4L0RA

Crystal structure of fgf2-interacting protein from homo sapiens. northeast structural genomics consortium target hr9027a.
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
74
structure length
74
Chain Sequence
GINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Centrosomal protein of 57 kDa
publication title Crystal structure of FGF2-interacting protein from Homo sapiens. Northeast Structural Genomics consortium id HR9027A
rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 34
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06657 Cep57_MT_bd Centrosome microtubule-binding domain of Cep57
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4l0rA00
1ZKEA 2MBGA 1Z0PA 2C5JA 3FXDB 3P7IA 1LRZA 2G0UA 1IJ5A 2KWIB 4J2CA 3CVRA 3L3PA 4CQIA 3MXZA 1QSDA 4EYYR 3TKLB 4B6XA 2KWHA 2IC9A 3CKDA 2C5IT 2XTLA 2IC6A 1H7CA 4FI5A 2X9WA 2X9YA 4DNDA 2CA5A 1IJ6A 4L0RA 3QUJA 3N5LA 3S4UA 3QK6A 2K48A 3FXEB 2X9XA 1LVFA 2C5KT
chains in the Genus database with same CATH superfamily
5JVDE 4LF9T 4EIWA 3GN5A 2E9XB 2XAFB 4YSXA 1D1CA 2WZIA 3UUXB 1O3XA 5KDMC 3ZC1A 3RLFF 5AQOB 5L2LA 5FP3A 1BR1A 4DR6T 5LBQB 3SS1A 3RGLA 3TLWA 5KXJA 2WB5A 3GMIA 4UIGA 5FXZA 4TN7B 4ZZCA 2J4GA 2P9BA 3UUNA 3CWZB 4XZCA 1MMNA 3ZN1B 3LSVA 5LHHB 5KMGP 1HF8A 2L8KA 2V7JA 3A7MA 3ETVA 4MALA 4PAGA 2YEVC 2L3LA 1E2AA 2YN6A 3FZKB 4IDNA 3ZN0B 2YOEA 3VHLA 2B1EA 3ZYMA 4YSZA 3QNUA 2JQQA 2V5CA 5CA0E 2X9YA 2W2UA 2XZEA 4MHCA 5CJ5A 4TWFA 2XQ9A 4ZS2A 3U3IA 2V7LA 1HNZT 2Y48B 5HYAA 5FXVA 2KINB 5LNKA 5FKYA 3ZMVB 3RYFE 3HKDE 1OEDE 1BR0A 2V5DA 4HFHA 3O1JA 3OYXA 4EEBA 3UFGA 3RF1A 3AE7A 4IL9A 2WQYA 3J7Yq 3P50A 4H9RC 3FBZA 5CGMA 3BK9A 4UVBB 2XQ6A 5HXCA 3K1SA 3ZYLA 3QB5A 2CBIA 3VRBA 4KHPT 1OEDC 1VCSA 1R8IA 2BG9E 3T8OA 3KV5A 4H63H 1UUSA 3LJCA 4TV8E 1UK5A 3AAEB 3A8YC 4QH1A 4PNIA 4X66T 3AAIA 4I43B 4IDPA 5L3BB 3RKGA 2IW5B 2L9QA 4HE8A 1OEDB 3B57A 4G63A 3FBLA 3ZLIA 5C3JA 4UV9B 2WWVA 2M6IA 3KBTA 2IC6A 2X9HA 4EEDA 2BG9C 5F8PA 4LMKA 5L3EB 2WSSV 4PJNA 2XAQB 3JC6C 2JQHA 1T98A 2XQYA 2BG9B 5AFUL 4DR2T 3KV9A 4ZI2D 1KEYA 5AQQB 2M6BA 5LCYA 3N9OA 3HKEE 3FXDB 4TWHA 4AQGA 2IIUA 3HA4A 3LK2B 5LA6E 2IUBA 4QX8B 4EZ4A 2BVLA 2WM9A 3D0TA 3PDYA 4V1Av 2LLYA 1US7B 2X51A 4U31A 4QHOA 2NWBA 2LEHA 4HWDA 2D9DA 2VASA 4CXXA 4TUYE 4I4TE 3AE9A 3WAKA 5AQGB 4HFEA 4IREA 5LBMA 2K3WA 2ZM2A 4PJMA 3C50A 4UF0A 5TAOA 5FVKA 3B13A 2JJ9A 5JR9C 2KZ7B 2VL8A 4H9NC 2WWUA 3PUQA 4AKIA 3EAMA 4AI6A 5JR9B 4DV6T 2H3RA 3E0ZA 3AEEA 2VB6A 5AQVB 4ISSA 5JRCA 4K0UA 1U4QA 2V8SV 3NRYA 1HCIA 1IZNB 4ILBA 4AKHA 5LMUT 2VQFT 2KMFA 2Q9QA 3FHNA 5AQSB 3C4ZA 1IAPA 4LF8T 4BA9A 3O1IA 2HN2A 2H7VC 4HEAA 3MZKB 1QLBA 4AQFC 3ZMSB 2XM1A 1CHUA 3MACA 3EABA 1WLXA 4TZ4C 4UVCB 1VRBA 1E7PA 4Z8XA 2N9DA 1ZP0A 2JRKA 1MIWA 2JIWA 4LF7T 4AISA 2HPJA 1HFAA 4QXHB 2VK9A 1XNRT 4PK5A 3ZEFB 3GN5B 2KT9A 2YDRA 4CQIA 2ZM6T 4NXMT 4E7ZA 1IBKT 3LFMA 2LSIA 2CRBA 2WMNA 4DR5T 5AQNB 3X1DA 4E7SA 4HKAA 1FJGT 4GOUA 1SHZC 2DWKA 4CN6A 3CQGB 4LFBT 3QC9A 5JDFA 3EDVA 5FL0A 2XAJB 2OLTA 4U2YA 4P0AA 2XSAA 1XZYA 5LP6E 3N9PA 2QA7A 3E22E 1YQ4A 2FUPA 4I55E 4IL4A 4ZI3C 4B3RT 5L3CB 4KBMB 4CI1B 4H9OC 1HNWT 1D1AA 4J2CA 5DQWA 4YY3T 2LRKA 4JV5T 4ISTA 2UUAT 3CQXC 3ESLA 4JYAT 4L9IA 3ZSSA 1KNPA 3OYZA 2C5JA 2UXCT 2H88A 3RIAA 2AXDS 3MK7C 3BQLA 2WDQA 1KK7A 3RYIE 3MXZA 5ETWA 5DABA 3AEBA 4COFA 3Q5XA 1KNZA 2LSKA 3VR9A 1S35A 5A1LA 2X9XA 5AQUB 1MMGA 3AE4A 2YU1A 1KNRA 2WS3A 2K9AA 4DMVA 2I59A 4FJOA 4JI0T 4LF5T 2XPKA 4U2ZA 3C64A 4F8HA 5HEJA 5LGNB 3P4RA 4IE0A 2CLYC 4IGUA 4OK0A 4HWIB 2LOSA 4AQYT 4GYSA 3ZJ2A 1WR0A 2X68A 2XHEB 2YU2A 1LVKA 1BR2A 2CLYB 4I50E 2WAUA 4KI0F 4C91A 4ERRA 1N34T 3AA1B 5AQMB 3OKQA 2NTXA 4OFZA 4UEMA 1D0XA 5M4YA 2KNDA 3E08A 3RYHE 5BMVE 1FIOA 2UU9T 2LSYA 1IBMT 4O4LE 3DP7A 5HEUA 4L5GA 4PK6A 4TNVA 2NW8A 4DV7T 2RP4A 4UXNB 1I94T 1FMVA 2WDVA 2J62A 5HWXA 2E9XD 5IHYA 3ZT6A 5J0ZA 5ABFA 1YW0A 4B3MT 1U5PA 2W61A 4H63V 4DV3T 1UX5A 3NBXX 1X79A 3AA0B 4PFPA 4NIQA 3MJXA 2CXDA 2ZLYA 2W67A 2CPTA 4O4IE 1X9BA 4UR9A 3LBXA 4FI5A 1W09A 5FMNA 3CPZA 3OBVE 5FVLA 1HG2A 5C8YE 2J47A 2I0MA 4UF0B 2YINA 2PJQA 4GK0E 2LHNA 1HNXT 1XNQT 2X0YA 3ZCIA 4MFRA 4ASKA 3PUZF 4H9QC 2V26A 3UU8A 5LYJE 2CEAA 1N36T 3PUVF 3Q2MA 1VOMA 1KFYA 3IEEA 5JREA 2XASB 3RIUA 1ZKEA 4IIJE 2CBJA 3M65A 2XUEA 3OPCA 4YJ2E 2BKOA 5AQJB 2Q9QC 2JMKA 3N5LA 3N2GE 5L3DB 3F31A 4JEHB 4IE5A 2JQKA 3F2EA 3U78A 4HWCA 2Q9QB 4WZXA 4LF4T 3ZPOA 