2W61A

Saccharomyces cerevisiae gas2p apostructure (e176q mutant)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
480
structure length
470
Chain Sequence
GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Glycoprotein
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
total genus 164
structure length 470
sequence length 480
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w61A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w61A01
3N15A 2A3AA 4ZE4A 4AD0A 1VBUA 2VC9A 4BA0A 1OIMA 1O7AA 5A6MA 1JXKA 4M56A 1H09A 1K9TA 4CUCA 2XVLA 1F4HA 3WH6A 3WEMA 1H49A 1V0MA 3W25A 3WQ4A 4H8VA 2O92A 1Q6FA 2FHBA 3SUUA 4AZBA 1E55A 5E09A 3I3DA 4GINA 2WC7A 3SCVA 3WMSA 3BSHA 4W87A 3NCOA 4C7FA 1CGTA 3GDBA 4PMDA 4CGTA 5KEZA 1VFMA 4CD7A 3AICA 3PZVA 5CGMA 2YDQA 1W2PA 4BQ5A 3OZOA 4GI9A 3L4XA 1JYVA 3RM4A 4JCLA 1L8NA 1V3MA 1HN1A 2VZUA 2Y8VA 3W6MA 1WDRA 1SFSA 2J7CA 3WH5A 3QR3A 4CKQA 3BXWA 2OSWA 5M5DA 2DSKA 1KXHA 1PX8A 3OLDA 2YA2A 3SCPA 2V5DA 2WZEA 5CGTA 4U3AA 4U5IA 2XIIA 4OKDA 5AY7A 3ALFA 2E9LA 1E4MM 3EMZA 2X1IA 3HU7A 4A3YA 4LYRA 2J7GA 1MW3A 3VU2A 3WEZA 4MAVA 5M03A 1C8QA 1EDQA 3L4UA 2WC4A 2PB1A 3U5UA 5C71A 4PTWA 2GSJA 4LYPA 1KGXA 3ZT6A 1VJSA 3AIWA 3ZM8A 3ZT7A 2GJPA 2Z1KA 4D72A 4QFUA 1TZ7A 1VF8A 1XH1A 2A3EA 4W85A 2VJXA 4X9YA 3DYMA 1E6RA 3FAWA 3CUFA 2HVMA 3OLGA 5A8MA 4D6DA 2J7HA 5ABEA 1PAMA 3M46A 3WNKA 1CNVA 1UYQA 4DM2A 2NW0A 4WIWA 3WH9A 4UFMA 2JE8A 4HA4A 1CXHA 5E0CA 3A4WA 3WFZA 1J12A 4WF7A 1W3HA 5A8QA 2GK1B 1EQPA 3WY1A 4B9ZA 1ISWA 1MXGA 3WUEA 5ABFB 1BG9A 3OG2A 4TX6A 3RJYA 3UEQA 2QPSA 3PZ9A 4R5EA 2C0HA 1KWGA 3GNRA 3CUIA 5CPSA 3BH4A 4MNJA 3VIGA 1X6NA 2CETA 4JHOA 1W1PA 1MQRA 2XGIA 4FLOA 4MB5A 4W88A 2WMIA 3DECA 3PTMA 4WSKA 4EAMA 1EDTA 1G5AA 4CU8A 2NT1A 4MAZA 3THDA 2XHYA 1IZKA 1NOUA 1HXJA 4S3KA 3II1A 4PMOA 4PSPA 3F5LA 3IJ9A 4UOQA 2EEXA 2A3HA 2EPKX 2ZIDA 3W4RA 3WDHA 4DUWA 3PZTA 1H4PA 1ESWA 1KXVA 7TAAA 1NOFA 1BQCA 3D3AA 4JZ5A 3VIJA 2BY1A 1XSIA 3VNYA 1PX3A 2WSKA 1NM9A 1VAHA 4HPHA 3GM8A 2VT0A 4JHZA 1E15A 3SEPA 4CVUA 1V6UA 2UY5A 2ZXDA 4A4AA 2BHUA 3FXYA 3MMDA 2WNWA 1CGXA 3J7HA 2JEQA 3N9KA 1XSKA 2UY2A 1GNXA 1UH4A 4OUEA 4H2CA 2F2HA 2XG9A 1V6WA 3GZAA 1Q4NX 4WKAA 3ALGA 1JF5A 3RPMA 2VVNA 3B8SA 2DPEA 1C92A 1JYWA 2WHKA 3A4XA 1WZLA 2BHZA 5JIPA 1KFWA 4EKJA 2WZHA 3IAQA 3SUWA 4LGXA 4UNIA 3F4VA 4E2OA 3PZOA 4PMUA 1MYRA 3CZGA 5LA0A 2UY4A 4PSRA 2WPGA 4V28A 4Q22A 1FH8A 1EGZA 4OBSA 4GZEA 1HIZA 1DP0A 3EDDA 5A6KA 1C90A 2FDMA 3ZQ9A 2BY3A 1UG6A 1JI2A 2UY3A 3WUBA 2J47A 2QV4A 3RCNA 2VCBA 3I3EA 3RDKA 1OWQA 1CPUA 4JCMA 1US2A 3AMGA 2GDVA 3L4YA 2GJXB 2YA1A 2VURA 1GORA 2AOSA 4TVUA 1E72M 4URIA 1JFXA 1KQZA 2ZX9A 1LWJA 3SURA 1LL7A 1ITXA 1W32A 1KGWA 4MJ2A 2AAAA 4U3CA 3PHAA 3T0BA 3TTQA 4J3XA 3AROA 5F7UA 1K6AA 2ZXBA 2ZX6A 2E4TA 4F66A 3WELA 3AS1A 1XYZA 5A94A 2WSPA 3W24A 3EDEA 2ZX5A 1B31A 1FHDA 1X1NA 3RILA 2FHCA 1AQHA 4DWSD 1W9BM 1PBGA 1EO5A 4YPJA 1OD8A 1I75A 4JFTA 1JI1A 1V3HA 3SUVA 4GI6A 2BVDA 4H8HA 1J9YA 4P8XA 3T0AA 3PTQA 1V08A 2C8NA 5HPCA 4ACYA 4AZCB 3MU7A 2WMFA 3VMNA 4RE3A 3VIOA 4F79A 5D4YA 3B9EA 2A3CA 2Y5EA 4DM1A 3L4WA 4GIAA 2BV9A 3GYCA 2ZUWA 1XYFA 5IFTA 3WQWA 4TXEA 1SYTA 4OIFA 2XVGA 3G6LA 1PEZA 5BRQA 3UG4A 4YHGA 5IFPA 1CXIA 2J4GA 3WFLA 4E8DA 1LL6A 4W86A 2WAGA 1A47A 1ISXA 3ZJ8A 4DWSB 4W7VA 2VZOA 4ZE5A 3LMYA 1V03A 3O2LA 1ODZA 4AZ7A 4W93A 3ARXA 4AD5A 3VMPA 1XRVA 2TAAA 4GPNA 4UFKA 6CGTA 1BYAA 1ISZA 1TR1A 5BXPA 3W81A 2VX7A 2CYGA 3TONA 4P7RA 2BXYA 1LG1A 1HP5A 3VOCA 3BGAA 4E4PA 2CEQA 4P8WA 4HMCA 1XD0A 3AQUA 1UKTA 4BQ4A 1WDSA 8A3HA 2D0GA 1AQMA 4A3HA 1KB3A 3AHYA 1E1EA 1VEOA 3FNDA 2IXUA 4AEEA 3WKZA 5DF0A 4MB3A 3L2MA 3AMDA 4ML4A 1GUVA 3IJ7A 1V3LA 3W29A 4J3WA 1DEDA 5GPRA 3W82A 3BAYA 4CD8A 3WF2A 2YBTA 3ZIZA 3PZMA 3MUAA 2WHMA 5A69A 5I23A 1G1YA 3WNLA 1JXJA 2JIWA 2VOTA 2V38A 3VM5A 1WO2A 3CGTA 4HOXA 1XH0A 1QBBA 3G6MA 2DQXA 4UZUA 3UG5A 4W7WA 4PCSA 4W8BA 2G41A 4PMNA 5IHRA 3GXMA 3SCWA 1E56A 2CXGA 3VKKA 1UR9A 1QNOA 4TTUA 3I3BA 3ZR6A 1CEOA 3QOKA 2F61A 2WZIA 2XM2A 1CBGA 4H41A 1E73M 4DUXA 1E6QM 2DT2A 2PI6A 2V3EA 5ABHA 1JD7A 1UWRA 4W7UA 3WBEA 5JIWA 1PZ2A 4N42A 4E8CA 2ZWZA 1W9DM 4PMXA 2JF7A 4B3LA 4MDPA 1EIBA 1XCXA 2DIJA 2V3GA 1GONA 2YDRA 1HKKA 3SCOA 1NOWA 2WVVA 3VD5A 3WMCA 1NWTA 2DSWA 3WD4A 1B3XA 1J0HA 4UTFA 1BVNP 5AYIA 4QAWA 4ZXLA 3UR7A 4QLJA 1FH9A 2EXOA 1PZ3A 4UQDA 1ZBKA 3ZJ6A 2VRJA 1N82A 2Z1SA 3VGHA 4M1RA 1SR0A 3MV11 4GO9A 3WF0A 1C7TA 5CLWA 1HT6A 4H8UA 4OJYA 2YDSA 4KMQA 2VZVA 4Z2KA 1GQKA 4IUGA 1DWFM 3QHMA 4WSJA 4H7VA 3CZ8A 2Y4SA 3GNPA 2D0HA 2DEPA 4LX4A 9CGTA 2V3FA 3N18A 1DWHM 1R8LA 1E3ZA 1M01A 1EA9C 1BPLB 3QOMA 1TMQA 4M29A 1M53A 1QI0A 1HJXA 4AEFA 1BAGA 4CD6A 2PBOA 3ARRA 2CIPA 2VQUA 5JBFA 3MUZ1 5EBAA 3AFBA 3N1AA 4EE9A 4RE2A 5CQ1A 3IJ8A 1R87A 2GVYA 3GH5A 1GQJA 1VFOA 3FY1A 1OSEA 3OGRA 3ZSTA 4CD5A 1B3YA 5BYWA 2BNJA 4B9YA 3BMWA 2QMKA 4TTGA 2A3BA 2VX6A 1ZBVA 2D22A 4NRSA 4D1JA 1G01A 3ARSA 1B0IA 4QP0A 1BF2A 1LF1A 5ECUA 1UD8A 3KWXA 3ZOAA 3SCUA 2BXZA 2EPLX 3AS2A 3EDFA 3VDCA 1HP4A 3WDPP 1JZ2A 1OCQA 5A2CA 2J62A 1BHGA 2QLYA 1WPCA 1DWGM 1XGZA 5A8OA 1WAWA 4JIEA 1GOMA 1XH2A 2X2YA 2G8ZA 3WUGA 4U33A 3AHXA 3ZT5A 3NSNA 