2W61A

Saccharomyces cerevisiae gas2p apostructure (e176q mutant)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
480
structure length
470
Chain Sequence
GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Glycoprotein
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
total genus 164
structure length 470
sequence length 480
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w61A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w61A01
5C70A 1DWIM 4QLKA 1KGUA 7TAAA 1QVBA 3HU7A 3SCSA 1GQKA 2O9RA 1AQ0A 4DWSC 4GIAA 4XZWA 4CCDA 1WAWA 1CECA 3N15A 1J10A 1V6YA 3DHPA 5E0FA 2ESCA 2PF0A 5GNYA 3GYCA 3VNYA 4AEEA 1EA9C 1TVPA 4J3VA 2YLAA 1R86A 2AAAA 1JG9A 2PI6A 1X6NA 3WUEA 1E0WA 1GQIA 4GI9A 1VJZA 4PN2A 4UQDA 4UFMA 4P8XA 1HJSA 3DYMA 3AMDA 5A6JA 1JYXA 1E0XA 1KB3A 1AMYA 3L4XA 4ZFMA 1BPLB 4CN1A 4AD3A 3K8KA 4WKFA 3VGDA 3WDIA 2WLZA 4OUEA 1L8NA 2J7BA 3FHQA 1E5NA 5CGTA 4CD6A 3BAYA 1CGTA 1G01A 1LL4A 1V0MA 3GBEA 2DT3A 2VZOA 4MAVA 2NT1A 2WHLA 5E6YA 3N12A 5FOOA 2C7FA 1F4HA 2VZUA 3MMUA 5GQBA 2A3BA 2FH8A 1J18A 3MSDA 4PEEA 2G8ZA 4CD8A 4JKMA 4PMVA 1V03A 4UZUA 5BXTA 3AI0A 3NJ3A 3EDEA 1BF2A 1TZ7A 1UWQA 4ACZA 1UQYA 1GJUA 2GJXA 3BAWA 3TTYA 4XZBA 2XIBA 5BCAA 4AXNA 1Z32X 2BY1A 1HF6A 2EEXA 1FFQA 1XD0A 4JKLA 4FF5A 4MB5A 1V3LA 1JI2A 3E1F1 1UOKA 3CO4A 2G3JA 2WWCA 3AHTA 1LWHA 5I78A 4ZEPA 2UY2A 1JZ7A 5C8BB 4HOZA 3BH4A 5A8OA 1GQJA 1P6WA 3L4ZA 5A3HA 1FP9A 1V3IA 1HP4A 3AHVA 2V38A 1KXTA 1NQ6A 4BQ3A 4PCSA 3ARTA 2ZUSA 1EO7A 3WF3A 1C8YA 1JZ3A 2AOSA 3DYOA 4AYSA 3VU2A 2WZEA 3SCUA 4FLSA 4JL1A 1V3MA 4HMDA 2D3NA 8CGTA 3GTNA 1VRXA 4A3HA 1SMAA 3IJ8A 4H8VA 5EFDA 2F61A 2GJRA 2VRJA 2YL8A 1B3ZA 1J0IA 1FHLA 4C7FA 4Z2IA 3ARYA 2WVVA 4AZGA 3TTSA 1E43A 2CPUA 2DSWA 8A3HA 4MAZA 4D1IA 1XHGA 2JIEA 5ABFB 4J3SA 3WL1A 2W4XA 2WB5A 3OG2A 4PTVA 5KZ6A 3VIIA 4W5UA 3WH8A 2XHYA 4W7WA 3VDCA 1K9EA 4B9ZA 3GNRA 3SIMA 2JALA 1M04A 1M01A 1JDCA 1QHZA 2VRKA 3CUHA 3UR8A 2JEQA 1ZBWA 3UG4A 4CGTA 1UHVA 3SCPA 4L4OA 2ZX7A 1KXVA 2D24A 1GONA 2WSPA 4MB3A 1PZ2A 1RD6A 2F2HA 3CPUA 1W9VA 5BRQA 3W26A 1CXIA 1KFWA 1E73M 1WZMA 1JYNA 2ZIDA 3ARUA 5CSYA 1J11A 1W3LA 2PWGA 1M53A 4M29A 1QI2A 1TG7A 1EDGA 1UR8A 2EPMX 3KZSA 3B9AA 4CVUA 3VD3A 2XIIA 2Q8XA 5CJ5A 1RH9A 3I3EA 2YL5A 3AHXA 2W63A 3AYSA 3ARZA 1JDDA 1K9FA 1BGAA 4H2CA 1HKIA 2XVNA 1MYRA 2WHKA 1NOUA 2ZICA 4D6CA 1E6XM 5A2CA 1HKMA 1WP6A 5DO8A 4AD2A 4W88A 1MVYA 3L4YA 4NRSA 1V02A 2X8RA 1UD8A 4ZXOA 3AIUA 3II1A 3VDBA 5CPQA 2B31A 2E9BA 3F4VA 1QNRA 4JCMA 3O6AA 3WF1A 3WNLA 1FH7A 5KEZA 5D4YA 1C91A 3CUFA 5CQ1A 3MMWA 3WNOA 3FHAA 5EB8A 3BCDA 3WF0A 3D5HA 3RJXA 4IISA 3VILA 3VD9A 3A3HA 2CKSA 5DT7A 1B3WA 5A6SA 1YQ2A 5M03A 5A69A 1XH0A 4W89A 4CD7A 2A3HA 4BQ5A 1VBUA 1JNEA 4OBSA 1ZJBA 3K8MA 2OYLA 5FL0A 4M1RA 1UD5A 1UWIA 4UQCA 1B9ZA 2YOCA 1A3HA 1CTNA 1W2VA 3OGVA 3AXXA 4E4PA 4H8UA 2W61A 1QW9A 2V3EA 3VDHA 5A8PA 3IAQA 3GZAA 2CHOA 2J7EA 3KL0A 5DF0A 1UWTA 1EDTA 1W1TA 3TTQA 2BNJA 1H41A 2WVVB 4LX4A 2VQUA 3PHAA 1MW3A 2CYGA 3BSHA 1E72M 2E40A 4BA0A 2A3EA 4R5EA 3NUKA 2YLLA 5I2UA 1JDAA 3N9KA 3TOPA 3J7HA 1V3JA 4M24A 3CZJA 3WY1A 4K68A 1CGUA 3O2LA 2OWXA 3GH5A 4PMYA 5I24A 2EPKX 4MNLA 5HBFA 1W9PA 1XCXA 1V02E 1BGGA 1XYZA 3WDPP 3NCOA 3PZNA 4XUYA 2VURA 1BTCA 3K8LA 3B8SA 5HNNA 4H41A 1U2YA 2IXVA 2VCAA 2Y24A 4D6EA 1J0ZA 4PMNA 1C92A 4IPLA 1UR9A 3SCVA 2J77A 3I3BA 3WDHA 3VTRA 9CGTA 4AMCA 3FAWA 5AYIA 3BCFA 2OSYA 3WH7A 4JKKA 1C8XA 2BFGA 1ODUA 2YIHA 3ZM8A 1FFRA 1OGSA 3ZJ8A 5CG0A 4B3LA 2D0FA 4U3AA 3MU7A 4B16A 2BVDA 2OLHA 2EQDA 1UKQA 2JIWA 2ZUMA 4KGLA 1XSJA 4OOZA 3ZSSA 5I6SA 1G1YA 3MMDA 3ZQ9A 1XCWA 4DUWA 1QBBA 2G3MA 1WDQA 4GI6A 1BYAA 1RP9A 3JUGA 4GZEA 2DIJA 3CUGA 3EBVA 3BAJA 3WQ4A 2BVYA 4HOWA 1E3ZA 1BVNP 4QCEA 3QHNA 3AMKA 4QP0A 1QPKA 1W9BM 1AVAA 5JBFA 2J7DA 5D9OA 5BXRA 5A8NA 1W9UA 1G9HA 1GUVA 1HX0A 4XV0A 2VT0A 4OZOA 4PMUA 3ECQA 2NW0A 3VO0A 1E5JA 4DM1A 4WSKA 4Z2HA 3BMVA 2ZUTA 3QGVA 2XFRA 1VJSA 5AYBA 3WN6A 5BXPA 3KE0A 5IFPA 1OCQA 1B30A 1UR2A 4OKDA 3CH9A 4GO9A 2WVUA 2D22A 1ISWA 2DPEA 3T2PA 4YHGA 4PUDA 5FD0A 1NOFA 4WF7A 4M8UA 2XSAA 1NARA 3AHYA 1LQ0A 5EFFA 1H4PA 4LPCA 1UKSA 3CMJA 3KWXA 4DWSA 1QW8A 4TX6A 2WBGA 4RE4A 3NSXA 1CXEA 3B9EA 1JGIA 4AZ5A 1CDGA 4ATWA 1KCKA 1LL7A 3IJ7A 4QCFA 4EANA 2UY3A 2VL4A 2XM2A 1UZ4A 4MB4A 1CGWA 4P8VA 5DFAA 3UETA 3VMPA 1QI0A 4YHEA 1UD4A 3ZO9A 3TTOA 1UH2A 3WF2A 4UOZA 5JBEA 2CCRA 3ZJ6A 1DEDA 5D9PA 3MANA 1E4MM 1GOKA 2QPUA 1W3HA 1NWSA 1LJYA 2D1ZA 3HJEA 4FMVA 2X2YA 1VIWA 1MQPA 1FHDA 4W87A 2ZE0A 3VMNA 3TP4A 1E3XA 2EPLX 1H09A 1U33A 3UR7A 4ML4A 1EQCA 4DWSB 4PSRA 5E9AA 4NRRA 5A95A 2V5DA 3CZ8A 3OLGA 2WVSA 2XGBA 1DWAM 1TE1A 4N42A 3VIKA 4UFJA 4BS0A 3OGRA 2XG9A 3W6MA 1GOWA 1QNSA 1LG2A 1UR0A 3F5KA 1UD3A 4AD0A 1ZS2A 1BYCA 3WD4A 4JFVA 4U2YA 5AY7A 2G4FA 2Y4SA 2F8QA 2CXGA 3AIBA 1M03A 1W3KA 2WC4A 2J8GA 5A6BD 3GXIA 5I3DA 1V6WA 3WNNA 3WDJA 4Z2KA 4ZE4A 4F66A 2CHNA 1HVXA 4FK9A 1OBAA 3PZTA 1OGGA 2E8ZA 2WMGA 3SEPA 1B3XA 3VIGA 3ZT7A 1KCLA 2DSUA 4ACYA 1O7AA 4HPGA 1FH8A 4M80A 1MXDA 4Z2LA 1PX8A 3OLDA 4JFUA 1OWQA 4GI8A 3MV11 4J3XA 3W82A 3VOCA 2C0HA 3VGGA 1NP0A 4IUGA 3MUZ1 2X05A 2W62A 4B3KA 3PZVA 3W29A 2J7CA 1N82A 3A4XA 1U30A 