2W61A

Saccharomyces cerevisiae gas2p apostructure (e176q mutant)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
480
structure length
470
Chain Sequence
GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Glycoprotein
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 164
structure length 470
sequence length 480
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w61A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w61A01
3ZT5A 4UFHA 3WUGA 4GQRA 1E5NA 3IJ9A 2J7CA 2J74A 3J7HA 2UY5A 3MUIA 2YDSA 3NDYA 4UQAA 3W37A 1H5VA 3VM5A 3VILA 3AYSA 2GK1A 4GKLA 3T0DA 4B9YA 2ZUMA 1MYRA 2WNWA 1XSIA 5ABFA 4HZ7A 3WF3A 1OIFA 5A6MA 1XH0A 5M3WA 5A6AA 5BXRA 1WO2A 1DWJM 3K8KA 5KEZA 4CU8A 5ECUA 4JL2A 5LA1A 2WVSA 4HA4A 1JDAA 1V0KA 5AC4A 4MNKA 2WHJA 3VX1A 1EXPA 4FK9A 5A2AA 3AROA 1B9ZA 4UOZA 2JEQA 4CCCA 2J62A 2WSKA 1EH9A 1ODZA 4FLQA 3MV01 1FA2A 5CQ1A 1F4AA 3PHAA 3OLIA 1WDQA 2YLLA 1UQZA 1FH7A 1KXHA 1FP8A 2DSVA 3QHNA 1M04A 3WUBA 4AC1X 1O7AA 3WUEA 3AZSA 3HU7A 3LPGA 4KH2A 1BYAA 1VF8A 5E9AA 4GO9A 2ZUTA 4AIEA 1K9TA 3A3HA 4TVDA 5E0CA 2J79A 2C0HA 1UD4A 1US2A 5A8OA 1E3XA 4IPNB 1ZBWA 5IXEA 4OIFA 5CGMA 2VX4A 3AIBA 4AZGA 3BGAA 1XSKA 1PX4A 1EOKA 1UD5A 1BG9A 3CO4A 4PN2A 3TP4A 1MXDA 4U5KA 1NWSA 2JF6A 3WBAA 1K9EA 4Q7NA 2WMKA 1BYDA 2JEPA 2F2HA 4S3JA 4F79A 1JFHA 5ABHA 1R87A 4P7RA 1C93A 3OG2A 4M29A 3NYDA 3SUVA 1PX8A 2DPEA 4AD3A 2CCRA 1RP9A 1BVNP 2VX5A 2A3HA 3VGFA 3OA5A 1CGXA 3VGHA 2WXDM 1HX0A 2AAAA 1ECEA 2VX6A 1H3GA 1KQYA 3B9DA 3B9AA 2DSWA 1J0JA 4HA3A 1VFFA 3WH8A 5I23A 2GJXA 4OKDA 4TTGA 2VR4A 2FGZA 3CHDA 1C8XA 3SCOA 4PCSA 4GXPA 4JFUA 3WIJA 2WC7A 4PTMA 3W28A 1J0ZA 3K8MA 1W3HA 3RM9A 3VOCA 1A47A 4W7VA 2UWFA 2DSUA 1GPFA 4HOZA 3VD3A 1HJQA 1V03A 3GH4A 1QI2A 2WMJA 4D71A 7TAAA 1YHTA 2Y24A 3W6MA 3W82A 1H1NA 2FH6A 4WLCA 4W89A 2XJ7A 2PWFA 4IISA 2WZEA 3KEHA 2DSZA 3U5UA 2V3EA 3ZSSA 1H4PA 3FAXA 2WVVB 5A6JA 1DWHM 3L4TA 4DUVA 1CGYA 2GDUA 4AZCA 1E6QM 2YJQA 1KBBA 1W1TA 4HU0A 3T09A 2XVLA 1LLOA 4M8UA 2YA2A 1WZAA 3SEPA 5A2CA 1JZ4A 2MANA 1E3ZA 2WCSA 4U2ZA 1E6XM 1JDCA 1IV8A 5DMYA 3AMKA 5BXPA 1JF5A 3RPMA 4XZBA 3AHTA 1HJSA 3GXFA 1HJXA 1UWTA 3VKKA 4GINA 3ZOAA 4W86A 2XWDA 2AMGA 4PTVA 4IUGA 1ZL1A 1E6PA 1B1YA 2PC8A 3LPOA 1Q6FA 1UKPA 4WF7A 4AD1A 5FOOA 4JFVA 1GZJA 1EO5A 1W9UA 5EFDA 2TAAA 4Z2JA 2GFTA 3WQWA 1W9VA 2YKKA 1HJVA 1L0PA 1JAKA 1FH9A 2CKRA 5EFFA 1CLXA 4DWSB 3F5LA 4UFLA 1HKJA 3GXDA 5HBFA 4PMVA 4D6FA 1FHLA 1VENA 4R5EA 1Q6DA 1UQYA 4NSBA 2YDRA 1DHKA 3WDRA 3AZTA 2D3LA 3BCFA 9CGTA 1OB0A 4BF7A 4HOWA 2W4XA 5HDRA 1UR1A 2XYLA 3AIEA 5CGTA 1EHNA 3WFLA 2WVUA 3CHCA 1J10A 1N82A 3ZM8A 1UD6A 4W8AA 3VINA 3UR8A 1QNPA 1QHPA 3UG4A 3WDQA 2FH8A 2PWDA 2BY1A 2ZWYA 1E6RA 4F9JA 4UFIA 6A3HA 3ZQ9A 3SUUA 4PBGA 1PAMA 2WPGA 4W88A 4KRTA 1E4IA 2EJ1A 3B8SA 1B2YA 3OLGA 3CGTA 4FF5A 1TA3A 1X6LA 1DWAM 2BS9A 1XHGA 3CMGA 4W8BA 2VUYA 4BZYA 1DEDA 3UETA 3CH9A 1NOFA 1NH6A 3ZMRA 2WZIA 4GI8A 4ZXLA 2JIEA 4PUEA 3UERA 2VR5A 3T2OA 1HNYA 3WD0A 1GQKA 3I3EA 3MKKA 4AMCA 4MB5A 1Q6CA 4HA1A 2CBUA 2GK1B 2BVYA 4W85A 4PEEA 4N0RA 3CHEA 2ZUNA 1JXJA 2YA1A 3BAXA 4F8XA 1VJZA 1E73M 1H49A 5DEZA 1ODUA 4TVUA 1CPUA 3CZ8A 2BY0A 4MDPA 4AIOA 3B9EA 1QBBA 3SCVA 2F8QA 4TX6A 3GTNA 3FHQA 3CHFA 4F9DA 1UWSA 1W32A 3TTOA 3M6DA 4U31A 2X09A 5HOSA 1EIBA 3U7BA 2XTKA 5F7UA 3KL0A 3CZKA 3LMYA 2VZUA 3ALFA 4X0NA 1E4LA 3AIUA 3SCTA 4HPHA 2YLAA 3MSGA 4CD7A 5D4YA 3QR3A 1V3MA 4LYQA 1C92A 3IANA 3PBGA 1UKOA 3NJ3A 1UR9A 1WZKA 2NT1A 3WMCA 4WSJA 2VRJA 3F4VA 2WVVA 3WFZA 1J01A 4Z2HA 2XWEA 1BSIA 5D9PA 1W3LA 2BXZA 1VAHA 1J12A 2WC3A 3N18A 4P8VA 3BLKA 2XVKA 2NW0A 3T2QA 3K1DA 4K68A 1V08A 2CESA 1KGUA 1MQPA 1DP0A 5BROA 1V6WA 3N11A 5FL0A 4RE3A 2E40A 2YL9A 3FHAA 1G01A 4AEEA 5A6BD 4GZEA 5DT7A 1G94A 2WWDA 1M01A 3WL0A 3HMCA 1VIWA 3WH7A 2CKSA 2PI6A 2W92A 3PZQA 2BFGA 1KXQA 2O9OA 1B30A 4NI3A 2ZUVA 5CPSA 4AZ5A 1OD8A 5FD0A 4PMDA 1OINA 1OGSA 1TR1A 2ZXQA 5HPOA 3VMNA 1VEMA 3MUY1 3AS0A 3BAKA 3MSDA 2VCAA 3TTQA 1XC6A 3AS3A 1TE1A 1UG6A 2O92A 4PMOA 3WDIA 2BVTA 5TD4A 3ARUA 1I1WA 2J7HA 2GJRA 4W5ZA 3AS1A 3WNMA 1CGUA 3ZIZA 4DWSA 3NCOA 4RE2A 5BRQA 1JZ5A 1CXHA 2DT0A 4H04A 4OOUA 4PMQA 4MADA 1HP5A 4HMEA 1E43A 4HMCA 2VOTA 3N17A 3W53A 5E09A 2B31A 2ZUWA 4U5IA 1JXKA 5A8PA 1PZ2A 1NP0A 3NSXA 4W84A 2J8FA 1J11A 1B3WA 5I24A 1C90A 1V6VA 1QI5A 5BYWA 3QHMA 2G3IA 1GOWA 2VTFA 1CGVA 5A69A 1UA7A 1DTUA 3AYRA 4PMYA 1PEZA 1BFNA 3U7VA 5M17A 1J0IA 5A3HA 4MB3A 4AY1A 5IHSA 3PTKA 4MB1A 5FL1A 1PBGA 4D6CA 1ISXA 4AD4A 1CGWA 2G4FA 1H41A 1GJUA 1BGAA 1D7FA 4E8CA 3ARRA 2ZX5A 4AZCB 1R85A 3EDDA 3EMZA 1NP2A 2WWCA 2VO5A 1LF1A 4P8UA 1B3ZA 2Q8XA 1JDDA 1CDGA 1XSJA 4AXNA 1JD7A 5EBAA 1W1VA 2D0FA 3N9KA 4CU6A 1O6IA 2CHOA 2BXYA 2XVPA 1AVAA 1NM9A 3BC9A 4W8LA 3ARSA 3DHUA 3ECQA 1XGZA 2X0HA 4CN1A 4J27A 3WEZA 1EQPA 1RD6A 2ZWZA 2FHBA 3RO8A 2QHAA 3IJ8A 3M46A 5I78A 1XH1A 2EXOA 2OSYA 3EMQA 1V0LA 2VI0A 1HP4A 3MO4A 1UR0A 3CUFA 2OYMA 1BHGA 3FAWA 1V3KA 2PF0A 2WM0A 4P8XA 4Z2KA 1GOKA 1OT1A 4LPCA 1JYWA 1E4NA 3NUKA 3WENA 2XIIA 3PZTA 2WHLA 1JL8A 4L4OA 1W9XA 1RH9A 1VFUA 1E56A 1UH4A 1R7AA 4W87A 1GQLA 4PTWA 4UQDA 3BXWA 3A4WA 4UFJA 4UFMA 3RILA 4GQQA 4PMRA 1Q4NX 2WKLA 5KZ6A 