4DV2T 2NP9A 3LDQB 4ZS3A 3I0QA 3EVYA 5LB7B 2EHOA 3W15B 2DWGA 3KVBA 2DCFA 2VURA 3RKOA 1LRZA 2YDSA 2E8IA 4HN9A 3IBPA 3TLSA 2V7IA 1V9DA 2X0HA 4YHHT 3SFDA 1T8BA 3HKBE 2UUBT 5DJQC 4H9PC 2WBLA 3TKLB 2YK0A 4HWFA 4X65T 4ZOLE 3H3MA 3AXJA 4ZXLA 5LXTE 3ZMZB 2NOXA 3VKGA 2IAKA 2XY8B 4TNWA 5ADXL 4JI8T 2BS3A 3UU5A 5EK2A 3RRWA 3JADA 1NAFA 4P09A 1G73A 4O8SA 1N33T 2FBWA 4YLHA 3AEFA 3S4UA 2ACXA 5LG3A 5LMNT 5AQKB 4AXPA 4QH4A 2VL0A 4EOZB 1S94A 1OXZA 1QSDA 2XAGB 3EHZA 2WMOA 3NKZA 1T72A 5HXRA 5LGUB 2VKHA 2K48A 2ES0A 1SE7A 5E0OA 3AA7B 3N9MA 3AAAB 5JH7E 2IHR1 1W0BA 2CXFA 3RRCA 4ZEYA 3FZLB 3ABVA 5HXEA 3VU7H 2UUCT 2ZM8A 3PTRB 4M1PA 3IHRA 4PK4A 1J5ET 3RX6A 5FY0A 3Q9DA 4IDOA 5HCJA 2V7KA 4LFCT 1D0YA 4F6RC 4HTEA 5JDMA 3RC3A 2LKHA 1SUMB 5AQFB 1N32T 4CI3B 3Q5DA 2E2AA 3QUJA 3ZMUB 5LHIB 4EB6E 4IE4A 2KWIB 2E5LT 2DL1A 2N2NA 2PG8A 4DVDA 4X5TA 5H6RB 3P8CD 5AQHB 2XQAA 4DBRA 5EK3A 2ODVA 3C4WA 2X66A 5LGTB 5JDQA 3HL6A 5L4HA 1JNZA 5FL1A 3JCFA 1MNEA 4DV0T 2XM2A 3UUBA 3UTKA 3UULA 5LJNA 3VKHA 4LMLA 3VR8A 2MPKA 1XDPA 4CXWA 3I1AA 4B6XA 3UU3A 3ANWB 2CE7A 2LM9A 2NR4A 3AE8A 3N9NA 2ACZA 2WZHA 4UVAB 5L3FB 3ZT5A 5HEGA 4Z90A 3DTOA 4U72A 4GKJT 4OYKA 2G0UA 3PU3A 2PBIA 2K24A 3P4PA 5JDNA 2BG9A 4WW0A 3AB3B 3I0OA 3CIRA 3PU8A 3DJBA 3RIFA 4YT0A 4QX7B 3EDUA 3LBXB 3PUXF 4B3ST 2LOPA 3ZKRA 4JLEA 4O4HE 3O1HA 3RC8A 2IDOB 3M3ZB 2D0TA 4YHJA 2XQ5A 5AQPB 3VRAA 4C90A 3RIUC 2WU2A 3RPUA 3R84B 4I0UA 1YXRA 2CHOA 3J9X1 2PFVA 4UV8B 4IT4A 3NVOA 4U33A 2XQ7A 4ZI3D 4EZHA 3ONLC 3AEAA 4JI6T 2ODUA 5L47A 1Z8UA 5HCMA 4PFOA 2CXLA 4ZHQE 4EXTA 2LT3A 2Y8DA 3RH3A 3FXEB 5CFBA 2EHOC 4O4JE 2CCQA 4H9SE 3AEDA 3ONJA 4YTPA 4DIDB 5LG4A 2W66A 3NZQA 4EYYR 3ETUA 5AQIB 1IBLT 3KINB 1MIVA 2EHOB 4KHZF 3OJAA 1ZV4X 3PURA 1NENA 1ZHCA 3ZJ1A 1Y64B 4Q25A 2V6YA 4GKKT 2UXNB 4NXNT 2W62A 2A3DA 4LFAT 5EZYE 1VCTA 2XTLA 2VWAA 3Q5EA 4QXCB 3UU6A 4EYUA 1XWMA 4EAHA 3KBUA 4DV5T 2LRLA 1UURA 2BKPA 4IHJE 3P4SA 3C4XA 3AVRA 3AXJB 4ILUA 5GONE 3L09A 3CKDA 5IYZE 2LJLA 3AE5A 4A56A 1MMAA 2DLRA 2H7OA 3AE2A 2ZM0A 4BJMA 4X62T 2D2SA 4IDQA 1L0VA 2V6XA 3O9XA 1Y01A 3UQ4A 1UCUA 4A97A 3F57A 2N1GA 1M62A 3GWHA 2E5VA 2SPCA 4TWDA 4OYJA 4O2BE 3N9LA 2CWYA 4AKGA 4IE6A 3GA8A 4WBNE 1UX4A 5BR8T 3UT5E 2NW7A 2IC9A 3KV6A 4TV9E 4DNDA 3TLVA 2XQ8A 2GK9A 4MBQA 1LVFA 1YKEB 1XMOT 2X67A 3N2OA 1YKHB 4KUMB 2WCAA 3SRZA 4YSYA 2XQ4A 3N2KE 5L3GB 3RQWA 2HHHT 2X0LB 2IMLA 2JQ9A 3OVUA 4U7YA 1M7KA 1YQ3A 4ILAA 2BS2A 3LK3B 2W0GA 2JMHA 2LE8A 2HN1A 1UGOA 5JRCB 1WRDA 4YFSA 4CN4A 4HFVA 5IUXA 5J1GA 2CHNA 4JI5T 2VKJA 2VKOA 5FNVE 3K3NA 5LHGB 1D1BA 2V1DB 3G06A 1QUUA 4JI7T 2HPLA 3FZFB 4X1YE 4DBQA 2BKNA 3CX6B 5KX5E 4EGWA 3NRXA 2J1DG 2MYSA 3Q5WA 4GK5E 3ONXA 2Q9QD 3PUAA 3V5UA 3CMLA 5JQGE 2F4VT 4JUYA 4MLKA 3I9YA 3P7IA 2VVSA 4QKNA 4ADZA 2ZMAA 2BBHA 2BS4A 4DR3T 1EZ3A 4JI3T 5F3JA 2MAWA 5AQRB 2Z6EA 3PJAJ 2I6HA 4HWHA 1BR4A 4KMCA 2BBJA 2MBGA 3K3QC 2K5BB 5H6QB 1XDOA 2A9UA 3T1HT 2AE9A 2FJDA 2LSJA 2MOZA 4ZI2C 2DNXA 2CMRA 3LG7A 4QH5A 4DO0A 3BQIA 3ZC0A 3SOLA 2OA5A 4WNKA 1WYBA 1E1HB 5FXWA 3JAEA 3ZSTA 3JC6D 1T7SA 2DHRA 1NEKA 5FYMA 2YKSA 1HS7A 1W0AA 5J2UE 4YTMA 1HTJF 3C98B 2QGSA 4NUVA 5FY7A 1HR0T 3L39A 2YDQA 3PUGA 3P4QA 4NPPA 2E9XA 2CWOA 4BAYB 4YJ3E 4G2AA 5IWAT 1B7TA 4HFBA 4PJJA 4L0RA 5DQVA 4JEUB 4DUZT 2KLQA 5FY1A 4CI2B 3WI3A 3ZT7A 2D5UA 3CX8B 4X20E 4ILCA 3FB2A 4DR4T 1AJ3A 4K0KT 3RHWA 4YXDA 3MA9A 3AE3A 5HAXA 3ZCJA 5CA1E 4U3CA 2WY2A 5LJMA 3I9WA 4O2AE 4GIWA 2KXPB 4CZZB 3EI0A 1OWAA 4N78D 2MTQA 3K3OA 1LKXA 1HX8A 5JTGA 1MNDA 1WR6A 3B5MA 4BJNA 4QWNB 2PTFA 1HG5A 1JNRA 3NZPA 5HWYA 1FMWA 2BZBA 2D0UA 4B3TT 4UELA 3K8PC 5HXSA 3R6NA 2X9WA 4P0BA 2DI4A 3IA3A 3TLTA 3O4XE 3RI5A 2V6YB 2XAHB 2W00A 2BDEA 4JI1T 3H3AA 4LMJA 5ABGA 3AE1A 4U7IA 1ZOYA 4PJLA 3PE0A 3SFEA 3CQCB 2KSRA 5EK4A 2XJ7A 1I6ZA 2V7MA 1KF6A 1DU2A 2OV9A 2VQET 3QOFA 4XAXB 4YTNA 2UXBT 4KX6A 3BQKA 4JI2T 5AQTB 4A5XA 5ABHA 2QYWA 4DUYT 3SWHA 1OEDA 3V5SA 2A2FX 4GYRA 4P1NA 3HKCE 3H37A 2FJEA 2H89A 4WYVA 3KV4A 4XBFB 4OX9T 3EUHA 4DR1T 4HFIA 3PUWF 2W63A 3L3PA 2NW9A 2QVAA 3FZMB 4X1KE 2KWHA 3C51A 5ABFB 3UFEA 3RYCE 2RA1A 4LF6T 4EV6A 1NWMX 3UQ7A 2BVMA 4ANJA 2RPAA 1ZEEA 3PUYF 1J1JA 1CUNA 4JBWF 3HR0A 3AE6A 5J2TE 3HI2A 1YD8G 4IE7A 2LHRA 3IF8B 2VKDA 5ABEA 3A5XA 5FXXA 2C5IT 1J5WA 5AQLB 3OTOT 4ZI7E 3QK6A 4Z91A 4U74A 4X1IE 5HEHA 1Z0PA 4DMWA 1WCRA 2WDRA 3NWIA 3ZMTB 3AECA 3PV0F 4A98A 4HFDA 2R6GF 2VVNA 3TLUA 1IJ6A 4JI4T 4WBOA 5L4EA 2LSGA 1D0ZA 3FZHB 5C2TA 2C5KT 3KVAA 3JAFA 1SA0E 5JDHA 5HEOA 5JDGA 1H7CA 2WP9A 4CN1A 2M67A 4HGAA 1HX1B 5JDLA 1WFDA 2W4XA 3ZYKA 4X64T 5JR9A 3P4WA 5LOVE 1FEWA 3KFWX 5HXHA 4PW8A 2B76A 4AKLA 3UUMA 3PUSA 3UU4A 3CK6A 2CM0A 1MIYA 2EHOD 4DR7T 1XMQT 2C0SA 3CVRA 1GQEA 2LM2A 3CX7B 3MKDA 4HFCA 5F5WA 4CXYA 3N9QA 2QRXA 4IDZA 2WU5A 2XSBA 3KDSE 3PJAA 3AA6B 4DV4T 1W9RA 2LKGA 2JPFA 5CB4E 3RQUA 1G8XA 2UXDT 2XQ3A 2FJBA 4AIUA 2HH7A 3L8RA 2CA5A 2UXXB 4QXBB 3AVSA 4DV1T 1WYCA 1MMDA 4AKRB 2NTYA 4TX5A 4ZZBA 3T1YT 1IJ5A 3AEGA 4AQFA 3WAJA 2E9XC 4KP3C 3LK42 3QB5K 3ANWA 2A72A 2Y6XA 4NUUA 2FJAA 4OHFA