4JHOA 4AD1A 5D9MA 4MB1A 5FL1A 5IFTA 1GPFA 3RIKA 1H5VA 3AS0A 4IPNB 3RILA 1US3A 3SUWA 4L4PA 3AYRA 2XVPA 4KRTA 1CXKA 4JZ5A 2QHAA 4GXPA 3MKKA 4AIUA 2JF7A 2CESA 4HMCA 4UOQA 1HL9A 3POCA 1GVYA 1EH9A 3DHUA 2WMIA 2XSBA 4OBRA 1NWTA 2XVGA 4ZXLA 4GO8A 2QLYA 1UD2A 3WH6A 3VDAA 3NIYA 1E6PA 1JI1A 2WVTA 3WF4A 2VX6A 2MANA 2ZWYA 1OGBA 4TVDA 5D9NA 3UERA 3MUIA 3PZUA 3MUAA 4M82A 3HMCA 1KR1A 4H8HA 2WMKA 1E0VA 1JD9A 1I75A 1PX3A 1XGZA 3QHOA 4AISA 5I5RA 3KL3A 2PBOA 1BYDA 1IV8A 3ZR6A 1D7FA 1PJ9A 3I3DA 2A3CA 5E09A 3OA5A 2XUCA 2XFYA 5IXEA 2ZXDA 4HTYA 4GKLA 3KL5A 3WMSA 1HJWA 1JZ5A 4W85A 3ZIZA 4PTWA 4W86A 1KGXA 3T2OA 4LGXA 1WZLA 1R7AA 2BY2A 2NT0A 1W3JA 1E15A 1UWUA 4WSJA 1CXLA 4F79A 1I1WA 4D72A 2VNCA 1HJUA 2WCAA 4F9JA 1S46A 1V0NA 1V6VA 5A8MA 3ZJKA 1BLIA 1Q6EA 4N0RA 1PBGA 2ZXBA 3MS8A 5DEZA 1TCMA 4PMXA 3RJYA 1WO2A 2QMKA 1ZBCA 4HMEA 1UKPA 1ZL1A 2V5CA 3TONA 2OSWA 3L4WA 4AZHA 1GOOA 1JZ8A 2WMFA 2YBTA 3UG5A 4Z2GA 1MW0A 1IZKA 3ARVA 3WKZA 1CLVA 4TVUA 3FN9A 1JZ6A 2J79A 4UTFA 1MWOA 3AICA 4LXFA 3W0KA 1CGVA 1HXJA 2E8YA 1CGYA 2WC3A 1MW1A 2DEPA 1HT6A 2ZX6A 2JEPA 3VIMA 4AWEA 1B1YA 1GJWA 1J0KA 1XSIA 4GPNA 2ZX5A 6A3HA 2FHCA 1IT0A 4UR9A 1J01A 3U7BA 4A3YA 3IK2A 1JXKA 2J4GA 3VINA 1BYBA 3D3AA 1WNOA 3VUPA 2J7HA 3OZOA 3WFLA 2VQTA 3T08A 5LA1A 1NOWA 1HJXA 1FH9A 3L4VA 4LYRA 2D0HA 4GQQA 3AS2A 2JFEX 1OSEA 1A47A 2VUYA 4WKHA 2XWEA 3L2MA 2X0HA 3AZTA 1QOXA 1J12A 1CNVA 4R27A 5A6MA 4EK7A 4GINA 4LQ1A 3OBAA 3AOFA 4S3KA 1UZ1A 3NDZA 5A1AA 5A6AA 4CD4A 2DSKA 3PN8A 3ARPA 1PAMA 4FLOA 1ZU8A 3BLPX 3PZIA 2GDUA 1WZKA 4D6HA 2WC7A 4LYQA 2FGZA 4DWSD 1BSIA 1OD0A 2DQXA 4P7NA 3GBDA 2WANA 4DUXA 4W5ZA 3VGHA 2ZWZA 1GCYA 4TVCA 3VGFA 3AQUA 1JXJA 1UA7A 3M46A 1XRVA 3AS3A 4JFSA 3K46A 2D20A 4KGJA 1J0YA 5CXPA 4JFWA 3B9DA 5E70A 2E4TA 3WD2A 3AMLA 3BAXA 4AZCA 3GNPA 2BXYA 3BGAA 4V2XA 1UKTA 2GK1A 3IANA 3U5UA 1DWJM 2D2OA 2CETA 3L4UA 1ZB5A 1JL8A 1UQZA 1OT2A 1TFVA 2WZHA 3WD3A 4J3WA 4OIFA 2QV4A 1JZ2A 1X1NA 3PTMA 2V3FA 5ABGA 3RM9A 2ZXAA 3RPMA 4U5IA 1Q6DA 3N13A 5IDIA 2CNCA 1PIFA 2ZXQA 1G5AA 4CVWA 3POHA 1MW2A 1QHOA 2XGIA 3AFBA 1DWHM 1VB9A 4E2OA 2W92A 3BXWA 4D71A 4J3UA 1X6LA 4JAWA 3WIJA 2DSVA 2E9LA 4AC1X 3UG3A 1D3CA 2XWDA 4W8LA 1OIFA 3VMOA 2YA0A 4ZE5A 4HZ7A 3THCA 2BV9A 3PZOA 3WD1A 1BAGA 1H2JA 5A8QA 2VX5A 4BZYA 4P7RA 4BQ2A 4NSBA 2D3LA 4TXEA 3N1AA 2JF6A 2VVNA 4Z2JA 1YHTA 1V0KA 3QR3A 2QPSA 1V6XA 1DTUA 3WBAA 1E6NA 3RM4A 1GVIA 1HP5A 1HKKA 2WMIB 3WEOA 2YA2A 5JIWA 1DHKA 2YL6A 2DH2A 3F5LA 1UD6A 4P8WA 3WQ6A 2XVLA 2FHFA 2GSJA 1E1EA 4AZCB 5M3WA 2WPGA 1QHPA 3EMQA 2GK1B 3VX1A 1B3VA 3LPGA 5JBDA 3EMCA 1VBRA 3MO4A 4MJ4A 2EPNA 2WW5A 2IUZA 4JIEA 1C90A 4PTMA 1E6ZA 4URIA 3VX0A 1PIGA 2YDRA 4HU8A 1V0LA 4QDMA 3SCNA 4F9DA 4UQAA 3WSUA 1I1XA 1W2PA 1J9YA 1D2KA 1WDRA 1UWSA 3FXYA 2UWFA 4U3CA 5AC5A 4W84A 4J28A 3GNOA 1J0HA 4H04A 3CZGA 2O9TA 2YDQA 3PZ9A 3WMBA 3T09A 2YDSA 3CGTA 4X0VA 1B0IA 2AMGA 2Z1SA 1GOIA 1OT1A 1BG4A 3WUGA 3WQVA 5ABHA 2WHJA 3EDFA 1KGWA 4MDOA 3PTKA 1MXGA 1E70M 3NSMA 2E0PA 2XVKA 3BSGA 1H49A 4UQEA 4HA1A 2CITA 4WK9A 1OM0A 5A2BA 4RE3A 1FA2A 3CUJA 5ABFA 4JFTA 2BS9A 1BQCA 1CEOA 5FKYA 1VFMA 3HN3A 2W67A 2YA1A 1GHSA 3WEZA 7A3HA 4W93A 4UZSA 3IAPA 4UOJA 4DM2A 3SUVA 2VI0A 3W28A 3VD7A 2XJ7A 2E3ZA 1ODZA 1EIBA 3F5JA 2WNWA 1V3HA 4AW7A 2D23A 1JAKA 3O9NA 4WKAA 1Q4NX 5A94A 1CPUA 3RCNA 4UCFA 5DMYA 4NI3A 3RO8A 3A6OA 4PSPA 2VX7A 2ZUNA 2CBIA 1TMQA 3CBWA 3U7VA 2V3GA 3PBGA 1KWGA 4CUCA 1JIBA 1E6SM 5C71A 3VIPA 1MFUA 1NWRA 2OWCA 2WWDA 1M7XA 4PMQA 2GFTA 3AIRA 4UFKA 1V6UA 5A2AA 4UFLA 2WBKA 3ZOAA 1UH4A 3KEHA 1C3FA 2QF8A 3CHDA 3RDKA 1W32A 3DC0A 3WQWA 4CCCA 2VJXA 2O9OA 3GH7A 1R87A 1EDQA 1WDPA 4YPJA 4HZ6A 3DECA 1B31A 1JF6A 1LF1A 6CGTA 3AXIA 2WK2A 4HOXA 1VFFA 3W37A 1XV8A 4UQBA 3NDYA 3WEMA 5D8ZA 1CYGA 3QOKA 1PZ3A 2CBVA 4V27A 2BHZA 4KRUA 4JHZA 2OYKA 5A6BA 5AC4A 1B90A 4QLJA 3OB8A 1L0PA 1PPIA 2BVTA 5HDRA 1GHRA 3FAXA 5E6ZA 3EDJA 1QNOA 2DSZA 2FGLA 2Y5EA 3A4WA 3LMYA 1Q6GA 2RGLA 2VZVA 2CBUA 3ARRA 4BCEA 4AEFA 3SUUA 1TVNA 3WBEA 4MJ2A 1CXHA 1FOBA 3RMEA 3WENA 1E40A 1UKOA 1VFUA 2PC8A 3WFZA 4EKJA 5E0CA 3G6MA 3U5YA 3FY1A 1LG1A 1GZJA 2W5FA 4MDPA 4UQ9A 2WKLA 1EHNA 3WD0A 3VM7A 1C7TA 3UEQA 1QI5A 3AIVA 3G6LA 3ZJ7A 3WL0A 4HPHA 3MUY1 2GUYA 4MADA 3SUSA 3FW6A 1G94A 1KXQA 4CN4A 5BXSA 2X09A 1W9XA 3VIOA 2DT2A 4HA3A 3N17A 2DH3A 3AIEA 2J25A 4AZIA 4MTVA 5EBAA 2G3IA 1EOMA 2PBGA 2W66A 5CPSA 2YL9A 3AHZA 1K9TA 1E4NA 1FP8A 5A6LA 3EDKA 4PMRA 1GW1A 1OB0A 1TUXA 4E8DA 1UH3A 2YKKA 1Q6CA 3ALFA 2VCBA 1AQHA 4TOQA 1E56A 2QMJA 2WMJA 3ZMRA 2DT0A 4PMDA 5IHSA 3VD5A 2UY5A 4KMQA 3ARWA 3K4AA 3WUFA 1KBBA 3OGSA 4PMZA 4AZ7A 3CUIA 2OSXA 3L4TA 4C7GA 2WKGA 2WM0A 3ZT6A 4AIEA 4BQ4A 4XB3A 5JIPA 2OYMA 3EMZA 2DT1A 1RPKA 3BLKA 4U33A 4EE9A 4OOUA 1E9LA 6TAAA 5I79A 1UR4A 4MPKA 2G3NA 2EJ1A 2PB1A 1VENA 1CGXA 5HXMA 4S3JA 2VTFA 3EDDA 2CERA 5EMYA 3W81A 3SCWA 2XPKA 3W53A 2VRQA 3VD4A 3ZT5A 2GDVA 1KQYA 1HNYA 5DT5A 1E71M 2Z1KA 1HKJA 4HZ8A 4F8XA 1ITXA 1OIMA 3EYPA 3NYDA 3PZQA 1XH1A 1OD8A 3WNMA 1LL6A 2J75A 3GXFA 1KBKA 2OWWA 3UCQA 1PX4A 1CIUA 3MSGA 4PRWA 4AIOA 1JD7A 3VIHA 3W25A 4EAMA 1JAEA 2VR5A 3M7SA 5HPCA 2XM1A 1XSKA 4OJYA 2YJQA 1BG9A 4AZ6A 2NSXA 2ZUUA 