4X62T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title N(6)-methyladenosine in mRNA disrupts tRNA selection and translation-elongation dynamics.
pubmed doi rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2014-12-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4x62T00
4YY3T 4GKJT 2UXCT 4LF4T 4AQYT 5LMUT 4JI2T 4DR5T 4B3ST 2HHHT 4X65T 4LF9T 4GKKT 4DR6T 1J5ET 4JI5T 4DUYT 4LF8T 1HNZT 4DUZT 1HNWT 1N36T 4X66T 4DV4T 4LFAT 4B3TT 1N32T 2F4VT 1XMQT 1I94T 3OTOT 4NXMT 4LF7T 4JI8T 5LMNT 2E5LT 4DV3T 2VQFT 4DR2T 2ZM6T 4LFCT 4JYAT 4LF5T 4LFBT 2UUBT 1XNRT 1XMOT 1N34T 2UUCT 2UUAT 1IBKT 4JI6T 1IBMT 4DR3T 4X62T 4OX9T 1XNQT 4YHHT 4LF6T 2UU9T 2VQET 2UXDT 4B3MT 5IWAT 1HNXT 1FJGT 4DR1T 4X64T 4DV0T 4JI0T 1IBLT 4DV1T 5BR8T 4DV7T 4JI3T 4DR4T 4K0KT 4DV5T 4JI7T 4DV2T 1N33T 4JI4T 3T1YT 4NXNT 3T1HT 1HR0T 4B3RT 4KHPT 4JV5T 4DV6T 2UXBT 4DR7T 4JI1T
chains in the Genus database with same CATH superfamily
3RHWA 3ONLC 2KNDA 2XASB 2NP9A 2JQQA 5LMUT 5FY7A 2IDOB 2HHHT 5HXCA 4LF9T 2LE8A 3F31A 3KINB 4GKKT 3AEAA 3AEEA 3PJAA 5C3JA 4PJMA 3A5XA 5CB4E 4J2CA 2KT9A 4LFAT 3PUWF 4PK5A 2K48A 3IEEA 1H7CA 4H9QC 4AQFC 2J47A 2WSSV 4QXHB 4QHOA 1WLXA 2XAJB 5JDLA 2VQFT 3P4PA 4JYAT 5JRCA 2CLYC 4LF5T 4UXNB 2BZBA 4MHCA 1YKEB 3P4WA 3ESLA 3HI2A 2WMOA 2XUEA 2EHOA 2ES0A 1W09A 3KV9A 4TV9E 5LNKA 2XM2A 1ZKEA 3L09A 3RC3A 2J4GA 3OVUA 3P4SA 3MKDA 2KLQA 5JQGE 3VU7H 2NWBA 4ILCA 4TZ4C 4YTMA 1S35A 3NRYA 4IE5A 3KV5A 2BG9B 5LGUB 2M6IA 4JEHB 3T8OA 3MJXA 3PUYF 2BS3A 3P4QA 1ZP0A 4GK5E 4TUYE 4JI7T 4NXNT 3OYXA 4I43B 3VRAA 4G2AA 3UU6A 4JBWF 5AQGB 3AEFA 4U2ZA 2UXCT 2MTQA 3AVRA 5ABHA 4B3ST 4XAXB 3ZSSA 4JUYA 4N78D 4EYUA 1JNZA 4AKHA 3KDSE 5H6RB 1XDPA 2RPAA 2BG9A 1S94A 5EK4A 4A98A 5HXSA 2XQ8A 4P0AA 4LMKA 3AE8A 4ILAA 5KX5E 3TKLB 1LRZA 4C90A 4NXMT 2YU1A 4PFOA 3UQ7A 2IAKA 3C64A 2LSKA 1QSDA 4X62T 2VURA 3Q9DA 3ZN1B 5ABFB 4PJNA 4LMLA 4WYVA 1T8BA 2W4XA 3NBXX 4ISTA 4ZI2D 1IBLT 2HN1A 5HYAA 5AQPB 3ZCJA 3AAAB 2XY8B 4DR4T 4DV5T 3HL6A 4EZHA 2E9XC 1HG5A 4JI4T 3KBUA 5KDMC 5AQMB 5AQRB 4CN4A 3W15B 3TLWA 2MOZA 2D5UA 2LRLA 2V8SV 3B5MA 4DR5T 2NW9A 3MZKB 5DJQC 1WYBA 4HWFA 3C51A 5ABFA 4KMCA 4DUYT 1UURA 4EV6A 5FVLA 1HNZT 5AQVB 5LOVE 2XQ5A 3K8PC 3SS1A 3LG7A 2W2UA 5AQUB 2JQHA 2CBJA 1VCSA 3ZCIA 2CA5A 2YK0A 3CQGB 1XNRT 1OEDA 2BG9E 4QX8B 5HCMA 4IE4A 1LVKA 4L9IA 2N9DA 2WAUA 3FBLA 4CXWA 1W0BA 3AEBA 1OXZA 4HWCA 2A72A 3N9NA 3ONJA 4CI1B 5EK3A 2I6HA 3ZMSB 4AXPA 3SRZA 4IL4A 2VKDA 3ZYKA 4DV7T 2Q9QC 2V6YA 3ONXA 3S4UA 3RYCE 2K3WA 3T1YT 2VVSA 2ZM0A 5TAOA 1KFYA 1ZHCA 1SUMB 3FHNA 4CXYA 3CK6A 2VB6A 3N9OA 2XZEA 2A3DA 4CN1A 3MACA 2D2SA 4O4JE 5LA6E 4CXXA 2A9UA 2FUPA 3ZEFB 1KNPA 2QA7A 5IYZE 2D0TA 4HWIB 4PK4A 5LMNT 4HFDA 1MMNA 2ODVA 1UUSA 1XMOT 2CCQA 3VHLA 4ZI3C 1G73A 2W63A 4H9NC 3QUJA 4YJ2E 2D0UA 4HFHA 3K3QC 3RQUA 4EXTA 2BVMA 4HFBA 4UF0B 1MNDA 3OKQA 3OBVE 4X20E 2MYSA 3NWIA 3N2GE 2JPFA 4MALA 3DTOA 4BAYB 2ACZA 2J1DG 4E7ZA 2W00A 5LG3A 4A5XA 5LHHB 4YT0A 4U72A 2M67A 3CQXC 2V7JA 4F6RC 4DR7T 3EDVA 1D1CA 3O1IA 5HEHA 4UVAB 3VKHA 3LFMA 3QB5K 3CWZB 