4X62T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x62T00
1HNZT 4JI2T 2ZM6T 2UUAT 5LMUT 4NXNT 4DUYT 4DUZT 4AQYT 4LF7T 4DV7T 3OTOT 4X64T 2F4VT 4DR4T 1N32T 1I94T 2UXDT 1HNWT 4B3TT 5IWAT 2VQET 2UXBT 4DR5T 1XNRT 4DV0T 4DV4T 4JI7T 4LF9T 2UU9T 4DR1T 4DV5T 4DV1T 4K0KT 4NXMT 2UUBT 4JI5T 1IBLT 2HHHT 5LMNT 2UUCT 4LF6T 1XNQT 2VQFT 4JI1T 4YHHT 1FJGT 1N33T 3T1YT 4JYAT 4OX9T 1HNXT 4JI4T 4DR7T 4LFBT 4X62T 4JI0T 1XMOT 4LFAT 4GKJT 4DV2T 1XMQT 4JI6T 4YY3T 1IBMT 4JV5T 4B3MT 4DR6T 4JI8T 1N34T 1N36T 4B3RT 5BR8T 4LF4T 3T1HT 1IBKT 4DR2T 4LFCT 2UXCT 4DR3T 1HR0T 4X65T 4JI3T 2E5LT 4KHPT 4DV3T 4B3ST 4LF8T 4DV6T 4LF5T 4GKKT 4X66T 1J5ET
chains in the Genus database with same CATH superfamily
2HN2A 1X9BA 4JI2T 2DWKA 2NW9A 4HWCA 3FZLB 5IHYA 5LGNB 2CE7A 2C0SA 4IHJE 5HXCA 4AQYT 2YK0A 2V7LA 3K1SA 1MIYA 2K24A 2H7VC 2OA5A 1FIOA 5ETWA 3UU8A 2F4VT 2XAJB 2H89A 1HTJF 3HKDE 2BS4A 5L3FB 1WYBA 3CX7B 3SS1A 4IL9A 2VL0A 3ANWA 2XASB 3EDUA 3JADA 2N1GA 4H63H 2H88A 4TNWA 4TUYE 3Q5WA 4JYAT 1J1JA 2XSBA 4QKNA 5AQUB 3VU7H 3PJAJ 2LSIA 1OEDA 1ZV4X 2XUEA 5LOVE 2JRKA 1IAPA 1WFDA 3ZT6A 2V6YB 3BQIA 2PJQA 4YTMA 5AQKB 4H9RC 2VL8A 1MNDA 3CK6A 3N2KE 3KV4A 3PUVF 3O4XE 4WBNE 2I59A 3J9X1 2ACZA 2R6GF 4WNKA 2BDEA 5L4EA 4HFBA 5HXEA 2ZM0A 2VB6A 5LXTE 3N9OA 4A5XA 3HKBE 4U3CA 4KX6A 3B57A 2LHRA 4JBWF 5ABFA 1T8BA 4DBRA 5JQGE 2B76A 1G73A 5HXRA 2Z6EA 4QXHB 1H7CA 2HN1A 4DV4T 3MKDA 1O3XA 4DMVA 4WW0A 4IDQA 2XQ7A 3T8OA 3KV6A 4K0UA 4L9IA 4K0KT 2BG9E 4DBQA 5J2UE 1J5WA 3K8PC 4UR9A 5AQRB 1BR4A 2XAFB 2XQYA 4EB6E 2VVSA 1HNXT 3ZMSB 3OYZA 4AQGA 3BK9A 2WMOA 4YLHA 4PW8A 2Q9QB 3ZCJA 2E5VA 2VWAA 5FYMA 4MHCA 5DJQC 3AAAB 2CPTA 1IBKT 1ZHCA 3PTRB 1VCSA 2BBHA 2J47A 3ZYMA 1HR0T 1UX5A 4UVBB 4KHPT 2IAKA 4AISA 4DV3T 5HWYA 5JDMA 2IW5B 1J5ET 4A56A 1HNZT 4ZXLA 3LBXB 2BG9B 2W66A 2JQHA 3ZC1A 5JR9C 2X0YA 1NENA 4U2ZA 1WCRA 1QLBA 5L47A 5HEOA 4X64T 2NWBA 4AKGA 4ZS2A 2UXXB 3GWHA 2K9AA 4A98A 1QUUA 5EK2A 2BS3A 4DIDB 3AE8A 3KV9A 3IF8B 4HGAA 2BVLA 1BR1A 2MOZA 4ANJA 1WRDA 1SHZC 4PJJA 4UIGA 1T72A 3CWZB 4LFBT 2JQQA 3F57A 3ONJA 4CI1B 2E9XC 4JI6T 3H37A 3K3QC 2W00A 5HCJA 5ABGA 4DR6T 3GA8A 4B3RT 3T1HT 4YT0A 4DR2T 2MYSA 3P8CD 1IJ6A 2LM2A 4ILCA 2E5LT 4H9SE 2D0TA 1D1CA 3DJBA 4LF8T 2ZM2A 2LLYA 4L0RA 4I43B 3UU6A 4Z8XA 3AVRA 3ZT7A 3MA9A 4YFSA 5CA1E 1HX1B 5AQOB 1MIWA 2KWIB 3JCFA 4BJMA 4FJOA 2MAWA 4LMLA 2KLQA 1IZNB 4AQFC 2VKOA 3ZMZB 2E2AA 4WBOA 3AA7B 2EHOD 2BZBA 3VRAA 4DV5T 2ODVA 3LBXA 4LMJA 2UUBT 4IDOA 4CN6A 2XQ6A 3RC3A 3MJXA 1GQEA 5C3JA 4U2YA 2XQAA 5FMNA 4C91A 2K48A 3LJCA 1XMOT 2YU2A 4ERRA 4LFAT 5H6QB 3Q5XA 4JUYA 2YKSA 2N2NA 3L09A 1M7KA 4OHFA 2CXLA 3ZSSA 4CZZB 5EK3A 4LFCT 4OYKA 4EEBA 2CMRA 4H63V 5L4HA 3LK2B 1HX8A 1JNRA 2RPAA 2BBJA 3TLSA 2X67A 3RH3A 2XHEB 4WYVA 3RIUC 5LBQB 2WDRA 4GOUA 4DUYT 1WLXA 5M4YA 4HFIA 2LRKA 5J1GA 3P4RA 1S94A 4DR4T 3NRXA 3ZYLA 3P50A 4O4JE 5JDQA 4GIWA 4J2CA 3V5UA 1D0XA 1NAFA 3JAEA 3TLUA 2NTXA 1T98A 2Q9QC 4HFEA 2HH7A 4KMCA 4DV1T 2YEVC 3CMLA 2L8KA 2IMLA 3SFDA 3KFWX 4PK4A 3EUHA 1FJGT 2FJBA 1N33T 2XQ3A 