4X62T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x62T00
4DV2T 4X65T 1FJGT 2UXCT 4DV3T 4DR5T 1IBMT 1XNQT 4DR4T 2F4VT 1IBLT 4LF6T 5LMNT 4DV6T 2UUBT 4KHPT 3T1YT 1XMQT 4X62T 1XNRT 4DV5T 4YHHT 1N34T 4LF9T 4DV1T 1XMOT 4JI6T 1HNWT 1HR0T 4JI2T 4LF8T 4DR3T 2E5LT 2VQFT 4LF4T 4LFCT 4GKJT 1I94T 4JI0T 2UUAT 4X64T 4DV7T 4JI1T 4DV0T 4NXMT 2UXDT 4LFAT 1J5ET 4B3MT 4LFBT 4B3ST 5LMUT 1IBKT 4JI7T 4AQYT 1N32T 4X66T 5IWAT 4JYAT 3OTOT 4DUYT 1HNXT 4JI3T 4JV5T 1N36T 4LF5T 2UXBT 4DUZT 4DR2T 2VQET 4JI5T 4DR1T 1HNZT 4LF7T 4DR7T 2UU9T 4OX9T 4GKKT 4B3TT 2ZM6T 4DV4T 1N33T 3T1HT 4YY3T 5BR8T 4JI8T 2HHHT 4JI4T 4NXNT 4B3RT 4K0KT 2UUCT 4DR6T
chains in the Genus database with same CATH superfamily
2K9AA 4AKGA 1OEDC 4UF0A 4ZI2D 3CX8B 3AA6B 2ACZA 2DLRA 4UEMA 2CBIA 4EGWA 4XZCA 2VURA 4JEHB 2JQQA 4H9NC 4CI3B 2BG9B 2CMRA 4YSYA 4DV1T 2N9DA 2WDVA 2SPCA 3LK3B 4LMLA 5CB4E 2LRKA 4ZI3D 3L09A 4IDQA 1ZEEA 2YU1A 2VB6A 2YN6A 3AVSA 2CHNA 1W09A 1D1CA 2E8IA 2XQ8A 3RIAA 3UTKA 4C90A 1D1AA 4LMKA 4A56A 2C5IT 2VVNA 5JDFA 5JTGA 3RYFE 3LDQB 5L3BB 5JQGE 3R6NA 5L3GB 2BG9C 2PTFA 5KDMC 2C0SA 4JI5T 5CA0E 3TLUA 2ACXA 4Q25A 1OEDE 3NVOA 4U2YA 5BR8T 1OEDA 3Q2MA 2YOEA 3AEBA 2VASA 2YEVC 4K0KT 3UU8A 3O4XE 1YQ3A 2FJDA 1XWMA 4DV2T 5HXEA 3OKQA 3Q5DA 3ZMSB 3UU6A 3UUMA 3JADA 1SE7A 3NKZA 3WAKA 3T8OA 1W0AA 4O4HE 5ABFB 4O2AE 3MKDA 3GN5B 2LEHA 3QNUA 2H7VC 3N2KE 2DHRA 2LHRA 2H3RA 2LOPA 4BAYB 4ZXLA 4HFIA 5FP3A 3HR0A 4JBWF 3AE8A 2G0UA 5AQLB 4QH4A 5HXSA 1BR4A 1YXRA 1UX5A 4ISTA 5JVDE 5JR9B 2BG9A 4CXWA 4CI1B 4JYAT 3AAIA 3EAMA 4ZI3C 3KVBA 1VCTA 3L8RA 2JRKA 2UXBT 4HWIB 3KBTA 3L3PA 3HL6A 3VU7H 4UVCB 4X20E 4DV4T 3VR8A 3UUXB 2WMOA 1NEKA 4U72A 3MJXA 3AEDA 2V6YB 2XY8B 3DP7A 4IT4A 2WZIA 3PJAJ 4UV8B 4DNDA 3CX7B 5JR9C 2B76A 2H7OA 3QK6A 4DBQA 3FBLA 5FXXA 4F6RC 3LFMA 4IDOA 4NPPA 5JDNA 2XUEA 4QX7B 5AQUB 5LBMA 1IJ6A 5L4HA 3N9QA 3ZJ2A 5AQMB 3OYXA 2DWGA 3UT5E 4CZZB 3LJCA 5FYMA 4HN9A 2ES0A 3B13A 2DWKA 3C51A 5KXJA 5AQOB 3ZYMA 5HCJA 2LHNA 5LHIB 3P4SA 2W0GA 5L3DB 2LOSA 1UUSA 4WBNE 2CWOA 2K3WA 3NWIA 2BS4A 3RC3A 4HGAA 5BMVE 2KINB 4FJOA 1MMGA 5ABFA 2E2AA 2WSSV 5AQIB 2LE8A 3VRAA 4DBRA 2XQYA 3J7Yq 3PUVF 3RKOA 4DR2T 3MXZA 4ZEYA 1MMDA 4H9RC 5AQPB 1N33T 2IC9A 2WM9A 2WBLA 3ZMTB 5HEJA 3FB2A 4TWDA 2PFVA 4ADZA 4YXDA 5JR9A 5AQTB 3JC6D 3QB5A 2CWYA 4I50E 4PAGA 2E9XD 4IREA 1L0VA 3PDYA 4G63A 2XHEB 3AA1B 3A5XA 2WMNA 4U7IA 3R84B 5HXCA 5HAXA 4I55E 5F3JA 4H9PC 2D9DA 2X0HA 2NP9A 5IYZE 4AKHA 4QH5A 2X66A 4JI6T 2V6YA 2ZM8A 5LHGB 4UR9A 3ZMZB 4DR3T 4ZZCA 5AQRB 2OLTA 3SWHA 3N2GE 2XSBA 5ADXL 4DVDA 2KNDA 1Z8UA 3X1DA 3EI0A 3ZMUB 4NUUA 2KXPB 4P0AA 1Y64B 3P4RA 2V7IA 2XAQB 3ZYLA 2X68A 2KWHA 3AEGA 5GONE 3C50A 1WR0A 3AECA 3IF8B 1W0BA 2N2NA 1WLXA 5EK2A 1ZKEA 2XAJB 3KV5A 4V1Av 2EHOC 5H6RB 4ZHQE 1HFAA 2ZM2A 3UU4A 3O1IA 2E9XB 3L39A 2WU2A 2I0MA 2XJ7A 4EYUA 5EK4A 2JJ9A 3O1JA 3M65A 4H9SE 2WAUA 2XAHB 2NWBA 2VL0A 3AEEA 3AE3A 4WNKA 2XASB 4O8SA 4ZI7E 3TLVA 3UUBA 2Z6EA 3ANWB 1M7KA 3LSVA 4UVAB 3FZHB 2MBGA 4G2AA 4PK4A 1HR0T 2WU5A 5LJMA 4KHZF 4IGUA 