2YDRA 5F3JA 5CFBA 4UF0A 2WP9A 2H7OA 3PTRB 3ZJ2A 2B1EA 2ODUA 4ZOLE 4YSXA 3DP7A 2YKSA 4X1IE 4AQGA 3K1SA 2QYWA 3RQWA 1UK5A 3EUHA 3SOLA 3LSVA 2LSYA 4DR2T 4BA9A 2PTFA 3E08A 3MA9A 4UV9B 3GWHA 5LP6E 5JTGA 4HFIA 2W61A 4DVDA 4KI0F 2RA1A 3SFEA 4IL9A 4X1YE 2WS3A 2UUAT 4H63V 3BQLA 2MAWA 4IGUA 1XNQT 4HGAA 5CA0E 2BKPA 2L9QA 3EHZA 2LKGA 5M4YA 3RPUA 2KZ7B 4DV0T 4Z90A 5KXJA 2NTYA 3LDQB 5DQVA 4HFCA 2CLYB 1QLBA 2R6GF 2E5VA 4HWDA 4QKNA 2Y48B 4K0KT 3ANWB 5F5WA 4AI6A 3IA3A 1HFAA 4IDQA 5L2LA 2AXDS 2WY2A 4YY3T 4EIWA 1X79A 4FI5A 3A7MA 4AQFA 1D0XA 5JR9C 2H88A 5CGMA 3AA7B 4L0RA 1NEKA 5AQFB 4XBFB 2DI4A 3PJAJ 2IIUA 4B3TT 2QRXA 5L3DB 3M65A 5FNVE 1V9DA 5FY0A 3RIAA 2BS2A 3RYIE 3X1DA 4H9RC 5CA1E 3ETUA 4LFBT 2N2NA 2G0UA 3GMIA 1N34T 1ZEEA 3PUVF 4ZZBA 2E9XD 1HCIA 3RC8A 1IBMT 1LVFA 2P9BA 2XJ7A 5AQNB 3L3PA 4LF6T 4I50E 4OYKA 2LHNA 2K5BB 1HNXT 3A8YC 1FJGT 4ERRA 1HF8A 4U3CA 1M7KA 4DIDB 1R8IA 2A2FX 4U33A 5BMVE 4OK0A 4TWDA 2RP4A 5FMNA 1AJ3A 3T1HT 4YJ3E 4DO0A 3QB5A 3FZHB 3AXJB 2DWKA 4P0BA 2HN2A 4HFEA 2LM2A 5AQHB 3CPZA 3N9PA 3HKEE 2UXNB 2YDSA 4JI5T 5JDHA 4YSZA 2CBIA 2E9XB 4ZXLA 1Z0PA 1G8XA 3GN5B 1HNWT 2V26A 3FZMB 2ACXA 5L3EB 5JH7E 3CIRA 3HKBE 3C98B 3JADA 3UU8A 4DV3T 5ABEA 2XSAA 4LFCT 4PAGA 2Q9QD 1U5PA 4IE0A 4AKGA 2XQ4A 3NVOA 3OPCA 3RF1A 2XM1A 2B76A 2JMHA 5L47A 2LM9A 2X68A 4PJLA 2E9XA 3I0QA 4TV8E 4ANJA 3C4WA 1E7PA 2NOXA 3VR8A 3EI0A 3LJCA 4EOZB 2W0GA 3NKZA 2VKHA 3R6NA 1YXRA 2YDQA 3RKGA 5L3BB 3ZT6A 2DLRA 4X5TA 4B6XA 3JCFA 3ZMUB 3E0ZA 2Q9QB 4JLEA 4CZZB 5LGNB 1J5ET 2J62A 4Z91A 5J0ZA 3H3MA 4ZI3D 2K9AA 3KVBA 4LF8T 3PU3A 4DUZT 4QH4A 2QVAA 1MIWA 1YKHB 4TNVA 1CUNA 5FP3A 4HN9A 3VRBA 1WFDA 1N32T 2X51A 4YFSA 2L3LA 5LGTB 3M3ZB 4E7SA 2C0SA 1YQ3A 1E1HB 2V7LA 3RGLA 3EABA 3WAJA 4GIWA 5FY1A 4AKRB 3LK42 4HE8A 4WW0A 3AE6A 2Q9QA 2CXDA 4YHHT 5FYMA 4AIUA 2WCAA 5DQWA 2WM9A 4I55E 1FEWA 1CHUA 5HEGA 4CQIA 1KNRA 4DBRA 4KP3C 3KV6A 3PDYA 2V5CA 2W66A 3AEGA 3P8CD 5JVDE 2XAFB 1HR0T 3AA1B 2WZHA 3IF8B 5HCJA 5ABGA 1SA0E 5EK2A 4QH1A 2XSBA 2IC6A 2FJDA 3MXZA 3KFWX 5JDNA 5JDQA 1MMAA 2CXFA 5E0OA 4HFVA 2CPTA 1IJ6A 2BKOA 3RIUC 3QK6A 5IUXA 4UV8B 2X0YA 1X9BA 3E22E 2BDEA 4EZ4A 5HEJA 1I94T 3JAEA 3L39A 4WZXA 3OTOT 3AB3B 3TLVA 4ZS2A 4CI2B 3WI3A 2VVNA 4LF7T 2WWVA 2E8IA 4XZCA 4PJJA 2OLTA 4PW8A 2ZLYA 4PFPA 5AQLB 4EEDA 4BJNA 1KEYA 1BR1A 5JDGA 5LHIB 4Q25A 2VWAA 3L8RA 4FJOA 5FXXA 4O2BE 3WAKA 4HWHA 2CWOA 2X66A 3AE2A 4AKIA 1MNEA 4NIQA 2WDRA 4DV2T 3AA0B 1XWMA 2CE7A 2KWIB 3CX8B 2Y8DA 1WR6A 2WB5A 1FMWA 3F2EA 4G63A 1D1AA 2C5IT 3AA6B 2BBHA 5L4HA 1YQ4A 2BBJA 2W62A 3PUAA 1HX8A 3RYHE 4U7YA 2LOPA 3Q5DA 2F4VT 4WBNE 5LYJE 3O4XE 4ILBA 4NUVA 2V6XA 2L8KA 2HH7A 2GK9A 3AE3A 5JR9B 2JQKA 4ZHQE 5A1LA 2M6BA 3QC9A 3ZYMA 4A56A 1XZYA 1WR0A 3UU5A 3UU3A 3ZT7A 2YN6A 2KXPB 3EVYA 2W67A 4B3MT 4X64T 2VL8A 3MK7C 5C2TA 1MIYA 3PE0A 3O1JA 3VKGA 3NZQA 4KX6A 4GYRA 2Y6XA 1EZ3A 1VOMA 3HR0A 1JNRA 3H37A 3QOFA 4ZS3A 1KF6A 4B3RT 1BR2A 4NPPA 2MBGA 3ZMTB 1U4QA 3P7IA 5JR9A 3OJAA 2JMKA 2X67A 2X9HA 3AECA 3TLSA 4LF4T 3SWHA 5ADXL 1W0AA 4IE7A 2VL0A 4QWNB 1D0YA 4YTNA 2XQ9A 2KINB 