chains in the Genus database with same CATH topology
5JVDE 2MBGA 5L3CB 4EIWA 4KBMB 3GN5A 2E9XB 3K3QC 2K5BB 4IE4A 2XAFB 5H6QB 4H9OC 1D1CA 4CI1B 2KWIB 3UUXB 1D1AA 1O3XA 4J2CA 5DQWA 5KDMC 3ZC1A 2LSJA 2MOZA 4ZI2C 2DNXA 5L2LA 5FP3A 4ISTA 1BR1A 5LBQB 2CMRA 3SS1A 2N2NA 2PG8A 4DVDA 3LG7A 3GMIA 3CQXC 3ESLA 4DO0A 4L9IA 4UIGA 3BQIA 3ZC0A 5H6RB 3OYZA 3P8CD 5FXZA 4TN7B 3SOLA 2C5JA 2OA5A 2P9BA 3UUNA 4WNKA 4DBRA 1WYBA 1E1HB 3C4WA 2ODVA 2X66A 5EK3A 3MK7C 5LGTB 3BQLA 5JDQA 3CWZB 5FXWA 1KK7A 3HL6A 4XZCA 3RYIE 3MXZA 1MMNA 3JC6D 3ZN1B 5ETWA 2DHRA 5DABA 5FYMA 5LHHB 5KMGP 1MNEA 3Q5XA 1HS7A 1HF8A 2L8KA 2LSKA 1KNZA 2V7JA 3ETVA 4MALA 5J2UE 1HTJF 1S35A 5A1LA 4PAGA 3UTKA 2YEVC 3UULA 2X9XA 3C98B 5LJNA 3VKHA 2L3LA 1MMGA 2QGSA 4NUVA 3ZN0B 5FY7A 2YU1A 3VHLA 2B1EA 2K9AA 3PUGA 4DMVA 3ZYMA 2I59A 4FJOA 2E9XA 4CXWA 2CWOA 4BAYB 3I1AA 2JQQA 4YJ3E 4B6XA 4G2AA 3ANWB 2CE7A 3C64A 5CA0E 2LM9A 1B7TA 2X9YA 4PJJA 3N9NA 4L0RA 4UVAB 5DQVA 5L3FB 5LGNB 4MHCA 4IE0A 4JEUB 3DTOA 4ZS2A 3U3IA 2V7LA 4U72A 2KLQA 5FY1A 4CI2B 4OYKA 2G0UA 2Y48B 3WI3A 2D5UA 3CX8B 3PU3A 2CLYC 4X20E 2PBIA 4IGUA 5HYAA 5FXVA 2KINB 5LNKA 3FB2A 4OK0A 2K24A 2LOSA 1AJ3A 5JDNA 4GYSA 3ZJ2A 2X68A 3MA9A 4WW0A 3AB3B 3I0OA 3ZMVB 5HAXA 3RYFE 3HKDE 3ZCJA 3PU8A 2XHEB 2YU2A 5CA1E 3DJBA 1BR0A 3O1JA 3OYXA 1LVKA 1BR2A 2CLYB 4I50E 2WAUA 5LJMA 4C91A 4ERRA 3J7Yq 4QX7B 3I9WA 3AA1B 4O2AE 3EDUA 4GIWA 4H9RC 3FBZA 2KXPB 3BK9A 4CZZB 3LBXB 3OKQA 4UVBB 1OWAA 5HXCA 2LOPA 2NTXA 2MTQA 4N78D 3K3OA 3ZYLA 4OFZA 1LKXA 4JLEA 4UEMA 1HX8A 1D0XA 5M4YA 4O4HE 3O1HA 2KNDA 3E08A 3RC8A 1MNDA 3RYHE 5BMVE 1FIOA 4H63H 3KV5A 1WR6A 3T8OA 4BJNA 2D0TA 2LSYA 3LJCA 4YHJA 4TV8E 4QWNB 3AAEB 1HG5A 4PNIA 4O4LE 3DP7A 3AAIA 4I43B 4C90A 3NZPA 5HWYA 4L5GA 4PK6A 5L3BB 1FMWA 2IW5B 2BZBA 2L9QA 4HE8A 2D0UA 4UELA 3B57A 4G63A 3R84B 3FBLA 3RPUA 3ZLIA 3K8PC 2NW8A 5HXSA 4UV9B 3KBTA 2RP4A 4UXNB 2IC6A 1FMVA 2X9HA 3J9X1 3R6NA 2PFVA 5HWXA 2X9WA 4UV8B 2E9XD 5IHYA 1YW0A 4P0BA 2DI4A 5F8PA 1U5PA 2W61A 4H63V 3O4XE 5L3EB 1UX5A 2WSSV 3NBXX 1X79A 2XAHB 2W00A 2BDEA 4PJNA 3H3AA 4ZI3D 2XAQB 3AA0B 4EZHA 3JC6C 4PFPA 3MJXA 2CXDA 1T98A 2ZLYA 2XQYA 4PJLA 3PE0A 5AFUL 4O4IE 3CQCB 2ODUA 3LBXA 5EK4A 3KV9A 4FI5A 4ZI2D 5FMNA 4PFOA 2V7MA 2CXLA 4ZHQE 3CPZA 4EXTA 2LT3A 2Y8DA 3OBVE 3RH3A 3FXEB 1HG2A 5C8YE 5LCYA 4XAXB 3N9OA 4UF0B 2YINA 2EHOC 2PJQA 4O4JE 4GK0E 2LHNA 3FXDB 2CCQA 3HKEE 4AQGA 4H9SE 3HA4A 3LK2B 3ZCIA 4MFRA 4ASKA 5LA6E 5LG4A 4H9QC 3BQKA 3NZQA 2V26A 4QX8B 4EYYR 3ETUA 5LYJE 3SWHA 2CEAA 1MIVA 3KINB 3V5SA 2A2FX 2EHOB 4GYRA 3OJAA 3Q2MA 4EZ4A 1ZV4X 3H37A 3HKCE 3PURA 2BVLA 1VOMA 1ZHCA 3IEEA 3ZJ1A 5JREA 2WM9A 3D0TA 2XASB 1Y64B 3KV4A 1ZKEA 3PDYA 4IIJE 4V1Av 4XBFB 3M65A 1US7B 2X51A 3EUHA 2XUEA 2NWBA 4QHOA 2LEHA 2UXNB 2W63A 3L3PA 2NW9A 2W62A 2VASA 2A3DA 4X1KE 4CXXA 4YJ2E 2KWHA 3C51A 5EZYE 2XTLA 2VWAA 3UFEA 3RYCE 4TUYE 4I4TE 2Q9QC 2RA1A 4QXCB 1NWMX 2JMKA 3N5LA 3N2GE 3WAKA 2BVMA 4EYUA 5L3DB 3F31A 4ANJA 1ZEEA 4JEHB 4IE5A 4EAHA 3KBUA 1CUNA 3HR0A 5LBMA 3F2EA 3U78A 5J2TE 2ZM2A 4PJMA 3C50A 3HI2A 4UF0A 1YD8G 4IE7A 5TAOA 2LHRA 3B13A 2Q9QB 4IHJE 3ZPOA 3C4XA 2JJ9A 3AVRA 2NP9A 3IF8B 2VKDA 4ILUA 5GONE 3A5XA 5FXXA 5JR9C 3L09A 3CKDA 2C5IT 5IYZE 4ZS3A 3I0QA 3EVYA 2LJLA 2KZ7B 4ZI7E 2VL8A 4H9NC 2WWUA 3PUQA 3QK6A 2EHOA 3W15B 4AKIA 2DWGA 3KVBA 4U74A 4X1IE 4A56A 1MMAA 2DLRA 2H7OA 1Z0PA 2DCFA 4DMWA 4AI6A 2ZM0A 3RKOA 1LRZA 5JR9B 4BJMA 3ZMTB 2E8IA 4HN9A 2D2SA 2H3RA 3E0ZA 3IBPA 2V7IA 1V9DA 3O9XA 2VB6A 1UCUA 1IJ6A 3F57A 4ISSA 2N1GA 5JRCA 4WBOA 2LSGA 3GWHA 1D0ZA 4K0UA 1U4QA 2SPCA 2C5KT 3NRYA 4OYJA 1HCIA 4O2BE 1IZNB 3HKBE 3N9LA 2CWYA 3KVAA 4AKHA 4AKGA 4IE6A 3GA8A 1SA0E 5DJQC 4WBNE 4H9PC 5JDHA 1UX4A 2WBLA 3TKLB 3UT5E 5JDGA 2KMFA 2NW7A 2YK0A 2IC9A 2Q9QA 3FHNA 4ZOLE 1H7CA 3KV6A 4TV9E 3C4ZA 4DNDA 1IAPA 2M67A 5LXTE 3ZMZB 4HGAA 