  4OK0 A;  5EK2 A;  3B5M A;  4DUZ T;  2HH7 A;  3AE2 A;  1WR0 A;  1FEW A;  2V8S V;  2XZE A;  4C90 A;  3E0Z A;  2WCA A;  1GQE A;  4GOU A;  5HXS A;  4ZEY A;  1Z8U A;  2XJ7 A;  3MKD A;  2B1E A;  5H6R B;  2LT3 A;  4P0B A;  4DV3 T;  2Z6E A;  2KXP B;  3D0T A;  1MIW A;  2G0U A;  2I59 A;  2DNX A;  5LGU B;  3UT5 E;  3EDV A;  1IJ6 A;  2CHN A;  4U31 A;  4GYR A;  2N2N A;  1X9B A;  4U7I A;  4ZI2 D;  5FXV A;  2W67 A;  4EZH A;  3RI5 A;  3P4Q A;  2ZM6 T;  4H9P C;  2X67 A;  2VAS A;  3ZC1 A;  3ZJ2 A;  4HTE A;  2V7J A;  4GIW A;  5EK3 A;  2MBG A;  4YTN A;  4DBQ A;  4Z90 A;  4IDO A;  4B3T T;  1MMG A;  3UUN A;  2V7M A;  2L8K A;  3VU7 H;  2D0U A;  3H3A A;  2XQ7 A;  2E9X D;  2XQY A;  3Q9D A;  4I4T E;  2K5B B;  2NW9 A;  5HXC A;  1KNP A;  4B3R T;  4ILU A;  3VR8 A;  4J2C A;  1JNZ A;  2X0L B;  2E5L T;  3T1Y T;  2LM2 A;  3O4X E;  3AEC A;  5JR9 B;  1MIY A;  2Y6X A;  3V5U A;  5HXH A;  2MYS A;  3FZM B;  2VQE T;  4TZ4 C;  3ZSS A;  1CHU A;  3L8R A;  4AKI A;  5LMN T;  3ZT5 A;  3RC3 A;  2UUB T;  2EHO D;  3N2K E;  3ONL C;  2DWK A;  3OPC A;  4X20 E;  4AKG A;  4COF A;  1ZHC A;  3PUW F;  1T98 A;  3N9O A;  3T1H T;  3AEG A;  3EI0 A;  2C5J A;  4X1Y E;  1M62 A;  3QUJ A;  4E7Z A;  4TV8 E;  2YDR A;  2UU9 T;  2MAW A;  2ODU A;  3QOF A;  5JDM A;  2I6H A;  4DV6 T;  4PW8 A;  3RIF A;  5DJQ C;  4XZC A;  2ZLY A;  2ACX A;  4DR5 T;  4G63 A;  4ILC A;  1VRB A;  3QK6 A;  3X1D A;  2CBJ A;  4BA9 A;  5LG4 A;  2JQQ A;  3AA6 B;  2GK9 A;  3A8Y C;  4YTM A;  1N36 T;  3QB5 A;  4KMC A;  4DV7 T;  3CML A;  1O3X A;  3QC9 A;  2WB5 A;  3O1I A;  4ASK A;  2DHR A;  2A3D A;  2UXB T;  2H7O A;  4K0K T;  4UVB B;  1S94 A;  2LSG A;  1D1B A;  3FXE B;  4LFB T;  5L3B B;  4U3C A;  3CX8 B;  3AA7 B;  2ACZ A;  3N5L A;  4LML A;  5ABF A;  2LEH A;  2YOE A;  2RPA A;  5JRC A;  3IF8 B;  4UVA B;  1VOM A;  2UXC T;  3RRC A;  4KX6 A;  1W0B A;  2CLY B;  3LFM A;  1MMD A;  1HS7 A;  4ZI3 D;  3G06 A;  2D5U A;  5AQR B;  3K3Q C;  5AQH B;  3L39 A;  5FY0 A;  3J9X 1;  4UIG A;  3PTR B;  3ZST A;  5IWA T;  3Q5D A;  3TLS A;  4H63 H;  1HNX T;  4HFD A;  2DCF A;  5ADX L;  5H6Q B;  4EYY R;  4CZZ B;  5L4E A;  3QNU A;  2BBJ A;  3KBU A;  4KI0 F;  