3BQIA 5LB7B 2EHOD 2DHRA 5HEOA 4DV4T 4QXBB 4QXCB 3RIFA 2XQ6A 5CJ5A 3FZLB 5HXHA 5HWXA 1Z8UA 1DU2A 1SE7A 2UUBT 3UULA 5LBQB 2X9XA 2WDQA 2WWUA 1J1JA 4IIJE 1SHZC 2X0HA 4KBMB 1B7TA 4NUUA 3ANWA 2FBWA 2BKNA 3UUXB 4P1NA 1I6ZA 3PUSA 4JI0T 1UX5A 3ABVA 2XAQB 4DMWA 5AQIB 2LT3A 1T72A 1UX4A 4JI3T 3Q5XA 3JC6C 2EHOB 3AE7A 3UQ4A 3UUNA 4IHJE 2JIWA 4KHPT 3D0TA 1UGOA 5H6QB 2FJAA 5AQKB 4GKJT 3UT5E 1W9RA 2KMFA 1HTJF 2KWHA 3NRXA 4ADZA 3AVSA 3KBTA 4X65T 1E2AA 5AQJB 4DR6T 3CX7B 3TLUA 2CXLA 5HXRA 5L3FB 5AQOB 4L5GA 4YHJA 1N36T 1MMDA 3CKDA 3HA4A 5KMGP 4H9SE 4CI3B 2MPKA 4BJMA 2LHRA 4IE6A 3O9XA 5FVKA 3RLFF 2Z6EA 2E5LT 2VASA 1OWAA 2AE9A 4ZI7E 3CX6B 3J7Yq 3N2KE 2XQ7A 2I0MA 3Q5WA 1IAPA 5HWYA 4JI6T 5LG4A 3VR9A 4DR3T 4H9PC 4MLKA 1BR0A 1KNZA 3AE5A 1BR4A 1HS7A 2I59A 2UU9T 1L0VA 4ISSA 3PV0F 4U7IA 3UUBA 4TWFA 3ZMZB 3CMLA 3FXEB 2YU2A 2CEAA 2LEHA 3AXJA 2K24A 2EHOC 2YINA 2VKOA 2LSJA 4YSYA 3Q2MA 2NW7A 3O1HA 1MMGA 3N9MA 3LK3B 4UVBB 5ETWA 2OA5A 3DJBA 4AKLA 3N2OA 3RI5A 3GN5A 3AEDA 1O3XA 3PUZF 3J9X1 3LBXB 1WCRA 1J5WA 4IDZA 2FJBA 2PJQA 2QGSA 4ASKA 3UU4A 3UFGA 4JEUB 2D9DA 2E2AA 3TLTA 4EEBA 2HPLA 5AQSB 3SFDA 2LLYA 2DL1A 2XTLA 4WBOA 2VKJA 5FKYA 2HPJA 4KHZF 4F8HA 2OV9A 4UIGA 4ZZCA 3ZKRA 3ZSTA 3EAMA 2WQYA 2PFVA 2BG9C 1ZOYA 2CWYA 3LBXA 3ZC0A 2UUCT 5JDMA 3HKCE 3P4RA 3AAEB 4OFZA 5FXVA 4I4TE 4U31A 4O4IE 5HXEA 5IWAT 3C4XA 4OYJA 4EB6E 2CRBA 3PUXF 1OEDB 3F57A 5FXZA 2JJ9A 2X0LB 2V5DA 1N33T 3Q5EA 2CMRA 4EGWA 5J1GA 3V5UA 5J2TE 4TX5A 4H63H 3BQKA 4YLHA 4UVCB 3G06A 1ZV4X 4AQYT 3RIUA 4H9OC 2V6YB 5L4EA 2IUBA 2XHEB 3ZC1A 2BS4A 1FIOA 2H7VC 5LJMA 1QUUA 4DBQA 3EDUA 4Z8XA 3GA8A 5AFUL 4LMJA 4GOUA 1US7B 2XQYA 4X66T 1IJ5A 5LJNA 1VRBA 1Y01A 4AISA 2X9WA 1D0ZA 1IZNB 4TN7B 4GK0E 2ZM2A 5FL0A 3FBZA 5GONE 5DABA 2ZM6T 4ILUA 3RRWA 3ETVA 1HG2A 4TNWA 1M62A 2WU2A 3RKOA 2H3RA 5LXTE 4IDNA 1NAFA 5LBMA 3C50A 3I0OA 4PNIA 2XQAA 3BK9A 2H89A 5LHGB 3CVRA 4X1KE 1OEDC 2V7MA 2YEVC 5L3GB 3KV4A 3AE1A 4HEAA 3K3OA 4P09A 3ZT5A 3I9YA 5LCYA 3U78A 3RYFE 5F8PA 2WBLA 3RRCA 2NTXA 3UUMA 1GQEA 3ZLIA 2UXBT 1WRDA 5EZYE 4IT4A 3RX6A 3KVAA 4WNKA 4ZI2C 4YTPA 2LJLA 5J2UE 1YW0A 1T7SA 1NENA 2IW5B 2LOSA 2PBIA 2WDVA 3N5LA 3PUQA 3N9LA 2UXXB 2V7KA 2LSIA 3V5SA 1MIVA 3AE9A 5HEUA 2LRKA 2YOEA 3I9WA 2PG8A 5AQTB 3CQCB 2DWGA 2ZMAA 4OHFA 3B13A 4O4LE 2XQ3A 2NR4A 5JREA 4O8SA 5AQQB 3ZJ1A 1OEDE 3JC6D 2CHOA 3IHRA 5IHYA 3U3IA 2IMLA 2NW8A 4YXDA 3ZMVB 1IBKT 3JAFA 1HX1B 3FXDB 2X9YA 3NZPA 4QH5A 2UXDT 2XAHB 4A97A 2DCFA 4ZEYA 2DNXA 2ZM8A 3IBPA 4MBQA 2FJEA 3ZPOA 4CN6A 2XPKA 4M1PA 3K3NA 2WU5A 4IDPA 4EYYR 2LSGA 1KK7A 4DV1T 3FZKB 5BR8T 1XDOA 2BVLA 3H3AA 3C4ZA 5JDFA 2VK9A 4JV5T 3HKDE 3QNUA 3RH3A 4JI1T 5C8YE 1T98A 4MFRA 4COFA 5FL1A 1YD8G 1NWMX 4JI2T 2C5KT 2IC9A 3FZFB 1Y64B 3PUGA 4O4HE 4O2AE 4IREA 4U2YA 4DMVA 3B57A 4HTEA 3OYZA 1WYCA 4V1Av 2XAGB 3N9QA 3AE4A 4QX7B 4EAHA 5L3CB 4UR9A 1UCUA 3PURA 1XMQT 3AAIA 3ZN0B 4K0UA 2IHR1 2WMNA 3LK2B 3PU8A 3UTKA 4JI8T 5FXWA 3ZYLA 4UELA 4UEMA 2N1GA 3FB2A 4HKAA 4GYSA 4OX9T 3UFEA 2VQET 3R84B 4U74A 4C91A 2JQ9A 4DR1T 4I0UA 2C5JA 3P50A 2V7IA 4PK6A 3I1AA 2V1DB 1VCTA 2SPCA 4IDOA 2JRKA 2LKHA 2WZIA 1LKXA 1FMVA 4TWHA 1D1BA 2CM0A 2CHNA 4DV6T 4DNDA 4KUMB 5HAXA 2KSRA 5JRCB
