2W61A

Saccharomyces cerevisiae gas2p apostructure (e176q mutant)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
480
structure length
470
Chain Sequence
b'GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Glycoprotein
total genus 164
structure length 470
sequence length 480
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w61A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w61A01
4BQ5A 3TA9A 1JYWA 3WF1A 1ISZA 4U2ZA 4FLOA 2VL4A 3VIGA 4CCDA 1D2KA 4AD3A 2J79A 1UWQA 1W1PA 3AQUA 4MB3A 1M03A 3FY1A 4UOJA 2UY3A 3LMYA 2OSXA 2VNCA 2ZUTA 3ZJ7A 2EPLX 1IZKA 4IISA 4UQAA 2G4FA 3W6MA 3UR8A 1XV8A 3WUEA 1V6XA 2D2OA 3AHYA 2Z1KA 4J3VA 1W3HA 2E0PA 5A6SA 4HA4A 1GUVA 1U2YA 3VX0A 2BVTA 2QMJA 1J0ZA 3F4VA 4MAVA 1RP8A 1Q4NX 2WZHA 3BC9A 3GZAA 3AIUA 1ZL1A 1HKJA 1W9PA 2J4GA 2O9TA 2J77A 1IV8A 1JZ8A 3AZSA 5DT7A 1NOFA 1G1YA 1CGVA 2WKGA 3M7SA 3N17A 1E5JA 1X6LA 1EQCA 1MWOA 2O9RA 2WBKA 1UH3A 4B3KA 2QLYA 2VZUA 3RM4A 3GXFA 3AXHA 4GI6A 4S3JA 2ZXBA 3GNRA 4V28A 2WHJA 4R27A 1VF8A 1QNQA 1E40A 1NARA 3ALFA 3LPFA 2V3GA 4JFSA 4M56A 1E3XA 1WKYA 1A47A 4GIAA 1WZMA 3BAWA 1MVYA 1WP6A 5BXSA 1LL4A 1CWYA 2A3CA 1OWQA 1UD4A 1F4AA 3AS0A 2ESCA 3VIPA 2D24A 1OSEA 3AS2A 4TTGA 1JI2A 1PZ2A 3WENA 5A3HA 1I75A 4FMVA 3N04A 1KBKA 4P7RA 2QHAA 1VFOA 1GONA 5KEZA 3OGRA 4GO8A 4MAZA 1B1YA 3K4DA 3VINA 4LPCA 4GQQA 1EA9C 4F8XA 2XVNA 4JKKA 4UFMA 4RL3A 3WMSA 1J10A 4NRRA 2FH8A 3L4UA 3VVGA 1SMDA 4GQRA 3AIQA 3AJ7A 1D7FA 3SUSA 3W26A 2Y2WA 3WBEA 1JF5A 1JDAA 1P6WA 4ZENA 3B9AA 5HBFA 2W4XA 4HOXA 1VFUA 3SCVA 5A94A 3OLDA 1QBAA 2E3ZA 1LLOA 2C0HA 2CHOA 2E8ZA 1WE5A 2QMKA 1B31A 4QFUA 4MB1A 5A6BA 2RGLA 9CGTA 4LYPA 4NSBA 2JEQA 5FKYA 1I1WA 2WC7A 1UOKA 3DHUA 2YA2A 3MMDA 2ZIDA 5CQ1A 3AHZA 2GUYA 5E9AA 3FNDA 1W2PA 2VO5A 1TFVA 4EAMA 5CPSA 1TZ7A 2PI6A 3FAXA 1L0PA 2J78A 3UESA 4UFIA 3AHVA 5DF0A 5DMYA 4P8WA 1XCXA 2O9PA 2UY4A 3D5HA 2WMHA 1ISVA 3IK2A 3WF3A 3TTQA 4PMQA 1Q6FA 1Q6EA 2VRJA 2VVSA 5FL0A 5ABGA 3AMCA 5CG0A 2VTFA 2V38A 4K68A 3W38A 1JI1A 4J3UA 3K1DA 2JIWA 3PZMA 3RM9A 4D72A 1TUXA 3GXMA 4PCSA 4ML4A 3UEQA 2CYGA 4UQDA 1K6AA 3MS8A 1Q6DA 4WSKA 1R85A 4CCCA 1R86A 2JIEA 3EDEA 2EPNA 4AZCA 4DWSA 4MPKA 2J8FA 4PYSA 3L4ZA 1UHVA 3KL5A 1JYXA 1GOOA 1GOWA 3I3DA 4KGLA 3PZUA 1E4NA 2PWHA 5BCAA 3FW6A 3ARXA 4ZXLA 1VFMA 1RPKA 1ZBWA 2GJRA 4Z2KA 1XD0A 2Z1SA 4JFVA 3BSHA 3UCQA 2ZE0A 1NWUA 4CN6A 1V02E 1K9TA 1HL9A 2BVDA 3SCSA 1MFUA 1UA3A 4PMUA 1E3ZA 3U7BA 4CN4A 3DYPA 2W63A 3W25A 2YJQA 2VQTA 4B9YA 4F9JA 1B90A 3AXXA 3WF4A 1LQ0A 4BQ4A 1SYTA 4AZ5A 2A3HA 1M53A 1PZ3A 5M17A 2J74A 5BYWA 4D6JA 5M3WA 5A6LA 2D0GA 3RM8A 2V3EA 2YLLA 2E9BA 4J28A 4AXNA 3IJ9A 2VURA 2BY2A 3PZ9A 2FHCA 4AIOA 4D1JA 1ZJBA 1M7XA 3MO4A 3AIWA 1HX0A 2O9OA 2BXYA 1K9EA 1FP9A 3CMGA 1ZU8A 3PTMA 3HN3A 3VDHA 2DH3A 6A3HA 1CGTA 2D23A 3NIYA 5A6AA 4F66A 2DEPA 3CZGA 1UKSA 4PMRA 1WPCA 1Q6CA 2PB1A 1SR0A 3WQ5A 4WJXA 4D6CA 2WMIA 3ZO9A 3FXYA 3RJYA 4DM2A 3CUHA 1UKPA 1V08A 2CETA 4GI8A 1J0YA 4HOZA 1EOKA 1OBAA 3ZMRA 2J8GA 1J0JA 4QLLA 1W9XA 1OGBA 3UG5A 3IJ8A 2W66A 3CHEA 4HZ7A 3WMBA 1HNYA 3AZTA 4LGXA 4GPNA 4EK7A 2Y5EA 2YIHA 4BF7A 3AOFA 3W27A 3VGHA 1HXJA 3WNMA 5E6YA 3CZEA 1WB0A 2V3DA 3DHPA 3SCOA 5FD0A 2ZUVA 1BYAA 1FH7A 2V5DA 3VNZA 2ZUWA 4ZXOA 4JL2A 2WMKA 3ECQA 3PZGA 3WH7A 3WD0A 3GH7A 3ZR6A 1PX8A 1XH1A 4HMEA 2YKKA 3RMEA 2OYMA 4DWSC 4H7VA 2YL8A 4MNLA 5M03A 4AZHA 1UD5A 3OLEA 3WDPP 1PBGA 2XVPA 3THCA 5A6KA 4AY1A 2XSBA 4U3AA 3T08A 4AZCB 1MFVA 4DWSB 5D9MA 1R7AA 3G6MA 2ZWZA 2VUYA 3CH9A 1WCGA 2EJ1A 3TOPA 4CUCA 5D4YA 5LA1A 3G6LA 3ARYA 4XZBA 1CGWA 3KWXA 4W86A 2EXOA 4EKJA 4AW7A 2DPEA 4PMXA 1GQLA 3THDA 3PZQA 4OBSA 2WAGA 3T0AA 5CPTA 4W7WA 3CMJA 3AMKA 2RGMA 1J0IA 1PJ9A 4TXEA 1CXLA 1UWUA 2DT3A 1CGXA 2XSAA 3FN9A 3MANA 1VEMA 2WC4A 1S46A 2BHUA 3WBAA 2JE8A 4TVCA 1I1XA 4JKLA 5C71A 3RPMA 1QNOA 2PWDA 4KMQA 2VX6A 4PEEA 2OWXA 5JBDA 1AQ0A 3NUKA 3SCRA 1J0HA 1E43A 4MADA 4RE4A 8A3HA 1JYNA 3BAKA 4HU8A 5BRQA 3VD9A 3T2OA 4UTFA 1HKIA 3WDJA 3KL3A 4UOZA 1MW3A 4MB5A 1RH9A 3F5LA 3UERA 3SCWA 4BCEA 4NZCA 2WVUA 3CUJA 4AIEA 1CECA 1CXFA 3K8LA 2QPSA 3OZOA 1ZJAA 1UR9A 1VENA 3OZPA 4N0RA 1CTNA 3AIBA 3SCPA 1GZJA 3AISA 3W81A 4DUXA 3BSGA 3BXWA 2WMIB 7A3HA 2X09A 4M82A 1QNRA 1CPUA 1E6QM 1UG6A 1QW8A 1TCMA 3POCA 3BLPX 5IDIA 1XHGA 1EQPA 2X05A 2CITA 4GXPA 4CU6A 3VU2A 1KXQA 1NP0A 3F5JA 5JBFA 5A8MA 4CKQA 2J7FA 3RIKA 4JKMA 4YPJA 2YDQA 3WL0A 4AEEA 1H5VA 1WNOA 3B9EA 1OT2A 4CVWA 3K46A 5HDRA 1GJUA 2X0YA 4MTVA 4GKLA 2D0HA 2EPOA 3A4XA 1JZ5A 4JCMA 4XUYA 1X6NA 1OCQA 1GOKA 2G3JA 4HOWA 3DC0A 4UOQA 3TP4A 2ZX5A 3ARZA 4B9ZA 3WQWA 3UETA 3MU7A 3N18A 2JEPA 5FOOA 1E4MM 2OSWA 5EB8A 5A8NA 1NWRA 1QNPA 1V3KA 1E0VA 2ZWYA 4W5ZA 3ZSTA 2VX5A 2DQXA 4AEFA 3RO8A 1GVIA 3AZRA 3L2LA 3SCUA 2AOSA 1FH8A 1XGZA 2YLAA 1QI4A 3OIHA 4PRWA 2OYKA 5IFPA 1BG9A 5DFAA 2XWDA 3ARQA 3JUGA 2JF7A 3SUUA 2WVTA 3OA5A 2ZUSA 1WDRA 3AMGA 3MV01 4FLSA 3RJXA 4L4PA 2VVNA 2D22A 5LYRA 2ZX8A 3MSDA 4N42A 1OM0A 1ZS2A 3BCFA 4XX6A 2F61A 1ITCA 1VEOA 4J3XA 1VBRA 2YOCA 3W0KA 2WZEA 3WDQA 1UYQA 2E4TA 1JZ7A 2CEQA 2WSPA 3NSNA 4NI3A 1KQZA 5F7UA 4HZ8A 1GQJA 5CLWA 3AI0A 3APGA 1B9ZA 1ESWA 1BGAA 4QCFA 3L4TA 3VD7A 3VIIA 4A3YA 