2W61A

Saccharomyces cerevisiae gas2p apostructure (e176q mutant)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
480
structure length
470
Chain Sequence
GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Glycoprotein
total genus 164
structure length 470
sequence length 480
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w61A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w61A01
4UCFA 2UY4A 1ISZA 2VCAA 4OOZA 3QHOA 1JDAA 5I2UA 3W53A 3CZEA 1JZ7A 1OM0A 3CZ8A 2WZHA 4ZXOA 3UG3A 3OLIA 4GQRA 4BZYA 5AC5A 1B2YA 2WSPA 2G3MA 4S3KA 4V28A 1EO7A 1JD9A 4AD4A 1WB0A 1QHOA 1LF1A 1WO2A 1JZ8A 3WNOA 4HMCA 4UQAA 3VIJA 3E1F1 3MUIA 1W2PA 3W6MA 2GJXA 3PTKA 4Z2KA 3GNPA 1E4LA 3L4YA 5GNXA 3CZLA 3TTYA 4J3WA 4P8XA 2WLZA 3ZOAA 3N17A 2VC9A 4N0RA 1V0LA 1FP8A 3CUHA 2WYSA 5A6BD 2CITA 4CD6A 2YLAA 1MW0A 5A3HA 3IAQA 2WMHA 4S3JA 3W0KA 3QGVA 1OIMA 3FXYA 1UA7A 8CGTA 1E6RA 1LG1A 2CBVA 2J7HA 5ECUA 1UR0A 4PTXA 2DSVA 1G9HA 2GJXB 1BVZA 4PMRA 3T08A 3WH9A 4P7LA 1EGZA 1XSIA 3SUTA 3FAWA 3SURA 4IISA 3OB8A 4PTVA 3WQ4A 4EAMA 1OWQA 1V0NA 4NF7A 4H8VA 1HJXA 1TZ7A 2CHNA 2PWHA 2WWCA 1TG7A 1MXDA 3G6LA 4JFUA 1ODZA 3GH4A 3IJ8A 3NSMA 1CGVA 4XV0A 1UHVA 1F4AA 3W82A 1GHRA 2QMKA 3WUEA 3RIKA 3VMNA 1UR2A 2VQUA 1V3MA 4AXNA 5A2BA 4GQQA 2GSJA 3PTQA 5DT5A 1W1YA 1M53A 4J28A 2PB1A 3AS2A 4MDPA 3CHDA 3J7HA 4BQ4A 3MU7A 2VRKA 4HPHA 1V3JA 1BGGA 3NIYA 3SCSA 3VIGA 5ABEA 3ARZA 1J10A 1HL9A 1IT0A 2FH8A 3ALGA 4TVCA 2ZIDA 4PSPA 1FH9A 2V3DA 4EK7A 2FGLA 3QOKA 4D6EA 1WKYA 2XYLA 3AMDA 4PEEA 1GNXA 4CD8A 2J78A 1WE5A 3ARYA 3WNKA 1VF8A 2W4XA 4WIWA 4L4PA 4UQDA 2J74A 2A3AA 3ZIZA 1PX3A 4CKQA 2WC7A 2BXYA 1ZJBA 4P7NA 3K1DA 2Z1SA 2WCSA 1JIBA 4CCEA 2QLYA 5CGTA 3WF2A 4CD7A 1GUVA 3IANA 4U5IA 4NRRA 4HU8A 2W66A 3ZJ8A 3DYMA 3TTSA 3MV01 2D3LA 1V6XA 5F7UA 4QAWA 2WW5A 2J7DA 1NOUA 1R87A 4JFTA 4EE9A 4PMDA 2W5FA 3WNPA 4NRSA 3MMUA 1W1VA 1VB9A 1C8QA 1VEMA 4XB3A 5GPRA 1KBBA 4QLJA 3B9DA 3UR7A 1CIUA 5IFTA 2DT1A 2CXGA 3CH9A 2V3FA 3K4DA 4HZ6A 2X05A 1Q6FA 4PUEA 1IZKA 5LA0A 5FOOA 1WAWA 1UG6A 4AZGA 3VVGA 3ZT7A 2FHFA 3WF4A 2CESA 3MS8A 3N13A 2E8YA 4R5EA 2BVTA 1JXJA 7TAAA 3KE0A 3AICA 1LJYA 2V5CA 3APGA 1XSJA 1W9UA 4TUFA 3AIUA 5IHRA 4Z2LA 3MUZ1 1PIFA 2PWEA 4E8CA 1QI4A 1EHNA 4URIA 1MXGA 3PZNA 1AQ0A 2BY2A 2D0HA 3B9EA 1XCWA 2RGMA 1RPKA 2XWDA 4UQCA 2IUZA 1GJUA 4D6JA 3WNNA 5D9PA 2WVSA 1PBGA 2WMFA 4W8AA 2OYLA 3T2OA 2F61A 1UR1A 4Z2GA 2JEQA 3AFBA 1ISYA 1UD2A 5C71A 1W91A 3WELA 5I77A 5D9NA 4OBSA 4K68A 5BWFA 3WD0A 2PC8A 1XYZA 3BXWA 1K9FA 2VUYA 1GQKA 4AD0A 1C93A 1UWRA 3VGBA 3EDDA 1ODUA 1QI3A 3NSXA 5BRQA 1HXJA 3KWXA 1QI0A 2C7FA 2Y8VA 3LMYA 3WQ5A 3KL5A 3AZSA 1E6QM 1VRXA 5CPSA 4W7WA 5BXTA 1ZU8A 2WANA 2DDXA 2J79A 1VENA 4FK9A 1R7OA 2BHUA 4KGJA 3ARWA 2C8NA 2IXUA 2ZXQA 3WH8A 4AZ6A 5LA2A 1OBAA 1PZ3A 3GXFA 3L4UA 1HF6A 2PF0A 3W24A 2X0HA 3IAPA 3VIKA 1C92A 1QNOA 5I6SA 3A47A 1UD6A 4LYRA 7A3HA 1KGWA 3EDFA 1B1YA 2CHOA 4BQ5A 1D7FA 3VIFA 3AOFA 4HPGA 3I3BA 4L4OA 4ZEPA 1SMDA 1JYXA 5AYBA 1JNEA 2WMIB 2GDVA 2CPUA 2WNWA 2QPSA 3VIOA 1ZL1A 2Y8KA 2VURA 3VUPA 2A3BA 3GDBA 1MQQA 2ZE0A 1RP9A 1B31A 1DTUA 1NWRA 2DSZA 3FNDA 3RJXA 4H2CA 4BF7A 2W92A 1H0GA 1JZ2A 4GZJA 5D4YA 3PZIA 2ZOXA 4HZ8A 3MUAA 2WVVA 1B3XA 1E15A 2DEPA 1L0PA 4Z2IA 1UH4A 1KR0A 1US3A 1J0ZA 1E56A 1WDPA 1E6XM 1BGAA 3VILA 1UKSA 1V3IA 4UTFA 3T0DA 1GVYA 2VCBA 2WHLA 4CD4A 3FHAA 3WENA 5C8BB 1JXKA 1HP5A 3ARQA 3WQVA 1WPCA 3PZMA 4W5UA 2A3HA 3VD4A 3II1A 3ARXA 1OINA 1TA3B 4GO8A 3WEOA 4X0NA 3O6AA 1H09A 1QHPA 4H7VA 4OIFA 2AOSA 1JL8A 3WMSA 2WVVB 3GXIA 1AVAA 4Q22A 3LPOA 4U3CA 1BYDA 4RE2A 4ZE4A 3B8SA 2D23A 1H4PA 4H41A 5M5DA 2JIEA 4B3LA 4DUXA 4BQ3A 1W3LA 2WCGA 4ATDA 1H2JA 2VR5A 2XPKA 4H8UA 5E0CA 4AD5A 4OZOA 3WUBA 2QPUA 4MB4A 4W5ZA 5EBAA 2GK1B 4BQ2A 3OGVA 1EDQA 2BY3A 4ZENA 3ZM8A 4W7UA 1B3YA 2VZTA 1CLVA 3BH4A 1JZ3A 1YQ2A 4UOZA 1XSKA 3L2MA 1JD7A 2JIWA 2J77A 1UWQA 3RDKA 4AEEA 1NOWA 2D3NA 4J3SA 1DWGM 3QHMA 1U2YA 3VDBA 5M17A 1BVNP 2EXOA 3ZT6A 1M01A 5KZ6A 1BTCA 1DWFM 1C3FA 1MWOA 4HMEA 1BFNA 2EPLX 2WPGA 2E4TA 4UOJA 5JIPA 2E3ZA 4LYPA 3RPMA 1KWGA 3M6DA 1PX8A 1AMYA 1FA2A 1TE1A 3MANA 4AIUA 2OSYA 4N42A 4UFKA 1OD8A 1UWIA 3O9NA 4TXEA 2OWXA 3SCRA 1QW9A 2CKRA 3ECQA 3CGTA 1GCYA 1GOWA 3WD4A 3OZOA 5E6YA 4ZFMA 4C7GA 4CD5A 3B9AA 1H0IA 2J7BA 3F4VA 5CSUA 6A3HA 2WLYA 3L4TA 4W8BA 1WZMA 1C8XA 1A3HA 2TAAA 3RMEA 2JALA 4UZUA 1A47A 1D2KA 5I23A 3WMBA 3RM9A 2WWDA 1VAHA 5I0DA 3AHZA 1SR0A 2D20A 1W3JA 3QOMA 1GOMA 1UKPA 1OSEA 2O9OA 2GUYA 2JE8A 5KEZA 2DSWA 3DHPA 4P7RA 2OYKA 4P8VA 2XSBA 1UOKA 4JZ5A 3W25A 1BG9A 2ZX8A 4ML4A 3I3EA 2EPNA 1V08A 4AD3A 1UH2A 5AYIA 3SCNA 1DHKA 2Q8XA 2QF8A 1WP6A 1HKJA 2YKKA 1ZBCA 3W81A 2OSXA 2PWFA 4CCCA 3W28A 3OLGA 1U33A 5E6ZA 4IPNB 4QFUA 4ATLA 1UWTA 2VZVA 1FP9A 1ZJAA 2GJPA 1JFHA 1W2VA 4Q7NA 1C7TA 3AJ7A 3BAXA 3BAYA 1DWHM 1WCGA 3HJEA 1AQHA 1VFOA 3ARRA 1JAKA 4TOQA 5CLTA 1UQZA 1JF5A 5DT7A 2XHYA 1V03A 1YHTA 3AHVA 3AS1A 3WD2A 1EA9C 3AIEA 1SYTA 3M7SA 4M8UA 1E6PA 2D0GA 3EMCA 1K9EA 1JG9A 4M80A 2D24A 3VNYA 3W6LA 4D6FA 3GH5A 3AMGA 1C7SA 1OGSA 2DT3A 1CECA 4MNJA 3DECA 2DIEA 2XFFA 2CNCA 3UCQA 1W3KA 3JUGA 4AIOA 1ESWA 5M03A 1BYCA 1B0IA 3WDQA 3BSGA 