chains in the Genus database with same CATH topology
4YY3T 4GKJT 2UXCT 4LF4T 4AQYT 5LMUT 4JI2T 4DR5T 4B3ST 2HHHT 4X65T 4LF9T 4GKKT 4DR6T 1J5ET 4JI5T 4DUYT 4LF8T 1HNZT 4DUZT 1HNWT 1N36T 4X66T 4DV4T 4LFAT 4B3TT 1N32T 2F4VT 1XMQT 1I94T 3OTOT 4NXMT 4LF7T 4JI8T 5LMNT 2E5LT 4DV3T 2VQFT 4DR2T 2ZM6T 4LFCT 4JYAT 4LF5T 4LFBT 2UUBT 1XNRT 1XMOT 1N34T 2UUCT 2UUAT 1IBKT 4JI6T 1IBMT 4DR3T 4X62T 4OX9T 1XNQT 4YHHT 4LF6T 2UU9T 2VQET 2UXDT 4B3MT 5IWAT 1HNXT 1FJGT 4DR1T 4X64T 4DV0T 4JI0T 1IBLT 4DV1T 5BR8T 4DV7T 4JI3T 4DR4T 4K0KT 4DV5T 4JI7T 4DV2T 1N33T 4JI4T 3T1YT 4NXNT 3T1HT 1HR0T 4B3RT 4KHPT 4JV5T 4DV6T 2UXBT 4DR7T 4JI1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 T;  4GKJ T;  2UXC T;  4LF4 T;  4AQY T;  5LMU T;  4JI2 T;  4DR5 T;  4B3S T;  2HHH T;  4X65 T;  4LF9 T;  4GKK T;  4DR6 T;  1J5E T;  4JI5 T;  4DUY T;  4LF8 T;  1HNZ T;  4DUZ T;  1HNW T;  1N36 T;  4X66 T;  4DV4 T;  4LFA T;  4B3T T;  1N32 T;  2F4V T;  1XMQ T;  1I94 T;  3OTO T;  4NXM T;  4LF7 T;  4JI8 T;  5LMN T;  2E5L T;  4DV3 T;  2VQF T;  4DR2 T;  2ZM6 T;  4LFC T;  4JYA T;  4LF5 T;  4LFB T;  2UUB T;  1XNR T;  1XMO T;  1N34 T;  2UUC T;  2UUA T;  1IBK T;  4JI6 T;  1IBM T;  4DR3 T;  4X62 T;  4OX9 T;  1XNQ T;  4YHH T;  4LF6 T;  2UU9 T;  2VQE T;  2UXD T;  4B3M T;  5IWA T;  1HNX T;  1FJG T;  4DR1 T;  4X64 T;  4DV0 T;  4JI0 T;  1IBL T;  4DV1 T;  5BR8 T;  4DV7 T;  4JI3 T;  4DR4 T;  4K0K T;  4DV5 T;  4JI7 T;  4DV2 T;  1N33 T;  4JI4 T;  3T1Y T;  4NXN T;  3T1H T;  1HR0 T;  4B3R T;  4KHP T;  4JV5 T;  4DV6 T;  2UXB T;  4DR7 T;  4JI1 T; 
#chains in the Genus database with same CATH topology
 3RHW A;  3ONL C;  2KND A;  2XAS B;  2NP9 A;  2JQQ A;  5LMU T;  5FY7 A;  2IDO B;  2HHH T;  5HXC A;  4LF9 T;  2LE8 A;  3F31 A;  3KIN B;  4GKK T;  3AEA A;  3AEE A;  3PJA A;  5C3J A;  4PJM A;  3A5X A;  5CB4 E;  4J2C A;  2KT9 A;  4LFA T;  3PUW F;  4PK5 A;  2K48 A;  3IEE A;  1H7C A;  4H9Q C;  4AQF C;  2J47 A;  2WSS V;  4QXH B;  4QHO A;  1WLX A;  2XAJ B;  5JDL A;  2VQF T;  3P4P A;  4JYA T;  5JRC A;  2CLY C;  4LF5 T;  4UXN B;  2BZB A;  4MHC A;  1YKE B;  3P4W A;  3ESL A;  3HI2 A;  2WMO A;  2XUE A;  2EHO A;  2ES0 A;  1W09 A;  3KV9 A;  4TV9 E;  5LNK A;  2XM2 A;  1ZKE A;  3L09 A;  3RC3 A;  2J4G A;  3OVU A;  3P4S A;  3MKD A;  2KLQ A;  5JQG E;  3VU7 H;  2NWB A;  4ILC A;  4TZ4 C;  4YTM A;  1S35 A;  3NRY A;  4IE5 A;  3KV5 A;  2BG9 B;  5LGU B;  2M6I A;  4JEH B;  3T8O A;  3MJX A;  3PUY F;  2BS3 A;  3P4Q A;  1ZP0 A;  4GK5 E;  4TUY E;  4JI7 T;  4NXN T;  3OYX A;  4I43 B;  3VRA A;  4G2A A;  3UU6 A;  4JBW F;  5AQG B;  3AEF A;  4U2Z A;  2UXC T;  2MTQ A;  3AVR A;  5ABH A;  4B3S T;  4XAX B;  3ZSS A;  4JUY A;  4N78 D;  4EYU A;  1JNZ A;  4AKH A;  3KDS E;  5H6R B;  1XDP A;  2RPA A;  2BG9 A;  1S94 A;  5EK4 A;  4A98 A;  5HXS A;  2XQ8 A;  4P0A A;  4LMK A;  3AE8 A;  4ILA A;  5KX5 E;  3TKL B;  1LRZ A;  4C90 A;  4NXM T;  