2UU9T

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 35
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uu9T00
1N36T 2VQFT 1XNQT 5LMNT 1J5ET 1XMOT 1FJGT 4LFBT 4B3MT 4X62T 4NXMT 4JI8T 4JI5T 5LMUT 4NXNT 4LFAT 2UUBT 4DV3T 4DUZT 2E5LT 4JI7T 1N33T 4DV4T 3T1HT 4YY3T 4JI4T 1N32T 4JV5T 1XMQT 2HHHT 4JI3T 4X64T 5IWAT 4DUYT 4JI1T 1HNWT 1N34T 3T1YT 4LF4T 4KHPT 4B3TT 4JYAT 4DV1T 4DV7T 4LF8T 2ZM6T 4DR7T 2UXCT 2F4VT 1IBMT 4LF7T 4JI2T 4DV2T 1HNXT 1XNRT 1IBLT 1IBKT 4JI0T 5BR8T 4B3ST 4YHHT 4DR1T 4DR4T 4DR2T 4GKKT 4X66T 4JI6T 4DR6T 1I94T 4DR5T 1HNZT 4X65T 4DR3T 4LFCT 2UUAT 2UUCT 4DV5T 4K0KT 1HR0T 4DV0T 4LF5T 4GKJT 4B3RT 2UU9T 4LF6T 2VQET 4DV6T 3OTOT 4AQYT 4LF9T 4OX9T 2UXDT 2UXBT
chains in the Genus database with same CATH superfamily
2Q9QD 1YKEB 2BG9C 1B7TA 2Q9QB 3VHLA 1OXZA 2NP9A 3LBXA 4YJ2E 3FZKB 5L4EA 2WY2A 2YK0A 4JBWF 2X51A 3U3IA 2YINA 2QVAA 4PJJA 2XPKA 3IBPA 2WSSV 3P4WA 2HPLA 2HPJA 4NPPA 1XMQT 5LB7B 2JQ9A 2WDRA 4EIWA 2R6GF 4O8SA 2JMHA 1FMWA 4QH4A 5ADXL 3SRZA 4DR7T 2BVLA 2CWOA 3CIRA 5JDNA 4AQFA 2QA7A 4TWHA 2LM9A 4HWFA 2MAWA 2ZM8A 1UK5A 1XWMA 4G2AA 5AQUB 2CPTA 2LT3A 5J2UE 3D0TA 2VL8A 3UUNA 1HX1B 4YT0A 2XJ7A 3RQUA 3PUXF 4LF6T 5HYAA 4AKHA 4WBNE 4OFZA 4DBQA 5EK3A 1UCUA 4KUMB 3IF8B 1J1JA 4UF0B 5JREA 3L39A 3AXJB 4KMCA 3EAMA 2NWBA 3F31A 5LMUT 3L8RA 1MNEA 3N2GE 4YLHA 1OEDE 2Y48B 4TX5A 4AI6A 1M7KA 3ZT7A 3NRXA 4F8HA 4JV5T 5KXJA 2CLYC 2D2SA 3EVYA 3RI5A 4H9RC 3KVBA 2VK9A 4ILAA 4AKRB 1HNWT 3QB5A 2FJDA 3FXEB 2FUPA 3L3PA 4I55E 3ZCIA 1NEKA 3JAEA 4HFHA 5LHIB 2UXCT 2J62A 1YQ3A 1MMAA 5CA0E 4WBOA 3ZT5A 1ZV4X 2B76A 2E9XD 2V26A 5AQRB 2AE9A 2IMLA 2E9XB 1EZ3A 4AQGA 5AQNB 4JI6T 5L3BB 4PK6A 3AEEA 2YDQA 4DR5T 4QXCB 2BS3A 3IEEA 5HWYA 5JR9A 2V6XA 2JJ9A 4X1KE 4EYYR 2CCQA 4DV5T 4DNDA 3T8OA 2VASA 4L0RA 5ABFA 3RKOA 4TV8E 5CFBA 1KNPA 4EYUA 2I59A 5FVLA 5FXWA 3Q5DA 3EI0A 5LJNA 4EB6E 2IW5B 4P0AA 1J5ET 2V5CA 4ZI3C 3H3AA 3VR8A 2D9DA 4ISSA 4NXMT 1BR2A 2VWAA 3PUGA 5DQWA 5A1LA 4ILBA 2N1GA 4AKLA 1Z8UA 3ONJA 4H9OC 2EHOA 5LCYA 3ZSSA 4O2AE 5L3CB 3NKZA 4YXDA 4HWCA 5LA6E 3Q9DA 4O4JE 4IL9A 3PU3A 4DVDA 4KBMB 5H6RB 3ZC0A 4LF4T 4KHPT 3P4QA 3AEAA 3R6NA 2ODVA 5L4HA 2QRXA 2J4GA 3I9WA 4WYVA 2KSRA 4X20E 2OV9A 5CGMA 4QXBB 5BR8T 3RHWA 1D0YA 4H9QC 2CA5A 5FMNA 3FZLB 2KXPB 5FNVE 1OEDB 1O3XA 1T72A 3SS1A 2UXNB 2XZEA 4AIUA 4FJOA 4CN1A 2LSJA 4K0KT 2LHNA 4EXTA 3CWZB 2JRKA 3NWIA 3VU7H 2HH7A 1QUUA 3PUWF 4JLEA 2WAUA 2XM2A 3SFEA 2G0UA 2CM0A 2C5JA 2PG8A 4X5TA 1VCSA 2ODUA 2X0HA 2E5LT 3H3MA 2LRLA 1U5PA 1E1HB 1NAFA 5DJQC 2IC6A 3I0OA 3ZMVB 2X68A 2OLTA 2K24A 2VURA 4QXHB 2V6YA 5J2TE 3IA3A 4B3TT 1R8IA 3AA7B 3AA6B 4TUYE 5HXSA 1WR6A 5LHGB 1X9BA 3LBXB 2BKNA 2KLQA 3KFWX 1IBMT 2CMRA 2WMNA 2X66A 5HXCA 1SA0E 4UR9A 4ZZCA 4OK0A 4U74A 1OEDC 3QOFA 5GONE 2FJAA 1D1CA 5JDGA 4DR2T 4YTNA 4O4IE 1XDOA 2HN2A 3KV9A 5AQOB 5ABGA 2V7JA 3MZKB 1HX8A 1BR4A 3C4ZA 3ZYMA 4ZHQE 2UU9T 2XUEA 4HFEA 2BBHA 3AE3A 1W09A 3UULA 2DWGA 2W4XA 1YQ4A 1D1BA 3PUVF 1XMOT 4X62T 4ASKA 4IDPA 4IDZA 2KWIB 1HFAA 4ISTA 4JI7T 4HEAA 4H9PC 