3GXDA 4J27A 5DEZA 1CZ1A 4TTUA 2WB5A 5CLWA 4W8LA 4JFWA 4AIEA 1CXIA 3AXXA 2ZXDA 1EDGA 1RP8A 5IDIA 3WBEA 5CXPA 5BXRA 1GVIA 1V0MA 1QBAA 2VVSA 1UWUA 4GZIA 1OD0A 1UD8A 4PMZA 1G01A 1JI2A 5JBFA 1JNDA 4PSRA 2YA0A 1BLIA 4HTYA 4UOQA 3VTRA 4QLLA 3GH7A 4Z2JA 1TUXA 4LXFA 1TVPA 2UY3A 3AIRA 1CDGA 2GVYA 2J62A 1PIGA 2W63A 2GJRA 2G3NA 3VMPA 2VMFA 5EFDA 1NARA 3WH7A 3WL0A 4F66A 2VRJA 1W3HA 4NSBA 3VIMA 1XC6A 4OKDA 3GBEA 3QR3A 1MW3A 1HKMA 2W91A 4JAWA 1LQ0A 3ALFA 4H8HA 4JKLA 3SEPA 1CBGA 1ZBWA 3K8MA 1V6VA 4RL3A 1I75A 1HJSA 1CGWA 1EIBA 2ZICA 3CHCA 2AAAA 2G3JA 3CUFA 1Q6GA 3ZSTA 4PYSA 5A2CA 1BQCA 1E43A 3LPGA 2CBUA 4AD2A 1GOOA 3VU2A 2DQXA 2VNCA 4PRWA 2OWWA 4AISA 3AMKA 2WK2A 1ITXA 3WUFA 1O6IA 2VZOA 4BS0A 3BMVA 1IZJA 4D1IA 1WNOA 4OBRA 5ABGA 1JZ4A 1MVYA 2YIHA 3AZRA 3VIPA 1ISVA 2V3EA 1UWSA 4HU0A 4CUCA 3WIJA 3WFZA 2ZXAA 3BLPX 5BROA 1VJSA 2V3GA 3RO8A 4BA0A 2E40A 1HJVA 2WMJA 3W29A 1E6SM 3VD9A 1MQRA 1E5JA 1CYGA 1US2A 1GZJA 5A94A 4GPNA 3WDRA 1TCMA 3SUSA 2XFYA 2FDMA 4KMQA 4GIAA 3EBVA 1OGBA 2PBGA 1VFFA 1H3GA 4OUEA 4PUDA 1ITCA 1V6UA 3VO0A 3CUGA 4PN2A 5I24A 1DEDA 3VDAA 1H41A 4RE4A 4MPKA 3RCNA 2FHCA 3D5HA 1HJWA 1KQYA 4W84A 3OBAA 4F8XA 3IJ7A 4GKLA 3ZJ7A 3UETA 4MNMA 4CCDA 3PZVA 1V02A 1CGYA 2GFTA 3W4RA 1QI5A 2O9RA 2W62A 3WH6A 2OSWA 4W88A 3THDA 1CWYA 4YHGA 1J11A 1Y7VA 2VJXA 3NUKA 4YN5A 3VGHA 2EPKX 1WDSA 2AMGA 3CZKA 3WFLA 4F79A 1LL4A 3AS3A 3W27A 4HOWA 4UQEA 2CEQA 3BAJA 4QDMA 4TX8A 4HOZA 3ZJ6A 1UKQA 1E1EA 5A6AA 2PBOA 2VT0A 2X0YA 3CZGA 4FLOA 1UR4A 4LGXA 3SUWA 5LYRA 4GXPA 4BCEA 3EMQA 3WUGA 4MB1A 4W87A 1QPKA 1E55A 2E0PA 1GORA 1UYQA 1XHGA 2XWEA 2YDQA 2W67A 3U5UA 1OB0A 2BHYA 1W1TA 1MYRA 4D6IA 1HP4A 3NCOA 4AD1A 3VNZA 2B31A 1VBUA 3AHTA 1E73M 3SCPA 1E6ZA 2YDRA 2ZX9A 2CYGA 3EYPA 2PWGA 8A3HA 3L4VA 3PZGA 3EDEA 1KXTA 4R27A 3ZJKA 1UR8A 4U31A 5JBDA 4MDOA 4DWSA 1E9LA 2D1ZA 4IUGA 5DMYA 3FAXA 1W9DM 4V27A 5FKYA 5IFPA 2EPOA 5FD0A 2WMIA 1J9YA 4XZWA 4AZIA 1CLXA 2WSKA 1HJQA 1VFUA 4PMXA 1B3ZA 3PZOA 4CGTA 5CQ1A 2VX7A 3ARPA 4FLRA 4NI3A 3AISA 4GI9A 4D71A 5I3DA 2ZUWA 4P8UA 4GI8A 3DYPA 3POHA 1E4IA 1R8LA 1E1FA 2PI6A 3OGSA 1E71M 3DC0A 3AIBA 4EKJA 1B9ZA 4DWSB 2ZX5A 1W9VA 4TX6A 4XX6A 3SCTA 1E0WA 2WKLA 3PBGA 3POCA 1GQJA 3WF3A 2X8RA 4CVUA 3T2QA 4PCTA 3EMZA 3TONA 5A6KA 1LLOA 1XRVA 1EXPA 2ZUNA 1BYAA 3AS0A 3HU7A 1JAEA 3U57A 1BF2A 3W38A 1MQPA 5E9AA 3IK2A 2VVNA 5EFFA 3QHNA 2WMGA 5D8WA 1OT1A 1KR1A 1TA3A 1XH0A 2PWDA 4F9JA 5ABFA 3EDKA 4J3TA 3N1AA 3PHAA 2YL9A 4PTMA 2J8GA 4W86A 3CHEA 2V38A 3TA9A 1C90A 1JF6A 2UY5A 3G6MA 3AHXA 2DIJA 5ABHA 4MJ2A 3AXHA 3KL3A 1V6WA 2YA1A 3UESA 4P7OA 1QNRA 1NQ6A 2BVDA 3ZR5A 3AHYA 5E70A 2YBTA 3OA5A 3TTOA 5D9MA 7CGTA 3VGFA 2GK1A 2EQDA 2W61A 2DSUA 2BY1A 4M81A 5ABFB 3VOCA 3AROA 5A6BA 3FN9A 3ZSSA 5E0FA 2WZEA 3VDHA 1CXKA 1G1YA 2X1IA 3M07A 2BV9A 2YDSA 5BXSA 2G4FA 1OCQA 1UH3A 3SCWA 1R85A 3PZQA 4WF7A 1KCLA 5A6MA 4WJXA 4AYSA 4TVUA 4IM4A 3AMLA 1ISWA 1V3HA 2YL5A 1PX4A 1V3LA 4UR9A 2XVPA 2XGIA 5JIWA 2O9PA 1CGTA 4AZ5A 1J0KA 2WVUA 3T0AA 4QCFA 4V2XA 3VD3A 3A4AA 4J3UA 2CETA 3SCVA 4QLKA 4U2ZA 3F5JA 3VKKA 1B90A 3LPFA 4Y7EA 4B9YA 4ZE5A 1AQMA 2JFEX 3PTMA 2J25A 4B9ZA 1PJ9A 4AMCA 1UZ4A 3FW6A 5AY7A 1QBBA 1E3ZA 1KBKA 1NWSA 3BAIA 3L4WA 4TTGA 2Y24A 4HP5A 5CG0A 4YPJA 1UA3A 2Y5EA 1NWUA 1TFVA 1GOQA 1J0IA 3BLKA 1KXHA 1ZBVA 3ARVA 4ACYA 4ZXLA 3ARUA 2VX6A 3PZ9A 2JEPA 1B3VA 2VQTA 1PEZA 4HMDA 3N18A 4NZCA 4M82A 1B3WA 3SIMA 2E9MA 4A4AA 2BXZA 3CBWA 5HOSA 2UWFA 2FH6A 2JF6A 2IXVA 1E0VA 2XIBA 4UNIA 2WAGA 1FHDA 4JCLA 4KH2A 1GOIA 2O9TA 2G41A 3VGGA 1QNPA 1EO5A 4U2YA 2DPEA 2XM1A 3LPPA 5A8QA 4WK9A 3CMJA 4UFLA 1DWIM 4GO9A 4PMVA 3N12A 1HL8A 4D72A 2FGZA 4DM2A 4HZ7A 4XUYA 1JYVA 3GTNA 5CPTA 5A8MA 4D6GA 3BCFA 2BVYA 5GNZA 1NWTA 4F9DA 1GJWA 5A95A 5BCAA 5E09A 3MO4A 4MNKA 4W93A 2EBNA 3K8KA 2YA2A 3VMOA 3CTTA 5A8PA 1X6NA 1M03A 5BYWA 3EDJA 3ARTA 3AYRA 3WDPP 1XV8A 5DF0A 3WD3A 4D6CA 4AZBA 5LA1A 2OLHA 4FLSA 3VX1A 1HNYA 2OYMA 3U7BA 2BHZA 2XSAA 2VRQA 1KQZA 3RM8A 4DWSC 1TVNA 2J47A 2VL4A 4OOUA 2YJQA 3BGAA 1UR9A 5I78A 5HXMA 1DP0A 1W9XA 4M24A 5TD4A 3FHQA 2E9LA 4UFJA 4U33A 6CGTA 3RM4A 4AWEA 1E4MM 5AC4A 1CXFA 5A6LA 4RE3A 3MMWA 2ZUUA 1QNSA 5HBFA 4M1RA 4W7VA 3WD1A 3NDZA 1KFWA 1MFUA 2WM0A 1ZS2A 4TVDA 2EPMX 5JBEA 3GYCA 2WHKA 1XYFA 2VR4A 4PMNA 3TP4A 2D22A 1UUQA 2BS9A 3AIQA 1HKIA 2RGLA 1UKTA 2NW0A 3WNLA 3WEMA 1JYWA 1JFXA 2WXDM 3AYSA 3WDIA 1E6NA 5CSYA 1ZB5A 1EQCA 3O2LA 1LWHA 3WQ8A 3BAWA 3WDHA 4C7FA 1UQYA 2XIIA 3NJ3A 2YOCA 1HKKA 1Z32X 3F5LA 3F5KA 3U7VA 3GBDA 3AXIA 4PTWA 4B16A 1HT6A 1XH2A 1OIFA 3BC9A 2Z1KA 3UR8A 1UD4A 5A8OA 1WZLA 5A1AA 1H11A 4MADA 1GOKA 1CXEA 4PMYA 1EOKA 3NYDA 1XD1A 4JHOA 2VCCA 2ZX7A 1C8YA 1WDRA 5CJ5A 1I1XA 5M3WA 1FHLA 1E5NA 4MB5A 2QHAA 2ZUMA 4FF5A 4OJYA 2WMKA 1J0YA 2J7EA 5DFAA 4W89A 4GINA 1JDDA 2OWCA 3WKZA 3AMCA 3SUVA 4JIEA 3I3DA 1V3KA 4JKKA 1KXQA 1ISXA 4MB3A 4W85A 3AIVA 3GXMA 2J7CA 2ZXBA 3T09A 1O7AA 3K8LA 1NP0A 4CU7A 1X6LA 3WN6A 4JL1A 5FIPA 3MV11 1JGIA 4QCEA 1PPIA 1CXHA 2XGBA 3WNMA 1JI1A 1R7AA 2VZSA 3ZT5A 5HPCA 1C91A 3AQUA 4AEFA 3MKKA 3W37A 2DGAA 3W26A 1VJZA 2ZWYA 3WQ6A 5FL1A 3KZSA 1L8NA 1NH6A 5A8NA 5IXEA 1E72M 4DUWA 4HA3A 2C0HA 4H04A 1GONA 