4X62T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x62T00
4DV7T 4DUZT 4DR2T 1N33T 4LFCT 5LMUT 4JI2T 4X65T 4K0KT 2HHHT 4JI3T 2UUCT 1XMOT 1XNRT 4JYAT 4LF6T 4B3TT 4DV2T 4DV6T 2VQFT 4LF4T 2UUAT 4JI0T 2UUBT 3OTOT 3T1HT 4NXNT 1HNZT 4JI4T 1IBMT 3T1YT 4DV5T 2UU9T 4JI6T 4DR3T 1HNWT 1XMQT 4YHHT 1FJGT 1IBKT 4JI1T 2UXDT 4AQYT 1IBLT 4DR5T 5IWAT 4DR7T 4GKKT 4DV0T 4DR6T 4LFAT 4DR4T 4DV1T 4LF7T 2VQET 4JV5T 4LF8T 4X62T 1I94T 1XNQT 4LF9T 4JI8T 4LFBT 2UXBT 4KHPT 4OX9T 1HNXT 4X66T 4NXMT 5BR8T 1HR0T 4JI5T 2UXCT 4B3ST 4YY3T 1N34T 2F4VT 4DUYT 4GKJT 1N32T 2ZM6T 5LMNT 4DV3T 4LF5T 4DR1T 1N36T 4JI7T 2E5LT 1J5ET 4B3MT 4B3RT 4DV4T 4X64T
chains in the Genus database with same CATH superfamily
2M67A 4BJMA 1Y64B 3ZSTA 2XQ5A 3P4QA 3N2OA 5HEGA 2W00A 1KK7A 2WP9A 4MLKA 4N78D 3SFDA 2BS3A 3IEEA 4HWFA 5AQNB 5LMUT 3RI5A 2Z6EA 4JI2T 3X1DA 5JDHA 2OV9A 4TNWA 2W61A 2BKOA 1MMAA 2CE7A 2H89A 1MNEA 2XQ3A 3AXJB 5AQOB 4IL4A 4HKAA 3ZCJA 3IF8B 3KVBA 4CXXA 3QUJA 4DVDA 2XQ6A 3DP7A 1S35A 3P4WA 1W09A 4TX5A 4UV9B 1XNRT 2WDVA 5JRCB 3MACA 5JVDE 1BR4A 2BZBA 3QNUA 4BAYB 3EVYA 2W67A 4CZZB 2D9DA 3IHRA 5LCYA 1OXZA 1QUUA 4O2AE 4OYKA 1DU2A 2WZHA 3C4WA 3V5SA 4QH1A 4X20E 4JI0T 1MMNA 2V5CA 3RLFF 4BJNA 2UUBT 1MIVA 4PJNA 3EUHA 4A56A 4PFPA 4KBMB 4HFDA 3ZT6A 5C2TA 2QGSA 2E9XA 4FI5A 3FZHB 2OLTA 3CMLA 1J5WA 3KDSE 2E9XC 4P09A 5EZYE 3JC6C 3OPCA 3S4UA 5AQLB 2LSGA 2XAGB 3CPZA 3ESLA 4MFRA 5JQGE 3NZPA 2CHNA 4AI6A 2YEVC 3PUVF 3NWIA 1XZYA 5AQIB 3ZJ1A 3ZMZB 5AQFB 3V5UA 2M6IA 3AAAB 2YK0A 4I0UA 3K1SA 3AE9A 3WAKA 2K5BB 1D1CA 3HKEE 2RA1A 1XMQT 2Q9QA 1FJGT 2A2FX 4HFCA 3ZPOA 1WCRA 2X66A 4AXPA 2CXFA 1MMGA 2HPJA 2VWAA 3L3PA 4H63V 4OYJA 3UULA 2Q9QD 3CWZB 4PK6A 2NP9A 3U3IA 2PFVA 3AAIA 4EB6E 4UELA 3AA1B 5CB4E 4ASKA 2L3LA 3LK3B 4WZXA 1KNRA 1UUSA 4YJ2E 1FIOA 4UIGA 5LHIB 1MMDA 2KXPB 1IBLT 2ZLYA 4GYSA 1T72A 1W9RA 3AE2A 4V1Av 4NUVA 5FXZA 3JADA 4HFEA 3H3AA 5L2LA 3RRCA 3FZMB 2NW7A 3FB2A 4Z8XA 2XQ8A 4IHJE 2CXLA 2DHRA 3CIRA 1KF6A 1YD8G 2FJAA 4ZS3A 4AQGA 3HI2A 3PUGA 3RYHE 1W0BA 4YSZA 4OHFA 3VRAA 4LF7T 4QKNA 2FBWA 3VHLA 4EV6A 3EDUA 4HN9A 4JBWF 3LFMA 2LOSA 3MA9A 2BG9B 3CX8B 4GOUA 3MK7C 1ZV4X 2WCAA 4IE6A 5LBMA 4CI3B 2LRLA 3EABA 4LF8T 3W15B 2WMOA 1OWAA 1V9DA 3F31A 2DL1A 3Q9DA 5FL1A 2K24A 2X68A 3C64A 4IDNA 4BA9A 5LHHB 1QLBA 5FY7A 2NTYA 3HL6A 3FBZA 2Y6XA 3ONXA 2E2AA 2MPKA 2LSJA 2WU5A 2ZM0A 3FZFB 4I50E 3RKOA 4ZZCA 4HEAA 1IZNB 4MALA 2XAJB 5DQVA 5ABHA 4KHPT 4U3CA 3PUSA 3ZYMA 3PTRB 4P0AA 3OJAA 2PBIA 2KMFA 4C90A 3AE1A 1JNZA 2LSKA 2NW9A 4DO0A 3CQXC 3CQGB 4CN6A 3ZEFB 5ETWA 4U74A 5BR8T 4E7ZA 2CBIA 3AB3B 2LM9A 3F2EA 4JI5T 2LSIA 5JDGA 4B3ST 2V7KA 2VL8A 5JREA 5JRCA 4DUYT 2C5JA 2LHNA 3UFEA 3RYFE 1G8XA 2IUBA 3OYXA 3M3ZB 2XY8B 3E0ZA 5C8YE 1T7SA 2V6XA 4YXDA 4DV3T 5JDNA 2X0HA 2D0UA 2JMHA 5J2UE 2JQHA 3AEDA 4COFA 4YT0A 5LJMA 1N36T 5L3BB 3O4XE 2A9UA 2M6BA 3K3OA 2CBJA 3WI3A 2WY2A 2H3RA 2HN2A 4B3MT 1WFDA 2J62A 3AE5A 3KV5A 3AEEA 4DUZT 4YTMA 4X1KE 2MAWA 3ZMSB 4DIDB 4DR2T 1N33T 5KX5E 3PUWF 4ILUA 4KUMB 4EYUA 3AA0B 1VRBA 3N2GE 