1W9XA 1Y7VA 1HF6A 1TFVA 4DWSA 1E3XA 1TA3B 3T08A 4BS0A 3VD3A 5EFFA 3TP4A 2VX4A 3OGVA 4YHEA 2XFFA 4AC1X 3WD3A 1EHAA 4P7OA 1W91A 4AZ5A 3K46A 4M80A 3WD2A 3VIKA 5GNZA 1JF6A 1ZS2A 2YIHA 1NP0A 1GZJA 3AZSA 2J74A 3WF1A 1UR8A 4KRUA 1I1XA 3VIPA 3AMLA 3PN8A 5JBEA 1NH6A 1QI5A 2VRQA 1KXTA 4Z2IA 4LPCA 3VDHA 4N0RA 1HNYA 3MSGA 3ARPA 4JKMA 1FFQA 2DT0A 4W89A 3RM8A 5BROA 3BMVA 2JFEX 1GVYA 1TCMA 1WKYA 5A2BA 2VTFA 1V0LA 5CSYA 4C7DA 5LYRA 2QF8A 2FH8A 4TVCA 2OWXA 1NARA 1J0ZA 4D6HA 2EQDA 3PZQA 3VX0A 3AXIA 2GDUA 2D2OA 1XV8A 4B15A 1D3CA 1E0WA 4IM4A 2DH3A 1QNRA 2YL9A 3WQ8A 1QHOA 2WBKA 3KEHA 2GUYA 1Q6DA 4XUYA 1GOQA 1TUXA 1B9ZA 1CENA 4W5ZA 2OSXA 2CBUA 1C3FA 5A6BA 1ZJBA 4MNKA 4HZ8A 3AHZA 5BWFA 3FHAA 1UZ1A 3ZSSA 3OIHA 2WWDA 1GOKA 1KGUA 1VFFA 2VUYA 4F9JA 5EB8A 1GVIA 2YOCA 1E9LA 5HXMA 3WBAA 1CXFA 3GNOA 3UCQA 4Z2HA 3APGA 1CLVA 3UG3A 3FN9A 1UKPA 1J0KA 1E6XM 1NP2A 1UQYA 1WE5A 3F5JA 3MMWA 3SCNA 5I3DA 1BTCA 2XJ7A 1UWTA 4ZEPA 1D2KA 4ATLA 1DWJM 4WLCA 2PWEA 1Z32X 2CHNA 4HA3A 4HA1A 4PMRA 3AI0A 5DFAA 1QHPA 4AISA 1OD0A 3PTKA 1PIGA 1LJYA 4WK9A 1UR4A 1JYNA 5A2AA 1JZ6A 1GHRA 3EDKA 1UD4A 1JAKA 1HX0A 3VD7A 2G3JA 3K8KA 5A6AA 1WDQA 2DSZA 3WD1A 1JDDA 2J8GA 2YA0A 2Q8XA 1E6PA 4QCEA 3B9AA 5D9OA 1BYCA 1E5JA 4GKLA 3S2CA 2E8YA 2BY2A 2V5CA 2D20A 1OB0A 2WLYA 3BSGA 1JZ7A 3TTOA 1BGAA 3WH8A 4UQ9A 2O9OA 1JDCA 4HU8A 5A6BD 2J7FA 3VMOA 2D1ZA 1HL8A 5A1AA 4M81A 3OA5A 1KWKA 5JBDA 1FH7A 5FIPA 1OGSA 2EPNA 2OLHA 5EMYA 1JAEA 4BCEA 1B3VA 2VCAA 4GO8A 1SMAA 2BS9A 1BG4A 5I5RA 1H3GA 4FLSA 2F8QA 4Z2JA 2E40A 5HDRA 2CBJA 4GZJA 3U7BA 2ZUUA 5CSUA 1RH9A 2XTKA 3OGSA 2JEPA 2ZUVA 4F9DA 4D6JA 3SUSA 2XVKA 2YLLA 7CGTA 4ACZA 3T2PA 3L4TA 3NDYA 3WD0A 2DSVA 2WCSA 3ZO9A 1C7SA 4ZXOA 3WEOA 4JL2A 3MUY1 3AXHA 4U2YA 3DHPA 3WQ5A 1VIWA 3W37A 2PC8A 1EOMA 1KBKA 2YL6A 1B30A 1CYGA 4P7NA 1DWIM 2VQTA 4Q7NA 5AC4A 5IHSA 2W63A 1LQ0A 3D5HA 1EXPA 2XVPA 2W4XA 1JZ3A 3UR8A 3WMBA 2XWEA 3OLIA 2DH2A 3KL5A 4D6CA 1KXQA 3MUIA 4IISA 3DC0A 5GQBA 2VMFA 2WCGA 1AVAA 3F5KA 2CERA 4MDOA 2J25A 1JFHA 5FKYA 1OGGA 1WZKA 2Y8KA 4LQ1A 1BSIA 2XPKA 1W9PA 3FHQA 4AD2A 2ESCA 2WWCA 1AQ0A 3VIMA 4UQAA 3L4VA 3SUTA 2X0YA 4D1IA 1CXEA 1HJVA 4OBRA 3PZIA 1ZL1A 2RGMA 3DYPA 4PRWA 2BVYA 4JKLA 3VPLA 3UESA 4HPGA 4CVWA 1MQQA 1XHGA 3ECQA 2WCAA 4PTVA 1E40A 2J8FA 3L4ZA 4U31A 5A6JA 4JFWA 1BLIA 4P8VA 3WNOA 1QNPA 3WQ6A 3CZEA 2DT1A 3U7VA 5D9MA 2WC3A 1ITCA 2VR5A 4FLRA 4AXNA 1E71M 4YN5A 1CGVA 3VUPA 4KGLA 6A3HA 2QHAA 5C70A 3DYOA 4PMYA 1HVQA 1V3IA 3IK2A 3TOPA 4D6GA 3SIMA 2W62A 1C91A 1PIFA 5I6SA 2QMJA 2VRKA 3CLWA 3ZJKA 1RP9A 5FL1A 1HJSA 1TG7A 5I2UA 2W92A 4Z2LA 1J11A 5DT5A 5DEZA 5A95A 1UR0A 4W84A 4IPLA 5A8PA 1OT2A 3BLKA 1J10A 3NYDA 5TD4A 3CZKA 2BY0A 1TE1A 4HMEA 2OYKA 4D6IA 2IUZA 1IZJA 3ARZA 4FMVA 2XWDA 1W3LA 3ARUA 1JZ5A 3WN6A 2D0FA 3ZR5A 1MQPA 2VI0A 1M04A 2XM1A 1B3WA 3UERA 2VO5A 2QPUA 5BXRA 5D9NA 1GOIA 1B90A 5A3HA 3FW6A 4QDMA 5HBFA 3KZSA 2DT3A 1VENA 4JFSA 3LPOA 3AIEA 4AD3A 1KQYA 2DDXA 2XFRA 1OM0A 1V3JA 1ECEA 2ZUNA 1UZ4A 1E4LA 3VD4A 1QW8A 2YLAA 4B3KA 4QCFA 5HNNA 1MW2A 1WZAA 1W3KA 4FF5A 1OIFA 2J78A 2XUCA 1LWHA 3AIBA 1CXKA 1UH2A 4UR9A 3VGGA 1FP9A 4KWUA 1CWYA 1QHZA 5C8BB 1G94A 4BF7A 2WKLA 4J7RA 3BAJA 1K9DA 4PBGA 3U5YA 5LA1A 4UFHA 2GK1A 3O6AA 2PWGA 4JFUA 1M03A 2CKSA 5EFDA 4B16A 2W67A 4ATDA 3KE0A 2W5FA 1BVZA 3W26A 4MADA 2XVNA 3ARVA 1CXLA 1UKQA 4GZIA 3AXXA 1C8YA 3AIVA 3QGVA 1UR2A 3WNPA 1G9HA 3GBDA 4HU0A 3T0DA 1BYDA 2FH6A 3W0KA 5IDIA 2WANA 5A6LA 3WQVA 4PMZA 2DSUA 1JG9A 2O9PA 1OT1A 3AMKA 3LPPA 4J3SA 3BLPX 2WMJA 3NUKA 1M7XA 3E1F1 1EO7A 2WXDM 4AZ6A 2VR4A 1VFUA 1BYBA 4PUEA 5E6YA 2XFYA 1J0YA 3T2OA 1BGGA 1QVBA 2PWFA 1NWRA 1GJWA 1UQZA 3PBGA 3CUHA 1W1TA 4UOJA 1UWUA 2O9TA 3RMEA 2G3IA 2XSBA 4KH2A 7A3HA 3VINA 1KCLA 3EMQA 5IXEA 4X0VA 1ZB5A 3MMUA 3VX1A 4J3TA 3VM7A 1VRXA 1UR1A 3WENA 3AYSA 2CPUA 3K4AA 1EDGA 4DWSC 1VJZA 5LA2A 1WDPA 3ARTA 3LPGA 1V0NA 3CUGA 4TVDA 1SMDA 1Q6CA 4S3JA 5CPQA 4MB1A 3JUGA 1UHVA 4AD4A 4FK9A 1ZBWA 1V6XA 2ZX7A 1JZ8A 4ATWA 3WUFA 4XX6A 3HN3A 1MW1A 3W38A 6TAAA 4AMCA 1WNOA 1B3ZA 3M6DA 2JIEA 2YJQA 1E43A 2WHLA 4U5KA 2WVSA 3T2QA 3CBWA 1H5VA 5I79A 4AIEA 4XB3A 3AJ7A 4P7QA 3W6LA 4PYSA 3CHFA 1J0IA 1WB0A 1OINA 2ZE0A 3WNMA 2W61A 2ZICA 5ABFA 4LXFA 3POCA 1W1YA 4CCEA 4CU6A 5M3WA 1AMYA 1VEMA 2CKRA 5GNYA 4OOZA 3S6TA 2X8RA 2WKGA 1IT0A 3B9DA 5DO8A 2VL4A 4GI8A 1NWSA 1A3HA 1WZMA 1UUQA 4J28A 2J79A 4W8AA 1ISYA 3PZUA 2ZOXA 1RD6A 1QOXA 1BFNA 3K8LA 4UOZA 1W2VA 5E6ZA 5FL0A 4PMVA 1QPKA 1X6LA 2XGBA 2WMIB 2E9MA 4DUVA 1O6IA 3MO4A 3CZLA 4XV0A 1JD9A 1CTNA 1H0IA 3ARYA 4XZWA 5CZKA 3BAIA 4BQ3A 1UWSA 1R7OA 1V6VA 1UD6A 1LL4A 1MWOA 2Y24A 2VZTA 2D3NA 1JIBA 5AC5A 3CMGA 4D6FA 3NDZA 1J18A 2EPMX 4ZENA 1UKOA 4L4PA 4CCCA 5CJ5A 5FD0A 2GJRA 1HKJA 2EPOA 3ZJ7A 5GNXA 2NSXA 4MJ4A 4AYSA 2PF0A 4HZ6A 2C7FA 4PUDA 3SCRA 1W1VA 2BFGA 3IAPA 1PX4A 4NSBA 4UZSA 1W9VA 4MPKA 3EBVA 4M8UA 2XYLA 2J77A 1GQLA 3ARWA 4MB4A 1E6NA 1XSJA 4CU7A 1E70M 3CUJA 2WMHA 2CESA 2OYLA 2YL5A 2ZUSA 3BAXA 1RPKA 4QLKA 3N17A 3CZJA 1QI2A 1MFVA 2OSYA 2WVVB 3WDJA 2ZX8A 1H41A 3VO0A 3BCDA 4XZBA 2X05A 3AISA 4TX8A 2WHJA 1VEPA 1E6SM 3VIHA 5A6SA 5BCAA 1FA2A 3MANA 4MNMA 1GOWA 5CG0A 1KBBA 4AW7A 