2BY0A 1TMQA 4KRTA 4YHEA 1QOXA 3BCDA 1HVQA 2NT1A 4DM1A 1CNVA 2A3EA 1VEPA 3WH5A 2G3IA 1Q6DA 2J75A 3MMDA 3AZTA 1W1PA 1CGXA 4M56A 1CTNA 3FY1A 1P6WA 1GQLA 1CENA 5FL0A 3S2CA 4AZCA 5BRPA 3OIHA 3SCUA 4AC1X 1J18A 3SCOA 1H49A 2YLLA 1SMAA 3T0BA 1HN1A 4C7DA 3TTQA 1KGXA 4E4PA 1DWAM 1GW1A 1TR1A 2WCAA 2FHBA 3UG4A 1M7XA 1Q4NX 1XCXA 4PMQA 2CERA 1LL6A 1MW1A 3TOPA 3T2PA 3VDCA 1K9DA 3OLEA 4B15A 2VZUA 2DT2A 2XTKA 3OLDA 3ZR6A 4PMUA 3CPUA 1FOBA 2F2HA 2WC3A 1BPLB 1HVXA 3A6OA 4AZCB 2CIPA 1RD6A 5A6SA 2Y2WA 3OGRA 1MW2A 5A69A 2EJ1A 1J12A 4CU8A 4HOXA 4CVWA 2HVMA 3BAKA 3CLWA 3KEHA 4HA1A 1KCKA 3WMCA 1NOFA 4J3VA 2J4GA 4PCSA 4FMVA 2Y4SA 3MSDA 3L4XA 1IV8A 1BHGA 4LX4A 1UKOA 3VX0A 4DUVA 3WF0A 2V5DA 5HDRA 3RILA 2DT0A 1V02E 4AZ7A 1FH8A 1CGUA 1RH9A 2VO5A 9CGTA 2QMJA 3WDJA 3K4AA 4AZHA 3AI0A 5HPOA 1U30A 1OT2A 4A3HA 2WHMA 1MFVA 2DSKA 3K46A 2QV4A 3DYOA 4EANA 1WZAA 1HJUA 5D8ZA 2ZWZA 1VBRA 1NP2A 3A3HA 1KGUA 1K6AA 3S6TA 5A6JA 3UERA 1V6YA 2DH3A 2J8FA 1KWKA 1WZKA 3OZPA 1VEOA 4J3XA 3U5YA 3UEQA 1E0XA 3WEZA 4WKHA 5BXPA 4B3KA 2VI0A 2YL8A 1CXLA 1XH1A 4U5KA 1BAGA 2ZUTA 1S46A 1M04A 1BYBA 2WC4A 2XJ7A 4PMOA 4P7QA 3GNOA 1JZ6A 2GDUA 4Z2HA 1N82A 1DWJM 2CBIA 3RJYA 1CEOA 1W9BM 4U3AA 3A4WA 3VGEA 3ZO9A 1H1NA 3BMWA 3VGDA 1FFRA 2X09A 2J7GA 2ZX6A 4MTVA 2D0FA 1JYNA 4CN4A 5I5RA 1G0CA 2G8ZA 3ZQ9A 1EQPA 1KB3A 4UFHA 3MUY1 5EMYA 2XFRA 3N9KA 4D6HA 3A4XA 4UFMA 4JL2A 2VX4A 3PZUA 4UQBA 1HIZA 3THCA 4JHZA 1V0KA 4UFIA 2NSXA 1GQIA 2XVGA 4ACZA 1W32A 4AW7A 3WQWA 3PZTA 1E4NA 4LPCA 5A2AA 2WHJA 3BSHA 5JUVA 3ARSA 1PZ2A 4WKFA 3WBAA 2XVKA 3M46A 1E40A 4KGLA 3HN3A 4GI6A 4X0VA 1Q6EA 2VOTA 5CGMA 1JDCA 2J7FA 3PN8A 2WKGA 1LWJA 4ATWA 1GPFA 5GQBA 6TAAA 1J01A 4JCMA 4JFVA 4P8WA 1FH7A 1KXVA 5C70A 1QNQA 5HNNA 1J0HA 4ACZB 4JKMA 3ZMRA 3AIWA 4JFSA 4E8DA 3NDYA 3WSUA 2CKSA 1QVBA 1PAMA 1K9TA 5EB8A 1X1NA 1CPUA 1XGZA 4CN6A 2F8QA 1I1WA 3VIIA 2XVNA 4UQ9A 3IJ9A 1ECEA 1JZ5A 3CHFA 3N11A 2UY2A 2DH2A 1G94A 1OGGA 3VPLA 1E3XA 3CMGA 3HMCA 4X9YA 4CU6A 2XUCA 1G5AA 1HX0A 1LL7A 3NSNA 2WBKA 2ZUSA 2HISA 1UZ1A 1QW8A 4IPLA 4D1JA 3CO4A 3SUUA 2D2OA 3VINA 4CN1A 4D6DA 2BNJA 2MANA 3VD5A 3VM5A 4E2OA 3L2LA 4KWUA 4HA4A 1SFSA 4WSJA 2E9BA 3CUIA 2ESCA 3VM7A 1EDTA 2EEXA 4FLQA 5IHSA 2ZUVA 1F4HA 1GHSA 1BSIA 1ZBKA 2E8ZA 3CUJA 1XD0A 3L4ZA 1EOMA 2JF7A 2WVTA 4LQ1A 3GM8A 3WL1A 1LG2A 1EHAA 4A3YA 2XM2A 4PBGA 2YBUA 2A3CA 1E70M 4J7RA 2CBJA 2O92A 5CZKA 2EO7A 4XZBA 4UZSA 1D3CA 2BFGA 4QP0A 1VIWA 3CZJA 4MJ4A 2VX5A 3GZAA 1H5VA 2WZIA 1EH9A 4DWSD 2YL6A 4M29A 1UD5A 3DHUA 2CCRA 4WLCA 4AY1A 3N15A 4MNLA 1J0JA 4GZEA 2XG9A 1BG4A 4KRUA 4WKAA 1QI2A 3VIHA 1W9PA 1B30A 3GNRA 3D3AA 5GNYA 5CPQA 3WY1A 3VD7A 4LYQA 1NM9A 1Q6CA 3KL0A 2VTFA 4WSKA 1WDQA 2XVLA 3CIVA 5D9OA 5DO8A 2NT0A 1UD3A 1R86A 5FCZA 4MAVA 3SCQA 1VFMA 1FFQA 1QHZA 2X2YA 3OG2A 3WF1A 3N04A 4MAZA 2WBGA 5I79A 3UG5A 3MSGA
chains in the Genus database with same CATH superfamily
2UY4A 1X8FA 1ISZA 3OHMB 1NAFA 1FJGT 1VPQA 3PSWA 3UG8A 3CZEA 1AH3A 1JZ7A 4LFYA 3TWBA 2WZHA 1LRZA 3OLIA 4N2YA 3UG3A 4BZYA 4NYYA 1VCGA 2V5JA 4DAIA 4MPQA 1ZZMA 4DR3T 4S3KA 4V28A 4AQGA 1ZKEA 1WO2A 3ATZA 3RO6A 4MJMA 3TSMA 2LJLA 4YT0A 4HMCA 4UQAA 1OEDA 4YS1A 2O4MA 1N2VA 1Q45A 2PWUA 3M1ZA 2IUBA 3PUEA 3AWNA 3KV9A 2VEKA 3GNPA 2GUBA 4UWMA 3C6CA 4P8XA 4WZHA 5IWAT 4DJDC 4P1NA 3LRLA 2O55A 4CI2B 3W73A 1VR6A 2WMHA 4B2DA 4NQ1A 3QGVA 1UA7A 3NZGA 8CGTA 2DUXA 1S5NA 3EWDA 4HA0A 2J7HA 4LB4A 2BOFX 3UUMA 1FHUA 1UR0A 1OFBA 1KEYA 4PTXA 3UXDA 2DSVA 2XZEA 4U28A 3T05A 2IS7A 1VIZA 2EHOA 3TQPA 4I8DA 3WH9A 3SUTA 3FAWA 4PTVA 3WQ4A 4EAMA 1OWQA 1EZ3A 1HJXA 3SBFA 2V2HA 4O16A 1DXEA 4ENLA 5AQTB 4JQAA 5JMUA 3O0FA 2ZCGA 1H1YA 2Z24A 3IJ8A 1R3QA 2WJEA 5AYZA 3NSMA 3NPVA 1CGVA 3W1LA 3TJXA 4QE4A 2GSEA 2YDAA 3N9QA 5BOEA 4M19A 2WP9A 1JCXA 1V3MA 3WLNA 4AXNA 2ZVIA 3KS6A 1R3TA 1ONRA 3GYEA 4GQQA 1V9DA 2G0UA 4J28A 2PB1A 4MYXA 4MDPA 2UZ9A 3J7HA 1EUNA 3T1HT 4EXBA 2HPLA 1IBLT 1Q2SA 3W23A 2VRKA 4HPHA 1L6SA 4OGZA 1AZ2A 3MCOA 3PFMA 2PDMA 3BTNA 2NOXA 4XBSA 4YWIA 4GJIA 3TCEA 3ARZA 4ZI2C 1IT0A 4WY0F 4TVCA 4Q6XA 1XJBA 1FH9A 2V3DA 3DI1A 3MHUA 4EK7A 2FGLA 4UF0A 2ZRUA 3QOKA 2XY8B 4A2SA 3EEGA 1GVRA 1SO4A 3AMDA 4DR4T 3R11A 1Z6KA 3ARYA 3NQBA 3WNKA 3AA0B 1JQVA 2W4XA 3S1VA 3G1RA 3C0QA 3B4UA 3NQ8A 3K1DA 2Z1SA 2R1MA 3TLTA 1JIBA 4KEUA 3RLGA 4FNQA 1GUVA 3GC4A 3ITVA 3ZMVB 1EKOA 2W66A 2XQ5A 3ZJ8A 2D3LA 4GOAA 2LSGA 1V6XA 3FJNA 1DXIA 4QAWA 2WW5A 3N73A 4FIQA 2PDHA 3N2BA 1XG4A 5FF3A 4HWCA 2P9BA 1C8QA 1W1ZA 2E28A 4UVCB 5GPRA 1KBBA 2DU2A 2LHRA 1XZYA 2DVTA 3QPEA 1E7PA 3BLIA 2Y61A 5J1GA 4A05A 3HR0A 1VYPX 4O1AA 4UV9B 3ZPOA 1X7FA 4NZ5A 5FOOA 3F57A 1S2TA 1UG6A 1PL9A 3VVGA 3ZT7A 2FHFA 3MS8A 4Z08A 3N13A 1W1IE 4IMDA 2E8YA 4R5EA 5CC5A 3T8QA 4Q8QA 4JIRA 4YTSA 3KE0A 2QPXA 1LJYA 2V5CA 3NVOA 1Z69A 3R84B 5FP3A 4JIIX 3AIUA 4Z2LA 1C9WA 2PWEA 1EZWA 3QV7A 1NWMX 5HINA 3LV6A 5G2IA 4HJFA 3B9EA 4DR2T 1XYCA 2V26A 2XWDA 5DJQC 2M67A 1VZWA 4P61A 4N02A 3WNNA 2GWGA 1IEXA 2VQFT 1YKEB 3KDSE 1PBGA 4H9SE 2OYLA 2AGTA 3ANVA 4ICMA 1UR1A 1EX5A 2PTYA 4ORMA 2OV9A 2JEQA 3K5XA 3AFBA 1OCBA 1XNQT 1UD2A 5C71A 2ISVA 1ZNNA 5D2VA 5D9NA 3BQ5A 4GNVA 4PJMA 1S2CA 4ZOCA 2PC8A 3UGVA 4C6DA 