2W61A

Saccharomyces cerevisiae gas2p apostructure (e176q mutant)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
480
structure length
470
Chain Sequence
GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Glycoprotein
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
total genus 164
structure length 470
sequence length 480
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w61A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w61A01
1WDRA 2IXVA 4PCTA 1NH6A 3EDDA 4GPNA 3ARUA 3A47A 1ISVA 3WENA 1L8NA 1K9DA 1NM9A 1BFNA 1TMQA 4CCCA 3MS8A 3AIQA 2VVSA 2ZUNA 3EDEA 4HZ6A 3WFZA 1MW1A 4MADA 2GJXA 1OWQA 1W1YA 4UQAA 3HJEA 1E40A 4JFVA 1GQJA 4A3YA 3WMBA 1U2YA 1Y7VA 2BV9A 1J0IA 1GORA 1KXTA 2WHKA 2NSXA 1B30A 1KGXA 4W5UA 3BMVA 2X8RA 1VEMA 3ALFA 1BYDA 2CXGA 3CGTA 3G6LA 5ABGA 2W5FA 1BYCA 4W88A 3K46A 2E8ZA 4FK9A 3ZQ9A 3T0BA 1M7XA 1FFQA 1JF5A 1HJWA 1UD6A 1E5NA 5IXEA 1C7TA 4GQQA 2D23A 1DEDA 4J28A 4HU8A 3CMGA 1VFUA 1D7FA 2X05A 1JZ7A 1V3JA 1AVAA 3VNYA 4D6EA 4L4PA 1VJSA 4X0NA 1W32A 1HL8A 5IHSA 2A3BA 1G01A 3WQWA 1UH2A 2A3CA 4H2CA 2XFYA 3QHMA 3MV01 4ATDA 1J0KA 4JKLA 4UNIA 3VM5A 1V6VA 4NSBA 4UQ9A 2JIEA 1HKJA 4DUWA 3MMUA 1RP9A 1UWQA 1B9ZA 2YLLA 4CD6A 2YDSA 4L4OA 2XVKA 4P7LA 3PN8A 1OIFA 3ARRA 1VFOA 1GJUA 1KWKA 5AC5A 1HVXA 1WKYA 3VGDA 4C7FA 2EPKX 4Z2KA 4H8HA 1MW0A 3L4YA 4B9YA 2GUYA 1R7AA 6TAAA 3AZTA 1N82A 1FH9A 1CXFA 4CUCA 3VX1A 1FH8A 2E9LA 3AISA 2BVTA 4QFUA 1W9DM 1WDPA 4FLOA 3RPMA 4LQ1A 3BCDA 3BSGA 1PBGA 4W7UA 7TAAA 3K1DA 3DYMA 4WLCA 3PHAA 1HJXA 2YKKA 2VNCA 1E5JA 3BLPX 3IJ8A 4URIA 3ARQA 5BCAA 5DEZA 1CWYA 2O92A 2C0HA 2JFEX 2XGIA 3FHAA 1BG4A 2WZHA 3NDYA 4TX6A 4YN5A 2J7EA 3VIHA 2HISA 1IZKA 3BH4A 3MKKA 3GXFA 3WDRA 3WH5A 1GCYA 5A8OA 2GJPA 1BGAA 4AEEA 4AZIA 3BAXA 1GOWA 3ZMRA 1NOFA 5M3WA 1ODZA 3RILA 1QI2A 3IJ9A 1V08A 3CUJA 1KWGA 3AMKA 1E43A 3ARYA 2BHYA 2OWWA 4KWUA 1KGWA 4UZSA 4AXNA 1GZJA 4GZIA 3D3AA 2V3EA 2Y2WA 1EH9A 3O2LA 4GKLA 2MANA 1VIWA 2CEQA 2WW5A 3KL0A 5DO8A 1ISWA 4XB3A 4CD4A 1OIMA 4AD5A 1QVBA 1J0YA 1V0MA 1B90A 1M03A 1Q6EA 4GI9A 1Q6GA 4J3UA 2WMKA 4JFSA 3GM8A 1A3HA 4OBRA 2WHMA 3CHEA 3MUY1 1TUXA 1R85A 4M56A 2CITA 2WHLA 3AHZA 3FW6A 4BQ5A 4GZEA 5A95A 1HT6A 3WMCA 3WD0A 1VJZA 4PUDA 2J47A 4EANA 2E0PA 1JNDA 3VD7A 4M8UA 4TOQA 1LJYA 4BQ4A 4DM1A 3GXMA 4GZJA 4BZYA 1HL9A 1HVQA 1LWJA 2ZUMA 8CGTA 1CGTA 1WPCA 4JFUA 4ATWA 1CXKA 4Z2IA 2PB1A 3MUAA 5D9NA 2YDQA 5DT5A 2GJRA 1NWTA 3MSGA 2YBUA 2NT1A 1ISXA 2NT0A 4PMNA 2QPUA 3OB8A 2ZX9A 2DH2A 2V5CA 5JBDA 1FP9A 1CXIA 2VZVA 4R5EA 1E4IA 1EDQA 3AIRA 3NCOA 4HMDA 2JF6A 1TA3B 4OBSA 3SCQA 3AOFA 1DHKA 1NOUA 2BFGA 1WDSA 4RE4A 5HDRA 1UD3A 4D6IA 3BMWA 4D6DA 1LG2A 1ZB5A 3DYOA 1PZ3A 3UEQA 2J4GA 2RGMA 2UWFA 3HN3A 