1HS7A 2KT9A 4YTPA 4ANJA 4DV7T 4NUVA 3EHZA 2UXDT 1NENA 1J5ET 3D0TA 2WQYA 1D1BA 4IE0A 3CVRA 2MPKA 3FZMB 3PUAA 1Z0PA 3C4WA 3EVYA 5F8PA 3F31A 2CCQA 3TLTA 1LVKA 1HX1B 3ZT6A 5L3FB 2X0YA 2V7LA 2VKJA 1MNEA 4DO0A 2BS3A 3ZLIA 4HWDA 4B3RT 3EDUA 3K3NA 4PFPA 5HCMA 4TZ4C 3PURA 1QSDA 4M1PA 3HKDE 3EABA 3KDSE 2KLQA 2NW9A 4ZS2A 4DR5T 2W00A 2W61A 3QOFA 4DV6T 4KBMB 4OYJA 4O4JE 2VWAA 2CRBA 2PBIA 3OVUA 2ZMAA 4EOZB 3NRXA 2E9XA 3CKDA 1BR1A 1D0XA 2JQ9A 4WBOA 1HNWT 2Q9QB 4YLHA 2WWVA 3S4UA 3WAJA 3HI2A 5FKYA 4JI1T 2M6BA 5CFBA 3SOLA 4WW0A 2L8KA 5CJ5A 4U31A 2IUBA 4TV8E 2X9YA 4XAXB 3ANWA 1WRDA 3RF1A 3GWHA 2CE7A 2L9QA 2UXNB 4EV6A 4DR1T 4YJ3E 4I43B 3IHRA 2UU9T 4GYRA 1WYBA 3QUJA 5LGTB 2ZM6T 2BKPA 2Q9QC 1YD8G 2OA5A 3RIFA 2BKOA 1FEWA 3ONXA 2IW5B 4JI8T 3KV6A 4EYYR 5A1LA 5AQVB 1XNQT 4DMVA 3FHNA 4ZOLE 5HEOA 4ERRA 1XNRT 2LLYA 4X5TA 3I1AA 4DV5T 2CM0A 4H9QC 1HG2A 4KP3C 4AKRB 3AB3B 2VVSA 1I94T 4C91A 2QRXA 4X1KE 5F5WA 4IE4A 3V5SA 3NBXX 1E7PA 3RRCA 4I4TE 4LFBT 3CX6B 5LMUT 2CHOA 2DL1A 2A2FX 5L3CB 2BZBA 3ABVA 4DUYT 1HNXT 2BVMA 4HFDA 3ZN0B 4KMCA 3JCFA 2V8SV 4P09A 3ZSSA 2NTXA 2QGSA 4EB6E 4O2BE 4YFSA 5HEUA 3ZN1B 5AQFB 3P4WA 3J9X1 3N9PA 4MLKA 3P7IA 2WZHA 5JRCB 2YINA 2C5JA 3LG7A 2JQHA 4CQIA 2ODVA 5H6QB 1UX4A 2IC6A 4TWHA 3ZC0A 4LF6T 3ZMVB 4X1YE 3PJAA 5DJQC 1XMQT 4X62T 3ONJA 3ZPOA 4A97A 1UK5A 3ZKRA 3AEAA 2N1GA 3ZCIA 2KMFA 1EZ3A 3CK6A 3C98B 4PJLA 4LF4T 2K24A 2BKNA 3EUHA 2CEAA 2RA1A 2XSAA 4EAHA 4A98A 5FY0A 3CWZB 1ZHCA 3M3ZB 3TKLB 2ZM0A 4AKLA 5LJNA 3ETUA 4YTNA 3E22E 2FBWA 4AXPA 3AE5A 4JEUB 4AQYT 4U7YA 2NTYA 2LSYA 4X66T 4HE8A 1G8XA 5LHHB 3KBUA 5IWAT 2CPTA 4P0BA 2WS3A 4E7SA 2W4XA 5FL0A 1O3XA 4JV5T 1NWMX 1BR2A 5AQSB 2EHOD 1KNPA 4OX9T 5J0ZA 2IDOB 2JIWA 4PK6A 2PJQA 2XZEA 4HFVA 3AE6A 2VL8A 1ZOYA 3AA0B 3GN5A 5LA6E 2AE9A 2FJEA 3JAEA 2YU2A 4GIWA 1VOMA 2W62A 2LSIA 4HFBA 2QA7A 2X51A 2ODUA 5LMNT 2LM2A 3A7MA 2XQ6A 3IEEA 4PK5A 4PJMA 4H63H 1D0ZA 4HFHA 4HKAA 2X67A 1US7B 1KK7A 4PNIA 2NOXA 5FNVE 2C5KT 4OFZA 2HPJA 2KWIB 3OPCA 2WDQA 3N9MA 3KINB 1HX8A 3VHLA 2HPLA 4P1NA 4U3CA 1G73A 4BA9A 4YT0A 1MIYA 2CXLA 4U74A 3RQWA 4ILBA 3SS1A 2A9UA 4IE7A 3DJBA 3DTOA 4TWFA 3SFEA 2EHOB 3F57A 4PW8A 5LOVE 2YDSA 1AJ3A 2I59A 1N36T 3U78A 3ETVA 4X1IE 2VQET 3RH3A 3CQCB 4TNVA 4LF7T 5ABEA 2DCFA 3F2EA 3CQXC 2NR4A 3GA8A 3T1HT 3RHWA 2HHHT 2XQ9A 3H3AA 5ABGA 4OYKA 4IL9A 4QH1A 5FY7A 2XM2A 3VR9A 3FZLB 2LRLA 1HCIA 3RRWA 1YKHB 4CN4A 1OWAA 3TLWA 4MBQA 1FIOA 1N34T 5LB7B 4LF9T 4EZ4A 1S94A 4H9OC 1U5PA 1UURA 2V6XA 3FZFB 3AE1A 3KV9A 5C2TA 2MTQA 2DI4A 3AAAB 4DV0T 2W63A 1MMNA 3FZKB 3VKGA 1FMVA 4HWFA 2CLYB 3QC9A 4GYSA 5C3JA 1KNZA 1IBKT 3RLFF 1R8IA 1IAPA 1KNRA 1OXZA 1LRZA 4WYVA 3ZEFB 5KX5E 3VKHA 2FJBA 3ZJ1A 3PUSA 4YJ2E 3Q5WA 3HKEE 5HXRA 4DR7T 3AE4A 3P8CD 2Q9QD 3PUXF 1M62A 3N9OA 1WFDA 3C4XA 4YY3T 4JI4T 2V7MA 1WYCA 1MMAA 4IDNA 1T7SA 4UELA 3B57A 3OBVE 2EHOA 2YDRA 2VKDA 2CLYC 3AA7B 4X65T 1FJGT 1T72A 1KF6A 5HEGA 2JMKA 2VKOA 4WZXA 2KSRA 2X0LB 4IIJE 2RP4A 3SRZA 4AI6A 3VRBA 5FL1A 3RYCE 4L9IA 2W2UA 4COFA 3MACA 3GMIA 4JI2T 4CXYA 