3M65 A;  4HFI A;  5LHG B;  4AQG A;  1YKH B;  3NRY A;  2NOX A;  1NAF A;  4YTP A;  2KZ7 B;  1U4Q A;  4ILB A;  4JI8 T;  2KIN B;  1HTJ F;  3P50 A;  3RQU A;  3NZQ A;  2CBI A;  2WBL A;  3IEE A;  5KXJ A;  4HFB A;  2LE8 A;  4EAH A;  4KUM B;  3LG7 A;  4DVD A;  4DBR A;  4EED A;  3EAB A;  3UU8 A;  3UFE A;  1ZEE A;  1IBL T;  3KVB A;  5IYZ E;  4EV6 A;  3AE1 A;  4TX5 A;  3NBX X;  3RKO A;  5LGT B;  2UUA T;  3WAJ A;  3FZK B;  3RQW A;  1XNR T;  3UU6 A;  2M6I A;  3AE7 A;  5L3F B;  2Q9Q D;  3ZKR A;  4JV5 T;  2J47 A;  2HHH T;  2W0G A;  5L3D B;  3AE9 A;  4PJJ A;  4P09 A;  4DND A;  4I50 E;  1HFA A;  3ZC0 A;  2W62 A;  2MOZ A;  4YJ3 E;  5LB7 B;  3UUL A;  4GKJ T;  2RA1 A;  2WAU A;  1T8B A;  4E7S A;  2EHO A;  5CB4 E;  1ZV4 X;  2Y48 B;  2CWY A;  2CM0 A;  2XQ5 A;  2E5V A;  2IHR 1;  1HCI A;  2V1D B;  3ZT6 A;  2N1G A;  5L2L A;  1G73 A;  2LSY A;  3KV9 A;  5AQN B;  4CXX A;  1UX4 A;  1W09 A;  5AQK B;  4HWC A;  4ANJ A;  3PV0 F;  1KK7 A;  2LJL A;  2VKJ A;  5J2T E;  5ABF B;  1HNW T;  5E0O A;  1D0Z A;  5JRC B;  4A98 A;  3C4W A;  2OLT A;  4QH1 A;  4EEB A;  2QYW A;  4CI1 B;  2WDQ A;  5LCY A;  2CXF A;  3CVR A;  4ZS2 A;  5JDF A;  3PUR A;  3UUM A;  3ZMU B;  3TLW A;  4H9Q C;  3ZT7 A;  3P4W A;  4IE5 A;  3LK3 B;  1QLB A;  1XMO T;  3WAK A;  4PK6 A;  4YHJ A;  5HCM A;  3IA3 A;  2XAQ B;  2XHE B;  4U2Z A;  2NR4 A;  1KNR A;  4H63 V;  4WW0 A;  4XAX B;  2AE9 A;  4YHH T;  2OV9 A;  5ETW A;  3OYX A;  3PUY F;  2IDO B;  5FXX A;  3N2O A;  4EZ4 A;  4PNI A;  3SOL A;  2DI4 A;  3KIN B;  2YK0 A;  3K8P C;  2B76 A;  2LRK A;  1VCS A;  3MXZ A;  3EHZ A;  3KBT A;  3FB2 A;  1SHZ C;  3PUG A;  4IST A;  4LF9 T;  4UVC B;  2WDV A;  4OFZ A;  2H88 A;  1X79 A;  2MTQ A;  2XM2 A;  4DR3 T;  4NXN T;  3K3O A;  4FJO A;  4AQF A;  1HG5 A;  2XTL A;  1MMN A;  5JDG A;  3PU8 A;  3JCF A;  2BG9 A;  4O2B E;  4K0U A;  2XY8 B;  3VKH A;  4PFO A;  3KDS E;  2CXL A;  4CI2 B;  2JMH A;  2LSJ A;  4QH5 A;  5AQF B;  5FXZ A;  2LOS A;  3GWH A;  1E2A A;  3NWI A;  4YSX A;  2NW7 A;  2CMR A;  1OXZ A;  2M67 A;  2BKO A;  3E08 A;  2WWU A;  4ZI7 E;  1IZN B;  2OA5 A;  4L5G A;  3RX6 A;  3FXD B;  2JQH A;  4JEH B;  2EHO B;  1WRD A;  4IIJ E;  4I55 