2ZLYA 3FB2A 4ANJA 4N78D 5HXRA 2X9YA 1H7CA 3C64A 4X64T 5AQPB 5AQHB 2X9XA 3SFDA 4CQIA 2LKHA 5LHHB 2V7LA 3CPZA 2GK9A 4DV7T 3C50A 2W2UA 3N9NA 3ZMSB 2KWHA 3AEFA 1XNRT 4QH1A 5IUXA 3NZQA 1HG5A 1WYBA 4YHHT 3NRYA 5F3JA 4FI5A 3ZN1B 5FVKA 2L9QA 3ZMTB 2WB5A 5L47A 1Y64B 2CXDA 4IE5A 3BQKA 3FZHB 1MMDA 3K1SA 2E8IA 4IDQA 3AA1B 4CI1B 1VCTA 4AQFC 5AQJB 5HXEA 2ES0A 2X67A 4MHCA 2XQ8A 5JVDE 4ZOLE 4CI3B 3CX8B 3N9PA 2YU1A 1VOMA 1LKXA 4CI2B 1MNDA 3CQGB 3JCFA 2PFVA 5JR9B 2A72A 4CZZB 3LK2B 4EZHA 1UGOA 5ABFB 3Q5XA 3PUAA 1NWMX 1N32T 5FXXA 2CE7A 2KZ7B 5DQVA 3AE1A 2XASB 4K0UA 2XAHB 2E2AA 3RIUA 3N9OA 4DV1T 1KFYA 2NTXA 5HCJA 3ZMUB 2CXFA 4IE0A 1HS7A 5BMVE 4U7YA 4UVCB 3VRBA 3RC8A 4JI0T 3HI2A 1X79A 2A9UA 1L0VA 2CEAA 2EHOD 4PAGA 5FYMA 2EHOB 5KX5E 5LYJE 2NR4A 4X66T 3PUSA 4A98A 4AKIA 4AKGA 2LRKA 1G8XA 1HR0T 1IJ5A 5IYZE 2LEHA 3GMIA 2C0SA 5JH7E 2JQQA 2M6BA 3GWHA 2ZMAA 3OTOT 3PTRB 3E08A 2UXDT 1LRZA 3CK6A 4ZI2D 5JR9C 1SHZC 5L3DB 4JI8T 1WFDA 1SE7A 3RYFE 3NBXX 2Q9QC 4OYKA 3PUYF 3ZN0B 2CHNA 2XQ3A 3KDSE 1ZP0A 4P0BA 4Q25A 4EZ4A 2BBJA 2YKSA 3HKCE 5LOVE 4PJLA 4GYRA 2BG9A 5JDLA 4J2CA 3RX6A 2WS3A 3ZCJA 2QGSA 3UU5A 4ILCA 4JI2T 2C5IT 4O4HE 4DMVA 3UUXB 3AE8A 1MMNA 4DR1T 2N9DA 2V8SV 3MACA 3CX7B 4XZCA 3RQWA 1UUSA 4QH5A 3N9LA 2NOXA 4P1NA 2UUCT 4IE4A 2BVMA 2V6YB 2JQHA 3KBUA 1XZYA 1WRDA 3KBTA 1NENA 2ZM2A 1W9RA 3AE4A 4EEBA 4HFBA 4HFVA 4AISA 3Q2MA 4YJ3E 5JDQA 3MKDA 4U31A 3AE7A 5HAXA 2PTFA 4LFAT 5C8YE 3KV6A 2D0TA 2K3WA 1BR1A 3RIFA 1QSDA 4HWDA 2XQ7A 4JI3T 3CQCB 4HKAA 3PURA 3JAFA 4UIGA 3H37A 2XM1A 2W61A 2FJEA 1VRBA 2WU2A 2MBGA 2XQ5A 3RPUA 4ZEYA 2VB6A 2F4VT 2BS4A 3LJCA 4UV9B 4KP3C 4IDOA 4YSYA 1CUNA 2HN1A 4TN7B 3F2EA 3KV5A 3QUJA 4PW8A 4EOZB 3AE5A 4HE8A 4HFCA 1S94A 2LSYA 1HNZT 2FJBA 2UUAT 3CQXC 3TLVA 4ERRA 5LG3A 3P8CD 3V5SA 1Z0PA 2E9XC 4KI0F 3UU8A 4U72A 1ZOYA 4LF5T 3P4PA 2WZHA 1LVFA 5LGUB 1DU2A 3AA0B 3FZMB 2LOPA 2VQET 4U7IA 3AE6A 4PNIA 2K9AA 2NTYA 2UXBT 3P4RA 2LSKA 1N36T 5LMNT 3RRWA 2KT9A 3UU6A 5L3GB 1KNRA 3PJAJ 1HTJF 4LMLA 4JI5T 4NIQA 2IC9A 1FMVA 1YW0A 4TV9E 4QX7B 3RYCE 3UUMA 2RP4A 2QYWA 2SPCA 2LOSA 3GA8A 4HWIB 4IE6A 2BZBA 5IWAT 4YSXA 3RYHE 3CMLA 2XQ4A 1N34T 1MMGA 3T1YT 2W0GA 4UV8B 3VRAA 2XY8B 2LSGA 2PJQA 3A8YC 3I9YA 2KINB 1JNRA 2L3LA 2XQ9A 4ZXLA 5KMGP 2UXXB 3P7IA 5LP6E 3UFGA 2Z6EA 2E5VA 2J1DG 5JQGE 1QLBA 4LFCT 2W63A 4BA9A 1HG2A 3N9MA 3BK9A 3NVOA 4DV0T 4GKJT 1M62A 2H7OA 3J9X1 2FBWA 3ZC1A 2RPAA 3PUZF 5LXTE 3ZPOA 5FL0A 3X1DA 5EZYE 2W66A 2VQFT 1T7SA 4HWHA 3FXDB 4TNWA 5FY1A 2BKPA 1T8BA 2ACXA 4YFSA 1OWAA 4HFDA 2WM9A 3LSVA 5AQMB 2XQYA 2WDQA 3AVRA 1E2AA 3BQLA 3M65A 2AXDS 2VVNA 2WMOA 5HXHA 2Y6XA 2ZM6T 1W0BA 3AAEB 4A5XA 2WP9A 4G63A 1J5WA 3EDUA 3MA9A 3GN5A 4B3ST 4PFOA 3ESLA 5HEGA 5JRCA 4YTPA 3N5LA 3JC6D 3RYIE 3PDYA 5H6QB 2DLRA 2K5BB 4M1PA 5LGTB 3CKDA 2XQAA 4COFA 4X65T 2NW7A 3EUHA 3OVUA 3ZYLA 3C4WA 3OYZA 4GYSA 3N9QA 2BG9B 3UT5E 2WQYA 4MFRA 1S35A 3S4UA 2I6HA 3QK6A 5FY0A 3UUBA 1LVKA 4H63V 3B57A 5TAOA 2DNXA 3P50A 4DV6T 3ONLC 2JPFA 5AFUL 2XHEB 5CB4E 2V7KA 3P4SA 1CHUA 3RF1A 5HEJA 3ZJ1A 