2ZXQA 1HL9A 3MKKA 3VIFA 4CN6A 5CPTA 5M17A 2WVTA 3CHCA 4KGJA 4NZCA 3AIUA 2W66A 3VILA 2W91A 3NSMA 3A3HA 1CZ1A 3RM9A 4HTYA 3KL3A 1XD1A 1V6YA 4MTVA 1KR0A 2AMGA 4PMQA 1CGWA 3MSDA 2BVTA 3GBEA 3OBAA 5I0DA 5JUVA 3OB8A 3SCQA 5BXTA 3AIQA 3ARQA 4GQQA 2NT0A 3NIYA 2ZXAA 3WL0A 3W53A 4V2XA 2JF6A 4JFVA 1QW9A 3M7SA 3THCA 4W8LA 1QI4A 2ZUTA 4M82A 3TA9A 4HOWA 1QNSA 5HPOA 3VVGA 2FGLA 4UQEA 4AY1A 3ZMRA 1B2YA 1C8XA 1V02A 4H04A 3GXDA 4C7GA 1FFRA 2GFTA 1WCGA 2RGLA 2MANA 5DT7A 5E0FA 1EOKA 1OBAA 3CMJA 3WF3A 2UWFA 2ZUMA 1U33A 3TTYA 1ZJAA 1MVYA 3AYRA 4FLQA 3CIVA 3WDQA 4RL3A 3RO8A 3NSXA 1D7FA 2VNCA 1KR1A 3BAWA 4OZOA 3WL1A 1E6ZA 1U2YA 2CBIA 2EBNA 3AOFA 2D23A 3TTSA 3RIKA 1CIUA 3WH7A 8CGTA 2FGZA 3KL0A 3GXFA 5E70A 1E4NA 4Y7EA 1JDAA 1GJUA 3BAKA 5HOSA 2PWHA 3SCSA 2PBGA 3N12A 2OWWA 2G3NA 3CHEA 1UH3A 1GCYA 1DHKA 4TUFA 5FOOA 5BRPA 2CNCA 1E1FA 1G0CA 2E8ZA 3VNZA 1H1NA 2WLZA 1E0VA 3DHUA 1E5NA 4UFIA 4AZIA 1TVPA 3AS0A 4CN4A 1HJUA 3CTTA 4CCDA 2WBGA 1LLOA 2BHYA 1FHLA 2G4FA 3OZPA 1GW1A 3WDRA 2X0HA 1HKIA 1HKMA 4U2ZA 1ISVA 1I1WA 3VGEA 5I77A 2GJXA 2CITA 4ACZB 2X09A 1EQCA 1ODUA 1P6WA 5AYBA 4JL1A 3PZGA 4J3UA 1WP6A 3EMCA 1DTUA 2CBVA 1E4IA 4AD1A 5KZ6A 4PCTA 1QBAA 2JALA 4UFJA 1R86A 1VBRA 1YHTA 3U57A 3CHDA 1EH9A 1RP8A 2B31A 3VGFA 5BXSA 1UA7A 1R7AA 3WSUA 1S46A 5D9PA 4BQ2A 2G3MA 2DGAA 2HISA 3BCFA 3K1DA 1MFUA 3HJEA 2WMGA 5E9AA 3CH9A 1PPIA 2EJ1A 3A6OA 4OOUA 3QHNA 3A4AA 2E9BA 1CGUA 1H0GA 4AZHA 3GXIA 4NF7A 1IV8A 3HMCA 1NWUA 2J7BA 4RE4A 3AMCA 1EHNA 4GQRA 2IXVA 1JL8A 2DIEA 3L2LA 4J27A 3UETA 4K68A 4UQCA 3GTNA 1QI3A 4JAWA 1B1YA 1K9FA 1H2JA 3O9NA 2EO7A 4QLLA 4PEEA 1GHSA 3FAXA 3M07A 3N11A 1YQ2A 2YBUA 2WMKA 3VDAA 3PZNA 3W27A 3N04A 1GQIA 4UCFA 5ABGA 1PJ9A 3A47A 4L4OA 3EDJA 1ZBCA 2OYMA 1US3A 4HOZA 4LYQA 4X0NA 4P7LA 1W9UA 1J01A 3IANA 4AZCA 5CXPA 2WM0A 1LG2A 2XSAA 4JKKA 1KCKA 3QHOA 4W5UA 3AZTA 1UWIA 3VGBA 1JGIA 2VZSA 3VDBA 2ZWYA 5I78A 4MNLA 1J0JA 1V3KA 4NI3A 2Y2WA 1K9EA 1H11A 4P8UA 4BZYA 2WVUA 1V02E 2XIBA 5D8WA 3VD9A 4HZ7A 4EK7A 1U30A 5I24A 2WB5A 3GH4A 1MXDA 3MS8A 1VB9A 3N13A 4D6EA 4EANA 4D71A 1FP8A 4WKFA 1TVNA 1W3JA 3AIRA 4ZFMA 1L0PA 5DMYA 3CO4A 2CCRA 3AZRA 2CHOA 1GPFA 1V0KA 4AWEA 4J3VA 1OGBA 3WIJA 4UQBA 2WK2A 4CD4A 1CECA 4IPNB 1TA3A 3NJ3A 3K4DA 1QNQA 4HP5A 1CGYA 3EYPA 2FHFA 4TOQA 4HMDA 2VCCA 4R27A 3POHA 5CLTA 3T09A 4UFLA 3MV01 1UD3A 2D3LA 2YKKA 4PTMA 3WDIA 4V27A 1DWAM 1E0XA 1F4AA 1ZU8A 3BC9A 1JZ4A 4CN1A 1HVXA 3K8MA 1UOKA 4AZGA 5A8NA 3SCTA 3OLEA 3GH7A 2VVSA 1Q6GA 2OWCA 5D8ZA 3VGDA 1UA3A 1NQ6A 5FCZA 3AS3A 4M24A 2O9RA 1GOOA 4Z2GA 4PN2A 2YL8A 1UWQA 2D24A 2WW5A 2PWDA 1HJQA 1Q6EA 2E3ZA 3WF4A 1MW0A 4GXPA 1JNDA 1XC6A 4KRTA 3VIIA 2VX5A 2J75A 1UD5A 3WNNA 3RJXA 1R85A 1UD2A 2E0PA 3AHTA 4AIUA 3LPFA 1C93A 2V3DA 1UKSA 4NRRA 3VTRA 4AIOA 1CDGA 3W28A 2J7DA 1JYXA 1HJWA 3CPUA 2WYSA 3AHVA 4WKHA 2J7EA 1CLXA 1FOBA 4PTXA 4WJXA 1JNEA 4F8XA 1XCWA
chains in the Genus database with same CATH superfamily
4TQTA 4AD0A 2GSHA 3ANWA 5A6MA 2D2SA 4ERAA 2F2KA 4N9DA 1H09A 3GVGA 4D2JA 3O8AA 3WH6A 3CAQA 3S1UA 2WP9A 2ABAA 2O92A 1ZP0A 3GFYA 3CX7B 2BDEA 2FHBA 3HGRA 3LXBA 3P0XA 5E5CA 3T1HT 1E55A 4G1KA 3I9WA 3VKJA 4KMCA 3SCVA 2WC7A 4W87A 4C7FA 4IJBA 1SFJA 3GDBA 4PMDA 4OVXA 1QK0A 1ONXA 1K77A 1MEIA 4CGTA 4Y9MA 1VLIA 1TJ0A 3W2JA 3OHMB 2FJDA 3NR0A 3PZVA 5EMLA 2YDQA 4DAIA 1IQ8A 3RM4A 3R0KA 3SJNA 1L8NA 3SZ8A 1V3MA 4W9TA 3THUA 3VABA 3DG6A 5HXCA 3QR3A 3TOYA 4N02A 1KCZA 2DSKA 2YXOA 4QBXA 1KXHA 2FVMA 4IDQA 4UUIA 4U5IA 4YSXA 1YRRA 3P50A 3FX4A 2QA7A 3KV5A 4KEVA 1Q7QA 3MO7A 4LUYA 1D1BA 2PZ0A 3CQ0A 4LYRA 2J7GA 4HNOA 5LYJE 2Q8ZA 1UGOA 4L80A 5M03A 3DU0A 4GIEA 1RY0A 4EWND 3HKEE 1DXIA 2LT3A 2WC4A 2X16A 3SRFA 5EK2A 4CXWA 4ILSA 1DV7A 1MRQA 2E6FA 3AIWA 3V35A 3ZT7A 4LY8A 1XQKA 4D72A 2FMOA 4GYPC 2A3EA 2VJXA 1AZ2A 5HXRA 3W7RA 4LV9A 3DYMA 3CUFA 2HVMA 3OLGA 2JGQA 5T9BG 1PAMA 3NL2A 4IZGA 3KVMA 1YADA 2NX1A 4RZBA 3KDSE 4FIQA 3A8YC 1W17A 5E0CA 1BRLA 2DVXA 2NQ9A 2YFOA 4WF7A 5A8QA 4X1IE 4YT0A 4REQB 4M51A 4B3MT 2X7WA 1BG9A 1GVOA 3OG2A 3NVOA 2C3ZA 1UASA 1EP2A 3TW7A 2QPSA 4R5EA 3H8AA 1KWGA 3OBKA 4ORMA 5CPSA 1TV2A 4I55E 3EAMA 4WDTA 2CCQA 3B13A 4GKTA 4JTUA 2WDRA 4MNJA 4DIAA 1XYMA 4JHOA 1DQWA 4EF9A 2FJBA 1DJYA 4IDOA 3BQLA 3HTWA 2WMIA 3DECA 5C9UA 4L64A 3MA9A 4N9EA 1EDTA 4DR2T 4X5TA 4LAUA 5DQPA 1UW9A 4C60A 2XHYA 4HN9A 1IZKA 4IIDA 2ISWA 3GC4A 3GHUA 1NOUA 4S3KA 3II1A 4PMJA 2E9XB 4ZI2C 3MYPA 3IJ9A 2EEXA 1W8SA 3WDHA 3GD6A 3W2LA 1ESWA 4C6KA 3UYIA 4F2BA 1DTNA 3TU9A 3LHVA 1PX3A 2WSKA 4D8AA 4HPHA 2VXNA 3ABRA 1H7XA 2GUBA 3NQ6A 5BMVE 3NQCA 3OOQA 1LBFA 5BWAA 3TC7A 4A4AA 3FXYA 1R46A 1UP0A 1ZTVA 2JEQA 3LTPA 2UY2A 1UH4A 4OUEA 3N2MA 1SHZC 2DUXA 4DWDA 3BUVA 3EWCA 1MNSA 3LSBA 3B8SA 5HWYA 3GW0A 4K1GA 3WFAA 5KETA 3L3PA 3DBPA 5JIPA 2X0LB 2IUBA 2PAJA 8XIMA 4E2OA 3BLEA 4HMNA 2WNNA 1PHQA 2UY4A 4PCPA 4RX0A 3AEAA 1OADA 4NIQA 3WAJA 1C8VA 4HK5A 3EDDA 1C90A 2FDMA 3GNNA 3ZQ9A 1RVKA 5K2ZA 5G5IA 2J47A 3RCNA 3AAIA 5FNVE 3I3EA 1OWQA 1CPUA 2GDVA 3LGDA 2GJXB 2VURA 3QV9A 4WCJA 3ZMTB 2AOSA 4MOZA 1FTXA 1PTDA 3T05A 1LWJA 4MHCA 1R3VA 4YLHA 4GQBA 2QIWA 4L1GA 1ADDA 4J3XA 4HFEA 5F7UA 3GE7A 3R43A 3H2AA 3TJ4A 2E4TA 3AXMA 