1CLVA 5LA2A 3W28A 4W87A 4P8UA 1JG9A 4W7UA 1ZB5A 2WHKA 1R8LA 2WSKA 4L4OA 3EMCA 2G8ZA 2BVYA 4CD6A 1HVXA 1QNSA 1GCYA 3VM7A 3W6LA 5HNNA 2ZUUA 1OINA 4ACZB 4MNMA 1KBBA 4H8VA 4RE2A 2PF0A 3A4WA 4CCEA 3IAPA 5A95A 1OIMA 1DWFM 2X0HA 1VJSA 5JIWA 4X0NA 4JIEA 1HP5A 5A6MA 5FIPA 1V6VA 5JUVA 3PTKA 4M81A 1K9DA 4JHZA 1G94A 1UR8A 1W1YA 4AZ7A 2XIIA 3NJ3A 3POHA 3NDYA 2Y24A 4OZOA 3WH8A 5KZ6A 1W9DM 1DWGM 2X2YA 4W84A 2FGZA 2VR4A 2VCAA 1TMQA 3VMPA 1E0WA 4F9DA 3WNPA 2FHFA 4KGJA 1JGIA 1CENA 2BY1A 2F8QA 1YHTA 4GZEA 1XSJA 4PSRA 1H49A 3WQ8A 4HA3A 1UWIA 4D6DA 5TD4A 3VMOA 1US3A 3WQ4A 2BS9A 3KZSA 3PZNA 4D6IA 1B2YA 4WKHA 1G01A 5CXPA 2WHLA 2DT1A 1KXTA 3ZIZA 4JCLA 2D3NA 3ARPA 2PBGA 3MUY1 5I79A 1TE1A 1BGGA 2VX4A 4PBGA 1KGXA 3GNPA 3K8KA 2CPUA 1E4LA 3WF0A 1WDPA 4QDMA 5A69A 1E1FA 2XTKA 1H1NA 2WANA 4PSPA 5IHSA 3ZR5A 5BROA 5A6BD 2YBUA 2FHBA 2DSZA 2GJPA 4P8XA 1V3JA 2O92A 4AD2A 2VI0A 3VILA 4OOZA 3WH5A 2UY5A 3U5YA 1CIUA 3N12A 2GVYA 1UKTA 4AZGA 1WDSA 3PHAA 1LF1A 3VUPA 3ARTA 2IUZA 3KEHA 2WVSA 2XJ7A 4IUGA 1JZ4A 1BYDA 3ZJKA 2VOTA 1KR0A 3B9DA 2DSKA 3VIFA 4HTYA 4J3WA 1E73M 2XUCA 3MKKA 5BRPA 3AHTA 1ZBVA 1QI2A 1PAMA 1VBUA 2QPUA 5CJ5A 4OOUA 3QHOA 4CVUA 1EO7A 3CBWA 1WZAA 2CXGA 1W3LA 4U3CA 3II1A 4BQ2A 1HJVA 3A3HA 1JNEA 4CD8A 4AYSA 4C7FA 5HPCA 4DWSD 3WY1A 4UQCA 3WQ6A 1XH0A 2Q8XA 4PMVA 4PMDA 1US2A 2OLHA 3VD4A 4PCTA 1UKOA 5GQBA 1PX3A 3EMQA 2AMGA 3CZ8A 1E55A 5GPRA 2DDXA 1V6YA 2E9MA 4CD5A 1JDCA 2GK1A 4GO9A 5DEZA 4PTWA 1JIBA 5FCZA 2WLYA 3EBVA 1E6ZA 1UWSA 1B3WA 3VIHA 1KXHA 4NF7A 2DT0A 4W93A 3GDBA 2X1IA 3ARUA 3GBEA 4C7GA 1NWTA 2VT0A 3SCNA 1G9HA 2QV4A 3N1AA 1V02A 3MMUA 3ALGA 1HF6A 2J7EA 4AIUA 2GDUA 1KGUA 1M01A 1E6SM 1NOWA 1BYCA 4X0VA 3WF2A 5HPOA 3GTNA 3LPGA 3WD2A 2YL5A 4TUFA 2CHNA 3W53A 4AZIA 4J27A 1LWJA 3QOMA 2WWCA 4ZEPA 3N11A 1W3KA 3CZJA 1DWAM 2VRKA 3WUFA 4KH2A 3BAXA 2WCAA 1BHGA 2WM0A 2YA1A 3MV11 1FA2A 3VD3A 1LJYA 3LPPA 2F2HA 4U5IA 1W9VA 3E1F1 2ZX6A 3ZSSA 4P7OA 2DSUA 3HJEA 5A6JA 3W82A 3OGVA 2GDVA 4FLQA 1O6IA 1W32A 2VJXA 4DUVA 3T2QA 3ZJ6A 4EANA 2PWEA 3LPOA 4UZUA 3VDCA 4JL1A 4OBRA 1CXKA 4MDPA 2D1ZA 3ARSA 2BNJA 1V3HA 4B16A 1KWGA 4TOQA 4E8DA 1NOUA 3SEPA 2J7GA 2CBJA 3DYOA 1LG1A 1ISWA 4Z2JA 1MXDA 1NQ6A 1UR2A 2BY0A 1MQPA 5CLTA 1KB3A 3PN8A 2ZOXA 2DH2A 2EBNA 2ZX9A 4P7NA 3ARWA 3QGVA 2YDSA 1LL7A 4ATDA 1E9LA 2BHZA 1H3GA 1A3HA 4XB3A 5D8WA 1KWKA 1OD8A 1CBGA 1BF2A 4X9YA 1V03A 1C92A 5FL1A 1G5AA 2XPKA 2WWDA 1E0XA 4LYRA 4W8AA 4JFWA 6TAAA 2X8RA 1PPIA 1GQIA 1XSKA 4Y7EA 4OKDA 4CD7A 4UQEA 4QLKA 2XM2A 3WD3A 3AXIA 3CIVA 4E8CA 5A2BA 1TR1A 3VM5A 1JNDA 4WIWA 3MSGA 3N13A 3W29A 5JIPA 4YN5A 1VB9A 5ABFA 3BMVA 3AIVA 1W1VA 2J62A 1UD8A 1XRVA 2D0FA 3L4XA 1E15A 4W88A 4W85A 4PN2A 2CNCA 1DP0A 3OBAA 2PBOA 4WLCA 3GH4A 5EBAA 4FK9A 4U5KA 1R7OA 1UR4A 1HJSA 1EOMA 2WCSA 4UFKA 4ACYA 1N82A 1EH9A 1IZJA 1XH2A 2ZXDA 3VIJA 3NYDA 2E8YA 1UA7A 2OYLA 3BH4A 3N9KA 4PUEA 4ATWA 1NWSA 4OUEA 5A8QA 3GH5A 1ODZA 3B8SA 4D6HA 5CSUA 1KFWA 1GQKA 1VIWA 5CGTA 5EFDA 4MNKA 2VCCA 2EQDA 3NDZA 2PC8A 3CTTA 2XYLA 2WW5A 4RE3A 1VFFA 1UD2A 1GW1A 3I3EA 4M1RA 4UZSA 1E4IA 2G41A 1JZ6A 1QHPA 5AYBA 1TA3A 2CBUA 3CUIA 2XIBA 4H2CA 4TX8A 3U57A 3CZLA 2ZXQA 3AMLA 2XGIA 2GFTA 1V0NA 2WHMA 4YHGA 3W24A 4LX4A 1AVAA 1O7AA 1C8QA 1CGYA 4D6EA 4CU7A 1PEZA 2G3NA 4KRUA 2CCRA 4EE9A 3U7VA 3WUGA 1E1EA 3S2CA 1L8NA 1Z32X 1JZ3A 1PX4A 1TG7A 4IPNB 3WKZA 3WH6A 1CDGA 5HOSA 1J01A 2XM1A 1HP4A 5M5DA 3VGEA 1E56A 5ABEA 2YA0A 4TTUA 2IXVA 2WPGA 3EDDA 4J7RA 4A4AA 1EDGA 2NT1A 1MXGA 2Y8KA 3ZT5A 2CKRA 3CHCA 3SCTA 1ISXA 5A1AA 3GXIA 3NSMA 1OIFA 5I3DA 3TTOA 1EXPA 4QP0A 5D8ZA 7TAAA 2NT0A 3AICA 2J75A 3GXDA 1QW9A 1OB0A 1HT6A 4TVDA 3RCNA 2A3EA 5AY7A 3QHNA 3KE0A 1J12A 1E71M 2GJXA 3O9NA 3N15A 5I77A 1B30A 4ZE4A 4HP5A 2IXUA 4GINA 3OLGA 1D3CA 3BLKA 5CSYA 3AYRA 1EDQA 4PMZA 4Q22A 4ZFMA 4HU0A 1J11A 4JFTA 5E09A 3VTRA 3HMCA 1J18A 1M04A 4P7LA 1XSIA 1H41A 5AYIA 1DHKA 1F4HA 1LG2A 2NSXA 1C7SA 2BHYA 1C93A 3WNOA 1C8XA 1QOXA 1OGSA 2FDMA 5I23A 4ZE5A 2YL6A 4GZJA 3O2LA 1CGUA 3GM8A 7CGTA 3A4AA 1BPLB 1OT1A 1UUQA 3PZOA 5I2UA 2BFGA 5IHRA 2XFRA 3DECA 1LL6A 3VIOA 3T0BA 1ZBKA 3VIMA 1QI5A 3VD5A 1DWHM 3WEOA 2EO7A 4QCEA 3VKKA 2DSVA 4YHEA 3CHFA 4Z2HA 2W91A 2YDRA 2XHYA 4MJ2A 1J9YA 4PMNA 1TA3B 4C7DA 2ZICA 3VDAA 2A3BA 2EPMX 2WCGA 1W3JA 3CO4A 1VEPA 2XVKA 3L2MA 4GI9A 1DWJM 3SIMA 3WDHA 5BXTA 1UWTA 3VOCA 1FHLA 3SUVA 1CLXA 1B3XA 2W92A 2D20A 1IT0A 3AIRA 1JXKA 2C8NA 4UQ9A 4F79A 5I78A 2UY2A 1W2VA 1H2JA 4QAWA 4Z2IA 2VCBA 2XVLA 3FHQA 2G3IA 2WKLA 4AZ6A 4H8UA 2XFYA 5A2AA 3WMCA 1YQ2A 2CKSA 3WUBA 3A47A 1KXVA 1TVNA 2VRQA 1UR1A 4Q7NA 4PTXA 4HPHA 3F5KA 3WNNA 2XVGA 1FH9A 3QHMA 2YL9A 1AQHA 1EO5A 1E72M 1G0CA 1RP9A 3O6AA 1GOMA 1LWHA 4URIA 4AZBA 3AMDA 1QHZA 1GORA 3AROA 3QR3A 1U30A 3L4YA 3NSXA 2GJXB 2QF8A 3AS3A 1FOBA 5E70A 1KGWA 3MUIA 1FFQA 2B31A 5GNXA 4H04A 4AD0A 1JAKA 1GOQA 1RD6A 5BXRA 4PUDA 4TX6A 3ARVA 1V3MA 5A8PA 1JDDA 4XV0A 2VZSA 1DTUA 2DIEA 1HJWA 3PTQA 1JD7A 4XZWA 1UD3A 3UG4A 2NW0A 2BXZA 4UFHA 4AWEA 4BQ3A 1MQRA 2XGBA 1CXEA 3M07A 2DT2A 1SFSA 2ZUMA 4LYQA 4UQBA 3FHAA 3TTSA 4UCFA 1KR1A 2XG9A 3VDBA 1NP2A 5D9OA 4LXFA 1OGGA 3CPUA 1QBBA 4UR9A 3HU7A 3CUFA 6CGTA 3WSUA 