2FBWA 4PJMA 4IGUA 4CI3B 4EV6A 2L9QA 5JR9B 4JI0T 2AXDS 4ZI3C 3N5LA 4MFRA 3PUXF 3KV5A 1D0YA 3BQKA 2J1DG 3O1JA 2EHOC 2BG9C 4UXNB 4JI8T 1KEYA 4QH1A 3EABA 4H9OC 4UV8B 2V5DA 4UF0B 5L3GB 4OK0A 1M62A 2XAHB 2MTQA 5HWXA 4YSZA 1X79A 4PAGA 5LHHB 2C5KT 2KMFA 2W0GA 3OYXA 3B13A 2ZM6T 5LMUT 2PFVA 5L3EB 4DUZT 2BVMA 4QXCB 3ZMTB 4YTPA 4M1PA 3P4SA 2V26A 3AEEA 3JC6D 1S35A 2JQ9A 2IC6A 3ZSTA 4HWHA 3AA0B 2PG8A 2W4XA 3QOFA 4P09A 5HXSA 5JDFA 4U33A 5LGTB 2WZHA 3UQ7A 5BMVE 2HPLA 1E2AA 4H9QC 4LF9T 2YDQA 4DO0A 3PUYF 2VVNA 4HFDA 2WU5A 2QVAA 4UEMA 1IBLT 4DVDA 3QB5A 3AVSA 2J4GA 4X5TA 3CPZA 2ACXA 3T1YT 3A7MA 4UVCB 5F3JA 5KXJA 1YQ3A 3L3PA 1UURA 4O4LE 2H7OA 3E08A 4TN7B 1XMQT 2DWGA 3FZMB 2LKHA 5LHGB 4MLKA 2D9DA 1ZOYA 4E7ZA 5L3DB 5F5WA 2LEHA 5LCYA 3DTOA 3GN5A 4IE0A 4EOZB 3C50A 3PE0A 5C2TA 1AJ3A 5JR9A 2X0LB 3ZYKA 3MK7C 3NZPA 2CWOA 1UCUA 5L3BB 3KBUA 2WQYA 4AKRB 2V7KA 5AQJB 3QNUA 4ILUA 5JRCB 3LG7A 3KBTA 2WU2A 1EZ3A 1YKHB 3Q9DA 4NIQA 3AXJB 4KHZF 4XAXB 5C8YE 3U78A 2VQET 1MMGA 1B7TA 5FXZA 1LRZA 4EEDA 3HKEE 4HFHA 4HWIB 5KX5E 4EYUA 3NVOA 3C64A 4NXMT 5LJNA 3SOLA 1UK5A 5LMNT 4NUUA 2Y48B 4TV8E 3O1HA 3TLWA 1VOMA 2V6XA 3FXDB 5LBMA 3H3MA 1WYCA 3SWHA 2E9XA 2CLYB 2RP4A 3ABVA 1IJ5A 3RYCE 4P1NA 4GKJT 2GK9A 3C4ZA 3ZEFB 3OJAA 3A5XA 3CQCB 5FY1A 3TLVA 4H9PC 1UUSA 5DABA 2N9DA 3IHRA 3HR0A 1ZP0A 2PBIA 3M3ZB 4KI0F 5CA0E 2XAGB 2XQ4A 5LG4A 2UXNB 3RGLA 4U74A 2XQ8A 3PUAA 4IDZA 3UUBA 4LF5T 2YDSA 4CQIA 2CWYA 3FZFB 3EVYA 4IL4A 2KWHA 2NW8A 2V7JA 4OFZA 3N2GE 3K3NA 4AKIA 3RX6A 2YDRA 2FJEA 2OLTA 1FMWA 5IWAT 2SPCA 1XNRT 2EHOB 5LNKA 3AE2A 2LE8A 3FHNA 2WM9A 3PUZF 4I50E 2V6YA 1XDOA 3AEAA 2XM2A 5JDGA 3E22E 1HS7A 3AE9A 1XNQT 1KNPA 4UVAB 5JREA 5FL1A 4X20E 3I9WA 5JVDE 2FUPA 2CM0A 5DQVA 3K3OA 4KBMB 4JI4T 1V9DA 2WDQA 3AXJA 5ABEA 5L3CB 1DU2A 1XDPA 2WS3A 3G06A 3PUSA 3D0TA 1YW0A 2XJ7A 4X1KE 1CUNA 3ONLC 3VR9A 2ES0A 2IDOB 3VKHA 2K5BB 3AE1A 4CN4A 4PFOA 3MXZA 1OXZA 3DP7A 3RHWA 1HF8A 2M6BA 4X66T 2DL1A 2VKJA 2ODUA 1XZYA 4NXNT 3PV0F 3RQWA 5GONE 4LF7T 3PURA 4DV7T 3EAMA 4QXBB 3UU5A 2LOPA 1YD8G 1YXRA 3V5SA 4HE8A 3VKGA 2CBJA 1I94T 1E1HB 1HNWT 1MIVA 2Q9QA 3O9XA 3HA4A 3ZN0B 2WY2A 3LSVA 5HXHA 3ZMUB 4TWFA 4ZOLE 1KNRA 2KT9A 3ZN1B 5AFUL 3RPUA 3KDSE 3R84B 3FZKB 5FY0A 3ZMVB 4YHHT 5EK4A 1Y01A 2DNXA 2CRBA 4DR7T 5HEHA 5TAOA 1NEKA 4B6XA 5CJ5A 1YQ4A 3EI0A 3AB3B 4CI2B 3A8YC 2EHOA 3ZC0A 2BG9A 3N2OA 4YJ2E 4ZI2D 2LKGA 5FVLA 2A72A 2MBGA 5LG3A 3E0ZA 4TNVA 4ISSA 3RYHE 2C5IT 2W63A 2NW7A 4ZI7E 5FNVE 3UU3A 1T7SA 3VHLA 3L8RA 4O4IE 3VR8A 3UFGA 3P4PA 2W62A 3QB5K 3ETVA 2UUAT 2XQ5A 3ZJ1A 2KSRA 3AA1B 1SE7A 1LVKA 3LFMA 4GYRA 4ZHQE 3ZCIA 2YU1A 3ZLIA 4GYSA 5AQLB 2CLYC 4JEUB 3NWIA 1FMVA 2AE9A 3PUQA 1OEDE 4X1YE 4BAYB 1VRBA 2V5CA 2NP9A 2LSKA 1OWAA 2FJAA 4EZHA 5J0ZA 4IT4A 5HEGA 4Q25A 3U3IA 1MMAA 4O2AE 3C98B 5KMGP 1QSDA 2E8IA 4X1IE 3CIRA 4TX5A 2MPKA 5AQMB 2D2SA 1UGOA 2LJLA 4AXPA 2KNDA 4P0AA 4PJLA 2X9XA 2UXCT 2BKNA 2W61A 2X51A 1WR0A 2L3LA 1LKXA 5LB7B 2P9BA 4GKKT 2V1DB 3AE7A 4CXYA 3NRYA 3OVUA 5LGUB 2V7IA 2W2UA 4ISTA 4XBFB 5LHIB 2JQKA 