2GK9A 4BA9A 2NOXA 3O1IA 4MBQA 1LVFA 1YKEB 2H7VC 3VKGA 4HEAA 2IAKA 2X67A 3N2OA 3MZKB 5JDLA 3ZYKA 1YKHB 4KUMB 3SRZA 5ADXL 3N2KE 5L3GB 5JR9A 4AQFC 5EK2A 3RRWA 5LOVE 1FEWA 1NAFA 4P09A 3ZMSB 1G73A 4O8SA 2X0LB 3MACA 3KFWX 5HXHA 4PW8A 1WLXA 4TZ4C 4YLHA 3S4UA 2ACXA 4UVCB 4AKLA 3UUMA 1VRBA 3PUSA 4AXPA 3LK3B 2W0GA 2CM0A 1MIYA 2JMHA 2EHOD 4EOZB 1S94A 1OXZA 2C0SA 3CVRA 4Z8XA 2LE8A 2N9DA 2JRKA 1MIWA 1QSDA 2XAGB 2HPJA 3CX7B 1HFAA 4QXHB 2VK9A 2WMOA 3MKDA 1WRDA 5JRCB 4YFSA 4HFVA 5J1GA 4CXYA 5HXRA 4PK5A 3ZEFB 5LGUB 3GN5B 2VKJA 2VKHA 3N9QA 2K48A 2KT9A 4IDZA 2ES0A 2VKOA 5E0OA 5FNVE 3K3NA 4CQIA 5LHGB 3KDSE 1D1BA 3AA7B 2V1DB 3N9MA 3AA6B 3AAAB 5JH7E 1QUUA 4E7ZA 2CXFA 3RRCA 2JPFA 5CB4E 3LFMA 2LSIA 1G8XA 2HPLA 2WMNA 4X1YE 5HXEA 4DBQA 3CX6B 3VU7H 5KX5E 4E7SA 2HH7A 3NRXA 4HKAA 2J1DG 2ZM8A 3PTRB 4GOUA 1SHZC 2CA5A 2MYSA 2UXXB 3Q5WA 4QXBB 2DWKA 4GK5E 3AVSA 3ONXA 4M1PA 3CQGB 3IHRA 4PK4A 3RX6A 3QC9A 5JDFA 2Q9QD 3EDVA 1WYCA 3PUAA 3Q9DA 5FY0A 3CMLA 3V5UA 5JQGE 1MMDA 2V7KA 2XAJB 4JUYA 4MLKA 4AKRB 3I9YA 3P7IA 2NTYA 4TX5A 4QKNA 1D0YA 1IJ5A 4ADZA 4P0AA 4F6RC 4HTEA 2ZMAA 5JDMA 4AQFA 3RC3A 5LP6E 3N9PA 1EZ3A 3WAJA 2QA7A 3E22E 2E9XC 4KP3C 5F3JA 4CI3B 3LK42 4I55E 2Z6EA 3ANWA 3QUJA 4ZI3C 2A72A 3ZMUB 2Y6XA 5LHIB 4NUUA 1BR4A 4EB6E 4KMCA 4OHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZKE A;  2MBG A;  1Z0P A;  2C5J A;  3FXD B;  3P7I A;  1LRZ A;  2G0U A;  1IJ5 A;  2KWI B;  4J2C A;  3CVR A;  3L3P A;  4CQI A;  3MXZ A;  1QSD A;  4EYY R;  3TKL B;  4B6X A;  2KWH A;  2IC9 A;  3CKD A;  2C5I T;  2XTL A;  2IC6 A;  1H7C A;  4FI5 A;  2X9W A;  2X9Y A;  4DND A;  2CA5 A;  1IJ6 A;  4L0R A;  3QUJ A;  3N5L A;  3S4U A;  3QK6 A;  2K48 A;  3FXE B;  2X9X A;  1LVF A;  2C5K T; 
#chains in the Genus database with same CATH topology
 5JVD E;  4LF9 T;  4EIW A;  3GN5 A;  2E9X B;  2XAF B;  4YSX A;  1D1C A;  2WZI A;  3UUX B;  1O3X A;  5KDM C;  3ZC1 A;  3RLF F;  5AQO B;  5L2L A;  5FP3 A;  1BR1 A;  4DR6 T;  5LBQ B;  3SS1 A;  3RGL A;  3TLW A;  5KXJ A;  2WB5 A;  3GMI A;  4UIG A;  5FXZ A;  4TN7 B;  4ZZC A;  2J4G A;  2P9B A;  3UUN A;  3CWZ B;  4XZC A;  1MMN A;  3ZN1 B;  3LSV A;  5LHH B;  5KMG P;  1HF8 A;  2L8K A;  2V7J A;  3A7M A;  3ETV A;  4MAL A;  4PAG A;  2YEV C;  2L3L A;  1E2A A;  2YN6 A;  3FZK B;  4IDN A;  3ZN0 B;  2YOE A;  3VHL A;  2B1E A;  3ZYM A;  4YSZ A;  3QNU A;  2JQQ A;  2V5C A;  5CA0 E;  2X9Y A;  2W2U A;  2XZE A;  4MHC A;  5CJ5 A;  4TWF A;  2XQ9 A;  4ZS2 A;  3U3I A;  2V7L A;  1HNZ T;  2Y48 B;  5HYA A;  5FXV A;  2KIN B;  5LNK A;  5FKY A;  3ZMV B;  3RYF E;  3HKD E;  1OED E;  1BR0 A;  2V5D A;  4HFH A;  3O1J A;  3OYX A;  4EEB A;  3UFG A;  3RF1 A;  3AE7 A;  4IL9 A;  2WQY A;  3J7Y q;  3P50 A;  4H9R C;  3FBZ A;  5CGM A;  3BK9 A;  4UVB B;  2XQ6 A;  5HXC A;  3K1S A;  3ZYL A;  3QB5 A;  2CBI A;  3VRB A;  4KHP T;  1OED C;  1VCS A;  1R8I A;  2BG9 E;  3T8O A;  3KV5 A;  4H63 H;  1UUS A;  3LJC A;  4TV8 E;  1UK5 A;  3AAE B;  3A8Y C;  4QH1 A;  4PNI A;  4X66 T;  3AAI A;  4I43 B;  4IDP A;  5L3B B;  3RKG A;  2IW5 B;  2L9Q A;  4HE8 A;  1OED B;  3B57 A;  4G63 A;  3FBL A;  3ZLI A;  5C3J A;  4UV9 B;  2WWV A;  2M6I A;  3KBT A;  2IC6 A;  2X9H A;  4EED A;  2BG9 C;  5F8P A;  4LMK A;  5L3E B;  2WSS V;  4PJN A;  2XAQ B;  3JC6 C;  2JQH A;  1T98 A;  2XQY A;  2BG9 B;  5AFU L;  4DR2 T;  3KV9 A;  4ZI2 D;  1KEY A;  5AQQ B;  2M6B A;  5LCY A;  3N9O A;  3HKE E;  3FXD B;  4TWH A;  4AQG A;  2IIU A;  3HA4 A;  3LK2 B;  5LA6 E;  2IUB A;  4QX8 B;  4EZ4 A;  2BVL A;  2WM9 A;  3D0T A;  3PDY A;  4V1A v;  2LLY A;  1US7 B;  2X51 A;  4U31 A;  4QHO A;  2NWB A;  2LEH A;  4HWD A;  2D9D A;  2VAS A;  4CXX A;  4TUY E;  4I4T E;  3AE9 A;  3WAK A;  5AQG B;  4HFE A;  4IRE A;  5LBM A;  2K3W A;  2ZM2 A;  4PJM A;  3C50 A;  4UF0 A;  5TAO A;  5FVK A;  3B13 A;  2JJ9 A;  5JR9 C;  2KZ7 B;  2VL8 A;  4H9N C;  2WWU A;  3PUQ A;  4AKI A;  3EAM A;  4AI6 A;  5JR9 B;  4DV6 T;  2H3R A;  3E0Z A;  3AEE A;  2VB6 A;  5AQV B;  4ISS A;  5JRC A;  4K0U A;  1U4Q A;  2V8S V;  3NRY A;  1HCI A;  1IZN B;  4ILB A;  4AKH A;  5LMU T;  2VQF T;  2KMF A;  2Q9Q A;  3FHN A;  5AQS B;  3C4Z A;  1IAP A;  4LF8 T;  4BA9 A;  3O1I A;  2HN2 A;  2H7V C;  4HEA A;  3MZK B;  1QLB A;  4AQF C;  3ZMS B;  2XM1 A;  1CHU A;  3MAC A;  3EAB A;  1WLX A;  4TZ4 C;  4UVC B;  1VRB A;  1E7P A;  4Z8X A;  2N9D A;  1ZP0 A;  2JRK A;  1MIW A;  2JIW A;  