2ZX8A 2VCCA 2BHUA 1ZBKA 3N18A 3ARQA 2X0YA 4DUVA 3AISA 4W8BA 2WMHA 3ARSA 3PZGA 1H3GA 4AZBA 1WKYA 2FDMA 3OIHA 3SURA 4RL3A 4HP5A 5LYRA 2TAAA 2WHMA 2CKRA 2VZSA 4J3TA 2DIEA 4J7RA 1HN1A 4M81A 1XC6A 4X9YA 5BWFA 4QFUA 1GNXA 2J62A 5M17A 5LA2A 1VF8A 4P8UA 3W6LA 4QAWA 1DWFM 3WUBA 3ARXA 4Q22A 4W8AA 1BFNA 1K9DA 3K1DA 1H0IA 1R85A 4W7VA 4WIWA 2J7FA 4Y7EA 4W7UA 5FIPA 1UG6A 4PYSA 1VAHA 2VO5A 5ECUA 2XFFA 1QNQA 2ZX9A 1TA3A 3VNZA 3VVGA 5TD4A 3VIJA 1RP8A 1JFHA 1W1PA 2BHYA 3WDQA 5BYWA 1MQRA 3CTTA 2CIPA 4A4AA 1SMDA 1UWRA 3WQ5A 4D6IA 1O6IA 1HJQA 1KWKA 1CZ1A 2WSKA 2C8NA 3AMCA 3WMCA 4CU7A 4Q7NA 3CZKA 1V3KA 1H0GA 4X0NA 3PTQA 2Y8KA 4QLLA 2Y2WA 2ZUWA 1WE5A 2DDXA 5I0DA 1E6QM 1QNPA 3APGA 2BY0A 2GJXB 2EO7A 1CWYA 3GXMA 3N04A 1AQMA 3ZSTA 4IM4A 4B15A 5ABEA 1EQPA 5FCZA 2VC9A 4H7VA 1WCGA 3CLWA 3CZLA 3THDA 4D6GA 1F4AA 4UFIA 4GZJA 5LA0A 3VKKA 1ISZA 3SCRA 4BF7A 4MNKA 4NF7A 2BXZA 3K4DA 3BAIA 5I77A 3BMWA 3VGEA 3WELA 1HIZA 2VVSA 4TTGA 4CN6A 4JL2A 1SFSA 5BRPA 1WDSA 2YBUA 3T0AA 4PBGA 5CPTA 4JCLA 3NSNA 1GQLA 3MV01 2IXUA 4CKQA 4AD4A 5F7UA 2ZOXA 1EO5A 4P7LA 1K6AA 3GH4A 1QI4A 2X1IA 2JE8A 5A6KA 3BC9A 4U5KA 3LPOA 2VR4A 4E8CA 4TX8A 1ZJAA 1UR1A 3SCOA 1PEZA 1DP0A 4KWUA 4D1JA 4TTUA 4CD5A 3QHMA 3W27A 3LPPA 3OLIA 3T2QA 3GDBA 4FLQA 1UA3A 1HJVA 1JZ4A 5GNZA 1R7OA 5CLTA 5M5DA 1XH2A 3WH5A 3SCQA 1H11A 3BAKA 4WJXA 1EHAA 1LWJA 4D6FA 1VEMA 2CEQA 1QI3A 3DYPA 1UUQA 2WLYA 3L2LA 1NP2A 3T0BA 1C8QA 2GJPA 2PWDA 2E9MA 2HISA 4ZENA 3AROA 3AJ7A 2PWHA 3AIQA 3LPFA 4KH2A 1NH6A 2BY3A 4GZIA 1OINA 3S6TA 4PCTA 4AY1A 1ISXA 2VX4A 3AIWA 1VEOA 1XD1A 3ALGA 1MFVA 2FH6A 1E6RA 4D6JA 3QOMA 5I23A 3CHEA 3FNDA 1G0CA 1DWGM 1NWUA 1JYVA 3M6DA 3GM8A 2EXOA 4CU8A 2O92A 1ISYA 2PWFA 1SYTA 2PWEA 3TA9A 4CU6A 2Y8VA 3N11A 1B3YA 1HVQA 4P7OA 3T0DA 2UY4A 3WNPA 1ECEA 4AD5A 3UESA 4ATLA 1Y7VA 1C93A 2CBJA 3WQ8A 4ACZB 3AS1A 3VM5A 2ZUVA 1EXPA 1KXHA 1J0JA 4UFHA 2EPOA 1B2YA 4P7QA 1Q6FA 3WH9A 2J74A 4PMOA 2EBNA 3AXHA 3M07A 5CSUA 1JNDA 2WXDM 4B9YA 3W38A 5GNXA 1UYQA 2J8FA 2WAGA 3RM8A 5IHRA 1CLXA 2VMFA 1TA3B 1QBAA 1TR1A 3PZMA 1H1NA 1WPCA 4LYPA 1ISVA 1MQQA 2O9PA 2FHBA 5GPRA 1ITCA 1SR0A 2VZTA 2J78A 1NM9A 5CLWA 1E1FA 2GVYA 2HVMA 4HU0A 1US2A 2J47A 4NZCA 4V28A 4ATDA 3CHFA 4YN5A 5CGMA 2G41A 1E55A 5BROA 1XYFA 1KR0A 1W1YA 1JYWA 1EGZA 4U2ZA 3WDRA 1W9DM 1KQZA 3VPLA 3CIVA 4M56A 3CMGA 1LLOA 2WCSA 4CCEA 3AMGA 2D0GA 2WZIA 4HA4A 3CZEA 1GOMA 4PUEA 2J7GA 1VEPA 4MNJA 1R8LA 3AZSA 1BHGA 2RGMA 5D8WA 4UNIA 5JUVA 1ZBVA 3S2CA 1W91A 5HPOA 4J27A 3SCTA 7CGTA 2XYLA 1V08A 2WYSA 1GOQA 4WLCA 1WZAA 3SUTA 3W4RA 4D6DA 3ZR5A 3U57A 1E4IA 1ESWA 1EOKA 4GQRA 1VFOA 2A3AA 1C7SA 1W1VA 1WB0A 1JF5A 1E4LA 1HL8A 1GORA 4TUFA 2DGAA 2XTKA 2W91A 3A47A 4U31A 3CHCA 3VIFA 5HOSA 3GXDA 4XX6A 1BVZA 1JFXA 3AZRA 3WNKA 1CENA 2WCGA 3IJ9A 3A4AA 4RE2A 4FLRA 3VGBA 4PTXA 3W24A 3OLEA 3OZPA 1IZJA 1CXFA 4C7DA 1CBGA 2VOTA 5CZKA 2V3DA 4MNMA
chains in the Genus database with same CATH superfamily
5C70A 5CA0E 2Q9QC 1DWIM 3AE4A 1DJNA 2DZUA 4ZA0A 5K7JA 4KWSA 1LT7A 1HTJF 5D04C 2VC6A 4QG9A 1HNWT 1QVBA 2FJEA 2XTLA 2NXHA 3QTGA 4B2DA 5LXXA 1WAWA 1PTAA 5EMUA 3SADA 3CX7B 2E5VA 3GYCA 2WJEA 4JTLA 1TVPA 4J3VA 1XP3A 3EWBX 3H2AA 2YLAA 1R86A 2CLMA 2PTXA 3WUEA 1GQIA 4GI9A 4UQDA 4WJ8A 4P8XA 1SVDA 4LB4A 3P84A 3T9PA 4DZAA 1VIZA 1AMKA 4LBUA 3OYXA 1AD4A 2OEJA 2QAPA 3JRKA 1KB3A 3L4XA 4CQCA 2VFIA 1JPKA 3VA8A 4CN1A 4ZFMA 4MWAB 3K8KA 3APTA 3DU0A 3AYTA 1XR2A 3NA8A 4I90A 1OYBA 5AHNA 2ACQA 4HQVA 2ATMA 3S1XA 1G01A 4IIEA 1LL4A 3JAFA 4EF8A 5DQVA 3UY8A 4DJDA 3H53A 4QKNA 3NO3A 2A2FX 2WHLA 3R13A 1DORA 5B7ZA 3IUDA 2C7FA 4Y2WA 4B92A 2VZUA 3HI2A 1W3IA 4MHCA 5PTDA 5FJTA 2M6BA 5L3GB 1FXPA 2B7PA 4JKMA 3B5MA 2QEZA 1SW0A 2R82A 3MK7C 2GGEA 3VNKA 3NJ3A 3EDEA 1XCFA 1UWQA 2BGSA 4ACZA 1SZGA 1F8IA 4IE6A 4KIRA 4Q4SA 3GG8A 1GJUA 3PF3A 4LS0A 2HK0A 3TTYA 2VGBA 4XZBA 4C1KA 2VENA 4O1FA 4AXNA 5AN7A 1FFQA 4FF5A 5DY3A 2PGRA 5FXWA 4EF9A 5JDQA 4J2CA 1JI2A 3OU8A 2WWCA 1LWHA 4DN1A 2BB0A 3PUSA 3P93A 4AKGA 3NGFA 5A8OA 3L4ZA 5HXEA 4QITA 3IIXA 1V3IA 4RCXA 1K03A 3LGGA 2V38A 3EOSA 4BQ3A 4KRZA 5C0QA 4E8GA 3C4ZA 4X65T 4QX8B 4DR4T 4Q4OA 3BMXA 2X30A 1UCWA 3W70A 5EFDA 2BS2A 3URAA 2F61A 1UPPA 1X6UA 2PGEA 2VRJA 2OB3A 3WBXA 4EX4A 5F4WA 1PVNA 3C2FA 1FHLA 4MWAD 5AVHA 1OF6A 3ARYA 2WVVA 3C3UA 3AU2A 1HGWA 3P4PA 4MFDA 4WOZA 3UCCA 3KDOA 3NQ8A 2YCLB 2DSWA 3B9OA 2HEJA 4MAZA 3T42A 1UP2A 2H7OA 1XHGA 2JIEA 2X0LB 1QTWA 2POZA 2J8TA 3QPEA 4XQ6A 2WB5A 3OG2A 5HWXA 5G1TA 3Q9DA 4LANA 1FXQA 2XHYA 3U4FA 1M01A 1QHZA 3G06A 5FJRA 1F7BA 3DEQA 3BURA 1Z3NA 3S3GA 1ZBWA 4X3ZA 3UG4A 4CGTA 1P1XA 2MPKA 2ZX7A 3SGUA 3KX6A 2D24A 2GOUA 1HZYA 4YMZA 3CPUA 2CLOA 4IP4A 2RDXA 1GK8A 4NJJA 1J11A 1W3LA 1EDGA 1UR8A 2EPMX 2ASHA 3OBEA 2Q8XA 2V8ZA 4H63V 4HNLA 3DG6A 1YTDA 1JDDA 3PJXA 2HSAA 4UTMA 4ROPA 4QJ4B 5DBUA 3N9NA 1NOUA 2P88A 2HNHA 2CFFA 5CGQA 5AHLA 4PZVA 4ZHQE 3QM3A 3TROA 1ICQA 3NQMA 3FYYA 3II1A 3TZNA 4QNWA 3F31A 1TJ1A 3FXGA 3P67A 5HNTA 1U1UA 1QNRA 3WF1A 4EYYR 3S1UA 2F38A 1C91A 3CUFA 1XPGA 5DY2A 5EB8A 3WF0A 3SDOA 3AE9A 1F05A 3PUZF 2CKSA 2X1RA 2OTDA 2XZ9A 3MO7A 4KHZF 4P5UA 1BXBA 4B90A 3JCFA 4C6DA 2E5DA 4BQ5A 5HAXA 1JNEA 2QF7A 4TZ4C 