5F5WA 4CN6A 2WWVA 3UU3A 5HEHA 4ZZBA 3L09A 2UUBT 2OA5A 2WDVA 5FKYA 1D0ZA 4DUZT 2B1EA 3HKEE 1N33T 2KMFA 5FP3A 4QHOA 3HKBE 4PFPA 2VKOA 2PBIA 2IAKA 5J1GA 1MIWA 4JI1T 4A97A 3EDVA 1IAPA 4LF8T 2MTQA 2YOEA 4IDNA 4UELA 1ZEEA 3A7MA 3JADA 5L3EB 4LF7T 1D0XA 4JUYA 1HNXT 4O4LE 1HF8A 3UFEA 2IUBA 3MXZA 4DO0A 3AAIA 2XAQB 1YD8G 2JQKA 4GK5E 4IIJE 3ZSTA 2CHOA 4DBRA 3ONXA 1KK7A 4ZS3A 5FXZA 3LK3B 4UVBB 3RRCA 2BKOA 3HR0A 3O1IA 2BDEA 1UX5A 4CXXA 2DL1A 2VKDA 3A5XA 2D5UA 3O1HA 2CBIA 2L8KA 3C98B 3UTKA 2WU5A 2VKJA 4HN9A 5JDHA 2MPKA 2H3RA 4C90A 1KEYA 3LFMA 4IL4A 3R84B 2NW9A 4WNKA 4MLKA 2DWKA 3PU8A 4I0UA 5L2LA 1ZKEA 2BS2A 2CLYB 4GK0E 5ETWA 1BR0A 5F8PA 3LDQB 3ANWA 4DV4T 4TZ4C 4U2YA 4QKNA 4TNVA 3RIAA 5HCMA 4ILUA 4DUYT 3HL6A 4YHJA 2CBJA 2XAFB 4QX8B 2V1DB 2DHRA 4WZXA 2W62A 2WWUA 3KINB 2M67A 4EV6A 2ACZA 3MJXA 3B5MA 3QB5K 4MALA 2VKHA 1ZHCA 2IHR1 5AQKB 2P9BA 4MBQA 3Q5EA 3EHZA 4I43B 1WCRA 3G06A 3BQIA 2CXLA 2EHOC 3K3NA 1Y01A 4B3RT 4ZI3D 2Y8DA 4OYJA 4KX6A 2LE8A 2DCFA 5AQTB 4HGAA 3WI3A 1YKHB 4LFBT 3AEDA 3HA4A 4H9SE 4QWNB 4F6RC 1E7PA 3KVAA 3DP7A 4ZI2C 4YY3T 3AE2A 1WR0A 5JTGA 2ZM0A 5AQVB 3DJBA 3E22E 2C5KT 5EK4A 4JYAT 2N2NA 4I4TE 2XAGB 2NW8A 2J47A 5LG4A 4ZI7E 2LLYA 5AQIB 1UURA 2V5DA 2LKGA 4AXPA 4TWDA 2WZIA 3FHNA 3NZPA 3CX6B 4XBFB 2H88A 2V7MA 2Q9QA 3FBZA 4JEHB 2V7IA 2XSBA 2LHRA 3QNUA 3K3QC 4HTEA 4DR6T 4PJNA 4ADZA 3ZT6A 3C51A 3N2KE 4O2BE 2H89A 3TLSA 3O4XE 1WYCA 4H63H 3VKHA 1W0AA 2MYSA 2I0MA 3DTOA 4UEMA 2JIWA 3TLTA 4V1Av 1T98A 3U78A 5M4YA 5JDFA 1IZNB 4PK5A 1I6ZA 4PK4A 3CVRA 3RC3A 3GN5B 5CJ5A 5JRCB 4IGUA 4NUVA 4Z91A 5DABA 3TLWA 1YXRA 4YTMA 4DV3T 2KNDA 4C91A 5HWXA 2A3DA 2MOZA 5C3JA 4GIWA 3UQ4A 1KF6A 5AQGB 3RH3A 2XAJB 3ZMZB 1MIYA 3RLFF 1XDPA 2VL0A 3MK7C 5AQLB 5KDMC 4BJNA 3OPCA 4IREA 2H7VC 2W00A 2X9WA 2XTLA 4LMJA 3RKGA 3E0ZA 5LBQB 4H9NC 4A56A 2A2FX 1KNZA 4E7ZA 4IT4A 2YEVC 4L5GA 4UF0A 2BG9E 3IHRA 3OYXA 3AXJA 3HKDE 4P09A 1HCIA 2LJLA 3OJAA 3AVSA 2W67A 4HFIA 3TLUA 2X0YA 2RA1A 2X0LB 4GOUA 1IJ6A 4DMWA 1FIOA 5HEUA 2LSIA 5LNKA 5IHYA 3W15B 2YU2A 3B13A 4B6XA 2DI4A 4ZS2A 5LJMA 4UVAB 2XQ6A 4IHJE 4WW0A 1XNQT 1WLXA 4XAXB 3VKGA 1FJGT 2CWYA 2K48A 3AEBA 5LBMA 4B3MT 5EK2A 3O1JA 3UQ7A 3M3ZB 1MIVA 3T1HT 5L3FB 2E9XA 3ZKRA 4JI4T 5LGNB 4U3CA 3V5UA 1UX4A 3PUQA 3FZFB 3SOLA 5FXVA 4IE7A 4PJMA 3ETUA 3OBVE 3AAAB 4BAYB 3ZEFB 4DV2T 3N2OA 1V9DA 1IBKT 3ABVA 3ETVA 3ANWB 5AQFB 2IDOB 4DR4T 4GKKT 1I94T 4LMKA 4EGWA 3AB3B 5ABEA 1FEWA 4YSZA 5J0ZA 3F57A 3EABA 5FL1A 3RIUC 3KV4A 5ABHA 4AQYT 4LF9T 4OX9T 1G73A 3TKLB 4L9IA 4DIDB 2LM2A 4KHZF 3UU4A 3WAKA 2M6IA 3PV0F 3O9XA 3LG7A 2XSAA 1US7B 3I0QA 3K8PC 4NXNT 3Q5WA 4CXYA 5HEOA 5C2TA 3ZLIA 1JNZA 2YDRA 4UXNB 4X1IE 3AE9A 4E7SA 1U4QA 2JMKA 1OEDA 2IIUA 3VR9A 2HHHT 5E0OA 4TWFA 3K3OA 4X1YE 4Z8XA 5AQSB 3J7Yq 2YDSA 4EAHA 3ZYKA 4U33A 5AQQB 3ZJ2A 4BJMA 4EEDA 2X9HA 2YN6A 4Z90A 2D0UA 3WAJA 4I50E 1AJ3A 3OKQA 1SUMB 5CA1E 1GQEA 1IBLT 1D1AA 4NUUA 3AEGA 3I1AA 2WCAA 3C4XA 2VVSA 4DR3T 4OHFA 4JEUB 3RGLA 2CRBA 3SWHA 3PE0A 3AECA 2WBLA 5FY7A 4CN4A 3JC6C 3LK42 3FBLA 3QC9A 5JDMA 3PJAA 4U2ZA 4CXWA