4LF7 T;  4AIS A;  2HPJ A;  1HFA A;  4QXH B;  2VK9 A;  1XNR T;  4PK5 A;  3ZEF B;  3GN5 B;  2KT9 A;  2YDR A;  4CQI A;  2ZM6 T;  4NXM T;  4E7Z A;  1IBK T;  3LFM A;  2LSI A;  2CRB A;  2WMN A;  4DR5 T;  5AQN B;  3X1D A;  4E7S A;  4HKA A;  1FJG T;  4GOU A;  1SHZ C;  2DWK A;  4CN6 A;  3CQG B;  4LFB T;  3QC9 A;  5JDF A;  3EDV A;  5FL0 A;  2XAJ B;  2OLT A;  4U2Y A;  4P0A A;  2XSA A;  1XZY A;  5LP6 E;  3N9P A;  2QA7 A;  3E22 E;  1YQ4 A;  2FUP A;  4I55 E;  4IL4 A;  4ZI3 C;  4B3R T;  5L3C B;  4KBM B;  4CI1 B;  4H9O C;  1HNW T;  1D1A A;  4J2C A;  5DQW A;  4YY3 T;  2LRK A;  4JV5 T;  4IST A;  2UUA T;  3CQX C;  3ESL A;  4JYA T;  4L9I A;  3ZSS A;  1KNP A;  3OYZ A;  2C5J A;  2UXC T;  2H88 A;  3RIA A;  2AXD S;  3MK7 C;  3BQL A;  2WDQ A;  1KK7 A;  3RYI E;  3MXZ A;  5ETW A;  5DAB A;  3AEB A;  4COF A;  3Q5X A;  1KNZ A;  2LSK A;  3VR9 A;  1S35 A;  5A1L A;  2X9X A;  5AQU B;  1MMG A;  3AE4 A;  2YU1 A;  1KNR A;  2WS3 A;  2K9A A;  4DMV A;  2I59 A;  4FJO A;  4JI0 T;  4LF5 T;  2XPK A;  4U2Z A;  3C64 A;  4F8H A;  5HEJ A;  5LGN B;  3P4R A;  4IE0 A;  2CLY C;  4IGU A;  4OK0 A;  4HWI B;  2LOS A;  4AQY T;  4GYS A;  3ZJ2 A;  1WR0 A;  2X68 A;  2XHE B;  2YU2 A;  1LVK A;  1BR2 A;  2CLY B;  4I50 E;  2WAU A;  4KI0 F;  4C91 A;  4ERR A;  1N34 T;  3AA1 B;  5AQM B;  3OKQ A;  2NTX A;  4OFZ A;  4UEM A;  1D0X A;  5M4Y A;  2KND A;  3E08 A;  3RYH E;  5BMV E;  1FIO A;  2UU9 T;  2LSY A;  1IBM T;  4O4L E;  3DP7 A;  5HEU A;  4L5G A;  4PK6 A;  4TNV A;  2NW8 A;  4DV7 T;  2RP4 A;  4UXN B;  1I94 T;  1FMV A;  2WDV A;  2J62 A;  5HWX A;  2E9X D;  5IHY A;  3ZT6 A;  5J0Z A;  5ABF A;  1YW0 A;  4B3M T;  1U5P A;  2W61 A;  4H63 V;  4DV3 T;  1UX5 A;  3NBX X;  1X79 A;  3AA0 B;  4PFP A;  4NIQ A;  3MJX A;  2CXD A;  2ZLY A;  2W67 A;  2CPT A;  4O4I E;  1X9B A;  4UR9 A;  3LBX A;  4FI5 A;  1W09 A;  5FMN A;  3CPZ A;  3OBV E;  5FVL A;  1HG2 A;  5C8Y E;  2J47 A;  2I0M A;  4UF0 B;  2YIN A;  2PJQ A;  4GK0 E;  2LHN A;  1HNX T;  1XNQ T;  2X0Y A;  3ZCI A;  4MFR A;  4ASK A;  3PUZ F;  4H9Q C;  2V26 A;  3UU8 A;  5LYJ E;  2CEA A;  1N36 T;  3PUV F;  3Q2M A;  1VOM A;  1KFY A;  3IEE A;  5JRE A;  2XAS B;  3RIU A;  1ZKE A;  4IIJ E;  2CBJ A;  3M65 A;  2XUE A;  3OPC A;  4YJ2 E;  2BKO A;  5AQJ B;  2Q9Q C;  2JMK A;  3N5L A;  3N2G E;  5L3D B;  3F31 A;  4JEH B;  4IE5 A;  2JQK A;  3F2E A;  3U78 A;  4HWC A;  2Q9Q B;  4WZX A;  4LF4 T;  3ZPO A;  4DV2 T;  2NP9 A;  3LDQ B;  4ZS3 A;  3I0Q A;  3EVY A;  5LB7 B;  2EHO A;  3W15 B;  2DWG A;  3KVB A;  2DCF A;  2VUR A;  3RKO A;  1LRZ A;  2YDS A;  2E8I A;  4HN9 A;  3IBP A;  3TLS A;  2V7I A;  1V9D A;  2X0H A;  4YHH T;  3SFD A;  1T8B A;  3HKB E;  2UUB T;  5DJQ C;  4H9P C;  2WBL A;  3TKL B;  2YK0 A;  4HWF A;  4X65 T;  4ZOL E;  3H3M A;  3AXJ A;  4ZXL A;  5LXT E;  3ZMZ B;  2NOX A;  3VKG A;  2IAK A;  2XY8 B;  4TNW A;  5ADX L;  4JI8 T;  2BS3 A;  3UU5 A;  5EK2 A;  3RRW A;  3JAD A;  1NAF A;  4P09 A;  1G73 A;  4O8S A;  1N33 T;  2FBW A;  4YLH A;  3AEF A;  3S4U A;  2ACX A;  5LG3 A;  5LMN T;  5AQK B;  4AXP A;  4QH4 A;  2VL0 A;  4EOZ B;  1S94 A;  1OXZ A;  1QSD A;  2XAG B;  3EHZ A;  2WMO A;  3NKZ A;  1T72 A;  5HXR A;  5LGU B;  2VKH A;  2K48 A;  2ES0 A;  1SE7 A;  5E0O A;  3AA7 B;  3N9M A;  3AAA B;  5JH7 E;  2IHR 1;  1W0B A;  2CXF A;  3RRC A;  4ZEY A;  3FZL B;  3ABV A;  5HXE A;  3VU7 H;  2UUC T;  2ZM8 A;  3PTR B;  4M1P A;  3IHR A;  4PK4 A;  1J5E T;  3RX6 A;  5FY0 A;  3Q9D A;  4IDO A;  5HCJ A;  2V7K A;  4LFC T;  1D0Y A;  4F6R C;  4HTE A;  5JDM A;  3RC3 A;  2LKH A;  1SUM B;  5AQF B;  1N32 T;  4CI3 B;  3Q5D A;  2E2A A;  3QUJ A;  3ZMU B;  5LHI B;  4EB6 E;  4IE4 A;  2KWI B;  2E5L T;  2DL1 A;  2N2N A;  2PG8 A;  4DVD A;  4X5T A;  5H6R B;  3P8C D;  5AQH B;  2XQA A;  4DBR A;  5EK3 A;  2ODV A;  3C4W A;  2X66 A;  5LGT B;  5JDQ A;  3HL6 A;  5L4H A;  1JNZ A;  5FL1 A;  3JCF A;  1MNE A;  4DV0 T;  2XM2 A;  3UUB A;  3UTK A;  3UUL A;  5LJN A;  3VKH A;  4LML A;  3VR8 A;  2MPK A;  1XDP A;  4CXW A;  3I1A A;  4B6X A;  3UU3 A;  3ANW B;  2CE7 A;  2LM9 A;  2NR4 A;  3AE8 A;  3N9N A;  2ACZ A;  2WZH A;  4UVA B;  5L3F B;  3ZT5 A;  5HEG A;  4Z90 A;  3DTO A;  4U72 A;  4GKJ T;  4OYK A;  2G0U A;  3PU3 A;  2PBI A;  2K24 A;  3P4P A;  5JDN A;  2BG9 A;  4WW0 A;  3AB3 B;  3I0O A;  3CIR A;  3PU8 A;  3DJB A;  3RIF A;  4YT0 A;  4QX7 B;  3EDU A;  3LBX B;  3PUX F;  4B3S T;  2LOP A;  