4OWGA 4F66A 4LF7T 3WELA 3VK5A 3DX5A 3Q45A 2ZX5A 2PLKA 4L9YA 4OYKA 1B31A 5DBTA 2FHCA 3RILA 1AQHA 1EO5A 1OD8A 1IE7C 3L23A 4NVTA 3ETUA 3PF3A 4JFTA 1R2RA 2Y48B 1RHCA 1JI1A 1V3HA 2CXEA 3W1XA 4OE7A 1J9YA 3T0AA 1V08A 4ACYA 1P43A 2X67A 3A22A 2XAGB 1S35A 2WOQA 4DO6A 4A56A 3LZ3A 1K4GA 4RNJA 1TWIA 5JRCB 2A3CA 3CQXC 3SFEA 4LSBA 4DM1A 4ZQOA 3HM7A 2J88A 3GYCA 4GFIA 5JDLA 4ERRA 1F6YA 1LBLA 1XYFA 5IFTA 4OIFA 3WK3A 1G67A 3GB6A 4G2AA 2XVGA 3KBSA 1ALDA 5BRQA 1DL3A 3QN3A 4HYWA 2J4GA 2CLEA 4XBFB 4KEMA 4V33A 2XN1A 4XSLA 2QGHA 4C1LA 4DWSB 3KVJA 3PUSA 1IEWA 3LMYA 5CSSA 1ODZA 3CQCB 1OFDA 1K1DA 4QE5A 4HNVA 3GRIA 1LQAA 4MZ1A 3I0QA 2LM9A 3VMPA 2GYIA 3E2VA 1XRVA 1XBZA 1D1AA 4AF0B 2HS6A 1D7KA 1IXQA 1FWWA 3PPCA 3QGKC 3EABA 3WAKA 3TONA 2F38A 1OF6A 4DI8A 3BGAA 4LF8T 2CEQA 4C90A 3EWXA 3VFCA 4XKYA 1UCWA 4P8WA 2PCQA 2RA1A 4ONVA 1Q2SA 2C0SA 3AQUA 4XTIA 2OT1A 3BVJA 3URAA 3VNJA 4DQWA 3PR2A 1KB3A 3RO6A 5CCZA 4YXDA 1R30A 3OA3A 1E1EA 1VEOA 4AEEA 2IXUA 5GJPA 3U9IA 3M5YA 5GJNA 4JQAA 2WNZA 4LFBT 4FI4A 4WR3A 3EOLA 5GPRA 4CD8A 4ZZ9A 2TYSA 3SO7A 3GG1A 3HKBE 2WHMA 3GNXA 5C7HA 2Q9QD 3OVPA 1BKSA 3S5NA 1JXJA 3GVQA 2QYGA 1H7RA 1WX0A 3EZ4A 3GIYA 3ICJA 1P0DA 1G7UA 3G0XA 1V5XA 2LEHA 4FXRA 1KV5A 1UZHA 3UG5A 1G8XA 1PWMA 4W8BA 5IHRA 3MCNA 1NFBA 3W1MA 3C98B 4ZI2D 3SCWA 2X41A 2CXGA 4TTUA 3C52A 1U83A 3IV8A 2XM2A 2VWAA 4H41A 1J2BA 4LUSA 4M5PA 1E73M 4F0SA 2IC9A 3YPIA 4DJED 4B3ST 1GKQA 4HCHA 4H63H 1UWRA 4IIBA 5DRCA 2XH4A 3W75A 4RDWA 4JIQA 1SZGA 4M1BA 3W7CA 5FJTA 5TF0A 4E8CA 2E67A 4FX8A 5DCBA 3U2EA 3SN0A 5JR9C 1XCXA 2YDRA 1GONA 3OVGA 3SCOA 1NOWA 5AB3A 1FRBA 2WVVA 1KM0A 3VD5A 1FWNA 1WAUA 1EPXA 1XBXA 4L65A 3F7JA 1J0HA 3KBMA 3ABSA 4UQDA 3BV7A 1XUUA 3MV11 4EYYR 1N55A 2WJFA 4TX9A 2I5IA 2VZVA 3J9X1 1GQKA 4IUGA 3WQEA 4ZFCA 1OQFA 2K24A 3TXVA 4WSJA 4H7VA 4CNUA 2Y4SA 2WQPA 3UYCA 5HEGA 9CGTA 2NVCA 1M01A 3QOMA 1MEWA 4NI8A 3AEBA 4M29A 4IL4A 1W1IE 1G4TA 4N6FA 1V51A 3TCEA 2CIPA 2VQUA 3USZA 3BURA 3UXAA 5CJMA 4HFDA 3G1YA 4O1DA 4RE2A 2DZXA 3BWWA 2OQHA 3IJ8A 2YW4A 3B40A 1R87A 3GH5A 1GQJA 1VFOA 3U78A 1EUNA 1OSEA 4FNTA 3OGRA 3NQGA 3LNPA 4O13A 1DIOA 3ZVIA 1F3TA 2QMKA 4TTGA 1OEDA 2A3BA 2VC5A 4Z1BA 1G01A 3UA3A 4QP0A 1X1OA 1LF1A 3T7VA 5LP6E 3IJIA 3TC3A 3R1ZA 3TX9A 1UMYA 2FB3A 3K3OA 2JQQA 3CKDA 4EACA 4Z08A 3VOJA 2XQ4A 1X98A 4YLWA 1HP4A 3WDPP 4YCOA 1BHGA 4UTMA 2RFGA 4GK5E 4WQ6A 4H9YA 1I2RA 1T40A 2A21A 4R9XA 3WUGA 3ZT5A 3P8IA 4I6KA 2NWBA 2ZZ1A 1WR0A 2BVMA 1RZMA 4HB7A 4IGMA 1DYSA 1KRCC 4TZ4C 3MA8A 1PVNA 4I7WA 3TP4A 3KTCA 2VX4A 2HVNA 2XFFA 5KXJA 1FWEC 6ENLA 1QT1A 2LLEA 4AC1X 3GDRA 1PCKA 1RSCA 2CW6A 1MZHA 4YVVA 5XIMA 4AZ5A 1CI1A 2BWGA 5CAKA 3UFYA 1Q7ZA 3QPYA 3VIKA 1XWMA 1OFAA 1JF6A 1JNZA 4X66T 1ZS2A 4O11A 4L6HA 5EYWA 4WXZA 4U7YA 1NP0A 4O52A 3NZGA 4I8DA 1UR8A 2K5BB 3OIXA 3M0VA 2GGHA 2H8XA 1D1CA 2PP1A 1NH6A 2VRQA 4UXDA 3VDHA 2CHRA 2P1FA 3C4WA 1UJPA 3ARPA 4JKMA 2DZTA 2P3EA 2MUCA 2LKHA 1I6NA 4IPJA 3KXQA 2PDUA 1RQBA 5BROA 1GVEA 1GVYA 3CV6A 1X97A 4CQBA 2DW6A 3CXOA 3ABXA 4KRZA 5CSYA 1W3NA 3Q9DA 4TVCA 1J0ZA 1KM2A 4D6HA 4JI8T 2NOXA 5FYMA 1ICSA 1PKLA 4FNSA 3TKFA 2GPTA 4IM4A 2PDGA 3UWEA 2HPJA 5HAXA 2WBKA 2GUYA 1Q6DA 1L6WA 3E5PA 3GTFA 5L3FB 5I06A 1P6CA 4HBKA 3FZMB 4LUJA 1J93A 4Q6XA 1P1XA 3AUJA 1XCFA 3I7RA 3AA7B 1XIJA 5A6BA 2BDQA 3TFCA 3AHZA 5BWFA 4EAHA 3U2OA 3MZKB 4AWUA 4MVAA 2HPIA 2WWDA 1KGUA 4RK8A 3UPBA 3WI3A 1POKA 3TC6A 5J2TE 5EB8A 1E9LA 3M7WA 3N4AA 3WBAA 5CC3A 5HXMA 1CXFA 3R84B 4NXNT 3PK7A 2NWSA 1PWLA 4QSFA 4U72A 1MDLA 1J0KA 1WE5A 1B3OA 1UQYA 2CXLA 2XJ7A 1EYWA 1UWTA 1O1HA 1TQXA 4H6KA 4ZEPA 1D2KA 1DWJM 2OCZA 3IV3A 2NXGA 3AE6A 4AISA 5JVDE 1BXNA 3N6QA 4JXCA 2A2IA 1YIXA 5AVHA 4IHJE 1X8FA 2GQ9A 5LIUX 4C6EA 1LJYA 3LM7A 5F4XA 3NFUA 1AH0A 4OX9T 2DJLA 2HSAA 4XAXB 2G3JA 3TQKA 3LSCA 1JDDA 2J8GA 3I65A 2Z6EA 2Q8XA 1YBQB 2PP3A 3F4DA 3LLFA 1XNQT 5PTDA 4FXJA 4DUYT 3TR9A 3S2CA 1ADOA 3GC5A 2V5CA 2D20A 3WLQA 3CPZA 3BSGA 1KKOA 1O12A 2FZ9A 1KFEA 4EYUA 1VLWA 3FOKA 3OA5A 1KWKA 4TV6A 2P8CA 5EMYA 4BCEA 1B3VA 1A5OC 1WYBA 1SMAA 5D2XA 1F8MA 1BG4A 1H3GA 3JR2A 4JNMA 5K9XA 4GZJA 3U7BA 4AXPA 2ZUUA 3UXDA 1LT8A 1Z41A 5JR9A 1XF0A 4YVXA 2FPTA 3KV9A 4PBEA 4ACZA 4S38A 3F4NA 2J9YA 1PKMA 3P5YA 5EMUA 2DSVA 4QJ3B 4O1AA 3WEOA 4JTHA 3MUY1 3OJAA 4F8HA 2F6UA 3AEDA 3W37A 4GUGA 4LF4T 5KMYA 3AXJB 2YL6A 4H01A 4LS0A 1B30A 5AC4A 4P7NA 4Q7NA 2VQTA 1LQ0A 2FTWA 2XVPA 2W4XA 4LC8A 3LHTA 2XWEA 1QPOA 3PBWA 4DBSA 3ABVA 4KFPA 3AEFA 3SSJA 3R0UA 3KL5A 5AQNB 4P5UA 4U4MA 3WLPA 3ZC0A 3MDUA 4D8LA 4XZCA 4MDOA 2J25A 3RGTA 5FKYA 1KM4A 3G1SA 1ZSXA 1W9PA 4AD2A 4F3HA 2DW7A 1L2QA 1S3HA 2I57A 1HFAA 3VIMA 4UQAA 3T81A 3SUTA 4AMAA 2X0YA 2WQDA 4OBRA 4LF9T 4KKXA 4COFA 4JYFA 4JKLA 4I43B 5L3CB 3H70A 2HBVA 1TPDA 1KNZA 4IQDA 1MQQA 4G1NA 3F2CA 3N4FA 2Y6XA 1HX1B 3LRMA 3L4ZA 2AAMA 1WA3A 4JFWA 4P8VA 3WNOA 1UUOA 1UUSA 4PZVA 3CZEA 4NJGA 2FKPA 2JKAA 3M1ZA 4NYUA 2VR5A 1UPMB 2W27A 4FSAA 1KV8A 1OFBA 5C55A 1Z7AA 4EX4A 5F2GA 1EWDA 2OLAA 2QHAA 3UUXB 3EGJA 5I3IA 3BJSA 5C70A 3TLSA 2HBXA 2OO0A 1PZ0A 3M0IA 1DXEA 3IK2A 3LN3A 1ENUA 1RA0A 3GK0A 4LUTA 3SIMA 2W62A 1C91A 1UIPA 2VRKA 2AQVA 4KCWA 1HJSA 5M4YA 1GZ1A 1TG7A 3TN6A 3P80A 