2YU1 A;  4PFO A;  3UQ7 A;  2IAK A;  3C64 A;  2LSK A;  1QSD A;  4X62 T;  2VUR A;  3Q9D A;  3ZN1 B;  5ABF B;  4PJN A;  4LML A;  4WYV A;  1T8B A;  2W4X A;  3NBX X;  4IST A;  4ZI2 D;  1IBL T;  2HN1 A;  5HYA A;  5AQP B;  3ZCJ A;  3AAA B;  2XY8 B;  4DR4 T;  4DV5 T;  3HL6 A;  4EZH A;  2E9X C;  1HG5 A;  4JI4 T;  3KBU A;  5KDM C;  5AQM B;  5AQR B;  4CN4 A;  3W15 B;  3TLW A;  2MOZ A;  2D5U A;  2LRL A;  2V8S V;  3B5M A;  4DR5 T;  2NW9 A;  3MZK B;  5DJQ C;  1WYB A;  4HWF A;  3C51 A;  5ABF A;  4KMC A;  4DUY T;  1UUR A;  4EV6 A;  5FVL A;  1HNZ T;  5AQV B;  5LOV E;  2XQ5 A;  3K8P C;  3SS1 A;  3LG7 A;  2W2U A;  5AQU B;  2JQH A;  2CBJ A;  1VCS A;  3ZCI A;  2CA5 A;  2YK0 A;  3CQG B;  1XNR T;  1OED A;  2BG9 E;  4QX8 B;  5HCM A;  4IE4 A;  1LVK A;  4L9I A;  2N9D A;  2WAU A;  3FBL A;  4CXW A;  1W0B A;  3AEB A;  1OXZ A;  4HWC A;  2A72 A;  3N9N A;  3ONJ A;  4CI1 B;  5EK3 A;  2I6H A;  3ZMS B;  4AXP A;  3SRZ A;  4IL4 A;  2VKD A;  3ZYK A;  4DV7 T;  2Q9Q C;  2V6Y A;  3ONX A;  3S4U A;  3RYC E;  2K3W A;  3T1Y T;  2VVS A;  2ZM0 A;  5TAO A;  1KFY A;  1ZHC A;  1SUM B;  3FHN A;  4CXY A;  3CK6 A;  2VB6 A;  3N9O A;  2XZE A;  2A3D A;  4CN1 A;  3MAC A;  2D2S A;  4O4J E;  5LA6 E;  4CXX A;  2A9U A;  2FUP A;  3ZEF B;  1KNP A;  2QA7 A;  5IYZ E;  2D0T A;  4HWI B;  4PK4 A;  5LMN T;  4HFD A;  1MMN A;  2ODV A;  1UUS A;  1XMO T;  2CCQ A;  3VHL A;  4ZI3 C;  1G73 A;  2W63 A;  4H9N C;  3QUJ A;  4YJ2 E;  2D0U A;  4HFH A;  3K3Q C;  3RQU A;  4EXT A;  2BVM A;  4HFB A;  4UF0 B;  1MND A;  3OKQ A;  3OBV E;  4X20 E;  2MYS A;  3NWI A;  3N2G E;  2JPF A;  4MAL A;  3DTO A;  4BAY B;  2ACZ A;  2J1D G;  4E7Z A;  2W00 A;  5LG3 A;  4A5X A;  5LHH B;  4YT0 A;  4U72 A;  2M67 A;  3CQX C;  2V7J A;  4F6R C;  4DR7 T;  3EDV A;  1D1C A;  3O1I A;  5HEH A;  4UVA B;  3VKH A;  3LFM A;  3QB5 K;  3CWZ B;  2YDR A;  5F3J A;  5CFB A;  4UF0 A;  2WP9 A;  2H7O A;  3PTR B;  3ZJ2 A;  2B1E A;  2ODU A;  4ZOL E;  4YSX A;  3DP7 A;  2YKS A;  4X1I E;  4AQG A;  3K1S A;  2QYW A;  3RQW A;  1UK5 A;  3EUH A;  3SOL A;  3LSV A;  2LSY A;  4DR2 T;  4BA9 A;  2PTF A;  3E08 A;  3MA9 A;  4UV9 B;  3GWH A;  5LP6 E;  5JTG A;  4HFI A;  2W61 A;  4DVD A;  4KI0 F;  2RA1 A;  3SFE A;  4IL9 A;  4X1Y E;  2WS3 A;  2UUA T;  4H63 V;  3BQL A;  2MAW A;  4IGU A;  1XNQ T;  4HGA A;  5CA0 E;  2BKP A;  2L9Q A;  3EHZ A;  2LKG A;  5M4Y A;  3RPU A;  2KZ7 B;  4DV0 T;  4Z90 A;  5KXJ A;  2NTY A;  3LDQ B;  5DQV A;  4HFC A;  2CLY B;  1QLB A;  2R6G F;  2E5V A;  4HWD A;  4QKN A;  2Y48 B;  4K0K T;  3ANW B;  5F5W A;  4AI6 A;  3IA3 A;  1HFA A;  4IDQ A;  5L2L A;  2AXD S;  2WY2 A;  4YY3 T;  4EIW A;  1X79 A;  4FI5 A;  3A7M A;  4AQF A;  1D0X A;  5JR9 C;  2H88 A;  5CGM A;  3AA7 B;  4L0R A;  1NEK A;  5AQF B;  4XBF B;  2DI4 A;  3PJA J;  2IIU A;  4B3T T;  2QRX A;  5L3D B;  3M65 A;  5FNV E;  1V9D A;  5FY0 A;  3RIA A;  2BS2 A;  3RYI E;  3X1D A;  4H9R C;  5CA1 E;  3ETU A;  4LFB T;  2N2N A;  2G0U A;  3GMI A;  1N34 T;  1ZEE A;  3PUV F;  4ZZB A;  2E9X D;  1HCI A;  3RC8 A;  1IBM T;  