3ZKR A;  4JLE A;  4O4H E;  3O1H A;  3RC8 A;  2IDO B;  3M3Z B;  2D0T A;  4YHJ A;  2XQ5 A;  5AQP B;  3VRA A;  4C90 A;  3RIU C;  2WU2 A;  3RPU A;  3R84 B;  4I0U A;  1YXR A;  2CHO A;  3J9X 1;  2PFV A;  4UV8 B;  4IT4 A;  3NVO A;  4U33 A;  2XQ7 A;  4ZI3 D;  4EZH A;  3ONL C;  3AEA A;  4JI6 T;  2ODU A;  5L47 A;  1Z8U A;  5HCM A;  4PFO A;  2CXL A;  4ZHQ E;  4EXT A;  2LT3 A;  2Y8D A;  3RH3 A;  3FXE B;  5CFB A;  2EHO C;  4O4J E;  2CCQ A;  4H9S E;  3AED A;  3ONJ A;  4YTP A;  4DID B;  5LG4 A;  2W66 A;  3NZQ A;  4EYY R;  3ETU A;  5AQI B;  1IBL T;  3KIN B;  1MIV A;  2EHO B;  4KHZ F;  3OJA A;  1ZV4 X;  3PUR A;  1NEN A;  1ZHC A;  3ZJ1 A;  1Y64 B;  4Q25 A;  2V6Y A;  4GKK T;  2UXN B;  4NXN T;  2W62 A;  2A3D A;  4LFA T;  5EZY E;  1VCT A;  2XTL A;  2VWA A;  3Q5E A;  4QXC B;  3UU6 A;  4EYU A;  1XWM A;  4EAH A;  3KBU A;  4DV5 T;  2LRL A;  1UUR A;  2BKP A;  4IHJ E;  3P4S A;  3C4X A;  3AVR A;  3AXJ B;  4ILU A;  5GON E;  3L09 A;  3CKD A;  5IYZ E;  2LJL A;  3AE5 A;  4A56 A;  1MMA A;  2DLR A;  2H7O A;  3AE2 A;  2ZM0 A;  4BJM A;  4X62 T;  2D2S A;  4IDQ A;  1L0V A;  2V6X A;  3O9X A;  1Y01 A;  3UQ4 A;  1UCU A;  4A97 A;  3F57 A;  2N1G A;  1M62 A;  3GWH A;  2E5V A;  2SPC A;  4TWD A;  4OYJ A;  4O2B E;  3N9L A;  2CWY A;  4AKG A;  4IE6 A;  3GA8 A;  4WBN E;  1UX4 A;  5BR8 T;  3UT5 E;  2NW7 A;  2IC9 A;  3KV6 A;  4TV9 E;  4DND A;  3TLV A;  2XQ8 A;  2GK9 A;  4MBQ A;  1LVF A;  1YKE B;  1XMO T;  2X67 A;  3N2O A;  1YKH B;  4KUM B;  2WCA A;  3SRZ A;  4YSY A;  2XQ4 A;  3N2K E;  5L3G B;  3RQW A;  2HHH T;  2X0L B;  2IML A;  2JQ9 A;  3OVU A;  4U7Y A;  1M7K A;  1YQ3 A;  4ILA A;  2BS2 A;  3LK3 B;  2W0G A;  2JMH A;  2LE8 A;  2HN1 A;  1UGO A;  5JRC B;  1WRD A;  4YFS A;  4CN4 A;  4HFV A;  5IUX A;  5J1G A;  2CHN A;  4JI5 T;  2VKJ A;  2VKO A;  5FNV E;  3K3N A;  5LHG B;  1D1B A;  2V1D B;  3G06 A;  1QUU A;  4JI7 T;  2HPL A;  3FZF B;  4X1Y E;  4DBQ A;  2BKN A;  3CX6 B;  5KX5 E;  4EGW A;  3NRX A;  2J1D G;  2MYS A;  3Q5W A;  4GK5 E;  3ONX A;  2Q9Q D;  3PUA A;  3V5U A;  3CML A;  5JQG E;  2F4V T;  4JUY A;  4MLK A;  3I9Y A;  3P7I A;  2VVS A;  4QKN A;  4ADZ A;  2ZMA A;  2BBH A;  2BS4 A;  4DR3 T;  1EZ3 A;  4JI3 T;  5F3J A;  2MAW A;  5AQR B;  2Z6E A;  3PJA J;  2I6H A;  4HWH A;  1BR4 A;  4KMC A;  2BBJ A;  2MBG A;  3K3Q C;  2K5B B;  5H6Q B;  1XDO A;  2A9U A;  3T1H T;  2AE9 A;  2FJD A;  2LSJ A;  2MOZ A;  4ZI2 C;  2DNX A;  2CMR A;  3LG7 A;  4QH5 A;  4DO0 A;  3BQI A;  3ZC0 A;  3SOL A;  2OA5 A;  4WNK A;  1WYB A;  1E1H B;  5FXW A;  3JAE A;  3ZST A;  3JC6 D;  1T7S A;  2DHR A;  1NEK A;  5FYM A;  2YKS A;  1HS7 A;  1W0A A;  5J2U E;  4YTM A;  1HTJ F;  3C98 B;  2QGS A;  4NUV A;  5FY7 A;  1HR0 T;  3L39 A;  2YDQ A;  3PUG A;  3P4Q A;  4NPP A;  2E9X A;  2CWO A;  4BAY B;  4YJ3 E;  4G2A A;  5IWA T;  1B7T A;  4HFB A;  4PJJ A;  4L0R A;  5DQV A;  4JEU B;  4DUZ T;  2KLQ A;  5FY1 A;  4CI2 B;  3WI3 A;  3ZT7 A;  2D5U A;  3CX8 B;  4X20 E;  4ILC A;  3FB2 A;  4DR4 T;  1AJ3 A;  4K0K T;  3RHW A;  4YXD A;  3MA9 A;  3AE3 A;  5HAX A;  3ZCJ A;  5CA1 E;  4U3C A;  2WY2 A;  5LJM A;  3I9W A;  4O2A E;  4GIW A;  2KXP B;  4CZZ B;  3EI0 A;  1OWA A;  4N78 D;  2MTQ A;  3K3O A;  1LKX A;  1HX8 A;  5JTG A;  1MND A;  1WR6 A;  3B5M A;  4BJN A;  4QWN B;  2PTF A;  1HG5 A;  1JNR A;  3NZP A;  5HWY A;  1FMW A;  2BZB A;  2D0U A;  4B3T T;  4UEL A;  3K8P C;  5HXS A;  3R6N A;  2X9W A;  4P0B A;  2DI4 A;  3IA3 A;  3TLT A;  3O4X E;  3RI5 A;  2V6Y B;  2XAH B;  2W00 A;  2BDE A;  4JI1 T;  3H3A A;  4LMJ A;  5ABG A;  3AE1 A;  4U7I A;  1ZOY A;  4PJL A;  3PE0 A;  3SFE A;  3CQC B;  2KSR A;  5EK4 A;  2XJ7 A;  1I6Z A;  2V7M A;  1KF6 A;  1DU2 A;  2OV9 A;  2VQE T;  3QOF A;  4XAX B;  4YTN A;  2UXB T;  4KX6 A;  3BQK A;  4JI2 T;  5AQT B;  4A5X A;  5ABH A;  2QYW A;  4DUY T;  3SWH A;  1OED A;  3V5S A;  2A2F X;  4GYR A;  4P1N A;  3HKC E;  3H37 A;  2FJE A;  2H89 A;  4WYV A;  3KV4 A;  4XBF B;  4OX9 T;  3EUH A;  4DR1 T;  4HFI A;  3PUW F;  2W63 A;  3L3P A;  2NW9 A;  2QVA A;  3FZM B;  4X1K E;  2KWH A;  3C51 A;  5ABF B;  3UFE A;  3RYC E;  2RA1 A;  4LF6 T;  4EV6 A;  1NWM X;  3UQ7 A;  2BVM A;  4ANJ A;  2RPA A;  1ZEE A;  3PUY F;  1J1J A;  1CUN A;  4JBW F;  3HR0 A;  3AE6 A;  5J2T E;  3HI2 A;  1YD8 G;  4IE7 A;  2LHR A;  3IF8 B;  2VKD A;  5ABE A;  3A5X A;  5FXX A;  2C5I T;  1J5W A;  5AQL B;  3OTO T;  4ZI7 E;  3QK6 A;  