4HWHA 3K8PC 2YINA 2C0SA 4U2ZA 2YDSA 2YOEA 2V5DA 4K0KT 1Z8UA 1M62A 4JI3T 1WRDA 2H88A 4ANJA 2UUCT 5L3EB 1XMOT 4KI0F 1D0ZA 3RIFA 4XAXB 1SA0E 3AAEB 5FVLA 3P4PA 1UX4A 4JYAT 4J2CA 4QXHB 4LF6T 5JTGA 1FEWA 4H9OC 4CQIA 3OVUA 1US7B 4Q25A 4LF4T 2UUAT 5LXTE 4DBRA 2I6HA 4UVBB 3RHWA 4JEHB 4C91A 4QHOA 1XWMA 1FMVA 4ZI2D 3C4XA 1UX5A 3ANWA 1HFAA 2JQ9A 2WQYA 1LVFA 4CN1A 1VCTA 4DV5T 3ONJA 5C3JA 2LRKA 2UU9T 3PUQA 4JI6T 2BKPA 4UVAB 3QC9A 4ILBA 2X51A 4ZOLE 1S94A 2FJDA 2C5IT 4PK5A 3QB5A 3O9XA 2BG9C 3LK2B 3VKGA 2CWYA 1KFYA 2XAFB 3N9OA 2MOZA 2QVAA 5FVKA 2IAKA 3ZMVB 1W0AA 1MNDA 3H3MA 4IE7A 3RKGA 3PJAJ 3UT5E 5HCJA 5HXSA 3HR0A 3CK6A 1H7CA 3NVOA 2X9YA 5JR9A 3TLSA 2DWGA 3AE6A 5FXXA 5LGUB 2D5UA 2UXNB 5HEOA 3R6NA 2XQ7A 2YDQA 4WNKA 4AQYT 2WAUA 2LHRA 2EHOB 1VCSA 4YJ3E 4DR5T 4ILAA 2WB5A 3FZKB 3P8CD 3UUNA 3AEFA 2LOPA 2N9DA 4YSYA 5IWAT 1KEYA 1HG2A 4HWIB 4GYRA 4U33A 4AKIA 2XAHB 2J4GA 2Q9QB 2XSAA 4TV8E 5ABEA 3EI0A 1OEDC 3PUYF 4ZHQE 5E0OA 1LVKA 4ZZBA 5IUXA 3BK9A 3OBVE 2X0LB 4XBFB 3O1IA 3LJCA 4MBQA 5L4HA 2HH7A 2X9HA 3I0OA 3RRWA 2IC6A 2X9XA 3E22E 5FYMA 2BVMA 2YN6A 4ZI2C 1BR2A 4TWFA 2K9AA 1I94T 2FJBA 2N1GA 4YTNA 2XQ4A 3BQKA 5ABGA 1FMWA 4CN4A 2FJEA 4IDZA 4E7SA 4KX6A 1SUMB 4UEMA 3C50A 3C98B 4JEUB 4JI8T 4JLEA 1I6ZA 3DTOA 4UF0A 4O4IE 2UXBT 1HTJF 2BVLA 1WYCA 4OX9T 4Z90A 4X1IE 2V1DB 4P0BA 4X66T 1IJ6A 4H63H 3O1HA 4CXYA 3Q2MA 4CXWA 5CFBA 4H9NC 3HKDE 2VK9A 3M65A 3PU3A 4H9RC 5HWYA 2YU1A 4ZEYA 2JMKA 2XQ9A 3AXJA 2R6GF 1YQ4A 4HGAA 3KVAA 4NIQA 2QYWA 4U7IA 4ILCA 4UV8B 2ZM8A 2A3DA 4H9QC 4PJMA 3WAJA 3AE4A 1T8BA 4GKJT 5J2TE 1OEDB 3G06A 5FMNA 4U2YA 3J9X1 5FY0A 5HEJA 3IBPA 2J47A 2UXXB 4X5TA 3TLUA 4L9IA 1ZKEA 2L8KA 4PAGA 1YKEB 2D2SA 3NRYA 4KP3C 5HXHA 4HWDA 3ZKRA 5L3FB 4JI7T 4H9PC 4EXTA 5HXEA 3EHZA 4O4JE 5HCMA 5BMVE 3GWHA 3TLTA 4YHJA 4ISTA 2IW5B 4B3RT 2J1DG 3E08A 2Y8DA 3LDQB 2I0MA 3GN5A 3C4ZA 3CQCB 3H37A 5FNVE 2W63A 3A5XA 2CHOA 4FJOA 2H7OA 2DCFA 1R8IA 5AQVB 3ZSSA 5JR9B 4LFCT 4MHCA 3N2KE 1IAPA 2LT3A 2X67A 2XM2A 1WR6A 2NTXA 4X65T 3RGLA 1CHUA 4IE4A 1E1HB 3UU6A 3ZC0A 1HX8A 2WBLA 2E9XD 4EEBA 2CA5A 1M7KA 4U7YA 3LK42 5FP3A 3PV0F 4I43B 3JAEA 5HXCA 5JDQA 4B6XA 1U4QA 3EAMA 2DLRA 2IMLA 2VKOA 2YU2A 3ONLC 4K0UA 3SRZA 4TWHA 3ZN0B 1JNRA 1ZEEA 4DV2T 4B3TT 5EK4A 4QX8B 2JIWA 3BQLA 4IE0A 5AQSB 5GONE 3UTKA 3L39A 2W2UA 3LG7A 3T1HT 1HNZT 1T98A 4DNDA 4NXNT 3A8YC 4ZS2A 4JI4T 1IBMT 2PJQA 5HEUA 2BBHA 3ZT5A 3ETUA 2XSBA 3ZCIA 1IJ5A 2EHOC 3L8RA 3VU7H 2D0TA 3AECA 5DQWA 4ZI7E 2VKJA 3HKBE 3JCFA 2WZIA 2W0GA 1HNWT 2G0UA 3QK6A 4AKGA 1UK5A 1WLXA 4EGWA 4ZI3D 1XDOA 2NOXA 5AFUL 5LJNA 4PW8A 2I59A 3DJBA 5HYAA 2CLYC 4TUYE 1G73A 2X0YA 4UF0B 5AQHB 4YHHT 3P4SA 2H7VC 2MYSA 4QH5A 3CKDA 3K3NA 3N9QA 4TV9E 2DWKA 4QX7B 4YSXA 2W62A 3I0QA 5LOVE 2IHR1 2GK9A 2ACXA 2LLYA 3HKCE 2OA5A 4PFOA 4U72A 3ZMUB 5EK2A 3UU5A 3AEAA 3ETVA 3IA3A 4PJLA 3RPUA 5LG4A 4JI1T 2RPAA 2V26A 1B7TA 5HAXA 1NEKA 5AQPB 4EZHA 5L3CB 2LJLA 4DR7T 4PNIA 3TLWA 2VL0A 3MZKB 2DI4A 2KT9A 4PJJA 2VURA 3PJAA 4DV0T 2BDEA 4WBNE 3P50A 1SHZC 2CCQA 4GIWA 4O2BE 3JAFA 