1ITXA 3IAQA 1JDDA 5CZKA 1UR8A 5A6AA 1HIZA 1M04A 1WO2A 2WMIB 3PZGA 3L2LA 4JZ5A 4RE2A 2ZOXA 4EAMA 3RJXA 3MSDA 4AW7A 5GNYA 3T08A 1IT0A 3ARSA 3K8MA 4OZOA 3VGBA 1CLVA 5BXPA 4H8UA 3T2PA 4FLQA 2X2YA 5GNXA 4TVCA 1XHGA 2Z1SA 4PTVA 4MAZA 2XVLA 1UG6A 3QR3A 2EPNA 2XVPA 3UR8A 2WMIA 1E70M 1W3KA 1XC6A 4B3KA 2Y8VA 2WSKA 3TA9A 2XGBA 3MUZ1 3OLDA 2DT1A 2FDMA 2WMHA 4W84A 3DHPA 2DDXA 2WVVA 2EPLX 1TFVA 4AD4A 5I0DA 1K9EA 4ZXOA 3N15A 3AIUA 1FHDA 2CBJA 3VD5A 1V6XA 4HOZA 4TXEA 1E0VA 4D1IA 2DT0A 3WF4A 1IV8A 4JFWA 3GH4A 3VIGA 2XJ7A 5HNNA 5BRPA 3W38A 3HMCA 1C92A 2DIEA 3LPFA 1OD0A 2V3DA 4PMZA 1JI2A 5LA1A 3NIYA 2D3LA 1AQ0A 1JFXA 1PPIA 3AQUA 3WL1A 1E3XA 1FHLA 3VMOA 1MQRA 1P6WA 1JD9A 3FN9A 1VFFA 3GTNA 4DWSA 3AS3A 1ISZA 1TE1A 3SCPA 3QGVA 3ARTA 3TP4A 4UZUA 2G8ZA 5AYIA 4DUXA 4C7DA 3OGVA 2G3IA 4B9ZA 1FA2A 2D0HA 4AZ7A 5CGTA 3WF1A 1XCWA 4Z2LA 2W91A 1VBUA 3VUPA 2JEPA 3PZUA 2PBOA 3WQ4A 3SCWA 2ZE0A 1GW1A 1GJWA 1FOBA 3TTQA 4PTXA 3HU7A 1MXGA 2XSBA 3BAYA 4HPHA 3WF3A 5A6BA 3CMJA 8A3HA 3W26A 3EMZA 4WKFA 4QLJA 3GH5A 3WUGA 2DSVA 3SUSA 5CPSA 2D24A 4U3AA 4J3XA 1JNEA 1X1NA 2WC7A 2WXDM 2AAAA 4PTMA 4UFJA 3EMCA 3M6DA 3ZR5A 4UOZA 4V28A 1NP2A 2QV4A 1WB0A 4AISA 1JZ2A 1J0ZA 4V27A 3O6AA 4W8AA 3AMDA 3UCQA 1OD8A 1UA7A 3T2OA 5EFFA 4MNMA 1KGUA 4D71A 2BHUA 4AIOA 5CLWA 3KEHA 3UR7A 2D20A 2D1ZA 4TTGA 2XVNA 4MDOA 3AYSA 3KWXA 5ABFB 2WZEA 5A69A 1DWHM 4U3CA 2VURA 4CVUA 1V0KA 1QOXA 2FGLA 2J7BA 2WWDA 4BA0A 3GBEA 1W91A 3CZLA 4AIEA 1JI1A 1DTUA 1BF2A 3WD4A 1AMYA 4LXFA 4PEEA 3SCNA 1XD1A 3PZIA 3CO4A 4MJ4A 2YLAA 1B3WA 4TUFA 3GNRA 1EA9C 4W8BA 1BGGA 4AY1A 2EQDA 4MTVA 2ZUWA 2J79A 2V3GA 3ZJ8A 2QHAA 3B8SA 3W81A 1E0XA 3W37A 2WANA 2UY2A 1UKTA 2WZIA 2A3HA 1FH7A 3WSUA 1MFVA 2OYLA 2OSXA 1UZ4A 3UG4A 4WIWA 5A1AA 3WIJA 3T2QA 1U30A 3WD1A 2ZUVA 1B3XA 3AHXA 1HX0A 2BS9A 2D0GA 2VZUA 1DWGM 4HZ8A 4CGTA 1E4NA 3MANA 3VMNA 4MB3A 4B16A 2ZUSA 2DH3A 3W6MA 5AY7A 2J8FA 1UR4A 1PX4A 1WNOA 4KRUA 3CPUA 5HPOA 1HJVA 3EDJA 2ZXAA 3VD4A 1E6PA 3S6TA 1VBRA 4GI8A 3WH8A 4ACZA 4UR9A 2XFFA 4M29A 3AXHA 1QBBA 2D0FA 1TVNA 1E72M 3UETA 1PIGA 1QI4A 2J77A 1EO5A 4PCSA 4ATLA 3PZ9A 2G41A 2VJXA 3PZMA 4J3TA 4MJ2A 4EK7A 1V3LA 1XCXA 2ZIDA 2FHCA 4KMQA 1E6RA 3RIKA 2ZXQA 4OOUA 1CGYA 1ODUA 3WDHA 2ZWZA 2WCGA 4ZE5A 1CBGA 1JXKA 3RCNA 5I79A 1WDQA 3D5HA 2WB5A 1QNSA 5D9PA 4XV0A 1JYXA 1V03A 3BAJA 4QLKA 1AQMA 1SYTA 4R27A 1V6UA 1D3CA 1WZLA 4JL1A 1TG7A 2BY2A 3NUKA 1W9PA 2WNWA 1EQCA 1O6IA 3TOPA 1IZJA 3OIHA 4FF5A 3VINA 3BAIA 2PWFA 1CGUA 3E1F1 1KCLA 3VU2A 1PJ9A 1H11A 2BXYA 5DFAA 3F5KA 3POCA 3W24A 2F61A 2J62A 1A47A 5AYBA 3F5JA 4ZXLA 1GOQA 5D4YA 3N18A 1O7AA 2CERA 2X1IA 1GPFA 2VRKA 3CZ8A 1UR9A 3FHQA 1PEZA 3L4XA 2ZX8A 1ITCA 4BQ2A 3WQ5A 1GOOA 2OLHA 3SCSA 1HKKA 