2PFVA 5LYJE 2J9ZA 1ICSA 1T0OA 1EYWA 1UWRA 4IFKA 4WDTA 3P80A 2E68A 2Z1XA 3DP7A 2XSXA 3IV3A 3NSXA 2QCMA 2C7FA 4DAFA 5CCZA 4HHHA 4A5XA 4W7WA 3RYCE 4KMCA 3FZFB 2XQ6A 2KLQA 2BHUA 4KGJA 4NHVA 3PS7A 1QFEA 5BOFA 5LA2A 3SR7A 1JPDX 1UWAA 1XLMA 5D03A 1E1HB 2BSLA 5I3HA 2X0HA 1A5UA 1QNOA 2WWVA 1QOQA 4LS1A 1POJA 3TN4A 2YYUA 1O12A 1OEDC 2CHOA 4BQ5A 4QJ1A 3MJMA 4X66T 1GZ1A 2HE5A 3H70A 4LC6A 4D9PA 1OYCA 5AYBA 3LEPA 3R5EA 2V82A 2CPUA 2WNWA 3VIOA 1WXZA 3GRIA 1XC4A 3VNLA 2KAUC 4U72A 4HNCA 5PTDA 2Y8KA 4PZVA 2A3BA 2ZZ2A 3GDBA 1RP9A 4LUSA 3TAKA 4B5TA 4GH1A 3S42A 4DYJA 3FNDA 3RJXA 1V5XA 5DCBA 1H0GA 4E7SA 1EJWC 1DQXA 2WVVA 3NO3A 1E15A 2EHOC 3PPHA 1MEHA 1UH4A 3G24A 1SW7A 3IEEA 1D1CA 1WDPA 1UOZA 4C6JA 1BGAA 3A3XA 4UTFA 5FJTA 5LHGB 1GVYA 3A5VA 2VFFA 3UJFA 1JXKA 4NX5A 2Q71A 4ZB0A 4MG4A 1WPCA 1T41A 2QRXA 3APTA 4F0RA 3VD4A 3KP1A 2VC5A 2A5HA 1TA3B 2C0AA 4O57A 4G5DA 2QXWA 4B5WA 4DZ5A 4DO5A 5IRPA 3RIUA 1QHPA 2W0UA 4WXZA 1LDCA 3WMSA 3MBDA 4Q22A 3DFQA 4H63H 4RE2A 4YWSA 3B8SA 3W7QA 3BV4A 2V1DB 5FVLA 2JQXA 4WNKA 5CKSA 3GE7A 1XKJA 3N6HA 1H2JA 2XPKA 3VNMA 4DLFA 4H8UA 1HQTA 3DN5A 5E0CA 4JUYA 3T8OA 3L2IA 5K4ZA 2QPUA 3UA3A 3N29A 4JHMA 4MB4A 2HCVA 2QCLA 2FB2A 4BQ2A 3QZEA 1HTJF 3F1QA 2B81A 2D9DA 4LALA 4W7UA 3BH4A 1JZ3A 1D3HA 4UOZA 4X60A 1XSKA 1F76A 4CQIA 1S2VA 3L2MA 3MJXA 2J77A 4KWSA 4A98A 1NOWA 1UBPC 4XAFA 4AEEA 4KHZF 1IWPA 3TE9A 6REQB 4AWSA 1DWGM 3LMZA 3QHMA 3RHGA 2GK9A 2OLAA 4WCJA 5A6TC 3L5LA 4RJEA 2EXOA 1KNZA 4IUOA 3ZT6A 3F2DA 1YBQB 2DV0A 1H7RA 1C3FA 2DZBA 4GIYA 5K7JA 4UOJA 3CLMA 4LYPA 2H7VC 1KWGA 2WJFA 3QQ0A 3W1UA 3MC5A 1YNPA 1TV4A 4V15A 4BR1A 2G37A 4AIUA 4N42A 4RW5A 1OD8A 2LSIA 5KINA 4Q8OA 3SCRA 2INEA 3OZYA 3IVSA 5DX7A 3CGTA 1MMGA 4UELA 4MWAD 4IIFA 3OZOA 3PJWA 1L6FA 3G2GA 4CD5A 1H0IA 3F4VA 3SY8A 2DLRA 2WLYA 1LBFA 1I0BA 5BZAA 1C8XA 1A3HA 1IIGA 1S35A 1O60A 3O6YX 5J5RA 1D3GA 3FEQA 2WWDA 3DESA 4FR1A 1GVOA 7REQA 1Q7QA 3LLXA 4GNJA 1OSEA 2BS4A 2E6FA 4GKKT 4OV9A 3PU3A 2JE8A 4BJNA 3D6NA 2HPMA 3CX8B 4QJ3B 4JYDA 3RGLA 5KETA 3CMLA 1EXBA 3EPOA 2XSBA 1UOKA 4JZ5A 1KNWA 2ZX8A 3G1VA 4ZZ9A 1UH2A 5G5IA 3SCNA 2Q8XA 2XN2A 3O1HA 2VKHA 3W81A 1CHUA 2ZZ6A 2PWFA 4DJDD 3GR7A 3U48A 5E6ZA 1JCJA 4ATLA 2LKGA 1UWTA 4DO0A 3CUZA 1W2VA 3E0FA 3O9XA 3H55A 4IMAA 1AQHA 3TKFA 3LLDA 2DI4A 1JF5A 3T07A 2SPCA 1HTIA 5F8PA 4UTWA 3LTSA 4RLIA 3UZXA 1EA9C 3AIEA 3QLDA 1XW8A 3NQFA 1NAL1 2D0GA 3EMCA 4QHRA 1JG9A 2E5CA 4LAMA 2HN1A 1C7SA 3AE7A 2DT3A 4HB7A 3UCQA 2XFFA 2CNCA 3VCRA 1VP5A 4AIOA 4QS6A 1BYCA 2YU1A 1UASA 1FCUA 3GDTA 2QDEA 2QJGA 5DEZA 3BOXA 1K6WA 4HWIB 2H6RA 4MFEA 3PUOA 4AIEA 3P4SA 3CV7A 3SB0A 2ADAA 5CXPA 1EZ2A 1UWUA 3LCLA 5CZTA 3OTRA 3BJTA 1IT7A 3FZHB 4TU1A 4ZI2D 2YA0A 3VZZA 3E6EA 4GC3A 1FWAC 5HXHA 4LV9A 4QWNB 4KT2A 1JULA 2A3LA 1OG0A 1TUXA 2EG8A 4RZ6A 3AU6A 3TYBA 3P4PA 2B0MA 4NU7A 3STCA 3UU6A 2ONEA 4LF4T 1QPRA 4Q8NA 1XBXA 1BWLA 4K1GA 5LGZA 5HCJA 2J62A 4B92A 3VMPA 3T4WA 1GG0A 4ECLA 5LHIB 2VRJA 2C15A 3K1GA 4S3CA 4NSBA 2RDWA 4DJED 3PR2A 2JGYA 1RJRA 4A21A 3V0TA 2OJPA 1LQ0A 4YVVA 3R0KA 1Q8JA 3BCJA 2CPTA 4MALA 3CHCA 5AFUL 2G3JA 2R9RA 3L5MA 1IF2A 1Q6GA 3RIUC 3GHUA 1QJWA 3ZSTA 2PGEA 5A2CA 1E43A 2CBUA 3E0VA 3ORWA 2N1GA 1W3IA 4L9XA 1GOOA 2X1TA 4DUZT 2DQXA 4IDZA 4PRWA 3XIMA 3AMKA 2WK2A 2DJXA 3WUFA 4BS0A 3OQ8A 1IZJA 1ZAHA 5ABGA 2YIHA 1X6UA 4IDQA 2E77A 5HQLA 2C1IA 2VGBA 1OJXA 3WFZA 4ILUA 1F6YA 1F3EA 2PDUA 4BFAA 4KCVA 1MNSA 1M65A 1CLKA 3E5PA 1GZJA 3WK1A 3T0CA 4J9JA 3WDRA 1FMVA 1TCMA 3SUSA 1ECQA 2E6AA 2V6YA 2FDMA 4KMQA 1T40A 1F61A 4Y9AA 1J4EA 2HDJA 2GJNA 2PBGA 3H24A 1V8EA 2Z7GA 1N55A 2H3BA 1F6KA 4GIEA 2PDBA 2OA5A 3VCCA 3VDAA 4AHQA 4S38A 2I17A 4XZMX 1MRQA 3N9SA 2X7VA 1KM0A 3P3BA 5H8UA 1YQ4A 3C64A 4AF0A 5L2LA 4DN1A 1FY6A 3UZYA 4W84A 2ISFA 4YMZA 4F8XA 3HM7A 1FWEC 4WBOA 4ASTA 4MSSA 4RK8A 3HJZA 4CCDA 3AE1A 4RE0A 4G56A 1XLKA 1RCOB 2PLKA 1V02A 3PSVA 1CGYA 2GFTA 1LM1A 2O9RA 5KX5E 1KRCC 5FF2A 1K4HA 3W85A 4W88A 3THDA 1Z9AA 4ALDA 5J8LA 1DORA 3HA1A 5HMSA 4N4PA 2ASHA 1Q3NA 3IARA 3M4HA 5F4WA 4HOWA 4PFMA 3BLEA 5L3CB 4UQEA 4XUGA 1QUUA 1U1HA 3CZGA 3GNDA 4JI5T 3ZS4A 4LGXA 4AQLA 1ZSXA 3WUGA 5CAKA 4MM1A 1LLZA 4W87A 1KW1A 3R2GA 4GXMA 3TIMA 1GORA 2YSWA 4FJOA 1UYQA 1XHGA 4LBRA 2YDQA 4F8HA 1W1TA 4PMJA 1HP4A 4U7IA 1DQWA 4F0HA 3VNZA 4KEVA 1E73M 5XIMA 2PEVA 3RNDA 8A3HA 1DJZA 4UIGA 3EDEA 3N2KE 2I16A 1FWIC 1AW1A 3H54A 3ZJKA 4U31A 5JBDA 1N7KA 2R94A 3LI0A 4O4WA 2QW5A 4B2DD 4CNTA 5IFPA 4ERIA 2N9DA 8XIAA 4XZWA 1CLXA 4BF5A 2KMFA 4L9IA 1VFUA 4PMXA 1B3ZA 3PZOA 4UTWC 3KHJA 1I2NA 3CIRA 2AXDS 1ZP3A 4FLRA 2YW3A 1FWCC 3SQSA 4A56A 2EHOD 5HAXA 2V8ZA 2WY2A 3STPA 3H22A 2UXCT 2PI6A 4IICA 3W7OA 3AIBA 3HURA 1TVLA 2INZA 3CQCB 2YCKX 4TWDA 1V79A 1LT8A 1CB7B 5AQNB 3RAOA 2GQ9A 4RV8A 3PULA 2ZRZA 2NVAA 2X8RA 4MHBA 4PCTA 1VLIA 3A21A 2ACXA 5A6KA 3H37A 1VLWA 3K2GA 4QROA 4K8EA 1V77A 3WJYA 4AC7C 1MQPA 3E2QA 3W38A 4HWDA 3IK2A 5EFFA 3S9ZA 3QHNA 2WMGA 1KR1A 4F9JA 2QCFA 4J3TA 4PTMA 1Y8BA 3LTPA 4W86A 4QQUA 2V38A 5AQJB 2UY5A 1G7VA 3G6MA 3P14A 2IDOB 1K03A 3TTEA 1UUOA 1GKPA 3WLSA 3A7MA 1P7TB 1KKRA 2BDEA 2VM8A 3I0OA 3B5MA 2YA1A 4FSAA 3FEMA 3GDMA 3NRXA 4LFCT 4P7OA 3DFOA 4HN4A 