4DM1A 4MNJA 1C90A 3GBDA 1JZ2A 1FP8A 4QLJA 1EGZA 1JL8A 1BVZA 3BMWA 3CUGA 3BAYA 4M8UA 1XC6A 3WD1A 1AQMA 4HA1A 3IJ7A 2WXDM 4W8BA 3VGGA 4WKFA 1W91A 2AAAA 1QPKA 2WC3A 3BGAA 4IPLA 3CZKA 3AS1A 1V6WA 3VO0A 5C70A 1JFHA 3CGTA 1H11A 1WDQA 3WFZA 1J0KA 1GHSA 5JBEA 1QHOA 1HL8A 5D9PA 1WZLA 3T2PA 1ITXA 1BAGA 4W7VA 1VJZA 1C3FA 1V3LA 4MB4A 1UKQA 1UR0A 4WSJA 3VGDA 1W9UA 2JF6A 1GOIA 1JYVA 2J7DA 4WKAA 4NRSA 1BLIA 3WD4A 3WIJA 3WQVA 4PMYA 4BZYA 2WZIA 4V2XA 1H0IA 3EDJA 3S6TA 2EPKX 1XD1A 3EYPA 4PTVA 1BYBA 2TAAA 1ISYA 3M46A 1HJUA 1AMYA 3DYMA 4AC1X 3I3BA 2EEXA 3WN6A 1GHRA 2VZTA 4MJ4A 2WB5A 5I24A 4V27A 1UH2A 1H09A 1HJQA 2VZVA 4CU8A 2W5FA 3L4WA 2CBVA 1B3YA 1EHAA 2WMFA 1UWRA 3SURA 3EDFA 2W62A 1HN1A 4D6GA 4AD4A 2Y8VA 2HVMA 4OJYA 1MQQA 5E0FA 5GNYA 5ABHA 2DSWA 1V0MA 1OD0A 1W1TA 1VAHA 3T09A 3VGBA 3EDKA 1B0IA 3VMNA 4JHOA 3WELA 5IFTA 2V3FA 4H8HA 1E6XM 1UZ1A 2D3LA 4S3KA 1BQCA 1NH6A 2WK2A 3ZT6A 3AIEA 2J47A 3PZIA 1UQZA 1UD6A 4WK9A 1E5NA 3D3AA 1HIZA 2WVVA 4U2YA 1GPFA 2VR5A 1BVNP 4W5UA 4E2OA 3IAQA 3WDRA 3VX1A 2J7HA 2DGAA 3AYSA 5E0CA 2WMJA 4E4PA 4JAWA 2DIJA 3L4VA 1X1NA 1KCKA 4M80A 2CBIA 5DT5A 3WEMA 4GZIA 3CLWA 5EFFA 2OWCA 3RILA 2OWWA 2PWGA 3WEZA 3OGSA 2WYSA 4HMDA 4TVUA 1BTCA 1E6RA 2JFEX 1UQYA 5I0DA 2CIPA 4BA0A 1CZ1A 1JF6A 1H0GA 4U31A 5DO8A 5HXMA 1V6UA 4B3LA 4M29A 1ZBCA 2GSJA 4J3SA 1GVYA 2WLZA 2PWFA 5I6SA 3FAWA 5C8BB 3PZVA 1E70M 3OLIA 1QI3A 1EDTA 5CPQA 3MUAA 1C8YA 5GNZA 3WH9A 3ZQ9A 2WMGA 4HZ6A 1KCLA 3AFBA 4FF5A 4DUWA 3BCDA 5BWFA 2GK1B 1V3IA 4H41A 1QI0A 3AHXA 3SUWA 2XFFA 1ODUA 5BXPA 4W8LA 1GJWA 4WF7A 5LA0A 1MW2A 4AMCA 4KRTA 4P7QA 3WDIA 4R5EA 3BAJA 2VC9A 3OB8A 1MW0A 1K9FA 3ZOAA 3ZM8A 3ARRA 2E9LA 2VX7A 1R87A 2XWEA 5D9NA 3CHDA 2ZXAA 1Q6GA 4BS0A 4UFJA 2WBGA 2G3MA 1FHDA 4LQ1A 1KQYA 4D71A 1B3ZA 3TONA 2ZX7A 1C7TA 2CESA 4AISA 3QOKA 4JFUA 3PZTA 1PIFA 3BAIA 4U33A 3A6OA 2HISA 2J7BA 3TTYA 5CGMA 1JXJA 4KWUA 5ECUA 1JFXA 3UR7A 4B15A 2CERA 1MYRA 3RDKA 5A8OA 4MDOA 5IXEA 1BFNA 4JZ5A 2C7FA 2JALA 3WNLA 1GNXA 1ECEA 1CXHA 2BV9A 5I5RA 1XYZA 2Y4SA 2OSYA 3MUZ1 1XYFA 1QVBA 1HKKA 4ACZA 2WVVB 4D6FA 3MMWA 3M6DA 4OIFA 3J7HA 3SCQA 2V5CA 4P8VA 1E6PA 3IANA 1SMAA 1V0LA 4D1IA 4W89A 5E6ZA 5CZKA 4HPGA 1Y7VA 1TVPA 2MANA 1WZKA 2J7CA 2UWFA 1XCWA 8CGTA 3PBGA 5AC5A 5EMYA 4CN1A 1CYGA 3ZJ8A 4AD5A 1CXIA 3VPLA 1DWIM 1EIBA 3VIKA 4CD4A 1HKMA 1DEDA 1W9BM 1NM9A 1CEOA 2W61A 1HJXA 3EMZA 1JD9A 4UNIA 2W67A 1BG4A 1WAWA 3K4AA 4PMOA 1JAEA 4ATLA 2WNWA 4IM4A 2ZUNA 1H4PA 2FH6A 1HVQA 3GYCA 4A3HA 4Z2LA 3WFLA 3W37A 4UFLA 2E40A 3ZT7A 1MW1A 5ABFB 3WNKA 3GNOA 5AC4A 1PIGA 4M24A 4AD1A 1FFRA 3KL0A 1UH4A 3T0DA 1B3VA 4FLRA 3WL1A 3UG3A 3U5UA 1E6NA 2FGLA 5A2CA 2A3AA 4PTMA 3NCOA 2VMFA 4Z2GA 1C91A 1CNVA 3OG2A 1VRXA 3SUTA 1WO2A 2J25A 3W4RA 3K8MA 2YBTA 1BSIA 4HMCA 3VGFA 1UZ4A 2BY3A 2VQUA 1U33A 3VNYA 1EHNA 1V0KA 4J3TA 4CGTA 2VZOA
chains in the Genus database with same CATH superfamily
2VOMA 1IEWA 3VCRA 4U2ZA 5CBBA 3A5VA 2VL4A 2HPMA 4ZGYA 4AD3A 2YBVA 2TSYA 1M03A 3HZ3A 4HMNA 3EKGA 4GIRA 3O7UA 3QFEA 4FO4A 1LVFA 1IZKA 4IISA 3C4XA 4LVGA 2IC9A 2NOXA 3WCZA 1YXYA 4HWCA 1V6XA 2VC5A 2QJHA 2Z25A 3BZGA 3WUEA 4LFCT 1FDYA 4N9EA 4KIEA 3MVTA 3PBVA 4GWEA 3S1XA 4QS5A 1BVWA 4J2CA 3LDQB 2ZM6T 1NJJA 3C2VA 4HSOA 5H6RB 1QOQA 2Y88A 3HA4A 2QMJA 5JDFA 3C56A 1M7KA 4AFYA 3AIUA 1HKJA 2J77A 4V33A 3AZSA 5CPOA 2Y5SA 1VKFA 4IDOA 1G1YA 3DOPA 3UXLA 3ZR4A 1X6LA 2WBKA 4JTUA 3IUHA 1T7LA 3GXFA 1OWAA 3GG8A 2PFHA 4V28A 2WHJA 2WQDA 3GG0A 3ABVA 1UMYA 4ZBCA 4U4MA 1Z69A 1UZHA 2A6LA 2V3GA 4JFSA 1E3XA 3NPUA 3R0KA 4TWDA 1HFBA 4LWWA 1MVYA 1NU5A 5L4HA 3A9IA 2A6NA 3OOQA 2DZAA 4MALA 3A13A 1ZQ5A 1ZOYA 3GWHA 4JI3T 2LSGA 3VDGA 3QUJA 4JLEA 1JI2A 1PZ2A 4NAEA 5A3HA 3RN6A 3B9OA 1OFOA 1KC7A 5MKGB 1XDOA 3OGRA 2HROA 4LS2A 3K4DA 1VPYA 4LPCA 4DJED 4IPIA 3LSVA 2WKJA 3EPMA 4JKKA 3TKFA 3TJLA 5FXZA 4PCPA 3VVGA 3WLTA 4GQRA 4NI8A 3W26A 2Y2WA 4HFBA 4HTEA 4E5TA 1P6WA 4ML9A 2ZLYA 2VYOA 3SY8A 4C6PA 1VFUA 3PTRB 3FS2A 3FJ6A 3M0JA 5LNRA 2OEJA 4IFKB 3OVGA 2E8ZA 4QFUA 4MB1A 3S5OA 3SS1A 4US5A 4LYPA 2OB3A 2VUNA 4FOJA 5FKYA 2YA2A 2ZIDA 5CQ1A 1GW9A 4DXVA 2VO5A 2QR6A 5D03A 2FUPA 1FWFC 1SO5A 4L7ZA 4BK9A 3GDRA 1HCIA 3O1NA 2VQFT 5DMYA 3C4ZA 4JEJA 4IDZA 3B97A 2WMHA 1PXGA 4MLKA 5DCBA 2NR4A 3SRDA 3TTQA 4PMQA 4U7IA 3P8CD 1JPKA 5L3BB 1Q6FA 5FL0A 3C8NA 3BG5A 4K38A 2ABAA 3W38A 1XQKA 4J3UA 3K1DA 4YXDA 2C1IA 2QAFA 2LE8A 3PZMA 1CCWB 3RM9A 2XQAA 1IGWA 1A0CA 1BEUA 4RV8A 1XL9A 3OYXA 1Q6DA 4MJZA 4AQGA 4A3QA 4LH8A 3E2SA 3SDOA 1TO3A 3IV8A 4MPKA 4AEOA 1GKQA 3UQ7A 1JYXA 4HPXA 1V51A 5HXCA 1GOOA 4H63H 3PUQA 3GAKA 3I3DA 3VKAA 3ARXA 1EF2A 4N4QA 1GYNA 3NKZA 4IT4A 4ERIA 5I03A 1V02E 3K8PC 4IMEA 6XIMA 3IIXA 4HBKA 2FZDA 2BVDA 3SCSA 3M0IA 1MFUA 2YR1A 1ZP0A 4PMUA 1E3ZA 3CAWA 3O15A 1DJQA 3UD6A 1A5NC 5E0KA 2VQTA 3TYUA 3N34A 4PFMA 2GWNA 3WF4A 1H60A 5LHGB 3JAFA 2Q09A 3VHLA 1KFEA 2POZA 3BUVA 4C6KA 2J74A 4D6JA 5A6LA 2C13A 2D0GA 3LGEA 3AE9A 4EYYR 4GH1A 4ZB0A 5LIKX 3M65A 4ICNA 1RVGA 1LP6A 4PK6A 5CZ0A 4J28A 2VURA 4QHRA 1E0UA 2E6FA 2FHCA 2AL2B 4FXJA 2P10A 2XH4A 1OFPA 4YS1A 2E1WA 3AEAA 3W7MA 1ZU8A 5BMWA 3GR8A 3SRFA 4GFSA 4ERGA 1XIJA 2E5LT 3VC5A 1XLEA 2DEPA 