1MYRA 3KL5A 1R8LA 2DT3A 4DWSB 5E09A 4U2YA 3THDA 2XPKA 3NSMA 4MB5A 2VI0A 4PTWA 5CSUA 1J0JA 3IJ7A 1JDAA 3U5UA 5BYWA 2E40A 3WEMA 2BVDA 3M07A 7A3HA 2GDUA 2ZXBA 4BF7A 4H04A 5A6KA 1Z32X 5IDIA 1YHTA 4W86A 1KQYA 1E55A 4W5ZA 3CHFA 4TVUA 1V3MA 4MNKA 4U5KA 4AZCA 3VILA 3PZQA 3AMGA 3UERA 4ZE4A 3GNPA 4PSPA 1H0GA 3AIEA 5A8MA 5CPQA 1PAMA 2BY1A 5HPCA 1QW9A 1AQHA 1GNXA 2VX5A 3WUBA 4LGXA 4WSKA 4IUGA 4UOJA 2OSWA 3WEZA 2C7FA 5D9MA 5CGMA 2CBIA 3B9EA 3NSNA 3VD9A 4NF7A 3PZOA 1UA3A 1OGGA 3AZRA 3T0AA 5CPTA 4MPKA 3RDKA 1QI5A 2VX7A 1UD8A 3CZKA 3CHDA 3VIIA 2XVGA 4C7GA 2QF8A 2PF0A 3CLWA 1NWUA 1US2A 4PMDA 1EXPA 3N13A 2GJXB 5I2UA 4M1RA 3WEOA 1UZ1A 2V5DA 3W25A 4EE9A 2EO7A 2J25A 1UWUA 2WVTA 4AZBA 1I1WA 3CH9A 4X0VA 1EOMA 3K8KA 1CIUA 5KZ6A 4D6JA 3VIFA 5JBEA 5E6YA 3EDKA 4HP5A 1BG9A 1US3A 1UWIA 7CGTA 3O9NA 1TA3A 2CHNA 1H41A 1CEOA 1X6NA 2VRJA 2CESA 4H8VA 4W93A 1UYQA 3OZOA 1C93A 4UCFA 4ZEPA 4QCEA 1S46A 4K68A 4Z2GA 3WNPA 3RO8A 5IHRA 3BCFA 4CN4A 1OM0A 2GK1B 1M53A 2RGLA 4PRWA 4UQCA 4AD3A 1NQ6A 3PBGA 4TVDA 2WKLA 5BXSA 3VGHA 3WDQA 5HXMA 4MB1A 2PBGA 1CGVA 1VEOA 3U7VA 3MMDA 4AZCB 1OGBA 1LL6A 1E3ZA 1QPKA 5EBAA 4ACZB 3CZJA 4X9YA 3VNZA 2WAGA 4JHOA 1XYZA 1VB9A 4BQ3A 2J78A 2G3MA 4PBGA 1PZ2A 1UWRA 3U57A 2E4TA 5ABFA 1H09A 2XHYA 3MV11 3SUUA 3TTSA 3UG5A 3VD3A 3AIBA 5FOOA 5I5RA 3N11A 1E4LA 3UG3A 1C90A 3IANA 3JUGA 3OLIA 2HVMA 3QOKA 4UTFA 3ZM8A 5ABHA 3SCOA 1UR2A 4H41A 4ACYA 4UQEA 2DGAA 4F8XA 4UFHA 2WLYA 1DWJM 4P7RA 3K4AA 1QNQA 1RPKA 4NZCA 1B0IA 1W9XA 5I6SA 3RM9A 4EKJA 2VZSA 3ARZA 2O9OA 5E6ZA 4ZFMA 4AZ5A 2VZTA 1JYVA 4P8WA 2W61A 1V02E 4GINA 4W7VA 1DP0A 5BROA 3WELA 3F5LA 3GXDA 1VENA 3AJ7A 2E8YA 4OUEA 4MNJA 2VZOA 3AHTA 1KR0A 1CNVA 1E73M 2O9PA 1J10A 1JF6A 1HP5A 3LPGA 4PMRA 3RMEA 1W3HA 1WCGA 4D72A 1C8XA 1WE5A 5LA0A 3SUWA 1V0LA 1B3VA 3BLKA 4CU8A 1CXLA 1B2YA 1CDGA 4HOWA 2WC3A 2W92A 3WQVA 1OT1A 1HXJA 4GO8A 3WMSA 4AIUA 4XZBA 1CZ1A 3VMPA 1ZJBA 1U33A 1CENA 2BY3A 3AHVA 2BXZA 3RM8A 3TTOA 3J7HA 2EXOA 1BHGA 3K4DA 2WBKA 4DUVA 4WSJA 2W66A 4LX4A 4HMCA 2WWCA 1JZ5A 2VMFA 1ESWA 1J11A 2OSYA 1QNOA 5IFPA 4DM2A 4DWSC 3L4VA 1UKSA 1KB3A 4ML4A 2FH8A 1R87A 4AD2A 1V3HA 2NW0A 4S3JA 1D2KA 3OG2A 5M17A 2OWXA 1E4MM 3AMCA 3IAPA 4KH2A 4U2ZA 2WK2A 4JAWA 5A2AA 2XTKA 1B1YA 4HTYA 3A4XA 1SMAA 4Q7NA 2YJQA 2O9TA 5IFTA 1MW3A 1PIFA 2V3FA 2QPSA 4WF7A 4U5IA 1MQQA 2WHJA 2W62A 2XIIA 4UQBA 4PMQA 1QW8A 1V0NA 4AYSA 4M80A 3WH6A 4GO9A 1GONA 1G9HA 1MQPA 1KXHA 2ZX7A 4HZ7A 3UESA 2WYSA 5DT7A 3CUHA 4A3HA 2VL4A 4B15A 5E70A 1UH3A 1LWHA 3THCA 4RL3A 1XH1A 1VFMA 2BNJA 4LPCA 2WMJA 4E8DA 4ZENA 2XUCA 1H3GA 5CG0A 3WN6A 3ZO9A 2YA1A 2CIPA 2QMKA 4NRRA 5GNZA 5A2CA 3SCRA 2G3JA 5A8PA 5BXRA 3T09A 3WBEA 4JL2A 3VIKA 4J3WA 1H2JA 5EB8A 1JG9A 