1BXBA 1JDFA 4HNVA 2BVDA 1XDJA 3RITA 2YBTA 3EPNA 3OA5A 4IH3A 3NZQA 5FEPA 4HYVA 1OF8A 3ZYLA 4YTPA 2I1OA 4DPPA 3HPAA 1SUMB 2ZQ0A 5ABFB 2QJHA 2PA6A 4KFPA 6ALDA 1JUEA 5A6BA 3XINA 5CPMA 3ZSSA 1O95A 1PDYA 2I9EA 4H9ZA 4JXCA 2BV9A 2YDSA 4KHPT 1FWRA 1Z3NA 3SCWA 3VNJA 1R85A 3EABA 1KCLA 5A6MA 4WJXA 3LSBA 4QX8B 3NPXA 3LK2B 4I7VA 1XP3A 4UR9A 2BBFA 1PVNA 1YADA 2CLEA 2NW8A 3P81A 4J2CA 4AZ5A 2BBHA 2WVUA 2HQAA 4DV2T 3P62A 1SO5A 5FAJA 2V63A 3BUVA 3NEHA 3FXDB 1FUYA 4J3UA 3H53A 2CETA 3L65A 4ZO7A 3F5JA 1SPQA 3VKKA 5HANA 4CQ9A 4AXPA 2QJMA 4FX8A 4ZE5A 2JFEX 4R33A 1JR1A 5JQ9A 3E0WA 2PUZA 2FJDA 1NWSA 1IJ6A 3ZKRA 3NAVA 2Y24A 3BW4A 4HP5A 3RR4A 5EMUA 1TFVA 1OABA 5CBJA 4K7YA 3K3OA 2VFDA 4ZO9A 2ATMA 1GVEA 3BLKA 4LEQA 1N34T 1DJHA 3RLVA 3W7HA 4ACYA 3ARUA 1V93A 4HHLA 5K4XA 2VX6A 2VGFA 1EC9A 3CXOA 1PEZA 2JJ9A 4HMDA 1OFRA 3KX6A 1O4UA 4GYSA 3TW9A 1OHLA 4XBJA 1JNZA 2BXZA 1I60A 4RXFA 4A4AA 3PNZA 2IXVA 1R2SA 3M9YA 2ICSA 1Q66A 3KW3A 3HOJA 5AQVB 3LQGA 4C5ZA 1XNRT 3EHZA 3R8RA 4J2PA 2G41A 3MUCA 2TYSA 3LTYA 3O15A 4E8GA 1VRDA 1QT1A 1VRBA 3CMJA 1DWIM 3CPRA 2F6KA 2FGZA 4HZ7A 3RC8A 9XIAA 4D6GA 4QQ3A 4MKVA 2PDPA 1ADDA 3C4XA 3NRYA 4F9DA 1GJWA 2QUUA 5E09A 5AQKB 3MO4A 2EBNA 3LXAA 4GYKA 2UUCT 3NQGA 3CTTA 5A8PA 3KINB 2E2AA 5BYWA 5FSDC 5CC7A 5FMNA 2W2UA 4I50E 2F38A 1XLDA 3T6CA 2TMDA 1V7AA 3W1QA 5LBMA 3WD3A 4JTHA 5LA1A 4IE7A 3QPZA 3E0ZA 2X0SA 1T6MA 3CNYA 3K3QC 4ICCX 1FX6A 2NV1A 2QCGA 2PRLA 4KESA 1KQZA 4KP3C 1TVNA 4DPQA 4H9VA 1T7LA 4MBQA 1GVSA 3QN3A 1LOLA 4M24A 3G1XA 2E9LA 4U33A 2Q3RA 5T8GA 4FX6M 3RM4A 4AWEA 3HTWA 3MMWA 2IQTA 2Y5JA 1QNSA 1BRLA 1RQEA 4N7QA 1MFUA 2WM0A 2NQHA 3AYVA 5IDZA 3WFAA 5FJRA 1RJPA 4NJHA 1Z42A 3WLIA 4GJ1A 3GG8A 4JIQA 2NV9A 2XGZA 1KBJA 1YDOA 4UTUA 4PEKA 1TUFA 3UP8A 4RNIA 2AGKA 2BS9A 4DMVA 4Q33A 4GX9A 4JTLA 3WDIA 1FWGC 5CSYA 3GS6A 1ZB5A 1EQCA 3O2LA 1EBHA 2P8BA 4GVIA 3I9WA 4HCDA 1K70A 4PC8A 1EP2A 1K8XA 3WDHA 2NW7A 3UWQA 4GUGA 4JTFA 1QOPA 2ZDSA 3OQEA 1Z32X 1G73A 3CQJA 3UY7A 3SSZA 2Y7DA 2V6AA 3GBDA 2BGNE 1OIFA 1P0KA 3EKZA 5HEHA 1GOKA 1TV8A 2AL2B 2VCCA 4FA3A 1RA0A 3WLKX 3EOSA 4K0KT 1I1XA 3W75A 3GVRA 4MB5A 3SRKA 3OPCA 1B4KA 1LQ2A 4OJYA 2KSRA 1J0YA 5L6UA 4CQ8A 2Q01A 4W89A 4GINA 4HHMA 3F2BA 4NVTA 4LJ3A 3WKZA 3AMCA 5EYWA 3CB8A 3UXLA 3GFYA 2HBXA 1KXQA 1ISXA 2PLMA 4H6QA 2ZZ7A 5M2FX 3F4NA 3MSRA 4I9TA 1KD0A 3SS1A 3U3IA 3ABXA 2J7CA 4NZFA 4RDWA 3T09A 5ADXL 2FPYA 3K8LA 1NP0A 1T96A 2A9UA 4L1WA 3URQA 2C79A 3MV11 4C1KA 4UIOA 4QCEA 3E74A 3F2CA 1KNRA 5JDHA 4E2DA 5HPCA 4YSZA 3SADA 1Z0PA 4XAZA 3W37A 1TE6A 4RR4A 3UZZA 3OVUA 3EOOA 2VQET 5CJMA 4D8AA 3UJRA 1HGWA 5IOBA 1VC4A 3EB3A 3CAQA 5A8NA 4HPJA 1REQB 1ZTVA 1E72M 1Y01A 4H01A 4NAEA 3L8RA 4CEXC 3VKHA 2A79A 1M7PA 1TMQA 2QAPA 5XINA 3NYZA 5HEOA 3BCDA 1WOBA 5GONE 4F4RA 2NT1A 3DERA 3MACA 4DM1A 1TTQA 3L5AA 4K8HA 4O50A 2K9AA 2RA1A 4IT4A 4DBEA 3WK3A 2BS3A 1EA0A 1XRTA 2R24A 1DJGA 3AZTA 3AUOA 1AJ3A 5LNVA 1CGXA 3USZA 5FJJA 1CTNA 3FY1A 1HUVA 1P6WA 4AKLA 2E9XD 1EIXA 5BRPA 3OIHA 3AEAA 1W1B1 4AC1X 4PUWA 1H49A 3ONJA 1SMAA 3KTCA 2QCCA 2RJGA 3MHGA 1AUSL 1K7XA 5KSWA 3A64A 3R79A 3KRBA 2ALRA 4M1PA 1MIYA 2TSYA 3NTYA 4G63A 3B8DA 3PJUA 2PMQA 5LZLA 1TPB1 2CERA 1J5TA 1MW1A 4MY8A 5G4WA 4B15A 1K3UA 2DT2A 3EWYA 2XTKA 1K8ZA 3OLDA 3TMQA 3SECA 2QIWA 2Q3OA 1FCBA 1FOBA 3OIXA 3P8IA 4HSNA 1HVXA 1SO3A 1FDJA 3TVAA 3EUHA 4L0RA 1WLXA 2Q6ZA 2Y0FA 2EJ1A 3FJ4A 2VHLA 1H7XA 4GQGA 4J1OA 4HOXA 3KEHA 4PCSA 1AW2A 3ZXWA 4HK7A 2VFEA 3HQOA 5LCYA 2V9DA 2X16A 5MKGB 2NWBA 1XLAA 3ZVHB 3RILA 4JN7A 4AZ7A 1DJYA 1MMNA 1FWDC 2IKGA 3E02A 3MCNA 1RH9A 2VO5A 4EAYA 2QMJA 3MWAA 2WWUA 4S3AA 3WDJA 4AG0A 3K4AA 1SFLA 4PK6A 3M0LA 3HBLA 4XKYB 3EPMA 5EU9A 4OHFA 2FJUB 4S39A 2QV4A 3DYOA 2F6XA 1WZAA 5AB3A 2QDDA 4XAXB 1KFYA 5L3GB 2DW6A 3W86A 1YTDA 3A3HA 2F9RA 3OPSA 5I7GA 3RCYA 2YZRA 3S6TA 3UERA 4GG9A 4FOJA 4LNCA 3CHVA 1VFLA 3ZMUB 1SHZC 1CXLA 3RHWA 1ZENA 4H00A 3UZ5A 1NF0A 5DY2A 3C51A 4LH8A 3FJLA 4GE8A 1E0UA 3GNOA 4DB7A 4LSBA 1JZ6A 1N82A 1ZHCA 2QUNA 1ZP0A 3LV5A 3LU2A 3QSTA 4JEQA 5HXSA 3RJYA 3PUVF 1F8IA 2KZ7B 1IWAA 5HWJA 2DUAA 1AD1A 4X2PA 4ISSA 4JTAA 1EJVC 2NQ9A 3P50A 4OQVA 5DCDA 3S2NA 3ZO9A 1LRNA 4AXKA 3UJSA 3PANA 2PP1A 1TJ2A 2KX9A 2X09A 3FIGA 1NIUA 4L1XA 2J7GA 4MYAA 1SSDA 2G8ZA 3ZQ9A 2BOGX 4PB5A 3TFXA 3MUY1 3N9KA 2XASB 5AN7A 5HJXA 4UFMA 4JL2A 2VX4A 3PZUA 4UQBA 5C8YE 3PJAA 1HIZA 3THCA 1GQEA 1V0KA 1AJ2A 4GIWA 1DVJA 2J24A 2FVMA 4LUTA 2O7QA 1N36T 3G22A 3BSHA 4WKFA 3WBAA 1TPUA 4XD6A 3LHZA 3HN3A 3PUAA 4GI6A 3HG3A 1Q6EA 2VOTA 4YTRA 3V5SA 2WKGA 4ATWA 4RZ4A 5BOOA 5GQBA 1G6CA 1NDYA 1QK0A 1S38A 1X98A 4JCMA 3M7WA 1KM5A 2IMRA 1FH7A 1KXVA 4NAFA 5HQMA 2HRWA 1HKVA 1SSGA 4RUBA 4E8DA 3WSUA 2FGBA 3ITXA 3OVGA 3B0YA 5I02A 2F8QA 4H9XA 3IUHA 2MAWA 1W54A 3VYLA 1I1WA 3VIIA 2XVNA 2DH2A 3BZJA 2EG6A 2HSAA 4FI5A 4REQB 1PYFA 1AG1O 1JQXA 4IE0A 2C14A 5JREA 1QW8A 3CO4A 4HFVA 3OHIA 4I9JA 3VINA 5HJLA 4IL0A 4WDWA 3CVRA 3W7NA 2MANA 4YJ2E 1PKLA 3B8WA 2DVXA 5AZ0A 3U3HA 2E6DA 4KWUA 3Q9DA 1H7NA 2P53A 4WSJA 1XFBA 1XRFA 4A35A 3STFA 3LBXA 4QM1A 2EEXA 3NKZA 3LCXA 5E0KA 4ZB5A 3LX9A 1GHSA 2E8ZA 3EB4A 1K8YA 3HIJA 1DKWA 3QV6A 3L4ZA 3AAIA 2E7FA 1EOMA 3B8TA 