4CXXA 3TLSA 5AQKB 4GOUA 4HEAA 3G06A 2MAWA 3ZSTA 5J2UE 5LG4A 4CI2B 4IHJE 3K8PC 5LXTE 4OK0A 4K0UA 2XQ7A 2PG8A 1CUNA 2XQ4A 4AIUA 1MIVA 3ZT5A 2GK9A 4PJNA 3OJAA 2OV9A 4MFRA 5FY1A 3BQIA 3BQLA 1X9BA 1ZV4X 5AQQB 5L3EB 2V26A 5JREA 2CXDA 3UULA 4NXNT 4A5XA 2CXFA 4L0RA 2D0UA 3V5UA 4DR6T 4IE6A 4ASKA 5LP6E 4DIDB 5JDQA 4KHPT 3T1YT 3I0OA 3RI5A 3OYZA 5LGNB 3IA3A 4TNWA 5E0OA 5JDLA 1VRBA 4J2CA 1CHUA 5DABA 5M4YA 5IUXA 5JH7E 5HYAA 2J4GA 4TUYE 1YW0A 4GKJT 4JI0T 2UUAT 2Y48B 4MALA 3LBXB 1LVFA 1GQEA 4Z8XA 2K5BB 3JAFA 5LGUB 4B3ST 3PUGA 2IHR1 5TAOA 3AAEB 1WR6A 5KMGP 2H89A 2YK0A 3ZC1A 1T8BA 5FXZA 4JI3T 2WCAA 3FBZA 3RC8A 5L4EA 4DUZT 1B7TA 3PUWF 3KFWX 3QB5K 2LKGA 3U3IA 2X9XA 3RQUA 4HTEA 4EEBA 1D0YA 1YQ4A 1J1JA 4HWCA 3Q5XA 2WB5A 2M6IA 1SUMB 2DNXA 3RYIE 5HWXA 2V7KA 2CBJA 2RPAA 2Q9QA 4OHFA 1NAFA 3K1SA 1IBMT 4ZI2C 5EK3A 1IBLT 2LSKA 2KZ7B 3PUYF 3UUNA 4IDPA 5JDGA 3UU5A 1FMWA 2NW8A 4HWHA 2LKHA 2XM1A 3N9NA 2VKHA 5EZYE 2BG9E 4CN1A 2XQAA 1J5WA 2BS2A 4DMWA 2LSGA 3KVAA 3FXEB 1BR0A 2ZLYA 1HTJF 2VQFT 4TV9E 5HXHA 3BK9A 3ZYKA 3KV4A 2X9WA 1DU2A 2XPKA 3ESLA 2XAGB 2HN1A 2XQ3A 4EEDA 4QX8B 5FXVA 3PV0F 3UFEA 2BBHA 4O4IE 2D5UA 1T98A 2XQ5A 2LM9A 3P4QA 3N2OA 5JDHA 1XZYA 2IMLA 3C64A 3CIRA 3PUZF 3AE2A 4H63V 3EDVA 4LF5T 5FVKA 4QXCB 3LK42 2BDEA 3RIUC 4AKIA 4GKKT 2BVLA 4AQFC 4EIWA 3LBXA 2D0TA 3E08A 1U4QA 3NRYA 2MOZA 3Q5EA 2IAKA 2MYSA 3HKBE 2FUPA 4IE5A 4UIGA 4YTMA 2UXCT 4KUMB 1IJ5A 4U33A 1ZP0A 2V5CA 3I9WA 5HWYA 2UUBT 5FMNA 3N9LA 3Q9DA 5FXWA 5C8YE 3UQ7A 4QKNA 3RGLA 3PU8A 4YHHT 5ABHA 4ZZBA 1XMOT 2K48A 3CMLA 4JLEA 4LF8T 5J2TE 2E5LT 3N5LA 4LFCT 4O4LE 2QVAA 3ZCJA 2CA5A 2I6HA 4NXMT 3AVRA 3UFGA 4B3MT 1SHZC 5J1GA 2JMHA 2D2SA 5JDMA 4JI7T 1SA0E 5AQNB 2P9BA 3PUQA 1WCRA 1QLBA 5JRCA 3K3QC 3ONLC 4I0UA 1UGOA 3RIUA 3P50A 3C4ZA 3PU3A 4AQFA 1HNZT 1MNDA 5AQJB 5CA1E 2LJLA 4XBFB 4LMJA 5LCYA 4PJJA 4JUYA 4QHOA 4EZHA 2Y8DA 3FXDB 2H88A 2HH7A 5FVLA 4U2ZA 2UUCT 2LT3A 3PTRB 4Z91A 3H3MA 1HF8A 3O1HA 5ETWA 2J47A 2A3DA 4ILAA 2QYWA 4ILUA 2V1DB 2WWUA 5LBQB 2HN2A 3AEFA 2BBJA 3UU3A 3RPUA 4MHCA 4GK5E 3HA4A 4AQGA 2V5DA 4UV9B 2UXXB 2A72A 1H7CA 4B6XA 3SFDA 1MIWA 4QXBB 3AE7A 3E0ZA 4TN7B 1E2AA 1QUUA 5CGMA 4NIQA 3PE0A 4QXHB 4IL4A 1IZNB 1JNRA 5AFUL 4N78D 1W9RA 3BQKA 3AXJB 1Y01A 3WI3A 1N32T 1X79A 3RX6A 4UF0B 1LKXA 3OTOT 5DQVA 2J1DG 1JNZA 3O9XA 4ISSA 1XDOA 3HKCE 4FI5A 2IIUA 4L5GA 3NZQA 2R6GF 4YSXA 3ZT7A 1E1HB 2WDRA 4BJNA 4IDZA 4HFCA 3B5MA 2B1EA 4GK0E 4HFEA 2X9HA 5HEHA 1I6ZA 3RYHE 4KX6A 3UQ4A 3A8YC 2E5VA 3H37A 2XAFB 5IHYA 4PFOA 3LK2B 4DV3T 3JC6C 4TX5A 4DR4T 2E9XC 2F4VT 4EXTA 5DQWA 2M67A 3I9YA 4Z90A 2LSJA 2YDQA 5LG3A 2WY2A 4YHJA 2JPFA 3W15B 4ILCA 1UCUA 2FJAA 1KFYA 3CQGB 4CN6A 5L47A 2XTLA 2YKSA 1HG5A 5LNKA 2JQKA 3AE9A 3IBPA 1S35A 2L3LA 1KEYA 2WP9A 4X64T 4UVBB 1XDPA 4LFAT 1OEDB 3RKGA 5L2LA 4ZS3A 2NW7A 2V7JA 2W67A 4KI0F 3P4PA 2J62A 3MZKB 2Y6XA 4YSZA 1VCSA 2W66A 3CPZA 1YKEB 3MK7C 5AQHB 4AISA 4F8HA 4B3TT 3K3OA 4E7ZA 3NZPA 4QWNB 5AQGB 2AXDS 4BJMA 3MA9A 5LYJE 4UXNB 1V9DA 2VK9A 3AXJA 3I0QA