3SIMA 3W4RA 4H2CA 2EPLX 1CENA 1ZBKA 2D0HA 1R7OA 4S3KA 1VEPA 5CJ5A 4PSPA 4D6HA 3AISA 4MJ2A 4UR9A 4M80A 4TVCA 1J9YA 2JFEX 2EO7A 3JUGA 1JZ3A 3DC0A 1IT0A 2JE8A 4EAMA 1V02E 3OIHA 2VZVA 3HN3A 2GSJA 3I3DA 3AMGA 2OYKA 2OWWA 2FGLA 1WDPA 2XHYA 3L4WA 2WMFA 3T2PA 3DYMA 3SCWA 3AXIA 4AD0A 1QPKA 4TTUA 2O9TA 2VC9A 1V3IA 3CIVA 1M53A 3RIKA 1TA3B 1LL7A 2OWCA 2GDVA 2A3BA 3ZJ7A 1BF2A 3CUGA 3WEOA 2J77A 3DYOA 2OYLA 5D8ZA 4WSKA 1CIUA 3WD4A 4FLRA 4ZE4A 1FFRA 2E3ZA 3BAYA 1HF6A 3VDCA 4UQCA 3TTYA 2WMIA 1IZJA 2A3CA 2C8NA 2YL8A 3ZJKA 1KXVA 1NARA 1E72M 5CG0A 3AHZA 2YL6A 2VRKA 1E70M 1W91A 3MANA 4J28A 3OLDA 3W81A 1E9LA 3G6LA 2V3DA 3D5HA 4TUFA 1JI2A 1MQQA 1CYGA 4W7WA 5JBDA 1CXKA 1NOWA 4U33A 1H11A 1WZMA 3WH9A 2W5FA 1MWOA 4AYSA 2WANA 3ZO9A 1B90A 1LQ0A 2WCGA 4IM4A 3WD3A 3PTMA 1GORA 5GQBA 1DWIM 4CVWA 1EO7A 3O9NA 2XUCA 1JD9A 1ZBCA 2QMKA 1TZ7A 1GOOA 1RP8A 4JFTA 4PYSA 4ACZB 2XIBA 2VX7A 4D1JA 1G9HA 2QV4A 2ZX9A 3VIFA 3VDBA 2CEQA 2ZX7A 4AEFA 4OZOA 4JCLA 4HOXA 3L4XA 1SYTA 5DFAA 4UZUA 2Y2WA 3WD2A 1ESWA 4JL1A 3L4YA 4GIAA 2CYGA 1W3KA 2CBIA 3ZSTA 1JF6A 1W9BM 2CHNA 4UZSA 1E5JA 4C7GA 5A2BA 4B3KA 3GXIA 1W9PA 4GI9A 1E0XA 3BLPX 1WZLA 3D3AA 1WP6A 4KRUA 4LQ1A 1C7SA 3K4DA 2QF8A 3VIJA 1D3CA 4CD8A 4H8VA 4BQ4A 1PZ3A 5D9NA 3RM4A 1JZ7A 5A95A 4JAWA 3SUWA 5IFTA 1GCYA 1XH2A 5D8WA 1VB9A 4B3LA 3KL5A 1B0IA 4LYPA 2WYSA 1CEOA 4TX8A 2DGAA 1KBKA 3EDKA 1OM0A 1MFVA 2WMHA 3U5YA 4ATLA 1PPIA 4BA0A 4J3WA 1UUQA 2NT0A 3RCNA 2ZIDA 1C91A 3AMDA 2HVMA 4HP5A 2UY2A 2WZHA 5IDIA 3EDEA 4AZIA 2OWXA 1F4HA 3L4VA 1C3FA 3WQ4A 4V28A 5GNZA 1Y7VA 1WAWA 1PIFA 1QW8A 3OGVA 4LXFA 1J0HA 1EDQA 2EEXA 2CBVA 3IK2A 3VU2A 3VMPA 2JALA 2BY2A 4BS0A 1XCXA 1J0YA 4XX6A 1D2KA 4GZJA 3AIQA 4X0VA 1C8QA 3AXHA 4YHGA 2V38A 1TVPA 3ARVA 3UG5A 4QLJA 1BGGA 1AQHA 3II1A 1BTCA 2WBGA 3SCQA 1FOBA 2YIHA 2X8RA 2ZICA 2WCAA 2XVNA 3NSNA 1S46A 1TG7A 1E0VA 1UYQA 3GXMA 5M5DA 4GZIA 1CLVA 4ZE5A 2FHCA 2BHYA 4D72A 4XB3A 2E9MA 3MU7A 5JIWA 5LA2A 3W29A 3BAIA 5E6YA 4D1IA 4PCTA 3RM8A 4NZCA 1K9FA 3N1AA 3O2LA 1G5AA 2D3NA 1NWTA 4DM1A 4CD6A 4AD2A 5FCZA 3POCA 4EKJA 3GBEA 4J3XA 3VNZA 3UESA 3WN6A 2EPMX 1ITCA 3WY1A 1E55A 3GH7A 2IUZA 3ALGA 1QVBA 5BCAA 1CGTA 4KGLA 2WKGA 3I3BA 5E6ZA 1R86A 3OGRA 4XUYA 2ZXAA 1ZJBA 2JIWA 4YPJA 2BHZA 5C71A 2PWEA 2V5DA 3MS8A 4AZ7A 1GQJA 2VURA 3T0BA 3QHOA 4L4PA 4JFSA 1H2JA 2ESCA 2WK2A 3IJ7A 5CLTA 5A6KA 3AICA 2DEPA 2VL4A 3VDHA 3BAWA 3FY1A 4A3YA 4QFUA 4DM2A 3BCDA 5D9MA 1QHOA 1PJ9A 3W0KA 3PZUA 3ZR6A 1KWGA 3W27A 4H8UA 3O6AA 1LWHA 1AQ0A 4CKQA 1MW0A 4EK7A 3F5KA 4CUCA 1ISYA 2UY3A 2HISA 3KL3A 1GQIA 1QI3A 2J7GA 3MMWA 1G1YA 3A6OA 1HIZA 4ACZA 2PWHA 1JGIA 5AYIA 1GNXA 1BAGA 5DT5A 4MJ4A 5BXSA 1NWUA 2GUYA 4LX4A 4IPLA 3UEQA 3W24A 2RGLA 5HNNA 3QGVA 1YQ2A 4J3UA 2VVNA 1B3VA 3WQ5A 2J47A 1HT6A 2XFRA 3VIPA 1XRVA 2IXVA 5CSUA 4D6IA 3VMOA 4V2XA 4MPKA 1BG4A 3K46A 3M07A 1UD3A 5GNXA 3BSGA 4MNMA 3K8LA 4EANA 3AMLA 2JF7A 2C7FA 3BAJA 3VNYA 3KWXA 3THCA 1EA9C 1K9DA 1WKYA 3AQUA 2GJPA 3GNRA 3VD9A 1HKIA 4DUWA 1JIBA 1E40A 3RMEA 3VPLA 1HN1A 3MMDA 1H0IA 3S2CA 2BY3A 1WB0A 2D20A 2J78A 2WMIB 1V0NA 3ARQA 2DIEA 1HJUA 2E0PA 2J7EA 1CXLA 1J0KA 2XG9A 3APGA 3AZRA 1ISWA 2J25A 1UOKA 1B3YA 2CPUA 5DF0A 1OWQA 1GONA 1E0WA 4Q22A 4AIUA 1QBAA 4KMQA 1W3JA 1PIGA 2E4TA 5I79A 5I5RA 1BVZA 3NIYA 1V6YA 1EDTA 1RPKA 4BCEA 3WDJA 1JNEA 2CETA 1UKTA 1JFXA 2VMFA 2XPKA 4ZENA 1V6XA 2RGMA 1MVYA 1CXEA 4QLLA 1KGXA 4QDMA 2CXGA 2VRQA 3ZJ6A 3WNPA 1C8YA 2WLYA 4J7RA 3AOFA 4U3CA 1JZ2A 2W61A 4HU8A 2V5CA 3CLWA 5IHRA 4P7LA 3VM7A 2A3AA 1E1EA 3CZGA 4XZWA 2Y8KA 1CXIA 1L8NA 1GVYA 3GYCA 2FHFA 3GZAA 1XD0A 3RDKA 3SCNA 1KFWA 1UH3A 3AJ7A 3FW6A 4UOQA 3U57A 5BWFA 1JI1A 3VX0A 1QW9A 1KR0A 4HTYA 3LPFA 1OGGA 4M56A 3OLEA 5BRPA 2VCCA 4MTVA 1QNRA 4JZ5A 3FN9A 1OGBA 1NWRA 1U2YA 3BMVA 1BYCA 3WQ8A 3CZEA 3WD1A 5FKYA 1UR4A 5CLWA 1W2VA 2X05A 2J75A 1EDGA 2J7BA 2J4GA 3KZSA 4JKMA 5C70A 4X9YA 2ZX8A 4ML4A 2GVYA 1HL9A 1VRXA 4H41A 5CPQA 3DYPA 4TOQA 4WKFA 2DT3A 1I1XA 2D0GA 2IXUA 1Z32X 3WSUA 3LPPA 3L4ZA 1U33A 2X1IA 5JBEA 4UQ9A 3AXXA 1X1NA 3AHYA 3EBVA 1VJSA 3IAPA 1V02A 1GW1A 5ABEA 2EPOA 2E8ZA 4ZFMA 5E0FA 2V3FA 1UH2A 1OT2A 3ARZA 4PMUA 4QCFA 1LWJA 2ZXBA 3VTRA 5JUVA 2O9PA 2DDXA 2J7DA 1ISZA 5CXPA 4AZHA 2YBUA 3MV11 1AQMA 5IFPA 1JAEA 1QNQA 4B15A 3CBWA 7A3HA 1SMDA 2W91A 2WMGA 3ZR5A 3WNLA 4V27A 3AI0A 3AHVA 2VZSA 5BXTA 5A8NA 3ARPA 4CD5A 1EQCA 1E6SM 3QOKA 4LYRA 4NRRA 3F5JA 7CGTA 2PBOA 2QLYA 1UR8A 3OGSA 3WNKA 1UKSA 3VD7A 2D23A 4DUXA 4AW7A 1V0MA 4JKLA 4LGXA 2XVGA 4JFWA 4HMDA 1VFOA 1JYVA 3PTQA 3BMWA 4UOJA 2EPNA 2XM2A 5ABGA 4D6GA 3WMSA 1NQ6A 1US3A 1MW1A 2Z1KA 3GM8A 3N13A 1WE5A 1G0CA 4U2YA 2OSWA 1CZ1A 3VIKA 2BHUA 3DECA 4DWSD 5HPCA 4JIEA 4CGTA 3WH6A 4GO8A 1JZ8A 4UQBA 1UKQA 2XSAA 4WK9A 2DT1A 1HVQA 2X0YA 4J3VA 2FDMA 2YA0A 4WJXA 4H7VA 4AZ6A 3WEMA 3EYPA 3EDJA 5GNYA 2WLZA 2CIPA 1V3JA 5LA0A 4MDOA 5LYRA 2WHMA 1QHZA 2XGBA 1ITXA 3L4UA 3NSMA 3G6MA 4OBSA 3ARXA 1X6NA 3EMCA 2EPKX 3CUJA 4FLSA 2W66A 3ZT7A 3RJXA 1OIMA 1BQCA 1QI0A 1JYXA 1KCLA 2WVTA 1JG9A 1V3HA 5DO8A 1MW2A 1MXGA 1ZBVA 2CERA 4NRSA 4QCEA 3ARWA 1FHDA 5I3DA 1B3XA 5HXMA 3T08A 2QMJA 5EMYA 3PZVA 3POHA 4F66A 1EOMA 1GOIA 1E6NA 4M1RA 3W26A 1BLIA 