3M41A 1UD5A 1UWIA 4JTQA 4UQCA 5A1LA 2EHOA 1B9ZA 5TNVA 1W2VA 3MUCA 1XBYA 3AXXA 4US6A 3AE7A 5H91A 2V3EA 1MNSA 3VKBA 3IAQA 4IMCA 2J7EA 3KL0A 4JYEA 1QWKA 3TYEA 4WR3A 1AH0A 4WVXA 4XBSA 3TCSA 2Y48B 1VFTA 3M7WA 1MW3A 3WLOA 3ZPOA 1S2VA 4JY8A 2CYGA 2E40A 1FHVA 3TKLB 3HPSA 5LNWA 3GVRA 1V5XA 4R5EA 1AJ2A 1K77A 3P0WA 2V7IA 4GI4A 4PCFA 4RNIA 3LEPA 2PDJA 3L23A 1HF8A 4GYPA 2MUCA 1VKFA 2FGBA 3DGBA 2Z7GA 3GA8A 2YCJA 2PP1A 3IV3A 2VURA 1RVKA 3ATYA 3B8SA 3VK5A 1VHCA 4S3BA 4LTSA 3DP7A 4LAMA 2ISVA 2IXVA 4PNIA 3GVQA 2VCAA 2Y24A 4I3GA 3CASA 4Y9PA 4D6EA 3MMTA 4UTTA 1WX0A 4PMNA 3ABXA 4GQGA 5LIXX 2EGZA 5KX5E 1B7TA 3JC6D 5I3HA 5K9CA 2ZRXA 1UPMB 3BCFA 2OSYA 3AALA 3GRIA 3RCYA 2BFGA 1IEQA 1ODUA 2QUMA 3NOYA 1WFDA 2QGHA 4KWOA 3VNMA 2NQHA 2Y6ZA 4A05A 1FFRA 1ADSA 4FI4A 5FSDC 4AI6A 4H4IA 1OGSA 5D2VA 4DR7T 3ZJ8A 5CG0A 2E67A 4B3LA 1POJA 2D0FA 4PUMA 1QR7A 2FZNA 4KGLA 5KZMA 5MKGA 1UP3A 1XSJA 2QYGA 4L4MA 4OOZA 3ZSSA 3T44A 1YTKA 4X63A 3URBA 4HBKA 1G1YA 3MMDA 3G3DA 3LCGA 1M5WA 4XO7A 1XCWA 2P8CA 4O50A 1MUMA 1N55A 1PWLA 2G3MA 4EOZB 4M3PA 5DXYA 1T6MA 4ZVJA 5D2TA 2V8SV 3UXIA 3C2OA 3PP7A 3BAJA 3PFRA 2PDHA 2G4JA 3W07A 3PUVF 1E3ZA 4QCEA 3QHNA 4RDYA 4QP0A 1QPKA 4R85A 1AVAA 4X1IE 1S5WA 3SWHA 3CX6B 1B3OA 1GUVA 3IRDA 4WZHA 4D2JA 4O0QA 2YB1A 4XV0A 1XIBA 5AYXA 1F3WA 2LEHA 4JI8T 4QROA 1XG3A 2NW0A 4GUHA 4Z2HA 1HR0T 1C29A 3BMVA 2EAWA 4Y90A 3KDNA 4GFIA 5AYBA 4IFKA 1GEQA 2VEIA 1B57A 2Y89A 2VD9A 4Q6JA 1O60A 1UR2A 3QW4B 1SZNA 1ISWA 5DABA 4NJKA 4DXVA 2DL1A 3C5QA 3DDMA 3CQJA 3K5XA 3T2PA 3NPUA 4YHGA 3N2XA 4ZB2A 3HFTA 3AO0A 3AWOA 1OJXA 4XZNX 3H70A 4DLMA 4CLMA 1UKSA 1TPC1 4JIPA 4DWSA 1QW8A 4K36A 2FVMA 2WBGA 2D69A 4GBUA 3B9EA 4AY7A 4AZ5A 1CDGA 5FJJA 3LENA 2YBVA 3DFTA 3CPZA 3GDKA 2LLEA 4HFVA 1V4YA 1XISA 2VL4A 4LSBA 5LOVE 3HURA 2E5CA 1CGWA 3UETA 3IJDA 1EJVC 1KEYA 1ZGDA 4YHEA 2HQAA 5F1UA 3KUMA 4N6EA 3TTOA 3WF2A 1N33T 5J04A 3MANA 4A5XA 1DIOA 2HPLA 1R6WA 4IQJA 1NWSA 2QUTA 5CH9A 3HJEA 5CC6A 3SFWA 4WX2A 2X2YA 5J0ZA 3O3RA 1VRDA 1O68A 3AAMA 4W87A 2ZE0A 3VMNA 1E3XA 3L39A 2VKOA 2EPLX 1N32T 5IRPA 3RX3A 3LI0A 3LCFA 4JDYA 5A95A 3E22E 3OLGA 3NKZA 3KVBA 1LWIA 1W5OA 4LU0A 1K7EA 3VIKA 2XU2A 4WDXA 1UR0A 1S2WA 1BYCA 5AFUL 3WD4A 4JFVA 5AY7A 2G4FA 5LP6E 3W87A 2WC4A 5ECVA 5BMXA 1BTMA 5I3DA 3H3MA 2J9YA 1V93A 1HVXA 3H55A 3OA3A 4DUOA 2E8ZA 2F2KA 1YMYA 4GX8A 3ZT7A 2XQ9A 2R91A 1XQKA 4YWSA 2R1LA 3PU8A 1O7AA 1FH8A 3FCPA 4CNPA 4C6FA 4O0KA 4ANJA 3B57A 1PX8A 3TQVA 3W7DA 3W82A 2BS4A 2C0HA 3OW1A 1NP0A 4IUGA 4YTMA 1W1A1 4NUWA 1EWEA 1U30A 4JHOA 1V9DA 1OFAA 4L1GA 5FL1A 5IFTA 3PUDA 1P0KA 3AUJA 1DXEA 2ZZ1A 2DU2A 2HPIA 1KM2A 3RKGA 4L6OA 1FCQA 1XMQT 6XIAA 2PRMA 5HMSA 3QFEA 2XVPA 3UWVA 1CXKA 2ISFA 2CE7A 4JTIA 3O4XE 1JDFA 4QJ1A 3P50A 3VHLA 3IARA 2HK1A 2HZGA 2PZ0A 4IFOA 4GXPA 3MKKA 4LVFA 5C9RA 3AA6B 1LRNA 2CESA 3LTYA 4F0RA 4LF7T 4FHAA 1WXJA 3NQVA 5AHIA 4A6GA 4S3FA 3BK0A 1GVYA 4FIRA 4XK2A 3G5EA 4OBRA 5HWMA 2YINA 4GO8A 2QLYA 1UD2A 3WH6A 3LLXA 3NIYA 3TWBA 3TU9A 3LB0A 2WVTA 3WF4A 2C0AA 3GC2A 4GGBA 2MANA 1EZWA 2ON3A 3LSBA 1S2AA 1Q7QA 4ILUA 3QQ0A 1ADDA 2PA6A 4XTDA 3RX4A 1UX5A 4H8HA 1ZP0A 2HN2A 4AISA 1IV8A 1LM1A 4UCGA 3C64A 3EXSA 1AZ1A 4AIBA 3WJWA 3QOFA 4MLRA 3DFSA 2CLPA 1M7OA 4JI4T 5IXEA 1R47A 4ZQOA 4GKLA 3WMSA 2R14A 3BVJA 3GUWA 2IMLA 3ZIZA 3WLHA 5GJNA 2CZ5A 3FEQA 3C0QA 3Q65A 4AVFA 2A9UA 3W1TA 2BY2A 1W3JA 1KNRA 1LZOA 1UWUA 4FP1A 5I3FA 3GAYA 3GWHA 3FJ4A 4F9JA 4PH6A 3S5YA 1VLIA 1V0NA 6PTDA 3MHFA 2YZRA 1V6VA 4DXKA 4EIVA 1A49A 2RFGA 5F4SA 4X22A 4AF0A 4M0XA 4N0RA 5HYAA 1PBGA 2QZRA 2ZXBA 3AU6A 2W79A 1JCTA 4JTSA 4PTNA 2HXUA 3RJYA 4ZI7E 1E51A 1X38A 2E9XD 4PUWA 3U2EA 2E7FA 1UKPA 2YPIA 3MUXA 4NZFA 2Y8DA 3TONA 3KVLA 5KETA 2QCDB 1RJQA 2AKMA 3PBUA 4IZGA 4AHPA 2LSYA 5I3JA 1GOOA 5LGXA 3I65A 1I60A 2CCQA 2PDYA 3QEZA 3QMTA 4GKKT 2YDAA 3QGKC 1GEHA 4TVUA 3FN9A 3IIPA 3BO9A 4UTFA 3AICA 4OYKA 1JUBA 4D9PA 2A85A 3NYZA 4DV2T 3W2LA 1IR2A 1YQ3A 1MW1A 2DZBA 2OR2A 4GJJA 3TOYA 1KFBA 1B1YA 3TYDA 3ITTA 3V5SA 2OCZA 4GPNA 1IF2A 2X9HA 5LHIB 2XIMA 2HS6A 1ZOYA 2IMRA 4UR9A 4I7WA 3PURA 5I3GA 1GVSA 1TE6A 3P61A 3QY8A 1JXKA 2BGQA 3AJXA 3VNIA 2J4GA 3NVDA 4JBWF 1WNOA 3DI0A 3D3FA 1KNZA 2A79A 1L2UA 3EEZA 2V81A 4YT0A 4NAEA 3L4VA 4LYRA 1TZZA 2D0HA 4MF4A 4GQQA 1I2RA 1A47A 4WKHA 3OG3A 3AZTA 3PS7A 4B5WA 3C8FA 4HNCA 3P5ZA 3LBXB 3N2OA 3HOJA 1J12A 1SJCA 1VBJA 4OQVA 1TO3A 5A1AA 5A6AA 1R8IA 1D0ZA 3F4CA 4CD4A 1Q7ZA 3EKGA 2VASA 1PAMA 4FLOA 2GDUA 4N4QA 1FWFC 4K8EA 3TC3A 4P0BA 3VRBA 4IE4A 2D5UA 1OD0A 3LCIA 3PBYA 3CV1A 1T96A 4P7NA 3LXAA 2WANA 3IEBA 2QGYA 4W5ZA 3VGHA 2WDRA 2GGHA 1I94T 1MEHA 4TN7B 3VGFA 2GQAA 1JXJA 1UA7A 1US0A 2KSRA 1XRVA 4LJ3A 4JFSA 5FAJA 3FEMA 5IM51 2D20A 2E8IA 4IPPA 1OCNA 3UXKA 3WQCA 2YW3A 3OZYA 1UJPA 4LW7A 4UNLA 1TELA 2BXYA 3GNPA 3GHUA 4GOAA 2LM2A 2D2OA 2P9BA 2HXTA 4IG2A 1JL8A 1UQZA 1OFQA 1MMDA 7ENLA 3FV9A 4OIFA 4HWDA 1RCQA 2V3FA 1BXCA 5HMFA 2QJGA 4QWNB 3N13A 1MZHA 5IDIA 3MXZA 4IXHA 3KCOA 3A3XA 5G2IA 3V16A 4AEOA 1G5AA 1Q5MA 3BJSA 5G2WA 3POHA 1H1ZA 4KF1A 3TC6A 1FKWA 5AQSB 2W92A 3BXWA 4LCRA 3PY2A 5HR6A 3DFQA 4CI2B 3WIJA 4DV7T 4RDVA 4AC1X 3Q67A 2ZM6T 4IMFA 1EGMA 3KAOA 3EA1A 1KKRA 1CX9A 