chains in the Genus database with same CATH topology
1N36T 2VQFT 1XNQT 5LMNT 1J5ET 1XMOT 1FJGT 4LFBT 4B3MT 4X62T 4NXMT 4JI8T 4JI5T 5LMUT 4NXNT 4LFAT 2UUBT 4DV3T 4DUZT 2E5LT 4JI7T 1N33T 4DV4T 3T1HT 4YY3T 4JI4T 1N32T 4JV5T 1XMQT 2HHHT 4JI3T 4X64T 5IWAT 4DUYT 4JI1T 1HNWT 1N34T 3T1YT 4LF4T 4KHPT 4B3TT 4JYAT 4DV1T 4DV7T 4LF8T 2ZM6T 4DR7T 2UXCT 2F4VT 1IBMT 4LF7T 4JI2T 4DV2T 1HNXT 1XNRT 1IBLT 1IBKT 4JI0T 5BR8T 4B3ST 4YHHT 4DR1T 4DR4T 4DR2T 4GKKT 4X66T 4JI6T 4DR6T 1I94T 4DR5T 1HNZT 4X65T 4DR3T 4LFCT 2UUAT 2UUCT 4DV5T 4K0KT 1HR0T 4DV0T 4LF5T 4GKJT 4B3RT 2UU9T 4LF6T 2VQET 4DV6T 3OTOT 4AQYT 4LF9T 4OX9T 2UXDT 2UXBT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 T;  2VQF T;  1XNQ T;  5LMN T;  1J5E T;  1XMO T;  1FJG T;  4LFB T;  4B3M T;  4X62 T;  4NXM T;  4JI8 T;  4JI5 T;  5LMU T;  4NXN T;  4LFA T;  2UUB T;  4DV3 T;  4DUZ T;  2E5L T;  4JI7 T;  1N33 T;  4DV4 T;  3T1H T;  4YY3 T;  4JI4 T;  1N32 T;  4JV5 T;  1XMQ T;  2HHH T;  4JI3 T;  4X64 T;  5IWA T;  4DUY T;  4JI1 T;  1HNW T;  1N34 T;  3T1Y T;  4LF4 T;  4KHP T;  4B3T T;  4JYA T;  4DV1 T;  4DV7 T;  4LF8 T;  2ZM6 T;  4DR7 T;  2UXC T;  2F4V T;  1IBM T;  4LF7 T;  4JI2 T;  4DV2 T;  1HNX T;  1XNR T;  1IBL T;  1IBK T;  4JI0 T;  5BR8 T;  4B3S T;  4YHH T;  4DR1 T;  4DR4 T;  4DR2 T;  4GKK T;  4X66 T;  4JI6 T;  4DR6 T;  1I94 T;  4DR5 T;  1HNZ T;  4X65 T;  4DR3 T;  4LFC T;  2UUA T;  2UUC T;  4DV5 T;  4K0K T;  1HR0 T;  4DV0 T;  4LF5 T;  4GKJ T;  4B3R T;  2UU9 T;  4LF6 T;  2VQE T;  4DV6 T;  3OTO T;  4AQY T;  4LF9 T;  4OX9 T;  2UXD T;  2UXB T; 
#chains in the Genus database with same CATH topology
 2Q9Q D;  1YKE B;  2BG9 C;  1B7T A;  2Q9Q B;  3VHL A;  1OXZ A;  2NP9 A;  3LBX A;  4YJ2 E;  3FZK B;  5L4E A;  2WY2 A;  2YK0 A;  4JBW F;  2X51 A;  3U3I A;  2YIN A;  2QVA A;  4PJJ A;  2XPK A;  3IBP A;  2WSS V;  3P4W A;  2HPL A;  2HPJ A;  4NPP A;  1XMQ T;  5LB7 B;  2JQ9 A;  2WDR A;  4EIW A;  2R6G F;  4O8S A;  2JMH A;  1FMW A;  4QH4 A;  5ADX L;  3SRZ A;  4DR7 T;  2BVL A;  2CWO A;  3CIR A;  5JDN A;  4AQF A;  2QA7 A;  4TWH A;  2LM9 A;  4HWF A;  2MAW A;  2ZM8 A;  1UK5 A;  1XWM A;  4G2A A;  5AQU B;  2CPT A;  2LT3 A;  5J2U E;  3D0T A;  2VL8 A;  3UUN A;  1HX1 B;  4YT0 A;  2XJ7 A;  3RQU A;  3PUX F;  4LF6 T;  5HYA A;  4AKH A;  4WBN E;  4OFZ A;  4DBQ A;  5EK3 A;  1UCU A;  4KUM B;  3IF8 B;  1J1J A;  4UF0 B;  5JRE A;  3L39 A;  3AXJ B;  4KMC A;  3EAM A;  2NWB A;  3F31 A;  5LMU T;  3L8R A;  1MNE A;  3N2G E;  4YLH A;  1OED E;  2Y48 B;  4TX5 A;  4AI6 A;  1M7K A;  3ZT7 A;  3NRX A;  4F8H A;  4JV5 T;  5KXJ A;  2CLY C;  2D2S A;  3EVY A;  3RI5 A;  4H9R C;  3KVB A;  2VK9 A;  4ILA A;  4AKR B;  1HNW T;  3QB5 A;  2FJD A;  3FXE B;  2FUP A;  3L3P A;  4I55 E;  3ZCI A;  1NEK A;  3JAE A;  4HFH A;  5LHI B;  2UXC T;  2J62 A;  1YQ3 A;  1MMA A;  5CA0 E;  4WBO A;  3ZT5 A;  1ZV4 X;  2B76 A;  2E9X D;  2V26 A;  5AQR B;  2AE9 A;  2IML A;  2E9X B;  1EZ3 A;  4AQG A;  5AQN B;  4JI6 T;  5L3B B;  4PK6 A;  3AEE A;  2YDQ A;  4DR5 T;  4QXC B;  2BS3 A;  3IEE A;  5HWY A;  5JR9 A;  2V6X A;  2JJ9 A;  4X1K E;  4EYY R;  2CCQ A;  4DV5 T;  4DND A;  3T8O A;  2VAS A;  4L0R A;  5ABF A;  3RKO A;  4TV8 E;  5CFB A;  1KNP A;  4EYU A;  2I59 A;  5FVL A;  5FXW A;  3Q5D A;  3EI0 A;  5LJN A;  4EB6 E;  2IW5 B;  4P0A A;  1J5E T;  2V5C A;  4ZI3 C;  3H3A A;  3VR8 A;  2D9D A;  4ISS A;  4NXM T;  1BR2 A;  2VWA A;  3PUG A;  5DQW A;  5A1L A;  4ILB A;  2N1G A;  4AKL A;  1Z8U A;  3ONJ A;  4H9O C;  2EHO A;  5LCY A;  3ZSS A;  4O2A E;  5L3C B;  3NKZ A;  4YXD A;  4HWC A;  5LA6 E;  3Q9D A;  4O4J E;  4IL9 A;  3PU3 A;  4DVD A;  4KBM B;  5H6R B;  3ZC0 A;  4LF4 T;  4KHP T;  3P4Q A;  3AEA A;  3R6N A;  2ODV A;  5L4H A;  2QRX A;  2J4G A;  3I9W A;  4WYV A;  2KSR A;  4X20 E;  2OV9 A;  5CGM A;  4QXB B;  5BR8 T;  3RHW A;  1D0Y A;  4H9Q C;  2CA5 A;  5FMN A;  3FZL B;  2KXP B;  5FNV E;  1OED B;  1O3X A;  1T72 A;  3SS1 A;  2UXN B;  2XZE A;  4AIU A;  4FJO A;  4CN1 A;  2LSJ A;  4K0K T;  2LHN A;  4EXT A;  3CWZ B;  2JRK A;  3NWI A;  3VU7 H;  2HH7 A;  1QUU A;  3PUW F;  4JLE A;  2WAU A;  2XM2 A;  3SFE A;  2G0U A;  2CM0 A;  2C5J A;  2PG8 A;  4X5T A;  1VCS A;  2ODU A;  2X0H A;  2E5L T;  3H3M A;  2LRL A;  1U5P A;  1E1H B;  1NAF A;  5DJQ C;  2IC6 A;  3I0O A;  3ZMV B;  2X68 A;  2OLT A;  2K24 A;  2VUR A;  4QXH B;  2V6Y A;  5J2T E;  3IA3 A;  4B3T T;  1R8I A;  3AA7 B;  3AA6 B;  4TUY E;  5HXS A;  1WR6 A;  5LHG B;  1X9B A;  3LBX B;  2BKN A;  2KLQ A;  3KFW X;  1IBM T;  2CMR A;  2WMN A;  2X66 A;  5HXC A;  1SA0 E;  4UR9 A;  4ZZC A;  4OK0 A;  4U74 A;  1OED C;  3QOF A;  5GON E;  2FJA A;  1D1C A;  5JDG A;  4DR2 T;  4YTN A;  4O4I E;  1XDO A;  2HN2 A;  3KV9 A;  5AQO B;  5ABG A;  2V7J A;  3MZK B;  1HX8 A;  1BR4 A;  3C4Z A;  3ZYM A;  4ZHQ E;  2UU9 T;  2XUE A;  4HFE A;  2BBH A;  3AE3 A;  1W09 A;  3UUL A;  2DWG A;  2W4X A;  1YQ4 A;  1D1B A;  3PUV F;  1XMO T;  4X62 T;  4ASK A;  4IDP A;  4IDZ A;  2KWI B;  1HFA A;  4IST A;  4JI7 T;  4HEA A;  4H9P C;  2ZLY A;  3FB2 A;  4ANJ A;  4N78 D;  5HXR A;  2X9Y A;  1H7C A;  3C64 A;  4X64 T;  5AQP B;  5AQH B;  2X9X A;  3SFD A;  4CQI A;  2LKH A;  5LHH B;  2V7L A;  3CPZ A;  2GK9 A;  4DV7 T;  3C50 A;  2W2U A;  3N9N A;  3ZMS B;  2KWH A;  3AEF A;  1XNR T;  4QH1 A;  5IUX A;  3NZQ A;  1HG5 A;  1WYB A;  4YHH T;  3NRY A;  5F3J A;  4FI5 A;  3ZN1 B;  5FVK A;  2L9Q A;  3ZMT B;  2WB5 A;  5L47 A;  1Y64 B;  2CXD A;  4IE5 A;  3BQK A;  3FZH B;  1MMD A;  3K1S A;  2E8I A;  4IDQ A;  3AA1 B;  4CI1 B;  1VCT A;  4AQF C;  5AQJ B;  5HXE A;  2ES0 A;  2X67 A;  4MHC A;  2XQ8 A;  5JVD E;  4ZOL E;  4CI3 B;  3CX8 B;  3N9P A;  2YU1 A;  1VOM A;  1LKX A;  4CI2 B;  1MND A;  3CQG B;  3JCF A;  2PFV A;  5JR9 B;  2A72 A;  4CZZ B;  3LK2 B;  4EZH A;  1UGO A;  5ABF B;  3Q5X A;  3PUA A;  1NWM X;  1N32 T;  5FXX A;  2CE7 A;  2KZ7 B;  5DQV A;  3AE1 A;  2XAS B;  4K0U A;  2XAH B;  2E2A A;  3RIU A;  3N9O A;  4DV1 T;  1KFY A;  2NTX A;  5HCJ A;  3ZMU B;  2CXF A;  4IE0 A;  1HS7 A;  5BMV E;  4U7Y A;  4UVC B;  3VRB