3CZGA 4HVXA 5IUXA 4HIBA 1SR0A 3R58A 4D6CA 2Q9QB 3ZO9A 1O5QA 3FXYA 1H1YA 3E5BA 1UX4A 2NWRA 1BRLB 1V08A 4UTTC 4AU0A 4X64T 4GUFA 2SFPA 1J0YA 4JD4A 3P0WA 2G37A 2QCDA 2VKHA 4B3ST 3U2CA 2W66A 3AU2A 2FJBA 3CHEA 4M5PA 5HWYA 4JTFA 3OIXA 3QH2A 4KIRA 3RU6A 3EOUA 1IR1A 2YIHA 1FHVA 2OLAA 1NAL1 1REQA 3CZEA 4LF8T 1WB0A 5FEZA 3NGFA 1BYAA 4TNWA 2XDFA 2ZUVA 5K7JA 4ZXOA 4L6DA 3SRZA 3ECQA 3S5YA 2D5UA 3S4UA 3FZMB 3HO8A 4X3ZA 3TLVA 1XLMA 1PX8A 3R8GA 2Z6JA 3MSRA 4PUWA 1JRCA 2I57A 2YL8A 3QEZA 1M9HA 4U74A 4AZHA 3THCA 5AQUB 5M2FX 2XSBA 3HF3A 4U3AA 1MFVA 3B8UA 4Q7BA 2R8WA 4O4JE 3AAMA 3SGUA 2HXTA 3W74A 2VUYA 3RKGA 2A2FX 2EJ1A 4B2DD 4AHQA 3SFEA 1RUSA 3P2VA 3RIUA 5LA1A 1MUMA 2Y85A 4O4IE 3WLIA 2JGYA 4DF0A 1Q63A 1F61A 2DPEA 4PMXA 4GNVA 4ZQCA 2UUAT 1A53A 3ZLGA 4XBJA 5CJNA 3PZQA 4OBSA 4RXGA 3SGGA 4W7WA 3AMKA 2RGMA 2PRLA 5J5RA 1CXLA 2DT3A 3FN9A 2XSAA 3M1ZA 4DR1T 4A8RA 4GACA 3Q67A 4AKRB 4EXQA 2QCNA 2NQHA 1I1XA 4JDYA 4JEQA 4JTEA 3RPMA 2VX6A 3W02A 5K9DA 4LS0A 3SCRA 4NYYA 4O1BA 3BAKA 1KM6A 3QMSA 4C90A 1I2OA 2MUCA 4Z42C 1MW3A 2PDMA 4QHOA 4NZCA 1CXFA 3Q5XA 1KF6A 1MMAA 1OABA 1ZJAA 1VENA 4N0RA 1T96A 5F2MA 3TLQA 3U4FA 3AEDA 3AIBA 1FWRA 1GZJA 2VC6A 3IEBA 3W81A 1L6YA 3UU3A 3BPWA 5G2HA 3TH6A 3REQA 1YKEB 4M82A 3LV5A 3FDGA 4AWTA 3PPGA 1CPUA 1E6QM 4BAYB 4YIWA 3POCA 1O5RA 1EQPA 1NENA 2X05A 2CITA 3T44A 1DJYA 1KXQA 2PDGA 5A8MA 1QO5A 3S1UA 4CKQA 3G1YA 3RIKA 3T8LA 2PGEA 1WDWA 1W5MA 2ZFAA 1RCXB 3GO2A 3B9EA 3H70A 4MTVA 4R53A 2VGGA 2V63A 4DJDA 3TK7A 4J3ZA 3UGRA 4AKIA 1J4EA 2VASA 2QYWA 4GBUA 3NPWA 1OCQA 1YNPA 4RDVA 4JYEA 3NO1A 3TROA 2D2GA 3UBPC 2DP3A 4B9ZA 3B4UA 3VZXA 1GVOA 1M41A 2YZRA 4NNAA 4NXSA 3N18A 1UC4A 2ICSA 2OOGA 4A05A 3CJPA 4GYPA 4YL2A 4N9DA 1H1ZA 3QOFA 1Q2RA 2WY2A 2R1LA 3LDVA 2XH7A 1PYFA 2G0WA 4ZOCA 3EI0A 2A7PA 3BURA 2WWUA 1FH8A 4WRHA 4QX8B 3UWQA 3HKBE 4JTQA 2OYKA 1GTEA 2IKHA 2HZGA 3QPZA 2FZBA 2X1UA 4PW8A 4IQLA 3PUXF 2VHLA 4PR4A 4MUZA 2ZUSA 3MV01 2VL0A 4L4PA 1OK6A 2D22A 6REQA 3QQ0A 3E74A 3S9YA 3MSDA 1WBJA 2F61A 4PH6A 2YOCA 4N7QA 3NM3A 1XDMA 4EEDA 3F4NA 1ME8A 4FXRA 1O12A 4AVFA 4KHPT 2WSPA 4ZZ9A 3SGZA 2IDOB 3APGA 5L4EA 4IQDA 4GISA 3W01A 3VD7A 2DI4A 1N7KA 2QGYA 2RA1A 4M6UA 4L4OA 4IMGA 3EMCA 3RO6A 3CK6A 4AY7A 4KESA 3K1SA 1FWEC 3VAVA 1GCYA 2ZZ7A 1K4HA 5FVLA 5HNNA 2Y7FA 4LUSB 4A3RA 2A2IA 5K4XA 1SZRA 1A80A 5HCJA 2QCEA 5FJOA 4CCEA 2BSLA 4WNKA 4NL1A 1E0TA 3C0LA 5JIWA 5FYMA 4MZ8A 3B03A 4X0NA 1TYGA 2J88A 1OK4A 5JUVA 3LG3A 4XG1A 1RVKA 3PTKA 3SZ8A 2L8KA 4JHZA 4OQVA 5HATA 4AZ7A 4QE1A 1AD4A 2LSIA 1DJXA 3NJ3A 3POHA 4YTNA 1W9DM 2X2YA 1GG1A 3VKJA 1W8SA 4Y9PA 5KITA 5HQLA 3EA1A 3T6CA 3PU3A 1TMQA 3VRAA 1MZRA 2OXNA 3G06A 2JKAA 3WNPA 4A6GA 2FHFA 4KGJA 4HKPA 2KMFA 4MMWA 4GZEA 5EGRA 1H49A 3WQ8A 4HA3A 5HMFA 4IDPA 1NEKA 2ACSA 3AYTA 4WY0F 4ZZCA 4Z0SA 4NZ1A 4UB9A 4Y2WA 1B2YA 3NQDA 4WKHA 1EP1A 5CXPA 2WHLA 1LRQA 1ZY9A 3R11A 2D3NA 2FZMA 4UV8B 1W5NA 4S3CA 3VU7H 2VX4A 1DVJA 2CPUA 2QQ6A 3L9CA 1VS1A 4QDMA 3Q5WA 2G95A 2Y5JA 4JIHA 4I7WA 4I4TE 4PSPA 1W1B1 5BROA 1YDYA 4QGCA 1JCLA 3GC5A 3N9PA 2GJPA 2ZC1A 3N3TA 4P8XA 4AD2A 3EHZA 3OW1A 3VILA 4P1NA 4OOZA 1A5KC 2O0TA 4QE5A 2OELA 3W15B 3WFAA 3U5YA 5JR9A 4AZGA 1WDSA 1TV5A 2VXNA 1RALA 1QU4A 3I10A 3T0CA 4YTUA 3P7IA 4E2BA 3ARTA 1A5LC 1IF2A 2IUZA 4YTRA 1EYWA 4FX7A 4DBWA 1UP2A 2OVLA 1JZ4A 1BYDA 3ZJKA 5DLCA 1DHPA 3G1SA 3IF8B 4TNVA 3UU6A 4LV4A 4J3WA 3O6CA 3MKKA 3G1HA 1Q8AA 1VBUA 3P82A 3RYSA 5CJ5A 4OOUA 1EO7A 3RPTA 1WZAA 3S6OA 4X1YE 1OEPA 4U3CA 3A3HA 1P0KA 4RDZA 3ONLC 1JNEA 3GDLA 2B7NA 3H55A 4MY1A 4AYSA 4CD8A 3K3NA 4NZ3A 1X9BA 4C7FA 5HPCA 3UFEA 3MY9A 1S2WA 1LM1A 1XH0A 3LBMA 3B8IA 4FIQA 4E6MA 4XTIA 2ALDA 2XQ9A 5EMJA 3N9RA 2VEKA 3ABSA 1X6UA 2YGYA 5GPRA 2DDXA 2E9XB 1V6YA 4JR5A 4XBKA 2ZRYA 1JDCA 4B4HA 3LK2B 4ZI7E 4LAKA 1CT5A 1JIBA 2X1TA 1JCYA 1JCTA 4ANJA 2OGJA 1KXHA 1X1ZA 1OC7A 1XUUA 3GVGA 2P1FA 4KX6A 3QR1A 3ITOA 1YTKA 1VRBA 1XINA 3CLMA 5L3DB 3COTA 3LCLA 3S47A 1VBJA 1AW1A 4CNSA 4I5XA 3G2GA 3NQFA 1KGUA 3U6WA 3CQIA 2KXPB 4Y90A 1K7EA 5HPOA 1QNVA 3LPGA 3WD2A 2YL5A 2C79A 2XZ9A 5HULA 4ZEPA 3N11A 4ORIA 5C3JA 3ZLFA 5DY2A 4G56A 4DPQA 4RUBA 3BAXA 3H2CA 1W1A1 1X38A 2Z6EA 2WM0A 4ZO8A 4DLFA 4DO5A 5AYXA 4NASA 7XIMA 1A0EA 4NAFB 3OTRA 4XD5A 4UTHA 2OQHA 4DIAA 4AXKA 1LJYA 1XLJA 3TQVA 2XUEA 4E2VA 3BDKA 2HHHT 1V7AA 4U5IA 1VFLA 2OCZA 3ZSSA 4P61A 1KW1A 1O6IA 3TAKA 4PL2A 2O7QA 3ZJ6A 4TV6A 4Z91A 1PHQA 3MI6A 2D1ZA 3JCFA 3VC6A 4B16A 5FACA 4E8DA 3PJAJ 3DYOA 1LG1A 1TELA 4Z2JA 2Z0IA 4GYFA 4LMKA 4JTAA 1IIHA 2BXVA 4H6KA 4Q8NA 3PBWA 4RX0A 4XQ6A 3NAVA 5HCMA 2G5WA 3KV9A 5F3JA 2Y6ZA 3L5LA 4N78D 1F73A 3I4KA 3OKQA 4ATDA 1H3GA 1F3EA 4UTWA 5AQFB 3E9AA 3IRDA 3ITYA 4NZFA 4EACA 1GQIA 1P6CA 2YXOA 3GC4A 4OKDA 4QLKA 3M0YA 4KWWA 2XM2A 4AF0A 1SZNA 4FOKA 1CI1A 5A2BA 1W6TA 3VM5A 1JNDA 1QASA 1FWCC 4YN5A 5ABFA 3BMVA 3AIVA 4AH7A 4S2BA 3AEBA 2D0FA 2W2UA 5CPNA 1SU5A 1TJ0A 2QDDA 5DMMA 5J04A 5E1QA 4UXNB 1DP0A 2GWGA 2VD9A 1IR2A 3GH4A 3IWPA 2F38A 1IBLT 4U5KA 1UR4A 3W1QA 4GMEA 4PJMA 3RYHE 4ZOLE 3TKLB 3NNTA 1EH9A 1E2AA 1XH2A 3NYDA 1MNEA 3BO9A 2H3RA 4CXXA 1UA7A 3UZZA 4DYJA 1MDRA 1TWWA 2GK9A 3PWIA 2QCHA 2PFVA 1OHLA 1C9DA 2YKSA 3KINB 