chains in the Genus database with same CATH topology
4DV2T 4X65T 1FJGT 2UXCT 4DV3T 4DR5T 1IBMT 1XNQT 4DR4T 2F4VT 1IBLT 4LF6T 5LMNT 4DV6T 2UUBT 4KHPT 3T1YT 1XMQT 4X62T 1XNRT 4DV5T 4YHHT 1N34T 4LF9T 4DV1T 1XMOT 4JI6T 1HNWT 1HR0T 4JI2T 4LF8T 4DR3T 2E5LT 2VQFT 4LF4T 4LFCT 4GKJT 1I94T 4JI0T 2UUAT 4X64T 4DV7T 4JI1T 4DV0T 4NXMT 2UXDT 4LFAT 1J5ET 4B3MT 4LFBT 4B3ST 5LMUT 1IBKT 4JI7T 4AQYT 1N32T 4X66T 5IWAT 4JYAT 3OTOT 4DUYT 1HNXT 4JI3T 4JV5T 1N36T 4LF5T 2UXBT 4DUZT 4DR2T 2VQET 4JI5T 4DR1T 1HNZT 4LF7T 4DR7T 2UU9T 4OX9T 4GKKT 4B3TT 2ZM6T 4DV4T 1N33T 3T1HT 4YY3T 5BR8T 4JI8T 2HHHT 4JI4T 4NXNT 4B3RT 4K0KT 2UUCT 4DR6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV2 T;  4X65 T;  1FJG T;  2UXC T;  4DV3 T;  4DR5 T;  1IBM T;  1XNQ T;  4DR4 T;  2F4V T;  1IBL T;  4LF6 T;  5LMN T;  4DV6 T;  2UUB T;  4KHP T;  3T1Y T;  1XMQ T;  4X62 T;  1XNR T;  4DV5 T;  4YHH T;  1N34 T;  4LF9 T;  4DV1 T;  1XMO T;  4JI6 T;  1HNW T;  1HR0 T;  4JI2 T;  4LF8 T;  4DR3 T;  2E5L T;  2VQF T;  4LF4 T;  4LFC T;  4GKJ T;  1I94 T;  4JI0 T;  2UUA T;  4X64 T;  4DV7 T;  4JI1 T;  4DV0 T;  4NXM T;  2UXD T;  4LFA T;  1J5E T;  4B3M T;  4LFB T;  4B3S T;  5LMU T;  1IBK T;  4JI7 T;  4AQY T;  1N32 T;  4X66 T;  5IWA T;  4JYA T;  3OTO T;  4DUY T;  1HNX T;  4JI3 T;  4JV5 T;  1N36 T;  4LF5 T;  2UXB T;  4DUZ T;  4DR2 T;  2VQE T;  4JI5 T;  4DR1 T;  1HNZ T;  4LF7 T;  4DR7 T;  2UU9 T;  4OX9 T;  4GKK T;  4B3T T;  2ZM6 T;  4DV4 T;  1N33 T;  3T1H T;  4YY3 T;  5BR8 T;  4JI8 T;  2HHH T;  4JI4 T;  4NXN T;  4B3R T;  4K0K T;  2UUC T;  4DR6 T; 
#chains in the Genus database with same CATH topology
 2K9A A;  4AKG A;  1OED C;  4UF0 A;  4ZI2 D;  3CX8 B;  3AA6 B;  2ACZ A;  2DLR A;  4UEM A;  2CBI A;  4EGW A;  4XZC A;  2VUR A;  4JEH B;  2JQQ A;  4H9N C;  4CI3 B;  2BG9 B;  2CMR A;  4YSY A;  4DV1 T;  2N9D A;  2WDV A;  2SPC A;  3LK3 B;  4LML A;  5CB4 E;  2LRK A;  4ZI3 D;  3L09 A;  4IDQ A;  1ZEE A;  2YU1 A;  2VB6 A;  2YN6 A;  3AVS A;  2CHN A;  1W09 A;  1D1C A;  2E8I A;  2XQ8 A;  3RIA A;  3UTK A;  4C90 A;  1D1A A;  4LMK A;  4A56 A;  2C5I T;  2VVN A;  5JDF A;  5JTG A;  3RYF E;  3LDQ B;  5L3B B;  5JQG E;  3R6N A;  5L3G B;  2BG9 C;  2PTF A;  5KDM C;  2C0S A;  4JI5 T;  5CA0 E;  3TLU A;  2ACX A;  4Q25 A;  1OED E;  3NVO A;  4U2Y A;  5BR8 T;  1OED A;  3Q2M A;  2YOE A;  3AEB A;  2VAS A;  2YEV C;  4K0K T;  3UU8 A;  3O4X E;  1YQ3 A;  2FJD A;  1XWM A;  4DV2 T;  5HXE A;  3OKQ A;  3Q5D A;  3ZMS B;  3UU6 A;  3UUM A;  3JAD A;  1SE7 A;  3NKZ A;  3WAK A;  3T8O A;  1W0A A;  4O4H E;  5ABF B;  4O2A E;  3MKD A;  3GN5 B;  2LEH A;  3QNU A;  2H7V C;  3N2K E;  2DHR A;  2LHR A;  2H3R A;  2LOP A;  4BAY B;  4ZXL A;  4HFI A;  5FP3 A;  3HR0 A;  4JBW F;  3AE8 A;  2G0U A;  5AQL B;  4QH4 A;  5HXS A;  1BR4 A;  1YXR A;  1UX5 A;  4IST A;  5JVD E;  5JR9 B;  2BG9 A;  4CXW A;  4CI1 B;  4JYA T;  3AAI A;  3EAM A;  4ZI3 C;  3KVB A;  1VCT A;  3L8R A;  2JRK A;  2UXB T;  4HWI B;  3KBT A;  3L3P A;  3HL6 A;  3VU7 H;  4UVC B;  4X20 E;  4DV4 T;  3VR8 