A;  3RC8 A;  4JI0 T;  3HI2 A;  1X79 A;  2A9U A;  1L0V A;  2CEA A;  2EHO D;  4PAG A;  5FYM A;  2EHO B;  5KX5 E;  5LYJ E;  2NR4 A;  4X66 T;  3PUS A;  4A98 A;  4AKI A;  4AKG A;  2LRK A;  1G8X A;  1HR0 T;  1IJ5 A;  5IYZ E;  2LEH A;  3GMI A;  2C0S A;  5JH7 E;  2JQQ A;  2M6B A;  3GWH A;  2ZMA A;  3OTO T;  3PTR B;  3E08 A;  2UXD T;  1LRZ A;  3CK6 A;  4ZI2 D;  5JR9 C;  1SHZ C;  5L3D B;  4JI8 T;  1WFD A;  1SE7 A;  3RYF E;  3NBX X;  2Q9Q C;  4OYK A;  3PUY F;  3ZN0 B;  2CHN A;  2XQ3 A;  3KDS E;  1ZP0 A;  4P0B A;  4Q25 A;  4EZ4 A;  2BBJ A;  2YKS A;  3HKC E;  5LOV E;  4PJL A;  4GYR A;  2BG9 A;  5JDL A;  4J2C A;  3RX6 A;  2WS3 A;  3ZCJ A;  2QGS A;  3UU5 A;  4ILC A;  4JI2 T;  2C5I T;  4O4H E;  4DMV A;  3UUX B;  3AE8 A;  1MMN A;  4DR1 T;  2N9D A;  2V8S V;  3MAC A;  3CX7 B;  4XZC A;  3RQW A;  1UUS A;  4QH5 A;  3N9L A;  2NOX A;  4P1N A;  2UUC T;  4IE4 A;  2BVM A;  2V6Y B;  2JQH A;  3KBU A;  1XZY A;  1WRD A;  3KBT A;  1NEN A;  2ZM2 A;  1W9R A;  3AE4 A;  4EEB A;  4HFB A;  4HFV A;  4AIS A;  3Q2M A;  4YJ3 E;  5JDQ A;  3MKD A;  4U31 A;  3AE7 A;  5HAX A;  2PTF A;  4LFA T;  5C8Y E;  3KV6 A;  2D0T A;  2K3W A;  1BR1 A;  3RIF A;  1QSD A;  4HWD A;  2XQ7 A;  4JI3 T;  3CQC B;  4HKA A;  3PUR A;  3JAF A;  4UIG A;  3H37 A;  2XM1 A;  2W61 A;  2FJE A;  1VRB A;  2WU2 A;  2MBG A;  2XQ5 A;  3RPU A;  4ZEY A;  2VB6 A;  2F4V T;  2BS4 A;  3LJC A;  4UV9 B;  4KP3 C;  4IDO A;  4YSY A;  1CUN A;  2HN1 A;  4TN7 B;  3F2E A;  3KV5 A;  3QUJ A;  4PW8 A;  4EOZ B;  3AE5 A;  4HE8 A;  4HFC A;  1S94 A;  2LSY A;  1HNZ T;  2FJB A;  2UUA T;  3CQX C;  3TLV A;  4ERR A;  5LG3 A;  3P8C D;  3V5S A;  1Z0P A;  2E9X C;  4KI0 F;  3UU8 A;  4U72 A;  1ZOY A;  4LF5 T;  3P4P A;  2WZH A;  1LVF A;  5LGU B;  1DU2 A;  3AA0 B;  3FZM B;  2LOP A;  2VQE T;  4U7I A;  3AE6 A;  4PNI A;  2K9A A;  2NTY A;  2UXB T;  3P4R A;  2LSK A;  1N36 T;  5LMN T;  3RRW A;  2KT9 A;  3UU6 A;  5L3G B;  1KNR A;  3PJA J;  1HTJ F;  4LML A;  4JI5 T;  4NIQ A;  2IC9 A;  1FMV A;  1YW0 A;  4TV9 E;  4QX7 B;  3RYC E;  3UUM A;  2RP4 A;  2QYW A;  2SPC A;  2LOS A;  3GA8 A;  4HWI B;  4IE6 A;  2BZB A;  5IWA T;  4YSX A;  3RYH E;  3CML A;  2XQ4 A;  1N34 T;  1MMG A;  3T1Y T;  2W0G A;  4UV8 B;  3VRA A;  2XY8 B;  2LSG A;  2PJQ A;  3A8Y C;  3I9Y A;  2KIN B;  1JNR A;  2L3L A;  2XQ9 A;  4ZXL A;  5KMG P;  2UXX B;  3P7I A;  5LP6 E;  3UFG A;  2Z6E A;  2E5V A;  2J1D G;  5JQG E;  1QLB A;  4LFC T;  2W63 A;  4BA9 A;  1HG2 A;  3N9M A;  3BK9 A;  3NVO A;  4DV0 T;  4GKJ T;  1M62 A;  2H7O A;  3J9X 1;  2FBW A;  3ZC1 A;  2RPA A;  3PUZ F;  5LXT E;  3ZPO A;  5FL0 A;  3X1D A;  5EZY E;  2W66 A;  2VQF T;  1T7S A;  4HWH A;  3FXD B;  4TNW A;  5FY1 A;  2BKP A;  1T8B A;  2ACX A;  4YFS A;  1OWA A;  4HFD A;  2WM9 A;  3LSV A;  5AQM B;  2XQY A;  2WDQ A;  3AVR A;  1E2A A;  3BQL A;  3M65 A;  2AXD S;  2VVN A;  2WMO A;  5HXH A;  2Y6X A;  2ZM6 T;  1W0B A;  3AAE B;  4A5X A;  2WP9 A;  4G63 A;  1J5W A;  3EDU A;  3MA9 A;  3GN5 A;  4B3S T;  4PFO A;  3ESL A;  5HEG A;  