1VFTA 2PRHA 1AL7A 3H2FA 2W92A 5DEZA 3BV4A 1UR0A 3M47A 3TV8A 1KTBA 5TD4A 3BLKA 3CPRA 2UV8G 4HMEA 4D6IA 1DQXA 1IZJA 4YYCA 3KCOA 1TV8A 5HANA 3ARUA 3MCMA 1JZ5A 1A4MA 1MQPA 1B3WA 3I7QA 3PPGA 2VO5A 5BXRA 1P1MA 4JX5A 1QPNA 1YXYA 3EOUA 2DT3A 2CMRA 4QIUA 4GYRA 3WCZA 3OZMA 4ZQNA 3H55A 1SU5A 4WEVX 3VD4A 1QW8A 5HNNA 4MWAB 3ZJ2A 3CK6A 1MW2A 4K8EA 5FMNA 3RLFF 4WY0A 1QNVA 1Q13A 3VDGA 4UR9A 1QK2A 5JVLA 3NPXA 5A6TC 1QHZA 5C8BB 3R10A 5EPDA 2DHRA 4EB6E 2FLIA 2V8ZA 2O7SA 4PBGA 5CC5A 3U5YA 1M5WA 3NQVA 1XI3A 3O6AA 4QH1A 2DZAA 2I16A 1NDYA 2W5FA 1S2AA 4K37A 4G7EB 5IHYA 1ZENA 1CXLA 2NW9A 1C8YA 3TXZA 1QWKA 1UR2A 4MUPA 2E5DA 3GTXA 3O0KA 3TCSA 2RAGA 1VHNA 1XDOA 2HPLA 2V7LA 1BKHA 1WXJA 5IDIA 1LLZA 4Z1CA 3ABZA 4DPPA 3TE9A 2DSUA 2O9PA 1FCUA 3LPPA 1M7XA 3E1F1 3SY1A 4JI6T 1EO7A 3U4AA 4AZ6A 4RCXA 4ADTA 1E9IA 1BYBA 3T2OA 2ISVA 3REQB 4DVDA 2HK1A 1GJWA 4GLEA 2I6HA 3MK7C 1NSJA 3EOEA 3PUZF 4MIMA 3QV8A 3VZZA 4WZHA 4RPPA 7A3HA 5FEZA 1S3TC 3EMQA 4EWJA 2KZHA 1VH7A 4O1EA 1OG6A 3VM7A 3TVAA 1UR1A 5LNRA 5LXTE 1EEXA 2ACRA 4DZAA 1Z48A 2V5BA 4YTRA 4OECA 1NTHA 4E2VA 1VJZA 1JGMA 4MZYA 3SQSA 2QULA 3K4WA 4BY3A 1V0NA 3CQHA 3ZLFA 3JUGA 1WQ5A 4QS6A 3TQ0A 4YSYA 1V6XA 2HPMA 1ZALA 1JZ8A 3C3UA 4XX6A 5CG7A 6TAAA 1J6OA 4A05A 4ADZA 4ZVJA 4G56A 3V5OA 2R1MA 4U5KA 1IWAA 2Q01A 3O1IA 1ITUA 1H5VA 3JZUA 4AQGA 1SM9A 4S2BA 3S46A 3URBA 3I10A 3QBUA 4UF0B 1RBLA 2OEJA 5LXXA 1TV3A 2CPTA 4OFZA 3ZN0B 4HSOA 2JPFA 4V15A 4ANJA 1AMYA 1VEMA 3CYVA 3S6TA 2X8RA 2WKGA 3B9DA 3SGUA 4W8AA 3MP3A 4UNLA 1YQ3A 2ZOXA 3GC2A 4GY1A 4IMAA 3A5XA 3Q5EA 3QYSA 2XGBA 2BGQA 2UUBT 1L6SA 4Q8UA 4XD4A 4CI3B 4MJMA 1O6IA 3SFWA 4XZWA 3RF9A 5CZKA 1S2VA 4BQ3A 1TVLA 4O15A 1PKYA 1V6VA 1UD6A 1PHWA 2VZTA 2D3NA 1JIBA 1FWRA 3TYZA 4G7FA 3H7UA 2OQYA 4ECLA 3S1WA 5AC5A 4TWDA 3DFHA 3LXAA 3NDZA 1J18A 1K8YA 4KCUA 2G50A 1L0VA 3VCNA 4CCCA 2NZLA 1XNRT 3CV7A 5GNXA 3DP7A 3W2MA 4AYSA 1M9HA 4PUDA 4QEEA 2QZRA 3IACA 2LRLA 2PTYA 2VGGA 4UZSA 3CAKA 3PTRB 5AYYA 4ERGA 4C1NA 4MKNA 4X60A 3GR8A 1XSJA 3HG4A 3ONLC 3LCWA 5CJNA 4QLKA 3N17A 3AE2A 1QI2A 2CWNA 3CZJA 3WDJA 3GNDA 4UMAA 2ZX8A 3T42A 3T07A 1XPGA 3DFNA 4LAKA 1TKKA 3PPHA 3SECA 3DN5A 3AU2A 2OU4A 3UJRA 1FA2A 3MANA 5BCAA 1GOWA 1SJCA 3QV7A 2JMHA 2V69A 4GUIA 4ZHQE 4UB9A 3T44A 1JCJA 1IT7A 3GU9A 1CB7B 3AIUA 3SFDA 1A5MC 3ATZA 2PUZA 2KSRA 3VILA 3QMSA 3A3HA 1FMWA 3GDKA 1OJXA 5J1GA 4LC6A 4XAGA 3RM9A 3KL3A 4C1KA 4RW5A 4DBRA 1XRSA 4ADSA 4PMQA 5LXEA 5I02A 3CK5A 4QE4A 1QLBA 1U5VA 5CC7A 2QDGA 4JTQA 3PE0A 3P7IA 4EIVA 6PTDA 5LMUT 3TIMA 3OB8A 3AIQA 4AX6A 3GKFA 4GQQA 2QCNA 4GABA 5LHGB 3NM1A 1W1B1 3W74A 3M7SA 4CXXA 3THCA 2AKZA 1REQB 1QI4A 2YKSA 5HPOA 4BWLC 1C8XA 2DUZA 5J2UE 4JEHB 4I8YA 4NASA 3DHDA 3O6DA 4C7GA 3UQNA 4UV9B 1TTIA 3GDMA 4QE1A 1AA1B 3CC1A 5DT7A 3ITXA 3S8HA 1EOKA 3CMJA 2O56A 4FNUA 2ZUMA 2VFEA 1QASA 3AVSA 3DI1A 3MKDA 1XR2A 2XINA 3EA1A 4RL3A 2H9AB 3BANA 1U1JA 1KFCA 2QUMA 3APYA 5M1TA 4I9AA 1F3WA 4OZOA 3WL1A 4US5D 2CLKA 1E6ZA 2YYUA 4KT2A 1AW5A 1KD0A 4K7YA 5F4WA 3GA8A 4Z0SA 2GWNA 2Y7EA 4JR5A 2EBNA 3AOFA 2D23A 4LY4A 2P5NA 4J2CA 1CIUA 4HFCA 1X39A 3WH7A 8CGTA 3EHZA 2WU2A 1MIYA 3CAWA 3QZ6A 2FGZA 4DNDA 5E70A 4D8ZA 2VFHA 3FB2A 4Y7EA 1JDAA 1PIIA 3SJ3A 3ITTA 4JEUB 2OO6A 5JMUA 3ZC1A 3O9XA 3LHZA 1GCYA 4YCPA 1K8CA 3GTIA 5HULA 2CNCA 2INEA 1KKRA 1E0VA 3DHUA 4AZIA 1TVPA 5CA1E 3HIJA 2Y89A 4K0KT 3SAZA 3EB4A 3C0SA 3TJXA 2BHYA 2QVAA 3PJXA 2DCFA 1I9CB 2V81A 1AW2A 4OTKA 3JS3A 2FIQA 3FYOA 3WQCA 5KTLA 4XD5A 4U2ZA 3I7SA 5AQMB 3C61A 3RIUC 3PZGA 1XGEA 2YCJA 4ZEYA 3EMCA 3L21A 3RITA 2PTXA 1DTUA 3ZJ1A 1LTDA 1QBAA 4UFJA 2FJAA 3G1XA 4Q8NA 4L56A 1MNZA 3LHYA 3O3RA 3QR0A 4KHPT 1UA7A 3T55A 2MNRA 1ZZMA 3S1GA 3VUSA 4BQ2A 1TE6A 2NQZA 4GYSA 3QY6A 1TTJA 3L09A 4E7ZA 1E7PA 3SDOA 2KAUC 2PDYA 3HFYA 1MFUA 3EPMA 2WMGA 4HK6A 3N9MA 2A2FX 3CH9A 2PDIA 1MUWA 3ISIX 1T98A 1MXSA 4RW3A 2E9BA 2NV1A 5K9CA 2BZNA 1IV8A 3HMCA 3AMCA 4JNZA 3W70A 2Y5SA 5GVJA 1Q3NA 4J27A 3UETA 2Q8LA 5DN1A 3NZQA 2YCIX 1O60A 4IQJA 1CHUA 4NZ5A 1CUNA 5T8GA 3PC0A 4F2UA 2VGBA 4DJDD 4RJEA 4PEEA 1GHSA 3KTXA 1YQ2A 2WJDA 2VB6A 2EKGA 4NX5A 3VDAA 2GVGA 2X51A 4WD0A 2J1DG 2PDHA 2HNEA 1V79A 1RCQA 4IMFA 1PSCA 4NAEB 2CLOA 4UCFA 5ABGA 4K7VA 1FKWA 1ZBCA 1JULA 1ELSA 4RZ4A 4X0NA 3ZLHA 4ZOBA 3NL6A 3DI0A 2Y7FA 4XBJA 3PANA 1LDCA 3FKKA 1XRFA 2Q09A 3CEUA 4W5UA 3AZTA 1UWIA 2ZM2A 2C19A 4E38A 1H62A 4LAOA 3VDBA 1Z69A 2XQ3A 4MNLA 1PB0A 3FV9A 5L2LA 4AVFA 3CMLA 1SW3A 2XQ5A 2XZEA 3C2RA 4ISTA 1H11A 1VZWA 3QW3A 3D3FA 5D8WA 4HJWA 5CBBA 3PJTA 3VD9A 5T26A 3MXZA 1CT5A 1I2PA 3UZZA 2E8IA 2QUUA 4LH8A 5HJXA 4WRHA 4NZ1A 4EANA 4JTAA 3UXKA 4WJ8A 1UK5A 2ODOA 4US5A 5DMYA 1JPDX 4L5ZA 2DIKA 3RRCA 4TNVA 2HTMA 2PDNA 1P0NA 5I7GA 5LHFA 5AHEA 1TIWA 3W1NA 4J3VA 5J5DA 3LMZA 4PFMA 1RLDA 2EG6A 1MMGA 4CD4A 1CECA 1AJZA 1Q45A 1TA3A 1UOZA 4WGXA 2LRKA 4KWVA 3I9YA 3KDOA 5M2FX 3R4IA 2INFA 2X0SA 5LGNB 1CGYA 4HP5A 4XO7A 1EJTC 3UU3A 3URQA 2P50A 4GYPA 3GG7A 3R8RA 3POHA 4XIAA 1UD3A 2Z00A 4DBDA 4V27A 1D8WA 2WM1A 1JZ4A 4PFOA 4YTMA 4A3RA 4EZHA 4GISA 1Q6GA 2OWCA 3BK9A 4PB4A 3EWDA 5FCZA 1OEDC 2NXHA 3AS3A 4ENLA 3MI2A 3VNDA 2HQAA 2JJ9A 5LNWA 3NL5A 1Y5XA 4HFHA 1IIGA 4OU1A 4TWHA 1MW0A 