1UWIA 1HKMA 3BH4A 1J18A 1LJYA 2E8YA 4PMNA 2XM1A 1W1PA 2DSKA 4D6DA 2G8ZA 2D1ZA 1VFMA 2DIJA 3S6TA 1GVIA 4P8WA 1XCWA 3TA9A 2Y8VA 2ZX6A 1CXFA 5A8QA 3SCUA 3UCQA 4YN5A 4MB4A 4QP0A 3SUSA 5M03A 3WELA 3IAQA 2ZUSA 1WDSA 1UWQA 3TONA 4JCMA 3CUIA 1QNSA 2G41A 3GH5A 3GNOA 2BVDA 4PRWA 2WBKA 4W93A 5I6SA 1I75A 4JHOA 5A8MA 3FXYA 4TXEA 1SFSA 4RL3A 1UWRA 2PBGA 4JHZA 1GJWA 1E71M 5JIPA 1FFQA 2XFYA 4Z2GA 1Q6GA 3N04A 1TFVA 1KR1A 3WNNA 1KQZA 3NDZA 1H09A 4NF7A 2WAGA 3OBAA 2A3EA 1C7TA 4UFKA 2E9BA 4B9ZA 5A6BA 4CCDA 1LG2A 3CMJA 1B31A 3W25A 4A4AA 1UA3A 2VNCA 3PZ9A 4A3HA 3K4AA 4UNIA 4EE9A 1JZ6A 5E70A 3VO0A 3WF2A 4ATDA 3GBDA 4U3AA 1CECA 1WCGA 4C7FA 4MAZA 1V3LA 1ZS2A 2CBJA 4ACYA 2WSPA 1JYNA 4P7NA 4ATWA 4J3TA 2VZTA 3VDAA 3VGDA 1GUVA 1KCKA 1HJWA 4P7OA 1LL4A 3SCRA 3OB8A 4QLKA 2QPSA 1WNOA 1K6AA 1E6ZA 3FNDA 1TUXA 3VIGA 2CITA 3MUZ1 2VZOA 4BQ2A 1HL8A 3A4AA 2DH2A 4D6JA 2DH3A 3CPUA 1KB3A 1VBUA 2Y5EA 3VD4A 3WMBA 1U30A 5I77A 3WF1A 3SCPA 4PMZA 4R27A 1M03A 2XSBA 2G3NA 1CTNA 3WKZA 6TAAA 4Z2LA 4AWEA 2ZUUA 3N15A 2OLHA 4XV0A 1HXJA 5AY7A 3VUPA 2G3MA 3PZMA 1W1YA 2VQUA 1SMAA 5A1AA 1OBAA 1MW3A 4Z2IA 4DWSC 4PTXA 5A94A 3QOMA 3WDPP 2YOCA 1BPLB 4BQ3A 1VBRA 1CBGA 4MNLA 1BYBA 2ZOXA 4OOZA 3WL1A 3ARTA 1TVNA 4UCFA 1CNVA 3L2MA 1LL6A 4JKKA 2W62A 2PB1A 3PZOA 3VIOA 1EGZA 4FLOA 3WH5A 1MQRA 1ISVA 3A47A 1NOUA 5FIPA 4CU7A 1E4MM 1XV8A 4C7DA 1OD0A 1VEOA 2EBNA 3DHPA 4H8HA 5I0DA 5ABFB 2OSXA 3MUAA 2VT0A 4PMXA 3SURA 3BSHA 1SR0A 2F61A 3TOPA 4HZ8A 1UD8A 1DWGM 4CN6A 1OSEA 1XD1A 4GI6A 2WW5A 4PUDA 2X2YA 4E2OA 5AYBA 4CD4A 1EHAA 1JNDA 1TCMA 4M81A 2V3GA 4OBRA 1W9DM 3VIHA 4W5UA 2CNCA 8CGTA 4WKAA 5A6LA 2VCBA 5CPTA 3L2LA 3OZOA 2BNJA 4CN4A 1W2PA 5I2UA 1TMQA 1M7XA 2EQDA 3WNOA 1QNOA 1FP9A 4AISA 2ZXDA 1E1FA 4E8DA 2UY4A 4YHEA 3VD5A 3CUHA 4GPNA 1E15A 3WQVA 2O9RA 3GNPA 4ZXOA 4UQEA 4RE4A 3HJEA 3GDBA 5CZKA 3SCSA 1CWYA 1P6WA 3WBEA 1R8LA 2XGIA 3PZIA 3E1F1 4CVUA 1H0GA 2DT2A 2PWGA 2YBTA 3AHXA 4FMVA 1UD2A 2Y4SA 2Z1SA 3RJYA 1GOQA 3AIWA 3CZJA 2QPUA 3AS2A 3VGEA 3WF4A 1ZU8A 4M82A 4AZBA 4AD5A 1OCQA 1PX3A 4BQ5A 4PSRA 2WHKA 2YDQA 1UZ1A 3MMUA 1FH8A 3UG3A 2W67A 1V6UA 2WC4A 5JBFA 4J3SA 5GPRA 3VGGA 4ZEPA 2W63A 4OJYA 4B16A 1LG1A 2G3JA 3WF0A 1WPCA 3VIMA 3CTTA 5CSYA 3PZGA 4KGJA 3AFBA 2VQTA 1XYFA 2YL5A 3AMCA 2XFFA 3W6LA 3EDFA 3CZLA 3TTSA 5D9OA 3PN8A 3PZNA 1Q6EA 1UR2A 4WIWA 1UHVA 2D24A 2GJXB 3AIRA 1XYZA 2E9LA 5C8BB 4HPGA 2AOSA 1KGWA 3SUTA 1MFUA 4E4PA 3M7SA 4MNJA 5A6SA 5EB8A 4UTFA 4Y7EA 2D2OA 2VJXA 3WDHA 1AMYA 2D22A 4D6EA 4OUEA 4W7UA 2VVSA 4MAVA 4KWUA 3WUFA 3ARYA 3ZT6A 3KE0A 1GOMA 1IZKA 4CCEA 1KXTA 1GHRA 3A4XA 4N42A 3UR7A 2ZE0A 2WB5A 1GHSA 2J8GA 1HVXA 3VGBA 3ZJ8A 2DQXA 1KWKA 1DWFM 1QOXA 3VIIA 4M24A 3THDA 1WDRA 2J7FA 3VVGA 3T0AA 5AC5A 1UZ4A 4HZ6A 2BV9A 3AIVA 4URIA 2NSXA 4WKHA 1HKKA 1QI4A 1UWUA 3N12A 6CGTA 8A3HA 1A3HA 3OZPA 3WQ6A 1ZB5A 3W38A 4QAWA 1ZJAA 4P7QA
chains in the Genus database with same CATH superfamily
3ZT5A 3QH2A 3WMLA 3IJ9A 4A97A 1S2TA 1UW9A 2J7CA 3NL6A 3Q2DA 3MUIA 4DX3A 2E6DA 5JDQA 3FIGA 1EXBA 1OCNA 4GBDA 3VM5A 1T0OA 4MVAA 3M65A 1ZUAX 4DV3T 4PK5A 5IRPA 1IGWA 1K6WA 1MMDA 2VEMA 2VEKA 1E9IA 3RPDA 2QR6A 2V1DB 1HO4A 5BXRA 3TN6A 1FWIC 2PTXA 1A5UA 5CBBA 1JDAA 3WI3A 3TVAA 4DO0A 1RSCA 4GBUA 3VX1A 4KX6A 1EXPA 4UOZA 1S1RA 2JEQA 4CNUA 2J62A 2WSKA 4XVDA 5CQ1A 4O4IE 1QFEA 3C2YA 2TODA 1TV3A 1WDQA 1HO1A 3TLTA 1UQZA 2X7VA 2ZYFA 5FY0A 3H8AA 4TX5A 3KBJA 1DIKA 3KRSA 1FP8A 5REQA 4HWDA 3K2GA 2DQWA 1M04A 4JI8T 4QDPA 1YXYA 1O7AA 1OEDB 3A7MA 3HU7A 5DN1A 4KH2A 1F07A 4BJMA 1BYAA 1VF8A 5E9AA 1OHLA 1QWGA 4GO9A 3TN3A 4AWTA 2ZUTA 4AIEA 3M0LA 2P76A 3Q9DA 4IXXA 4PNIA 2RJGA 1US2A 3CQGB 4UC5A 2G5WA 1W5MA 3AIBA 4ZVJA 4H63V 1PX4A 3UZWA 3IGXA 2C18A 1Q66A 2JF6A 2XAJB 3OOQA 4XO7A 3KVAA 1K1DA 4NNBA 1JFHA 4WNKA 3B5MA 5ABHA 1R87A 5C2TA 5BMWA 3G2GA 3OG2A 4M29A 1R46A 4A35A 3NYDA 1PX8A 3PDYA 3JW7A 2DPEA 4EPDC 1BVNP 1GK8A 3OA5A 2R8WA 2Y0FA 4RR4A 1WKDA 2UU9T 4KEZA 1HX0A 1XIDA 1S5MA 1KQYA 2MYSA 1O5QA 3WH8A 5B80A 5T91A 4PK6A 3PP7A 3N2OA 2FGZA 3V5UA 3CHDA 2L8KA 3GC2A 3NDOA 3GIYA 4GXWA 1XYMA 3WIJA 3BQKA 2X9YA 3VKCA 3JRKA 3M0ZA 1JPMA 3W28A 2BGSA 3LHZA 3PUVF 1W3HA 5DCBA 3KVMA 1PHQA 3VD3A 1HJQA 3GH4A 4WDUA 1QI2A 4JYEA 5L3CB 1YHTA 5FSEC 4HSHA 3W6MA 4DYKA 4YFSA 4IISA 4PB3A 2MTQA 1OYCA 1FDJA 3SBFA 3MWAA 5FF0A 3COTA 3BOXA 1M7KA 3ZMVB 1K3UA 3R1ZA 4FP1A 2GWGA 1FWNA 3FJ4A 4IPPA 4U4MA 4IZGA 2YJQA 3I65A 1XYAA 1W1TA 3A5FA 1GJPA 1LLOA 3QV9A 4UV9B 3FS2A 3MUCA 3QJAA 4UTWC 5I3HA 5HYAA 5A2CA 1X8CA 4OQVA 1D0ZA 3CM4A 3ITLA 2D2GA 4HEAA 1JDCA 5DMYA 3P7IA 5BXPA 4U7IA 3PUGA 3DG7A 4XZBA 3RPMA 3V5CA 3KTXA 3AHTA 3G18A 4EB6E 5K2ZA 4LJ3A 3GXFA 1HJXA 2OU4A 3TLQA 3Q4DA 1XBZA 5IWAT 3UWVA 2NQJA 2XWDA 4LNYA 2PRLA 3R89A 3B0VC 2ZM8A 2LLEA 3M0JA 2Z2UA 2NQLA 4TNWA 4JFVA 5LNSA 4ZS3A 4IIDA 1W9VA 3CL7A 3DFHA 3T8LA 1HJVA 1CLXA 3KWSA 4DWSB 3F5LA 4D6FA 3JU2A 3NQ7A 2P1FA 3EWWA 2C16A 1UQYA 3EWCA 1Y65A 2YDRA 4X1YE 1KA9F 4LH8A 4JDYA 3BCFA 1QNVA 4J3ZA 5HDRA 2B0MA 2XYLA 1X96A 3AIEA 2QPXA 1OG0A 2WVUA 3PK7A 3HI2A 3BJTA 3UR8A 4K7YA 2RDUA 2BY1A 2ZWYA 2QJHA 2A72A 4UFIA 5JQ9A 6A3HA 1ZJIA 3ZQ9A 3A23A 4DJFD 4LBSA 1TB3A 4DXVA 1O3XA 