E;  2LHN A;  2QA7 A;  2LSI A;  2YEV C;  3AB3 B;  2VVS A;  4O8S A;  4QXC B;  2A9U A;  3ZCJ A;  1US7 B;  3SFE A;  3K3N A;  1OED A;  3KV4 A;  3TKL B;  4ZI2 C;  2JPF A;  2W61 A;  4O4J E;  5KMG P;  4IL9 A;  4CN4 A;  2XQA A;  3NZP A;  1YW0 A;  2BKP A;  5LNK A;  3MZK B;  4AIU A;  2Q9Q A;  3RYF E;  2PFV A;  3VR9 A;  1JNR A;  3RIU C;  1UUR A;  4X64 T;  3CX6 B;  3N9M A;  2WQY A;  3MAC A;  3ANW A;  4O4L E;  5LBQ B;  3ZMT B;  4DO0 A;  2HN2 A;  3DP7 A;  3NVO A;  2I0M A;  4X1I E;  3NKZ A;  2NTX A;  3KFW X;  2E9X C;  4Q25 A;  4UEL A;  2VL0 A;  1E1H B;  3JAF A;  1UK5 A;  3J7Y q;  3Q5E A;  4TN7 B;  5L4H A;  2A72 A;  3AE8 A;  1E7P A;  2D9D A;  2WZH A;  1W0A A;  4HWI B;  1IBK T;  2BS3 A;  2C5K T;  3U3I A;  4PK4 A;  4WBN E;  4V1A v;  1J5W A;  3F57 A;  4MAL A;  4HWF A;  1KFY A;  2V6X A;  2LLY A;  3ZMS B;  1W9R A;  3AED A;  4ILA A;  2V26 A;  5JDH A;  1UX5 A;  5FL0 A;  2YIN A;  5FVL A;  2V7K A;  2X68 A;  3OYZ A;  2XAS B;  4QX7 B;  1WYC A;  4HGA A;  4YT0 A;  2XPK A;  3CPZ A;  2BG9 B;  1XMQ T;  2KLQ A;  3R84 B;  5FNV E;  2SPC A;  4LF8 T;  3N9P A;  2ES0 A;  5F8P A;  3EVY A;  2WU5 A;  2L9Q A;  3AEA A;  2LM9 A;  5AQV B;  2HN1 A;  5AQJ B;  3FZL B;  3GMI A;  1DU2 A;  1R8I A;  2X9Y A;  2XAH B;  2UUC T;  3VRA A;  2XQ3 A;  1FJG T;  5AQO B;  2DL1 A;  4Z8X A;  2HPJ A;  1J1J A;  4X65 T;  3EDU A;  4OX9 T;  3ZPO A;  1FMW A;  3QB5 K;  4U2Y A;  4LMJ A;  5FKY A;  5JR9 C;  2FJE A;  3RRW A;  2BS4 A;  4A56 A;  5ABE A;  1WFD A;  1YQ3 A;  4X5T A;  3TLU A;  2X66 A;  2C5I T;  3JC6 D;  3RIA A;  2JMK A;  4H9O C;  3RYI E;  4IE4 A;  1NEN A;  1OED B;  3BK9 A;  4BJN A;  1BR4 A;  4DV1 T;  3AE5 A;  2V7L A;  2ZM2 A;  3L3P A;  4UV9 B;  2BDE A;  2K24 A;  4ZI3 C;  2XAF B;  2Q9Q B;  1BR0 A;  5ABG A;  5L3G B;  3VHL A;  4DID B;  4YSY A;  1MIV A;  4A97 A;  4AIS A;  4IE0 A;  4DR4 T;  5CJ5 A;  5F5W A;  1ZOY A;  1LKX A;  3DJB A;  1MMA A;  2NWB A;  4PJL A;  2IAK A;  1UUS A;  3SS1 A;  1KNZ A;  4JUY A;  3MA9 A;  4IDQ A;  4ERR A;  3HKB E;  3BQI A;  5KDM C;  5J0Z A;  4QHO A;  4YJ2 E;  2NP9 A;  5LJN A;  3OVU A;  2Y8D A;  5EK4 A;  5AFU L;  4G2A A;  4QXB B;  3ZMZ B;  1WYB A;  2E8I A;  4O2A E;  2JJ9 A;  