A;  3UUX B;  2WMO A;  1NEK A;  4U72 A;  3MJX A;  3AED A;  2V6Y B;  2XY8 B;  3DP7 A;  4IT4 A;  2WZI A;  3PJA J;  4UV8 B;  4DND A;  3CX7 B;  5JR9 C;  2B76 A;  2H7O A;  3QK6 A;  4DBQ A;  3FBL A;  5FXX A;  4F6R C;  3LFM A;  4IDO A;  4NPP A;  5JDN A;  2XUE A;  4QX7 B;  5AQU B;  5LBM A;  1IJ6 A;  5L4H A;  3N9Q A;  3ZJ2 A;  5AQM B;  3OYX A;  2DWG A;  3UT5 E;  4CZZ B;  3LJC A;  5FYM A;  4HN9 A;  2ES0 A;  3B13 A;  2DWK A;  3C51 A;  5KXJ A;  5AQO B;  3ZYM A;  5HCJ A;  2LHN A;  5LHI B;  3P4S A;  2W0G A;  5L3D B;  2LOS A;  1UUS A;  4WBN E;  2CWO A;  2K3W A;  3NWI A;  2BS4 A;  3RC3 A;  4HGA A;  5BMV E;  2KIN B;  4FJO A;  1MMG A;  5ABF A;  2E2A A;  2WSS V;  5AQI B;  2LE8 A;  3VRA A;  4DBR A;  2XQY A;  3J7Y q;  3PUV F;  3RKO A;  4DR2 T;  3MXZ A;  4ZEY A;  1MMD A;  4H9R C;  5AQP B;  1N33 T;  2IC9 A;  2WM9 A;  2WBL A;  3ZMT B;  5HEJ A;  3FB2 A;  4TWD A;  2PFV A;  4ADZ A;  4YXD A;  5JR9 A;  5AQT B;  3JC6 D;  3QB5 A;  2CWY A;  4I50 E;  4PAG A;  2E9X D;  4IRE A;  1L0V A;  3PDY A;  4G63 A;  2XHE B;  3AA1 B;  3A5X A;  2WMN A;  4U7I A;  3R84 B;  5HXC A;  5HAX A;  4I55 E;  5F3J A;  4H9P C;  2D9D A;  2X0H A;  2NP9 A;  5IYZ E;  4AKH A;  4QH5 A;  2X66 A;  4JI6 T;  2V6Y A;  2ZM8 A;  5LHG B;  4UR9 A;  3ZMZ B;  4DR3 T;  4ZZC A;  5AQR B;  2OLT A;  3SWH A;  3N2G E;  2XSB A;  5ADX L;  4DVD A;  2KND A;  1Z8U A;  3X1D A;  3EI0 A;  3ZMU B;  4NUU A;  2KXP B;  4P0A A;  1Y64 B;  3P4R A;  2V7I A;  2XAQ B;  3ZYL A;  2X68 A;  2KWH A;  3AEG A;  5GON E;  3C50 A;  1WR0 A;  3AEC A;  3IF8 B;  1W0B A;  2N2N A;  1WLX A;  5EK2 A;  1ZKE A;  2XAJ B;  3KV5 A;  4V1A v;  2EHO C;  5H6R B;  4ZHQ E;  1HFA A;  2ZM2 A;  3UU4 A;  3O1I A;  2E9X B;  3L39 A;  2WU2 A;  2I0M A;  2XJ7 A;  4EYU A;  5EK4 A;  2JJ9 A;  3O1J A;  3M65 A;  4H9S E;  2WAU A;  2XAH B;  2NWB A;  2VL0 A;  3AEE A;  3AE3 A;  4WNK A;  2XAS B;  4O8S A;  4ZI7 E;  3TLV A;  3UUB A;  2Z6E A;  3ANW B;  1M7K A;  3LSV A;  4UVA B;  3FZH B;  2MBG A;  4G2A A;  4PK4 A;  1HR0 T;  2WU5 A;  5LJM A;  4KHZ F;  4IGU A;  1HS7 A;  2KT9 A;  4YTP A;  4ANJ A;  4DV7 T;  4NUV A;  3EHZ A;  2UXD T;  1NEN A;  1J5E T;  3D0T A;  2WQY A;  1D1B A;  4IE0 A;  3CVR A;  2MPK A;  3FZM B;  3PUA A;  1Z0P A;  3C4W A;  3EVY A;  5F8P A;  3F31 A;  2CCQ A;  3TLT A;  1LVK A;  1HX1 B;  3ZT6 A;  5L3F B;  2X0Y A;  2V7L A;  2VKJ A;  1MNE A;  4DO0 A;  2BS3 A;  3ZLI A;  4HWD A;  4B3R T;  3EDU A;  3K3N A;  4PFP A;  5HCM A;  4TZ4 C;  3PUR A;  1QSD A;  4M1P A;  3HKD E;  3EAB A;  3KDS E;  2KLQ A;  2NW9 A;  4ZS2 A;  4DR5 T;  2W00 A;  2W61 A;  3QOF A;  4DV6 T;  4KBM B;  4OYJ A;  4O4J E;  2VWA A;  2CRB A;  2PBI A;  3OVU A;  2ZMA A;  4EOZ B;  3NRX A;  2E9X A;  3CKD A;  1BR1 A;  1D0X A;  2JQ9 A;  4WBO A;  1HNW T;  2Q9Q B;  4YLH A;  2WWV A;  3S4U A;  3WAJ A;  3HI2 A;  5FKY A;  4JI1 T;  2M6B A;  5CFB A;  3SOL A;  4WW0 A;  2L8K A;  5CJ5 A;  4U31 A;  2IUB A;  4TV8 E;  2X9Y A;  4XAX B;  3ANW A;  1WRD A;  3RF1 A;  3GWH A;  2CE7 A;  2L9Q A;  2UXN B;  4EV6 A;  