5TD4A 4LYRA 5A6BD 1KR1A 4HA4A 4AMCA 1JZ4A 3NDZA 1KBKA 1UHVA 4GQRA 5D8WA 1E9LA 3B9DA 1W9VA 4JCLA 2JE8A 1YQ2A 1QHZA 3CUIA 1QI0A 2VOTA 4JHZA 3EBVA 2W67A 3SUTA 3L2MA 3SCVA 1XYFA 5E9AA 1UWSA 4NRSA 3WH7A 4J3SA 4FMVA 3AZSA 1R86A 3OBAA 1HNYA 5FD0A 5GPRA 4F9JA 1UUQA 4YHEA 2ZXDA 2IUZA 4N42A 1CPUA 3CBWA 1Q6FA 4QLLA 3BC9A 3N12A 3NJ3A 1EHNA 1E6NA 3ZT6A 2C8NA 4V2XA 2QLYA 1MWOA 1OB0A 5FL1A 1ZBWA 2XWDA 1JGIA 2D2OA 1BTCA 1CXHA 1ZU8A 4AZGA 1G1YA 1EHAA 2XIBA 2Y4SA 2CYGA 3LMYA 3CUGA 4J3VA 1CLXA 4GI6A 2JALA 2PWGA 4N0RA 4RE3A 4D1JA 1LF1A 3OLGA 4XX6A 2FHBA 3MU7A 3VOCA 1Q4NX 2D3NA 4CN1A 5A6JA 1NP0A 1MXDA 1UOKA 4XZWA 3VPLA 3PTKA 5CQ1A 1V3IA 3EYPA 3RM4A 2CBVA 3FY1A 3VVGA 2Q8XA 2BY0A 3WFLA 4XUYA 5CLTA 2IXUA 4MDPA 4E2OA 4CVWA 4NI3A 2F2HA 5D9OA 1B3YA 1XSIA 1VF8A 2ZUTA 1KQZA 2VTFA 1L0PA 5LYRA 3ARXA 5ECUA 3BAWA 4AZ6A 2CHOA 3LPPA 3VIOA 1EOKA 3ARPA 4IISA 4D6HA 1LQ0A 1GQIA 3WDJA 4KRTA 3F4VA 3DHUA 3VIMA 3N04A 2XM2A 1CXEA 4HA1A 4D6CA 1ZBVA 3WF0A 1E56A 1OT2A 4YPJA 3SURA 1G0CA 4PMVA 4Z2HA 1XGZA 1J12A 1BYAA 1OBAA 4CU7A 4P7QA 1W1PA 2J7CA 1OGSA 2BVYA 1GOKA 4QP0A 5EMYA 3VDHA 1Q6CA 4CD7A 4CD5A 4DWSD 4Q22A 3GYCA 4HOXA 5E0CA 4AWEA 2YL5A 1JXJA 2XFRA 3VDAA 2ZX6A 4E8CA 2DSUA 2YA0A 2X0YA 2J74A 3SIMA 3VGEA 1DWIM 5CXPA 1KXQA 3L4TA 4P7OA 1CYGA 2BHZA 3CIVA 3WUEA 5I78A 4MAVA 1J18A 2DEPA 4HPGA 1CTNA 4AD0A 1JIBA 2VC9A 2ZX5A 3VDBA 3A4WA 1G5AA 4OJYA 1KBBA 3GNOA 1GHRA 1WAWA 4BCEA 3FAWA 3WKZA 2J8GA 3SUVA 1E6QM 2W4XA 2XSAA 2DSWA 2UY5A 3AFBA 2Y8KA 4PMYA 5FIPA 3T0DA 3AICA 1E15A 3WDIA 3KE0A 1JFHA 1UWTA 1WZAA 3N9KA 4IPLA 5BWFA 2WVSA 5A2BA 1E0WA 2VCAA 2WMFA 2WMGA 2ZUUA 4OOZA 2G4FA 3ZR6A 3ZT5A 3ZT7A 4MB4A 4UFMA 4P8VA 1BYBA 4FLSA 4U33A 3W28A 3ZJ6A 1W3JA 2GFTA 5I23A 2WSPA 4AEFA 1GOMA 1UR1A 2VQUA 2YDRA 3FXYA 3POHA 5F7UA 3GDBA 1KFWA 3ZOAA 2YA2A 4UOQA 1QI3A 1UD4A 3WQ6A 3PZVA 1FFRA 1BPLB 3IK2A 4WKHA 4TTUA 2E3ZA 3EDFA 5FKYA 1KCKA 5BRQA 3WQ8A 3AIVA 3VX0A 2VVNA 2YBTA 3I3DA 4W89A 1EGZA 4A4AA 4PUEA 3AXXA 3PTMA 4JFTA 3ALGA 3W0KA 3WD2A 1K6AA 1HF6A 2J7HA 4CKQA 4Z2JA 2UY3A 5A8QA 1JDCA 1SFSA 2J7FA 4AC1X 5FL0A 1UKQA 2YL8A 3II1A 1XH0A 3OLEA 4CCEA 2YL9A 1UQZA 1F4HA 1JYWA 4HMEA 1EIBA 1HJQA 5I77A 4M81A 3QHNA 2CBUA 2Y24A 3GH7A 2F8QA 1V6YA 1HN1A 3RJYA 4UQDA 1ZBCA 1EDTA 4KGLA 1HJSA 3A3HA 5M5DA 4D6GA 1UKPA 1V3KA 3CZGA 3OGRA 4BS0A 4D6FA 1FP8A 1JYNA 2QMJA 3ZJKA 2ESCA 4HU0A 5BXTA 5JBFA 4P8XA 4LYPA 5C8BB 3L4ZA 3NSXA 1H5VA 3MMWA 2DT2A 1MW2A 3M7SA 3EMQA 5C71A 1RD6A 1PX3A 4W85A 2AMGA 2YOCA 2FGZA 3W82A 4F79A 1W9BM 1HJUA 1H1NA 1I1XA 1TZ7A 2GK1A 1J01A 2A3EA 3WL0A 1BLIA 3GXIA 1QNRA 2X09A 5DF0A 3KZSA 1ZBKA 3W27A 4J7RA 1M01A 2ZICA 1W3LA 4AD1A 1SR0A 1VRXA 1B3ZA 4E4PA 4CN6A 4HA3A 1KXVA 3N1AA 2V38A 3AS2A 1GHSA 3TONA 