4CN1 A;  4JEU B;  2QRX A;  4NUU A;  1SUM B;  3UTK A;  4DV0 T;  1XNQ T;  2WY2 A;  3ZN1 B;  3FBL A;  4DR6 T;  3AE6 A;  3LK2 B;  2JIW A;  3UUX B;  4BJM A;  1N33 T;  3AVS A;  3V5S A;  3HKE E;  5AQS B;  5FXW A;  4AQY T;  2CLY C;  2W66 A;  2IW5 B;  3S4U A;  4IRE A;  4YXD A;  2R6G F;  4OYJ A;  4WBO A;  2CCQ A;  4TNW A;  5HXE A;  2UXN B;  4YSZ A;  4QX8 B;  1G8X A;  3PUZ F;  5AQI B;  3BQK A;  3K1S A;  1BR2 A;  3CQC B;  2V5D A;  2CXD A;  1WLX A;  5JH7 E;  4NPP A;  4AXP A;  3Q5W A;  2MPK A;  2XQ9 A;  3AEF A;  2PJQ A;  3IBP A;  4EB6 E;  4OHF A;  3C50 A;  1HNZ T;  5HEU A;  3AA0 B;  4NXM T;  2XM1 A;  2WZI A;  5AQQ B;  1NEK A;  3JAD A;  2BBH A;  1FMV A;  4IDN A;  2M6B A;  2K48 A;  1WR6 A;  2XSB A;  3AE4 A;  5HCJ A;  4DV5 T;  1T72 A;  2YU2 A;  3LDQ B;  4IL4 A;  4UF0 A;  2FBW A;  1FIO A;  3AAE B;  1N32 T;  3DTO A;  1J5E T;  5CA0 E;  4HE8 A;  2WSS V;  3H37 A;  3AXJ A;  2LSK A;  4QXH B;  3AA1 B;  5FVK A;  3O1H A;  5AQP B;  1BR1 A;  3MJX A;  4M1P A;  2WMO A;  2LKH A;  3TLV A;  4KP3 C;  3P4R A;  5CA1 E;  2W00 A;  3LSV A;  3P4P A;  3F31 A;  4A5X A;  4LF6 T;  3KV5 A;  2V7I A;  5IUX A;  2X0H A;  3UUB A;  4FI5 A;  1EZ3 A;  4EIW A;  3ETV A;  1HR0 T;  2LRL A;  3FZH B;  4TWD A;  4I0U A;  5AQU B;  3C4Z A;  5IHY A;  2JQ9 A;  4H9R C;  3KV6 A;  5C3J A;  2CHO A;  1SE7 A;  4MBQ A;  3Q5X A;  4DMW A;  1N34 T;  4HFH A;  3P4S A;  2PG8 A;  2WWV A;  2V6Y A;  1Y01 A;  2LKG A;  4LF4 T;  2F4V T;  4H9N C;  5EZY E;  2KWI B;  4EGW A;  3RF1 A;  4JI7 T;  3M3Z B;  3PUS A;  4QH4 A;  3UU3 A;  3PJA A;  4IGU A;  4IT4 A;  5J1G A;  1OWA A;  3AEB A;  4HWD A;  1I94 T;  1XDP A;  5LP6 E;  4IDZ A;  5M4Y A;  4UXN B;  3AAI A;  2X9W A;  2VUR A;  2CWO A;  2LHR A;  3PU3 A;  2BG9 E;  3RGL A;  1U5P A;  4X62 T;  4EYU A;  1V9D A;  4JI1 T;  4ZZC A;  2VWA A;  3HR0 A;  3I0Q A;  2VK9 A;  2FJB A;  3O1J A;  1VCT A;  4YY3 T;  3TLT A;  1MND A;  3ONJ A;  1SA0 E;  3SFD A;  2KWH A;  1Z0P A;  2X0Y A;  4UEM A;  5HEH A;  4HKA A;  3NRX A;  5KX5 E;  2H7V C;  3OJA A;  4B3S T;  3AAA B;  4UF0 B;  1IAP A;  3N2G E;  5JRE A;  1S35 A;  3CK6 A;  4WYV A;  2WU2 A;  1YKE B;  2WS3 A;  4TV9 E;  4KBM B;  1HX8 A;  5LHH B;  