2FPYA 3DU0A 4OUEA 4WJ8A 4D6HA 2E5DA 5CSUA 4C6FA 3DBNA 1GQKA 1VIWA 5TQLA 3LY0A 5EFDA 1UCWA 2XYLA 2WW5A 4UNLA 4J2MA 2HQAA 3I3EA 3LX9A 3PJTA 2GGEA 1OCBA 3G8EA 4LUTB 4WXYA 3LZ5A 5JH2A 1TA3A 5LNSA 3RHWA 2N1GA 1OEDA 2X67A 2OOFA 2XIBA 3C8FA 5BWAA 7ENLA 2YXXA 3NXLA 3U57A 4K39A 4O0KA 3CZLA 1ADOA 1RK5A 4H9TA 2GFTA 1V0NA 3DFOA 4YHGA 4LX4A 1O7AA 4D6EA 1FMWA 3G77A 4QS6A 4G63A 3U7VA 1E1EA 1L8NA 1VCVA 2CLHA 3CQ0A 3UF9A 1BTMA 1BXCA 4IIDA 1DJIA 1RD5A 3NYZA 4IPNB 3WKZA 3WH6A 5HOSA 2K24A 1EKOA 3IEEA 1J01A 1UIOA 1KRCC 2ZZ3A 4LFYA 1IZNB 1HP4A 1JDFA 4ZZBA 3R5EA 1IXQA 4B5WA 2XN2A 1PTGA 2IXVA 3EDDA 4J7RA 3G5EA 3EAUA 3KOFA 1T7SA 4A4AA 3ZT5A 2NT1A 1Q66A 3CHCA 3SCTA 3UWVA 1NF7A 1G6CA 2GZXA 3GVRA 3O0KA 2CZEA 1G7VA 4GKKT 4HWDA 3OVRA 2WNNA 5D8ZA 3MJMA 7TAAA 1D3GA 2I9EA 4IICA 5L6UA 2ISWA 3BG3A 5AQPB 2HSAA 1JCMP 2YCIX 3URNA 1OB0A 1HT6A 3L7RA 1N8WA 2HH7A 2A3EA 5F8PA 3MJYA 2AQWA 1H51A 3UA3A 3P80A 2GJXA 3O9NA 3Q58A 4LVAA 2ISDA 2NQJA 1MDLA 1TPC1 2DUXA 3MJXA 4L9IA 4Q22A 2XU2A 1D0XA 5I06A 1E1CA 1UJQA 4XAPA 4JFTA 1J18A 1V5XA 1S5TA 1RQHA 4PUMA 5D2YA 1XSIA 3W2KA 3FZFB 2DV0A 2A79A 5AYIA 1C7SA 1LT8A 4UTMA 4O4LE 1F3TA 3ENLA 4IZGA 1QOXA 1YBQA 1OGSA 1WUEA 2FDMA 5CGQA 3U2OA 1JEZA 1ZAHA 1BPLB 3E5PA 5AQJB 1UUQA 2FPVA 1EZ3A 3S0CA 3UPWA 2QV5A 1S5NA 1P0BA 1QLBA 1ZLPA 3U2EA 4JEHB 5TNVA 1PO9A 5AQTB 2QCMA 3UYCA 3WEOA 4QCEA 3NQBA 4NJKA 4Z2HA 3ZMVB 2W91A 4KEZA 1P1MA 3STCA 4L61A 2QJMA 1R38A 2EPMX 4ERAA 2V9DA 1DWJM 3SIMA 4JNZA 2OO0A 2Y70A 1R3SA 2P88A 2Y8DA 4YVPA 4BHYA 3F7JA 2W92A 3T55A 2D20A 1IT0A 3AIRA 2C8NA 4Y9OA 2CHRA 4DJDC 3PULA 1AH0A 3AXKA 1NDWA 2LRKA 4GY1A 1EF3A 2UV8G 1DQXA 1NDYA 3P0XA 1H2JA 4LEQA 2X0SA 1WR0A 4Z2IA 2VCBA 2DW7A 4BI6A 1FXQA 3FHQA 3CHVA 1YTEA 5LHFA 3MUCA 1P7TB 4TWHA 4JQ1A 1RK6A 1TVNA 2GJNA 1JR1A 3NQCA 3NO3A 2AQVA 1JJKA 1A5MC 1F07A 5HJXA 3FZKB 3LXAA 1FH9A 4ZOEA 4PNIA 4DV2T 4Q8UA 3QHMA 3CTLA 3KLKA 1XBVA 1EO5A 1E72M 5FXXA 4E3VA 4JV5T 4URIA 3QSRA 2VEMA 4O1DA 5F5WA 3K2GA 3AROA 2QW5A 3TJXA 4G7FA 2DORA 4MY8A 5I7GA 3IJ6A 3L4YA 3NSXA 4M7SA 1XISA 3UUNA 5E70A 3GN5A 3QKEA 3U78A 3G0UA 2UUBT 1KGWA 1YW0A 3T40A 5HK4A 4O1CA 3OVPA 4UIGA 3MTWA 4JICA 3G0SA 4MPQA 3KV5A 4MLJA 4UCGA 1LBLA 4AD0A 1JAKA 1FXPA 3M5VA 4I55E 3QV9A 1V3MA 4US5D 1HO4A 1F2JA 1XJBA 1DTUA 2DIEA 3L5MA 3OODA 3KP0A 4L1WA 3H2AA 4BQ3A 3M0ZA 2XGBA 4R7OA 3GD6A 4R85A 4XZ9A 4EXTA 4BJMA 3S2JA 4LYQA 1S1PA 3NR0A 4WBOA 4HU4A 1M3UA 4DUZT 4ISTA 3BLFA 3RYIE 1KR1A 3M43A 4LVFA 2H88A 1S1RA 1EJXC 5HXRA 3CPUA 3N2BA 3W7CA 2XQYA 4I7UA 4S2CA 1E9ZB 3LG7A 1VCSA 3GBDA 1FP8A 3LI1A 4QLJA 3M0HA 2GUBA 3BMWA 2W27A 2OX4A 4TV8E 3JR2A 4UELA 1PE1A 5L2LA 1WDDA 4LMLA 2QNEA 4HWFA 1EPVA 3N2XA 1Q7MA 2I14A 1QPKA 2WC3A 3AS1A 1KFJA 5C70A 5KINA 2K48A 3P5ZA 5GJNA 3CGTA 2L9QA 4B3ZA 2WAUA 1GJPA 3T2PA 4DZHA 2WU2A 2WM9A 3CX8B 1BAGA 1X39A 2UBPC 4XSMA 1K03A 2X2GA 1V3LA 3A21A 4MB4A 5DQPA 2AKZA 3MC5A 5U7SA 2DJLA 3FX4A 4EP8C 3IPWA 4WKAA 3E2VA 1K8CA 2F7FA 5FVKA 1PSCA 3HTWA 4AY8A 1FWHC 2CCQA 4BZYA 5D2VA 3E96A 1WXZA 4MWAB 4PTVA 3FJ4A 1A5CA 1OC6A 3PVFA 1HJUA 3I65A 2CA5A 4U28A 5LHIB 3KRZA 5JDQA 1XLGA 2P50A 3CX6B 1US0A 1D1CA 2H7OA 3ANWA 2VZTA 3JZUA 2ZE3A 3WLSA 8XIAA 4GFIA 4MKVA 3QM3A 4HCDA 1HN1A 1ZP4A 3ABQA 3UWEA 9RUBA 4OJYA 5E0FA 4FEZA 1V0MA 4XVDA 1ZSXA 3EDKA 5GJMA 5JU6A 3N6HA 1B0IA 3VMNA 4XTDA 3RI5A 5LIUX 3MO7A 2PTFA 4DVDA 1IZCA 3T05A 1IWAA 2D3LA 1NH6A 3K30A 2WK2A 1RBLA 1XG3A 4JTTA 3DUGA 2J47A 3PZIA 3HG2A 3D3AA 1HIZA 4B3TT 1GPFA 1ICSA 1G69A 2IQDA 3IAQA 2QGHA 2CU0A 3VX1A 4ZHQE 1VBHA 4EPDC 3AYSA 1HGWA 4KPLA 4E4PA 4GYKA 2DIJA 3L4VA 5A5WA 4LF1A 1WRDA 2V8SV 2FZNA 2QUTA 3CLWA 1QPQA 3AE1A 3OGSA 2V6YA 2WYSA 1VPQA 5LIXX 4HMDA 2ASHA 4UTIA 3TMLA 2CLYC 1OCJA 2N2NA 4L9XA 1BXBA 3LA4A 1QTWA 3ATYA 5DXXA 4KF1A 4U31A 1AODA 3VOFA 1V6UA 3AE3A 2BBJA 1LWIA 2X30A 1EUNA 4CQBA 5C8BB 3ICJA 2XGZA 2YOEA 4K7VA 4JTIA 1OCNA 2PDJA 3D47A 5F2GA 3ZQ9A 5F1VA 1EZ2A 4HZ6A 5EBUA 4E4FA 3XIMA 3AFBA 1MNDA 2X16A 4FF5A 5T9BG 1OF6A 2GGHA 2CM0A 1HX8A 4KFPA 2OV9A 2DVTA 2IS7A 2EKGA 4PK4A 4I6VA 4WF7A 3GHUA 4DO0A 1I2QA 2VFHA 3W7HA 1MW2A 4KRTA 3WMLA 4AAJA 4LAMA 1G8XA 5AVHA 1SO4A 1SZEA 1K9FA 3NGJA 3NEHA 4WSHA 3ZOAA 1AA1B 3TMQA 2E9LA 4XZIA 3KTXA 2VX7A 3PPHA 3C51A 5D9NA 5CZJA 3PG9A 3MWAA 3FYYA 2I59A 3ABXA 1Q6GA 3H8AA 2WBGA 1EIXA 1UUMA 2I5GA 1B3ZA 3OQ8A 4MFEA 1M62A 5TAOA 2IPFA 4AISA 3KBMA 4LTSA 2LRLA 4XKYB 1J96A 4Q3MA 3AE2A 1YDNA 3LCWA 3TTYA 4QITA 4HWHA 3EPNA 4YSYA 4DBEA 1JFXA 3QBUA 4B15A 1MYRA 3OZMA 2ATMA 1BFNA 2JALA 1PTAA 2BV9A 2RJHA 2C16A 5AHIA 3STGA 1I60A 1HKKA 4D6FA 1BR2A 3KCJA 3MMWA 3BLLA 3J7HA 5F4XA 1JQVA 3LHVA 1KCXA 4W89A 5GONE 3UYIA 3HPXA 1DJGA 1ZAIA 1OY0A 4DJFA 4C1NB 4CN1A 5EMYA 4DJDD 5JVLA 3TWAA 5L3CB 3ZJ8A 1DIKA 2WO5A 3VPLA 1EIBA 3PG8A 1Q7ZA 4AKGA 1HKMA 4XAZA 2INFA 1KKOA 1W9BM 3UFYA 3EDVA 3JS3A 3NOEA 2K3WA 1CEOA 1QR7A 2XIMA 3B8WA 3BW2A 1EBGA 2FJDA 2EHOC 2W67A 1BG4A 2I1OA 4U7YA 5C9UA 4NX0A 4NZ5A 5G1TA 2L5HA 2WNWA 5HEUA 4IM4A 2GSHA 4G5DA 1A4LA 2ZUNA 4XD6A 5LHEA 1Q6QA 3FBLA 5TIMA 3WFLA 3W37A 2H3DA 4UTUA 4E3TA 3N2OA 3V18A 5BNKA 4TX9A 5MKGA 2Z1VA 3GNOA 1FFRA 1Q65A 2C6QA 3H2MA 1CX9A 3OVQA 4FLRA 2VDGA 2OG9A 4UEMA 