1BR1A 1OEDE 3QB5K 1Y01A 4HFHA 3UQ4A 3K3QC 3RC8A 2VVNA 2EHOA 1ZP0A 3CX7B 3NRXA 2SPCA 2W4XA 4LMKA 4YFSA 4CI1B 2VVSA 1D1BA 3U78A 3KINB 3I1AA 4IL9A 4UVCB 1XNQT 4IE5A 1LKXA 3SOLA 2DNXA 3FXEB 5JDMA 3AEBA 4HWCA 4IDQA 2X9WA 4OFZA 3FZLB 2CWOA 5CA0E 5AQRB 1SE7A 1WR0A 3N9LA 4IDOA 3UQ7A 1UGOA 1HNXT 4NXMT 5J0ZA 1UCUA 1ZHCA 3A7MA 1L0VA 2MBGA 3ZYLA 4AQFC 5ADXL 1BR0A 4QXCB 1U5PA 2LKHA 3D0TA 2ACZA 3KV6A 2WWVA 4AQFA 1HR0T 2UXCT 3ZT7A 5AQKB 3UU4A 2B76A 2ODVA 4U31A 2JQKA 2W66A 4YY3T 4G2AA 4YTPA 1N32T 2E8IA 2ZM6T 2IIUA 3C51A 2PG8A 3UU8A 3OKQA 3ZN1B 4AKLA 5LMNT 2BG9E 4GK0E 5M4YA 2NWBA 3PUZF 3UUBA 3AE7A 4DBQA 4F6RC 3NBXX 2WMNA 3B5MA 2A72A 1KNPA 3GA8A 4QWNB 5H6QB 2BKNA 2ODUA 2V6YA 4I55E 2JQQA 4ADZA 1YKHB 2E5LT 1QSDA 2NW8A 2L9QA 5KXJA 1Z0PA 2WS3A 2XZEA 3GN5B 4ISSA 2LE8A 1YQ3A 4TZ4C 3VR8A 2V7MA 2WDQA 4UR9A 3CVRA 4X64T 4DV7T 2KINB 3MKDA 2QA7A 4QXBB 5JDFA 4DMWA 4X1YE 3Q5EA 2P9BA 4KHZF 3KV4A 3O1JA 2IDOB 1CUNA 2RP4A 3CX6B 3FXDB 4L0RA 4DR4T 2WDRA 2BS4A 3Q5XA 2CPTA 2E5VA 3UUMA 5L4EA 4M1PA 2JJ9A 4IDPA 2BBJA 3RIUA 3J7Yq 3AA7B 4IIJE 5ABFB 4HTEA 5F3JA 5LHGB 3R84B 1WYBA 2HHHT 4OK0A 4AKHA 5CJ5A 1LRZA 1OEDA 3ANWB 4XZCA 5L3GB 1YW0A 1UURA 2KLQA 2NR4A 2ZMAA 4O4LE 4EZ4A 2XQAA 3RIAA 3P7IA 3VRBA 1GQEA 1YXRA 4DV6T 2Q9QC 4TN7B 2VQFT 1D1AA 2YDRA 3RQWA 3QOFA 2CLYB 2YKSA 3N9NA 5FKYA 1AJ3A 1MIYA 5FXVA 3OTOT 1KNZA 2AXDS 3I9YA 5AQTB 3ZYKA 5IYZE 2CRBA 4GK5E 3KV9A 3SFEA 1D0YA 3GMIA 4TNVA 4WYVA 3SS1A 3LBXA 3TLVA 4ZI3C 4A5XA 4KMCA 3AVRA 2CEAA 3N9PA 4TWDA 2WSSV 1O3XA 2XTLA 3PU8A 5AQGB 4L5GA 4DR3T 2AE9A 2VKHA 1E2AA 5HXRA 1X9BA 5AQJB 3AEGA 3JC6D 3Q5DA 3RQUA 3ZC1A 4A98A 4EOZB 2XUEA 3ABVA 3NKZA 1XDPA 3N5LA 5TAOA 3T8OA 2VB6A 5JDLA 4P1NA 1ZOYA 4IT4A 4LMLA 3UUXB 5LGTB 3KFWX 2WU2A 2XQYA 3MXZA 3ZJ2A 1IBKT 3TKLB 4LFAT 3RIUC 3N9MA 2V7IA 3PDYA 2LSYA 2WWUA 2Y48B 3RX6A 3P4RA 5LGNB 2JPFA 2KWHA 2UXDT 5AQUB 2EHOD 3UFGA 2CMRA 2XHEB 5LP6E 1HS7A 2XPKA 4YLHA 3RYCE 5LYJE 1D0XA 2PTFA 3L09A 4GKKT 4LMJA 4HFBA 2KSRA 3LBXB 3OYZA 4DR6T 3VR9A 4O8SA 5A1LA 5L3DB 5F5WA 4DV1T 2VQET 5EK3A 5IHYA 1HF8A 4AKRB 3AA6B 2V6YB 3NZQA 5LNKA 4G63A 4F8HA 5FL0A 1HG5A 2WM9A 3RH3A 4DMVA 2V7LA 5KMGP 4JV5T 2VKDA 3KBUA 2KWIB 2ES0A 4IGUA 2K3WA 2VASA 4JUYA 5LB7B 4EAHA 4X62T 5CGMA 3PE0A 5FY1A 5LG3A 2XM1A 5L47A 2V7JA 5HEHA 5F8PA 3AVSA 4LF9T 1NENA 4UXNB 3ZLIA 3EDVA 1HX1B 3T1YT 2KNDA 4LFBT 4HFIA 5ABFA 2CM0A 3BQIA 3KBTA 3RYIE 5KDMC 2LEHA 1VOMA 2XAQB 2BG9A 1NWMX 4I4TE 2BS2A 5DJQC 5AQMB 3VKHA 3F57A 4HE8A 3FHNA 2IC9A 4QH4A 5DABA 3RC3A 3SWHA 5LA6E 2CXDA 4HFVA 2K48A 3AE3A 3HA4A 5LBQB 2C5KT 2JRKA 4Z91A 3AE8A 1J1JA 1HCIA 2QRXA 3B57A 4NUUA 4ZXLA 5CA1E 5AQQB 3FBLA 3PUAA 4H9SE 4A97A 3RF1A 1EZ3A 5JH7E 4WW0A 3PUXF 4CI2B 2V8SV 3I9WA 4PK4A 2E9XB 3Q5WA 4AISA 4EIWA 4EYYR 4ERRA 1N34T 1E7PA 2FUPA 3LSVA 2ZM2A 5HWXA 1NAFA 2F4VT 1X79A 2KZ7B 2HN1A 3UU3A 2LM2A 2N2NA 4IREA 4AIUA 5JR9C 4LF5T 3PURA 4DR1T 4O4HE 5FXWA 2LKGA 4NPPA 4WBOA 2MTQA 5J1GA 5H6RB 1MIWA 2B1EA 3ZMTB 2XJ7A 3MJXA 1J5ET 2XASB 2HPLA 3B13A 4DV4T 4EEDA