5HA7A 4KX6A 3IF8B 1ME7A 2BV9A 3EA3A 3PZOA 3OQEA 3CQXC 4BZYA 4P7RA 2KWHA 3UFGA 4RPQA 4TXEA 4YCPA 1AW2A 1VJIA 2AQWA 2GSEA 3A21A 1IXNA 4PA8A 2QPSA 3KOYA 2H9AA 1DTUA 4XKYA 3TMQA 1HP5A 3UWEA 5AQQB 3XINA 2WMIB 3F1QA 5CC5A 1W5QA 4REQA 2NQ5A 1UD6A 3ZMUB 2INZA 3TYBA 2VELA 4A8LA 4ZZBA 4LH8A 2GSJA 4Q8MA 2WPGA 5AYZA 4DMVA 3C0SA 3NDOA 1PDYA 4DNMA 2QGSA 3LCLA 3GW3A 3MO4A 2IUZA 4KBMB 1C90A 2FVLA 2UXDT 4HU8A 4UQAA 4UVCB 1XFCA 2CWXA 2EG6A 1I1XA 1W2PA 4E7ZA 1GKRA 4KW2A 2BG5A 1RK5A 2FYMA 3DFHA 3FXYA 5AC5A 2A21A 3HQNA 4YTSA 1QU4A 1PHWA 2YDQA 3PZ9A 4GRSA 3WMBA 4O10A 2PDUA 1YXRA 1OVDA 3CGTA 3GTXA 2MYSA 3ITYA 4V33A 4NJHA 1GOIA 1OT1A 4KCUA 1T5AA 3EDFA 1KGWA 1E70M 1XYBA 3W00A 1EP1A 2VB6A 3TSBA 3ZYZA 3HZ3A 1UUOA 1RHCA 4ZMGA 1SFJA 4WY0B 4YIWA 4DF1A 4HA1A 4H9XA 1UZHA 5LG3A 1BRLB 2NQLA 1SJBA 3C4WA 1R2TA 1FA2A 5ABFA 5KSWA 1H51A 2E68A 2DZAA 8XIMA 1VGAA 2TRSA 3HN3A 4B5SA 2Y70A 2YA1A 3KLLA 3Q5EA 3W1NA 2LSJA 1A5LC 2GQ3A 3SUVA 4EIWA 3VD7A 3DCPA 5IYZE 4X62T 2UBPC 4NHVA 3F5JA 4LAZA 4OHQA 3K1SA 2PLCA 1RK6A 4B3ZA 1V3HA 4DYJA 2WPBA 3O9NA 1L8PA 1SO3A 2PTFA 1Q4NX 4X61A 1CPUA 4A3QA 4UCFA 5DMYA 1MMNA 5H2ZA 2RPAA 2AMXA 1TMQA 1KM4A 3VABA 2FZMA 2V3GA 3LCHA 1KWGA 3M5VA 3O1NA 4MYAA 4CUCA 3NVTA 2DUXA 4UV8B 3DUGA 1NWRA 1KRCC 1T7SA 2P50A 4UFLA 3G1AA 1OXZA 3KBMA 3ZOAA 3W72A 1C3FA 2QF8A 5HQLA 1W32A 4AB4A 1CI1A 3A24A 3AE8A 2HNEA 2ZVRA 5BMVE 4DIAA 4G2AA 1R87A 3M0ZA 1IGSA 2QJIA 2EHOB 2GGJA 2GUUA 1GTHA 1NDVA 1U83A 4JTJA 4FXRA 3DECA 1O1ZA 6CGTA 3LBCA 3AXIA 2E9XB 1G69A 3UPBA 1KM1A 1VFFA 4FNQA 1XV8A 3QOKA 1O1HA 4V27A 5LXEA 2BHZA 3VE7A 3QV6A 4RNJA 4WY0A 2OYKA 5A6BA 3QV7A 1VBHA 3PU3A 3UUBA 2DI4A 3FYOA 5I07A 3LQLA 2EF9A 3FAXA 4DMWA 1WOAA 1WDWA 2FGLA 2Y5EA 4Q6XA 3LM7A 3SUUA 3S6OA 1T0OA 4XVDA 1VFUA 4E38A 4PK4A 2PAJA 3G6MA 3U5YA 2CLYC 1LG1A 3PNZA 4MDPA 4PUNA 2WKLA 1HNZT 3UEQA 4EXBA 1E2AA 5HEOA 2TYSA 4DBWA 3WL0A 2C16A 3U8GA 3BLOA 3FVMA 3MUY1 3PJWA 3EDUA 4O8AA 1G94A 2DWGA 1AL7A 5DANA 1NU5A 3WJYA 1JEZA 2RJGA 2DT2A 3EOLA 5BWAA 3N17A 3LHZA 2A0NA 3FZHB 1KV8A 1XYMA 1MXSA 3NQAA 4MTVA 4J3ZA 4M6UA 5EBAA 2H3BA 2C15A 4IJBA 3UYIA 2WDVA 4UMBA 1TSIA 3P14A 3PUEA 4V1Av 4H3DA 4MMWA 3CMLA 4DUZT 1TUXA 2A6LA 4X1YE 2UXCT 3ALFA 1AQHA 5IHYA 1S3HA 2NOXA 2WMJA 3ZLHA 1BWKA 3LN3A 2E6DA 4KMQA 1VC4A 1ZY9A 3BICA 3WUFA 4CEXC 4JS3A 5KZDA 1PDZA 4FIQA 4L6HA 3CUIA 2OSXA 1O94A 1KBLA 3W9ZA 4MALA 4FXSA 1TMLA 4JLEA 4ZGYA 4KUMB 4PL1A 4BQ4A 4XB3A 3OP2A 4NXSA 4JTAA 4NAFA 2DT1A 2DIKA 3WQOA 4U33A 3BLKA 3WLPA 1E9LA 3COTA 3ANWB 2WP9A 4IGSA 3LM3A 1KCZA 4LVAA 2FJDA 2EJ1A 4FJOA 3EWUA 1YPFA 3R11A 1OX5A 1ZSXA 3GU1A 5H1WA 2CERA 4XUGA 1WKDA 4LY8A 3HV8A 2XPKA 4IPJA 2R1NA 1AH4A 1KQYA 4QBXA 1HNYA 2GVGA 5FF7A 1TV7A 2NUWA 3GN5A 3UYCA 2BXVA 2QJHA 2PS2A 3R94A 3LYEA 2O55A 5AQFB 3X1DA 1BD0A 3BARA 3LK3B 3DBNA 2YGYA 1MEWA 2RH9A 4MOZA 3RPDA 1K8YA 2YJQA 4GK5E 4YHHT 2BP1A 2ZX8A 5IUXA 1U5PA 4S3CA 2I59A 4CEUC 4DUVA 3CAKA 3LD5A 3O7UA 3R0DA 4MZ1A 2WMHA 1H3GA 4UTHA 3M0LA 4YFSA 4NNCA 2GPTA 3FB2A 4RL3A 1A3WA 2CKRA 2VZSA 3PC0A 4U7IA 3VCNA 1XC6A 4H2HA 5IDZA 4IPIA 5M17A 5LBQB 5LA2A 3ZFHA 3W6LA 2IQ0A 4QAWA 3WUBA 1WUEA 4DF2A 3K1DA 3MCNA 1J2BA 1H0IA 1R85A 4W7VA 3I7RA 1GKPA 4AVNA 5FIPA 3VCRA 1MIVA 3RMJA 2Q01A 4HFHA 2QCLA 3W1LA 2VD8A 1ZHAA 2BG9B 2Z6IA 3LBXA 1QNQA 2ZX9A 3VKJA 3E0ZA 3R6IA 3R89A 1DXIA 1M65A 1W1PA 3G18A 1QO2A 4DPPA 4JV5T 1XLAA 2BHYA 3WDQA 1SSGA 5BYWA 4HWIB 1TX2A 4Y6GA 4D6IA 3HKCE 1KWKA 4TUYE 2WSKA 4CU7A 1I0BA 2OEMA 4LFAT 1VD6A 5EYWA 4Q25A 3SI9A 2FQIA 1WE5A 3SZ8A 3G8EA 2ZDRA 3URNA 4YVPA 2DDXA 5I0DA 2J9XA 1S5TA 1QNPA 2HE5A 2PLKA 1CWYA 4L1WA 5CB4E 2Q71A 1AQMA 4HE8A 5TF0A 5ETWA 4X9SA 4H9UA 1GVOA 2BMBA 3A22A 3RK8A 2JJ9A 2Z2UA 2VC9A 4G1NA 1XDLA 1WCGA 2ZZ7A 3CZLA 4HNTA 2KINB 3DC8A 4D6GA 4WYVA 5AQPB 4LUIA 3R1ZA 2H6RA 3VKKA 4JEJA 2WBLA 2IPFA 3SCRA 2O7QA 3MBDA 1E7PA 3BLFA 4NF7A 2BXZA 5FACA 3BAIA 3UU8A 4J35A 4O28A 4F0MA 3VGEA 1DJXA 2VUNA 1X39A 4IGMA 4JCLA 3FBZA 4MM1A 2G96A 2NW9A 3GG0A 3MV01 4XZMX 4EYUA 4P2VA 4RV3A 4R88A 2B81A 2ZOXA 4NJIA 5LXTE 1OK4A 5CC3A 3STPA 3PDYA 1EO5A 1K6AA 1JPMA 2X1IA 5HEJA 2JE8A 1SUXA 3DN5A 2OT1A 3LBMA 4GISA 4JEQA 2YW4A 5HANA 3FXDB 4D1JA 4AY8A 4TTUA 4Z0SA 3N9LA 1OF8A 3QV8A 2FBWA 3FKRA 3HBLA 3W74A 5GNZA 4PTDA 1R7OA 3NOEA 2GVEA 5M5DA 4JN8A 3SCQA 1H11A 1IHIA 3UJFA 5I3IA 2DVXA 3ITGA 3CL6A 4D6FA 1K70A 4NPPA 1QI3A 3UVAA 1UMYA 3ZJ1A 2WAUA 3KRBA 4IJCA 4ERAA 1ZZMA 3PE0A 1WQ5A 2GJPA 4O8SA 2PWDA 3CEUA 2Z2BA 4IH3A 4WDUA 3WI3A 3AROA 3LK42 3LPFA 1I6NA 3IRSA 2YXOA 4GBDA 2BY3A 3MVTA 3BQLA 3F4WA 4PCTA 4AY1A 1M6JA 4PODA 4FXJA 1MFVA 1S5VA 3MCMA 1J96A 3M6DA 2ABAA 2J6VA 1DQWA 1ISYA 2QCFA 5FXZA 1YQ4A 2PWEA 4CU6A 2UXXB 2Y8VA 1N8FA 1HVQA 3T0DA 3F2BA 4U7YA 2HVNA 4AD5A 4ATLA 4HFEA 3FHNA 1LUCB 2OO0A 2C91A 4ACZB 1Q3NA 5HXSA 1ZCCA 4O53A 4ILAA 1TJ2A 4P7QA 1EJUC 5ENLA 1XMOT 3PSWA 2J74A 1SA0E 1QATA 4FNSA 4PMOA 2IAKA 2LLYA 3VR9A 3QVQA 3P74A 5LSMA 2YKSA 5CSUA 4JEUB 2FKPA 3HG2A 5D37A 3W38A 3AUOA 3P0XA 4R7JA 1P7TB 2WAGA 5IHRA 4YNGA 4F3HA 2VMFA 2AL1A 4P09A 1W56A 3C0JA 1H1NA 4ZO6A 1PUDA 4ALDA 4QH5A 4EGWA 4Z1BA 1YPXA 4DELA 2FHBA 5GPRA 3P7IA 2J78A 2PDGA 1NM9A 4OFZA 2GVYA 4FR1A 1AJ3A 3SN1A 1BR1A 4HU0A 2PDBA 3GVWA 3OVPA 2A2IA 2RUSA 1EEXA 1LBFA 3U9IA 3NZGA 3JR2A 5DMMA 1RR2A 2G41A 1E55A 3W22A 4B4HA 3G1XA 1JYWA 3E38A 1EGZA 3WDRA 2IQDA 1JNZA 1KQZA 3CIVA 4M56A 2XAGB 4JTGA 1LLOA 1M68A 3GNDA 2WZIA 4HA4A 3CZEA 2FMOA 2J7GA 1R2SA 1ZKEA 4MNJA 3AZSA 1BHGA 5D8WA 3Q58A 5JUVA 1ZBVA 1B54A 1UZDA 4Z8XA 4J27A 3SCTA 2VL8A 5CFBA 2J88A 1PO9A 2WMNA 3RCMA 3IJ6A 3ZR5A 3BG9A 3L2IA 2BVLA 5HK4A 1NAL1 3PPGA 1E4IA 4IX0A 4GQRA 4LAUA 2ZTKA 2A3AA 1WB0A 2OLAA 4ICCX 3V36A 1JF5A 1XL9A 1W3TA 2VFGA 1NY1A 1UP0A 2XTKA 3G1DA 1E1CB 3G1RA 4XWUA 1RQEA 2AAMA 5HOSA 1BF6A 5MHBA 1BSLA 3WNKA 4O4IE 4RE2A 5I02A 1T41A 2ZYFA 2P10A 3OLEA 1Y8BA 1IZJA 4IGNA 3DG3A 1X9BA 3H2CA 3T8LA 4QLKA 3HQ1A 5AVNA 1KGUA 4WDWA 5JMUA 2WNQA 7TAAA 3KTCA 1F61A 4C6LA 4DWSC 4GIAA 2F6UA 1OZMA 4C91A 3N15A 4DLFA 1J10A 1V6YA 3DHPA 5GNYA 4AEEA 1KO0A 2WQYA 1OABA 3I7QA 3OPCA 4UXDA 2AAAA 2PI6A 3H3AA 3V75A 5D2XA 2NW8A 4PN2A 3GO2A 4E3VA 3TFCA 3CIXA 3CT7A 2ZRWA 2DVTA 3OZMA 4FSAA 1JYXA 2IW5B 2OXNA 4LFCT 1AMYA 4BWLA 4FNUA 5HEUA 4AD3A 3WDIA 4OUEA 3I6TA 5CGTA 4CD6A 2NLIA 2JMHA 1CGTA 1VBGA 2QJMA 3OVRA 1XIGA 3QKEA 2NT1A 1VOMA 1L6FA 1ICPA 1XFBA 3N12A 4O4WA 4DQWA 3DFNA 4Q4QA 1F4HA 5H6HA 2V5JA 4A22A 5D2YA 2A3BA 4EVZA 2INEA 4PEEA 3SW6A 4LMLA 1YLVA 1WBHA 3GFYA 4PMVA 3GDMA 3AYVA 4UZUA 5BXTA 3RKOA 4GC4A 5C2TA 1G6CA 1GYMA 1OFPA 3QKZA 3TN3A 3ITLA 1TJ0A 4L7ZA 3LV5A 5L9FA 4I5XA 1Z32X 1HF6A 1XD0A 3T78A 3H26A 1A4LA 1Q6QA 4LS2A 3D47A 3LLFA 3OQ8A 4LNYA 4DJED 3R6NA 1DKWA 4BFAA 1UOKA 3KBNA 3AHTA 1IWPA 4YVVA 4ZEPA 4ILSA 1DJGA 3TFXA 2R94A 4F48A 1K4GA 1WR6A 1NWMX 1P6WA 1QT1A 3AEDA 3MHGA 4IFRA 3S4TA 3MC5A 3HGSA 4PCSA 2OLTA 3TLWA 1EO7A 2ZUSA 1ZAIA 3W86A 1JZ3A 3DYOA 2WJFA 4NJGA 2WZEA 1TPEA 3UA3A 1O66A 4FLSA 4JL1A 2JK2A 1V3MA 2C71A 3UXLA 1HG3A 2VKHA 3AWNA 4L4LA 2IW0A 1GOXA 1XLMA 1HKVA 1OFBA 2YL8A 5D38A 1LRQA 4C7FA 3SFDA 4LF8T 5K4XA 4AZGA 1SZRA 3TTSA 7REQA 1E43A 3WAKA 4IGHA 5XINA 3ESLA 3MKCA 3N2MA 4IDQA 2D0UA 4CNUA 5ABFB 3OPSA 3WL1A 2ZLYA 3MP3A 3V5OA 2W4XA 4BA9A 3V0SA 5FXVA 4YTNA 3BV7A 3LHYA 4WRHA 1TR9A 3T4WA 4W7WA 4I0UA 4PEKA 3R43A 4I55E 5C6MA 4WOQA 3GNRA 1M04A 3UJ2A 2NUXA 2VEPA 4XBKA 3UR8A 1IIGA 3EA2A 4N2YA 3IIVA 5IBXA 3VZXA 1PZ2A 4FX6M 1HCIA 3HPFA 2UUCT 1W9VA 5BRQA 3S0CA 4CQDA 3RYFE 2CU0A 3QTPA 2PEVA 5L3BB 1E73M 4MG4A 1WZMA 5LMUT 5CSYA 1Q2RA 2AQVA 2Z25A 1BWVA 3KZSA 4CVUA 1EZ2A 3VD3A 5CJ5A 1QNVA 1RH9A 3N29A 3NZRA 1WYCA 3AHXA 1T8BA 3ETUA 3AYSA 1Z8UA 4O15A 3RUBL 3BQ6A 4H2CA 4LEQA 2NXIA 1MYRA 4A21A 2PSNA 4D6CA 1G8XA 2I6HA 4L9XA 3U3IA 5C9XA 4PK5A 2JRKA 4M6VA 5A2CA 8RUCA 1HKMA 1WP6A 5DO8A 1MVYA 2V68A 1W37A 2IKIA 1V02A 2X8RA 3AIUA 1S5NA 2VP8A 5CPQA 3XIMA 3T1YT 3APYA 3O6AA 3A12A 4GJ1A 1FH7A 3DG7A 3ZS4A 1W1ZA 1XZYA 5D4YA 2X2GA 6XIMA 3A5FA 3MMWA 1Z0PA 1D0YA 3BCDA 1YTEA 3VILA 1Z44A 4X66T 4TX5A 2RDUA 5M03A 1EF3A 1EP2A 1XH0A 5XIAA 4CD7A 1PZ1A 2A3HA 4AG0A 2G97A 3UY7A 1SHZC 2OYLA 4JD4A 3C50A 1EJTC 4M1RA 4MKSA 2MNRA 3QMRA 1ITQA 4ILBA 4DY1A 4Z90A 2H89A 2FPTA 2PDKA 2C1GA 1W6TA 1W0AA 1TMHA 2VQET 3SFKA 3ONLC 1U5JA 2XQ6A 1DTNA 5T9CE 3GZAA 3ZEFB 4C1LA 4MLJA 4TWFA 5DF0A 1ZNNA 2QAFA 4H6QA 4S2CA 4UTWC 3TTQA 4MBQA 1HX1B 4UTUA 6ALDA 4IT4A 1H41A 2WVVB 4LX4A 3GTFA 1BKSA 3ZVHA 9RUBA 2QPXA 1E72M 4U74A 2A3EA 3ZLFA 3AE2A 4CXXA 5TQLA 3TOPA 3CMFA 4H9VA 3FK4A 3SN4A 6REQB 3QR0A 1NDZA 3VI2A 3UWUA 1T8QA 3FA4A 3GIYA 1KFLA 3ZMZB 5C3JA 3GH5A 1RUSA 4MNLA 3BOLA 1W9PA 5HBFA 1XCXA 5GVJA 3NQ2A 2LRLA 3WDPP 1REQB 2J13A 4XUYA 2YK0A 1T72A 1TRIA 3HQOA 1BTCA 1OCBA 3GU2A 3EWXA 1QOQA 1U2YA 3N6JA 2W2UA 4YXDA 1NF0A 4QSFA 5JTGA 5LNSA 3DFOA 1IAPA 1C92A 4AQLA 2IC6A 4BKNA 3N2KE 3SCVA 4AFYA 3QPYA 2J77A 3I3BA 2V7JA 1H7CA 2J24A 1P0NA 5M4YA 3WH7A 4JKKA 2EPHA 2F6XA 1ADOA 4BWLC 2QULA 2YIHA 3S2JA 3HPAA 1HFBA 4V1XA 1KV5A 4XAZA 1ECQA 3KBTA 3FBLA 4B16A 4U3AA 2JIWA 1LROA 3LUTA 2A6NA 5I6SA 4H9RC 4HNNA 1DIEA 5L4HA 3ZQ9A 2SFPA 2EHHA 2V7MA 3GDRA 4ZI3D 3GQYA 1BYAA 1W5MA 3BOFA 1BVWA 3B40A 3MZ2A 3WQ4A 2BVYA 3RITA 4HOWA 4UTLA 2AGTA 5T26A 3ABVA 2PDCA 3AMKA 4Q7BA 1SO6A 3GR8A 3Q37A 5JH1A 5A8NA 1W9UA 3TW9A 1HX0A 4WBOA 2VT0A 4XIAA 2QJNA 3NM1A 4C6CA 4G63A 1E5JA 2ZZ6A 4GZ7A 4WSKA 4GGHA 3W7CA 4AYGA 3QGVA 5JVLA 1VJSA 1WYIA 2QDGA 2EKCA 4JTFA 1TV3A 5BXPA 2IKHA 2MTQA 4YVXA 3A9IA 4OKDA 5I3KA 3W02A 4JIHA 2DPEA 4GVGA 3TR2A 4Z1YA 4PUDA 4M8UA 4AVOA 3VOIA 1NARA 3HG4A 2BDEA 1H4PA 4GX9A 4IL0A 4AX7A 1IGWA 2E25A 3CMJA 1IYXA 3NSXA 1OYAA 4AX6A 2VEMA 1JGIA 1UASA 1DJZA 3KVMA 2ZM2A 1KCKA 3B97A 3RFAA 4DAFA 4EANA 1A5SA 1NJJA 2CLIA 1Z6KA 3DBPA 4ZFCA 1F74A 4R33A 3MP4A 3IIZA 3K3NA 1SO4A 3RX2A 4A3RA 1T99A 2ZFAA 4LVGA 1TJPA 1UD4A 3WQDA 3ZO9A 1UH2A 4UOZA 4HSHA 5JBEA 1H61A 5JRCA 3ZJ6A 5D9PA 4ADUA 4DO4A 3S5SA 1E4MM 4ZL1A 2OKOA 4S38A 4L5ZA 1H7NA 5AQKB 3CQ0A 3PPCA 2Q8ZA 3WZ0E 1LJYA 2PGWA 4C6BA 4GC3A 3IEEA 5JDNA 1EUAA 1VIWA 1T98A 3TP4A 3C6CA 3ZMTB 1PKLA 1XLHA 4YCOA 1H09A 4DIDB 4LCSA 1R9XA 3HM7A 1EC8A 4DWSB 4PSRA 1UBSA 3ZWSA 3I7SA 4NRRA 4RX0A 2CMRA 1DWAM 4DNHA 1F6PA 4AKHA 2GWGA 1Q45A 2UXBT 1QPQA 5LNRA 2Y7GA 3PTRB 4BS0A 3OGRA 1GGOA 1GOWA 3F5KA 4FX8A 2NV1A 1ZS2A 2CWYA 3L5LA 1REQA 2RKXA 3RPTA 1YDYA 2F8QA 2CXGA 2VWSA 3IIOA 4HHMA 4HJFA 3QK6A 