1XC6A 4QH5A 1SO4A 4KRTA 3VIIA 2CWXA 3F03K 1UD5A 3AE5A 1R85A 1JRCA 1YLVA 2F6KA 3A24A 3LPFA 3PS7A 3PP7A 1UKSA 3PBYA 2IQTA 4LCRA 3RPUA 4TNWA 1W5OA 5IYZE 1SFTA 2ZZ4A 4JHMA 3STEA 1BR1A 2Y70A 1Q8JA 2LOPA 1FQ0A 1XCWA 4ROQA 3QMRA 1VBUA 4BA0A 1OIMA 1O7AA 4PL2A 1ZOYA 4M56A 5EZYE 1A5SA 4B3TT 3CQGB 1KRMA 5BR8T 1P48A 1L6FA 2ISSA 4QX7B 2GQ8A 3KRZA 3W85A 3W1LA 4AZBA 4X63A 3I3DA 4NUVA 3SIZA 2K3WA 3NCOA 1D3HA 3TQPA 2DZPA 3A3WA 7REQA 3H7VA 4KWSA 4BK9A 3CB8A 4A8IA 1WYCA 4I9TA 1W2PA 4BQ5A 4MF4A 3WQFA 4TIMA 2DZWA 4GVFA 4JCLA 4B3RT 3BOXA 1S39A 1ME9A 2AL2A 5REQB 1F61A 4WJEA 2CLFA 2J7CA 3DFYA 2V6YA 4MALA 1AG1O 1GWJA 3LV5A 4H9QC 3NL3A 1YDYA 4TV5A 5CPLA 3OLDA 1B7TA 1PX8A 2WKJA 2WZEA 4U3AA 5AY7A 4YTPA 2QGYA 1TYGA 3ABQA 3LGEA 3MC5A 4QXHB 2JK2A 1A0CA 3OW1A 4BJNA 1OX4B 2QV5A 1MW3A 3VU2A 4QX8B 2E9XA 2MTQA 1YDNA 1CX9A 4IE0A 5H6RB 4M7SA 3L4UA 3E38A 1KGXA 1T7SA 2C79A 3ZM8A 1M68A 4I0UA 1TZ7A 3O1NA 3UJFA 4R33A 1XH1A 1XMQT 2XQ7A 3QNUA 1W0AA 3N19B 4PGLA 3IA3A 3M46A 4GOAA 4DV5T 3RFAA 2NW0A 1RALA 4XKMA 3PWGA 1CXHA 1XLMA 1H7WA 2VD8A 4INFA 1ZPTA 3RK8A 2D9DA 1J12A 1W3HA 2YZ5A 3URNA 1EQPA 3WY1A 4B9ZA 1XIDA 4LYKA 1Z44A 1ISWA 2PGWA 1THFD 4H9XA 4LBRA 3O16A 4M1PA 3RJYA 1EJWC 2BASA 2V2HA 2XISA 2NV9A 2IS7A 2BOFX 2C0HA 3ZZ1A 1O5XA 1OK4A 3N29A 4F0HA 4H19A 4DMWA 4ZZBA 3GIPA 1X6NA 1K8ZA 1W1PA 1NEYA 3PB2A 3VCRA 3MCOA 3VXGA 1UCUA 3P60A 3C0LA 3SI9A 2V9DA 2E5BA 3QC3A 1G5AA 4GXWA 2VYOA 4E6MA 2RP4A 4MAZA 1T99A 4PMOA 5U4NA 3VKHA 4FF7A 4UOQA 2EPKX 2A3HA 1HR0T 2YU2A 5AHFA 1W9RA 7TAAA 3D3AA 3H22A 2BG9A 1XSIA 3VNYA 1NM9A 1VAHA 4MGGA 4JY8A 1A49A 4JHZA 1E15A 1FY6A 1H1YA 3QKEA 1S1PA 3J7HA 4JEJA 1XSKA 3TZNA 3V4BA 3WQDA 5JH2A 1RJPA 4HKPA 1GNXA 2X2GA 2I17A 2Y8DA 1TTPA 1NF7A 3RPMA 5HXHA 1VGAA 1O95A 1W5QA 1JYWA 4MMWA 1N34T 2PCEA 3NNTA 4LFAT 4EKJA 2WZHA 3IAQA 3LENA 4CNOA 1YPIA 4PW8A 4PMUA 4Z91A 3VKGA 1JPIA 2ZZ5A 3PULA 1TWDA 1MZRA 2WPGA 5HUPA 1SW0A 4AG0A 1C9WA 2R1KA 3UJ2A 1UX5A 2WY2A 1EGZA 3B8IA 4DBEA 1OX4A 1UUMA 2BXVA 5EMJA 4LRTA 5EKYA 3PSWA 1ML1A 2BY3A 1JI2A 3E0IA 1JCNA 3R25A 5BRBA 5C9ZA 3DH7A 2HE8A 3L65A 3RDKA 5FF2A 4JCMA 3G8RA 3AMGA 3LCIA 3TLUA 3K1SA 4URIA 5I00A 4H9OC 4K1WA 3KINB 2UZ9A 1E9ZB 3S1VA 2OOFA 3SURA 3FJ4A 1D3GA 1W32A 3SY5A 1H7NA 4U3CA 2AAAA 2JQKA 1WUFA 1H1ZA 1AH4A 3CS2A 4Q4QA 2FVKA 1K6AA 4NYYA 2ZXBA 1UROA 1W1A1 4PFPA 4HZMA 3C8FA 3AS1A 5A94A 2YFNA 2YU1A 4FNPA 1X1NA 3A9BA 4DR3T 1W9BM 2ZTJA 3TAKA 1YXDA 1YXCA 4G63A 3O0FA 1V7AA 4GI6A 3E3HA 3PTQA 5HPCA 3RXZA 1Q6QA 3FCPA 5FAJA 3VMNA 3MQTA 4CQDA 1E2AA 2PDXA 4HPJA 4ZB0A 5C7VA 3VIOA 3M43A 4XAPA 4S3EA 1RK6A 2G0UA 4HGAA 4IXHA 1EKOA 4H9RC 1V8EA 2ZRXA 4O57A 3L7RA 2GOUA 2WDVA 4TXEA 3MT1A 2ZRZA 3MJXA 1GOXA 1DIEA 1SO6A 3WFLA 5C2GA 4E8DA 1KM6A 4W86A 3RYFE 1J5SA 1U5JA 4Y8FA 1A47A 4JQ4A 4DNMA 2C0AA 4ZE5A 4ES4A 3ZWTA 3PJAA 4DY1A 3Q94A 1EFZA 1MIWA 3OJGA 1B4EA 2TAAA 4GPNA 4KFNA 1O5QA 1ISZA 3UR5A 2DVUA 4US6A 1DQUA 5AZ0A 1FJGT 3R6NA 4HSNA 2BXYA 1H7CA 3ZCJA 4E4PA 3PAOA 4LU0A 1XD0A 4I7UA 2ZMAA 5D02A 4BQ4A 3QB5A 2QR6A 1WDSA 1F8IA 3HQ1A 2D0GA 1I2QA 3WO8A 2OJPA 2ZYFA 7PTDA 3AHYA 2IKHA 3CO8A 3L2MA 3E0LA 2FTPA 3SR7A 2VOMA 1BR2A 3U48A 4J3WA 3U8GA 3W82A 3BAYA 4RZ6A 2YBTA 3ZIZA 3B5MA 3PNZA 3MUAA 2GGIA 2ZC8A 2X1RA 3ONJA 3KBNA 2QJHA 3QY7A 4B4FA 2QDDA 1WO2A 3SFKA 1YXRA 3PFRA 4CI1B 3EB3A 1UX4A 2JKEA 1IEVA 1XH0A 1QBBA 3O06A 1T96A 5E1QA 2DQXA 4W7WA 3NQ8A 5LNSA 2E5LT 3HPSA 1SVDA 3FEMA 5EK4A 4E0CA 3GXMA 1Q66A 3EVYA 3JC6C 5H6QB 2D69A 1VOMA 3QOKA 3PUGA 1VC4A 3R89A 3FSUA 3M65A 1DE5A 1US0A 1R8IA 5GJMA 2DT2A 2WAUA 3KFWX 2PI6A 2J66A 2PDMA 3WLTA 3IVTA 4YMZA 4M19A 1XIEA 4O8SA 4PA8A 4UMBA 2E6DA 5JIWA 3L9CA 4QG9A 1AMKA 1W9DM 4PR4A 2JF7A 4B3LA 4MDPA 2V3GA 2R94A 3WMCA 2DSWA 3LOTA 7REQB 2PLJA 3SQLA 4UTFA 4IDNA 2CWOA 2YX0A 3QXBA 4QAWA 2EXOA 4R7WA 3K2GA 2CC0A 3BO9A 3KW3A 2HN2A 2F7FA 3LA4A 4GO9A 3RN6A 1C7TA 4QSHA 3ZR4A 2JQXA 2KMFA 3BICA 4O0ZA 3TLTA 3CIWA 3IARA 4O2BE 4DRSA 1N36T 3CZ8A 5IUXA 4O12A 9RUBA 4KIEA 4FO4A 2C18A 4MLRA 3N18A 4UTWA 3IF8B 4M6UA 1WXYA 1E3ZA 2HXTA 3FHNA 3LK6A 3DFPA 1QI0A 2Z4GA 4CD6A 3DAQA 3ARRA 3H12A 3DGBA 3MUZ1 3UJEA 4XZLX 2ZFAA 3AFBA 4YHHT 3B4YA 1OYCA 4BI7A 3AA6B 4AH7A 4R34A 3WLRA 5C3JA 3LG3A 4CD5A 1B3YA 3LHWA 4ISSA 2Z6IA 5HYAA 4DJDA 4B9YA 2R24A 4H7ZA 3G3MA 3OODA 1ZBVA 2D22A 2PDBA 1HTIA 1FVPA 1B0IA 1TB3A 4Q8QA 3GZ3A 3UFGA 5ECUA 4HGXA 1XFBA 4XG1A 3HBLA 3S5SA 3ZOAA 3SCUA 4QTGA 3CYJA 1M1BA 3NXLA 3Q58A 3AS2A 3CHVA 3EDFA 2PDQA 1SZNA 2ADAA 3H2EA 1OCQA 5A2CA 2BG9E 2XU2A 2QLYA 1XGZA 4JIEA 3GG0A 1GOMA 2PS2A 3NO3A 1I45A 1XGDA 2J8TA 4HNNA 4GCAA 2G8ZA 4U33A 1VBGA 2XH2A 1W3TA 5D30A 3NSNA 5DQVA 2YYTA 5G4EA 2XQAA 2FMNA 1E3XA 1TA3B 2WSYA 3T08A 4B5VA 4XIMA 2OV9A 4YS1A 2GGGA 1CB2A 4YHEA 2KXPB 3DHFA 1KW1A 1MMNA 1UBSA 4DR1T 4EXBA 2IQDA 3T0CA 3GY1A 2WSSV 4XISA 4KF1A 5AHLA 1R3YA 4UVCB 4KBXA 3SW6A 3N5LA 3R0DA 1EC7A 1S1RA 1P0EA 3RR1A 5LJNA 4Z1AA 1KBIA 3TYUA 1IEQA 4A22A 4C1NB 2I59A 3AZSA 1MMAA 5CZTA 4P0BA 4Q7BA 4JI2T 3UXLA 3WLIA 2DY3A 2NSOA 1I1XA 1GVSA 3VIPA 1QI5A 4XAFA 5AQPB 4EVZA 1KXTA 4Z2IA 3W83A 2DQWA 1EC8A 1F76A 1FWAC 1J6PA 4WGHA 1Z9AA 1ZY9A 1J4EA 3CTLA 3GXNA 3MWAA 1TCMA 1WKYA 3PUXF 5KITA 