4DR1 T;  4YJ3 E;  4I43 B;  3IHR A;  2UU9 T;  4GYR A;  1WYB A;  3QUJ A;  5LGT B;  2ZM6 T;  2BKP A;  2Q9Q C;  1YD8 G;  2OA5 A;  3RIF A;  2BKO A;  1FEW A;  3ONX A;  2IW5 B;  4JI8 T;  3KV6 A;  4EYY R;  5A1L A;  5AQV B;  1XNQ T;  4DMV A;  3FHN A;  4ZOL E;  5HEO A;  4ERR A;  1XNR T;  2LLY A;  4X5T A;  3I1A A;  4DV5 T;  2CM0 A;  4H9Q C;  1HG2 A;  4KP3 C;  4AKR B;  3AB3 B;  2VVS A;  1I94 T;  4C91 A;  2QRX A;  4X1K E;  5F5W A;  4IE4 A;  3V5S A;  3NBX X;  1E7P A;  3RRC A;  4I4T E;  4LFB T;  3CX6 B;  5LMU T;  2CHO A;  2DL1 A;  2A2F X;  5L3C B;  2BZB A;  3ABV A;  4DUY T;  1HNX T;  2BVM A;  4HFD A;  3ZN0 B;  4KMC A;  3JCF A;  2V8S V;  4P09 A;  3ZSS A;  2NTX A;  2QGS A;  4EB6 E;  4O2B E;  4YFS A;  5HEU A;  3ZN1 B;  5AQF B;  3P4W A;  3J9X 1;  3N9P A;  4MLK A;  3P7I A;  2WZH A;  5JRC B;  2YIN A;  2C5J A;  3LG7 A;  2JQH A;  4CQI A;  2ODV A;  5H6Q B;  1UX4 A;  2IC6 A;  4TWH A;  3ZC0 A;  4LF6 T;  3ZMV B;  4X1Y E;  3PJA A;  5DJQ C;  1XMQ T;  4X62 T;  3ONJ A;  3ZPO A;  4A97 A;  1UK5 A;  3ZKR A;  3AEA A;  2N1G A;  3ZCI A;  2KMF A;  1EZ3 A;  3CK6 A;  3C98 B;  4PJL A;  4LF4 T;  2K24 A;  2BKN A;  3EUH A;  2CEA A;  2RA1 A;  2XSA A;  4EAH A;  4A98 A;  5FY0 A;  3CWZ B;  1ZHC A;  3M3Z B;  3TKL B;  2ZM0 A;  4AKL A;  5LJN A;  3ETU A;  4YTN A;  3E22 E;  2FBW A;  4AXP A;  3AE5 A;  4JEU B;  4AQY T;  4U7Y A;  2NTY A;  2LSY A;  4X66 T;  4HE8 A;  1G8X A;  5LHH B;  3KBU A;  5IWA T;  2CPT A;  4P0B A;  2WS3 A;  4E7S A;  2W4X A;  5FL0 A;  1O3X A;  4JV5 T;  1NWM X;  1BR2 A;  5AQS B;  2EHO D;  1KNP A;  4OX9 T;  5J0Z A;  2IDO B;  2JIW A;  4PK6 A;  2PJQ A;  2XZE A;  4HFV A;  3AE6 A;  2VL8 A;  1ZOY A;  3AA0 B;  3GN5 A;  5LA6 E;  2AE9 A;  2FJE A;  3JAE A;  2YU2 A;  4GIW A;  1VOM A;  2W62 A;  2LSI A;  4HFB A;  2QA7 A;  2X51 A;  2ODU A;  5LMN T;  2LM2 A;  3A7M A;  2XQ6 A;  3IEE A;  4PK5 A;  4PJM A;  4H63 H;  1D0Z A;  4HFH A;  4HKA A;  2X67 A;  1US7 B;  1KK7 A;  4PNI A;  2NOX A;  5FNV E;  2C5K T;  4OFZ A;  2HPJ A;  2KWI B;  3OPC A;  2WDQ A;  3N9M A;  3KIN B;  1HX8 A;  3VHL A;  2HPL A;  4P1N A;  4U3C A;  1G73 A;  4BA9 A;  4YT0 A;  1MIY A;  2CXL A;  4U74 A;  3RQW A;  4ILB A;  3SS1 A;  2A9U A;  4IE7 A;  3DJB A;  3DTO A;  4TWF A;  3SFE A;  2EHO B;  3F57 A;  4PW8 A;  5LOV E;  2YDS A;  1AJ3 A;  2I59 A;  1N36 T;  3U78 A;  3ETV A;  4X1I E;  2VQE T;  3RH3 A;  3CQC B;  4TNV A;  4LF7 T;  5ABE A;  2DCF A;  3F2E A;  3CQX C;  2NR4 A;  3GA8 A;  3T1H T;  3RHW A;  2HHH T;  2XQ9 A;  3H3A A;  5ABG A;  4OYK A;  4IL9 A;  4QH1 A;  5FY7 A;  2XM2 A;  3VR9 A;  3FZL B;  2LRL A;  1HCI A;  3RRW A;  1YKH B;  4CN4 A;  1OWA A;  3TLW A;  4MBQ A;  1FIO A;  1N34 T;  5LB7 B;  4LF9 T;  4EZ4 A;  1S94 A;  4H9O C;  1U5P A;  1UUR A;  2V6X A;  3FZF B;  3AE1 A;  3KV9 A;  5C2T A;  2MTQ A;  2DI4 A;  3AAA B;  4DV0 T;  2W63 A;  1MMN A;  3FZK B;  3VKG A;  1FMV A;  4HWF A;  2CLY B;  3QC9 A;  4GYS A;  5C3J A;  1KNZ A;  1IBK T;  3RLF F;  1R8I A;  1IAP A;  1KNR A;  1OXZ A;  1LRZ A;  4WYV A;  3ZEF