4US5A 1RBAA 1HFAA 4FAMA 3WNNA 3WDJA 5L3FB 4F66A 3VC6A 4FK9A 1CHUA 4E7SA 3IGXA 3LRMA 3PZTA 1SO5A 1GJPA 3SEPA 5LIWX 2ATSA 4H83A 5FJPA 4ACYA 2UZ9A 2ANUA 4HPGA 3V18A 4A98A 3BG5A 5LNVA 4M80A 2E9XA 4HU4A 2UV8G 2HV5A 3TXZA 4GI8A 2FJUB 2ZDSA 1P0BA 3FFSA 4FI5A 2X05A 1PV8A 4D8LA 2W62A 3H4GA 4B3KA 2GGGA 5AC6A 3H8AA 4H9TA 1OC6A 1MZRA 2PFVA 1UOZA 1PHQA 3KINB 3GB6A 1I2NA 3AS0A 3OO2A 2QCCA 4AXPA 2V63A 1WXZA 3WG6A 3TLSA 4G7EA 3TJIA 3PUWF 3A5XA 3EHZA 4F0HA 3RG6A 2VM8A 3QZ6A 4AQFC 4PJLA 4CQAA 4C6NA 3DZ1A 2JF7A 3B8TA 2B4GA 1IEWA 3SRZA 3UULA 4I5UA 1EBHA 1TPB1 3LGDA 1FJGT 1TV8A 3LRKA 2GLKA 4HGAA 1OC5A 3LRLA 5LGNB 2NR4A 2XSBA 5JDHA 1RLCL 5FF2A 1SSDA 2OLSA 4KPLA 1XLCA 5I06A 2QA7A 1EJWC 3BLDA 3PJAJ 1OGBA 2H3RA 5D33A 2VFDA 4XAGA 3SQLA 3NTYA 4AAJA 3R8HA 4PFMA 1IBLT 3HMCA 1E0VA 1I75A 1XGZA 3R0UA 4H9PC 3W88A 3TYAA 3RLFF 3KL3A 4EXAA 1R9YA 4MLKA 3KV9A 2ODUA 4UV9B 2YZ5A 3M5YA 1L6WA 5FXXA 4JNMA 4O4JE 1PE1A 3S42A 3I3DA 2G5WA 2ZXDA 3PPHA 2VHLA 3KL5A 4M1BA 1HJWA 3JAEA 2CLKA 4DBUA 4CQIA 4W85A 4PTWA 1TREA 2FPVA 4WJEA 4LGXA 1P0DA 3NQCA 2QQ6A 3E0LA 2ZZ5A 3CK6A 2ZRUA 2BODX 3HGJA 4AH7A 3CPGA 5J5RA 4L9ZA 4BHYA 2M6IA 5L6UA 3H2NA 2WCAA 1HJUA 1P0EA 2QCEA 4ADSA 5JU6A 4KCTA 3PAOA 4XTIA 3ZJKA 1IZNB 3MY9A 1PXGA 2E1WA 1TCMA 5EL1A 2NX1A 1EWDA 2UU9T 4AHQA 3MYPA 4IREA 3AEBA 2OSWA 1OWAA 1I2OA 4AZHA 1JZ8A 2WMFA 3UG5A 4BAYB 2Y62A 1MW0A 1UWAA 3M0MA 1IZKA 5CAHA 4IDPA 2BKOA 1JZ6A 1K7XA 3UPWA 3PBVA 4HGXA 1MWOA 3BG3A 3W0KA 1CGVA 1HGYA 2HMCA 1HXJA 3SS1A 2DEPA 3EABA 4DJEC 3CB8A 3RIUC 3H21A 2JEPA 1KM0A 1A5NC 3M0KA 2ZX5A 6A3HA 4RPPA 1MMAA 4F2UA 5FMNA 3B0PA 5HXCA 3BANA 3RU8X 4L1XA 1BYBA 3D3AA 2XAHB 1FWBC 3NRYA 3C52A 2J7HA 4FS9A 1Y5VA 5LJNA 3TIMA 2L3LA 1NOWA 1HJXA 2HWGA 4LUSB 3AS2A 1OSEA 2XWEA 1QK0A 1Q4WA 3PWAA 3V0UA 1Z89A 1HL2A 4HFDA 3M1ZA 4K3ZA 3PB0A 1XIMA 2CXLA 1Y5XA 3WLQA 2QCHA 1CCWB 3QYSA 4C6QA 1D1BA 1ZCOA 2BG9E 3AOFA 3NDZA 1IJ5A 5AQMB 4JI1T 4GNKB 4JTCA 2DSKA 4B3RT 5LHFA 2QCGA 5CBIA 3GNNA 1S1PA 1VLWA 5G1YA 3DHFA 1BSIA 4FNPA 3KHDA 1ZJHA 3UU4A 3G0XA 4QNEA 2ZA1A 3M64A 4S39A 1ZQ5A 1R9ZA 3IVTA 4DUXA 4DV0T 1U1HA 4GA8A 4AKLA 4LT9A 2J6XA 1DE5A 1V7AA 3ZXWA 3M46A 4H9NC 1HQTA 1A0EA 3S5OA 2X51A 4JOMA 3W75A 4JTUA 1DHPA 3PAJA 5E70A 2QCNA 3AAIA 3TTEA 5FF3A 3EOUA 1L0VA 4I43B 3T1GA 4WD0A 3BGAA 3PM6A 2QUVA 5U7SA 2GK1A 3IANA 3P3BA 3U5UA 1W1B1 4OX9T 4QQ3A 4F40A 3BLIA 2NVAA 1IXPA 2VOMA 3VXGA 3QJAA 1IT8A 4J3WA 2AQOA 4G9PA 3PTMA 3U78A 1OEPA 2ES0A 3TW7A 2QDHA 3OTOT 3EWYA 5CPMA 3VNJA 3USBA 5A6TC 1P43A 4IP7A 2ACZA 1A50A 1QHOA 1AJ0A 3AFBA 4NZ5A 4TIMA 1XIIA 1U1JA 3TDFA 4E2OA 4S3DA 4K7YA 3P5YA 4JNYA 1X6LA 1D3GA 5FY0A 2E9LA 4C6EA 9XIAA 3L67A 1D3CA 4CXYA 4U72A 1KW1A 4HK7A 3VKGA 1RD5A 4N02A 3VMOA 4ZE5A 4HZ7A 3THCA 1OFRA 4XO6A 3ETVA 3NPXA 5A8QA 3ZYLA 4J2PA 4BQ2A 4I7VA 3N1AA 4ZO8A 4LF6T 4Z2JA 5KINA 4PBEA 1V0KA 4O1CA 4YU1A 1YX1A 1VFHA 1V6XA 3LZ3A 3AAEB 4EXTA 1E6NA 3W7OA 1PYFA 2Z26A 3EB2A 1XBVA 5L3DB 3W1RA 1EF2A 5FF4A 3CX8B 1DHKA 4GLEA 3V7PA 2DH2A 3F5LA 4ZODA 3CWZB 4P8WA 3WQ6A 3RH3A 1S2TA 1F73A 2PTYA 3WO8A 1E1EA 5AC7A 3NZ1A 3W7EA 2QCMA 3CV6A 2GK1B 3LPGA 2QVNA 2XQ3A 1LOLA 3EMCA 5J2UE 2EPNA 4JIEA 1E6ZA 5CC7A 1W1IE 1D8WA 4URIA 1PZ0A 2YDRA 1XC4A 4GACA 4XZHA 1I2PA 3NWIA 2ALRA 4QDMA 3ZCIA 1F3XA 3H24A 4BJMA 3GDTA 1J9YA 1EPVA 4E2BA 4PK6A 1S35A 2PLJA 4ASKA 1VRBA 3VDGA 1Q7MA 4U3CA 1LUCA 4W84A 3RHWA 1OK6A 2EG7A 3WK3A 3DERA 1MI3A 1DIDA 3SSZA 1LDCA 3NBXX 3T09A 3TQPA 4X0VA 4O14A 2AMGA 4N9BA 4W4QA 1BG4A 2WY2A 3WQVA 5M2FX 2XN0A 2V30A 3W7RA 4QEHA 4YTQA 3TJLA 2R1MA 4GVHA 1H49A 1E9ZB 5E9XA 3GR4A 5AHMA 3JW7A 5A2BA 4LFBT 2Y5SA 4TU1A 2BOFX 1JCMP 3RIUA 1RJPA 1BQCA 4O4HE 5HXHA 2GYIA 4DZHA 4UZSA 3REQA 4UOJA 4KCVA 4YYFA 4DM2A 3FX4A 4MJMA 2VI0A 3AC0A 4DO7A 2XJ7A 2E3ZA 3CB3A 1ODZA 1XYCA 3RPUA 2WNWA 5HXRA 2OGYA 4AW7A 3JS3A 4C60A 2EHOD 1PCKA 5A94A 3RCNA 4YLWA 4KFNA 3ANWA 4PSPA 3GWQA 3PBGA 1ZALA 3HG3A 1R3VA 1JIBA 1VR6A 1MFUA 2VKZG 2WWDA 4PMQA 3SY5A 1RY0A 4UFKA 3UQ4A 3C0LA 3ABOA 4ZZ9A 4K0UA 2WBKA 1Z48A 3K3QC 1UH4A 3KEHA 3CHDA 5DQWA 2A7PA 3DC0A 3WQWA 2QDDA 2VJXA 3D6NA 3EOEA 1DJIA 2A1YA 3YPIA 2F6KA 1WDPA 1WUFA 4NIRA 3SSJA 2WM1A 1FWCC 2H90A 1JF6A 3A7MA 4M1PA 2WK2A 3WQGA 2KT9A 2UXNB 2YN6A 4HOXA 1HW6A 3V5FA 4BF5A 3I6RA 5D8ZA 1CYGA 4Q8NA 4CI1B 4H7ZA 4US5D 1JDEA 4G2DA 4JGDA 3OB8A 1EB3A 2PP0A 4DJFC 2I56A 1OFEA 5HDRA 1GHRA 2GK9A 3G0SA 1Q6OA 3KVKA 2DHRA 3EDJA 1US7B 2DSZA 4K37A 1Q6GA 2RGLA 3ARRA 3B05A 4YXGA 4AEFA 1CUNA 1CXHA 1FOBA 3Q2DA 1S5MA 2D73A 3GSMA 5FA5A 1UKOA 5G1MA 4EKJA 3T81A 3I0OA 3G77A 4ERIA 4JICA 1QI5A 4RXGA 3G6LA 1FWSA 1YDOA 2A4AA 4HPHA 3SRFA 3Q94A 4INFA 4QISA 4MADA 1OFOA 2WJDA 2IPJA 4CN4A 2OX4A 1XGEA 5C7HA 5CBBA 3CUXA 1KFJA 4R9OA 3AIEA 2XZ7A 1DVJA 1KCXA 2G3IA 1K6WA 3E5PA 3W7PA 3GMIA 4GH3A 4A29A 4PCPA 1ZEEA 2YR1A 1E4NA 3RRAA 5C2CA 3P4QA 4PMRA 1OB0A 3P62A 4E8DA 1UURA 2INFA 4C6PA 1FWGC 2LRKA 4CI3B 4TV8E 5IHSA 2E1DA 3VD5A 1J5SA 2CRBA 2J9ZA 3P8CD 3ARWA 3K4AA 4ZQMA 3OGSA 4J4KA 4HYWA 1QJWA 3PFMA 3GIQA 1AL8A 4O18A 2WKGA 3ZT6A 2PU1A 4HPXA 3CQKA 3CJPA 4QXHB 4ZQNA 5HAOA 4EE9A 4OOUA 1WCRA 3CQGB 3NAVA 3UZ5A 4I9JA 2LJLA 3GHSA 1SPQA 2NQJA 1XF0A 3W3OA 2V7LA 1AH3A 3H7RA 