3QGAC 3UUNA 1ZENA 4OUIA 5AFDA 4I9AA 1I45A 1LQAA 1PE1A 3LLFA 3CGTA 3DFTA 4LV9A 4Q4OA 1HQTA 4FF5A 1X6LA 2BS9A 1XHGA 3CHVA 5BMXA 2BB0A 2P5NA 3S8HA 1NOFA 1S5VA 4AKLA 1NH6A 2X9XA 3ZMRA 2WZIA 4ZXLA 2JIEA 3UERA 3O1JA 4H9NC 3MBDA 5FSDC 1GQKA 3I3EA 3MKKA 1IBMT 2XQAA 4MB5A 4AMCA 3E5BA 4JTEA 5HJLA 2ZRWA 3USZA 3T55A 2CBUA 1HGWA 1XF0A 1Z7AA 1R6WA 2V69A 1GZ1A 4TIMA 1VKFA 1G4SA 4N0RA 3B8VA 3VOGA 2ZUNA 1JXJA 5BOOA 3ZVIA 3M0HA 2G97A 4UTWA 4B4HA 2I14A 4QE4A 3ANUA 1XRSA 4MDPA 2PCQA 4X62T 1QBBA 3SCVA 2F8QA 4C6QA 2OO6A 3ME3A 1YPFA 4F9DA 1UWSA 3T1YT 1W32A 3GW3A 5FNVE 4U31A 4DBQA 3GRIA 1FRBA 1PL9A 2VL0A 4DNDA 3QY6A 5HOSA 4YSXA 3U7BA 2OZTA 3CZKA 1J2WA 3LMYA 3KFTA 3W86A 3TCSA 1H7WA 4RW5A 1WKEA 2EG8A 3AIUA 3NPXA 4HPHA 4PRTA 3ZN0B 2GVEA 5D4YA 3JCFA 5AHIA 2A7PA 1Q5MA 4LVGA 4LYQA 4EPKA 2NT1A 3NQCA 4WSJA 2WVVA 2BMBA 3WFZA 4C65A 3T40A 1T40A 3NQ2A 5D9PA 2R94A 3H3AA 1W3LA 3VOFA 1HCIA 5LCYA 2BXZA 3N18A 2NVAA 2D73A 3QFWA 2XVKA 3AVSA 4K68A 1V08A 4IFKA 5AQOB 1DP0A 4EIVA 4I9MA 1RUSA 3VE7A 4RE3A 2RDTA 5LHGB 3FHAA 3T0CA 1MIWA 3R0UA 3V5FA 4CNSA 3R10A 1H51A 4MALA 3GU2A 4AQFC 1G94A 5EKYA 1M01A 3WL0A 2GJNA 2CKSA 1D1AA 4JTKA 3T8OA 3LU2A 1NF0A 2O9OA 1B30A 3EB2A 3NNTA 4HGXA 1ZHCA 5AHFA 2W79A 2PZNA 1V8EA 1A53A 1AD1A 4PMDA 1OINA 3N6QA 1EC7A 5KZDA 3AS0A 4LF7T 4YL2A 5AQTB 1KTBA 3AXMA 3G1FA 3VRBA 2VCAA 3P80A 1FIOA 5DMMA 1WR0A 1TE1A 3AYVA 2O92A 4PMOA 1JRCA 3K30A 4ZBCA 3T07A 5TD4A 2V6YA 1EF2A 5HA7A 3NQBA 3AS1A 3SOLA 3A9BA 2V82A 4C1NB 3T1GA 1N8FA 4OOUA 3Q45A 3BE7A 1HP5A 2V2DA 1DVJA 2PLCA 2VOTA 3N17A 1LLWA 4OFCA 5E09A 5K9DA 1AH3A 2B31A 5GJNA 4ZQPA 2OEKA 3U4AA 4PUKA 1PZ2A 2HV5A 4IIFA 3W7EA 1MZHA 2PDGA 4D9PA 4TV5A 2J8FA 4JEHB 4MWAC 5I24A 1L6WA 3K13A 3QHMA 2E25A 3UPWA 2HQAA 1P5BA 2IW5B 4NAFA 2X9HA 1B7TA 1G69A 3AYRA 1S2CA 1U5PA 1J0IA 4MB3A 4XZIA 5HINA 4AY1A 3PTKA 2DHRA 1BWLA 2ZKMX 4AD4A 1CGWA 3MHGA 2G4FA 4XAXB 2QIIA 1I2QA 4UTIA 3UA3A 4QAIA 4QDWA 3WAKA 1XYCA 3EDDA 1E0UA 2XFWA 4HU4A 1L2UA 2Q8XA 1JDDA 1R3TA 4NVTA 2VEGA 1TV2A 1XP3A 3SN1A 3F31A 3IUDA 4CU6A 5GJPA 1NM9A 3IV8A 2PP1A 4WZHA 3DHUA 3LY0A 2FJAA 3STEA 4J27A 2QUUA 1T5AA 3WEZA 5D33A 1EQPA 2A9UA 1OVDA 5LXEA 4CI3B 2FHBA 1YKHB 4BY3A 3UJ2A 4DEFA 4B3ZA 3UJFA 2OLAA 5J5DA 3M5XA 2WM0A 3AE2A 1E4NA 5H2ZA 3NUKA 4H7CA 3PZTA 3ABVA 1JL8A 3RC3A 2Y5SA 1Z8AA 3CQIA 3OYXA 3OVPA 3NQ8A 1R7AA 4PTWA 1LYXA 4UQDA 4GK8A 2LOSA 3CMFA 3ONJA 4WHBA 1WBHA 2Z2BA 2WS3A 4DJDC 5L2LA 1XFBA 3MKDA 2EPLX 5L47A 1XR2A 3RRXA 5CJ5A 1TWDA 4QS6A 4PSPA 5DBUA 4QWNB 3EX2A 1W09A 1IBLT 3U3IA 1TELA 1I6ZA 2QVHA 2GUBA 2NWSA 3WYZA 1IT0A 4DZIA 2EKGA 1V02E 1OCBA 2VZVA 3HN3A 1J5WA 2OYKA 2OWWA 4DHGA 4I43B 2XHYA 5BOEA 4LWWA 3DYMA 3SCWA 4AD0A 4IPJA 2O9TA 3FOKA 3GTFA 2VC9A 3E3HA 5I02A 5J04A 3FA4A 5FF7A 5HXCA 5DABA 2VASA 5BZAA 3RIKA 4MWAA 2NW7A 5D2WA 4MUPA 3IV3A 2XASB 3R11A 3H12A 1BWVA 2C5IT 1EZWA 2VKDA 5L4EA 3DYOA 2OYLA 5D8ZA 4F3HA 2ACSA 2Y7GA 3V0TA 2HBXA 3WD4A 1XLAA 1E1CA 1NWMX 2E3ZA 2YK0A 3T4CA 1IZJA 2A3CA 2MPKA 2YL8A 3ZJKA 5I06A 5AVNA 5JMUA 1X9BA 3AUJA 4RUBA 4C91A 1NARA 4TMBA 1ENUA 1Y5WA 2WSSV 2C13A 1H63A 5FI8A 3GNXA 1OCJA 2VRKA 4IE5A 3C61A 1E70M 4J28A 3G6LA 4Q8PA 1PVNA 4TUFA 1CYGA 5JBDA 3LGEA 5I00A 1NOWA 3W1AA 3TYCA 4N4QA 1MWOA 4AYSA 2WANA 4RXFA 4JXCA 5FJTA 4IM4A 3WD3A 3PTMA 4CVWA 1EO7A 1BR1A 3O9NA 1TZ7A 1RP8A 1XQKA 3S1UA 1SU5A 3RU6A 4R34A 1G9HA 2ABAA 1GKQA 3VDBA 4J1OA 2ZX7A 1LOQA 4OZOA 4Q8NA 3UWWA 4ZQNA 3GG7A 4TO8A 5EA9A 1BF6A 5DFAA 2V81A 4YTQA 4AIBA 1WOBA 2FKPA 4H9VA 3W2KA 5DX7A 2CYGA 3NQ6A 1F2JA 1YD8G 1W3KA 3JVAA 3EPNA 1G6CA 3LBXA 2YXXA 1W9BM 5HEJA 1VFSA 4B5VA 3LHTA 4QS5A 4B3KA 4IFKB 4Z08A 4DPPA 3I6RA 2X1UA 4DJDA 5KZEA 2I57A 3BLIA 4H3DA 4H8VA 4JV5T 5A95A 4JAWA 2QGSA 5D8WA 3IACA 1UURA 3BG3A 2HZGA 2RJHA 4C6OA 3IGSA 4O2BE 4LV4A 4OTKA 4P0AA 2WYSA 1CEOA 3W1UA 3PUSA 5AFUL 2FJEA 4HJWA 2DIKA 3RCNA 1C91A 4Y6GA 2WZHA 3U8GA 3ZLHA 2ISFA 4FXJA 4S2CA 4AZIA 3UZYA 3WQ4A 2GGEA 3VK5A 4NYUA 3KX6A 4Q6XA 2DL1A 2XSXA 4A2SA 3GHRA 2QA7A 1SUMB 3CT2A 3HKBE 4JTRA 3LX9A 3EOLA 3VU2A 2VFFA 1V7AA 1A5OC 7XIMA 1XRFA 3C3NA 3P2VA 4LAUA 1XLKA 3FLUA 4JI2T 1W5PA 4IE4A 4X0VA 1FCVA 3NO1A 2W6RA 2R14A 4H9YA 4YHGA 2VFIA 3ARVA 5JH2A 4I3GA 3CWNA 2I59A 4S3CA 3SCQA 2Y89A 2X8RA 3CEPA 1TV5A 4ZQRA 1DTNA 2BSLA 2ZICA 2JMHA 5AQJB 4O1CA 1S46A 3CV6A 1LZOA 1TG7A 1E0VA 1UYQA 4GY7A 2AL2A 5M5DA 4AVOA 3C3UA 1G8XA 2BHYA 4D72A 3KRUA 2DWKA 2E9MA 4PK4A 1DHPA 3M0KA 2PDUA 4Q6JA 3W29A 5C0QA 2PDLA 4PCTA 2VELA 1Z41A 3L09A 4WOZA 1UZHA 4I9JA 4DM1A 2QDGA 4JIQA 3EAMA 5DJQC 1WXYA 2DW6A 2Z1WA 3POCA 2BS4A 4TN7B 3C5QA 3WN6A 2EGZA 3EA2A 4FIQA 2EPMX 1R2SA 1E55A 3WY1A 3GH7A 2R9RA 3H4WA 3QN3A 4NYYA 2QIWA 3BICA 4KGLA 1D9EA 4IX2A 5E6ZA 1P7TB 4C5ZA 4XUYA 3CEUA 2Q02A 3T05A 1HX8A 5JDFA 4ASTA 2E5LT 1HTIA 2UXBT 2BHZA 3G1YA 2V5DA 1R3RA 4M6VA 1OC5A 4AZ7A 3PUDA 3RLUA 1RR2A 3HURA 1H2JA 3L8RA 4M3PA 1X7FA 4YJ3E 2GOUA 2WK2A 3IJ7A 5F1VA 2OVLA 3ZLGA 5HWXA 3W73A 2QVNA 5J8LA 1PYMA 4IX0A 2NTXA 3VDHA 2C71A 3BCDA 1QHOA 3PZUA 4KHPT 1LWHA 4J4KA 5I09A 3F5KA 3FDGA 2HISA 1GQIA 2Y88A 4X1KE 1BR0A 3CTLA 4ACZA 4ONVA 1JGIA 3PNZA 2I16A 1XBXA 2GUUA 5G4WA 4GI4A 4K8EA 1YW0A 4HKAA 2WSYA 3IA3A 2RGLA 