3FK4A 2FGLA 5A2CA 1V9DA 4PTMA 5I3KA 5CEWA 4V1XA 1LBMA 4BI5A 3K8MA 4O8SA 4FSAA 3C5QA 1ZTVA 1W37A 1B7TA 4IFKA 2VZOA 4R5EA 4EPKA 1JYWA 3IJQA 3WF1A 3NPVA 1XKJA 4S3BA 4FLOA 2IHR1 3VIGA 4CCDA 1UWQA 4XD3A 2IW5B 3KVAA 3FY1A 4UOJA 3LMYA 1IT8A 3P4SA 2ZUTA 5HMDA 1QCWA 2EPLX 2RJGA 1NFPA 1OEDC 4UQAA 2G4FA 3W85A 2PG8A 1NVMA 3UR8A 3KWSA 2P9BA 3TNBA 1P0NA 2D2OA 3AHYA 4IGHA 2Z1KA 3ZWTA 4O4WA 1W3HA 4HZMA 3TFXA 2E0PA 2ES0A 2ALRA 4K36A 4FOUA 4C6OA 3F4VA 4MAVA 4Y96A 3WAKA 1RP8A 3UXKA 2HVOA 3TV8A 4LCRA 4N6FA 3S9IA 3ID7A 3M7SA 4ZQNA 1EWDA 3WLKX 3LXCA 4N9CA 4B3KA 4QWNB 2Q3RA 3DCPA 4RNHA 3T4WA 4GI6A 4S3JA 3F4WA 3O4XE 4ZO7A 3GNRA 1LCOA 2DNXA 4R27A 4TX5A 1VF8A 1QNQA 3B0PA 1FIOA 3WZ0E 3LPFA 3CQJA 3EGJA 1K8ZA 2X42A 1WKYA 3LSCA 4YCPA 3BAWA 3NDOA 2PSNA 4W9TA 3CV7A 4F0HA 2A3CA 3M5ZA 2WZTA 2REQB 2PDKA 3EB4A 1F4AA 1G4PA 1PL9A 3AS0A 2ESCA 2BODX 2HNEA 2D24A 1R3VA 3AS2A 3TQPA 1TPEA 4TTGA 2VGFA 3R43A 1HG3A 5IRPA 1W56A 1XWMA 2BZBA 3N04A 1KBKA 1VC4A 4P7RA 1GONA 2XQ4A 3N25A 1M1BA 4GO8A 4B5SA 4MAZA 2P3EA 1B1YA 4GUHA 2AL2A 3H7RA 5G1YA 3WG6A 2ZRVA 4EXAA 1R2TA 1OYAA 4IOTA 2P0IA 4RL3A 4C5ZA 3LMZA 2FH8A 1T41A 3AIQA 1KBJA 2NQ5A 3GAYA 3TYAA 4PUKA 4IIJE 4JNYA 4KMCA 1YNQA 3O6YX 3HGOA 4ZCWA 1VJIA 2Y62A 4ZENA 3B9AA 3QRHA 5HBFA 2V2DA 2Q9QA 4X2PA 5A94A 5AVNA 1QBAA 1MNZA 3CX7B 4Z90A 1BRLA 2C0HA 2CHOA 1WE5A 1EEXA 3AE6A 5BMXA 5J1GA 2V2HA 3AHZA 3N9LA 2UXXB 1W2PA 4MZ1A 4XIAA 3FAXA 2B7QA 4BWLA 3UESA 3BVJA 4UFIA 1B3OA 3AHVA 4S1FA 5DF0A 4HFVA 3GUWA 3D5HA 1T0OA 3B3DA 1ISVA 3I7QA 3B0YA 4MJMA 2VVSA 1Q6EA 5CG0A 2FVLA 3HI2A 2UZ9A 3O06A 2C71A 4BKNA 3MYOA 5PTDA 1S94A 4PA8A 4LF4T 4D72A 1TUXA 3DERA 4PFPA 4EF8A 3UEQA 4K7YA 2CYGA 1SFLA 2X9HA 5FF3A 3LTSA 4IL0A 2E8IA 2PWUA 1R85A 2JIEA 3CS2A 3EDEA 2J8FA 2WM1A 3L4ZA 5AFDA 3C2OA 3LK3B 3G3MA 3FOKA 5I3JA 3LCXA 3M64A 2FJKA 3CYJA 4KGLA 2LSJA 2LEHA 4E7SA 1E4NA 1A5BA 1VD6A 2PWHA 4H6QA 4ZXLA 1YXCA 1GPWA 2BG9A 2Z1SA 3UCQA 3BSHA 1WXJA 1H7XA 2ZE0A 3DFYA 4E4UA 5AQMB 1XC4A 3EWDA 3KRSA 5AECA 3QY6A 4F2UA 4PUUA 1XGDA 5B7YA 9XIAA 2CLLA 3W25A 3GW3A 2YJQA 1XBYA 1BR0A 3CT2A 5AQOB 4BQ4A 1SYTA 3KW3A 2VFGA 2C5IT 4YTQA 3PAOA 4WBNE 4AWSA 3QLLA 1Z3NA 3M0VA 2EPHA 3I6TA 1MMFA 1KM3A 3RM8A 3KDOA 3L3PA 2E9BA 4IGMA 3PJAA 4JGDA 5ABTA 4UNKA 3CWNA 3M5YA 1SO3A 3L67A 3PZ9A 1UIPA 4AIOA 4D1JA 1ZJBA 1M7XA 4PJLA 4UR7A 1DYSA 3DKJA 4O0ZA 3TLLA 4JI5T 2D23A 2AE9A 1ZP3A 1UKSA 2P0OA 1TRDA 1LORA 5D37A 3M3ZB 2PB1A 2XINA 3WQ5A 4HCHA 2ZCGA 2WV8A 2ANUA 4ZSUA 4GI8A 3BLDA 5LGTB 4M6QA 3UQNA 5CSRA 1QATA 4EPEC 2J8GA 5AQKB 1J0JA 3FJNA 1TQJA 1OGBA 3IJ8A 1TTIA 5FJUA 3CV1A 5C5YA 4GPNA 4EK7A 1FRBA 4BF7A 4QG9A 4IQEA 3ZEFB 1XDJA 2C18A 3O16A 3P7YA 2YYTA 3UU8A 2FTYA 3DHPA 1D7KA 4XAYA 3SCOA 4S38A 3VNZA 5IBXC 4JL2A 3PZGA 3WD0A 3ZR6A 3ITCA 2Q02A 4L56A 4F8HA 3D3FA 3RMEA 2OYMA 3LFMA 4DWSC 2NWBA 1JPHA 2EHOD 4H7VA 2H9AB 4B5NA 5HEHA 1PWLA 4LVBA 3WDPP 3KCOA 4AY1A 3LLFA 3N73A 3T08A 1ZJIA 3AXJB 3G6MA 2QYGA 1WCGA 3NL5A 4CUCA 1AL8A 2PDYA 1L0VA 4M6PA 1EUAA 2R1PA 3KWXA 4I0UA 2J9YA 4EKJA 4QG6A 4KHZF 3PJUA 4DWDA 2NTXA 3RF9A 4GZ7A 1GQLA 4NY2A 3THDA 5B80A 1U1HA 3L0NA 3PF3A 3LGDA 5CPTA 3CMJA 1J0IA 4GKTA 4M7TA 1GKPA 4UIOA 3FZHB 5DQWA 3MANA 4IDNA 2X40A 2LOSA 4TUYE 4F0SA 2BOFX 4TVCA 3V0UA 5C71A 5HWJA 3W1AA 2C5JA 1QNOA 3TWBA 4WOQA 3ZZ1A 2DL1A 2FYMA 2QUMA 4PEEA 4IXHA 1AQ0A 2ADAA 3NUKA 5C54A 1OEDE 3KM8A 2PTDA 5AQRB 1J0HA 3VNLA 8A3HA 4IH3A 4RE4A 4J4KA 5BRQA 3T2OA 3BLOA 3KL3A 4UOZA 3MA9A 4MB5A 4IGUA 3F5LA 5AC8A 3SCWA 4BCEA 4WYVA 2WVUA 3HPSA 3CUJA 3TNOA 1O5XA 3O1IA 1KTBA 5DX7A 1YXDA 1W0MA 1VIZA 3XISA 4DV5T 1L6SA 1UR9A 3Q5DA 1CTNA 2DVXA 1KM1A 1PS9A 3KVBA 2BOEX 3GXPA 3RG6A 4MIMA 4DUXA 1LVKA 1JCNA 3BXWA 3N2KE 4LUSA 2DU2A 1RQEA 2LKHA 1N33T 3CB8A 4MY9A 1TCMA 3CMFA 5IDIA 3F2DA 4DR3T 6ALDA 3I68A 3W1PA 2X68A 2V5LA 5LNKA 5JBFA 1T72A 4HTBA 3RKOA 4A98A 1JPDX 3OHMB 3WL0A 1P5BA 4AEEA 4AX7A 4FHAA 4A2RA 3W7OA 1J2WA 3CYVA 3SJ3A 1VCFA 4CVWA 3K46A 1GJUA 3KLLA 3DP7A 2QUUA 1QJWA 3MKVA 3W75A 3LI0A 4GKLA 2D0HA 2FIQA 3A4XA 3ESLA 2C91A 1BWKA 4XUYA 3CWOX 2VL8A 4US6A 3FXDB 3UWUA 2G3JA 4UOQA 1JQXA 2PDXA 3NWRA 4ZI2C 3HGJA 3BV4A 2QDGA 1I6NA 3SN1A 2HMCA 4OYKA 3V4BA 1SA0E 4QQ3A 1RA0A 4TU1A 3F4DA 4EZHA 5FOOA 3W1RA 2OSWA 5A8NA 1AL7A 4QJ3B 3KHDA 3SY5A 4DEFA 2R1KA 4RPQA 2YW4A 1FUYA 2PTYA 3ZSTA 2VFEA 3NL2A 5D33A 1TX0A 5DANA 1JPMA 1XDPA 3RO8A 4MYAA 4R3UA 1XFCA 4GX8A 3AZRA 1YW1A 3L2LA 4ASTA 2AOSA 1MUCA 1XGZA 1WOAA 2YLAA 4O4HE 1NQKA 2NZLA 2WU5A 5DFAA 3LQGA 3A3WA 5EMMA 3ARQA 3G18A 4JN6A 1D0ZA 1AJ3A 7REQB 2AXDS 4O28A 5D2WA 3OA5A 2Y89A 3C3UA 1WDRA 1FWWA 4FLSA 2VVNA 4YNGA 1TREA 4GXWA 5LYRA 3F2CA 1W31A 1ZS2A 2X1SA 1XCFA 5XIAA 2RDUA 4YMZA 1TV4A 4H6RA 1UYQA 2E4TA 3ZYZA 5A1LA 3NSNA 1KQZA 1DL3A 5CLWA 1IXOA 3UU5A 3AI0A 1L6WA 3OBVE 1B9ZA 3WQDA 1ESWA 1BGAA 1R2SA 3C4WA 2E7FA 3L4TA 1POJA 3DIPA 2VKDA 4W7UA 1XYLA 3MP3A 4JYDA 4XZHA 3ZVHB 4AG0A 2GYIA 1TZZA 2G8ZA 2BVYA 3NQ2A 3CC1A 5D04C 2I9UA 1EYEA 4CD6A 1HVXA 1QNSA 3B05A 3PP7A 3W6LA 4Q6JA 5AQHB 1OF8A 2ZUUA 1SJCA 3BW3A 3FIGA 2OZ8A 4A3UA 1OINA 2PDIA 4MNMA 4YVXA 2PMQA 2V30A 1W54A 2R6OA 1KBBA 4RE2A 1FQ0A 2OTDA 3MKDA 1QW7A 3IAPA 4ADTA 4DJFC 1OIMA 