1TB3A 2OZTA 5FESA 5HEGA 1G4PA 1ONXA 3W7GA 4S3JA 4V15A 3EGJA 3EDDA 3CWNA 3W81A 4KCWA 3VD4A 3ZT5A 2K24A 3P2VA 2FB3A 1VHNA 5DT5A 4FNRA 4DR2T 1E71M 2Z1KA 1HKJA 3EI0A 1A5BA 2XQ4A 1KD0A 3PSVA 4E6MA 1N34T 2XH2A 4NAEB 3WAJA 1S2CA 1KBKA 1XRSA 1PX4A 3DXIA 3R8GA 1XRTA 2NSOA 2EKGA 1GQNA 3CS2A 4LEFA 2VR5A 2HDJA 5HPCA 3EX4A 1BG9A 5KTLA 5EZYE 1M9HA 4EWJA 1SUMB 2QT3A 1ZBKA 3TEVA 1Q6RA 4B5UA 3NRXA 1TVLA 3TJXA 3AISA 3ITCA 3LDVA 4TO8A 4W8BA 3ID7A 5AQRB 3ARSA 2OOFA 3FSTA 3PZGA 5G4WA 1J4EA 4AWSA 2FDMA 2TSYA 5K2ZA 4KFOA 4PFHA 3W85A 3OIHA 5FF0A 4GYPC 3H23A 3SURA 5EK2A 2V0TA 4H19A 3GE7A 4HCDA 4QFUA 4HPJA 1HG2A 3GC5A 2J62A 2V6XA 3O8AA 4XBJA 3T0TA 1VF8A 1A5AA 3NL6A 5J1GA 3CU2A 3C86A 1DWFM 4Q22A 4W8AA 5JRCB 4MZ8A 2DZSA 4HVXA 4I6VA 1E1HB 1VFLA 4WIWA 3TSMA 4Y7EA 4DI9A 3TAKA 5JH7E 1FCVA 1GQEA 3SN0A 1TTIA 2XFFA 3O15A 2VC5A 5CPLA 2W6RA 3VVGA 1F8MA 5TD4A 1RP8A 3UWYA 4AF0B 5LG4A 3G1SA 5LMNT 3KBUA 1PCWA 1V77A 4H9ZA 5FJOA 1MQRA 3CTTA 2CIPA 4A4AA 3I9WA 4JI5T 4XISA 1O6IA 3OOQA 1QASA 3AMCA 3WMCA 2QUUA 4H9OC 3AEAA 4NUVA 4X0NA 3REQB 2Y8KA 3DOPA 4QLLA 4N9DA 4ZSUA 3S47A 2CLFA 2J1DG 5HQEA 3FJNA 1VZWA 2B0MA 1E6QM 3APGA 2GJXB 2EO7A 3BLLA 1B4KA 2GZXA 2ISDA 3MACA 1FHUA 3N04A 3XISA 3PUGA 3ZSTA 4IM4A 4B15A 1NQKA 1XDOA 4GQBA 4GNJA 5LIKX 1SW7A 3CLMA 4HB7A 3RF9A 3THDA 3UUNA 1F4AA 4UFIA 4PMJA 4WCJA 3NL5A 4NXKA 4JIQA 2Y61A 4N9CA 4BF7A 4BY3A 1ZPTA 2VEKA 1W8GA 2NV9A 4PW8A 1K3UA 4I6KA 1ML1A 4MFRA 4OV4A 3PBWA 2B7QA 2VVSA 5D2WA 4EAYA 4CN6A 1P6CA 2WS3A 2YBUA 2JKEA 1G7UA 4BJNA 2ZKMX 2K9AA 4I50E 2IXUA 4AD4A 2H7VC 1J2WA 4J5NA 3SBFA 4C5YA 4KEVA 4M51A 2YFNA 3U2ZA 4NY2A 3GH4A 2JQQA 1QI4A 5A6KA 1QW7A 4U5KA 1SM9A 3ZMVB 2ZE3A 4B3ST 1PEZA 1DP0A 4KWUA 2QIWA 3E3HA 5FY7A 1JPHA 1EJSC 1Q85A 1XIEA 3W27A 1P7TA 3T2QA 3OLIA 4FLQA 3A4JA 4XSMA 3WK1A 1IR1A 3FIGA 2X7WA 3BLEA 3QY6A 2I14A 5CLTA 4ZI2D 3WH5A 1NTHA 4ISSA 3NQBA 3GNXA 3BAKA 4UIOA 2NWRA 5HJXA 3SGGA 1EHAA 5TBOA 1LWJA 3F2DA 5CZ0A 2CZEA 5LGZA 3M0XA 2C18A 2ZM8A 3L2LA 1P5BA 1NP2A 4YTTA 4GK8A 3GVVA 2E9MA 1Z8AA 4MUPA 3KOZA 3QR1A 4NL1A 2PWHA 2HVOA 2IS7A 3HQPA 5DJQC 3AIQA 3G0UA 1OINA 3S6TA 2VX4A 1GG1A 2BG9A 1XD1A 1SZEA 2FH6A 1E6RA 1FWWA 1M3UA 1R2RA 3QOMA 5I23A 3T4CA 4MIMA 1G0CA 5FEWA 1JYVA 4GKJT 4DYEA 4F0SA 2KLQA 4CU8A 4ORIA 4XAYA 3G1HA 4NKCA 2OZ8A 4AQGA 2X1UA 1SYTA 3TA9A 4S1FA 3KS6A 4IMDA 1B3YA 4P7OA 3B0XA 3A13A 1ECEA 1OG0A 2XDFA 1C93A 1F6KA 4XD3A 2PDPA 1KXHA 3QSRA 1O5KA 2EPOA 3O0KA 5MF5A 4I9MA 3NVOA 3KZPA 3L12A 1RJRA 1EJXC 3UF9A 1JNDA 2WXDM 5AZ0A 3Q5XA 4B9YA 5H6RB 4DBQA 2J8FA 2XH7A 4HPNA 4JTTA 2PRHA 1QBAA 3W2UA 1WPCA 4LYPA 1ISVA 2O9PA 3GTHA 2QCDA 1ITCA 3LMZA 4O16A 2OFJA 1MIWA 2R6GF 4Q8WA 3M3ZB 2DLRA 4DJDC 3P80A 4KETA 4V28A 4AHOA 3CHFA 4UF0B 2GVLA 1R38A 3N4FA 3TLVA 4B4FA 4XKYB 5DMLA 3B8WA 3W83A 3PR2A 1XYFA 4EWND 1W1YA 2DQWA 3ONJA 4OUIA 3UZWA 3VPLA 3W1PA 4ZTYA 4FOKA 4A56A 2D0GA 3AMGA 4XZ9A 3BSMA 3H2FA 2JGYA 1VEPA 3BL3A 4EZHA 3KBVA 4IG2B 4UNIA 1J93A 3S2CA 1Q63A 1W91A 1D9EA 2VWAA 1EP3A 1QPNA 4JTEA 2WYSA 1GOQA 4WLCA 4HU3A 4MKVA 1FRBA 1WZAA 4K7VA 4FNTA 4JX6A 2GJNA 3VKHA 1WKEA 2HH7A 3M5ZA 1EOKA 1VFOA 2LSIA 2AKZA 1E4LA 4F2BA 3W15B 1K1DA 1GVRA 3EDVA 2W91A 4UF0A 3M0IA 4U31A 3NZQA 3R25A 3TKFA 3VIFA 3WJZA 4R7OA 1MSSA 4XX6A 2OJPA 2WU5A 1CENA 3IJ9A 3A4AA 3PWGA 4FLRA 3OJGA 1NFGA 3VGBA 1LCOA 2SPCA 1YDVA 3W24A 2I5QA 1CXFA 1R30A 2I5IA 4NNAA 5CZKA 4QH1A 2V3DA 4XD4A 4MNMA 5C7VA 3ZVHB 2QVHA 3KVAA 2XQAA 2PWUA 4ROQA 3RLHA 4ZS3A 3HU7A 2O9RA 3EPNA 4EPBC 4ISTA 3G24A 1CECA 2DUZA 2ESCA 1C9WA 1EA9C 1XBZA 5F1VA 1W0MA 1H5YA 2XHEB 1X6NA 5LGUB 1E0WA 1VJZA 2OX1A 3UNTA 2G0WA 1TTPA 2PTZA 1UR3M 4KEZA 2PDFA 2XY8B 2ZVIA 3LQGA 3V4BA 3AMDA 1E0XA 1D7KA 4WBNE 3ERPA 3NEHA 4WKFA 5E0KA 2WLZA 5EK3A 5DRCA 2J7BA 3FHQA 1E5NA 2AL2A 3B0YA 1S1RA 2GL5A 1TCDA 5HWYA 3BAYA 3C2VA 3MWCA 1DJYA 3WYZA 4IHCA 2DT3A 2VZOA 2VQFT 1YXCA 1GYLA 2VDGA 1P4CA 4Y9MA 1YBQA 5E6YA 4UTKA 2VXNA 5GQBA 2ZZ4A 1R46A 5HWNA 2YFOA 1LVFA 4AQFA 1J18A 1IZCA 1A5KC 4OYJA 4LRSA 1RY8A 2DVUA 2WJZA 2Y7EA 3F2EA 1A5CA 4G6CA 3QXBA 1QSDA 1TZ7A 2OU4A 1FBAA 4Q7IA 1UQYA 3BDKA 3BJTA 1BQGA 2GJXA 2PURA 3BAWA 4UWMA 2XIBA 5BCAA 2BY1A 5JH2A 4K1GA 4JKLA 4MB5A 1V3LA 5H6QB 3E1F1 4GH1A 2WQPA 5F2GA 4GG9A 1QFEA 1XYAA 1PIIA 3BH4A 2D2GA 4W9TA 1OFDA 5K4ZA 3MDWA 1M62A 2Q9QD 1HP4A 1ONEA 3AHVA 7ODCA 4HYRA 5FY1A 1NQ6A 3R0KA 4DR5T 3KBWA 1C8YA 3RR1A 2Z28A 3PANA 2WMOA 2WSYA 3VU2A 1CB2A 1TV4A 4HMDA 4UELA 8CGTA 1JCNA 1VRXA 3CWHA 4NP7A 1FQ0A 1SMAA 3IJ8A 3UGRA 2O0TA 2XQYA 1L2QA 1XJBA 3SECA 2OEKA 3BQ5A 5AC8A 1B3ZA 1J0IA 4K39A 2PD9A 2H8ZA 4Z2IA 1N8IA 3O63A 1ITUA 5HNRA 1TX0A 3ZZ1A 4Z91A 1X97A 2DUAA 3U3HA 4Y8FA 4ECLA 3DKJA 1EBGA 5AQHB 1GVEA 5AOUA 1KTNA 4DB7A 5EKYA 2E5BA 3G2GA 4J3SA 4DF0A 3N9RA 1JPIA 2CZFA 1GZGA 2XGZA 4PTVA 2B7OA 4L80A 3RRWA 1R3SA 2H9AB 4W5UA 4K6AA 3E6EA 3UP8A 3WH8A 1K9EA 2W0UA 2HS8A 4B9ZA 3EKLA 2GJLA 1GVFA 1V51A 1FVPA 4PRRA 2JALA 3SIMA 3AA7B 3F03K 2Q3RA 4WXYA 3B0VC 1NDWA 1UUSA 2VRKA 1YW0A 1EYWA 2NZLA 2YXGA 2XFWA 3CUHA 2LKHA 4N4PA 4OV9A 3A9BA 2E28A 4L4OA 1KC7A 3EPOA 4HTBA 1RD6A 1P1MA 2F2HA 2W3ZA 3N6QA 2QRXA 4E3TA 1LP6A 3E0WA 2D2SA 2Q3OA 3W26A 2JPFA 2GWNA 1O5XA 5F2M