chains in the Genus database with same CATH topology
4DV7T 4DUZT 4DR2T 1N33T 4LFCT 5LMUT 4JI2T 4X65T 4K0KT 2HHHT 4JI3T 2UUCT 1XMOT 1XNRT 4JYAT 4LF6T 4B3TT 4DV2T 4DV6T 2VQFT 4LF4T 2UUAT 4JI0T 2UUBT 3OTOT 3T1HT 4NXNT 1HNZT 4JI4T 1IBMT 3T1YT 4DV5T 2UU9T 4JI6T 4DR3T 1HNWT 1XMQT 4YHHT 1FJGT 1IBKT 4JI1T 2UXDT 4AQYT 1IBLT 4DR5T 5IWAT 4DR7T 4GKKT 4DV0T 4DR6T 4LFAT 4DR4T 4DV1T 4LF7T 2VQET 4JV5T 4LF8T 4X62T 1I94T 1XNQT 4LF9T 4JI8T 4LFBT 2UXBT 4KHPT 4OX9T 1HNXT 4X66T 4NXMT 5BR8T 1HR0T 4JI5T 2UXCT 4B3ST 4YY3T 1N34T 2F4VT 4DUYT 4GKJT 1N32T 2ZM6T 5LMNT 4DV3T 4LF5T 4DR1T 1N36T 4JI7T 2E5LT 1J5ET 4B3MT 4B3RT 4DV4T 4X64T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV7 T;  4DUZ T;  4DR2 T;  1N33 T;  4LFC T;  5LMU T;  4JI2 T;  4X65 T;  4K0K T;  2HHH T;  4JI3 T;  2UUC T;  1XMO T;  1XNR T;  4JYA T;  4LF6 T;  4B3T T;  4DV2 T;  4DV6 T;  2VQF T;  4LF4 T;  2UUA T;  4JI0 T;  2UUB T;  3OTO T;  3T1H T;  4NXN T;  1HNZ T;  4JI4 T;  1IBM T;  3T1Y T;  4DV5 T;  2UU9 T;  4JI6 T;  4DR3 T;  1HNW T;  1XMQ T;  4YHH T;  1FJG T;  1IBK T;  4JI1 T;  2UXD T;  4AQY T;  1IBL T;  4DR5 T;  5IWA T;  4DR7 T;  4GKK T;  4DV0 T;  4DR6 T;  4LFA T;  4DR4 T;  4DV1 T;  4LF7 T;  2VQE T;  4JV5 T;  4LF8 T;  4X62 T;  1I94 T;  1XNQ T;  4LF9 T;  4JI8 T;  4LFB T;  2UXB T;  4KHP T;  4OX9 T;  1HNX T;  4X66 T;  4NXM T;  5BR8 T;  1HR0 T;  4JI5 T;  2UXC T;  4B3S T;  4YY3 T;  1N34 T;  2F4V T;  4DUY T;  4GKJ T;  1N32 T;  2ZM6 T;  5LMN T;  4DV3 T;  4LF5 T;  4DR1 T;  1N36 T;  4JI7 T;  2E5L T;  1J5E T;  4B3M T;  4B3R T;  4DV4 T;  4X64 T; 
#chains in the Genus database with same CATH topology
 2M67 A;  4BJM A;  1Y64 B;  3ZST A;  2XQ5 A;  3P4Q A;  3N2O A;  5HEG A;  2W00 A;  1KK7 A;  2WP9 A;  4MLK A;  4N78 D;  3SFD A;  2BS3 A;  3IEE A;  4HWF A;  5AQN B;  5LMU T;  3RI5 A;  2Z6E A;  4JI2 T;  3X1D A;  5JDH A;  2OV9 A;  4TNW A;  2W61 A;  2BKO A;  1MMA A;  2CE7 A;  2H89 A;  1MNE A;  2XQ3 A;  3AXJ B;  5AQO B;  4IL4 A;  4HKA A;  3ZCJ A;  3IF8 B;  3KVB A;  4CXX A;  3QUJ A;  4DVD A;  2XQ6 A;  3DP7 A;  1S35 A;  3P4W A;  1W09 A;  4TX5 A;  4UV9 B;  1XNR T;  2WDV A;  5JRC B;  3MAC A;  5JVD E;  1BR4 A;  2BZB A;  3QNU A;  4BAY B;  3EVY A;  2W67 A;  4CZZ B;  2D9D A;  3IHR A;  5LCY A;  1OXZ A;  1QUU A;  4O2A E;  4OYK A;  1DU2 A;  2WZH A;  3C4W A;  3V5S A;  4QH1 A;  4X20 E;  4JI0 T;  1MMN A;  2V5C A;  3RLF F;  4BJN A;  2UUB T;  1MIV A;  4PJN A;  3EUH A;  4A56 A;  4PFP A;  4KBM B;  4HFD A;  3ZT6 A;  5C2T A;  2QGS A;  2E9X A;  4FI5 A;  3FZH B;  2OLT A;  3CML A;  1J5W A;  3KDS E;  2E9X C;  4P09 A;  5EZY E;  3JC6 C;  3OPC A;  3S4U A;  5AQL B;  2LSG A;  2XAG B;  3CPZ A;  3ESL A;  4MFR A;  5JQG E;  3NZP A;  2CHN A;  4AI6 A;  2YEV C;  3PUV F;  3NWI A;  1XZY A;  5AQI B;  3ZJ1 A;  3ZMZ B;  5AQF B;  3V5U A;  2M6I A;  3AAA B;  2YK0 A;  4I0U A;  3K1S A;  3AE9 A;  3WAK A;  2K5B B;  1D1C A;  3HKE E;  2RA1 A;  1XMQ T;  2Q9Q A;  1FJG T;  2A2F X;  4HFC A;  3ZPO A;  1WCR A;  2X66 A;  4AXP A;  2CXF A;  1MMG A;  2HPJ A;  2VWA