5JRC A;  4YTP A;  3N5L A;  3JC6 D;  3RYI E;  3PDY A;  5H6Q B;  2DLR A;  2K5B B;  4M1P A;  5LGT B;  3CKD A;  2XQA A;  4COF A;  4X65 T;  2NW7 A;  3EUH A;  3OVU A;  3ZYL A;  3C4W A;  3OYZ A;  4GYS A;  3N9Q A;  2BG9 B;  3UT5 E;  2WQY A;  4MFR A;  1S35 A;  3S4U A;  2I6H A;  3QK6 A;  5FY0 A;  3UUB A;  1LVK A;  4H63 V;  3B57 A;  5TAO A;  2DNX A;  3P50 A;  4DV6 T;  3ONL C;  2JPF A;  5AFU L;  2XHE B;  5CB4 E;  2V7K A;  3P4S A;  1CHU A;  3RF1 A;  5HEJ A;  3ZJ1 A;  5F5W A;  4CN6 A;  2WWV A;  3UU3 A;  5HEH A;  4ZZB A;  3L09 A;  2UUB T;  2OA5 A;  2WDV A;  5FKY A;  1D0Z A;  4DUZ T;  2B1E A;  3HKE E;  1N33 T;  2KMF A;  5FP3 A;  4QHO A;  3HKB E;  4PFP A;  2VKO A;  2PBI A;  2IAK A;  5J1G A;  1MIW A;  4JI1 T;  4A97 A;  3EDV A;  1IAP A;  4LF8 T;  2MTQ A;  2YOE A;  4IDN A;  4UEL A;  1ZEE A;  3A7M A;  3JAD A;  5L3E B;  4LF7 T;  1D0X A;  4JUY A;  1HNX T;  4O4L E;  1HF8 A;  3UFE A;  2IUB A;  3MXZ A;  4DO0 A;  3AAI A;  2XAQ B;  1YD8 G;  2JQK A;  4GK5 E;  4IIJ E;  3ZST A;  2CHO A;  4DBR A;  3ONX A;  1KK7 A;  4ZS3 A;  5FXZ A;  3LK3 B;  4UVB B;  3RRC A;  2BKO A;  3HR0 A;  3O1I A;  2BDE A;  1UX5 A;  4CXX A;  2DL1 A;  2VKD A;  3A5X A;  2D5U A;  3O1H A;  2CBI A;  2L8K A;  3C98 B;  3UTK A;  2WU5 A;  2VKJ A;  4HN9 A;  5JDH A;  2MPK A;  2H3R A;  4C90 A;  1KEY A;  3LFM A;  4IL4 A;  3R84 B;  2NW9 A;  4WNK A;  4MLK A;  2DWK A;  3PU8 A;  4I0U A;  5L2L A;  1ZKE A;  2BS2 A;  2CLY B;  4GK0 E;  5ETW A;  1BR0 A;  5F8P A;  3LDQ B;  3ANW A;  4DV4 T;  4TZ4 C;  4U2Y A;  4QKN A;  4TNV A;  3RIA A;  5HCM A;  4ILU A;  4DUY T;  3HL6 A;  4YHJ A;  2CBJ A;  2XAF B;  4QX8 B;  2V1D B;  2DHR A;  4WZX A;  2W62 A;  2WWU A;  3KIN B;  2M67 A;  4EV6 A;  2ACZ A;  3MJX A;  3B5M A;  3QB5 K;  4MAL A;  2VKH A;  1ZHC A;  2IHR 1;  5AQK B;  2P9B A;  4MBQ A;  3Q5E A;  3EHZ A;  4I43 B;  1WCR A;  3G06 A;  3BQI A;  2CXL A;  2EHO C;  3K3N A;  1Y01 A;  4B3R T;  4ZI3 D;  2Y8D A;  4OYJ A;  4KX6 A;  2LE8 A;  2DCF A;  5AQT B;  4HGA A;  3WI3 A;  1YKH B;  4LFB T;  3AED A;  3HA4 A;  4H9S E;  4QWN B;  4F6R C;  1E7P A;  3KVA A;  3DP7 A;  4ZI2 C;  4YY3 T;  3AE2 A;  1WR0 A;  5JTG A;  2ZM0 A;  5AQV B;  3DJB A;  3E22 E;  2C5K T;  5EK4 A;  4JYA T;  2N2N A;  4I4T E;  2XAG B;  2NW8 A;  2J47 A;  5LG4 A;  4ZI7 E;  2LLY A;  5AQI B;  1UUR A;  2V5D A;  2LKG A;  4AXP A;  4TWD A;  2WZI A;  3FHN A;  3NZP A;  3CX6 B;  4XBF B;  2H88 A;  2V7M A;  2Q9Q A;  3FBZ A;  4JEH B;  2V7I A;  2XSB A;  2LHR A;  3QNU A;  3K3Q C;  4HTE A;  4DR6 T;  4PJN A;  4ADZ A;  3ZT6 A;  3C51 A;  3N2K E;  4O2B E;  2H89 A;  3TLS A;  3O4X E;  1WYC A;  4H63 H;  3VKH A;  1W0A A;  2MYS A;  2I0M A;  3DTO A;  4UEM A;  2JIW A;  3TLT A;  4V1A v;  1T98 A;  3U78 A;  5M4Y A;  5JDF A;  1IZN B;  4PK5 A;  1I6Z A;  4PK4 A;  3CVR A;  3RC3 A;  3GN5 B;  5CJ5 A;  5JRC B;  4IGU A;  4NUV A;  4Z91 A;  5DAB A;  3TLW A;  1YXR A;  4YTM A;  4DV3 T;  2KND A;  4C91 A;  5HWX A;  2A3D A;  2MOZ A;  5C3J A;  4GIW A;  3UQ4 A;  1KF6 A;  5AQG B;  3RH3 A;  2XAJ B;  3ZMZ B;  1MIY A;  3RLF F;  1XDP A;  2VL0 A;  3MK7 C;  5AQL B;  5KDM C;  4BJN A;  3OPC A;  4IRE A;  2H7V C;  2W00 A;  2X9W A;  2XTL A;  4LMJ A;  3RKG A;  3E0Z A;  5LBQ B;  4H9N C;  4A56 A;  2A2F X;  1KNZ A;  4E7Z A;  4IT4 A;  2YEV C;  4L5G A;  4UF0 A;  2BG9 E;  3IHR A;  3OYX A;  3AXJ A;  3HKD E;  4P09 A;  1HCI A;  2LJL A;  3OJA A;  3AVS A;  2W67 A;  4HFI A;  3TLU A;  2X0Y A;  2RA1 A;  2X0L B;  4GOU A;  1IJ6 A;  4DMW A;  1FIO A;  5HEU A;  2LSI A;  5LNK A;  5IHY A;  3W15 B;  2YU2 A;  3B13 A;  4B6X A;  2DI4 A;  4ZS2 A;  5LJM A;  4UVA B;  2XQ6 A;  4IHJ E;  4WW0 A;  1XNQ T;  1WLX A;  4XAX B;  3VKG A;  1FJG T;  2CWY A;  2K48 A;  3AEB A;  5LBM A;  4B3M T;  5EK2 A;  3O1J A;  3UQ7 A;  3M3Z B;  1MIV A;  3T1H T;  5L3F B;  2E9X A;  3ZKR A;  4JI4 T;  5LGN B;  4U3C A;  3V5U A;  1UX4 A;  3PUQ A;  3FZF B;  3SOL A;  5FXV A;  4IE7 A;  4PJM A;  3ETU A;  3OBV E;  3AAA B;  4BAY B;  3ZEF B;  4DV2 T;  3N2O A;  1V9D A;  1IBK T;  3ABV A;  3ETV A;  3ANW B;  5AQF B;  2IDO B;  4DR4 T;  4GKK T;  1I94 T;  4LMK A;  4EGW A;  3AB3 B;  5ABE A;  1FEW A;  4YSZ A;  5J0Z A;  3F57 A;  3EAB A;  5FL1 A;  3RIU C;  3KV4 A;  5ABH A;  4AQY T;  4LF9 T;  4OX9 T;  1G73 A;  3TKL B;  4L9I A;  4DID B;  2LM2 A;  4KHZ F;  3UU4 A;  3WAK A;  2M6I A;  3PV0 F;  3O9X A;  3LG7 A;  2XSA A;  1US7 B;  3I0Q A;  3K8P C;  4NXN T;  3Q5W A;  4CXY A;  5HEO A;  5C2T A;  3ZLI A;  1JNZ A;  2YDR A;  4UXN B;  4X1I E;  3AE9 A;  4E7S A;  1U4Q A;  2JMK A;  1OED A;  2IIU A;  3VR9 A;  2HHH T;  5E0O A;  4TWF A;  3K3O A;  4X1Y E;  4Z8X A;  5AQS B;  3J7Y q;  2YDS A;  4EAH A;  3ZYK A;  4U33 A;  5AQQ B;  3ZJ2 A;  4BJM A;  4EED A;  2X9H A;  2YN6 A;  4Z90 A;  2D0U A;  3WAJ A;  4I50 E;  1AJ3 A;  3OKQ A;  1SUM B;  5CA1 E;  1GQE A;  1IBL T;  1D1A A;  4NUU A;  3AEG A;  3I1A A;  2WCA A;  3C4X A;  2VVS A;  4DR3 T;  4OHF A;  4JEU B;  3RGL A;  2CRB A;  3SWH A;  3PE0 A;  3AEC A;  2WBL A;  5FY7 A;  4CN4 A;  3JC6 C;  3LK4 2;  3FBL A;  3QC9 A;  5JDM A;  3PJA A;  4U2Z A;  4CXW A; 
#chains in the Genus database with same CATH homology
 1N36 T;  2VQF T;  1XNQ T;  5LMN T;  1J5E T;  1XMO T;  1FJG T;  4LFB T;  4B3M T;  4X62 T;  4NXM T;  4JI8 T;  4JI5 T;  5LMU T;  4NXN T;  4LFA T;  2UUB T;  4DV3 T;  4DUZ T;  2E5L T;  4JI7 T;  1N33 T;  4DV4 T;  3T1H T;  4YY3 T;  4JI4 T;  1N32 T;  4JV5 T;  1XMQ T;  2HHH T;  4JI3 T;  4X64 T;  5IWA T;  4DUY T;  4JI1 T;  1HNW T;  1N34 T;  3T1Y T;  4LF4 T;  4KHP T;  4B3T T;  4JYA T;  4DV1 T;  4DV7 T;  4LF8 T;  2ZM6 T;  4DR7 T;  2UXC T;  2F4V T;  1IBM T;  4LF7 T;  4JI2 T;  4DV2 T;  1HNX T;  1XNR T;  1IBL T;  1IBK T;  4JI0 T;  5BR8 T;  4B3S T;  4YHH T;  4DR1 T;  4DR4 T;  4DR2 T;  4GKK T;  4X66 T;  4JI6 T;  4DR6 T;  1I94 T;  4DR5 T;  1HNZ T;  4X65 T;  4DR3 T;  4LFC T;  2UUA T;  2UUC T;  4DV5 T;  4K0K T;  1HR0 T;  4DV0 T;  4LF5 T;  4GKJ T;  4B3R T;  2UU9 T;  4LF6 T;  2VQE T;  4DV6 T;  3OTO T;  4AQY T;  4LF9 T;  4OX9 T;  2UXD T;  2UXB T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...