1LVF A;  2P9B A;  2XJ7 A;  5AQN B;  3L3P A;  4LF6 T;  4I50 E;  4OYK A;  2LHN A;  2K5B B;  1HNX T;  3A8Y C;  1FJG T;  4ERR A;  1HF8 A;  4U3C A;  1M7K A;  4DID B;  1R8I A;  2A2F X;  4U33 A;  5BMV E;  4OK0 A;  4TWD A;  2RP4 A;  5FMN A;  1AJ3 A;  3T1H T;  4YJ3 E;  4DO0 A;  3QB5 A;  3FZH B;  3AXJ B;  2DWK A;  4P0B A;  2HN2 A;  4HFE A;  2LM2 A;  5AQH B;  3CPZ A;  3N9P A;  3HKE E;  2UXN B;  2YDS A;  4JI5 T;  5JDH A;  4YSZ A;  2CBI A;  2E9X B;  4ZXL A;  1Z0P A;  1G8X A;  3GN5 B;  1HNW T;  2V26 A;  3FZM B;  2ACX A;  5L3E B;  5JH7 E;  3CIR A;  3HKB E;  3C98 B;  3JAD A;  3UU8 A;  4DV3 T;  5ABE A;  2XSA A;  4LFC T;  4PAG A;  2Q9Q D;  1U5P A;  4IE0 A;  4AKG A;  2XQ4 A;  3NVO A;  3OPC A;  3RF1 A;  2XM1 A;  2B76 A;  2JMH A;  5L47 A;  2LM9 A;  2X68 A;  4PJL A;  2E9X A;  3I0Q A;  4TV8 E;  4ANJ A;  3C4W A;  1E7P A;  2NOX A;  3VR8 A;  3EI0 A;  3LJC A;  4EOZ B;  2W0G A;  3NKZ A;  2VKH A;  3R6N A;  1YXR A;  2YDQ A;  3RKG A;  5L3B B;  3ZT6 A;  2DLR A;  4X5T A;  4B6X A;  3JCF A;  3ZMU B;  3E0Z A;  2Q9Q B;  4JLE A;  4CZZ B;  5LGN B;  1J5E T;  2J62 A;  4Z91 A;  5J0Z A;  3H3M A;  4ZI3 D;  2K9A A;  3KVB A;  4LF8 T;  3PU3 A;  4DUZ T;  4QH4 A;  2QVA A;  1MIW A;  1YKH B;  4TNV A;  1CUN A;  5FP3 A;  4HN9 A;  3VRB A;  1WFD A;  1N32 T;  2X51 A;  4YFS A;  2L3L A;  5LGT B;  3M3Z B;  4E7S A;  2C0S A;  1YQ3 A;  1E1H B;  2V7L A;  3RGL A;  3EAB A;  3WAJ A;  4GIW A;  5FY1 A;  4AKR B;  3LK4 2;  4HE8 A;  4WW0 A;  3AE6 A;  2Q9Q A;  2CXD A;  4YHH T;  5FYM A;  4AIU A;  2WCA A;  5DQW A;  2WM9 A;  4I55 E;  1FEW A;  1CHU A;  5HEG A;  4CQI A;  1KNR A;  4DBR A;  4KP3 C;  3KV6 A;  3PDY A;  2V5C A;  2W66 A;  3AEG A;  3P8C D;  5JVD E;  2XAF B;  1HR0 T;  3AA1 B;  2WZH A;  3IF8 B;  5HCJ A;  5ABG A;  1SA0 E;  5EK2 A;  4QH1 A;  2XSB A;  2IC6 A;  2FJD A;  3MXZ A;  3KFW X;  5JDN A;  5JDQ A;  1MMA A;  2CXF A;  5E0O A;  4HFV A;  2CPT A;  1IJ6 A;  2BKO A;  3RIU C;  3QK6 A;  5IUX A;  4UV8 B;  2X0Y A;  1X9B A;  3E22 E;  2BDE A;  4EZ4 A;  5HEJ A;  1I94 T;  3JAE A;  3L39 A;  4WZX A;  3OTO T;  3AB3 B;  3TLV A;  4ZS2 A;  4CI2 B;  3WI3 A;  2VVN A;  4LF7 T;  2WWV A;  2E8I A;  4XZC A;  4PJJ A;  2OLT A;  4PW8 A;  2ZLY A;  4PFP A;  5AQL B;  4EED A;  4BJN A;  1KEY A;  1BR1 A;  5JDG A;  5LHI B;  4Q25 A;  2VWA A;  3L8R A;  4FJO A;  5FXX A;  4O2B E;  3WAK A;  4HWH A;  2CWO A;  2X66 A;  3AE2 A;  4AKI A;  1MNE A;  4NIQ A;  2WDR A;  4DV2 T;  3AA0 B;  1XWM A;  2CE7 A;  2KWI B;  3CX8 B;  2Y8D A;  1WR6 A;  2WB5 A;  1FMW A;  3F2E A;  4G63 A;  1D1A A;  2C5I T;  3AA6 B;  2BBH A;  5L4H A;  1YQ4 A;  2BBJ A;  2W62 A;  3PUA A;  1HX8 A;  3RYH E;  4U7Y A;  2LOP A;  3Q5D A;  2F4V T;  4WBN E;  5LYJ E;  3O4X E;  4ILB A;  4NUV A;  2V6X A;  2L8K A;  2HH7 A;  2GK9 A;  3AE3 A;  5JR9 B;  2JQK A;  4ZHQ E;  5A1L A;  2M6B A;  3QC9 A;  3ZYM A;  4A56 A;  1XZY A;  1WR0 A;  3UU5 A;  3UU3 A;  3ZT7 A;  2YN6 A;  2KXP B;  3EVY A;  2W67 A;  4B3M T;  4X64 T;  2VL8 A;  3MK7 C;  5C2T A;  1MIY A;  3PE0 A;  3O1J A;  3VKG A;  3NZQ A;  4KX6 