A;  3L3P A;  4H63 V;  4OYJ A;  3UUL A;  2Q9Q D;  3CWZ B;  4PK6 A;  2NP9 A;  3U3I A;  2PFV A;  3AAI A;  4EB6 E;  4UEL A;  3AA1 B;  5CB4 E;  4ASK A;  2L3L A;  3LK3 B;  4WZX A;  1KNR A;  1UUS A;  4YJ2 E;  1FIO A;  4UIG A;  5LHI B;  1MMD A;  2KXP B;  1IBL T;  2ZLY A;  4GYS A;  1T72 A;  1W9R A;  3AE2 A;  4V1A v;  4NUV A;  5FXZ A;  3JAD A;  4HFE A;  3H3A A;  5L2L A;  3RRC A;  3FZM B;  2NW7 A;  3FB2 A;  4Z8X A;  2XQ8 A;  4IHJ E;  2CXL A;  2DHR A;  3CIR A;  1KF6 A;  1YD8 G;  2FJA A;  4ZS3 A;  4AQG A;  3HI2 A;  3PUG A;  3RYH E;  1W0B A;  4YSZ A;  4OHF A;  3VRA A;  4LF7 T;  4QKN A;  2FBW A;  3VHL A;  4EV6 A;  3EDU A;  4HN9 A;  4JBW F;  3LFM A;  2LOS A;  3MA9 A;  2BG9 B;  3CX8 B;  4GOU A;  3MK7 C;  1ZV4 X;  2WCA A;  4IE6 A;  5LBM A;  4CI3 B;  2LRL A;  3EAB A;  4LF8 T;  3W15 B;  2WMO A;  1OWA A;  1V9D A;  3F31 A;  2DL1 A;  3Q9D A;  5FL1 A;  2K24 A;  2X68 A;  3C64 A;  4IDN A;  4BA9 A;  5LHH B;  1QLB A;  5FY7 A;  2NTY A;  3HL6 A;  3FBZ A;  2Y6X A;  3ONX A;  2E2A A;  2MPK A;  2LSJ A;  2WU5 A;  2ZM0 A;  3FZF B;  4I50 E;  3RKO A;  4ZZC A;  4HEA A;  1IZN B;  4MAL A;  2XAJ B;  5DQV A;  5ABH A;  4KHP T;  4U3C A;  3PUS A;  3ZYM A;  3PTR B;  4P0A A;  3OJA A;  2PBI A;  2KMF A;  4C90 A;  3AE1 A;  1JNZ A;  2LSK A;  2NW9 A;  4DO0 A;  3CQX C;  3CQG B;  4CN6 A;  3ZEF B;  5ETW A;  4U74 A;  5BR8 T;  4E7Z A;  2CBI A;  3AB3 B;  2LM9 A;  3F2E A;  4JI5 T;  2LSI A;  5JDG A;  4B3S T;  2V7K A;  2VL8 A;  5JRE A;  5JRC A;  4DUY T;  2C5J A;  2LHN A;  3UFE A;  3RYF E;  1G8X A;  2IUB A;  3OYX A;  3M3Z B;  2XY8 B;  3E0Z A;  5C8Y E;  1T7S A;  2V6X A;  4YXD A;  4DV3 T;  5JDN A;  2X0H A;  2D0U A;  2JMH A;  5J2U E;  2JQH A;  3AED A;  4COF A;  4YT0 A;  5LJM A;  1N36 T;  5L3B B;  3O4X E;  2A9U A;  2M6B A;  3K3O A;  2CBJ A;  3WI3 A;  2WY2 A;  2H3R A;  2HN2 A;  4B3M T;  1WFD A;  2J62 A;  3AE5 A;  3KV5 A;  3AEE A;  4DUZ T;  4YTM A;  4X1K E;  2MAW A;  3ZMS B;  4DID B;  4DR2 T;  1N33 T;  5KX5 E;  3PUW F;  4ILU A;  4KUM B;  4EYU A;  3AA0 B;  1VRB A;  3N2G E;  4HWH A;  3K8P C;  2YIN A;  2C0S A;  4U2Z A;  2YDS A;  2YOE A;  2V5D A;  4K0K T;  1Z8U A;  1M62 A;  4JI3 T;  1WRD A;  2H88 A;  4ANJ A;  2UUC T;  5L3E B;  1XMO T;  4KI0 F;  1D0Z A;  3RIF A;  4XAX B;  1SA0 E;  3AAE B;  5FVL A;  3P4P A;  1UX4 A;  4JYA T;  4J2C A;  4QXH B;  4LF6 T;  5JTG A;  1FEW A;  4H9O C;  4CQI A;  3OVU A;  1US7 B;  4Q25 A;  4LF4 T;  2UUA T;  5LXT E;  4DBR A;  2I6H A;  4UVB B;  3RHW A;  4JEH B;  4C91 A;  4QHO A;  1XWM A;  1FMV A;  4ZI2 D;  3C4X A;  1UX5 A;  3ANW A;  1HFA A;  2JQ9 A;  2WQY A;  1LVF A;  4CN1 A;  1VCT A;  4DV5 T;  3ONJ A;  5C3J A;  2LRK A;  2UU9 T;  3PUQ A;  4JI6 T;  2BKP A;  4UVA B;  3QC9 A;  4ILB A;  2X51 A;  4ZOL E;  1S94 A;  2FJD A;  2C5I T;  4PK5 A;  3QB5 A;  3O9X A;  2BG9 C;  3LK2 B;  3VKG A;  2CWY A;  1KFY A;  2XAF B;  3N9O A;  2MOZ A;  2QVA A;  5FVK A;  2IAK A;  3ZMV B;  1W0A A;  1MND A;  3H3M A;  4IE7 A;  3RKG A;  3PJA J;  3UT5 E;  5HCJ A;  5HXS A;  3HR0 A;  