4AKLA 4DR5T 4CXXA 5CB4E 4CN1A 5HEJA 1VCTA 4JI7T 3LDQB 3ETUA 3PDYA 2D0UA 1FEWA 1YKEB 1D1AA 5FXXA 4LF6T 5FVKA 4JI1T 5L2LA 5H6RB 2CHNA 2X66A 5HAXA 4YXDA 4WZXA 3MACA 4EGWA 1U4QA 3AEGA 2CBIA 2JJ9A 3AE4A 2WDVA 3TKLB 4YSYA 1KF6A 4PK6A 5FKYA 2Y8DA 1R8IA 4X65T 3NBXX 2NTYA 3F2EA 1W0AA 2XSAA 2LSYA 2VKHA 4COFA 4HN9A 5LYJE 4Z91A 5J2TE 2FJDA 2V8SV 3UULA 2ZM8A 5A1LA 4QX8B 5AQSB 1CHUA 3BQLA 3OTOT 3RKGA 3P4WA 3N9NA 4E7SA 2JIWA 3VRBA 3N9QA 4ILBA 4B3TT 1US7B 2UXBT 2XZEA 4NUVA 2NOXA 3PUGA 3TLTA 2KXPB 2IUBA 2VK9A 3AEFA 3HI2A 4O4HE 1Y64B 3I1AA 4I0UA 2CXFA 1JNZA 4AIUA 1LVFA 2WZIA 5JDLA 4P0BA 3X1DA 5IUXA 4UF0A 2LHNA 4IE6A 5JDNA 1KFYA 4U72A 3EDVA 4UV9B 1NWMX 5FXVA 4IE5A 4N78D 2LRLA 3UQ4A 2LM9A 5F8PA 1D1BA 3AE5A 4BA9A 4XZCA 4GK5E 5AQGB 4IREA 2X9HA 1W0BA 4JV5T 5JTGA 4IE7A 1N34T 5BR8T 3ZT5A 3WAKA 1ZKEA 2CXDA 4EXTA 1HG5A 3JC6C 5KDMC 3RF1A 2CEAA 4HEAA 2KINB 4DNDA 4B3ST 4DV6T 5ADXL 3S4UA 1Z8UA 5FP3A 4U31A 2E9XD 4IDPA 3SFEA 3AECA 3OKQA 2NR4A 1WR6A 3UUXB 3C4XA 3CKDA 2ZLYA 4EYYR 2QYWA 2LSGA 4PJNA 3FBLA 2XPKA 4O8SA 4EIWA 4AQFA 2LT3A 3RYIE 4L5GA 4DMWA 2VQFT 3AAIA 3PJAA 1W09A 2IC9A 2XM1A 2IHR1 3Q5DA 3ZPOA 4NPPA 4F8HA 3F31A 4I4TE 4FI5A 3W15B 3CQGB 5CFBA 1OEDC 3FBZA 4HWDA 4ZZBA 1IBMT 4TZ4C 1SUMB 3AE6A 5FY7A 5JRCA 3HKCE 1BR2A 2J62A 5LA6E 3QC9A 2HPJA 4U7IA 2A3DA 1HG2A 4Z90A 4PK5A 4F6RC 2YINA 2G0UA 3UUNA 5JDHA 3P7IA 4ADZA 2YOEA 2KZ7B 3AA6B 2W67A 2JMKA 2LOSA 3FB2A 2BS2A 3I0QA 2DLRA 3RIUA 5FXWA 4TWDA 3I9YA 2WAUA 1N32T 4QH4A 3N9PA 3AEBA 2UXDT 2X0HA 3RI5A 5FL0A 2WSSV 4G2AA 2XAQB 4DR1T 1MNEA 3RKOA 2X9YA 3LK3B 2UUCT 5AQHB 3OPCA 2XY8B 3GMIA 4IIJE 5ABHA 3EHZA 3IEEA 1G8XA 2BKPA 4CXWA 2D5UA 2Y6XA 2M6IA 2M67A 3M65A 3C51A 3PUWF 2Q9QD 2WP9A 4YY3T 3RYFE 3AAEB 3RRWA 4B3MT 2JPFA 2I0MA 3RQUA 3RIFA 1N36T 3SRZA 5AQTB 2H3RA 3KVAA 3O1IA 2ZMAA 3ONXA 2QGSA 3UU4A 5CGMA 2C5JA 5IYZE 2XTLA 2XQ9A 5AQNB 3PU3A 2DHRA 1XWMA 2VKDA 4I55E 4ZI3D 3HL6A 3B5MA 1SA0E 3NZQA 3MZKB 4YHJA 5HEUA 3IA3A 2A9UA 3FZHB 4BJNA 2K3WA 2WCAA 3L39A 2X9WA 3UT5E 4AI6A 5EZYE 2CA5A 2RA1A 3QUJA 2DCFA 1D0ZA 4DV0T 3UTKA 2CHOA 4JEHB 4ZS3A 2UU9T 3FXEB 2V7MA 4PNIA 1KK7A 4IE4A 5AQVB 2WWUA 4JI5T 4U7YA 4LMKA 3P4QA 4QHOA 3PU8A 2QA7A 4OYJA 2WBLA 4OX9T 4HKAA 3J7Yq 3Q2MA 4TV9E 4HWFA 3ZKRA 4EZ4A 4HFCA 3RIAA 3WAJA 4YTNA 3I0OA 4UELA 1KNZA 3AE3A 4QX7B 1I6ZA 4QWNB 1W9RA 3NKZA 5LJMA 2JMHA 3CQXC 3LK42 3QK6A 4AKHA 2VURA 4ASKA 3UUMA 4LF4T 1MMNA 4ZZCA 2WB5A 4TWHA 3CX8B 5HYAA 2YN6A 3RC8A 4C90A 3N9MA 1L0VA 3H3AA 4GK0E 4V1Av 4ZEYA 5AQFB 4YJ3E 3CVRA 5DQWA 3CX6B 4HTEA 3AEDA 2PTFA 3ANWB 4YSXA 3UFEA 4H9NC 1HFAA 4JLEA 2WWVA 2B1EA 3KVBA 4KP3C 3JAFA 2CCQA 1E7PA 3C4WA 3GN5B 1OEDB 2DI4A 3R6NA 4ILAA 4KUMB 4O2BE 1U5PA 1ZEEA 3KINB 3ZJ2A 1Z0PA 3WI3A 4HFVA 4PFPA 4ZI2C 4A97A 2LSJA 4G63A 3RLFF 1MMDA 2HHHT 3OBVE 4EAHA 5LP6E 5AQIB 4MBQA 1UX4A 4X62T 2WMNA 1BR0A 2QRXA 3RRCA 2VASA 2BKOA 4DV2T 2X68A 3Q5EA 4QH5A 3IBPA 4MALA 5ABFB 4DR3T 3ESLA 2A2FX 4IDNA 2IIUA 4JI3T 2OV9A 5AQQB 5E0OA 5AQPB 1HCIA 3N9LA 2I6HA 5HCMA 2E9XB 5JH7E