A;  4GYR A;  2Y6X A;  1EZ3 A;  1VOM A;  3HR0 A;  1JNR A;  3H37 A;  3QOF A;  4ZS3 A;  1KF6 A;  4B3R T;  1BR2 A;  4NPP A;  2MBG A;  3ZMT B;  1U4Q A;  3P7I A;  5JR9 A;  3OJA A;  2JMK A;  2X67 A;  2X9H A;  3AEC A;  3TLS A;  4LF4 T;  3SWH A;  5ADX L;  1W0A A;  4IE7 A;  2VL0 A;  4QWN B;  1D0Y A;  4YTN A;  2XQ9 A;  2KIN B;  3BQI A;  5LB7 B;  2EHO D;  2DHR A;  5HEO A;  4DV4 T;  4QXB B;  4QXC B;  3RIF A;  2XQ6 A;  5CJ5 A;  3FZL B;  5HXH A;  5HWX A;  1Z8U A;  1DU2 A;  1SE7 A;  2UUB T;  3UUL A;  5LBQ B;  2X9X A;  2WDQ A;  2WWU A;  1J1J A;  4IIJ E;  1SHZ C;  2X0H A;  4KBM B;  1B7T A;  4NUU A;  3ANW A;  2FBW A;  2BKN A;  3UUX B;  4P1N A;  1I6Z A;  3PUS A;  4JI0 T;  1UX5 A;  3ABV A;  2XAQ B;  4DMW A;  5AQI B;  2LT3 A;  1T72 A;  1UX4 A;  4JI3 T;  3Q5X A;  3JC6 C;  2EHO B;  3AE7 A;  3UQ4 A;  3UUN A;  4IHJ E;  2JIW A;  4KHP T;  3D0T A;  1UGO A;  5H6Q B;  2FJA A;  5AQK B;  4GKJ T;  3UT5 E;  1W9R A;  2KMF A;  1HTJ F;  2KWH A;  3NRX A;  4ADZ A;  3AVS A;  3KBT A;  4X65 T;  1E2A A;  5AQJ B;  4DR6 T;  3CX7 B;  3TLU A;  2CXL A;  5HXR A;  5L3F B;  5AQO B;  4L5G A;  4YHJ A;  1N36 T;  1MMD A;  3CKD A;  3HA4 A;  5KMG P;  4H9S E;  4CI3 B;  2MPK A;  4BJM A;  2LHR A;  4IE6 A;  3O9X A;  5FVK A;  3RLF F;  2Z6E A;  2E5L T;  2VAS A;  1OWA A;  2AE9 A;  4ZI7 E;  3CX6 B;  3J7Y q;  3N2K E;  2XQ7 A;  2I0M A;  3Q5W A;  1IAP A;  5HWY A;  4JI6 T;  5LG4 A;  3VR9 A;  4DR3 T;  4H9P C;  4MLK A;  1BR0 A;  1KNZ A;  3AE5 A;  1BR4 A;  1HS7 A;  2I59 A;  2UU9 T;  1L0V A;  4ISS A;  3PV0 F;  4U7I A;  3UUB A;  4TWF A;  3ZMZ B;  3CML A;  3FXE B;  2YU2 A;  2CEA A;  2LEH A;  3AXJ A;  2K24 A;  2EHO C;  2YIN A;  2VKO A;  2LSJ A;  4YSY A;  3Q2M A;  2NW7 A;  3O1H A;  1MMG A;  3N9M A;  3LK3 B;  4UVB B;  5ETW A;  2OA5 A;  3DJB A;  4AKL A;  3N2O A;  3RI5 A;  3GN5 A;  3AED A;  1O3X A;  3PUZ F;  3J9X 1;  3LBX B;  1WCR A;  1J5W A;  4IDZ A;  2FJB A;  2PJQ A;  2QGS A;  4ASK A;  3UU4 A;  3UFG A;  4JEU B;  2D9D A;  2E2A A;  3TLT A;  4EEB A;  2HPL A;  5AQS B;  3SFD A;  2LLY A;  2DL1 A;  2XTL A;  4WBO A;  2VKJ A;  5FKY A;  2HPJ A;  4KHZ F;  4F8H A;  2OV9 A;  4UIG A;  4ZZC A;  3ZKR A;  3ZST A;  3EAM A;  2WQY A;  2PFV A;  2BG9 C;  1ZOY A;  2CWY A;  3LBX A;  3ZC0 A;  2UUC T;  5JDM A;  3HKC E;  3P4R A;  3AAE B;  4OFZ A;  5FXV A;  4I4T E;  4U31 A;  4O4I E;  5HXE A;  5IWA T;  3C4X A;  4OYJ A;  4EB6 E;  2CRB A;  3PUX F;  1OED B;  3F57 A;  5FXZ A;  2JJ9 A;  2X0L B;  2V5D A;  1N33 T;  3Q5E A;  2CMR A;  4EGW A;  5J1G A;  3V5U A;  5J2T E;  4TX5 A;  4H63 H;  3BQK A;  4YLH A;  4UVC B;  3G06 A;  1ZV4 X;  4AQY T;  3RIU A;  4H9O C;  2V6Y B;  5L4E A;  2IUB A;  2XHE B;  3ZC1 A;  2BS4 A;  1FIO A;  2H7V C;  5LJM A;  1QUU A;  4DBQ A;  3EDU A;  4Z8X A;  3GA8 A;  5AFU L;  4LMJ A;  4GOU A;  1US7 B;  2XQY A;  4X66 T;  1IJ5 A;  5LJN A;  1VRB A;  1Y01 A;  4AIS A;  2X9W A;  1D0Z A;  1IZN B;  4TN7 B;  4GK0 E;  2ZM2 A;  5FL0 A;  3FBZ A;  5GON E;  5DAB A;  2ZM6 T;  4ILU A;  3RRW A;  3ETV A;  1HG2 A;  4TNW A;  1M62 A;  2WU2 A;  