2E9MA 1QHOA 2DSZA 3QOMA 2DQXA 3AS0A 4Y7EA 3ZSTA 1Q6DA 3WNNA 1BQCA 4PMOA 4UFIA 2CPUA 2FH6A 3WNKA 1QHPA 1MVYA 1ISYA 3WF2A 1ZL1A 1WZMA 5C70A 3VGGA 1E1EA 1GOIA 3AROA 1G94A 2PWHA 4AZHA 1JL8A 1V02A 1BVZA 1NWSA 2CKSA 1K9FA 2W63A 4PMUA 1C91A 2VQTA 1UD5A 4UFLA 3GZAA 3AHYA 3DECA 3U7BA 2XYLA 1E1FA 5ABEA 1V6WA 3BSHA 1WZKA 2O9RA 3MUIA 1ZS2A 2XM1A 3NYDA 1DWFM 1W1TA 3WNMA 4LYQA 3GBDA 2WVVB 3AI0A 1OCQA 1WP6A 4QDMA 1C7SA 5I24A 3OZPA 5JUVA 5D8ZA 1UKOA 1H0IA 5HBFA 1HKIA 4PMXA 2YL6A 4JIEA 1LL7A 5LA2A 3W6LA 4WKAA 3VGFA 3BXWA 3ZJ7A 2JF7A 3A4AA 3FAXA 1EO7A 2VO5A 1K9TA 3LPOA 2VCBA 3FNDA 2XG9A 3VDCA 2WVUA 1JZ3A 2B31A 1F4AA 2OWCA 2ZWYA 3AIWA 5A94A 3ZIZA 2PI6A 2WM0A 3VO0A 4H7VA 3AXIA 2WCSA 2GVYA 5M03A 4QAWA 3M46A 1JD7A 1JZ8A 2GDVA 3VKKA 3TTYA 2PWDA 3WNLA 4IM4A 3W4RA 3W53A 4F9DA 2VX4A 3PZTA 1TR1A 1C8QA 4P7NA 1VAHA 1HKMA 3AS1A 5DMYA 2VR5A 2OYKA 3VIJA 1CGWA 1X6LA 1NARA 2G3NA 4MNLA 1GQKA 2E9BA 4JKKA 2PC8A 2VCCA 1I75A 1EQPA 1XV8A 3AMLA 4P8UA 2WPGA 1H4PA 1QBAA 3VTRA 2WC4A 2WLZA 3WY1A 4CU6A 2CKRA 1E71M 1TCMA 1ECEA 3ARWA 4TX8A 2DSKA 3B9AA 1JZ6A 3A6OA 3WDPP 1XD0A 5FCZA 1PX8A 3DYPA 3APGA 3WNOA 1E6XM 1GVIA 2YIHA 3WH9A 4W7WA 2VUYA 3G6MA 4CCDA 5A8NA 2OYMA 1EDGA 1NWRA 1W2PA 2GSJA 4W87A 2VR4A 1W1VA 3BGAA 4WJXA 2XWEA 4UFKA 4CD8A 3ECQA 1GUVA 3CTTA 3L4WA 1JAKA 4GIAA 5KEZA 1W9UA 2J7DA 2JEQA 2CNCA 3K8LA 1R7OA 3I3BA 3MO4A 5JIPA 2FHFA 1H49A 6CGTA 5A3HA 3CHCA 3QHOA 4W8LA 5A6LA 4QCFA 5JIWA 2DPEA 3DC0A 9CGTA 1RH9A 5CJ5A 4IPNB 1XSKA 4PSRA 3PZNA 2D22A 3WUFA 1XSJA 2CETA 2VRQA 3WD3A 3U5YA 1BAGA 2EPMX 5I3DA 1C3FA 2WCAA 4KGJA 1ZJAA 3VM7A 2X0HA 3SCUA 3ARVA 1E6ZA 3BAKA 2AOSA 4U31A 1QNPA 1UH4A 3CUFA 3SCTA 2Y5EA 1MFUA 5E0FA 1SMDA 1W2VA 5CSYA 2J7GA 3S2CA 3AYRA 4PN2A 1NOWA 1GQLA 6A3HA 1OINA 2DIJA 4JKMA 1C8YA 1XH2A 3WBAA 2CCRA 1UR0A 2EEXA 2A3AA 3N17A 2EJ1A 1RP8A 2UY4A 2VX6A 1GVYA 1DWAM 4FLRA 1OSEA 5A6MA 1TVPA 1JAEA 2PWEA 2TAAA 1UD2A 1BVNP 3I3EA 4WK9A 2J75A 2EBNA 4GXPA 4PYSA 4M82A 1E6SM 1CGXA 1LL4A 2WKGA 5AC4A 2EPOA 5HOSA 1BSIA 1CECA 1VEPA 2VT0A 4B3LA 5A6SA 4F66A 3CZEA 1LLOA 4YHGA 1J9YA 3W29A 5EFDA 1HP4A 1XRVA 3KL3A 3L4UA 4J27A 4S3KA 3VIPA 1UQYA 3PTQA 3OA5A 4OIFA 2WBGA 3SEPA 1LG1A 2JIWA 3ZSSA 3OGSA 4OKDA 5GQBA 1J0HA 1B31A 2Z1KA 4M24A 4JCMA
chains in the Genus database with same CATH superfamily