chains in the Genus database with same CATH topology
1HNZT 4JI2T 2ZM6T 2UUAT 5LMUT 4NXNT 4DUYT 4DUZT 4AQYT 4LF7T 4DV7T 3OTOT 4X64T 2F4VT 4DR4T 1N32T 1I94T 2UXDT 1HNWT 4B3TT 5IWAT 2VQET 2UXBT 4DR5T 1XNRT 4DV0T 4DV4T 4JI7T 4LF9T 2UU9T 4DR1T 4DV5T 4DV1T 4K0KT 4NXMT 2UUBT 4JI5T 1IBLT 2HHHT 5LMNT 2UUCT 4LF6T 1XNQT 2VQFT 4JI1T 4YHHT 1FJGT 1N33T 3T1YT 4JYAT 4OX9T 1HNXT 4JI4T 4DR7T 4LFBT 4X62T 4JI0T 1XMOT 4LFAT 4GKJT 4DV2T 1XMQT 4JI6T 4YY3T 1IBMT 4JV5T 4B3MT 4DR6T 4JI8T 1N34T 1N36T 4B3RT 5BR8T 4LF4T 3T1HT 1IBKT 4DR2T 4LFCT 2UXCT 4DR3T 1HR0T 4X65T 4JI3T 2E5LT 4KHPT 4DV3T 4B3ST 4LF8T 4DV6T 4LF5T 4GKKT 4X66T 1J5ET
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  4JI2 T;  2ZM6 T;  2UUA T;  5LMU T;  4NXN T;  4DUY T;  4DUZ T;  4AQY T;  4LF7 T;  4DV7 T;  3OTO T;  4X64 T;  2F4V T;  4DR4 T;  1N32 T;  1I94 T;  2UXD T;  1HNW T;  4B3T T;  5IWA T;  2VQE T;  2UXB T;  4DR5 T;  1XNR T;  4DV0 T;  4DV4 T;  4JI7 T;  4LF9 T;  2UU9 T;  4DR1 T;  4DV5 T;  4DV1 T;  4K0K T;  4NXM T;  2UUB T;  4JI5 T;  1IBL T;  2HHH T;  5LMN T;  2UUC T;  4LF6 T;  1XNQ T;  2VQF T;  4JI1 T;  4YHH T;  1FJG T;  1N33 T;  3T1Y T;  4JYA T;  4OX9 T;  1HNX T;  4JI4 T;  4DR7 T;  4LFB T;  4X62 T;  4JI0 T;  1XMO T;  4LFA T;  4GKJ T;  4DV2 T;  1XMQ T;  4JI6 T;  4YY3 T;  1IBM T;  4JV5 T;  4B3M T;  4DR6 T;  4JI8 T;  1N34 T;  1N36 T;  4B3R T;  5BR8 T;  4LF4 T;  3T1H T;  1IBK T;  4DR2 T;  4LFC T;  2UXC T;  4DR3 T;  1HR0 T;  4X65 T;  4JI3 T;  2E5L T;  4KHP T;  4DV3 T;  4B3S T;  4LF8 T;  4DV6 T;  4LF5 T;  4GKK T;  4X66 T;  1J5E T; 
#chains in the Genus database with same CATH topology
 2HN2 A;  1X9B A;  4JI2 T;  2DWK A;  2NW9 A;  4HWC A;  3FZL B;  5IHY A;  5LGN B;  2CE7 A;  2C0S A;  4IHJ E;  5HXC A;  4AQY T;  2YK0 A;  2V7L A;  3K1S A;  1MIY A;  2K24 A;  2H7V C;  2OA5 A;  1FIO A;  5ETW A;  3UU8 A;  2F4V T;  2XAJ B;  2H89 A;  1HTJ F;  3HKD E;  2BS4 A;  5L3F B;  1WYB A;  3CX7 B;  3SS1 A;  4IL9 A;  2VL0 A;  3ANW A;  2XAS B;  3EDU A;  3JAD A;  2N1G A;  4H63 H;  2H88 A;  4TNW A;  4TUY E;  3Q5W A;  4JYA T;  1J1J A;  2XSB A;  4QKN A;  5AQU B;  3VU7 H;  3PJA J;  2LSI A;  1OED A;  1ZV4 X;  2XUE A;  5LOV E;  2JRK A;  1IAP A;  1WFD A;  3ZT6 A;  2V6Y B;  3BQI A;  2PJQ A;  4YTM A;  5AQK B;  4H9R C;  2VL8 A;  1MND A;  3CK6 A;  3N2K E;  3KV4 A;  3PUV F;  3O4X E;  4WBN E;  2I59 A;  3J9X 1;  2ACZ A;  2R6G F;  4WNK A;  2BDE A;  5L4E A;  4HFB A;  5HXE A;  2ZM0 A;  2VB6 A;  5LXT E;  3N9O A;  4A5X A;  3HKB E;  4U3C A;  4KX6 A;  3B57 A;  2LHR A;  4JBW F;  5ABF A;  1T8B A;  4DBR A;  5JQG E;  2B76 A;  1G73 A;  5HXR A;  2Z6E A;  4QXH B;  1H7C A;  2HN1 A;  4DV4 T;  3MKD A;  1O3X A;  4DMV A;  4WW0 A;  4IDQ A;  2XQ7 A;  3T8O A;  3KV6 A;  4K0U A;  4L9I A;  4K0K T;  2BG9 E;  4DBQ A;  5J2U E;  1J5W A;  3K8P C;  4UR9 A;  5AQR B;  1BR4 A;  2XAF B;  2XQY A;  4EB6 E;  2VVS A;  1HNX T;  3ZMS B;  3OYZ A;  4AQG A;  3BK9 A;  2WMO A;  4YLH A;  4PW8 A;  2Q9Q B;  3ZCJ A;  2E5V A;  2VWA A;  5FYM A;  4MHC A;  5DJQ C;  3AAA