2D0UA 1DWFM 1GOXA 1VJSA 4I5RA 4LUIA 3C2FA 1QO2A 4JIEA 2OJPA 2K5BB 4R33A 3UP8A 5A6MA 2PZNA 2ZRUA 2EGZA 1V6VA 3EWYA 5CA1E 4M81A 1K9DA 1N8IA 3RQWA 1IIGA 1UBSA 3FZLB 3LBXB 1G94A 3ZMSB 4IXXA 4HN8A 2V7KA 2WDQA 3ONCA 4IP4A 3EVYA 1NELA 3AVRA 2ODOA 1XQLA 1DWGM 4YU1A 3NEVA 2FGZA 4YVVA 3NFUA 5B7ZA 5H6QB 4I9AA 1E0WA 1WA3A 5CC6A 4POCA 2PU1A 2J24A 1JGIA 4F2TA 2BY1A 3SRKA 5C9XA 3VR8A 3VMOA 3WQ4A 2WOQA 4CQAA 3KZSA 2YN6A 1AZ2A 3PZNA 2UXNB 5KDMC 4DR5T 4ECLA 4IE4A 1Y8BA 3ZIZA 4WDTA 5C2GA 4JCLA 2QRXA 3DI1A 3MUY1 1Z6KA 3GZ3A 4LSBA 3TN4A 2B7PA 3GNPA 1S38A 2Z7GA 3K8KA 4NAFA 3AA0B 4B5TA 5EMUA 3LHTA 3TE9A 4PFOA 5A69A 4ICMA 1E1FA 2WANA 4MVAA 5AHFA 4ILCA 3LTPA 2HPLA 2VB6A 3W2NA 5A6BD 3I9WA 2DY3A 2NUWA 3RH3A 1V3JA 1Z89A 2VI0A 4HK6A 3RX3A 2W3ZA 2LHRA 1J2BA 1OADA 3H21A 3PUOA 3A5FA 1UKTA 2XQ3A 3PHAA 4IIEA 4X9SA 3KHJA 4PJNA 3VUPA 3B0UX 2V5JA 3KEHA 2WVSA 5C2XA 5LG3A 3G3DA 2LOPA 4RKAA 5FI8A 3AWOA 3B9DA 3GMIA 2BOGX 3VOHA 3RLGA 4QJ1A 3S3GA 1TPFA 3GTFA 5BRPA 3AHTA 1ZBVA 1QI2A 2ACUA 3CL8A 2QPUA 4CVUA 2CLFA 4K0KT 3W22A 1ZHCA 3CBWA 4AVNA 4R9OA 3II1A 3PB0A 3JADA 3GY1A 1O60A 4JPGA 4DWSD 3DFTA 2VGBA 4HSNA 1PZ0A 5HXEA 1US2A 3FKRA 1T5AA 4L1GA 3VD4A 3C98B 3U3HA 1XLCA 5GQBA 3EMQA 4P5UA 3CZ8A 4Z08A 3USZA 4CD5A 3N14A 3WYZA 2Z6IA 3A12A 5HMSA 2BG5A 3U4AA 3C0SA 4LC6A 5LIYX 4OYJA 2VWSA 1XIEA 4DR6T 2X1IA 3ARUA 3GBEA 1NWTA 4ZQOA 2V5KA 1G9HA 4EV6A 2QV4A 3N1AA 4NVTA 1OG6A 4WX2A 2DW6A 5LNUA 2BKOA 4JTKA 4NAEB 3CKDA 2J7EA 4JTCA 4AIUA 3IS4A 3M0XA 1H7NA 5TBOA 1M01A 1NOWA 4X0VA 1DJWA 1O3XA 4JN8A 4H9PC 4NHVA 2F6UA 3ZN0B 2BS4A 3FGCB 2J9XA 2DZXA 1H61A 3T1GA 2ODVA 5FAJA 3EX6A 2VRKA 1TTQA 4KH2A 2HK0A 2YA1A 3MV11 1UX5A 4MSSA 2WDVA 3BCJA 2GVJA 1OZQA 1XLHA 3IRSA 3CAKA 1RAKA 3LPPA 4HE8A 1HNZT 1W9VA 5HNUA 4P0BA 1J5SA 3C50A 1S5VA 2VFIA 3HJEA 3SECA 5A6JA 4G9PA 4DR2T 2E1DA 3W82A 2GDVA 1YYAA 4DUVA 4EIVA 2E77A 4EANA 1HF8A 3A3XA 3VDCA 4JL1A 4OBRA 3WQEA 3ARSA 2BNJA 1V3HA 1T8BA 4JI7T 4Z1BA 2JK2A 5C2CA 4GJ1A 2I16A 4DBUA 1PKNA 4GQBA 2Z1XA 1Y01A 3ZLIA 2BY0A 3AUJA 5JTGA 4P0AA 3TDFA 1FWSA 3E0WA 3K3QC 1H7CA 2YDSA 1DJNA 4XD4A 3LJCA 2BHZA 4XB3A 5D8WA 1KWKA 4JI4T 1C92A 4QJ4B 5JVDE 2WWDA 1Q3NA 3TEVA 4JN7A 3NZQA 3SQSA 4LCSA 3W7QA 2BG9C 3EEGA 1I9CB 4C6IA 2I6HA 3R94A 3OJGA 3HA1A 3RYFE 2QGSA 4ZI2D 4AUBA 2BVWA 3PUAA 3N13A 4HGXA 3ZYMA 4QXBB 1VB9A 4IUOA 3P4QA 1F5ZA 2J62A 1YEYA 1XRVA 5C9RA 3DFNA 3BK0A 2GQAA 1PCKA 3KOXA 3OBEA 3E0LA 3OBAA 2PBOA 4O1FA 1SJAA 4V15A 2BVMA 3PUSA 3R1ZA 1K7FA 5HR6A 2XFWA 5EBAA 3V16A 4FK9A 2Z26A 4ZOBA 5IOBA 3D0TA 1GK8A 4UFKA 1EOMA 2CEAA 3WQCA 3UZJA 3VIJA 2ZXDA 4HHHA 2E8YA 2ZM8A 3LQLA 1TSIA 5H2ZA 2H90A 3R25A 3I7RA 3RCYA 3PE0A 1L2QA 3W1XA 1XIHA 4ATWA 1IHIA 3F1QA 3GH5A 1TJ2A 1NY1A 3N5LA 3PPFA 2XIJA 3Q4DA 1PTDA 5CGTA 3EAMA 4MNKA 3W70A 2EQDA 2R14A 3I0OA 4DMWA 1GEHA 2PC8A 4RE3A 1VFFA 1TV8A 1A49A 4O50A 4M1RA 4UZSA 1XIDA 3GXNA 2CBUA 4JUYA 3HGRA 3CUIA 5T26A 4LJ3A 4D8LA 1FX6A 3MBDA 2ZXQA 2FVKA 4Q7IA 2WHMA 1A3WA 1EA0A 3MMTA 1AVAA 4A29A 1C8QA 5DBUA 4CU7A 3UUBA 4KRUA 2GQ9A 2J1DG 2LLYA 3T1HT 2F4VT 5IWAT 3LCIA 5H91A 1TG7A 4QNEA 2X66A 3G24A 2JPFA 2R1MA 1ZEEA 4X65T 4I9JA 4DJFD 1D9EA 1QPRA 2PP3A 3P50A 5LXTE 2QCGA 5ABEA 3RUBL 2YA0A 4KWVA 2WPGA 3PNZA 1U83A 4C6EA 4C6DA 1EP2A 5AQLB 3ZCJA 2AMXA 3CQXC 2PF8A 2Y8KA 1L6GA 4IQJA 4GGHA 5CZTA 3H12A 3MHUA 1D0YA 3E0FA 3TTOA 1LOLA 4GD0A 3VABA 4QP0A 2HTMA 3I4EA 1J1JA 3QV6A 1IXNA 5BU9A 3NRYA 4KS0A 1P43A 3AICA 5AYZA 3GXDA 4GA8A 1W0BA 1HL2A 5JDMA 2TYSA 1W09A 1UPMB 2AGKA 2DLRA 3QHNA 3KE0A 5FJIA 2M67A 3VKHA 3C0QA 3LUTA 4LUYA 2NXGA 5I77A 4ZE4A 4HP5A 3WLNA 4CQIA 3OLGA 4YYFA 2GVGA 3AYRA 4PMZA 1OC5A 4PB5A 3VKBA 4GBDA 1J11A 4H9VA 4DO6A 5E09A 3VTRA 3EXSA 3WK1A 3P4PA 3RIAA 1XPGA 4QISA 1H41A 3PBUA 1DORA 5AHLA 3ITTA 1LZOA 2FJUB 4J40A 1CHUA 2GL5A 1DHKA 1F4HA 2WMOA 1C93A 1IBMT 3T8QA 1O4UA 1MI3A 4AQYT 4R34A 3CIXA 2HBXA 5I23A 3AE8A 4GZJA 5DBTA 3KOZA 3O2LA 1CGUA 1E7PA 1ME7A 2FB2A 1X8FA 5AZ1A 3OJAA 4PTDA 4R9XA 8TIMA 4P2VA 5IHRA 4KCTA 3VIOA 1UC5A 4HFCA 5H8MA 4JBWF 3NQ8A 2BKPA 5DQVA 3OG3A 3VD5A 1DWHM 4MOZA 2IUBA 2DJXA 2XZEA 3TIMA 2DSVA 4H9NC 2YDRA 4MJ2A 1MMGA 1J9YA 3OYZA 3MP5A 3RGTA 3OTOT 5AQVB 1W3JA 4O17A 1ELSA 1RPXA 3P93A 3SIZA 3CO4A 4ZEYA 1VEPA 2XVKA 4GI9A 2PDQA 1UWTA 4WDUA 2WBLA 4JIIX 4MZYA 2HPJA 3RR1A 4LV9A 3SUVA 3HR0A 1JXKA 4F79A 3C0JA 5I78A 2LJLA 2UY2A 2B1EA 3E22E 4QAWA 3NA8A 3FA3A 3A4JA 2WKLA 3VKCA 2XAHB 1K77A 3WMCA 1YQ2A 3FCPA 4X62T 3ZLHA 4X1IE 2ZTKA 2VRQA 3EWBX 5LMNT 4OECA 3F5KA 3WNNA 3H22A 2OQLA 2KZ7B 1EC8A 3JVAA 3CK5A 4MWAA 4WEVX 4AXPA 5K9XA 1A5AA 3RGLA 1G0CA 4KUMB 4D9PA 5C0QA 1KV5A 1QHZA 1GORA 2VK9A 3DFPA 4YTSA 1U30A 4O11A 1VCTA 1PKMA 2QF8A 3AS3A 2OFJA 3ZPOA 4Z1AA 1GVFA 1LQAA 4ZMGA 3UZYA 4J35A 2D2JA 2Q9QD 1RD6A 3UW6A 4PUDA 4DNDA 3ARVA 1PVNA 3THAA 4NUVA 3I9YA 4J5NA 3IIZA 4HWIB 1I6ZA 1XYAA 3TLSA 1HJWA 4O1EA 6REQB 4DBSA 4XZWA 1UD3A 3ELFA 2ZZ6A 4EXBA 3ABZA 4AWEA 3M07A 3AE7A 1R5YA 4CI1B 2ZUMA 2DZTA 2LT3A 4D8ZA 3I1AA 3C6CA 4LEFA 4N4PA 4HNTA 3TTSA 3NL3A 3UQ4A 3V5OA 1NP2A 5D9OA 1QBBA 3L66A 2R6GF 1S2VA 3WSUA 4DM1A 4MNJA 4UVBB 3CUZA 1C90A 4ZB5A 3BOXA 1EGZA 4H7CA 1JL8A 1BVZA 2BGSA 4B90A 1XC6A 