1WDRA 2QKFA 1EJSC 1D8WA 3EDDA 3HKBE 3A47A 4CQDA 4NL1A 1R2TA 3WENA 4YTMA 2VL8A 1TMQA 1J2BA 4LH8A 3VKCA 2OLSA 3AIQA 1XGEA 4YVPA 4ZODA 4QQUA 1ONEA 4HZ6A 4KEUA 3VKJA 1MW1A 2E8IA 4MADA 2GJXA 2KZHA 3HQ1A 1OWQA 4DO4A 3TYUA 2QPXA 1REQA 4BKNA 4JFVA 1GQJA 1PS9A 1EFZA 1W37A 4LV9A 1Y7VA 1J0IA 1GORA 1KXTA 2FBWA 2WHKA 2NSXA 1KGXA 4I6KA 2X8RA 3R5EA 1EZWA 1BYDA 2CXGA 4RDZA 3U2ZA 3FZLB 3XIMA 3FOKA 1BYCA 4W88A 3GAKA 4K8GA 3ZQ9A 1JNRA 1H7PA 1UD6A 1JF5A 2NQZA 1E5NA 1S2CA 1DJQA 1AH4A 4RDWA 2X05A 5JRCB 1OFEA 3RYIE 1JZ7A 4TR9A 2VC6A 4H9PC 1V93A 1VJSA 4HGAA 4UV9B 1HL8A 3WQWA 4JN8A 1EF2A 4H2CA 5JU6A 2QIIA 5CC7A 4KERA 3EAMA 4DNDA 4ATDA 3WFAA 1MNEA 3A3XA 3RR1A 1FDJA 4B3RT 3VM5A 3LK6A 4CI1B 4NSBA 4REQB 3TC7A 3UT0A 2M6BA 5CC6A 1RP9A 3W1UA 1Q7ZA 4CD6A 1ZAJA 1VCGA 4P7LA 4LS0A 1XQLA 3LQGA 4WEVX 1KWKA 3TQKA 4DVOA 2EPKX 4HN8A 5T8GA 3GVQA 4MUZA 3N3MA 2VFFA 1SU5A 4K39A 5H91A 3HMJG 3VX1A 3TJIA 3RRCA 2E1WA 4LQ1A 3CHVA 1H60A 3K1DA 1T98A 4DBRA 1WDWA 1HJXA 1ZGDA 3BLPX 2DCFA 3IJ8A 5BCAA 2J9ZA 2P9BA 1HNWT 2D73A 2XAJB 2JFEX 1IEWA 3FHAA 1BG4A 3IS4A 2A3DA 2C79A 5C9ZA 4S3BA 4Q4PA 2VGBA 3QQWA 3URAA 2V7LA 1F3EA 1VC4A 4G56A 1P7TA 5G1TA 2QCNA 1QI2A 3IJ9A 3CJPA 1KWGA 3UXKA 4PUKA 3S1WA 3BARA 1IBKT 1E43A 1LT8A 3LM3A 2BHYA 2XZEA 4K38A 4AXNA 3M0VA 4GZIA 4HKAA 3RLHA 3S5OA 4E8GA 4OU1A 3ZVIA 2VFHA 1EH9A 3BDKA 3O2LA 1K4GA 1VIWA 3KL0A 3L7RA 5HULA 5TNVA 2XUEA 1QVBA 3LTSA 3C0SA 2E9XD 2HBXA 4DF2A 1J1JA 4J3UA 4QDPA 2WMKA 4G7FA 3LG3A 4EP8C 3HR0A 4B5UA 3P8IA 1R2RA 1YNYA 2A5HA 2CITA 3FW6A 3AE9A 1QOQA 2I57A 3UZZA 3WMCA 1VJZA 3DEQA 2E0PA 1JNDA 3OPCA 4S2BA 4M8UA 3HQOA 4TOQA 1LJYA 4K2SA 3TH6A 4YWSA 4PK5A 4JTQA 5KINA 1HF8A 4DM1A 3ITGA 1HL9A 1LWJA 2ZUMA 3DFSA 2G0UA 1TREA 3KBSA 2LE8A 5AC6A 3EOLA 3B3DA 4H6RA 1W1A1 5FY7A 2NR4A 2YDQA 1VLWA 3MSGA 1FWWA 3R84B 5CZ0A 4G5DA 4QNWA 3GVWA 4JEJA 2ADAA 3P74A 1P43A 2DH2A 2V5CA 4R7JA 1FX6A 4G1KA 5ECVA 1QUUA 1HG2A 3AIRA 3SCQA 3AOFA 3PPGA 1DHKA 3RYSA 4KP3C 5JR9A 2UXNB 3B0PA 3CX6B 3IAQA 4Q8MA 3HGJA 5CZKA 5BOFA 5FF2A 1HIZA 4K7VA 1M04A 4CXYA 2WMIB 2J8TA 3PZGA 1OX6A 2ZTKA 3UWYA 3QR1A 3WAKA 2V8SV 4EAMA 4XKMA 4UTIA 3ES8A 3U2OA 2XAQB 1IT0A 3DG6A 3UGRA 1RY0A 1ICPA 4XO7A 4O13A 2QVAA 3ABXA 1S1PA 4FLQA 4PTVA 2XVLA 2OOFA 3CV6A 2Y62A 3QR3A 2XVPA 2DIKA 3JZEA 4B3KA 4L64A 3MB9A 2DT1A 3DHPA 3VAVA 1TFVA 4H1ZA 4UVAB 1GKQA 4AD4A 4ZXOA 1H1ZA 3N15A 2QUNA 2YU2A 3N2KE 1OX4A 1OQFA 1YLVA 3AIUA 3K3OA 1WKFA 1VLIA 2CBJA 4PRTA 3RRXA 3DCPA 3VFCA 5L3CB 5E93A 3V5OA 1Q4WA 4D1IA 4HT3A 1HNZT 4DR7T 4XIMA 1PYMA 3GH4A 2I5QA 4A3UA 2VEKA 2XJ7A 3VIGA 3HQNA 4XK2A 4WUIA 5HXHA 3LPFA 4AHQA 4E7SA 4MKNA 4AH7A 1OD0A 4HMNA 1JI2A 4H9UA 1R38A 1RPXA 3LSVA 4I8YA 3TEVA 1AQ0A 2VDIA 1JFXA 2HSAA 4DMVA 3G22A 2E9XB 4G7EA 4ZR8A 3P5ZA 1QSDA 4AC7C 1P6WA 1LDCA 2NSOA 5K7JA 3GTNA 3AE8A 1ISZA 1TE1A 2ISVA 5AYIA 3AE4A 1QR7A 1R6WA 3EEGA 4RW3A 3AU6A 4BA9A 4ZI3D 4UIOA 4JTRA 5CGTA 4A8NA 1XCWA 3K3QC 3L5AA 1VYSX 3VUPA 4IHJE 2G5WA 3PZUA 2PBOA 1OFBA 2DVTA 1GW1A 1GJWA 3P4RA 1FOBA 2IDOB 1J5WA 4HPHA 1XG3A 1IJ6A 3OQEA 2MOZA 4WKFA 3GH5A 4UTWC 4KI0F 2JKPA 5CPSA 3N2MA 4X1IE 3RX2A 3HGRA 2OV9A 3VNMA 4U3AA 