1LVF A;  3AXJ B;  1HG2 A;  1OED E;  3A7M A;  4QKN A;  2D2S A;  3CWZ B;  1HF8 A;  2FJA A;  2X9X A;  3CKD A;  5DQW A;  3AE3 A;  3FZF B;  5FP3 A;  3ZMV B;  4LMK A;  5JVD E;  3RYH E;  4KHP T;  5HEO A;  4PJM A;  4TWH A;  1B7T A;  3N9Q A;  4EOZ B;  3U78 A;  4HFE A;  4CQI A;  3RC8 A;  2WDR A;  1D1A A;  4ISS A;  3GN5 A;  5FMN A;  3HKD E;  2X9H A;  1UGO A;  1CUN A;  2IC6 A;  3UFG A;  3OKQ A;  2XSA A;  2EHO C;  2H89 A;  1HX1 B;  3I1A A;  3OTO T;  4GYS A;  2YN6 A;  2W2U A;  5LHI B;  1KF6 A;  4MLK A;  4LFC T;  4F8H A;  3WI3 A;  4I43 B;  4PJN A;  2KT9 A;  2ZMA A;  2NTY A;  2J62 A;  3PJA J;  4TWF A;  4ZHQ E;  3RH3 A;  2P9B A;  4C91 A;  2V6Y B;  2IIU A;  1T7S A;  5HXR A;  3L09 A;  3Q2M A;  2CPT A;  2CRB A;  1IJ5 A;  3RYC E;  2CA5 A;  4JI0 T;  5AQL B;  2VKO A;  4UV8 B;  5DQV A;  2BVM A;  4PK5 A;  5HWX A;  5AQG B;  4GK0 E;  2H3R A;  1IBM T;  5J2U E;  2VL8 A;  3AEE A;  2N9D A;  4HFC A;  3N9L A;  4ZS3 A;  3I0O A;  2KMF A;  5LG3 A;  2QGS A;  4DUY T;  4MFR A;  4HEA A;  3SWH A;  2XQ6 A;  3CQX C;  3IHR A;  3F2E A;  1NWM X;  2BVL A;  3UU5 A; 
#chains in the Genus database with same CATH homology
 4WBO A;  4EZ4 A;  2CCQ A;  4PNI A;  5HXE A;  2UXN B;  2V7M A;  4QX8 B;  1G8X A;  2L8K A;  3VU7 H;  2D0U A;  3SOL A;  4WNK A;  2DI4 A;  3I9W A;  2ZM0 A;  3LBX A;  3H3A A;  3BQK A;  2E9X D;  2RP4 A;  2XQY A;  3R6N A;  3KIN B;  1BR2 A;  3CQC B;  1MNE A;  2YK0 A;  2CXD A;  3K8P C;  3Q9D A;  4HN9 A;  4I4T E;  2K5B B;  3HKC E;  1WLX A;  3MXZ A;  5HXC A;  3JC6 C;  2NW9 A;  5JH7 E;  3KBT A;  3FB2 A;  4AXP A;  4F6R C;  1SHZ C;  3A5X A;  3Q5W A;  3PUG A;  4IST A;  4ILU A;  2C0S A;  2WM9 A;  2PJQ A;  3IBP A;  4J2C A;  4O4H E;  2X0L B;  4OHF A;  4UVC B;  3C50 A;  5LBM A;  4OFZ A;  4EB6 E;  5JQG E;  5LYJ E;  2K9A A;  1X79 A;  2MTQ A;  1D0X A;  2ODV A;  2W63 A;  3OBV E;  3AA0 B;  3HL6 A;  3O4X E;  3K3O A;  4FJO A;  4AQF A;  5JR9 B;  1HG5 A;  2XTL A;  1MMN A;  5JDG A;  1MIY A;  3PU8 A;  2Y6X A;  4O2B E;  4K0U A;  5HYA A;  3V5U A;  5HXH A;  3VKH A;  2MYS A;  4PFO A;  3KDS E;  1D0Y A;  2CXL A;  4TZ4 C;  4CI2 B;  1FMV A;  2VB6 A;  4AQF C;  4O4I E;  4PAG A;  3ANW B;  2JMH A;  4AKI