3CK6 A;  1H7C A;  3NVO A;  2X9Y A;  5JR9 A;  3TLS A;  2DWG A;  3AE6 A;  5FXX A;  5LGU B;  2D5U A;  2UXN B;  5HEO A;  3R6N A;  2XQ7 A;  2YDQ A;  4WNK A;  4AQY T;  2WAU A;  2LHR A;  2EHO B;  1VCS A;  4YJ3 E;  4DR5 T;  4ILA A;  2WB5 A;  3FZK B;  3P8C D;  3UUN A;  3AEF A;  2LOP A;  2N9D A;  4YSY A;  5IWA T;  1KEY A;  1HG2 A;  4HWI B;  4GYR A;  4U33 A;  4AKI A;  2XAH B;  2J4G A;  2Q9Q B;  2XSA A;  4TV8 E;  5ABE A;  3EI0 A;  1OED C;  3PUY F;  4ZHQ E;  5E0O A;  1LVK A;  4ZZB A;  5IUX A;  3BK9 A;  3OBV E;  2X0L B;  4XBF B;  3O1I A;  3LJC A;  4MBQ A;  5L4H A;  2HH7 A;  2X9H A;  3I0O A;  3RRW A;  2IC6 A;  2X9X A;  3E22 E;  5FYM A;  2BVM A;  2YN6 A;  4ZI2 C;  1BR2 A;  4TWF A;  2K9A A;  1I94 T;  2FJB A;  2N1G A;  4YTN A;  2XQ4 A;  3BQK A;  5ABG A;  1FMW A;  4CN4 A;  2FJE A;  4IDZ A;  4E7S A;  4KX6 A;  1SUM B;  4UEM A;  3C50 A;  3C98 B;  4JEU B;  4JI8 T;  4JLE A;  1I6Z A;  3DTO A;  4UF0 A;  4O4I E;  2UXB T;  1HTJ F;  2BVL A;  1WYC A;  4OX9 T;  4Z90 A;  4X1I E;  2V1D B;  4P0B A;  4X66 T;  1IJ6 A;  4H63 H;  3O1H A;  4CXY A;  3Q2M A;  4CXW A;  5CFB A;  4H9N C;  3HKD E;  2VK9 A;  3M65 A;  3PU3 A;  4H9R C;  5HWY A;  2YU1 A;  4ZEY A;  2JMK A;  2XQ9 A;  3AXJ A;  2R6G F;  1YQ4 A;  4HGA A;  3KVA A;  4NIQ A;  2QYW A;  4U7I A;  4ILC A;  4UV8 B;  2ZM8 A;  2A3D A;  4H9Q C;  4PJM A;  3WAJ A;  3AE4 A;  1T8B A;  4GKJ T;  5J2T E;  1OED B;  3G06 A;  5FMN A;  4U2Y A;  3J9X 1;  5FY0 A;  5HEJ A;  3IBP A;  2J47 A;  2UXX B;  4X5T A;  3TLU A;  4L9I A;  1ZKE A;  2L8K A;  4PAG A;  1YKE B;  2D2S A;  3NRY A;  4KP3 C;  5HXH A;  4HWD A;  3ZKR A;  5L3F B;  4JI7 T;  4H9P C;  4EXT A;  5HXE A;  3EHZ A;  4O4J E;  5HCM A;  5BMV E;  3GWH A;  3TLT A;  4YHJ A;  4IST A;  2IW5 B;  4B3R T;  2J1D G;  3E08 A;  2Y8D A;  3LDQ B;  2I0M A;  3GN5 A;  3C4Z A;  3CQC B;  3H37 A;  5FNV E;  2W63 A;  3A5X A;  2CHO A;  4FJO A;  2H7O A;  2DCF A;  1R8I A;  5AQV B;  3ZSS A;  5JR9 B;  4LFC T;  4MHC A;  3N2K E;  1IAP A;  2LT3 A;  2X67 A;  2XM2 A;  1WR6 A;  2NTX A;  4X65 T;  3RGL A;  1CHU A;  4IE4 A;  1E1H B;  3UU6 A;  3ZC0 A;  1HX8 A;  2WBL A;  2E9X D;  4EEB A;  2CA5 A;  1M7K A;  4U7Y A;  3LK4 2;  5FP3 A;  3PV0 F;  4I43 B;  3JAE A;  5HXC A;  5JDQ A;  4B6X A;  1U4Q A;  3EAM A;  2DLR A;  2IML A;  2VKO A;  2YU2 A;  3ONL C;  4K0U A;  3SRZ A;  4TWH A;  3ZN0 B;  1JNR A;  1ZEE A;  4DV2 T;  4B3T T;  5EK4 A;  4QX8 B;  2JIW A;  3BQL A;  4IE0 A;  5AQS B;  5GON E;  3UTK A;  3L39 A;  2W2U A;  3LG7 A;  3T1H T;  1HNZ T;  1T98 A;  4DND A;  4NXN T;  3A8Y C;  4ZS2 A;  4JI4 T;  1IBM T;  2PJQ A;  5HEU A;  2BBH A;  3ZT5 A;  3ETU A;  2XSB A;  3ZCI A;  1IJ5 A;  2EHO C;  3L8R A;  3VU7 H;  2D0T A;  3AEC A;  5DQW A;  4ZI7 E;  2VKJ A;  3HKB E;  3JCF A;  2WZI A;  2W0G A;  1HNW T;  2G0U A;  3QK6 A;  4AKG A;  1UK5 A;  1WLX A;  4EGW A;  4ZI3 D;  1XDO A;  2NOX A;  5AFU L;  5LJN A;  4PW8 A;  2I59 A;  3DJB A;  5HYA A;  2CLY C;  4TUY E;  1G73 A;  2X0Y A;  4UF0 B;  5AQH B;  4YHH T;  3P4S A;  2H7V C;  2MYS