B;  2CPT A;  1IBK T;  1ZHC A;  3PTR B;  1VCS A;  2BBH A;  2J47 A;  3ZYM A;  1HR0 T;  1UX5 A;  4UVB B;  4KHP T;  2IAK A;  4AIS A;  4DV3 T;  5HWY A;  5JDM A;  2IW5 B;  1J5E T;  4A56 A;  1HNZ T;  4ZXL A;  3LBX B;  2BG9 B;  2W66 A;  2JQH A;  3ZC1 A;  5JR9 C;  2X0Y A;  1NEN A;  4U2Z A;  1WCR A;  1QLB A;  5L47 A;  5HEO A;  4X64 T;  2NWB A;  4AKG A;  4ZS2 A;  2UXX B;  3GWH A;  2K9A A;  4A98 A;  1QUU A;  5EK2 A;  2BS3 A;  4DID B;  3AE8 A;  3KV9 A;  3IF8 B;  4HGA A;  2BVL A;  1BR1 A;  2MOZ A;  4ANJ A;  1WRD A;  1SHZ C;  4PJJ A;  4UIG A;  1T72 A;  3CWZ B;  4LFB T;  2JQQ A;  3F57 A;  3ONJ A;  4CI1 B;  2E9X C;  4JI6 T;  3H37 A;  3K3Q C;  2W00 A;  5HCJ A;  5ABG A;  4DR6 T;  3GA8 A;  4B3R T;  3T1H T;  4YT0 A;  4DR2 T;  2MYS A;  3P8C D;  1IJ6 A;  2LM2 A;  4ILC A;  2E5L T;  4H9S E;  2D0T A;  1D1C A;  3DJB A;  4LF8 T;  2ZM2 A;  2LLY A;  4L0R A;  4I43 B;  3UU6 A;  4Z8X A;  3AVR A;  3ZT7 A;  3MA9 A;  4YFS A;  5CA1 E;  1HX1 B;  5AQO B;  1MIW A;  2KWI B;  3JCF A;  4BJM A;  4FJO A;  2MAW A;  4LML A;  2KLQ A;  1IZN B;  4AQF C;  2VKO A;  3ZMZ B;  2E2A A;  4WBO A;  3AA7 B;  2EHO D;  2BZB A;  3VRA A;  4DV5 T;  2ODV A;  3LBX A;  4LMJ A;  2UUB T;  4IDO A;  4CN6 A;  2XQ6 A;  3RC3 A;  3MJX A;  1GQE A;  5C3J A;  4U2Y A;  2XQA A;  5FMN A;  4C91 A;  2K48 A;  3LJC A;  1XMO T;  2YU2 A;  4ERR A;  4LFA T;  5H6Q B;  3Q5X A;  4JUY A;  2YKS A;  2N2N A;  3L09 A;  1M7K A;  4OHF A;  2CXL A;  3ZSS A;  4CZZ B;  5EK3 A;  4LFC T;  4OYK A;  4EEB A;  2CMR A;  4H63 V;  5L4H A;  3LK2 B;  1HX8 A;  1JNR A;  2RPA A;  2BBJ A;  3TLS A;  2X67 A;  3RH3 A;  2XHE B;  4WYV A;  3RIU C;  5LBQ B;  2WDR A;  4GOU A;  4DUY T;  1WLX A;  5M4Y A;  4HFI A;  2LRK A;  5J1G A;  3P4R A;  1S94 A;  4DR4 T;  3NRX A;  3ZYL A;  3P50 A;  4O4J E;  5JDQ A;  4GIW A;  4J2C A;  3V5U A;  1D0X A;  1NAF A;  3JAE A;  3TLU A;  2NTX A;  1T98 A;  2Q9Q C;  4HFE A;  2HH7 A;  4KMC A;  4DV1 T;  2YEV C;  3CML A;  2L8K A;  2IML A;  3SFD A;  3KFW X;  4PK4 A;  3EUH A;  1FJG T;  2FJB A;  1N33 T;  2XQ3 A;  2FBW A;  4PJM A;  4IGU A;  4CI3 B;  4EV6 A;  2L9Q A;  5JR9 B;  4JI0 T;  2AXD S;  4ZI3 C;  3N5L A;  4MFR A;  3PUX F;  3KV5 A;  1D0Y A;  3BQK A;  2J1D G;  3O1J A;  2EHO C;  2BG9 C;  4UXN B;  4JI8 T;  1KEY A;  4QH1 A;  3EAB A;  4H9O C;  4UV8 B;  2V5D A;  4UF0 B;  5L3G B;  4OK0 A;  1M62 A;  2XAH B;  2MTQ A;  5HWX A;  4YSZ A;  1X79 A;  4PAG A;  5LHH B;  2C5K T;  2KMF A;  2W0G A;  3OYX A;  3B13 A;  2ZM6 T;  5LMU T;  2PFV A;  5L3E B;  4DUZ T;  2BVM A;  4QXC B;  3ZMT B;  4YTP A;  4M1P A;  3P4S A;  2V26 A;  3AEE A;  3JC6 D;  1S35 A;  2JQ9 A;  2IC6 A;  3ZST A;  4HWH A;  3AA0 B;  2PG8 A;  2W4X A;  3QOF A;  4P09 A;  5HXS A;  5JDF A;  4U33 A;  5LGT B;  2WZH A;  3UQ7 A;  5BMV E;  2HPL A;  1E2A A;  4H9Q C;  4LF9 T;  2YDQ A;  4DO0 A;  3PUY F;  2VVN A;  4HFD A;  2WU5 A;  2QVA A;  4UEM A;  1IBL T;  4DVD A;  3QB5 A;  3AVS A;  2J4G A;  4X5T A;  3CPZ A;  2ACX A;  3T1Y T;  3A7M A;  4UVC B;  5F3J A;  5KXJ A;  1YQ3 A;  3L3P A;  1UUR A;  4O4L E;  2H7O A;  3E08 A;  4TN7 B;  1XMQ T;  2DWG A;  3FZM B;  2LKH A;  5LHG B;  4MLK A;  2D9D A;  1ZOY A;  4E7Z A;  5L3D B;  5F5W A;  2LEH A;  5LCY A;  3DTO A;  3GN5 A;  4IE0 A;  4EOZ B;  3C50 A;  3PE0 A;  5C2T A;  1AJ3 A;  5JR9 A;  2X0L B;  3ZYK A;  3MK7 C;  3NZP A;  2CWO A;  1UCU A;  5L3B B;  3KBU A;  2WQY A;  4AKR B;  2V7K A;  5AQJ B;  3QNU A;  4ILU A;  5JRC B;  3LG7 A;  3KBT A;  2WU2 A;  1EZ3 A;  1YKH B;  3Q9D A;  4NIQ A;  3AXJ B;  4KHZ F;  4XAX B;  5C8Y E;  3U78 A;  2VQE T;  1MMG A;  1B7T A;  5FXZ A;  1LRZ A;  4EED A;  3HKE E;  4HFH A;  4HWI B;  5KX5 E;  4EYU A;  3NVO A;  3C64 A;  4NXM T;  5LJN A;  3SOL A;  1UK5 A;  5LMN T;  4NUU A;  2Y48 B;  4TV8 E;  3O1H A;  3TLW A;  1VOM A;  2V6X A;  3FXD B;  5LBM A;  3H3M A;  1WYC A;  3SWH A;  2E9X A;  2CLY B;  2RP4 A;  3ABV A;  1IJ5 A;  3RYC E;  4P1N A;  4GKJ T;  2GK9 A;  3C4Z A;  3ZEF B;  3OJA A;  3A5X A;  3CQC B;  5FY1 A;  3TLV A;  4H9P C;  1UUS A;  5DAB A;  2N9D A;  3IHR A;  3HR0 A;  1ZP0 A;  2PBI A;  3M3Z B;  4KI0 F;  5CA0 E;  2XAG B;  2XQ4 A;  5LG4 A;  2UXN B;  3RGL A;  4U74 A;  2XQ8 A;  3PUA A;  4IDZ A;  3UUB A;  4LF5 T;  2YDS A;  4CQI A;  2CWY A;  3FZF B;  3EVY A;  4IL4 A;  2KWH A;  2NW8 A;  2V7J A;  4OFZ A;  3N2G E;  3K3N A;  4AKI A;  3RX6 A;  2YDR A;  2FJE A;  2OLT A;  1FMW A;  5IWA T;  2SPC A;  1XNR T;  2EHO B;  5LNK A;  3AE2 A;  2LE8 A;  3FHN A;  2WM9 A;  3PUZ F;  4I50 E;  2V6Y A;  1XDO A;  3AEA A;  2XM2 A;  5JDG A;  3E22 E;  1HS7 A;  3AE9 A;  1XNQ T;  1KNP A;  4UVA B;  5JRE A;  5FL1 A;  4X20 E;  3I9W A;  5JVD E;  2FUP A;  2CM0 A;  5DQV A;  3K3O A;  4KBM B;  4JI4 T;  1V9D A;  2WDQ A;  3AXJ A;  5ABE A;  5L3C B;  1DU2 A;  1XDP A;  2WS3 A;  3G06 A;  3PUS A;  3D0T A;  1YW0 A;  2XJ7 A;  4X1K E;  1CUN A;  3ONL C;  3VR9 A;  2ES0 A;  2IDO B;  3VKH A;  2K5B B;  3AE1 A;  4CN4 A;  4PFO A;  3MXZ A;  1OXZ A;  3DP7 A;  3RHW A;  1HF8 A;  2M6B A;  4X66 T;  2DL1 A;  2VKJ A;  2ODU A;  1XZY A;  4NXN T;  3PV0 F;  3RQW A;  5GON E;  4LF7 T;  3PUR A;  4DV7 T;  3EAM A;  4QXB B;  3UU5 A;  2LOP A;  1YD8 G;  1YXR A;  3V5S A;  4HE8 A;  3VKG A;  2CBJ A;  1I94 T;  1E1H B;  1HNW T;  1MIV A;  2Q9Q A;  3O9X A;  3HA4 A;  3ZN0 B;  2WY2 A;  3LSV A;  5HXH A;  3ZMU B;  4TWF A;  4ZOL E;  1KNR A;  2KT9 A;  3ZN1 B;  5AFU L;  3RPU A;  3KDS E;  3R84 B;  3FZK B;  5FY0 A;  3ZMV B;  4YHH T;  5EK4 A;  1Y01 A;  2DNX A;  2CRB A;  4DR7 T;  5HEH A;  5TAO A;  1NEK A;  4B6X A;  5CJ5 A;  1YQ4 A;  3EI0 A;  3AB3 B;  4CI2 B;  3A8Y C;  2EHO A;  3ZC0 A;  2BG9 A;  3N2O A;  4YJ2 E;  4ZI2 D;  2LKG A;  5FVL A;  2A72 A;  2MBG A;  5LG3 A;  3E0Z A;  4TNV A;  4ISS A;  3RYH E;  2C5I T;  2W63 A;  2NW7 A;  4ZI7 E;  5FNV E;  3UU3 A;  1T7S A;  3VHL A;  3L8R A;  4O4I E;  3VR8 A;  3UFG A;  3P4P A;  2W62 A;  3QB5 K;  3ETV A;  2UUA T;  2XQ5 A;  3ZJ1 A;  2KSR A;  3AA1 B;  1SE7 A;  1LVK A;  3LFM A;  4GYR A;  4ZHQ E;  3ZCI A;  2YU1 A;  3ZLI A;  4GYS A;  5AQL B;  2CLY C;  4JEU B;  3NWI A;  1FMV A;  2AE9 A;  