A;  2LSJ A;  3RC3 A;  2K48 A;  5F3J A;  2EHO D;  3P8C D;  5FXZ A;  1WR6 A;  2LOS A;  3BQL A;  3GWH A;  3N2K E;  2DWK A;  5FYM A;  4X20 E;  4AKG A;  2YU2 A;  3CQG B;  3MK7 C;  1ZHC A;  4UF0 A;  4XBF B;  2HPL A;  1T98 A;  2NW7 A;  3N9O A;  1FIO A;  2CMR A;  1OXZ A;  3AAE B;  3ZYM A;  1QUU A;  3DTO A;  2C5J A;  4X1Y E;  3QUJ A;  3HA4 A;  2M67 A;  4E7Z A;  3E08 A;  2WWU A;  4ZI7 E;  5CA0 E;  1IZN B;  4HE8 A;  1AJ3 A;  2WSS V;  3H37 A;  2OA5 A;  4TV8 E;  3O9X A;  4L5G A;  3RX6 A;  4IHJ E;  3GA8 A;  3FXD B;  2VKD A;  3LK4 2;  4EXT A;  2LSK A;  3GN5 B;  3C51 A;  2YU1 A;  4QXH B;  4JEH B;  3AA1 B;  2EHO B;  1WRD A;  3O1H A;  2ODU A;  4IIJ E;  3PDY A;  3ONX A;  4I55 E;  2LHN A;  5JDM A;  1BR1 A;  2QA7 A;  2LSI A;  4B6X A;  3ZEF B;  3MJX A;  4M1P A;  2YEV C;  4PW8 A;  5DAB A;  3AB3 B;  4TUY E;  5LXT E;  2WMO A;  3C98 B;  2XUE A;  5JDQ A;  2JRK A;  2CEA A;  4KP3 C;  4O8S A;  4L0R A;  2XAJ B;  4QXC B;  3ZCJ A;  5DJQ C;  1US7 B;  3K3N A;  5CA1 E;  4XZC A;  1UCU A;  2DWG A;  2W00 A;  2ACX A;  2XAG B;  2ZLY A;  3KV4 A;  5FY7 A;  3TKL B;  4ZI2 C;  3PE0 A;  3F31 A;  2JPF A;  4G63 A;  1VRB A;  2W61 A;  3QK6 A;  5BMV E;  3B57 A;  4O4J E;  4AKR B;  4BA9 A;  3SRZ A;  3KV5 A;  5KMG P;  5LG4 A;  3NZP A;  1YW0 A;  2JQQ A;  1ZKE A;  2V7I A;  3AA6 B;  2GK9 A;  5LNK A;  2CE7 A;  3MZK B;  4CXW A;  4EIW A;  4FI5 A;  1EZ3 A;  2Q9Q A;  3ETV A;  4KMC A;  3RYF E;  2PFV A;  3ZLI A;  3CML A;  1O3X A;  3C4Z A;  3ZYL A;  3PUA A;  3QC9 A;  4IE7 A;  5LJM A;  5IHY A;  3O1I A;  4ASK A;  2DHR A;  3CX6 B;  2A3D A;  3N9M A;  4YFS A;  2Q9Q C;  2E9X A;  3MAC A;  2H7O A;  3ANW A;  4UVB B;  4O4L E;  4H9R C;  1S94 A;  3KV6 A;  5LBQ B;  2LSG A;  3ZMT B;  3KVA A;  4MBQ A;  4DO0 A;  3Q5X A;  3W15 B;  4DMW A;  3DP7 A;  1D1B A;  3FXE B;  4AKH A;  5L3B B;  4X1I E;  2NTX A;  3KFW X;  2E9X C;  4UEL A;  3CX8 B;  3AA7 B;  5L3C B;  2PG8 A;  4BAY B;  3N5L A;  4HFV A;  1H7C A;  1E1H B;  5A1L A;  2LEH A;  2VKH A;  5HAX A;  5JRC A;  3IF8 B;  4H9N C;  4UVA B;  1VOM A;  5EZY E;  3RRC A;  3J7Y q;  4TN7 B;  2CLY B;  3LFM A;  1QSD A;  2KWI B;  3I9Y A;  4OYK A;  1MMD A;  1HS7 A;  4ZI3 D;  2A72 A;  