4Z91 A;  4U74 A;  4X1I E;  5HEH A;  1Z0P A;  4DMW A;  1WCR A;  2WDR A;  3NWI A;  3ZMT B;  3AEC A;  3PV0 F;  4A98 A;  4HFD A;  2R6G F;  2VVN A;  3TLU A;  1IJ6 A;  4JI4 T;  4WBO A;  5L4E A;  2LSG A;  1D0Z A;  3FZH B;  5C2T A;  2C5K T;  3KVA A;  3JAF A;  1SA0 E;  5JDH A;  5HEO A;  5JDG A;  1H7C A;  2WP9 A;  4CN1 A;  2M67 A;  4HGA A;  1HX1 B;  5JDL A;  1WFD A;  2W4X A;  3ZYK A;  4X64 T;  5JR9 A;  3P4W A;  5LOV E;  1FEW A;  3KFW X;  5HXH A;  4PW8 A;  2B76 A;  4AKL A;  3UUM A;  3PUS A;  3UU4 A;  3CK6 A;  2CM0 A;  1MIY A;  2EHO D;  4DR7 T;  1XMQ T;  2C0S A;  3CVR A;  1GQE A;  2LM2 A;  3CX7 B;  3MKD A;  4HFC A;  5F5W A;  4CXY A;  3N9Q A;  2QRX A;  4IDZ A;  2WU5 A;  2XSB A;  3KDS E;  3PJA A;  3AA6 B;  4DV4 T;  1W9R A;  2LKG A;  2JPF A;  5CB4 E;  3RQU A;  1G8X A;  2UXD T;  2XQ3 A;  2FJB A;  4AIU A;  2HH7 A;  3L8R A;  2CA5 A;  2UXX B;  4QXB B;  3AVS A;  4DV1 T;  1WYC A;  1MMD A;  4AKR B;  2NTY A;  4TX5 A;  4ZZB A;  3T1Y T;  1IJ5 A;  3AEG A;  4AQF A;  3WAJ A;  2E9X C;  4KP3 C;  3LK4 2;  3QB5 K;  3ANW A;  2A72 A;  2Y6X A;  4NUU A;  2FJA A;  4OHF A; 
#chains in the Genus database with same CATH homology
 5JVD E;  2MBG A;  5L3C B;  4EIW A;  4KBM B;  3GN5 A;  2E9X B;  3K3Q C;  2K5B B;  4IE4 A;  2XAF B;  5H6Q B;  4H9O C;  1D1C A;  4CI1 B;  2KWI B;  3UUX B;  1D1A A;  1O3X A;  4J2C A;  5DQW A;  5KDM C;  3ZC1 A;  2LSJ A;  2MOZ A;  4ZI2 C;  2DNX A;  5L2L A;  5FP3 A;  4IST A;  1BR1 A;  5LBQ B;  2CMR A;  3SS1 A;  2N2N A;  2PG8 A;  4DVD A;  3LG7 A;  3GMI A;  3CQX C;  3ESL A;  4DO0 A;  4L9I A;  4UIG A;  3BQI A;  3ZC0 A;  5H6R B;  3OYZ A;  3P8C D;  5FXZ A;  4TN7 B;  3SOL A;  2C5J A;  2OA5 A;  2P9B A;  3UUN A;  4WNK A;  4DBR A;  1WYB A;  1E1H B;  3C4W A;  2ODV A;  2X66 A;  5EK3 A;  3MK7 C;  5LGT B;  3BQL A;  5JDQ A;  3CWZ B;  5FXW A;  1KK7 A;  3HL6 A;  4XZC A;  3RYI E;  3MXZ A;  1MMN A;  3JC6 D;  3ZN1 B;  5ETW A;  2DHR A;  5DAB A;  5FYM A;  5LHH B;  5KMG P;  1MNE A;  3Q5X A;  1HS7 A;  1HF8 A;  2L8K A;  2LSK A;  1KNZ A;  2V7J A;  3ETV A;  4MAL A;  5J2U E;  1HTJ F;  1S35 A;  5A1L A;  4PAG A;  3UTK A;  2YEV C;  3UUL A;  2X9X A;  3C98 B;  5LJN A;  3VKH A;  2L3L A;  1MMG A;  2QGS A;  4NUV A;  3ZN0 B;  5FY7 A;  2YU1 A;  3VHL A;  2B1E A;  2K9A A;  3PUG A;  4DMV A;  3ZYM A;  2I59 A;  4FJO A;  2E9X A;  4CXW A;  2CWO A;  4BAY B;  3I1A A;  2JQQ A;  4YJ3 E;  4B6X A;  4G2A A;  3ANW B;  2CE7 A;  3C64 A;  5CA0 E;  2LM9 A;  1B7T A;  2X9Y A;  4PJJ A;  3N9N A;  4L0R A;  4UVA B;  5DQV A;  5L3F B;  5LGN B;  4MHC A;  4IE0 A;  4JEU B;  3DTO A;  4ZS2 A;  3U3I A;  2V7L A;  4U72 A;  2KLQ A;  5FY1 A;  4CI2 B;  4OYK A;  2G0U A;  2Y48 B;  3WI3 A;  2D5U A;  3CX8 B;  3PU3 A;  2CLY C;  4X20 E;  2PBI A;  4IGU A;  5HYA A;  5FXV A;  2KIN B;  5LNK A;  3FB2 A;  4OK0 A;  2K24 A;  2LOS A;  1AJ3 A;  5JDN A;  4GYS A;  3ZJ2 A;  2X68 A;  3MA9 A;  4WW0 A;  3AB3 B;  3I0O A;  3ZMV B;  5HAX A;  3RYF E;  3HKD E;  3ZCJ A;  3PU8 A;  2XHE B;  2YU2 A;  5CA1 E;  3DJB A;  1BR0 A;  3O1J A;  3OYX A;  1LVK A;  1BR2 A;  2CLY B;  4I50 E;  2WAU A;  5LJM A;  4C91 A;  4ERR A;  3J7Y q;  4QX7 B;  3I9W A;  3AA1 B;  4O2A E;  3EDU A;  4GIW A;  4H9R C;  3FBZ A;  2KXP B;  3BK9 A;  4CZZ B;  3LBX B;  3OKQ A;  4UVB B;  1OWA A;  5HXC A;  2LOP A;  2NTX A;  2MTQ A;  4N78 D;  3K3O A;  3ZYL A;  4OFZ A;  1LKX A;  4JLE A;  4UEM A;  1HX8 A;  1D0X A;  5M4Y A;  4O4H E;  3O1H A;  2KND A;  3E08 A;  3RC8 A;  1MND A;  3RYH E;  5BMV E;  1FIO A;  4H63 H;  3KV5 A;  1WR6 A;  3T8O A;  4BJN A;  2D0T A;  2LSY A;  3LJC A;  4YHJ A;  4TV8 E;  4QWN B;  3AAE B;  1HG5 A;  4PNI A;  4O4L E;  3DP7 A;  3AAI A;  4I43 B;  4C90 A;  3NZP A;  5HWY A;  4L5G A;  4PK6 A;  5L3B B;  1FMW A;  2IW5 B;  2BZB A;  2L9Q A;  4HE8 A;  2D0U A;  4UEL A;  3B57 A;  4G63 A;  3R84 B;  3FBL A;  3RPU A;  3ZLI A;  3K8P C;  2NW8 A;  5HXS A;  4UV9 B;  3KBT A;  2RP4 A;  4UXN B;  2IC6 A;  1FMV A;  2X9H A;  3J9X 1;  3R6N A;  2PFV A;  5HWX A;  2X9W A;  4UV8 B;  2E9X D;  5IHY A;  1YW0 A;  4P0B A;  2DI4 A;  5F8P A;  1U5P A;  2W61 A;  4H63 V;  3O4X E;  5L3E B;  1UX5 A;  2WSS V;  3NBX X;  1X79 A;  2XAH B;  2W00 A;  2BDE A;  4PJN A;  3H3A A;  4ZI3 D;  2XAQ B;  3AA0 B;  4EZH A;  3JC6 C;  4PFP A;  3MJX A;  2CXD A;  1T98 A;  2ZLY A;  2XQY A;  4PJL A;  3PE0 A;  5AFU L;  4O4I E;  3CQC B;  2ODU A;  3LBX A;  5EK4 A;  3KV9 A;  4FI5 