1V0LA 2D2HA 4C7DA 2QF8A 3P61A 1NARA 3PZQA 5G4HC 4YJ3E 4IREA 3AA0B 4FXFA 3WK0A 3K30A 4ZSTA 4B15A 1D3CA 2DH3A 3S83A 1TV5A 3LTYA 1KFYA 2P53A 4AKIA 3N73A 3MYOA 3WQ8A 4AUBA 4JS3A 1XLIA 2I14A 3NO5A 2A3LA 1CENA 1CCWB 1EJRC 3MI6A 4LOCA 4ILBA 2I5QA 3T9PA 3MW7A 3C2YA 2XIQA 3IGSA 4HZ8A 3RX6A 1SFLA 2VWSA 3EX2A 1GG0A 5HAOA 3W2KA 4BF9A 3ZSSA 1GOKA 4H9UA 3XISA 1WBJA 4FPSA 3TA6A 3FJLA 4DPQA 3APGA 5AQUB 3UG3A 5HR6A 3O1JA 1BF6A 1NP2A 4B91A 3F5JA 5CPMA 4FAMA 2HS8A 1XIGA 5MF5A 4A35A 4ATLA 4WLCA 3V0TA 5E9XA 3D0TA 4HA3A 4HA1A 4PMRA 1QHPA 1OD0A 3PTKA 2PP0A 1ZEEA 3ZLIA 4E2DA 2QCLA 4G8TA 2Z2UA 1GHRA 3VD7A 3K8KA 5A6AA 3WD1A 4UELA 1KFBA 2CRBA 1I2OA 1DJXA 3RKGA 1UR3M 2BG9C 3AJXA 3C0QA 3V3WA 4QCEA 5D9OA 5FVKA 2C16A 1FWJC 3NM3A 2ES0A 4QHRA 2GQ3A 3LSVA 2NW7A 1JZ7A 3TTOA 4H8NA 4KETA 3N25A 2O9OA 3NRYA 1JDCA 5A6BD 1FDZA 4HWCA 3VMOA 1HL8A 3U6WA 4DLMA 4M81A 5JBDA 3FS2A 3CIRA 3RRAA 1VYSX 2M6BA 2EPNA 2OLHA 3BG9A 3Q2MA 3DCPA 2ZZ7A 4BR1A 4Q4RA 5D05A 3UWZA 4FLSA 1ZJHA 2E40A 5HDRA 1A3WA 3HPFA 5CSUA 2JEPA 3NQAA 2OZ3A 2ZUVA 3LHUA 5CZJA 4NY2A 3SUSA 4D6JA 3HV8A 1L9WA 2XVKA 1TPH1 2YLLA 7CGTA 5BOFA 2G0WA 3T2PA 3W7KA 3BARA 2OEKA 3O6YX 4N7QA 3NDYA 3ENLA 3TSBA 3WD0A 1KFJA 3SOLA 1C7SA 1H63A 4NXSA 5AQRB 4LCQA 4JL2A 4BFAA 3E74A 3DIPA 3DFTA 3W86A 2AMXA 4U2YA 3WQ5A 2PC8A 3TH6A 4IE4A 1XLBA 2E28A 1DWIM 2W63A 4JLEA 3MKVA 2A7PA 4KBMB 2YZRA 3A5FA 4FJOA 3UR8A 4I90A 1WOBA 4H4IA 2PRLA 5GQBA 4DZIA 2VMFA 2DWKA 3OU8A 1JFHA 4M6PA 3W1TA 4CQ8A 4LQ1A 5C54A 3CWOX 4AHQA 3FHQA 4LJ3A 1AQ0A 4ICNA 3IUDA 1T72A 3FDKA 2VKZG 2XZ9A 3Q37A 4H1ZA 1HJVA 3W02A 2RGMA 4GBDA 4PRWA 2A9UA 1PS9A 2BGNE 4NZ4A 1MMDA 3VPLA 3E12A 3UESA 2ON3A 1IXNA 3KVBA 3W1PA 1XHGA 3PUOA 4AY8A 4N78D 4PTVA 1D9EA 3CUZA 4U31A 4DV7T 4F0LA 3AUOA 3CIXA 5HWMA 1TPUA 2PTZA 2DT1A 1OF8A 3CWNA 5D9MA 2WC3A 3W1UA 4G6CA 5HWNA 3WK1A 2LOSA 4AXNA 1E71M 3GVVA 2GGEA 3VUPA 2VQET 5LHEA 1IWPA 4N9BA 3DYOA 3KHDA 1TPWA 3RR4A 4UTWC 3TYEA 2QCGA 4QJ1A 4R3UA 2ZA2A 5JH7E 2V5LA 3TOPA 3OYXA 1DORA 3RYIE 1PIFA 5I6SA 2QMJA 5I07A 3CLWA 2X42A 5FL1A 1KTNA 1RBAA 5A95A 4IG2A 4W84A 3FXDB 1A5AA 4DV1T 2BLEA 3LQLA 5A8PA 4DYJA 2OYKA 4QDPA 3MZNA 3FVDA 1LOSA 2XWDA 1XIMA 3PJAJ 3U2ZA 2D0FA 3PWIA 2V30A 2WDQA 4Y96A 1KM3A 2PZNA 2ACUA 3BLOA 3O15A 2OX4A 4B92A 3S5OA 1B90A 5AQQB 5A3HA 4PB5A 1JCYA 3KZSA 4S2CA 4M7TA 5AOUA 4E2BA 2POTA 3LERA 1YMYA 1VENA 3LPOA 3AIEA 4PUJA 1Y01A 1EZ2A 3CPGA 4XUGA 4O4LE 2XFRA 1BR4A 4C91A 1UZ4A 4EOUA 2YLAA 1GYMA 4B3KA 4QCFA 1WZAA 4FP1A 1W3KA 2XUCA 2V7KA 4LAMA 3N6HA 3VGGA 2WM9A 1G7VA 1YDVA 2K9AA 4M3PA 5K7JA 4BF7A 2OMAA 3FZKB 3M0XA 3VE9A 3EDVA 2XQYA 3L5LA 3VI2A 1J1JA 1K9DA 3OEXA 3IJLA 5LA1A 4NNAA 1QPQA 2BX7A 2GK1A 3WLHA 4ILUA 4JFUA 5EFDA 2W67A 4ATDA 5LBMA 5FF0A 3W26A 4MADA 4IOTA 3TUUA 1RCOB 3ARVA 3HR0A 3TYAA 3QGVA 5G1MA 2PD9A 4HT3A 4ZI7E 2X30A 5L9FA 3T0DA 1BYDA 4S3DA 3B8WA 5D2WA 2WANA 2ZM6T 1IR2A 1QRQA 3G06A 3WQVA 4ALDA 3TN4A 3GLCA 1QU4A 4LNYA 4J3SA 3FYYA 2ZM8A 2LSGA 4DYEA 2WXDM 3B9NA 4LEQA 3MHUA 4AWSA 2VR4A 1VFUA 1F6KA 1TX0A 2XFYA 1HS7A 3ELFA 3TLVA 5L3BB 1BGGA 2HRWA 1W0BA 5FSDC 1HO1A 4UOJA 2V7JA 2W9MA 1UWUA 2O9TA 2YCKX 4G9PA 4WNKA 2VFGA 3RMEA 1W6TA 3E2RA 4DNHA 4KH2A 3EEZA 3PSVA 3QJAA 3VINA 1G6CA 2PTWA 3AEGA 1ZB5A 4X0VA 3W01A 5IXEA 4GA8A 1WKDA 4IP5A 1VRXA 1YNPA 3SQMA 2CPUA 3FK4A 3GAKA 4DWSC 2PWVA 4IQEA 3S4UA 4H6EA 4ZB2A 3ARTA 3PUVF 3L5MA 5AQOB 3KTSA 2QPXA 2WV8A 4HFIA 1Q6CA 4S1FA 3IRSA 1ZBWA 1XBVA 4LUIA 2W2UA 3KS6A 5GONE 3ZYKA 1K7EA 2AGKA 4GVIA 2ACXA 5LZLA 1BXBA 2QUTA 3N9RA 4DR6T 1T41A 2QCHA 3EXSA 1B3ZA 2YJQA 2D0UA 2WHLA 2R6GF 2P3ZA 2WVSA 2OXNA 3MTWA 1KNRA 2RH9A 1JEZA 4P7QA 3W6LA 2XQ8A 3CHFA 1RR2A 4GUJA 1I2NA 3WNMA 4DJEC 5U7SA 5ABFA 1JRBA 2PEVA 4GQ0A 1AZ1A 1E1CB 5M3WA 4CU6A 5GNYA 4OOZA 3TYDA 5AHNA 4H9ZA 3AECA 4A3UA 2PFVA 5D2TA 3BQ6A 5DO8A 2PU1A 3HURA 3INPA 1UUQA 2J79A 3PZUA 5L3EB 1VCSA 2TODA 1RD6A 4Q3MA 3K8LA 5MKGA 4UOZA 2N2NA 5FL0A 1F3EA 4OGZA 5E6ZA 4RDYA 1VS1A 3W15B 2WMIB 4MBQA 3CL7A 2QJNA 1LRTA 4JIPA 3CZLA 4XV0A 3ARYA 1CTNA 3GR7A 3TW6A 3SRDA 3EKLA 3WJZA 2YN6A 4K2SA 4DJFA 2Y24A 3EX1A 3H7RA 4RNHA 1Q6RA 3TR2A 5JXQA 4LVFA 3W7EA 3H37A 4HNUA 5CZ0A 5CJ5A 2I9EA 2H90A 3VRBA 2PU0A 2NSXA 4Z0JA 3ZMZB 4HZ6A 2WZTA 1DPMA 4N2YA 2H3BA 1W1VA 2BFGA 4A2RA 2IMLA 1R2SA 1PX4A 2BS4A 4NSBA 4GH3A 5LNVA 3AWOA 3A3XA 3JVAA 4M8UA 2WMNA 1F74A 1GQLA 1POJA 2PRMA 3BL3A 1YBQA 3BLLA 2UXXB 2E5VA 2CESA 1M3UA 2YL5A 3ZVHA 4H9MA 4FNRA 3BAXA 1RPKA 1AK5A 2OSYA 2NVDA 1H41A 3BCDA 1OFEA 3NBXX 4K8GA 2X05A 4YTSA 3AISA 4Q8MA 4QHOA 4BAYB 2WHJA 1VEPA 1E6SM 3VIHA 1Q65A 1EJSC 5CG0A 3BCJA 2CZEA 3T1YT 4AW7A 1X8CA 4XAYA 3W7LA 2JMKA 3G1AA 1TZZA 3MKKA 5DCDA 1P7TA 4DELA 2ZA3A 5M17A 3GSMA 2WVTA 3CHCA 1EIXA 4IT4A 1ZRQA 4H7CA 2WSQA 3V5UA 1XYCA 5D2VA 1CZ1A 3B8TA 1WKFA 4YTUA 4EPDC 1XD1A 1XMOT 3JZEA 2VM8A 2I7GA 2IPJA 1CGWA 5AHMA 1S2CA 4KHZF 5I0DA 5JUVA 5BXTA 3QMTA 2L9QA 4YTNA 2Y88A 1QR7A 3NIYA 5HINA 1XX1A 4I5RA 3W53A 4K38A 3CV2A 2HH7A 4W8LA 3HPZA 1QNSA 4ZL1A 1JCMP 3VVGA 4AIBA 1HX8A 1O3XA 1B2YA 2A7NA 4IP4A 1FFRA 4PH6A 5FXWA 2BKNA 2RGLA 4JPGA 3F4WA 2FB2A 5E0FA 5HEHA 3HA1A 5HJYA 4LTSA 3TROA 2REQB 4JTCA 5HQLA 4MFDA 1DJQA 4U7IA 1TPEA 4GACA 