4C6QA 4J3XA 1X1NA 2HN1A 1PUDA 3R58A 3QQ0A 3EMCA 3M6DA 1NP2A 1DYSA 5HINA 4A2SA 5AHNA 3AEAA 1EZ3A 3UULA 2FJBA 2IPJA 3UCQA 4NZ3A 1O12A 2Z28A 1XZYA 1EJUC 1TV8A 2E6DA 3HV9A 1T6MA 1NVMA 4Q4KA 4D71A 4AIOA 4LBSA 4MY1A 2RDXA 2CFFA 1XKJA 2D1ZA 1POKA 2Z00A 3GDLA 3C56A 3AYSA 5D32A 4PJNA 4U3CA 2VURA 3M5XA 1QOXA 2YCLB 2J7BA 4CI3B 2XQ7A 1VFSA 4E2BA 1SZNA 3GBEA 1XFBA 4GQBA 3GN5B 5AQFB 1JI1A 3FCPA 3U2CA 3WD4A 4I9MA 3PY2A 1Q8JA 4PEEA 3SCNA 3TQ0A 1S35A 4FXFA 3CO4A 3BQLA 4WW0A 1G4PA 4J35A 1B3WA 2E6YA 4TUFA 2ZZ6A 3MZ2A 1TPB1 1EA9C 3LTYA 3CWHA 3FYPA 3ZJ8A 1E0XA 2WANA 1JVNA 5LGTB 2UY2A 1UKTA 2WZIA 1FWEC 4ZQPA 3WSUA 1MFVA 1JCNA 2LLYA 2CLYB 3OTRA 3W1PA 3AJXA 3UG4A 5KXJA 3WIJA 3QPYA 3WCZA 1KBJA 2AKMA 1B3XA 3LSCA 3AHXA 4LVFA 1FXPA 3WLKX 2BS9A 2VZUA 3IJQA 2WDVA 4HZ8A 4YNGA 2IMLA 3VMNA 2ZZ3A 1JCLA 4DV2T 4QQ3A 2DH3A 1T72A 5AY7A 3LXAA 2I6HA 3DFTA 1UR4A 1QPOA 3C0JA 1UB3A 4KRUA 3CPUA 3UPBA 3BLOA 3VD4A 3S6TA 4KRZA 3C4ZA 3WH8A 5A8GA 1ZAIA 4L6DA 3AXHA 1TVNA 1E72M 2J77A 1A4LA 3UZXA 1EO5A 4PCSA 1WR0A 4H9TA 5FJOA 2G41A 4LAUA 3LMZA 4UUIA 1XCXA 2KXPB 2RHGA 3UXAA 3PTRB 2FZ9A 2FHCA 3B57A 2RH9A 4IFRA 3RIKA 2ZXQA 3KTCA 4OOUA 1CGYA 3N2GE 4ZE5A 2WQPA 2ABAA 4GMEA 1JXKA 4HSOA 2R6OA 1HG3A 1I9CB 4RLIA 3H2NA 1A5KC 1WDQA 3EA3A 4DXXA 4HEAA 1TPWA 5D9PA 2D69A 3RITA 1JYXA 3RKGA 4UR7A 4E3TA 1TV3A 1SZFA 3H4WA 1AQMA 4R27A 2ZRWA 3N4FA 2BKOA 1TG7A 1V9DA 1H7NA 3NUKA 3C2VA 3VRBA 1O6IA 3TOPA 4WSHA 1Q7QA 1V79A 3FVDA 3VINA 4DJDA 3W2MA 3OYZA 1XYMA 1CGUA 4FOJA 3UQNA 3C64A 3RLFF 2BXYA 2PRHA 2BS2A 4EEBA 2Z27A 3Q9DA 4RV3A 3W24A 4CQAA 2HROA 4Z1DA 1YQ4A 4AUBA 1J5TA 4PCNA 5AYBA 4H9SE 4ZXLA 3W7MA 1GOQA 2Z29A 4Z91A 3N18A 1BXNA 3S6DA 1FEWA 4LUSB 2PP1A 2FPVA 1GPFA 5DCEA 3RCMA 3QEZA 3TSBA 3FHQA 3URNA 4DJEC 3L4XA 2DL1A 3E2RA 3F4DA 3O9XA 2OLHA 2R1MA 1MYRA 3TQPA 3I0QA 1KK7A 4O1FA 3QC9A 3DXIA 4HN9A 4HHLA 4DWSB 4EB6E 3PUGA 3THDA 3NSMA 4MB5A 2VI0A 4I5XA 1J0JA 1PB0A 1JDAA 1VCFA 3M07A 4JYFA 3GWQA 4BF7A 5A6KA 7A3HA 1Z32X 4IL2A 1FWRA 4KEZA 3EPMA 3G18A 1YHTA 3W3OA 1KQYA 1E55A 3NM3A 3UWQA 4W5ZA 5I3HA 4AMAA 4S3AA 3PU3A 4K6AA 2A1YA 1CLKA 5U4NA 3E0FA 4N9CA 3RLVA 1ZHAA 4GUFA 1ZNNA 3BLLA 3AMGA 2V82A 3EWCA 3FS2A 3W23A 4F2TA 4KESA 3DHDA 4GUJA 5H6QB 4QTGA 4PCPA 1PAMA 4FO4A 1DJYA 1TMHA 3WUBA 3W00A 1OZMA 4BHYA 5FEPA 2OSWA 3WEZA 3TOYA 4E38A 2I9UA 3AA0B 4OFCA 3B9EA 1QK2A 3V3WA 1T8BA 4NVTA 3N2TA 3W1XA 2GUBA 3CIXA 4MPKA 1OFAA 2TSYA 1QI5A 1UD8A 3CZKA 2BSLA 4M5PA 2QF8A 4K36A 7PTDA 3EKGA 3AB3B 3FLUA 3GS6A 2GJXB 3UXDA 2V5DA 3DI1A 2EO7A 2EJAA 2UXXB 1EJTC 1PSCA 4L5ZA 1HS7A 4AZBA 3GU2A 5JREA 4PTNA 3Q5DA 3SY5A 4H8NA 4JY8A 3PUEA 2PLJA 5KZ6A 5L3GB 3OKQA 3EDKA 4GY1A 1EPXA 1Q7MA 2SFPA 4CQ8A 7CGTA 2RFGA 4QAIA 1A3XA 3EX4A 