3PUQ A;  1OED E;  4X1Y E;  4BAY B;  1VRB A;  2V5C A;  2NP9 A;  2LSK A;  1OWA A;  2FJA A;  4EZH A;  5J0Z A;  4IT4 A;  5HEG A;  4Q25 A;  3U3I A;  1MMA A;  4O2A E;  3C98 B;  5KMG P;  1QSD A;  2E8I A;  4X1I E;  3CIR A;  4TX5 A;  2MPK A;  5AQM B;  2D2S A;  1UGO A;  2LJL A;  4AXP A;  2KND A;  4P0A A;  4PJL A;  2X9X A;  2UXC T;  2BKN A;  2W61 A;  2X51 A;  1WR0 A;  2L3L A;  1LKX A;  5LB7 B;  2P9B A;  4GKK T;  2V1D B;  3AE7 A;  4CXY A;  3NRY A;  3OVU A;  5LGU B;  2V7I A;  2W2U A;  4IST A;  4XBF B;  5LHI B;  2JQK A;  4AKL A;  4DR5 T;  4CXX A;  5CB4 E;  4CN1 A;  5HEJ A;  1VCT A;  4JI7 T;  3LDQ B;  3ETU A;  3PDY A;  2D0U A;  1FEW A;  1YKE B;  1D1A A;  5FXX A;  4LF6 T;  5FVK A;  4JI1 T;  5L2L A;  5H6R B;  2CHN A;  2X66 A;  5HAX A;  4YXD A;  4WZX A;  3MAC A;  4EGW A;  1U4Q A;  3AEG A;  2CBI A;  2JJ9 A;  3AE4 A;  2WDV A;  3TKL B;  4YSY A;  1KF6 A;  4PK6 A;  5FKY A;  2Y8D A;  1R8I A;  4X65 T;  3NBX X;  2NTY A;  3F2E A;  1W0A A;  2XSA A;  2LSY A;  2VKH A;  4COF A;  4HN9 A;  5LYJ E;  4Z91 A;  5J2T E;  2FJD A;  2V8S V;  3UUL A;  2ZM8 A;  5A1L A;  4QX8 B;  5AQS B;  1CHU A;  3BQL A;  3OTO T;  3RKG A;  3P4W A;  3N9N A;  4E7S A;  2JIW A;  3VRB A;  3N9Q A;  4ILB A;  4B3T T;  1US7 B;  2UXB T;  2XZE A;  4NUV A;  2NOX A;  3PUG A;  3TLT A;  2KXP B;  2IUB A;  2VK9 A;  3AEF A;  3HI2 A;  4O4H E;  1Y64 B;  3I1A A;  4I0U A;  2CXF A;  1JNZ A;  4AIU A;  1LVF A;  2WZI A;  5JDL A;  4P0B A;  3X1D A;  5IUX A;  4UF0 A;  2LHN A;  4IE6 A;  5JDN A;  1KFY A;  4U72 A;  3EDV A;  4UV9 B;  1NWM X;  5FXV A;  4IE5 A;  4N78 D;  2LRL A;  3UQ4 A;  2LM9 A;  5F8P A;  1D1B A;  3AE5 A;  4BA9 A;  4XZC A;  4GK5 E;  5AQG B;  4IRE A;  2X9H A;  1W0B A;  4JV5 T;  5JTG A;  4IE7 A;  1N34 T;  5BR8 T;  3ZT5 A;  3WAK A;  1ZKE A;  2CXD A;  4EXT A;  1HG5 A;  3JC6 C;  5KDM C;  3RF1 A;  2CEA A;  4HEA A;  2KIN B;  4DND A;  4B3S T;  4DV6 T;  5ADX L;  3S4U A;  1Z8U A;  5FP3 A;  4U31 A;  2E9X D;  4IDP A;  3SFE A;  3AEC A;  3OKQ A;  2NR4 A;  1WR6 A;  3UUX B;  3C4X A;  3CKD A;  2ZLY A;  4EYY R;  2QYW A;  2LSG A;  4PJN A;  3FBL A;  2XPK A;  4O8S A;  4EIW A;  4AQF A;  2LT3 A;  3RYI E;  4L5G A;  4DMW A;  2VQF T;  3AAI A;  3PJA A;  1W09 A;  2IC9 A;  2XM1 A;  2IHR 1;  3Q5D A;  3ZPO A;  4NPP A;  4F8H A;  3F31 A;  4I4T E;  4FI5 A;  3W15 B;  3CQG B;  5CFB A;  1OED C;  3FBZ A;  4HWD A;  4ZZB A;  1IBM T;  4TZ4 C;  1SUM B;  3AE6 A;  5FY7 A;  5JRC A;  3HKC E;  1BR2 A;  2J62 A;  5LA6 E;  3QC9 A;  2HPJ A;  4U7I A;  2A3D A;  1HG2 A;  4Z90 A;  4PK5 A;  4F6R C;  2YIN A;  2G0U A;  3UUN A;  5JDH A;  3P7I A;  4ADZ A;  2YOE A;  2KZ7 B;  3AA6 B;  2W67 A;  2JMK A;  2LOS A;  3FB2 A;  2BS2 A;  3I0Q A;  2DLR A;  3RIU A;  5FXW A;  4TWD A;  3I9Y A;  2WAU A;  1N32 T;  4QH4 A;  3N9P A;  3AEB A;  2UXD T;  2X0H A;  3RI5 A;  5FL0 A;  2WSS V;  4G2A A;  2XAQ B;  4DR1 T;  1MNE A;  3RKO A;  2X9Y A;  3LK3 B;  2UUC T;  5AQH B;  3OPC A;  2XY8 B;  3GMI A;  4IIJ E;  5ABH A;  3EHZ A;  3IEE A;  1G8X A;  2BKP A;  4CXW