B;  5KX5 E;  3VKH A;  2FJB A;  3ZJ1 A;  3PUS A;  4YJ2 E;  3Q5W A;  3HKE E;  5HXR A;  4DR7 T;  3AE4 A;  3P8C D;  2Q9Q D;  3PUX F;  1M62 A;  3N9O A;  1WFD A;  3C4X A;  4YY3 T;  4JI4 T;  2V7M A;  1WYC A;  1MMA A;  4IDN A;  1T7S A;  4UEL A;  3B57 A;  3OBV E;  2EHO A;  2YDR A;  2VKD A;  2CLY C;  3AA7 B;  4X65 T;  1FJG T;  1T72 A;  1KF6 A;  5HEG A;  2JMK A;  2VKO A;  4WZX A;  2KSR A;  2X0L B;  4IIJ E;  2RP4 A;  3SRZ A;  4AI6 A;  3VRB A;  5FL1 A;  3RYC E;  4L9I A;  2W2U A;  4COF A;  3MAC A;  3GMI A;  4JI2 T;  4CXY A;  4CXX A;  3TLS A;  5AQK B;  4GOU A;  4HEA A;  3G06 A;  2MAW A;  3ZST A;  5J2U E;  5LG4 A;  4CI2 B;  4IHJ E;  3K8P C;  5LXT E;  4OK0 A;  4K0U A;  2XQ7 A;  2PG8 A;  1CUN A;  2XQ4 A;  4AIU A;  1MIV A;  3ZT5 A;  2GK9 A;  4PJN A;  3OJA A;  2OV9 A;  4MFR A;  5FY1 A;  3BQI A;  3BQL A;  1X9B A;  1ZV4 X;  5AQQ B;  5L3E B;  2V26 A;  5JRE A;  2CXD A;  3UUL A;  4NXN T;  4A5X A;  2CXF A;  4L0R A;  2D0U A;  3V5U A;  4DR6 T;  4IE6 A;  4ASK A;  5LP6 E;  4DID B;  5JDQ A;  4KHP T;  3T1Y T;  3I0O A;  3RI5 A;  3OYZ A;  5LGN B;  3IA3 A;  4TNW A;  5E0O A;  5JDL A;  1VRB A;  4J2C A;  1CHU A;  5DAB A;  5M4Y A;  5IUX A;  5JH7 E;  5HYA A;  2J4G A;  4TUY E;  1YW0 A;  4GKJ T;  4JI0 T;  2UUA T;  2Y48 B;  4MAL A;  3LBX B;  1LVF A;  1GQE A;  4Z8X A;  2K5B B;  3JAF A;  5LGU B;  4B3S T;  3PUG A;  2IHR 1;  5TAO A;  3AAE B;  1WR6 A;  5KMG P;  2H89 A;  2YK0 A;  3ZC1 A;  1T8B A;  5FXZ A;  4JI3 T;  2WCA A;  3FBZ A;  3RC8 A;  5L4E A;  4DUZ T;  1B7T A;  3PUW F;  3KFW X;  3QB5 K;  2LKG A;  3U3I A;  2X9X A;  3RQU A;  4HTE A;  4EEB A;  1D0Y A;  1YQ4 A;  1J1J A;  4HWC A;  3Q5X A;  2WB5 A;  2M6I A;  1SUM B;  2DNX A;  3RYI E;  5HWX A;  2V7K A;  2CBJ A;  2RPA A;  2Q9Q A;  4OHF A;  1NAF A;  3K1S A;  1IBM T;  4ZI2 C;  5EK3 A;  1IBL T;  2LSK A;  2KZ7 B;  3PUY F;  3UUN A;  4IDP A;  5JDG A;  3UU5 A;  1FMW A;  2NW8 A;  4HWH A;  2LKH A;  2XM1 A;  3N9N A;  2VKH A;  5EZY E;  2BG9 E;  4CN1 A;  2XQA A;  1J5W A;  2BS2 A;  4DMW A;  2LSG A;  3KVA A;  3FXE B;  1BR0 A;  2ZLY A;  1HTJ F;  2VQF T;  4TV9 E;  5HXH A;  3BK9 A;  3ZYK A;  3KV4 A;  2X9W A;  1DU2 A;  2XPK A;  3ESL A;  2XAG B;  2HN1 A;  2XQ3 A;  4EED A;  4QX8 B;  5FXV A;  3PV0 F;  3UFE A;  2BBH A;  4O4I E;  2D5U A;  1T98 A;  2XQ5 A;  2LM9 A;  3P4Q A;  3N2O A;  5JDH A;  1XZY A;  2IML A;  3C64 A;  3CIR A;  3PUZ F;  3AE2 A;  4H63 V;  3EDV A;  4LF5 T;  5FVK A;  4QXC B;  3LK4 2;  2BDE A;  3RIU C;  4AKI A;  4GKK T;  2BVL A;  4AQF C;  4EIW A;  3LBX A;  2D0T A;  3E08 A;  1U4Q A;  3NRY A;  2MOZ A;  3Q5E A;  2IAK A;  2MYS A;  3HKB E;  2FUP A;  4IE5 A;  4UIG A;  4YTM A;  2UXC T;  4KUM B;  1IJ5 A;  4U33 A;  1ZP0 A;  2V5C A;  3I9W A;  5HWY A;  2UUB T;  5FMN A;  3N9L A;  3Q9D A;  5FXW A;  5C8Y E;  3UQ7 A;  4QKN A;  3RGL A;  3PU8 A;  4YHH T;  5ABH A;  4ZZB A;  1XMO T;  2K48 A;  3CML A;  4JLE A;  4LF8 T;  5J2T E;  2E5L T;  3N5L A;  4LFC T;  4O4L E;  2QVA A;  3ZCJ A;  2CA5 A;  2I6H A;  4NXM T;  3AVR A;  3UFG A;  