2PBI A;  4YLH A;  4H9S E;  2D5U A;  3K3Q C;  3PUS A;  2C5K T;  3U3I A;  4PK4 A;  5JDL A;  4WBN E;  5FY0 A;  3J9X 1;  4UIG A;  3PTR B;  4IGU A;  3C64 A;  1OWA A;  4V1A v;  5J1G A;  3F57 A;  4MAL A;  4AKL A;  5LP6 E;  4CI3 B;  4IDZ A;  3ZMS B;  3ESL A;  4H63 H;  5M4Y A;  3HI2 A;  2ZM8 A;  4UXN B;  3AAI A;  2X9W A;  2V26 A;  3ZCI A;  3LBX B;  2CWO A;  5JDH A;  2DCF A;  2LHR A;  5ADX L;  1UX5 A;  4NUV A;  5H6Q B;  2YIN A;  4EYY R;  3PU3 A;  4CZZ B;  2V7K A;  4CXY A;  3AVR A;  2J1D G;  3FHN A;  3KBU A;  1U5P A;  3M65 A;  2X68 A;  4EYU A;  1V9D A;  3PUQ A;  3OYZ A;  2XAS B;  4QX7 B;  5LHG B;  3P7I A;  2VWA A;  3HR0 A;  4AQG A;  3I0Q A;  2VK9 A;  1WYC A;  1LRZ A;  1YKH B;  3NRY A;  4HGA A;  4ADZ A;  2NOX A;  1NAF A;  5JDN A;  3O1J A;  3RPU A;  4MHC A;  3CPZ A;  5GON E;  3ETU A;  4X1K E;  2KZ7 B;  1MND A;  2L3L A;  1D1C A;  3C4X A;  2KLQ A;  3ZYK A;  3R84 B;  1U4Q A;  5FNV E;  1SA0 E;  4N78 D;  2SPC A;  2KIN B;  1HTJ F;  3N9P A;  2KWH A;  4AI6 A;  4QWN B;  1Z0P A;  3EUH A;  3NZQ A;  4JLE A;  2ES0 A;  5LA6 E;  4GK5 E;  5F8P A;  3EVY A;  4UEM A;  4HKA A;  2L9Q A;  2WBL A;  3FBZ A;  3NRX A;  3IEE A;  5KX5 E;  2LM9 A;  2LE8 A;  4EAH A;  2H7V C;  3GMI A;  3OJA A;  2X9Y A;  2XAH B;  4KUM B;  3LG7 A;  4L9I A;  4DVD A;  4DBR A;  2X51 A;  3E22 E;  3VKG A;  4Z8X A;  3AAA B;  2HPJ A;  4UF0 B;  1IAP A;  3N2G E;  3UFE A;  1S35 A;  4IE6 A;  1ZEE A;  5JRE A;  5JR9 A;  3N9N A;  3EDU A;  3KVB A;  3ZPO A;  3B13 A;  2IC9 A;  3CX7 B;  5IYZ E;  1FMW A;  2UXX B;  1YKE B;  4TV9 E;  4TX5 A;  3NBX X;  3RKO A;  5LGT B;  1Y64 B;  4KBM B;  5JR9 C;  1HX8 A;  3RRW A;  5L3E B;  5LHH B;  1YD8 G;  1LVF A;  3WAJ A;  1HG2 A;  5HWY A;  4QKN A;  2D2S A;  4DMV A;  4A56 A;  3CWZ B;  5L3F B;  2Q9Q D;  1HF8 A;  3T8O A;  2KND A;  2X9X A;  2X66 A;  2D0T A;  2W0G A;  3CKD A;  5L3D B;  5DQW A;  2C5I T;  3JC6 D;  4PFP A;  4PJJ A;  5FY1 A;  5FP3 A;  4P09 A;  4DND A;  2JMK A;  4H9O C;  4I50 E;  3ZMV B;  1HFA A;  3ZC0 A;  3RYI E;  3ZJ1 A;  2W62 A;  5JVD E;  2MOZ A;  4IE4 A;  3BK9 A;  3RYH E;  2WMN A;  4YJ3 E;  3UUL A;  4PJM A;  2RA1 A;  1B7T A;  4BJN A;  3N9Q A;  4EOZ B;  2WAU A;  2DLR