2B4GA 3QGVA 1F74A 4PL1A 1L6SA 4J3UA 3G77A 1I2PA 2J47A 1T72A 3VIPA 4C6CA 1XRVA 1H50A 1UUMA 2VHLA 5DBTA 5CSUA 1OWAA 3VMOA 4DRSA 4CQDA 3K46A 3J9X1 1FBAA 4AKIA 2B1EA 3KXQA 3QQ0A 3UG8A 2FYMA 4AMAA 3DG3A 3AXJA 1V77A 2JF7A 5LNUA 2AAMA 3KWXA 4GOUA 5CSRA 2C5JA 3GNRA 3GD6A 3VD9A 4KBMB 4K36A 3V35A 2BDEA 1JIBA 4OU1A 4JTSA 4X3ZA 4IIJE 3RRAA 2OOFA 4OWGA 3CAWA 2D20A 3ARQA 2CWNA 5CBJA 1CXLA 2QCFA 2XG9A 4GZ7A 2HPIA 1YTKA 1UOKA 2NZLA 4S2BA 3N5LA 1UGOA 1Q85A 2CPUA 2EF9A 4Q4MA 5DF0A 4B2DD 4Q22A 3W2MA 1W3JA 3AAEB 1PIGA 2E4TA 4Q8WA 1FTXA 1BVZA 3UXIA 1BVWA 1JPHA 2EG6A 3BL3A 5EY5A 3FA5A 2UXDT 3M41A 1EDTA 3BCJA 1ICSA 2PC4A 3ANVA 4GRSA 3ZMZB 1WXZA 2PFVA 3RFAA 1W37A 3S5ZA 4BCEA 2QCDB 2YFOA 3HQNA 4XISA 4YHHT 1JNEA 4A22A 2RHGA 4QR6A 2NUXA 3GXPA 2EHOD 1AZ1A 1H7OA 4YJ2E 3WLQA 2L5HA 2RGMA 4F8HA 4QLLA 3CYJA 3GVRA 2VRQA 3QLDA 2C0AA 5JTGA 1YNQA 7PTDA 2HJPA 3EABA 3PAOA 1JZ2A 2W61A 4ICMA 4HU8A 3CLWA 5IHRA 3D47A 1UROA 2E1WA 4HPJA 5KX5E 1LBLA 3UUXB 2FHFA 3N2MA 4LRSA 1KFKA 2JK2A 3LBXB 4ORMA 4EAYA 3U57A 4UOQA 1QW9A 2XN0A 5KETA 1EL3A 1OGGA 3W02A 4DJFC 1F3XA 3GKAA 3B40A 1NY1A 1FDZA 4XK2A 4ZZBA 2E8IA 1QATA 1QNRA 1HS7A 2CZ5A 1SR9A 1J79A 3FN9A 3B04A 4E4FA 2Z1BA 2D2JA 3QB5K 3ZS4A 4ROPA 1OC7A 1BYCA 4M0XA 3GMIA 3E22E 1W2VA 2LLYA 2J7BA 1C9DA 3SN4A 5C70A 4X9YA 2ZX8A 3TR2A 2YCIX 4JX4A 4H41A 3DYPA 2VWAA 1I1XA 1VYSX 4A05A 3TYZA 1Z3NA 3LPPA 3L4ZA 2OELA 5CEWA 3G1SA 1WKFA 1CX9A 3EBVA 4DO6A 4G1NA 2OKOA 2EPOA 2E8ZA 3GAYA 1G73A 1D0YA 3W9ZA 1UH2A 1WOAA 5HXHA 1LM1A 4PMUA 1PKLA 2HWGA 5EK4A 2QYGA 2O9PA 1BR2A 2DDXA 4ICCX 3AA0B 1ISZA 4JUYA 2YBUA 1AQMA 2EJAA 1QNQA 2W91A 4OBTA 3R8RA 2YDAA 3N9QA 2XQ4A 2PSNA 4V27A 4UTUA 4CLMA 5FF3A 4MGGA 3GR7A 2O0TA 2BS2A 1LTDA 1AA1B 2NUWA 2NSOA 1XLGA 4YIWA 3NO5A 4IHCA 1I0BA 4EPEC 3WJZA 2DW7A 3CIWA 1A5NC 2PBOA 4GX8A 1F73A 2Y7EA 1QSDA 4C6LA 5LGZA 4FXRA 3BUVA 3PANA 1A0CA 2GZXA 1TWIA 1SW7A 3XIMA 3UYIA 3ZC0A 3BMWA 5ABGA 5CBIA 3DFSA 4REQB 3D3FA 3QK6A 1MW1A 3MDWA 3GM8A 4QQ3A 1YTDA 1G0CA 1NFGA 2H6RA 5H8MA 5BRBA 4U2YA 5RUBA 2BHUA 2MNRA 4FB7A 3DECA 1ITQA 4UF0A 1U1HA 1VZWA 4PBEA 4GO8A 2KWIB 1JZ8A 4H01A 2JRKA 4G7FA 4M7SA 2XSAA 3CX8B 7ENLA 1HVQA 4J3VA 9XIAA 1FWFC 5AQNB 1H7XA 4JQAA 4WJXA 3OW1A 2IPWA 1KV5A 2JQXA 5JDHA 3J7Yq 3WEMA 4DJFA 5HMSA 2CIPA 1V3JA 2P10A 4AXPA 4MG4A 4E7ZA 4MDOA 2ZZ7A 3L4UA 3NSMA 1X6UA 3VHLA 2PDFA 4OBSA 1Q6LA 1XUUA 4UB9A 2XAGB 3RJXA 2ZZ5A 1KFEA 3I7QA 4PUJA 1MW2A 1ZBVA 4KIEA 1FWHC 4J9JA 4GKTA 4QCEA 1FQ0A 4LUJA 2FDSA 3S47A 1TWZA 1BWKA 5L6UA 1F6KA 4F66A 1EOMA 1GOIA 1BLIA 4L9XA 2BKNA 1HKMA 3FFSA 2LHNA 1LJYA 3QTGA 3F2BA 5FJRA 2XM1A 3TNOA 4RDZA 3CUXA 3S6OA 2G8ZA 1R8IA 1YIXA 2D1ZA 3EXRA 2DIJA 1LWIA 4JTHA 7REQA 3TA9A 5KMYA 4OYJA 3IJIA 3VXGA 3AXJB 2NW9A 5HXRA 1CXFA 1RCXB 3SCUA 1IF2A 3MSRA 3WELA 4QRNA 3UU6A 3IAQA 2ZUSA 5AQUB 3LBMA 3FZFB 4DN1A 1EP3A 2WBKA 1FMWA 5I6SA 4ZTXA 3RX6A 3HZ3A 2PDJA 3MWCA 1I75A 2VP8A 3R7MA 3FXYA 4TXEA 4NKCA 4WGHA 3CV7A 4GIYA 4GK0E 1LT7A 1UWRA 4JHZA 1NF7A 2ALDA 3DDMA 2IPFA 3URQA 1Q8AA 3I9WA 2CXEA 4ALDA 4WBOA 4IXHA 3WNNA 5D02A 4K0KT 4RCXA 3TJ4A 3NDZA 4C6NA 1D8CA 3KDNA 1YXRA 4AKRB 2E9BA 2YBVA 3CMJA 1B31A 2J27A 4FPSA 3W25A 8XIMA 3HJZA 2VNCA 4KETA 2X40A 4ZB0A 3MI6A 1W1ZA 2LSGA 1VBGA 5E70A 3VO0A 3G0UA 5T9BG 2PGRA 4U3AA 1CECA 1V3LA 1ZS2A 2Y70A 1JYNA 3IIPA 1ICQA 2LRKA 3REQA 3LSCA 3VGDA 1GUVA 1SW0A 4P5UA 1LL4A 3QY8A 1FWBC 2PURA 1RK6A 4JTCA 1WNOA 1MEIA 1JNRA 1E6ZA 1VQTA 4K3ZA 5HCJA 2F6UA 4HYWA 3MUZ1 2HS6A 1ZEEA 2DCFA 2IDOB 4HPNA 1HL8A 2I0MA 4I90A 4IMGA 1P6CA 4Y9OA 2DH3A 1IWPA 3CPUA 4N9DA 4WY0A 3FEMA 1KB3A 5D2VA 3CT7A 5HWJA 1VBUA 3QLLA 4NXKA 5MF5A 2XQ9A 3RIUC 5I77A 2YN6A 4L4MA 3M0VA 4PMZA 4R27A 2VD9A 1S94A 3BGGA 1AJ0A 2G3NA 2UUCT 2NVDA 1OXZA 1PXGA 3AXKA 4Z2LA 3K4WA 2CZFA 4UNKA 1GPWA 1HTJF 2ZUUA 1TQXA 3WLHA 3SS1A 4HHHA 4X61A 3G1XA 2E28A 4O8AA 5AY7A 2X16A 1XPGA 1OX4B 2LHRA 2X30A 1OBAA 3PPGA 4I5UA 3UUBA 4PTXA 2D9DA 4PJJA 3WDPP 5KSWA 3BQ6A 3KUMA 3L67A 4ILSA 5G2WA 4Q4RA 1BYBA 2ZOXA 3F7JA 5JDLA 1LL6A 4JKKA 3W7GA 2W62A 4L1WA 4UTJA 3FX4A 1KV8A 1OEDE 1E51A 4R7OA 4DV5T 1RY8A 2EBNA 5I0DA 5KDMC 1UP0A 3R13A 3NPUA 2OSXA 4IREA 2BOEX 3B9NA 3V5SA 1LBFA 2F61A 1RVGA 4I7WA 3TOPA 2ABBA 4WR3A 3IJLA 2WJDA 1UX4A 1DPMA 3WLSA 4GI6A 3R8HA 2H88A 1OFRA 4ORIA 5CC7A 3N9LA 4OBRA 2JGYA 1W9DM 1S5TA 4D8LA 2CNCA 4PUMA 3VKGA 4E2BA 3A22A 5ENLA 4WGXA 2FZDA 2GDQA 3V36A 4DF2A 1ONWA 2ZDRA 5I2UA 5EBUA 3WNOA 5LSMA 3TH6A 1KF6A 4AISA 1E1FA 3O0KA 2PDMA 4NI8A 4LAOA 1W31A 4ZO8A 4UQEA 3DJBA 3MY9A 2BVLA 3GDBA 5CZKA 1Q45A 2XQ7A 4PFPA 3U2CA 5LKYA 1T7SA 3WBEA 2XGIA 3PZIA 4GMEA 4CVUA 2PWGA 4Q4QA 5AYYA 3AHXA 1T98A 3NGFA 3NVOA 3BLFA 2Y4SA 1MUWA 3RJYA 1GOQA 2QPUA 2G96A 2LM9A 4HK5A 4LFYA 4RE0A 4AX7A 1KLZA 2Z1VA 1FH8A 1ZAJA 1V6UA 4F4RA 1OZMA 4MKVA 3RIUA 4JIIX 5GPRA 3VGGA 4ZEPA 4RV3A 4JQ2A 3D46A 4OJYA 1DOSA 4KMCA 1WPCA 4IT1A 3NL2A 3CTTA 5CSYA 3PZGA 2PS2A 3P5ZA 3AMCA 5T8GA 4M1BA 3TUUA 3CZLA 5D9OA 2A6LA 3PN8A 3PZNA 1Q6EA 2DUAA 4UELA 2D24A 2GJXB 1EC8A 4JN6A 4KKXA 3NEVA 5HQEA 4O1EA 2P9BA 3LB0A 4C6JA 3B03A 3C2RA 3LG7A 4TUYE 3SUTA 3AWNA 3E38A 5JVDE 4K37A 5HNRA 4E4PA 1W3TA 5E5CA 2HXTA 4HMNA 2LKGA 5A6SA 1XGDA 1DYSA 