4B3M T;  1SHZ C;  5J1G A;  2JMH A;  2D2S A;  5JDM A;  4JI7 T;  1SA0 E;  5AQN B;  2P9B A;  3PUQ A;  1WCR A;  1QLB A;  5JRC A;  3K3Q C;  3ONL C;  4I0U A;  1UGO A;  3RIU A;  3P50 A;  3C4Z A;  3PU3 A;  4AQF A;  1HNZ T;  1MND A;  5AQJ B;  5CA1 E;  2LJL A;  4XBF B;  4LMJ A;  5LCY A;  4PJJ A;  4JUY A;  4QHO A;  4EZH A;  2Y8D A;  3FXD B;  2H88 A;  2HH7 A;  5FVL A;  4U2Z A;  2UUC T;  2LT3 A;  3PTR B;  4Z91 A;  3H3M A;  1HF8 A;  3O1H A;  5ETW A;  2J47 A;  2A3D A;  4ILA A;  2QYW A;  4ILU A;  2V1D B;  2WWU A;  5LBQ B;  2HN2 A;  3AEF A;  2BBJ A;  3UU3 A;  3RPU A;  4MHC A;  4GK5 E;  3HA4 A;  4AQG A;  2V5D A;  4UV9 B;  2UXX B;  2A72 A;  1H7C A;  4B6X A;  3SFD A;  1MIW A;  4QXB B;  3AE7 A;  3E0Z A;  4TN7 B;  1E2A A;  1QUU A;  5CGM A;  4NIQ A;  3PE0 A;  4QXH B;  4IL4 A;  1IZN B;  1JNR A;  5AFU L;  4N78 D;  1W9R A;  3BQK A;  3AXJ B;  1Y01 A;  3WI3 A;  1N32 T;  1X79 A;  3RX6 A;  4UF0 B;  1LKX A;  3OTO T;  5DQV A;  2J1D G;  1JNZ A;  3O9X A;  4ISS A;  1XDO A;  3HKC E;  4FI5 A;  2IIU A;  4L5G A;  3NZQ A;  2R6G F;  4YSX A;  3ZT7 A;  1E1H B;  2WDR A;  4BJN A;  4IDZ A;  4HFC A;  3B5M A;  2B1E A;  4GK0 E;  4HFE A;  2X9H A;  5HEH A;  1I6Z A;  3RYH E;  4KX6 A;  3UQ4 A;  3A8Y C;  2E5V A;  3H37 A;  2XAF B;  5IHY A;  4PFO A;  3LK2 B;  4DV3 T;  3JC6 C;  4TX5 A;  4DR4 T;  2E9X C;  2F4V T;  4EXT A;  5DQW A;  2M67 A;  3I9Y A;  4Z90 A;  2LSJ A;  2YDQ A;  5LG3 A;  2WY2 A;  4YHJ A;  2JPF A;  3W15 B;  4ILC A;  1UCU A;  2FJA A;  1KFY A;  3CQG B;  4CN6 A;  5L47 A;  2XTL A;  2YKS A;  1HG5 A;  5LNK A;  2JQK A;  3AE9 A;  3IBP A;  1S35 A;  2L3L A;  1KEY A;  2WP9 A;  4X64 T;  4UVB B;  1XDP A;  4LFA T;  1OED B;  3RKG A;  5L2L A;  4ZS3 A;  2NW7 A;  2V7J A;  2W67 A;  4KI0 F;  3P4P A;  2J62 A;  3MZK B;  2Y6X A;  4YSZ A;  1VCS A;  2W66 A;  3CPZ A;  1YKE B;  3MK7 C;  5AQH B;  4AIS A;  4F8H A;  4B3T T;  3K3O A;  4E7Z A;  3NZP A;  4QWN B;  5AQG B;  2AXD S;  4BJM A;  3MA9 A;  5LYJ E;  4UXN B;  1V9D A;  2VK9 A;  3AXJ A;  3I0Q A; 
#chains in the Genus database with same CATH homology
 4DV2 T;  4X65 T;  1FJG T;  2UXC T;  4DV3 T;  4DR5 T;  1IBM T;  1XNQ T;  4DR4 T;  2F4V T;  1IBL T;  4LF6 T;  5LMN T;  4DV6 T;  2UUB T;  4KHP T;  3T1Y T;  1XMQ T;  4X62 T;  1XNR T;  4DV5 T;  4YHH T;  1N34 T;  4LF9 T;  4DV1 T;  1XMO T;  4JI6 T;  1HNW T;  1HR0 T;  4JI2 T;  4LF8 T;  4DR3 T;  2E5L T;  2VQF T;  4LF4 T;  4LFC T;  4GKJ T;  1I94 T;  4JI0 T;  2UUA T;  4X64 T;  4DV7 T;  4JI1 T;  4DV0 T;  4NXM T;  2UXD T;  4LFA T;  1J5E T;  4B3M T;  4LFB T;  4B3S T;  5LMU T;  1IBK T;  4JI7 T;  4AQY T;  1N32 T;  4X66 T;  5IWA T;  4JYA T;  3OTO T;  4DUY T;  1HNX T;  4JI3 T;  4JV5 T;  1N36 T;  4LF5 T;  2UXB T;  4DUZ T;  4DR2 T;  2VQE T;  4JI5 T;  4DR1 T;  1HNZ T;  4LF7 T;  4DR7 T;  2UU9 T;  4OX9 T;  4GKK T;  4B3T T;  2ZM6 T;  4DV4 T;  1N33 T;  3T1H T;  4YY3 T;  5BR8 T;  4JI8 T;  2HHH T;  4JI4 T;  4NXN T;  4B3R T;  4K0K T;  2UUC T;  4DR6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...