A;  4ZI2 D;  5FMN A;  4PFO A;  2V7M A;  2CXL A;  4ZHQ E;  3CPZ A;  4EXT A;  2LT3 A;  2Y8D A;  3OBV E;  3RH3 A;  3FXE B;  1HG2 A;  5C8Y E;  5LCY A;  4XAX B;  3N9O A;  4UF0 B;  2YIN A;  2EHO C;  2PJQ A;  4O4J E;  4GK0 E;  2LHN A;  3FXD B;  2CCQ A;  3HKE E;  4AQG A;  4H9S E;  3HA4 A;  3LK2 B;  3ZCI A;  4MFR A;  4ASK A;  5LA6 E;  5LG4 A;  4H9Q C;  3BQK A;  3NZQ A;  2V26 A;  4QX8 B;  4EYY R;  3ETU A;  5LYJ E;  3SWH A;  2CEA A;  1MIV A;  3KIN B;  3V5S A;  2A2F X;  2EHO B;  4GYR A;  3OJA A;  3Q2M A;  4EZ4 A;  1ZV4 X;  3H37 A;  3HKC E;  3PUR A;  2BVL A;  1VOM A;  1ZHC A;  3IEE A;  3ZJ1 A;  5JRE A;  2WM9 A;  3D0T A;  2XAS B;  1Y64 B;  3KV4 A;  1ZKE A;  3PDY A;  4IIJ E;  4V1A v;  4XBF B;  3M65 A;  1US7 B;  2X51 A;  3EUH A;  2XUE A;  2NWB A;  4QHO A;  2LEH A;  2UXN B;  2W63 A;  3L3P A;  2NW9 A;  2W62 A;  2VAS A;  2A3D A;  4X1K E;  4CXX A;  4YJ2 E;  2KWH A;  3C51 A;  5EZY E;  2XTL A;  2VWA A;  3UFE A;  3RYC E;  4TUY E;  4I4T E;  2Q9Q C;  2RA1 A;  4QXC B;  1NWM X;  2JMK A;  3N5L A;  3N2G E;  3WAK A;  2BVM A;  4EYU A;  5L3D B;  3F31 A;  4ANJ A;  1ZEE A;  4JEH B;  4IE5 A;  4EAH A;  3KBU A;  1CUN A;  3HR0 A;  5LBM A;  3F2E A;  3U78 A;  5J2T E;  2ZM2 A;  4PJM A;  3C50 A;  3HI2 A;  4UF0 A;  1YD8 G;  4IE7 A;  5TAO A;  2LHR A;  3B13 A;  2Q9Q B;  4IHJ E;  3ZPO A;  3C4X A;  2JJ9 A;  3AVR A;  2NP9 A;  3IF8 B;  2VKD A;  4ILU A;  5GON E;  3A5X A;  5FXX A;  5JR9 C;  3L09 A;  3CKD A;  2C5I T;  5IYZ E;  4ZS3 A;  3I0Q A;  3EVY A;  2LJL A;  2KZ7 B;  4ZI7 E;  2VL8 A;  4H9N C;  2WWU A;  3PUQ A;  3QK6 A;  2EHO A;  3W15 B;  4AKI A;  2DWG A;  3KVB A;  4U74 A;  4X1I E;  4A56 A;  1MMA A;  2DLR A;  2H7O A;  1Z0P A;  2DCF A;  4DMW A;  4AI6 A;  2ZM0 A;  3RKO A;  1LRZ A;  5JR9 B;  4BJM A;  3ZMT B;  2E8I A;  4HN9 A;  2D2S A;  2H3R A;  3E0Z A;  3IBP A;  2V7I A;  1V9D A;  3O9X A;  2VB6 A;  1UCU A;  1IJ6 A;  3F57 A;  4ISS A;  2N1G A;  5JRC A;  4WBO A;  2LSG A;  3GWH A;  1D0Z A;  4K0U A;  1U4Q A;  2SPC A;  2C5K T;  3NRY A;  4OYJ A;  1HCI A;  4O2B E;  1IZN B;  3HKB E;  3N9L A;  2CWY A;  3KVA A;  4AKH A;  4AKG A;  4IE6 A;  3GA8 A;  1SA0 E;  5DJQ C;  4WBN E;  4H9P C;  5JDH A;  1UX4 A;  2WBL A;  3TKL B;  3UT5 E;  5JDG A;  2KMF A;  2NW7 A;  2YK0 A;  2IC9 A;  2Q9Q A;  3FHN A;  4ZOL E;  1H7C A;  3KV6 A;  4TV9 E;  3C4Z A;  4DND A;  1IAP A;  2M67 A;  5LXT E;  3ZMZ B;  4HGA A;  2GK9 A;  4BA9 A;  2NOX A;  3O1I A;  4MBQ A;  1LVF A;  1YKE B;  2H7V C;  3VKG A;  4HEA A;  2IAK A;  2X67 A;  3N2O A;  3MZK B;  5JDL A;  3ZYK A;  1YKH B;  4KUM B;  3SRZ A;  5ADX L;  3N2K E;  5L3G B;  5JR9 A;  4AQF C;  5EK2 A;  3RRW A;  5LOV E;  1FEW A;  1NAF A;  4P09 A;  3ZMS B;  1G73 A;  4O8S A;  2X0L B;  3MAC A;  3KFW X;  5HXH A;  4PW8 A;  1WLX A;  4TZ4 C;  4YLH A;  3S4U A;  2ACX A;  4UVC B;  4AKL A;  3UUM A;  1VRB A;  3PUS A;  4AXP A;  3LK3 B;  2W0G A;  2CM0 A;  1MIY A;  2JMH A;  2EHO D;  4EOZ B;  1S94 A;  1OXZ A;  2C0S A;  3CVR A;  4Z8X A;  2LE8 A;  2N9D A;  2JRK A;  1MIW A;  1QSD A;  2XAG B;  2HPJ A;  3CX7 B;  1HFA A;  4QXH B;  2VK9 A;  2WMO A;  3MKD A;  1WRD A;  5JRC B;  4YFS A;  4HFV A;  5J1G A;  4CXY A;  5HXR A;  4PK5 A;  3ZEF B;  5LGU B;  3GN5 B;  2VKJ A;  2VKH A;  3N9Q A;  2K48 A;  2KT9 A;  4IDZ A;  2ES0 A;  2VKO A;  5E0O A;  5FNV E;  3K3N A;  4CQI A;  5LHG B;  3KDS E;  1D1B A;  3AA7 B;  2V1D B;  3N9M A;  3AA6 B;  3AAA B;  5JH7 E;  1QUU A;  4E7Z A;  2CXF A;  3RRC A;  2JPF A;  5CB4 E;  3LFM A;  2LSI A;  1G8X A;  2HPL A;  2WMN A;  4X1Y E;  5HXE A;  4DBQ A;  3CX6 B;  3VU7 H;  5KX5 E;  4E7S A;  2HH7 A;  3NRX A;  4HKA A;  2J1D G;  2ZM8 A;  3PTR B;  4GOU A;  1SHZ C;  2CA5 A;  2MYS A;  2UXX B;  3Q5W A;  4QXB B;  2DWK A;  4GK5 E;  3AVS A;  3ONX A;  4M1P A;  3CQG B;  3IHR A;  4PK4 A;  3RX6 A;  3QC9 A;  5JDF A;  2Q9Q D;  3EDV A;  1WYC A;  3PUA A;  3Q9D A;  5FY0 A;  3CML A;  3V5U A;  5JQG E;  1MMD A;  2V7K A;  2XAJ B;  4JUY A;  4MLK A;  4AKR B;  3I9Y A;  3P7I A;  2NTY A;  4TX5 A;  4QKN A;  1D0Y A;  1IJ5 A;  4ADZ A;  4P0A A;  4F6R C;  4HTE A;  2ZMA A;  5JDM A;  4AQF A;  3RC3 A;  5LP6 E;  3N9P A;  1EZ3 A;  3WAJ A;  2QA7 A;  3E22 E;  2E9X C;  4KP3 C;  5F3J A;  4CI3 B;  3LK4 2;  4I55 E;  2Z6E A;  3ANW A;  3QUJ A;  4ZI3 C;  2A72 A;  3ZMU B;  2Y6X A;  5LHI B;  4NUU A;  1BR4 A;  4EB6 E;  4KMC A;  4OHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...