2KXPB 3LGDA 5EMKA 4EXAA 3MP4A 1XUUA 1LG2A 2XM2A 4PBGA 1LYXA 2A3CA 1OX5A 3EX1A 3KDOA 4J7RA 2CBJA 2O92A 5CZKA 1XIDA 5H8PA 2SFPA 4QP0A 4XZHA 3CZJA 2CLIA 2VX5A 3KV4A 1H5VA 2WZIA 1EH9A 4DI8A 1LVFA 1RLCL 4OFCA 4JI7T 1SFTA 2WBLA 4AY1A 4LBUA 1RALA 5DELA 3LHYA 1J96A 3NDOA 4MNLA 3T44A 2XG9A 4WKAA 1P5BA 1IR1A 3VIHA 3O1JA 2PTWA 3D3AA 4K6AA 5CPQA 3VD7A 1G4EA 1NM9A 1S2UA 3KL0A 4HFCA 4H9OC 4DHGA 3MHFA 4UMBA 1I2OA 2WU2A 2ES0A 3GU1A 2ACUA 1FRBA 2NT0A 1H7WA 3TAOA 1VOMA 4Q4RA 3E22E 4WX2A 4IE5A 4MAVA 4DR1T 5JR9C 4QG6A 3W9ZA 3SCQA 2CZEA 2LRLA 3WF1A 3N04A 3E12A 3CQKA 3KOWA 4NIRA 5I79A 4OX9T 1XUZA 3U4FA 1BXNA 5DRCA 5I09A 3ZFHA 3W1AA 2M6BA 4B5XA 3NNTA 3B9NA 4JX4A 2VCAA 4OOZA 3QHOA 3ABVA 4H8NA 3PUDA 1IIHA 3GHTA 2DZWA 3BO9A 2GYIA 3T1GA 1A50A 3UULA 4C6KA 4UTLA 2G3MA 2NR4A 5JRCB 1LZOA 4DR5T 3RLUA 4GUFA 5L3FB 1YPIA 1LT7A 2XIMA 3E1F1 1W2PA 1QW7A 5GJNA 2OGYA 3W6MA 2FVKA 2GJXA 1GEQA 3PTKA 4HGAA 2PU1A 2REQA 4Z2KA 5GNXA 3CZLA 1EUAA 2WLZA 2VC9A 5HNTA 4N0RA 4DI9A 1FP8A 4QXIA 5A6BD 3NWIA 4S3JA 2YXOA 3QYQA 3IIZA 4UNLA 2QKFA 2QGHA 1E6RA 1LG1A 3UWVA 3QLLA 3I6RA 4BY3A 5ECUA 4O1DA 3W87A 1G9HA 2CLHA 4XK2A 1OEDB 1LCOA 5I03A 3T08A 3B05A 4P7LA 1XSIA 3SURA 3WQGA 2FJEA 3R43A 1DIEA 4RXGA 3WLMA 4H8VA 2PWHA 1Z44A 5EKYA 3G6LA 3BGGA 2G95A 1GPWA 3WLTA 2MTQA 5F2GA 5G2WA 3TC7A 4O17A 4GY0A 4YVXA 2VXNA 3W82A 2AKMA 5JDMA 3WUEA 2QVHA 2RAGA 1UR2A 2VQUA 3O6CA 3M65A 2Z6IA 3U78A 3VR9A 3SFWA 3B04A 2VFIA 3PTQA 4OUIA 5DT5A 4XZNX 3AS2A 1DE5A 2EHOB 4ZQRA 1KF6A 4Q4KA 1ALDA 1BGGA 3JR2A 5A1LA 3NIYA 4AKHA 3UVIA 2PLCA 2PE4A 2PGRA 1W1A1 3VKDA 3GTIA 2FH8A 4Q4SA 3ALGA 4EOZB 3W7EA 4UVBB 4QNEA 4RZBA 4INFA 5FESA 2E5BA 4PJJA 2XYLA 5I3IA 1KK7A 1UC5A 1GNXA 4CD8A 3N25A 3UQ7A 2J78A 1HFAA 3L66A 3AXJA 1VF8A 4GUJA 3U4AA 4L4PA 1WUFA 2A3AA 3ZIZA 5HCMA 4CKQA 1ZCOA 3T1YT 3E3HA 3S5OA 1GOXA 1OX6A 3PV0F 4P2VA 2WC7A 4DR6T 1ZJBA 3EA1A 1S5MA 3Q5XA 4O14A 5F2LA 1XI3A 2VWAA 3R58A 4HU8A 2RH9A 3H2OA 3DYMA 3TTSA 2PPGA 3AUJA 5EK2A 1R87A 3VFCA 3V1PA 3K30A 2Q9QA 3MMUA 4PA8A 3LDQB 4XB3A 2BASA 3UR7A 1Q6LA 2OU4A 2OEJA 4LT9A 2PDXA 2F84A 2V3FA 3OBKA 2A0NA 3V0SA 5C9ZA 3ETVA 4UTJA 4H9TA 4UXDA 5F1VA 3WF4A 2CESA 4L5ZA 3NVTA 1TTJA 2BVTA 4EXTA 3AICA 9XIMA 3APGA 1A5AA 1S1RA 4JQ3A 4NNAA 4UEMA 2QJJA 3MUZ1 3GTXA 1B4EA 4X9SA 3W01A 3VNKA 3K4WA 4E8CA 4LY4A 1QI4A 2HXTA 4URIA 1MXGA 1TPDA 2E25A 2BY2A 2QGSA 3XISA 4PULA 5C3JA 3HGSA 3CEPA 5LA6E 4DO7A 4GUHA 3DC8A 1J8VA 1MNZA 4QDWA 3FXGA 2RGMA 1RPKA 4GHRA 4UQCA 5IHYA 4MZ8A 4Z1BA 5C2TA 2VGGA 2XISA 4B91A 2D2SA 5D9PA 3N9MA 2WVSA 1J6OA 2WMFA 2XU2A 3OU8A 2V67A 4IJCA 2Y88A 4KCWA 5CH9A 3CL8A 1MSSA 3OG3A 4Z0SA 2R1NA 3TLLA 4JQ4A 5LIKX 1XIBA 3W1RA 3WELA 4GYPA 1YXYA 2Q8ZA 1XDOA 2I56A 3VFLA 2QCDA 3ITGA 3FBZA 3M0JA 4L64A 4WZXA 1K9FA 1GQKA 1W8GA 1C93A 1VQTA 2BG9E 1IZCA 1LOQA 3O06A 4ZQMA 4GABA 3QV9A 4KPLA 5BRQA 2DCFA 1HXJA 4XG1A 4PUJA 1LRQA 3LMYA 1E6QM 5CPSA 2OT0A 4PL2A 4ZODA 2P5NA 4P0AA 1VENA 1R7OA 4FK9A 2IXUA 3MXZA 1OBAA 1PZ3A 2R91A 1SVDA 3S3GA 3ONCA 2PF0A 3PB2A 5I6SA 1UD6A 4R88A 1KGWA 4O8RA 4ZO6A 1EP3A 1WX0A 1B1YA 2JK2A 3CQHA 4JQ1A 4DZHA 3T55A 5BMWA 1GKQA 1XLHA 1AMKA 4JI1T 2NXHA 1UR3M 1JYXA 1JNEA 2WMIB 3KZPA 2GDVA 4KS0A 5KDMC 2RDUA 1RVKA 5FJPA 1U22A 4O4LE 4CLMA 2VURA 2ACRA 3AXMA 4GCAA 5C9RA 5CAHA 2ZE0A 4UTMA 3ZJ1A 1F2JA 2VEFA 3OBEA 5I00A 1UIOA 3IRDA 3TQ0A 2BLEA 3JRKA 3PZIA 4H9PC 1UPMB 2ZOXA 4Q8UA 1B3XA 4GMEA 2DEPA 4YTMA 2N2NA 1L0PA 2GGIA 4Q8PA 4TN7B 3NZ1A 1YE4A 2LRKA 3P0XA 3RH3A 3M64A 2QCEA 3E5BA 1YDYA 3UNTA 1G4SA 2NQ5A 3T0DA 6PTDA 5HEGA 4HCLA 1XWMA 5HYAA 3GDLA 5C8BB 4GA8A 3NXFA 3ARQA 1GYLA 4LUSB 5AHFA 1BSLA 2VP8A 1T98A 1KRMA 2A3HA 3PZMA 4ZB2A 5HMFA 1U5PA 1CB2A 2OO0A 1J2BA 2IW0A 3WEOA 4CEUC 3UWZA 4Q4PA 1ONWA 2AOSA 2O0TA 2WVVB 1AVAA 4X22A 3GXTA 4OK0A 2HS6A 5TF0A 2D23A 5L3BB 3BQKA 4K36A 4B3LA 3DBNA 3SGZA 1MMDA 3ZLIA 4AD5A 4DNMA 3OJGA 4N9BA 3NA8A 4W5ZA 5EBAA 2NWSA 1EDQA 3G3MA 1OY0A 3RI5A 3VAVA 1P4CA 1OZMA 4QIUA 1AH4A 1CLVA 3UBPC 5LNWA 1CX9A 3DTOA 1TJRA 3IIOA 4YCOA 4XISA 1AL8A 4Q3MA 2D3NA 4TUYE 3FDKA 3KBTA 4DIAA 4HCHA 3QC0A 5BMVE 3VDBA 3O7UA 5EL1A 3ZMZB 1NEYA 3MZ2A 1U5JA 4YL2A 3UZWA 4MUPA 4ZTYA 1DWFM 1T5AA 1MWOA 1BFNA 2Q9QC 1MZHA 2E4TA 4IL4A 3RRCA 5JIPA 4XO6A 1UP3A 3X1DA 5LHFA 3W1NA 5FY0A 3UXIA 1EC7A 3MANA 4IIGA 4JOMA 3NQ2A 3O07A 1UWIA 4TXEA 1MUMA 1GOWA 3UXAA 1YIXA 3WD4A 3BZGA 1WR0A 5E6YA 1JPMA 4ZFMA 5I06A 3SJNA 5CSUA 6A3HA 4H2HA 5A5WA 2A7NA 1BEUA 4IOTA 3L4TA 4LUYA 4W8BA 3ZMSB 5TBOA 2JALA 4UZUA 1S5VA 4O4HE 3RM9A 3U6WA 1VAHA 3GDKA 3LRMA 5I0DA 4JIHA 2PTXA 2VELA 1SR0A 2D20A 3W76A 5CJNA 3HGRA 4ONVA 1TZ9A 3AJXA 3PF3A 4WDUA 3EI0A 2GUYA 1HX1B 3ZMTB 2Q8LA 4J3ZA 2XIOA 3F03K 2OYKA 4HWFA 1VFSA 3IJIA 4US6A 2BS2A 3LD5A 1BG9A 1W3TA 2PODA 3NL2A 3VKCA 2EPNA 3IUDA 1V08A 4ZFCA 3A22A 4HK5A 1HKJA 1P0BA 2JKEA 1ZBCA 2V7MA 5REQA 1JNRA 3W28A 2XN1A 4PGLA 2CE7A 3WQDA 2V30A 3QH2A 4Q7NA 3V5FA 1RR2A 4GYPC 4JTSA 4X1IE 1TPEA 3EX4A 3ERPA 5KITA 5CLTA 1YD8G 5F4SA 4O13A 2GQAA 1V03A 3H6OA 1T7SA 1ADSA 4HKPA 1EGVA 1SYTA 4KCTA 1TRDA 4M8UA 2M6IA 5LXXA 1SZFA 3S9IA 3VDGA 4DQWA 1NQKA 2D24A 1MDLA 4UTHA 4BK9A 4NUUA 3WBYA 3DHDA 1W3KA 3MVIA 4BKNA 5LOVE 1ESWA 