3GXTA 3BZJA 3WDHA 3LZ5A 2IQ0A 1AMYA 4YTNA 2B76A 3AAMA 1SO4A 3PWIA 4H9MA 2POTA 3U4FA 8XIAA 3PR2A 3PU8A 3KE0A 1H62A 4QX4A 3SRZA 4WJEA 4N42A 1GKRA 3LK6A 1GHSA 2J8GA 2TRSA 1HVXA 1F7BA 3V18A 1OF8A 4MHCA 3CL8A 1WDRA 3VVGA 5AC5A 5C2XA 3E0ZA 1B5TA 4ILUA 2BV9A 4EOUA 1L6FA 3GAKA 4URIA 4HWHA 1L6YA 4N4PA 2BG9C 3HQ1A 1RJRA 1KTCA 4QAWA 2V2HA 4UFHA 2ACQA 2IC9A 4GQRA 1E5NA 2H3DA 3VDGA 1Y8BA 1V6TA 2UY5A 3H7UA 3TA6A 1YBQA 2YDSA 3NDYA 3BG5A 2ZRUA 3DZ1A 4FNPA 4B9YA 2QJIA 3NXLA 4M51A 5LHEA 3DI1A 3Q67A 4HZ7A 3WF3A 1HG5A 4IE0A 4R85A 5FEPA 4S23A 2YSWA 1QT1A 1FXQA 4N02A 5M3WA 5A6AA 3K8KA 5KEZA 3ETUA 4QE1A 5LA1A 2QJMA 2WVSA 4HA4A 5F4SA 4FXSA 5AC4A 4ENLA 1FWRA 4GQBA 5B7ZA 1LOSA 4FK9A 4X66T 1VCSA 2UZ9A 3TSMA 4CCCA 5HANA 4FO4A 3SM0A 1ODZA 4FLQA 1FA2A 1VPYA 1GEHA 3HTWA 1F4AA 3EUHA 3IS4A 2OT0A 3OLIA 1XICA 2X1SA 4LUSA 3MYOA 4Y9AA 3DCPA 1XIGA 3WUBA 4ZODA 3WUEA 3AZSA 3B3DA 3R58A 1MUCA 1GQNA 2HHHT 4IGNA 1P0KA 1V93A 4DBWA 4BKNA 3SGGA 2C0HA 3LG3A 4WEVX 1E3XA 4IPNB 1EZ2A 2R82A 5IXEA 3B8WA 2VX4A 3LDQB 4XAZA 1XSKA 1TZZA 3R94A 1YNPA 1BG9A 3CO4A 4PN2A 3TP4A 1MXDA 4U5KA 3GDRA 1EJXC 4ZB2A 3WBAA 1T41A 2P50A 4WDXA 2WMKA 2FJBA 4GIWA 2JEPA 2F2HA 4M1PA 2LSYA 2PDPA 2R24A 2V5LA 3H23A 3NG3A 4HHPA 4P7RA 4L0RA 1DE5A 3FBLA 2Z6JA 4HCHA 4IH3A 2UXXB 2YKSA 4YTMA 3TKFA 3W74A 4QG9A 3QMRA 3RXZA 1CGXA 3VGHA 1SJCA 3QOFA 3W1PA 2CHRA 1F3TA 2WQYA 2BGQA 2VX6A 2J13A 1H3GA 3B9DA 3R8GA 2DSWA 1GTHA 4HA3A 4S3FA 2FJDA 2BG9A 4OKDA 2XINA 3ZYKA 4TTGA 2XIMA 3OJAA 1GW9A 3WCZA 3R0DA 3SCOA 2VGGA 1DKWA 9RUBA 2C1HA 2IC6A 2EHOC 4PTMA 1EPXA 2KT9A 3D0CA 2QDDA 1ZAHA 1A47A 1G4TA 4W7VA 2ZTJA 3NWIA 1GPFA 4HOZA 1VPXA 1V03A 4ISTA 5LOVE 4XIAA 2DZTA 2WMJA 1JQVA 4DMVA 1H1NA 1AW2A 4P61A 4WLCA 5AKQA 4W89A 3P8IA 4EXTA 4DELA 1WBJA 1EYEA 4EPBC 4DR1T 3KEHA 1U1JA 2DSZA 4ZQMA 3U5UA 4BFAA 1DJWA 1JGMA 3HKCE 4DLMA 1CGYA 4JI3T 4ADZA 4EXQA 5FJIA 2F6XA 2Y7DA 2ZVIA 3MKCA 3CO8A 3T09A 1KM4A 1RJQA 4QSFA 2DY3A 3NOEA 4M8UA 5DMLA 4OX9T 4OHFA 1EJSC 2C1IA 3E2RA 3G8EA 3S2LA 3S2NA 4FHAA 3STCA 4HZMA 4U2ZA 2X68A 4L4LA 1E6XM 1UK5A 3LXBA 5CH9A 3U2EA 2VENA 3P81A 4PL2A 1HJSA 3VKKA 1D3GA 3ZOAA 2AMGA 3GWQA 4PTVA 3LV5A 3BMXA 4IUGA 5G5IA 3CAKA 1E6PA 3W87A 2NP9A 4JPGA 2PC8A 3SZ8A 1DJNA 2C91A 3WK1A 1UKPA 4WF7A 1SO6A 3AE8A 3I4KA 2W3ZA 3KP1A 3W84A 1A5SA 4BF5A 5EFDA 4Z2JA 2TYSA 2GFTA 3WQWA 3S9ZA 3SRHA 3UYCA 4K38A 1X39A 1I94T 1HKVA 4EWND 2JMKA 2XH7A 4R5EA 2A6NA 4WXYA 3OTRA 1Q6DA 2HRWA 3LMZA 3NPVA 4M7TA 1ZRQA 1DHKA 1X38A 3QM3A 4MPQA 3AZTA 1DIOA 2AQWA 2D3LA 4A2RA 9CGTA 1BR4A 4PRRA 4JDBA 2W4XA 1AL8A 3KVJA 1T99A 1F6PA 2GPTA 1EHNA 3CNYA 5DQVA 4B2DA 1OYAA 3WLNA 1J10A 3ZM8A 1UD6A 2JJ9A 4A3RA 1SFTA 1EP2A 3VINA 3AU2A 1QNPA 3UG4A 2CW6A 4IQJA 1A5LC 3PUEA 1VC4A 1E6RA 4F9JA 2EKCA 1AK5A 1IGSA 1C29A 3SUUA 2VQFT 1PAMA 5G1TA 2WPGA 2E2AA 2C14A 2NWBA 3B8SA 3OLGA 4QIUA 3KBNA 5C2GA 3RHGA 4LANA 2W2UA 4TV9E 4A3UA 4AH7A 5I3KA 3CMGA 3KZPA 3CWZB 4BZYA 2GGGA 3CH9A 1AUSL 5K4ZA 4I55E 4PUEA 4N78D 5C9ZA 4LF8T 3T2OA 4O12A 3IBPA 4B90A 4I6KA 3BLLA 1EEXA 5I3GA 5AQMB 3NQEA 4NX0A 4DBEA 4DZAA 3NVDA 1QRQA 1ZPTA 1EJUC 4PEEA 2ACZA 1CLKA 3RIAA 2J66A 3SGZA 1TJ2A 1TTJA 2YA1A 5T9CE 4F8XA 4O1BA 4ERAA 4TX9A 4C6DA 3LRLA 4XTDA 5C7VA 2DZWA 2BY0A 3F57A 2G95A 4AIOA 2AE9A 2HSAA 3QPYA 4TX6A 3GTNA 3JZUA 5HUPA 3UWZA 2Q71A 5CFBA 3TMLA 4P09A 3CMLA 3CQXC 6PTDA 4O4JE 1LT8A 3OP2A 5AB3A 3OVUA 2Q6ZA 2D0UA 3ALFA 1E4LA 3LTYA 3SCTA 2W00A 4CD7A 4HNCA 1SZNA 4WJ8A 1XIJA 1C92A 3EAUA 4IDOA 3IANA 4LUSB 1KFLA 1UKOA 3PBGA 1L2QA 3NJ3A 5LNKA 2XHEB 1E1HB 3PTRB 1CCWB 4AF0A 4Z8XA 1J01A 1LRTA 5LGNB 3Q5XA 3MA9A 1F3WA 2WC3A 1NSJA 3BLKA 4MLKA 2O7SA 1OADA 1ZV4X 1QPQA 1MNSA 2KZ7B 3N11A 2HDJA 3DFPA 2E40A 5AYXA 4GVGA 3MCOA 1R2RA 4S3BA 3QW3A 5DT7A 2YB1A 3XINA 4DBUA 4GYPC 3URNA 4NL1A 3M6YA 2W92A 2BFGA 3ABSA 5AC6A 3ANYA 4EP8C 2ZUVA 3VFCA 5AQPB 3S1VA 1HG3A 1OGSA 1TR1A 1DIDA 3W7CA 1VEMA 3N4AA 3PM6A 2CWYA 4PC8A 3AS3A 1AW1A 2WP9A 1QLBA 4JY9A 1TE6A 4GNKB 3WDIA 3EXTA 3T7VA 2GJRA 3WNMA 1CGUA 3ZIZA 1K7XA 2INZA 4ERRA 3NCOA 4RE2A 3UBPC 2HE5A 1JZ5A 1Q2RA 4PMQA 4H04A 3V75A 4MADA 2X66A 3S4UA 4U5IA 5MKGA 1YEYA 3TLVA 3BV7A 4Z1AA 5EMUA 1ICPA 5BNKA 5HK4A 1B3WA 4Y9NA 1C90A 3G06A 2Z2AA 5BYWA 1O5RA 4EF8A 3PUWF 1VBHA 2ADAA 1EFZA 3HG4A 3W75A 3UUMA 3KRBA 5LGUB 3ITOA 3GUGA 1PEZA 1BFNA 3U7VA 1A3XA 4ILAA 4MB1A 1D1CA 4JX6A 5LMUT 4GYRA 4DY1A 4HGAA 3B97A 2HTMA 1R5YA 4XD3A 4CQCA 1SZFA 1XMQT 1BGAA 1D7FA 3H7RA 3ARRA 4BWLC 3I9YA 3CWOX 4H9UA 3C8FA 4G1KA 1Z9AA 3EMZA 2K3WA 2VO5A 2JKPA 2PCEA 2I9UA 4P8UA 1B3ZA 1XSJA 3UWQA 2O55A 3IIZA 5EBAA 2D0FA 3N9KA 2OODA 3H7VA 3Q37A 2CHOA 3DERA 2BXYA 3B8TA 4IQLA 3KCJA 4GKKT 2QW5A 4ZZCA 2PLJA 1K8YA 1FUYA 3OVQA 1XLLA 1MNDA 4KBXA 3RO8A 4HWFA 1V0LA 1HP4A 5AQKB 1TX0A 1J8VA 1O1ZA 3HG5A 4O57A 3FAWA 1V3KA 4QG6A 3VI2A 3RR1A 2TSYA 1NFPA 4XKMA 1GOKA 1KRAC 1HNXT 1JYWA 3A9IA 2XIIA 2WHLA 4L4OA 3TSBA 2E6AA 4AAJA 2FZMA 3RQWA 4HYRA 3ABZA 4R9XA 3LCXA 1O1HA 3RLFF 1S39A 3A4WA 4GYJA 1ECQA 1GYLA 4UFMA 3RILA 4LW7A 5LIUX 4GUGA 1V5XA 3ABQA 5KZ6A 4QG8A 5LGXA 1MRQA 1FXPA 3W6YA 3F4NA 2CU0A 3HFYA 5GVJA 1R7OA 3QSRA 1U22A 1IEWA 3FCPA 5D2TA 3GYEA 1Y64B 2IUBA 1YXCA 2QJJA 