A;  1BR4 A;  3U78 A;  4CQI A;  3RC8 A;  5TAO A;  2V7L A;  2ZM2 A;  5LGN B;  3L3P A;  1D1A A;  4ISS A;  3GN5 A;  4U74 A;  4E7S A;  2NW8 A;  4UV9 B;  2EHO A;  4U72 A;  2BDE A;  2K24 A;  4ZI3 C;  2XAF B;  2Q9Q B;  1BR0 A;  5L3G B;  5FMN A;  2A2F X;  5CB4 E;  1ZV4 X;  3HKD E;  3VHL A;  2LOP A;  2X9H A;  2Y48 B;  2IC6 A;  1CUN A;  2CWY A;  2CM0 A;  1MIV A;  3OKQ A;  3LJC A;  2EHO C;  2BZB A;  1HCI A;  4IE0 A;  2E9X B;  3I1A A;  2V1D B;  2N1G A;  5L2L A;  1LKX A;  3DJB A;  4P0A A;  3ZN0 B;  1G73 A;  4GYS A;  1MMA A;  2LSY A;  2NWB A;  4PJL A;  3KV9 A;  4ZOL E;  5C8Y E;  5LHI B;  4MLK A;  1LVK A;  4CXX A;  2IAK A;  1UX4 A;  3WI3 A;  4I43 B;  3SS1 A;  1KNZ A;  5LOV E;  4PJN A;  4OK0 A;  2KT9 A;  2ZMA A;  4JUY A;  5EK2 A;  2NTY A;  3MA9 A;  4ANJ A;  4ZHQ E;  2HH7 A;  1KK7 A;  3RH3 A;  2LJL A;  2VKJ A;  1FEW A;  4ERR A;  2P9B A;  4C91 A;  5J2T E;  4C90 A;  3HKB E;  3E0Z A;  3BQI A;  5E0O A;  5HXR A;  1D0Z A;  5JRC B;  4GOU A;  3C4W A;  5KDM C;  5HXS A;  3L09 A;  3Q2M A;  3MKD A;  4QHO A;  4CI1 B;  2B1E A;  5H6R B;  4YJ2 E;  5LCY A;  2LT3 A;  2NP9 A;  4P0B A;  5LJN A;  2Y8D A;  2Z6E A;  2KXP B;  5EK4 A;  3D0T A;  4G2A A;  4QXB B;  5AFU L;  3ZMZ B;  1MIW A;  1IJ5 A;  1WYB A;  3RYC E;  2CXF A;  3CVR A;  2CA5 A;  2G0U A;  2I59 A;  4ZS2 A;  5JDF A;  2DNX A;  2E8I A;  2VKO A;  4O2A E;  5LGU B;  3UT5 E;  3EDV A;  1IJ6 A;  3PUR A;  2JJ9 A;  4UV8 B;  3UUM A;  4GYR A;  2N2N A;  5DQV A;  2BVM A;  4JEU B;  3ZMU B;  4PK5 A;  5HWX A;  4GK0 E;  4ZI2 D;  4H9Q C;  4NUU A;  5FXV A;  4EZH A;  3UTK A;  2H3R A;  4IE5 A;  5J2U E;  2VL8 A;  3LK3 B;  3ZN1 B;  3FBL A;  4H9P C;  3WAK A;  2N9D A;  2X67 A;  3LK2 B;  4PK6 A;  4YHJ A;  3UUX B;  4BJM A;  3AVS A;  2VAS A;  3N9L A;  3V5S A;  4ZS3 A;  3HKE E;  3ZC1 A;  3ZJ2 A;  4HTE A;  3I0O A;  2XAQ B;  2V7J A;  2KMF A;  2XHE B;  2QGS A;  4GIW A;  5EK3 A;  2MBG A;  5FXW A;  2CLY C;  4H63 V;  4MFR A;  4WW0 A;  4HEA A;  4XAX B;  2IW5 B;  4DBQ A;  3S4U A;  3SWH A;  5ETW A;  3OYX A;  3CQX C;  3IHR A;  1MMG A;  3F2E A;  5FXX A;  1NWM X;  4OYJ A;  3N2O A;  2BVL A;  3UUN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...