5FJTA 3WD1A 1IBKT 5FEPA 4FALA 5JDLA 4O4VA 4GYRA 3IJ7A 2IQ0A 3Q5EA 3BSMA 3FXEB 2GQ8A 1Q7QA 2BG9E 4Q25A 3VGGA 1S2CA 3SSZA 5C9WA 4GE8A 4JQ2A 2VKJA 1D8WA 3PBMA 4IPLA 2V69A 4LYKA 1JFHA 3CT7A 2WZMA 1Z9AA 1HTJF 3PPCA 3PK7A 4V1YA 2PBIA 3KX6A 1GHSA 4H9OC 5C2TA 4QROA 1I2RA 2CXEA 3UWWA 2YU1A 4W7VA 2CZFA 3TFCA 2VEFA 3RRCA 1C3FA 1WKDA 1ZRQA 2J9ZA 3N9MA 2QCLA 4WSJA 1GYMA 2JF6A 3WLOA 3R6IA 1J79A 1AMKA 1Q8JA 4NRSA 3WD4A 3O8AA 3SADA 3GNNA 4M51A 1VBGA 1EJRC 3RX6A 2PTXA 4QXIA 1H0IA 3S6TA 2EPKX 3PR2A 3CAVA 1U5JA 3QMTA 1ISYA 5G4WA 3BJFA 5AN7A 4K3ZA 4HT3A 1AMYA 2MYSA 3EOOA 2M6BA 3R8HA 3P74A 1O94A 3WN6A 2ACXA 4MJ4A 2WB5A 4TMBA 4XKYA 1H09A 4IE6A 2NX1A 4EPBC 4CU8A 2W5FA 3EOEA 3L4WA 2CBVA 3SURA 2W62A 4A8LA 1RLDA 4FAMA 3W84A 3PM6A 5GNYA 4CI2B 5ABHA 2DSWA 2HNHA 2VELA 4D8AA 1W1TA 2FMOA 3QLDA 3S2MA 5JRCB 3B8VA 4JHOA 5JH7E 4I8YA 1MXSA 3QFWA 2V3FA 3GNDA 1E6XM 5D30A 1UZ1A 4S3KA 1B4EA 1BQCA 2OZTA 4HHLA 3M41A 2X0LB 1UQZA 1UD6A 4WK9A 1E5NA 4IL2A 4XBFB 2NQ9A 4QKNA 3HIJA 3EWUA 3RX4A 3C64A 4NPPA 4B5XA 1JCJA 4DB7A 5DELA 2YCLB 1ZHAA 1IGSA 4E7ZA 4JAWA 1EWEA 2YZ5A 1KCKA 3WEMA 2CBIA 4C1NA 3V7PA 3NTYA 1EEPA 1V4YA 4GZIA 5LA6E 1VLWA 3BQ5A 2LLEA 3WEZA 4HN9A 3LBCA 3BICA 1BTCA 2DCFA 3WAJA 2QPXA 2JFEX 5AQQB 3KV4A 3TLUA 3B5MA 3LEPA 1MRQA 1SZGA 2BS2A 4Q8PA 3GIYA 3VUSA 2P8BA 3RX2A 1QFEA 4C6CA 2CLYB 2V1DB 1TPVA 5HXMA 4B3LA 4NQ1A 3VZYA 3GU9A 2CW6A 1JPIA 2GSJA 2IPJA 2QZRA 4IWWA 2WLZA 2PWFA 3IUDA 4TR9A 3PZVA 1E70M 3GU1A 3Q37A 1J6PA 4LRSA 5C7HA 1QI3A 3A23A 3TXZA 4ADZA 3MUAA 3EX3A 1MO0A 3S83A 5JQGE 5BOFA 3H7VA 1KCLA 3MCNA 4QXHB 2B7OA 3TJIA 4DUWA 5XIMA 5BWFA 1FCBA 4IJBA 4XKMA 7TIMA 1YMYA 2R9RA 5LA0A 5LIWX 4YLHA 2YPIA 3KFTA 1XGEA 1EPXA 2FMNA 2WSRA 3GTIA 5HINA 1YDVA 3QXBA 3RK8A 1MW0A 5RUBA 2IQTA 2XWEA 3NURA 3CHDA 2ZXAA 2VEPA 3RC8A 4BS0A 2QAPA 4UFJA 3B0XA 2G3MA 1KRMA 3NL6A 3OO2A 1AJZA 4GLEA 4LQ1A 4G1KA 2ZX7A 2DQWA 2CESA 3GXTA 3QOKA 4JFUA 1RBAA 1K3UA 3PZTA 1PIFA 4X20E 4WGXA 3UGVA 4PK5A 2D2HA 3QTGA 4ZB2A 1QK2A 3HL6A 1H7WA 1TJPA 2ZYFA 3MT1A 2NUYA 3AAIA 3UR7A 1UP3A 3AYVA 4LF9T 1UPPA 2CERA 1VH7A 2PS2A 4LBRA 2OA5A 1JUEA 2V6XA 4JZ5A 1MNSA 3MHFA 1GNXA 4NP7A 2DZPA 3PJWA 1QVBA 4ACZA 3CWHA 4MKSA 1YE4A 4OIFA 3SCQA 3GR4A 4H2HA 1R3WA 2V5CA 4P8VA 1E6PA 3AE5A 4D1IA 2HE8A 4WCJA 8XIMA 3HG4A 3O05A 1VYPX 2MANA 1EJWC 2J7CA 2UWFA 3PBGA 4JIQA 1S35A 1DXFA 4J9JA 1DJZA 4Z17A 1CXIA 1W17A 3MHGA 3VIKA 3WQFA 4OV4A 4L5GA 3I6EA 3R10A 4UNIA 2J66A 1WYCA 1H5YA 1RV8A 4PMOA 3RNDA 1PWMA 2REQA 4JNMA 4HNNA 2FH6A 2EHOB 2OKTA 3GYCA 1R3YA 4Z2LA 3UY8A 5ABFB 5AC4A 3G1VA 3M16A 4EVZA 4I50E 4AD1A 3SN4A 4F6RC 4BR1A 4H01A 3U5UA 3V0TA 1OFAA 2A3AA 3SRHA 3MI2A 3NCOA 4G2DA 1S39A 1C91A 4IJRA 4RNFA 3NBXX 2INZA 3N6JA 5CC7A 2YBTA 2NV2A 1MEHA 1UZ4A 3AJXA 5HANA 4DZIA 1K8YA 2VQUA 4O1AA 1G67A 2VD8A 4GYJA 5CFBA 5D09A 3E49A 2E09A 3C2YA 4J3TA 5T91A 4CGTA 1WBHA 4BQ5A 2P3ZA 3TA9A 2VEGA 3T0TA 1ISZA 4ZO9A 3WJXA 2KAUC 4HFDA 1WUFA 2J79A 1W1PA 2NX9A 2NW8A 5E0OA 3QR0A 3R6NA 4UTLA 2FZ8A 2OSXA 2VNCA 2BMBA 3P8JA 3ZJ7A 2A7RA 5HEJA 2IC6A 3W6MA 3W7NA 1LT7A 4JIPA 1XV8A 4C6MA 3HPFA 3IK4A 3JZEA 4DAFA 2QJNA 2BDEA 1OEDB 2RAGA 4H00A 5A6SA 1MUWA 4KEUA 2BVTA 5KTLA 2W9MA 4IGSA 1Q4NX 2CFFA 3GZAA 2V8ZA 4X63A 4O14A 2J4GA 1JZ8A 5DT7A 1NOFA 1GKRA 3S46A 1CGVA 1UGOA 2WKGA 3N2CA 3E2QA 3KRBA 1E5JA 2GOUA 2X41A 1EQCA 4H9QC 4EAHA 1MWOA 2O9RA 2QLYA 2VZUA 3AXHA 3QVQA 4JQ3A 4DBDA 2ZXBA 5GVJA 2Y7EA 2HJPA 3QKZA 1E40A 1NARA 2OODA 3UU0A 4IFOA 4CQ8A 1HR0T 3QB5K 4M56A 2C15A 3NPXA 4Z8XA 3MZKB 1A47A 2QIWA 1WZMA 4QBXA 1BWVA 1OWQA 1UD4A 1EZWA 2Q8LA 1VCGA 2PDBA 1OSEA 2PTZA 1VHNA 3W88A 3WENA 1X79A 5HEGA 2UUCT 1I75A 4YTTA 4FMVA 4ZO6A 4X5TA 2ZQ0A 2QHAA 1VFOA 5KEZA 4OFCA 3FKKA 3STFA 4JQ4A 1DIDA 1OQFA 4F8XA 3LXBA 4QSHA 4JX5A 1VR6A 3KBSA 3WMSA 1J10A 4GG9A 3AAEB 3L4UA 1SMDA 4WY0B 5LXXA 2KT9A 2BB0A 1JF5A 4KRZA 1ONXA 1WKFA 3PNUA 3TC6A 1Z8AA 3OLDA 1IQ8A 1LLOA 4JTGA 4FR6A 4ILBA 3S9ZA 1XBZA 5HQEA 1JRBA 2QUVA 2QMKA 1B31A 2A9UA 1TV7A 9CGTA 2DIKA 3KOYA 4NSBA 3AEEA 5K2ZA 3DG3A 4O18A 4CCZA 1I1WA 2JKEA 5HAXA 1KCZA 3DHUA 2IAKA 1B5TA 1YD8G 4JI8T 2X9XA 2ZBTA 3T4CA 4BJHA 5CPSA 1DXIA 4LFBT 4GX9A 4HQVA 3TXVA 1TZ7A 2PI6A 3L09A 1L0PA 2V0TA 2J78A 3UT5E 3LLDA 5J0ZA 2O9PA 2PLCA 2UY4A 4WUIA 2WSQA 2VRJA 5ABGA 5DJQC 3O0FA 2JQQA 2WSYA 3W1UA 2VTFA 4K68A 3LN3A 4ZL1A 2JIWA 2Z29A 3E3HA 4PCSA 4ML4A 5JMUA 2HRWA 4MYXA 2DZVA 3CIWA 4ZS3A 4UQDA 5IDZA 1ALDA 3MS8A 1W0AA 4NT0A 4CQ9A 4MF4A 4WSKA 3XINA 3NOYA 3URQA 2EPNA 5K9CA 3AXJA 3PURA 3KL5A 3HG3A 4KBXA 3A7MA 5C7VA 2YU2A 2A72A 3WBWA 5BCAA 1VFMA 5DXYA 1ZBWA 5C9ZA 4FZIA 5BMVE 1DV7A 4G8TA 2OEMA 1DIEA 1NWUA 1K9TA 4ZFCA 1HL9A 4REQB 4DLMA 2DWGA 2X9WA 2IKJA 4KEMA 3UUXB 2QIIA 1EC9A 2R1NA 3U7BA 3BLEA 2W63A 2QS8A 4N2YA 4B9YA 1X96A 4F9JA 2Q71A 1B90A 4A8IA 3VA8A 1LQ0A 4IP5A 5G2WA 1FWGC 4GOAA 4RNJA 1M53A 1ZCCA 3BOLA 1PZ3A 3NQEA 5M17A 5BYWA 5M3WA 2J6VA 3KS6A 1X98A 3W7EA 1PDZA 1XLAA 3ZYLA 3LCGA 2JGQA 4EEBA 2O55A 1U5PA 2YLLA 3PSWA 5LZLA 1UB3A 4ORMA 1IEXA 3IJ9A 4I7VA 3WQOA 3GN5B 2RP4A 1TKKA 4OHFA 4TZ4C 3AIWA 1HX0A 3V1PA 2WQYA 1FP9A 3GU2A 4S3AA 2QF7A 3N6QA 2OX1A 3HN3A 3UJRA 1V93A 1VRDA 2DH3A 4HPJA 3VDHA