1DE6A 3MC5A 1J9YA 1KNWA 2EO7A 3JUGA 1JZ3A 4I5XA 3DC0A 1XLHA 2WMNA 3LFMA 4HFDA 1VYPX 3E2VA 4GACA 3BG9A 3AMGA 2EHOB 4RW3A 4BF9A 3H26A 4ZO6A 2OXNA 3SI9A 4M19A 5EU9A 1MMNA 4TNVA 4B5XA 3MVIA 1O68A 2OWCA 2H8ZA 3UT0A 1ML1A 3VNMA 3ZJ7A 1A0DA 4WSKA 5D32A 4YSYA 1BXNA 4FLRA 1XLFA 3S1GA 3PJAJ 4NXSA 3KHJA 3BAYA 3CB3A 2AQOA 3HO8A 3P4SA 4UQCA 5FJUA 4BWLA 5LMNT 4YLHA 1VIZA 1GZGA 1AW5A 1HX1B 1T8BA 3MANA 3W81A 2XIQA 2QAFA 2XU2A 2C79A 2VGIA 2V3DA 3HGSA 2UUAT 4H9SE 1CXKA 2PODA 1H11A 2OG9A 2W5FA 1B90A 4EF9A 3RMJA 3PNUA 1ZBCA 4NQ1A 1KNPA 2QMKA 3LCWA 2CWXA 4JFTA 1MEHA 3IHRA 3GG8A 5G2IA 3N2GE 2XIBA 1ITUA 2BKPA 3IVTA 2PWVA 4HOXA 5J2UE 3L4XA 4ZFCA 2A2FX 4BHYA 2WNZA 3AE6A 3GU1A 3UFGA 4GXMA 1W1B1 4GIAA 1BKHA 2D2HA 1ALDA 4UR7A 3UGRA 4LF4T 4E6MA 5E1QA 4TR9A 3XISA 4UZSA 2OV9A 1E5JA 3A64A 5JRCA 4GA8A 3AEBA 5L3GB 3O16A 3Q2MA 4GI9A 4CCZA 1E0XA 5HMDA 3O0FA 4N6FA 5HR6A 3K4DA 3O6CA 1EZ3A 5AC8A 3VIJA 5C6MA 5HEOA 3N9MA 1D3CA 1QO2A 3MZNA 1REQB 2G0WA 5D9NA 2X7WA 3O06A 3EEGA 3SUWA 5A8GA 2V8SV 1KKRA 1SJDA 1XH2A 1TPWA 3G0XA 3KL5A 2YU2A 4QH1A 1KM0A 3AECA 3UU0A 5C54A 3P74A 4LYPA 5KTLA 4HNOA 5FP3A 2QCNA 3I6EA 1OM0A 4PCNA 4O19A 3STGA 3NXFA 1PPIA 4J3WA 1UUQA 1RCOB 3ITYA 1TPVA 4UV8B 2ZM2A 4MIMA 4HP5A 1F8MA 1XG3A 3RX2A 1SA0E 4X9SA 2X9WA 1TCDA 5AZ0A 1F4HA 1X7IA 3UNDA 1C3FA 3T78A 4E5TA 3KOWA 4V28A 1WAWA 3P8JA 1LBMA 1PIFA 4LS0A 2B81A 1QW8A 4LXFA 4FNRA 3HM7A 1YDYA 3L7RA 1A5KC 2H9AA 2JALA 3QKZA 3RIFA 4NJIA 3KVLA 3RRWA 1GQEA 1KC7A 1RK5A 4IL9A 2Q9QD 4BS0A 2HNHA 1J0YA 3VU7H 3EGJA 1H7RA 3AIQA 4MBQA 4DO4A 1C8QA 3AXHA 4LOCA 1TVPA 1JUBA 1PB0A 2ZQ0A 1AQHA 3II1A 4NG3A 1HF8A 1DBTA 4MJMA 1FOBA 3INPA 2YIHA 4A8RA 3ITCA 1XGEA 3NGJA 4UVAB 3ZVHB 1RBLA 3NVTA 2VFHA 4GZIA 3NQAA 4NHVA 1TTIA 5CC6A 4PA8A 3TR9A 5JIWA 3IPWA 3PG8A 3I4EA 4ECLA 4D1IA 1A4MA 3RM8A 3CB8A 3N1AA 1JPKA 3O2LA 1G5AA 3EWDA 2D3NA 1NWTA 3ITXA 4B3TT 1VHNA 4GOAA 4EKJA 4YTUA 1BSLA 3GBEA 3UESA 2L3LA 4QXBB 1P0BA 2ZA3A 4HWIB 3RYFE 4ZOAA 4F0HA 1LUCB 1CGTA 3N3TA 3I3BA 1R86A 3LHUA 3V1PA 4Y9MA 2RFGA 4LVDA 4MFDA 3GNNA 2KINB 4QE5A 3MQTA 4CNPA 2PWEA 3KOYA 2Z25A 1QMLA 3T0BA 5F1UA 3TE9A 3IGHX 4EACA 3PJXA 3KRZA 4L4PA 4WSHA 2H3BA 2VYOA 4JIRA 5A6KA 3CYVA 3CKDA 2DEPA 2VL4A 3BAWA 4M6UA 5EPDA 4QFUA 3QVQA 1KWGA 4DR6T 2BG5A 4HA0A 4CUCA 1ISYA 3MMWA 2BASA 2DFAA 4PUWA 5J1GA 3PUOA 4KQNA 3KOXA 2PWHA 1XKYA 2NVCA 2QVAA 4QHOA 3UF9A 5DT5A 2VC6A 1AD4A 4MJ4A 1JPDX 5BXSA 3MYPA 4K8GA 4LX4A 1DJZA 4K1WA 3PTDA 3H2AA 3W24A 1SE7A 3UWUA 2FPYA 2VVNA 3H2FA 1B3VA 3W07A 1Q6QA 2XFRA 3W2JA 1K8CA 4PCPA 4JQ3A 4LALA 2GYIA 4A21A 4HJFA 1B54A 3QTPA 4LU0A 6ALDA 2YW4A 4X5TA 4EXBA 4I7VA 2C7FA 3THUA 4QJ1A 3VNYA 2KNDA 2WAUA 4H6EA 1EA9C 1K9DA 4JGDA 4DPQA 1Z48A 1PTAA 3VABA 1VHCA 1W0AA 1HNWT 1ZY9A 3L68A 3WFAA 4X2PA 5G4HC 1E40A 3UTKA 3UQ4A 4JN7A 2XDFA 5DRIA 1WB0A 3PUAA 1MMGA 3OU8A 1IIGA 3GLCA 1V0NA 3HQOA 4Z0SA 3C0LA 4JNMA 1OK4A 2J25A 4DR3T 3BVJA 1FWEC 4HYVA 1LCOA 3G0SA 1E0WA 1Z8UA 2I7GA 4KMQA 1BEUA 4LFAT 5I79A 4LF6T 5I5RA 1POKA 3RN6A 3NIYA 2AMXA 1KNZA 2QS8A 2Z1XA 3MACA 4IL4A 5EYWA 3C50A 3KV9A 1GYNA 1X97A 2D69A 4JS3A 3TJIA 3TKLB 3IUHA 2VMFA 3LD5A 2ZZ1A 4K7VA 3G22A 1CXEA 1KGXA 2WM9A 3FYPA 4QDMA 2BKOA 4WXZA 2CXGA 1XDOA 4IWWA 3WNPA 5AQHB 1C8YA 2QCLA 3ZXWA 4U3CA 3A3WA 3VNLA 2V5CA 4P7LA 2V6AA 3VM7A 1E1EA 4PW8A 1BKSA 1CXIA 5AQQB 1L8NA 1GVYA 3GZAA 1XD0A 2CLYC 1KFJA 1KFWA 1UH3A 2QKFA 1SM9A 2QJGA 5TIMA 4LEFA 3VX0A 4HTYA 3LPFA 3UXDA 4U10A 2Y7FA 5BRPA 1IZNB 1JQXA 2WZTA 3KOFA 1WUFA 3O1NA 3P82A 1MZRA 2J9YA 1SSDA 4NZJA 4EEDA 5C9WA 5U7SA 1NWRA 3BMVA 3QC0A 1UJPA 4B5NA 2GJLA 4KCWA 2ZFAA 1UR4A 2X05A 1RD5A 1EDGA 1PDYA 2V63A 1N8WA 2WDQA 5F2GA 4QH4A 2GVYA 4Y8EA 2OT1A 4HTEA 4TOQA 2DT3A 4HNTA 3W2UA 2BTMA 1ME7A 3AAAB 1U33A 2DI4A 1UP3A 1M7PA 2XQ6A 1V02A 5ABEA 3IIOA 4LEQA 3LUTA 4ZFMA 4AI6A 1UCUA 4FXFA 1AJZA 3W7RA 3SRDA 2W0UA 5JUVA 3VTRA 1KCXA 1YKEB 1XS2A 4G8TA 4H7ZA 1T7LA 3CX6B 2KWHA 5CXPA 3L9CA 2E5DA 3GTHA 4PJLA 4OECA 3LHVA 3MV11 4G2DA 5IFPA 3W7HA 1JAEA 2E6YA 3CBWA 7A3HA 4RDYA 1D7KA 4X2RA 1WQ5A 1WA3A 1RLDA 3GC4A 3L21A 3VKBA 2DJXA 1EB3A 4BEQA 3W7JA 3AHVA 5BXTA 2PU1A 4XZCA 4O8SA 1OYBA 3SAZA 4NJJA 3ORWA 1EQCA 2V5KA 3AC0A 2BODX 3ANWA 2BP1A 3O1IA 2ZRXA 7CGTA 1UR8A 1DXFA 3WNKA 1YRRA 5K4XA 3IARA 4NAEB 3JAFA 4YHJA 3H6OA 3BLEA 2D23A 1VOMA 2ANUA 5FF4A 4AW7A 4O17A 1O5XA 2GGIA 4LGXA 2YCEA 1EP1A 2XVGA 3TYDA 3P60A 4JFWA 4HMDA 1JYVA 3PTQA 2EPNA 5F5WA 3EEZA 3O3RA 4UCGA 3AA6B 1IJ6A 5AECA 1LRNA 5FXWA 1BRLB 4FOKA 2Z1KA 3LV6A 1UIPA 2JQKA 5AQIB 2KX9A 1HW6A 1OFBA 1CZ1A 1QUUA 3SFEA 4DWSD 4AHQA 5CZTA 4JIEA 1RA5A 3VC6A 2HNEA 4U28A 1UKQA 2G37A 2O7QA 3TMQA 4PBFA 4WK9A 2DT1A 2X0YA 3H2NA 4AX6A 4KWOA 2FDMA 4YSZA 3PG9A 1DQWA 3ID7A 4H7VA 4DR4T 3EYPA 2FPTA 3EDJA 4L1GA 4M5PA 5GNYA 4IG2A 2RDXA 5LYRA 3X1DA 2VM8A 2WHMA 1QHZA 5TBOA 3GHTA 4X65T 3KP0A 3W88A 1QOPA 2DVXA 3ARXA 2WQDA 2BLEA 2EPKX 3C86A 3ZT7A 1IXNA 1GTEA 3OG3A 3TLSA 1OIMA 3H53A 3W7MA 1BQCA 4YCPA 4NZ5A 2IHR1 2CLIA 1KCLA 3EX6A 1JG9A 2Z29A 1MXGA 4A6GA 2CERA 2KZHA 3ARWA 3S5SA 1FHDA 4PODA 2ZRYA 1AQFA 2QULA 2QMJA 1NEYA 2Z4GA 1RQHA 4H9PC 3PB0A 4M1RA 3W26A 3G3DA 3RR4A 5EMJA 3P4QA 4E3VA 2IKJA 4XBSA 1XBVA 