A;  4QH5 A;  3CKD A;  3K3N A;  3N9Q A;  4TV9 E;  2DWK A;  4QX7 B;  4YSX A;  2W62 A;  3I0Q A;  5LOV E;  2IHR 1;  2GK9 A;  2ACX A;  2LLY A;  3HKC E;  2OA5 A;  4PFO A;  4U72 A;  3ZMU B;  5EK2 A;  3UU5 A;  3AEA A;  3ETV A;  3IA3 A;  4PJL A;  3RPU A;  5LG4 A;  4JI1 T;  2RPA A;  2V26 A;  1B7T A;  5HAX A;  1NEK A;  5AQP B;  4EZH A;  5L3C B;  2LJL A;  4DR7 T;  4PNI A;  3TLW A;  2VL0 A;  3MZK B;  2DI4 A;  2KT9 A;  4PJJ A;  2VUR A;  3PJA A;  4DV0 T;  2BDE A;  4WBN E;  3P50 A;  1SHZ C;  2CCQ A;  4GIW A;  4O2B E;  3JAF A;  1BR1 A;  1OED E;  3QB5 K;  1Y01 A;  4HFH A;  3UQ4 A;  3K3Q C;  3RC8 A;  2VVN A;  2EHO A;  1ZP0 A;  3CX7 B;  3NRX A;  2SPC A;  2W4X A;  4LMK A;  4YFS A;  4CI1 B;  2VVS A;  1D1B A;  3U78 A;  3KIN B;  3I1A A;  4IL9 A;  4UVC B;  1XNQ T;  4IE5 A;  1LKX A;  3SOL A;  2DNX A;  3FXE B;  5JDM A;  3AEB A;  4HWC A;  4IDQ A;  2X9W A;  4OFZ A;  3FZL B;  2CWO A;  5CA0 E;  5AQR B;  1SE7 A;  1WR0 A;  3N9L A;  4IDO A;  3UQ7 A;  1UGO A;  1HNX T;  4NXM T;  5J0Z A;  1UCU A;  1ZHC A;  3A7M A;  1L0V A;  2MBG A;  3ZYL A;  4AQF C;  5ADX L;  1BR0 A;  4QXC B;  1U5P A;  2LKH A;  3D0T A;  2ACZ A;  3KV6 A;  2WWV A;  4AQF A;  1HR0 T;  2UXC T;  3ZT7 A;  5AQK B;  3UU4 A;  2B76 A;  2ODV A;  4U31 A;  2JQK A;  2W66 A;  4YY3 T;  4G2A A;  4YTP A;  1N32 T;  2E8I A;  2ZM6 T;  2IIU A;  3C51 A;  2PG8 A;  3UU8 A;  3OKQ A;  3ZN1 B;  4AKL A;  5LMN T;  2BG9 E;  4GK0 E;  5M4Y A;  2NWB A;  3PUZ F;  3UUB A;  3AE7 A;  4DBQ A;  4F6R C;  3NBX X;  2WMN A;  3B5M A;  2A72 A;  1KNP A;  3GA8 A;  4QWN B;  5H6Q B;  2BKN A;  2ODU A;  2V6Y A;  4I55 E;  2JQQ A;  4ADZ A;  1YKH B;  2E5L T;  1QSD A;  2NW8 A;  2L9Q A;  5KXJ A;  1Z0P A;  2WS3 A;  2XZE A;  3GN5 B;  4ISS A;  2LE8 A;  1YQ3 A;  4TZ4 C;  3VR8 A;  2V7M A;  2WDQ A;  4UR9 A;  3CVR A;  4X64 T;  4DV7 T;  2KIN B;  3MKD A;  2QA7 A;  4QXB B;  5JDF A;  4DMW A;  4X1Y E;  3Q5E A;  2P9B A;  4KHZ F;  3KV4 A;  3O1J A;  2IDO B;  1CUN A;  2RP4 A;  3CX6 B;  3FXD B;  4L0R A;  4DR4 T;  2WDR A;  2BS4 A;  3Q5X A;  2CPT A;  2E5V A;  3UUM A;  5L4E A;  4M1P A;  2JJ9 A;  4IDP A;  2BBJ A;  3RIU A;  3J7Y q;  3AA7 B;  4IIJ E;  5ABF B;  4HTE A;  5F3J A;  5LHG B;  3R84 B;  1WYB A;  2HHH T;  4OK0 A;  4AKH A;  5CJ5 A;  1LRZ A;  1OED A;  3ANW B;  4XZC A;  5L3G B;  1YW0 A;  1UUR A;  2KLQ A;  2NR4 A;  2ZMA A;  4O4L E;  4EZ4 A;  2XQA A;  3RIA A;  3P7I A;  3VRB A;  1GQE A;  1YXR A;  4DV6 T;  2Q9Q C;  4TN7 B;  2VQF T;  1D1A A;  2YDR A;  3RQW A;  3QOF A;  2CLY B;  2YKS A;  3N9N A;  5FKY A;  1AJ3 A;  1MIY A;  5FXV A;  3OTO T;  1KNZ A;  2AXD S;  3I9Y A;  5AQT B;  3ZYK A;  5IYZ E;  2CRB A;  4GK5 E;  3KV9 A;  3SFE A;  1D0Y A;  3GMI A;  4TNV A;  4WYV A;  3SS1 A;  3LBX A;  3TLV A;  4ZI3 C;  4A5X A;  4KMC A;  3AVR A;  2CEA A;  3N9P A;  4TWD A;  2WSS V;  1O3X A;  2XTL A;  3PU8 A;  5AQG B;  4L5G A;  4DR3 T;  2AE9 A;  2VKH A;  1E2A A;  5HXR A;  1X9B A;  5AQJ B;  3AEG A;  3JC6 D;  3Q5D A;  3RQU A;  3ZC1 A;  4A98 A;  4EOZ B;  2XUE A;  3ABV A;  