4KX6A 1U33A 3TTYA 1GZGA 3CQJA 4L0RA 4FLQA 5HR7A 3CIVA 3M5VA 2UXBT 2C71A 2VNCA 1KR1A 3CH0A 4AQYT 1IGWA 1TUFA 3AXKA 5C2TA 2E9XD 1YTDA 1XUZA 3L39A 4Y9AA 3APTA 3TTSA 3RIKA 2H3RA 3OPSA 1NVMA 1DHPA 3P8CD 1KBLA 3BQKA 1MRAA 1IGSA 3VOFA 3GXFA 1IIHA 3GUGA 3WYZA 3PJWA 5C9WA 3DDMA 1R3TA 3OBVE 3N9QA 3O1HA 4PAGA 1LKXA 2PWHA 2QGSA 3LY0A 2PBGA 3N12A 2OWWA 2X1UA 1P0BA 2G3NA 2ZDRA 4H3DA 2ATMA 3FXGA 1UH3A 3JAFA 5FOOA 2Y62A 1OCJA 1E1FA 5ADXL 3CX6B 4WXYA 2E8ZA 3WX7A 4UFIA 2ASHA 3BJFA 4JTKA 1ZUAX 3E2SA 3VE7A 1FHLA 4O14A 3OZPA 2X0HA 2UBPC 1HKIA 1HKMA 2GVEA 4Z1DA 2TRSA 1DE6A 2RDXA 2GJXA 2CITA 2PGFA 1MUCA 2R1NA 1KLZA 1ODUA 3H4XA 3NQ2A 2IW0A 3E02A 2FZ8A 5DY3A 2WO5A 4A29A 1OFQA 5D09A 2JALA 5T91A 2PE4A 2ZRYA 1NDVA 1XICA 1R86A 1VBRA 4L5GA 1YHTA 3U57A 4HWIB 2VQFT 4B5TA 1RP8A 2B31A 3IHRA 4P1NA 1F7BA 3ONXA 3WJWA 3EA2A 1R7AA 1NDWA 4IH3A 3WSUA 5C8YE 1A5NC 2G3MA 3TNBA 3UZXA 3W7HA 2VKDA 1MNDA 3BCFA 3KP0A 4FEZA 1T8QA 3LGGA 3UU4A 3I6RA 5E9AA 1H61A 3KV4A 2EJ1A 3A6OA 3KLKA 4O4WA 4OOUA 3QHNA 2BKOA 4MFEA 3LEPA 3CT7A 3A4AA 1U4QA 3RQUA 5FY7A 2CLLA 2OELA 2J7BA 4RE4A 2VP8A 5KX5E 3S3GA 3M4HA 3A5VA 4GQRA 3AWNA 4EAYA 3DKLA 1O5RA 2IXVA 1JL8A 4DJFD 4IMEA 4K68A 3D6NA 4GIYA 4EF8A 3GTNA 4E5TA 3M64A 2REQA 5BZAA 2V67A 4JIRA 3JU2A 1B1YA 3TYCA 4FHAA 1RQHA 4X1YE 2GUUA 2OFJA 4UTIA 1AH3A 1SJBA 4WY0F 2IDOB 3BW4A 3PZNA 1ONRA 4ZBCA 3N04A 3KM8A 1PJ9A 2J13A 4Q33A 5FAGA 2A79A 2IKIA 4L4OA 4AHOA 4ROPA 1JDFA 4LB4A 4EZ4A 4P7LA 2Q71A 1J01A 3RQWA 4AX7A 4QS5A 4AZCA 5CXPA 4DB7A 2XSAA 4JKKA 1KTCA 4IDZA 1RD5A 1VJIA 3R79A 3W00A 3VGBA 2RHGA 2VZSA 2ZWYA 3S42A 2VL8A 1J0JA 2G4JA 1JUKA 4LFCT 1ZAJA 4KCTA 2Y2WA 1R38A 4G2DA 1K9EA 4P8UA 4BZYA 2WVUA 3AU6A 4J9JA 5JDNA 1V02E 1X38A 3SWHA 3OP2A 3MUXA 3DERA 4FOJA 4MY1A 5I24A 1GGOA 4HU4A 1ZCCA 4E4UA 3N9LA 4DJEA 4IIFA 3MPGA 1UMLA 1IBKT 3N13A 2CXDA 3N9NA 1PKNA 3AYVA 5AYXA 4HHHA 3UPMA 2LSYA 2KX9A 1C9DA 3AAEB 1KRBC 4ZFMA 3S6DA 4LALA 3CO4A 3J7Yq 2HXUA 3CL6A 1OC6A 2CHOA 5AQVB 1VFLA 4AWEA 4LS1A 2PD5A 3C56A 1XLGA 2XFWA 2R14A 2A1YA 1VYPX 2Z26A 4LAZA 3GIQA 3K4DA 1WBHA 4IPPA 1QNQA 3DESA 2PGRA 2QJIA 5FJJA 3EYPA 2FGBA 1SZRA 4A97A 3CUXA 1FWFC 4X2RA 5CLTA 2SPCA 4KEZA 3AYTA 3MV01 5AFUL 2D3LA 4XZMX 2YKKA 4DEFA 3WDIA 2V0TA 1DWAM 2LSJA 1E0XA 2ONEA 1F4AA 1YEYA 2FTYA 2LSKA 1ZU8A 4RV8A 2I0MA 3W7IA 1HVXA 1UOKA 1KLYA 1TPFA 2RDTA 3WLSA 4RNFA 3GH7A 2VVSA 3A13A 4GGHA 3RGLA 3W07A 1UA3A 1G73A 5L3GB 3DFQA 4GD0A 2O9RA 4ZTYA 1XIIA 2YL8A 1ZCOA 3BW2A 3CM4A 2D24A 2E3ZA 3W7QA 5FSEC 4JTEA 3FIGA 3WK2A 1H7PA 2ACSA 2VX5A 4AU0A 4C6CA 2E0PA 1QOQA 3AHTA 1A5UA 3V5CA 4AIUA 2V82A 3H2MA 2FBWA 1XLEA 4HNTA 3R8GA 3M3ZB 5HNRA 2DWGA 1JYXA 1HJWA 3LLDA 3LBOA 4HCLA 1CLXA 1FOBA 4PTXA 1X9BA 1EXBA 3T8QA 3KAOA 3N15A 2A3AA 3C2VA 2GJLA 3M41A 1JXKA 4IP7A 2VEKA 1K9TA 1FWHC 5BW6A 1WV2A 3WEMA 3WQ4A 4H8VA 3SUUA 2OODA 2YBVA 1N2VA 2Y85A 1IJ5A 3WMSA 5LIWX 3WBWA 3WQOA 4B5SA 3OG3A 3C4UA 5KMGP 3S2NA 4ASKA 4AXKA 3NAVA 4CD7A 5FEXA 3GN5A 4X2PA 2VK9A 1NAFA 5CGMA 3UT0A 2L3LA 3OZOA 4GI9A 3L4XA 3RLUA 3LDQB 4CNTA 1HN1A 1XG3A 4UEMA 3GDTA 5JU6A 4FX6M 4B6XA 4Q8WA 2Y8VA 4R53A 1WDRA 3WH5A 1SGJA 5EA9A 4CKQA 1W3IA 3NOEA 3BXWA 4Q4SA 4CQAA 2IKJA 3SCPA 2YA2A 3BSMA 4LUSB 5CGTA 1EZWA 2XIIA 2CM0A 3NYZA 4GIWA 3ALFA 3IJ6A 3EMZA 5JDGA 4QQ3A 2X1IA 2VUNA 5DJQC 1N8FA 3N2BA 4A3YA 1QAPA 5T9CE 2VENA 4GYKA 3P62A 4MAVA 4GKKT 3GW3A 2HMCA 3UT5E 3A4JA 2YW3A 1M62A 4GZ7A 4GXMA 3UW6A 5TAOA 5JDQA 3R2GA 4EIWA 4GMEA 1ITQA 2PB1A 3U5UA 4AKGA 2GSJA 1FWBC 4LYPA 4RKAA 1VQTA 1VJSA 1T5AA 4IL0A 2GJPA 3WLOA 4IXXA 3H3AA 1XDLA 1XIBA 4W85A 1FHUA 4BI6A 5A8MA 1GTEA 1QPRA 2BP1A 5ABEA 2J7HA 3L0KA 3R7MA 1VBHA 3WNKA 2KINB 2ACZA 3N9PA 1AFSA 4O17A 4Q4KA 3HF3A 4DM2A 1A5CA 2PFHA 2JE8A 4R7JA 3Q5WA 4YSZA 4HA4A 5FP3A 4GNVA 2L8KA 4AI6A 3BG3A 5H2ZA 2WNQA 5FESA 4KCVA 3G1HA 2G3FA 2E25A 3ID7A 1HW6A 2GK1B 2N1GA 2XQ9A 1MXGA 3WUEA 4TX6A 3TLWA 2CEAA 4U74A 3RX2A 3M0HA 4GWEA 3GNRA 3L66A 5F2LA 5AKQA 1SR9A 1TWWA 3ANUA 4QITA 4ICCX 5HNTA 3BH4A 3VIGA 3MHGA 4FOKA 1IT8A 1MQRA 5CZSA 4FLOA 1REQA 1QSDA 3PTMA 1P5BA 1ICPA 1JUBA 3USBA 3W6YA 5B80A 4CU8A 3THDA 4MSSA 2H6RA 4PSPA 4MPQA 3F5LA 4S3GA 3W4RA 2ZIDA 3ES7A 3EB2A 3PZTA 1H4PA 3RI5A 1KXVA 1TPVA 1NOFA 3T8OA 1BQCA 1OEPA 2V26A 3ZMSB 3DJBA 2BY1A 1FWIC 5J8LA 2B7PA 3GM8A 2VT0A 1YTKA 3NQFA 4DN1A 1V6UA 5RUBA 3W3OA 1M41A 1R0MA 1I4NA 3MMDA 2WNWA 3C64A 1CGXA 1EUAA 4IG2B 4GNKB 1XDMA 1JCLA 1S2UA 2OX1A 4X1KE 3T0TA 4ZQCA 2CLIA 4H2CA 4P2VA 3AVRA 3GZAA 1AODA 1Q4NX 4WKAA 2FPYA 1JF5A 1IR1A 5AQIB 1H7OA 1C92A 3P8JA 2WHKA 4JTIA 3A4XA 1WZLA 1KFWA 1TZ9A 3SUWA 4UNIA 3IUHA 3PZOA 1W1ZA 1MYRA 3CZGA 5LA0A 2WMOA 5E0KA 5TQLA 4Q22A 2CLYC 4OBSA 3UWWA 4GZEA 5A6KA 2DL1A 5AZ1A 2YB1A 1UG6A 3EAUA 2UY3A 4AQFC 2QV4A 2VCBA 4CQIA 4LF5T 1QFEA 1XISA 4FI5A 4C5ZA 4KWOA 1XLDA 5DQWA 1Y5WA 1US2A 2FPVA 1ZP3A 4KQNA 3L4YA 2YA1A 3V0SA 4S23A 1GORA 2R9RA 1JQVA 2Z1WA 5HWJA 4TVUA 1ZAIA 2ZX9A 1KQZA 2PURA 3ITOA 3NEVA 1UPPA 1ME8A 3LRLA 2NX9A 4QQUA 3C6CA 3SY8A 2L5HA 4HTEA 1LT7A 4C6PA 3TTQA 1R3WA 3ETVA 4O54A 3FKRA 1LRNA 2ZA1A 3T40A 5HCJA 1TJ2A 1XYZA 2IHR1 3W24A 3EDEA 4QAIA 5E0OA 3GS6A 1XQLA 4DWSD 1DJGA 3KUMA 4UNKA 5HATA 4ZB5A 2OGJ