2IPGA 4IGSA 4I50E 1J18A 2FFIA 4LS2A 3UFYA 4Q4PA 3R2GA 5IOBA 3H2EA 1GVIA 5H6RB 4EZHA 1YYAA 1Q13A 4ZSTA 1UJQA 4Y90A 1JPIA 5LHIB 3KVBA 1SSGA 4FNSA 2RP4A 2IMRA 3RQUA 2PGWA 3RHWA 2OCZA 1I2RA 3HV9A 1WDSA 4JCMA 2A0NA 2PGEA 2G41A 2HROA 4QXCB 2PP0A 3GH5A 3GNOA 3HOJA 4TMCA 3N4FA 6XIAA 4W93A 3T44A 1WR6A 3AU6A 4DUYT 1EF3A 1LROA 1SHZC 1SFSA 4NJGA 2PBGA 2MOZA 1E71M 4DAIA 5TQLA 5JIPA 1US7B 2CLHA 4O1FA 1RHCA 5I03A 4ZOEA 4DJED 1N33T 3N04A 3ZN1B 1TFVA 3UR5A 3U0HA 1HNZT 4CQ8A 1QCWA 1H09A 2VEIA 3OBAA 4RNHA 1C7TA 4UFKA 4DBRA 1LG2A 2YCLB 3ITTA 3OBEA 3RX3A 5HQLA 1EJWC 5KMGP 1JZ6A 3N2KE 4ATDA 3RKGA 4GJJA 4P1NA 1WCGA 1XZYA 3ESLA 3GVWA 2VZTA 3VDAA 4P7OA 4S3GA 1UMLA 4KFOA 1R3QA 2QPSA 3GHUA 4LT9A 4XZ9A 3B4YA 1TO3A 1XM3A 3FNDA 1EX5A 1TUXA 2X42A 1YQ4A 1AH0A 3QPZA 3TX9A 2CZVA 1VH7A 3QY7A 3VCNA 3TAOA 2VZOA 3QV8A 2DH2A 3TYAA 1M1BA 3GXNA 3RCMA 2WSQA 3W76A 2FZ9A 3CL6A 4L9ZA 2G3FA 3WF1A 1OZQA 1M03A 1XI3A 2XSBA 5CC3A 1ZSXA 1CTNA 1Q7QA 2IKGA 4PTNA 4FNTA 4F0SA 3WKZA 3MUXA 3GN5A 2QT3A 4GY1A 4XV0A 4YTSA 3ONXA 1HXJA 3V0UA 3ENLA 4Q8QA 2QNEA 2G3MA 4ZEYA 3THQA 1MIYA 3W7OA 5A94A 3PUQA 4A8NA 1BPLB 1XG4A 4JTJA 4LTSA 5LB7B 1CBGA 4MNLA 1W8GA 5JXQA 3M5VA 4OOZA 3WL1A 1TVNA 1CNVA 3L2MA 3UZJA 2PB1A 2AGTA 4DO5A 4L6HA 3VIOA 1EGZA 1GT8A 5HJXA 3OO2A 3A47A 3LK42 4MFRA 4NU7A 4C7DA 1OD0A 2DWGA 3DHPA 1NFBA 2Y62A 3SURA 3O1HA 3BSHA 1SR0A 3N9SA 3RPUA 3BLDA 1R2TA 1O5KA 3QNUA 2C5KT 4CN6A 1S38A 1XD1A 4IOTA 2WW5A 4PUDA 4E2OA 5AYBA 3JC6C 3LXAA 4CD4A 3PUXF 1TCMA 1BD0A 3NRXA 4W5UA 3UCDA 4ZA0A 4CZZB 3DFYA 3B8UA 4ZHQE 4A5XA 1ELSA 3W2NA 1M62A 4CN4A 5I7GA 3LNPA 1DJIA 4BR1A 1YKWA 3TLUA 1NJJA 4Y9PA 4QISA 4JTTA 5F2IA 1QNOA 5REQB 1FP9A 2GQ9A 2UY4A 1M7OA 3TN4A 3H55A 5AHNA 4PR4A 2OZ0A 3PJWA 3C0JA 4I9TA 4GUJA 3MK7C 2CE7A 3UWEA 4RE4A 2BDQA 4S39A 1KRCC 1CWYA 1P6WA 4C6KA 4I4TE 1R8LA 4GISA 4NT0A 3G1HA 3ZYMA 2HK1A 3W7DA 2BVWA 1UD2A 2Z1SA 4I7UA 3AIWA 1XPYA 4AD5A 3WQCA 3ISIX 4BQ5A 4PSRA 4MHBA 1XLIA 2XZ9A 2YDQA 2CLYB 3ATYA 3P67A 1UZ1A 1Z44A 3BK0A 3KCLA 3MMUA 3UG3A 4B92A 1XIBA 2W63A 5FESA 1ZAIA 4B16A 5D2XA 3W70A 3DFNA 1J6PA 2P88A 2VQTA 4IMDA 1L8PA 4GGBA 2E6FA 2FLIA 3A3XA 4C6MA 5K9XA 2YEVC 1QPRA 4LBRA 3O05A 4EEBA 3VOJA 4E2VA 3FJNA 4UTMA 2Q9QC 1ADOA 3M7SA 4XSMA 2YYTA 3I10A 3ABRA 2PG8A 4MNJA 4RZ6A 3TAKA 3WLPA 1XMOT 1H7CA 5EB8A 1QXLA 2ZMAA 3MP5A 2VJXA 3O7UA 4G7EA 2VQET 3H70A 4YVPA 5TAOA 4UMBA 4B5SA 3ARYA 3SFWA 2Q8ZA 3GG1A 1GOMA 1W5NA 4JQ4A 3IIVA 4RX0A 3TJLA 4M6QA 1KXTA 4KEUA 1GHRA 2ZE0A 2FZBA 2WB5A 3SECA 1AZ2A 3M64A 1DQUA 1PHWA 3ZJ8A 2DQXA 4BJNA 1KWKA 3VIIA 4YTPA 4YLWA 2CEAA 4KPLA 3IGUA 3RYHE 4IUOA 3T0AA 3FZLB 1TX2A 1TPB1 2ZZ4A 3AIVA 3AUOA 1QI4A 1ME9A 4DI9A 8A3HA 6CGTA 4FI4A 2DZSA 1FHVA 3W7LA 1Y01A 3PJAA 3UA4A 4H4IA 4GVIA 3S9IA 5BR8T 5D09A 5JR9C 3IVSA 5E9XA 4H8NA 3WUGA 4JTQA 1XW8A 3M0XA 2J74A 4ISSA 3ZMTB 1JRBA 4DZHA 4UQAA 1H5VA 1P48A 4PE8A 3I0OA 3VILA 2GK1A 3T0DA 1MDRA 1RCQA 1KTNA 3IRDA 4O0KA 1XNQT 5FJJA 3ZR4A 4N7QA 3P8CD 3N2CA 2PDCA 4F40A 2QYWA 6REQA 2ODVA 1MYRA 1XSIA 2WNWA 5ABFA 5LGTB 4JTFA 3ZWTA 4F0LA 3U6WA 4C6FA 5A6MA 4G5DA 4Z1CA 4DB7A 1WYCA 2H3RA 3EI0A 3PBVA 1S2WA 4CU8A 4JL2A 1S5WA 3E6EA 1V0KA 4XKYA 2ODOA 3CC1A 2WHJA 5E0KA 5A2AA 3LEPA 1F9CA 3AROA 1B9ZA 4E3TA 2ZVRA 4JIPA 4PGLA 4LUTA 4AFYA 3PHAA 4YWSA 5LZLA 4GQ0A 1KM5A 3S83A 1G4EA 2ICSA 3MA8A 2IAKA 3CVRA 3R6NA 4NZFA 1FH7A 3E0LA 3C64A 3EDVA 1CB7B 1KXHA 4L80A 2PDWA 1S2VA 3RLHA 4AC1X 4OV9A 3UVAA 2WSRA 4Q8OA 1ZP0A 3LPGA 3UGVA 2CWOA 3ITVA 3L66A 2Q9QA 1K9TA 2OEJA 4TVDA 2KSRA 3GO2A 4WZXA 2J79A 5A8OA 3KV5A 1ZBWA 1W3NA 5CGMA 4IQEA 2VK9A 3W2LA 1N34T 3TW6A 4QROA 1FHUA 1UD5A 4UBPC 1JDFA 5FEWA 4I5RA 3P4PA 3L0NA 1NWSA 4CQBA 3LGDA 4GE8A 2V6XA 4Q7NA 3W1QA 1KLYA 1BYDA 2X41A 2VDIA 2VGFA 4F79A 3LCLA 3PWAA 3C4WA 4B91A 4US6A 4KF1A 3TC6A 4B4FA 2REQA 5JDNA 4AKGA 3SUVA 1UMYA 1OFEA 2Z7GA 3WAJA 5LIKX 3QKEA 4AD3A 2CCRA 1A5CA 3GHSA 2VX5A 2A3HA 4O15A 4LF2A 2AAAA 1GVQA 3CIXA 1ECEA 4GCAA 2PDQA 5AYZA 3K3NA 3B9AA 4HN8A 1I4NA 5I23A 5L3EB 2XIJA 1R3VA 2V67A 5LJNA 3MKVA 1CHUA 1UCWA 1S2UA 1TPH1 3MW7A 4PCSA 3MJMA 4GXPA 5JR9A 4MJZA 1N32T 1VCVA 1EWDA 3LN3A 4ZMGA 5LNRA 2HEJA 1J0ZA 4S3EA 4IDZA 1IT7A 3RM9A 3B05A 1JVNA 1WX0A 2UWFA 2DSUA 2FUPA 3F4DA 3RLGA 3N19B 2FVKA 2K5BB 4RZ4A 2Y24A 4X22A 3W1MA 3W82A 3MCNA 2V7MA 2PWFA 2WZEA 4CNTA 4MY9A 1PCWA 2HK0A 4WYVA 1WLXA 2V3EA 1E7PA 3ZSSA 2WVVB 3AWOA 1DWHM 3L4TA 4EYUA 4DUVA 1KCZA 2GDUA 4IMEA 3CAQA 5M4YA 3DENA 2OLTA 1H1YA 3H22A 4LB4A 2CXLA 3NWRA 3BOLA 3H2OA 2YA2A 1WZAA 3SEPA 4K2SA 1JZ4A 4GABA 1O94A 1U5VA 1IJ5A 2WCSA 2R1MA 2L9QA 1TJPA 1RPXA 5J0ZA 1IV8A 3LA4A 1QR7A 3AMKA 1JF5A 2J6VA 3A5XA 1UP2A 4IJRA 1UWTA 3TFCA 4GINA 4W86A 1ZL1A 5GJMA 1B3OA 4GHRA 4KCVA 1ZLPA 2FVMA 2PTFA 3LPOA 3E0VA 1ZALA 4QH5A 1GZJA 4KFPA 1W9UA 3ZLIA 4NP7A 3RI5A 2V6YB 1IQ8A 1JAKA 3FDKA 3URBA 4LCSA 5EFFA 4XUGA 4GFIA 1TTPA 1WDWA 4DI8A 4UFLA 3GXDA 1M7JA 3N29A 1FHLA 5CKSA 5CAKA 1VENA 1ONEA 3GW0A 1SQ7A 2FFCA 3WDRA 2ODUA 3TDFA 4G63A 3L3PA 2XN1A 3VR9A 4DIDB 2AL1A 3A5VA 2QUNA 3WFLA 4NAFB 1Q2SA 3CHCA 1N82A 4W8AA 1T8QA 4PAGA 1QHPA 3N2BA 3WDQA 2FH8A 1OEDA 1SZGA 1ZQ5A 1MMFA 3AE5A 4LF5T 3PVFA 4PBGA 3HBLA 2X0LB 4KRTA