3NKZ A;  1XDP A;  3N5L A;  5TAO A;  3T8O A;  2VB6 A;  5JDL A;  4P1N A;  1ZOY A;  4IT4 A;  4LML A;  3UUX B;  5LGT B;  3KFW X;  2WU2 A;  2XQY A;  3MXZ A;  3ZJ2 A;  1IBK T;  3TKL B;  4LFA T;  3RIU C;  3N9M A;  2V7I A;  3PDY A;  2LSY A;  2WWU A;  2Y48 B;  3RX6 A;  3P4R A;  5LGN B;  2JPF A;  2KWH A;  2UXD T;  5AQU B;  2EHO D;  3UFG A;  2CMR A;  2XHE B;  5LP6 E;  1HS7 A;  2XPK A;  4YLH A;  3RYC E;  5LYJ E;  1D0X A;  2PTF A;  3L09 A;  4GKK T;  4LMJ A;  4HFB A;  2KSR A;  3LBX B;  3OYZ A;  4DR6 T;  3VR9 A;  4O8S A;  5A1L A;  5L3D B;  5F5W A;  4DV1 T;  2VQE T;  5EK3 A;  5IHY A;  1HF8 A;  4AKR B;  3AA6 B;  2V6Y B;  3NZQ A;  5LNK A;  4G63 A;  4F8H A;  5FL0 A;  1HG5 A;  2WM9 A;  3RH3 A;  4DMV A;  2V7L A;  5KMG P;  4JV5 T;  2VKD A;  3KBU A;  2KWI B;  2ES0 A;  4IGU A;  2K3W A;  2VAS A;  4JUY A;  5LB7 B;  4EAH A;  4X62 T;  5CGM A;  3PE0 A;  5FY1 A;  5LG3 A;  2XM1 A;  5L47 A;  2V7J A;  5HEH A;  5F8P A;  3AVS A;  4LF9 T;  1NEN A;  4UXN B;  3ZLI A;  3EDV A;  1HX1 B;  3T1Y T;  2KND A;  4LFB T;  4HFI A;  5ABF A;  2CM0 A;  3BQI A;  3KBT A;  3RYI E;  5KDM C;  2LEH A;  1VOM A;  2XAQ B;  2BG9 A;  1NWM X;  4I4T E;  2BS2 A;  5DJQ C;  5AQM B;  3VKH A;  3F57 A;  4HE8 A;  3FHN A;  2IC9 A;  4QH4 A;  5DAB A;  3RC3 A;  3SWH A;  5LA6 E;  2CXD A;  4HFV A;  2K48 A;  3AE3 A;  3HA4 A;  5LBQ B;  2C5K T;  2JRK A;  4Z91 A;  3AE8 A;  1J1J A;  1HCI A;  2QRX A;  3B57 A;  4NUU A;  4ZXL A;  5CA1 E;  5AQQ B;  3FBL A;  3PUA A;  4H9S E;  4A97 A;  3RF1 A;  1EZ3 A;  5JH7 E;  4WW0 A;  3PUX F;  4CI2 B;  2V8S V;  3I9W A;  4PK4 A;  2E9X B;  3Q5W A;  4AIS A;  4EIW A;  4EYY R;  4ERR A;  1N34 T;  1E7P A;  2FUP A;  3LSV A;  2ZM2 A;  5HWX A;  1NAF A;  2F4V T;  1X79 A;  2KZ7 B;  2HN1 A;  3UU3 A;  2LM2 A;  2N2N A;  4IRE A;  4AIU A;  5JR9 C;  4LF5 T;  3PUR A;  4DR1 T;  4O4H E;  5FXW A;  2LKG A;  4NPP A;  4WBO A;  2MTQ A;  5J1G A;  5H6R B;  1MIW A;  2B1E A;  3ZMT B;  2XJ7 A;  3MJX A;  1J5E T;  2XAS B;  2HPL A;  3B13 A;  4DV4 T;  4EED A; 
#chains in the Genus database with same CATH homology
 4DV7 T;  4DUZ T;  4DR2 T;  1N33 T;  4LFC T;  5LMU T;  4JI2 T;  4X65 T;  4K0K T;  2HHH T;  4JI3 T;  2UUC T;  1XMO T;  1XNR T;  4JYA T;  4LF6 T;  4B3T T;  4DV2 T;  4DV6 T;  2VQF T;  4LF4 T;  2UUA T;  4JI0 T;  2UUB T;  3OTO T;  3T1H T;  4NXN T;  1HNZ T;  4JI4 T;  1IBM T;  3T1Y T;  4DV5 T;  2UU9 T;  4JI6 T;  4DR3 T;  1HNW T;  1XMQ T;  4YHH T;  1FJG T;  1IBK T;  4JI1 T;  2UXD T;  4AQY T;  1IBL T;  4DR5 T;  5IWA T;  4DR7 T;  4GKK T;  4DV0 T;  4DR6 T;  4LFA T;  4DR4 T;  4DV1 T;  4LF7 T;  2VQE T;  4JV5 T;  4LF8 T;  4X62 T;  1I94 T;  1XNQ T;  4LF9 T;  4JI8 T;  4LFB T;  2UXB T;  4KHP T;  4OX9 T;  1HNX T;  4X66 T;  4NXM T;  5BR8 T;  1HR0 T;  4JI5 T;  2UXC T;  4B3S T;  4YY3 T;  1N34 T;  2F4V T;  4DUY T;  4GKJ T;  1N32 T;  2ZM6 T;  5LMN T;  4DV3 T;  4LF5 T;  4DR1 T;  1N36 T;  4JI7 T;  2E5L T;  1J5E T;  4B3M T;  4B3R T;  4DV4 T;  4X64 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...