A;  2D5U A;  2Y6X A;  2M6I A;  2M67 A;  3M65 A;  3C51 A;  3PUW F;  2Q9Q D;  2WP9 A;  4YY3 T;  3RYF E;  3AAE B;  3RRW A;  4B3M T;  2JPF A;  2I0M A;  3RQU A;  3RIF A;  1N36 T;  3SRZ A;  5AQT B;  2H3R A;  3KVA A;  3O1I A;  2ZMA A;  3ONX A;  2QGS A;  3UU4 A;  5CGM A;  2C5J A;  5IYZ E;  2XTL A;  2XQ9 A;  5AQN B;  3PU3 A;  2DHR A;  1XWM A;  2VKD A;  4I55 E;  4ZI3 D;  3HL6 A;  3B5M A;  1SA0 E;  3NZQ A;  3MZK B;  4YHJ A;  5HEU A;  3IA3 A;  2A9U A;  3FZH B;  4BJN A;  2K3W A;  2WCA A;  3L39 A;  2X9W A;  3UT5 E;  4AI6 A;  5EZY E;  2CA5 A;  2RA1 A;  3QUJ A;  2DCF A;  1D0Z A;  4DV0 T;  3UTK A;  2CHO A;  4JEH B;  4ZS3 A;  2UU9 T;  3FXE B;  2V7M A;  4PNI A;  1KK7 A;  4IE4 A;  5AQV B;  2WWU A;  4JI5 T;  4U7Y A;  4LMK A;  3P4Q A;  4QHO A;  3PU8 A;  2QA7 A;  4OYJ A;  2WBL A;  4OX9 T;  4HKA A;  3J7Y q;  3Q2M A;  4TV9 E;  4HWF A;  3ZKR A;  4EZ4 A;  4HFC A;  3RIA A;  3WAJ A;  4YTN A;  3I0O A;  4UEL A;  1KNZ A;  3AE3 A;  4QX7 B;  1I6Z A;  4QWN B;  1W9R A;  3NKZ A;  5LJM A;  2JMH A;  3CQX C;  3LK4 2;  3QK6 A;  4AKH A;  2VUR A;  4ASK A;  3UUM A;  4LF4 T;  1MMN A;  4ZZC A;  2WB5 A;  4TWH A;  3CX8 B;  5HYA A;  2YN6 A;  3RC8 A;  4C90 A;  3N9M A;  1L0V A;  3H3A A;  4GK0 E;  4V1A v;  4ZEY A;  5AQF B;  4YJ3 E;  3CVR A;  5DQW A;  3CX6 B;  4HTE A;  3AED A;  2PTF A;  3ANW B;  4YSX A;  3UFE A;  4H9N C;  1HFA A;  4JLE A;  2WWV A;  2B1E A;  3KVB A;  4KP3 C;  3JAF A;  2CCQ A;  1E7P A;  3C4W A;  3GN5 B;  1OED B;  2DI4 A;  3R6N A;  4ILA A;  4KUM B;  4O2B E;  1U5P A;  1ZEE A;  3KIN B;  3ZJ2 A;  1Z0P A;  3WI3 A;  4HFV A;  4PFP A;  4ZI2 C;  4A97 A;  2LSJ A;  4G63 A;  3RLF F;  1MMD A;  2HHH T;  3OBV E;  4EAH A;  5LP6 E;  5AQI B;  4MBQ A;  1UX4 A;  4X62 T;  2WMN A;  1BR0 A;  2QRX A;  3RRC A;  2VAS A;  2BKO A;  4DV2 T;  2X68 A;  3Q5E A;  4QH5 A;  3IBP A;  4MAL A;  5ABF B;  4DR3 T;  3ESL A;  2A2F X;  4IDN A;  2IIU A;  4JI3 T;  2OV9 A;  5AQQ B;  5E0O A;  5AQP B;  1HCI A;  3N9L A;  2I6H A;  5HCM A;  2E9X B;  5JH7 E; 
#chains in the Genus database with same CATH homology
 1HNZ T;  4JI2 T;  2ZM6 T;  2UUA T;  5LMU T;  4NXN T;  4DUY T;  4DUZ T;  4AQY T;  4LF7 T;  4DV7 T;  3OTO T;  4X64 T;  2F4V T;  4DR4 T;  1N32 T;  1I94 T;  2UXD T;  1HNW T;  4B3T T;  5IWA T;  2VQE T;  2UXB T;  4DR5 T;  1XNR T;  4DV0 T;  4DV4 T;  4JI7 T;  4LF9 T;  2UU9 T;  4DR1 T;  4DV5 T;  4DV1 T;  4K0K T;  4NXM T;  2UUB T;  4JI5 T;  1IBL T;  2HHH T;  5LMN T;  2UUC T;  4LF6 T;  1XNQ T;  2VQF T;  4JI1 T;  4YHH T;  1FJG T;  1N33 T;  3T1Y T;  4JYA T;  4OX9 T;  1HNX T;  4JI4 T;  4DR7 T;  4LFB T;  4X62 T;  4JI0 T;  1XMO T;  4LFA T;  4GKJ T;  4DV2 T;  1XMQ T;  4JI6 T;  4YY3 T;  1IBM T;  4JV5 T;  4B3M T;  4DR6 T;  4JI8 T;  1N34 T;  1N36 T;  4B3R T;  5BR8 T;  4LF4 T;  3T1H T;  1IBK T;  4DR2 T;  4LFC T;  2UXC T;  4DR3 T;  1HR0 T;  4X65 T;  4JI3 T;  2E5L T;  4KHP T;  4DV3 T;  4B3S T;  4LF8 T;  4DV6 T;  4LF5 T;  4GKK T;  4X66 T;  1J5E T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...