3ABOA 5M03A 3RGTA 3SN1A 1B0IA 3BSGA 4PUUA 3NBXX 4J27A 2ZRYA 2CM0A 1WCRA 3NO5A 2WB5A 5CLWA 1UCWA 3BK0A 5AQHB 4QR6A 4MLJA 1EDGA 4NUVA 3UJ2A 5BXRA 1V0MA 1KCXA 2A72A 1QBAA 2X9WA 4GZIA 3O3RA 1FBAA 4LAZA 5A8GA 3GFZA 1JI2A 4JY8A 4Q8TA 4E2BA 1SW3A 5LXTE 4LCRA 1C29A 3H2NA 2ZKMX 2JKPA 3BURA 4LXFA 4V1YA 3Q65A 1CI1A 4A29A 4UMAA 3THUA 1SZNA 3AIRA 5BNKA 3K1SA 3TC3A 4QGCA 1PIGA 2LT3A 1KTBA 1A5SA 4WHBA 1L2UA 1W5NA 3WH7A 4FXJA 4B3TT 5H2ZA 1YXRA 3WLQA 4MZYA 3GBEA 1IJ5A 3QR3A 1MW3A 3LGEA 1GT8A 2I59A 3CQIA 4H8HA 2Y6XA 1BR4A 1O5RA 3ISIX 5B7ZA 2PFHA 1EIBA 1PTGA 1MMAA 2AAAA 2I5GA 3PK7A 3LPGA 3M0VA 4AD2A 1YYAA 5I3GA 2VNCA 3W00A 2OWWA 2KINB 1ITXA 2ZRWA 2XFWA 4OBRA 4IXXA 2CXLA 4J35A 3C98B 2V3EA 2X1UA 4OFZA 1UWSA 4HU0A 4R7WA 3VOJA 3GG0A 2CU0A 4YJ5A 4CUCA 2V5LA 5LJNA 3WQOA 2ZXAA 3NG3A 3BLPX 1XDPA 1VJSA 2OKTA 3WLOA 3ABSA 1FKXA 3Q45A 2HPJA 1OEPA 2E40A 2NX9A 1OXZA 3CC1A 2WMJA 4LVDA 4BA0A 1KO0A 2LHNA 2V8SV 3T9PA 1PWLA 5HWNA 3LJCA 4WVXA 1CYGA 1RUSA 4M0XA 4GPNA 5TNVA 3EX2A 1VYSX 2Z1VA 3EBVA 3M47A 4ERGA 3ETUA 3Q5DA 1H3GA 4OUEA 3TEVA 1N8WA 3VA8A 1V6UA 2WS3A 1DEDA 5LHHB 4HHPA 4N6EA 3BK9A 2VEIA 2ZLYA 1X38A 3HB9A 3RCNA 3E2SA 4A2RA 1HJWA 1KQYA 5DRIA 2YK0A 3DU0A 3OBAA 3IJ7A 4GKLA 3ZLFA 3GG1A 1UMLA 3FYPA 4Z1CA 3BW3A 1ICPA 4GVFA 4ZCWA 3NPUA 4IMCA 4QAIA 2V6YB 2CLOA 3HQNA 2Y70A 4KERA 2CZFA 1Y7VA 3I4EA 3CIWA 2UXBT 5FACA 1FWFC 3TK7A 3C4ZA 3NUKA 3N2XA 3VGHA 2EPKX 4IQDA 2ZDRA 4QITA 3CZKA 2E6YA 2K3WA 3MJYA 2H3RA 3ENLA 2VUNA 1J93A 4QDMA 4TX8A 4AF0B 4FP1A 4MY1A 1UKQA 2X0YA 1UR4A 4C91A 4IPJA 5LYRA 3U2OA 4GXPA 2C18A 1QPKA 2YPIA 4EAHA 2E0PA 1OZQA 1Q4WA 5C6MA 2ODUA 3GIPA 1SW0A 3EDUA 4X2RA 3SRHA 4PW8A 1MYRA 4AY8A 3TYDA 3CK6A 1N8IA 3NCOA 3LI1A 3LHTA 2B31A 4EWND 1E6ZA 2W3ZA 3FGCB 3SY1A 2ZX9A 1UZDA 3UXKA 2ZC8A 3RPUA 1AZ1A 1OFOA 3L4VA 3OA3A 1Q65A 2Z2UA 1KXTA 2BG9B 3CAWA 4LNYA 3WLJA 5LKYA 1QDSA 5HMDA 2Z2AA 4I90A 3EEZA 4MDOA 6TIMA 2O7SA 2D1ZA 4IUGA 5DMYA 4Z1DA 1W9DM 3GA8A 5FKYA 3QTPA 3EWBX 4HU3A 4ASKA 1TJ0A 4KEZA 2ATSA 5AHMA 3I9YA 2VX7A 4GI9A 4IFOA 5HUPA 4D71A 3MSYA 3DYPA 3S4UA 1E1FA 4A8NA 3OGSA 3DC0A 3AEEA 4J5NA 2W0GA 2H88A 1HL2A 1LTDA 2TPSA 2VFHA 3GMIA 1W9VA 2ZZ5A 3E38A 3SCTA 1E0WA 3MT1A 1HKWA 4FXSA 3PBGA 4ZA0A 2B76A 1GQJA 3WF3A 1SO6A 3TONA 1EXPA 2ZUNA 1VCSA 2V7JA 1RVGA 2P76A 4NL1A 4O12A 5BW6A 5D8WA 1R3YA 1OT1A 1TA3A 3S46A 2X67A 3N1AA 4G8TA 2YL9A 2J8GA 2QF7A 1N32T 5ABHA 4JBRA 1Y64B 2QULA 1TV3A 3AXHA 3QEZA 3A4JA 5C9WA 5AHEA 1V6WA 4XD5A 2YX0A 4RX0A 4PBEA 4XZ9A 3UESA 1IXNA 2HROA 3TC6A 2DY3A 1NQ6A 4ZHQE 5E70A 1IAPA 3G1SA 4ZEYA 4E7ZA 3VGFA 2WO5A 1KM1A 1S94A 2QR6A 2Z6JA 4GJJA 3LSVA 4C90A 1SJCA 3O6DA 2FLIA 4Q8WA 2OB3A 4WJ8A 5E0FA 1NY1A 5HJYA 5D2TA 2IKHA 4I9AA 1CXKA 3IVUA 2PF8A 4KWVA 3M07A 3WLRA 5CB4E 3PZQA 2J9XA 4O1BA 1E2AA 4KFNA 3AE5A 3C3UA 2Z2BA 2Q9QD 4OHQA 3M5VA 3M16A 7PTDA 1YBQA 1W0BA 2XVPA 4EYYR 2HVNA 2XGIA 5JIWA 5E0OA 1CGTA 2QNEA 3WJXA 5FAGA 4ERAA 2R1KA 2Z00A 4V2XA 3PURA 3W3OA 2UUAT 1I2PA 4CNOA 1B90A 3MKCA 1X1OA 3STEA 2YB4A 3TDFA 4B9YA 3V36A 3C86A 9RUBA 3AWOA 1DYSA 3N9NA 2G3FA 4UUIA 4DJEA 3ES7A 3R8HA 1DHPA 4F2BA 1M3UA 4AMCA 3IK4A 2WV8A 5AY7A 1XLFA 3ITYA 1KBKA 4ZI7E 1XICA 4BI7A 3BAIA 1W37A 1TIMA 3L4WA 4WD0A 4YCPA 3ICJA 4HFBA 4MF4A 3M0HA 5CG0A 4NG3A 3LCWA 2ZTKA 1NWUA 4PH6A 2D0TA 1R3WA 1GOQA 3HKBE 1J0IA 4LMLA 4JX5A 3ARVA 1HNXT 3MTWA 2PBIA 4ZXLA 5CBIA 1BQGA 4E6MA 4JI4T 4XD3A 5C2GA 1FWTA 3N18A 4FNTA 3OBVE 5E1QA 3BSMA 2WU5A 2FH6A 4LAKA 4F40A 4DV0T 4GBDA 2WAUA 4GNKB 2FUPA 4HGXA 4E38A 1FHDA 2UXDT 3WJSA 4OWGA 3P93A 4IQLA 1YTKA 1GOIA 3RU6A 3N5LA 1QNPA 3HQPA 4U2YA 2XH2A 3GVVA 2XM1A 3LPPA 2Z1WA 4PCNA 4UFLA 1GYNA 4GO9A 1HL8A 1JYVA 4AYGA 4FIRA 4XD4A 5CPTA 3PNUA 4JTQA 1Q85A 1X39A 3KS5A 4H7ZA 5GNZA 1NWTA 1XGDA 3GKFA 3KP0A 5EBUA 1FMWA 5G1TA 1TIWA 4GRSA 2BB0A 1ZY9A 2MYSA 4UMCA 4UTKA 3ITLA 4XTIA 1OFEA 3DXIA 2CLFA 3IACA 3AYRA 1XV8A 3UCDA 4AZBA 1BTMA 3DKLA 2CZ5A 1K1DA 3VX1A 1AJZA 4PB4A 2XSAA 2VRQA 5FF4A 1PV8A 1X1ZA 3OYZA 2NLYA 4LRTA 4O28A 2VL4A 4AX6A 2VYOA 2CXFA 1UR9A 3N3TA 4H9QC 3B06A 3FHQA 1DOSA 3NWRA 4ZS3A 4ZQCA 4IZGA 4M1RA 1WXYA 1KFWA 3A3WA 5D37A 2PG8A 4DXXA 2EPMX 2FMNA 1XYFA 2VR4A 3VI2A 4PMNA 3NM3A 4AHOA 5EMMA 2OR2A 1FIOA 1RY0A 2V5BA 5MF5A 2RGLA 3CX7B 2NW0A 2WMOA 1FWJC 3GQYA 3B97A 6XIAA 5ETWA 3UWUA 2VOMA 3ESLA 2O4QA 1XPGA 1JYWA 1JFXA 4KETA 1E6NA 3H7VA 3PU8A 3GVWA 3QBUA 3QTGA 4P09A 1LWHA 3WQ8A 3AAEB 3RN6A 4DBQA 3M6YA 4MFDA 4ZZCA 3FA5A 4DZIA 3W7MA 4DY1A 4C7FA 4JNYA 4P0BA 1UQYA 2LOPA 1H7PA 1TREA 1LKXA 4DX3A 2NX1A 3NJ3A 4YYFA 2WDVA 4CXXA 3F5LA 4B5SA 1P43A 3P60A 4B3ZA 4EB6E 4B16A 1XH2A 3BC9A 1UD4A 1WZLA 5A1AA 2OFJA 1H11A 1VS1A 4MADA 1EL3A 1RPXA 4MLRA 3EGJA 4JHOA 1E9IA 1WDRA 3HG2A 5HAOA 4V33A 3LY0A 4ROPA 2WQPA 1RBOB 2LE8A 5M3WA 1FHLA 1E5NA 1ITUA 4PUNA 4Q4QA 2E5DA 2WMKA 4JTDA 1A4LA 4YHHT 3LLFA 1P48A 3TLUA 4R53A 2OEMA 4PFHA 3I6EA 4JIEA 3GWHA 3I3DA 3BOFA 3IS4A 4JKKA 3TLSA 4UR8A 1WA3A 3JS3A 4N9CA 4GBUA 2ISWA 2VWSA 3QSRA 2G0WA 3GC5A 3Q4DA 5H6HA 5HEUA 2ZXBA 1O7AA 2A1YA 4JL1A 2XQ3A 3ZYMA 1H63A 3MZNA 2VDIA 3T42A 2XGBA 1R7AA 4HN9A 1T72A 3PDYA 3EWWA 1I2QA 1Q6OA 2FZDA 3W26A 3CAKA 3UCCA 2LSKA 3NOEA 3LHWA 3KZSA 