3RKO A;  2H3R A;  5LXT E;  4IDN A;  1NAF A;  5LBM A;  3C50 A;  3I0O A;  4PNI A;  2XQA A;  3BK9 A;  2H89 A;  5LHG B;  3CVR A;  4X1K E;  1OED C;  2V7M A;  2YEV C;  5L3G B;  3KV4 A;  3AE1 A;  4HEA A;  3K3O A;  4P09 A;  3ZT5 A;  3I9Y A;  5LCY A;  3U78 A;  3RYF E;  5F8P A;  2WBL A;  3RRC A;  2NTX A;  3UUM A;  1GQE A;  3ZLI A;  2UXB T;  1WRD A;  5EZY E;  4IT4 A;  3RX6 A;  3KVA A;  4WNK A;  4ZI2 C;  4YTP A;  2LJL A;  5J2U E;  1YW0 A;  1T7S A;  1NEN A;  2IW5 B;  2LOS A;  2PBI A;  2WDV A;  3N5L A;  3PUQ A;  3N9L A;  2UXX B;  2V7K A;  2LSI A;  3V5S A;  1MIV A;  3AE9 A;  5HEU A;  2LRK A;  2YOE A;  3I9W A;  2PG8 A;  5AQT B;  3CQC B;  2DWG A;  2ZMA A;  4OHF A;  3B13 A;  4O4L E;  2XQ3 A;  2NR4 A;  5JRE A;  4O8S A;  5AQQ B;  3ZJ1 A;  1OED E;  3JC6 D;  2CHO A;  3IHR A;  5IHY A;  3U3I A;  2IML A;  2NW8 A;  4YXD A;  3ZMV B;  1IBK T;  3JAF A;  1HX1 B;  3FXD B;  2X9Y A;  3NZP A;  4QH5 A;  2UXD T;  2XAH B;  4A97 A;  2DCF A;  4ZEY A;  2DNX A;  2ZM8 A;  3IBP A;  4MBQ A;  2FJE A;  3ZPO A;  4CN6 A;  2XPK A;  4M1P A;  3K3N A;  2WU5 A;  4IDP A;  4EYY R;  2LSG A;  1KK7 A;  4DV1 T;  3FZK B;  5BR8 T;  1XDO A;  2BVL A;  3H3A A;  3C4Z A;  5JDF A;  2VK9 A;  4JV5 T;  3HKD E;  3QNU A;  3RH3 A;  4JI1 T;  5C8Y E;  1T98 A;  4MFR A;  4COF A;  5FL1 A;  1YD8 G;  1NWM X;  4JI2 T;  2C5K T;  2IC9 A;  3FZF B;  1Y64 B;  3PUG A;  4O4H E;  4O2A E;  4IRE A;  4U2Y A;  4DMV A;  3B57 A;  4HTE A;  3OYZ A;  1WYC A;  4V1A v;  2XAG B;  3N9Q A;  3AE4 A;  4QX7 B;  4EAH A;  5L3C B;  4UR9 A;  1UCU A;  3PUR A;  1XMQ T;  3AAI A;  3ZN0 B;  4K0U A;  2IHR 1;  2WMN A;  3LK2 B;  3PU8 A;  3UTK A;  4JI8 T;  5FXW A;  3ZYL A;  4UEL A;  4UEM A;  2N1G A;  3FB2 A;  4HKA A;  4GYS A;  4OX9 T;  3UFE A;  2VQE T;  3R84 B;  4U74 A;  4C91 A;  2JQ9 A;  4DR1 T;  4I0U A;  2C5J A;  3P50 A;  2V7I A;  4PK6 A;  3I1A A;  2V1D B;  1VCT A;  2SPC A;  4IDO A;  2JRK A;  2LKH A;  2WZI A;  1LKX A;  1FMV A;  4TWH A;  1D1B A;  2CM0 A;  2CHN A;  4DV6 T;  4DND A;  4KUM B;  5HAX A;  2KSR A;  5JRC B; 
#chains in the Genus database with same CATH homology
 4YY3 T;  4GKJ T;  2UXC T;  4LF4 T;  4AQY T;  5LMU T;  4JI2 T;  4DR5 T;  4B3S T;  2HHH T;  4X65 T;  4LF9 T;  4GKK T;  4DR6 T;  1J5E T;  4JI5 T;  4DUY T;  4LF8 T;  1HNZ T;  4DUZ T;  1HNW T;  1N36 T;  4X66 T;  4DV4 T;  4LFA T;  4B3T T;  1N32 T;  2F4V T;  1XMQ T;  1I94 T;  3OTO T;  4NXM T;  4LF7 T;  4JI8 T;  5LMN T;  2E5L T;  4DV3 T;  2VQF T;  4DR2 T;  2ZM6 T;  4LFC T;  4JYA T;  4LF5 T;  4LFB T;  2UUB T;  1XNR T;  1XMO T;  1N34 T;  2UUC T;  2UUA T;  1IBK T;  4JI6 T;  1IBM T;  4DR3 T;  4X62 T;  4OX9 T;  1XNQ T;  4YHH T;  4LF6 T;  2UU9 T;  2VQE T;  2UXD T;  4B3M T;  5IWA T;  1HNX T;  1FJG T;  4DR1 T;  4X64 T;  4DV0 T;  4JI0 T;  1IBL T;  4DV1 T;  5BR8 T;  4DV7 T;  4JI3 T;  4DR4 T;  4K0K T;  4DV5 T;  4JI7 T;  4DV2 T;  1N33 T;  4JI4 T;  3T1Y T;  4NXN T;  3T1H T;  1HR0 T;  4B3R T;  4KHP T;  4JV5 T;  4DV6 T;  2UXB T;  4DR7 T;  4JI1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...