1L8NA 4GOUA 2WPBA 1EC8A 4HA3A 2DP3A 1UX4A 4IGNA 5DQPA 4YHEA 1XLBA 4BJHA 4DJEC 4LMKA 1XISA 2PJQA 3P67A 1R5YA 1CNVA 1OYAA 2WNZA 4MKNA 4IMGA 4JTEA 2ZM0A 1F3WA 3WH5A 1X79A 2BOEX 1Q6DA 3MMDA 3HV9A 3HL6A 4IL2A 5FL0A 3P84A 4LANA 1O94A 1XIMA 4NJKA 4NAEB 1J18A 1RY8A 4C1NA 1FDYA 3VZXA 1HN1A 1EB3A 4O2AE 1KGXA 1I0DA 4ILBA 1XIFA 2FHBA 4NKCA 3B8VA 2BKNA 2FVLA 4L6HA 1BWVA 4H9NC 4YXGA 2BVWA 4PMQA 4KBMB 1MI3A 4KBXA 1IEQA 4LCQA 3VDCA 1K9DA 3R6NA 1D8CA 4I7WA 5AQRB 4OE7A 3ZR6A 3VOGA 2NVCA 3A6OA 1F05A 3IGXA 3MDWA 8RUCA 1RD6A 5DXYA 4RDVA 2RKXA 1F3XA 4NNCA 3K13A 3OGRA 1OVDA 5H6QB 3W1PA 1MW2A 4LF2A 5A69A 4H9UA 3KVLA 3A8YC 4CU8A 3VK5A 4CVWA 4HA1A 4EF8A 4J3VA 2J4GA 4FMVA 2Y4SA 3MSDA 3GHRA 3L4XA 3T40A 1BHGA 3PPGA 1UKOA 3LERA 1AL7A 4KEMA 4YHJA 1W09A 3AALA 1NDWA 2DT0A 1FH8A 1XIGA 2JBMA 5DCEA 2HNHA 4AEOA 5K9DA 5HWYA 1U30A 3KWSA 4A3HA 2QUMA 2WHMA 1IGWA 3K46A 1NEKA 1GZGA 4DXKA 5D8ZA 2WSQA 3VCNA 2LSJA 1L6WA 5B80A 3QYSA 3VZYA 5IYZE 2NUWA 2DH3A 3LDVA 3FKKA 5JR9B 4N4QA 3N6JA 2V68A 3W1XA 3H4GA 2CLYC 1E0XA 3WEZA 5CFBA 2ZRVA 2CLLA 2VI0A 3P6LA 1NDVA 2RP4A 4IMEA 4M7SA 3WX7A 1N8FA 1BAGA 4AWUA 5KXJA 1S46A 1EBGA 2A4AA 1EF3A 2XJ7A 1UP2A 2GDUA 4Z2HA 1X96A 4FI4A 1WFDA 4M5PA 4FNPA 1YW0A 2QGYA 1TZZA 3MKVA 4HYRA 1W9BM 4ZOAA 1MUWA 4A97A 4C6FA 2L3LA 3R0UA 4NIQA 3R25A 3GW3A 3I7RA 3ABZA 5LNKA 2J27A 5CPNA 2ZX6A 1F7BA 4DBDA 2D0FA 1SE7A 4O54A 4CN4A 5I5RA 1J5WA 1EQPA 4JIPA 4U74A 4JD4A 1YTEA 3A4XA 2XQAA 2QS8A 3BLDA 4S23A 1P6CA 4CI1B 3FVDA 4DJFA 1GQIA 3D46A 4ACZA 5A2AA 5BRBA 3FFSA 2WHJA 2NV2A 1IGSA 3SW6A 2HJPA 4YIWA 1MIVA 3M0XA 2BP1A 4C65A 3JU2A 1M5WA 4X0VA 2Z0IA 1D7KA 1P6BA 3B8IA 2ZZ4A 5FVKA 5CGMA 3DFYA 2FQIA 4H4IA 2OLTA 2YEVC 6TAAA 1SZRA 4Y2WA 1J01A 3M3ZB 1D9EA 4DZAA 5C70A 2CEAA 2B7OA 2YCEA 4LUTB 4JFSA 1HS7A 2JRKA 1Y5XA 1F5ZA 4IJBA 2Y7GA 1QVBA 1KFBA 1Z7AA 1K9TA 3PG9A 1TX2A 3NL6A 1W6TA 3URBA 3VC5A 2DZXA 5EB8A 3LZ3A 4CN6A 3EXSA 4B6XA 4ZTXA 3UPBA 1JZ5A 2FZ8A 1A0CA 1G94A 1CT5A 1RZMA 1IEWA 4TV9E 1OGGA 4AQFA 2BG5A 3ITCA 2FTPA 3P5ZA 4X9YA 2W00A 2XUCA 3SO7A 5DN1A 5J2UE 5CG7A 1UZ1A 4NJGA 4XAPA 2VDGA 1ELSA 4NAFB 3KLLA 2AL1A 1Q7MA 4CN1A 1Q63A 2NUXA 1EJSC 2PTDA 3G1AA 4L4MA 3M0YA 3CWOX 3VM5A 3N9PA 3N9RA 3L2LA 3N9LA 2P3EA 2QCHA 1NELA 4HA4A 5JQGE 4H9MA 5JDGA 4G2AA 1HNWT 2ESCA 1AD4A 5IHSA 1F4HA 4L61A 1AFSA 3G0UA 3TQVA 2JF7A 3MPGA 2XHEB 2WVTA 3UPMA 1EHAA 4YJ3E 2Z4GA 1TV7A 1E70M 2FZBA 2VFGA 2VR2A 4GUIA 3Q2MA 1CUNA 4HNOA 3TSDA 4PJNA 4UZSA 3JAFA 2BFGA 2HH7A 4NXNT 2YXGA 3PTRB 5J0ZA 3DFHA 3AAMA 2G4JA 4CI3B 4EIWA 3NM1A 4WLCA 4EVZA 2QV5A 2RJHA 4YTNA 3GFXA 1YKHB 1BG4A 3B4YA 4KRUA 4C5YA 4HYWA 4K1WA 1LQAA 2OX4A 5LXEA 4TWFA 2OX1A 5D2XA 1W9PA 2A7RA 2XZ9A 3ELFA 4WY0A 2FMOA 4I8YA 1RBAA 2X9HA 2E9XA 4CNUA 3N19B 4C6MA 2YBVA 4C6CA 2PTFA 3H12A 5D9OA 4Y8EA 1R86A 4KCUA 3KTSA 4QNWA 3N9OA 1PB0A 1XINA 3STGA 4FB7A 4BJMA 1FFQA 1A3WA 2X2YA 3DAQA 3GW0A 3QV8A 2YW4A 1R3SA 3UZJA 4QXCB 3C3NA 5L47A 3VKAA 4IT1A 1NF7A 3IJLA 5BMXA 4ES4A 1UB3A 4NNBA 1XM3A 3AROA 5L4HA 3QC9A 3MSGA 4UCFA 1QMLA 2HNEA 5I2UA 4MY9A 1IE7C 3W53A 1OM0A 4ZXOA 1AA1B 4S3BA 4GQRA 3CIXA 5AC5A 3OEXA 1B2YA 1KLZA 1MEWA 2PGWA 2WSPA 3DI0A 2H3DA 5CZ0A 1EO7A 1JD9A 1WB0A 1QHOA 3WJWA 1LF1A 1K4GA 1JZ8A 2GQ8A 2AQVA 3WNOA 1NFGA 3M44A 1H7OA 3NEVA 3MUIA 4DF1A 2E5LT 2J88A 3PBWA 3RYSA 2AL2A 1E4LA 3C0LA 5LGTB 1RV8A 3TTYA 1F3TA 4J3WA 2A6LA 3SGUA 2WDRA 3N17A 5CZSA 3R6IA 3CUHA 2WYSA 5AHNA 2WDQA 2CITA 5G1MA 2BGQA 2PDJA 1P0NA 4CD6A 4GYJA 1OIMA 3FXYA 1VKFA 4JN8A 2XIQA 1BXCA 2CBVA 3PBVA 2YFOA 4IQEA 4JN6A 1SUXA 2VB6A 2G50A 4TNWA 3KBMA 2GJXB 3QMRA 4PMRA 4CQAA 3VOIA 1TWWA 4QEEA 2Z7KA 2REQB 1EGZA 4LVFA 1FCVA 3OB8A 3VRBA 3AE3A 4PK5A 4NF7A 1TZ7A 3QRHA 4M6VA 1TG7A 4NYUA 1MXDA 4B5UA 4NZ4A 3BQLA 3GKAA 4JFUA 3BG3A 3BWWA 1SQ7A 3TN3A 2D69A 4FHAA 4XV0A 1F4AA 3W07A 1GHRA 2QMKA 1N33T 2PU0A 4DF2A 5A2BA 4IP5A 1M53A 5FJUA 3CHDA 3DGBA 1TQXA 4BQ4A 2I14A 3MU7A 3C2EA 4RPPA 5LG3A 3P4WA 1XBZA 2P50A 1OCJA 3F7JA 3A9IA 3MMTA 2J6VA 1OFAA 1UROA 1E1CA 3W2LA 4LF8T 2ZIDA 4ZI3C 4IP7A 5D04C 2PS2A 3W7LA 3WAJA 4D6EA 1WKYA 3AVSA 4R7JA 3R0DA 2Y1HA 5LGXA 4S3FA 1XYAA 1WE5A 2DWKA 3P7IA 4NZ3A 4CXWA 2PP0A 4WIWA 2VC6A 1PX3A 3QK6A 3GLCA 3FS2A 4TV5A 4AQFC 2L9QA 4B5NA 3KHDA 4LB3A 2YOEA 1MIWA 4CD7A 3IGHX 4U5IA 4W9TA 2GOKA 3LCIA 2J7DA 4KFOA 4JFTA 1YEYA 2YCLA 4DF0A 2W5FA 3WNPA 4CNSA 2ZZ1A 1VB9A 1OK6A 5AC8A 1HW6A 4UNKA 3W7PA 4K8GA 1CIUA 4D8ZA 2DT1A 4L80A 2CXGA 3CH9A 2WM1A 1HF8A 4HZ6A 2X05A 3RG6A 4PUEA 1WBHA 3KLKA 3TNOA 1I45A 3R10A 4AVFA 4AZGA 5HXCA 3NQVA 4TZ4C 4UC5A 1XQLA 2D2HA 2GVJA 1O1ZA 3BW2A 3KBNA 2XDFA 4X5TA 3M41A 2FPVA 5MKGA 1JXJA 2HPIA 1XGEA 4L1GA 4AKGA 2OKOA 3ONXA 2WJDA 3TYEA 4XSLA 1KLYA 3O1NA 4DBRA 1XSJA 4TUFA 3LCFA 3EA2A 5LMUT 1WXJA 1PIFA 4YY3T 5F2IA 4Z0JA 3AA7B 1EHNA 1Q2RA 5F5WA 1QSDA 1AQ0A 1QWKA 4PL1A 3WQPA 5I3JA 3IIVA 2PSNA 1XCWA 2CXEA 5DY3A 4IMFA 1FWWA 3UU3A 4WJEA 2YB1A 3N2TA 3C61A 1GJUA 4D6JA 2C3ZA 2WJZA 1FXQA 3KVAA 3H21A 5HXRA 1QO2A 5FY7A 3FZMB 5LGUB 2FYMA 3W88A 2E9XC 3AE9A 4WDXA 1XPYA 2HVOA 5G4EA 5AYXA 2H9AA 5JDLA 2R1PA 4Z2GA 2QA7A 3RLHA 3RYFE 1KM3A 2PD5A 1W91A 5I77A 5FXVA 2CLKA 4OBSA 5BWFA 3W02A 3WD0A 1PTAA 4HTEA