1X6NA 1YDYA 2FPYA 4JX5A 3AECA 4MF4A 1IBLT 2PMQA 4F0KA 1DJXA 1EC7A 4ZEPA 4FB7A 4AY8A 4B4FA 4B2DD 2ODUA 3X1DA 1F76A 4YFSA 3BQ5A 1LUCA 4H63V 1J2WA 2PRLA 1OFRA 3AALA 3V5SA 4OHQA 4PRWA 4UQCA 5ABTA 3GK0A 4MZYA 1GJPA 3FA5A 2WKLA 2PZNA 3OBKA 8TIMA 3LZ3A 2BOEX 3VGHA 5XIMA 3WDQA 5HXMA 2HRWA 1D3GA 4MB1A 3T6CA 4AZCB 1XLLA 1OGBA 1U5JA 3TLWA 2V7MA 6XIAA 1E3ZA 3H2CA 4LANA 3W7KA 4ACZB 1DBTA 1YPIA 4YVXA 1VB9A 4AXPA 3IJIA 1NDYA 2OXNA 2NVDA 4OQVA 2DZPA 2E4TA 3K1SA 4RZBA 3M47A 1H09A 2XHYA 4XIAA 3O7UA 3TU9A 4HIBA 3S3GA 2WMNA 2LSIA 1S3TC 3E0IA 3JUGA 2HVMA 2YXOA 1FIOA 4H41A 4ACYA 3P61A 4F8XA 2H88A 3R79A 2WKJA 3IUHA 5I03A 2WLYA 4LUTA 4OV4A 4P7RA 3SFKA 1W9XA 4EGWA 2VHLA 3M9YA 4EKJA 1F2JA 4I90A 3W1RA 1AL8A 1N32T 1FXQA 3BE7A 3KLLA 1AH3A 2HPMA 2NW7A 5G4WA 4PFOA 4WBNE 2K3WA 1W5QA 5CGQA 1DP0A 4PULA 2VOMA 3GXDA 1Z7AA 3AJ7A 4A3RA 1W0MA 3GDRA 4GVIA 3NQ6A 4XZMX 2MNRA 2NQJA 2KINB 3LPGA 2CXLA 1W3HA 1WCGA 4D72A 5DY3A 2HS6A 4GIEA 3MC5A 1V0LA 3KHJA 1B3VA 1C8VA 4B5VA 4QXIA 1CXLA 5EL1A 4HFCA 4HHPA 2X67A 4X66T 3ZMVB 1OT1A 3LCLA 4GO8A 1IE7C 4XZBA 5CJNA 4JI2T 1O5QA 3RLUA 2P0IA 3FVMA 4QXCB 2EXOA 4Z8XA 2WP9A 4DUVA 5C2CA 4WSJA 1V51A 2WZMA 3ZLGA 2ALRA 2WWCA 4NIRA 2OGJA 4XWUA 3WLLA 3NPXA 1ESWA 3N3TA 2OSYA 3T0TA 4GIYA 4DM2A 2Z2BA 1ENUA 1N8IA 4ML4A 3GHSA 3PAOA 3EX1A 1V3HA 1D2KA 3UY7A 3AMCA 3OHIA 3UY8A 3PNZA 1TO3A 1OYBA 5F5WA 4KH2A 3N9RA 4U2ZA 3F2EA 3A4XA 4JQ4A 1N8FA 3RIUC 1P1XA 1YBQA 2QPSA 3UWWA 1EYEA 4WF7A 4PZVA 4DR6T 3EDUA 3B0UX 1P7TB 3LOTA 2W62A 3T8QA 4UQBA 4GHRA 1FUYA 1OFDA 4IP7A 1QW8A 3KVBA 1UK5A 3UQ4A 2BASA 2A7PA 3MDUA 1MRQA 2OKOA 2DI4A 1XCFA 1B54A 2DVXA 3BLIA 1XIHA 3HBLA 4A3HA 4JYAT 4Z1YA 1BR1A 4LFYA 3THCA 1MMGA 2BNJA 2WMJA 3B8DA 5CG0A 2P3ZA 4S39A 1ZHCA 2UBPC 2YA1A 1JUEA 2A6NA 4NRRA 4WZXA 5A2CA 5EMUA 2XAFB 3T09A 3WBEA 1NWMX 3MHUA 4MJZA 3I10A 4DAIA 2FMOA 5TD4A 1NDZA 4MWAD 6PTDA 1KR1A 1SGJA 1JZ4A 4I5UA 3B9DA 4QG6A 2BBFA 1YBQB 1QI0A 3CUIA 3EBVA 2W67A 3L2MA 4PCFA 1Z8AA 5DMMA 3SCVA 2HQAA 1G73A 1IXPA 1X8CA 1Q6LA 4NRSA 2QV5A 5DBTA 3WH7A 4FMVA 2AXDS 3AZSA 3U8GA 3H26A 5CA0E 3IEEA 4I55E 5G2HA 2MAWA 1XWYA 1B4EA 3PU8A 4F9JA 1UUQA 3EZ4A 2ASHA 2V2CA 1CPUA 3CBWA 1TZ9A 1Q6FA 2XGZA 4KUMB 1EHNA 3VCNA 1AG1O 3B13A 1J79A 3GC2A 2V7IA 2PGRA 3RF9A 5CG7A 3EEZA 1MDRA 3E0ZA 3TMQA 1XYBA 1ZBWA 4HYWA 2Z7KA 4A6GA 5CH9A 1G1YA 4WVXA 1EHAA 3TN6A 7XIMA 1KM6A 1XM3A 3N29A 1CLXA 3H7VA 4WDTA 4KWWA 2OJPA 3V75A 2JGYA 3I6TA 1LF1A 3PJWA 3MA8A 4DV6T 4XX6A 3KAOA 2D3NA 3NQDA 5A6JA 1PHWA 4BJNA 1DIOA 4S3EA 4MLJA 1K77A 1VFTA 4HWHA 1VJIA 4YTQA 2PBIA 2BY0A 3FXDB 3EGJA 3S6OA 3WFLA 2BZBA 1KFBA 2OO0A 4ILCA 4C6OA 4E2OA 2C1HA 5EY5A 1A5UA 3EOSA 5D9OA 1VF8A 1UPPA 1YDVA 2VFEA 2VTFA 1L0PA 3AUJA 3IRDA 3W1QA 3EX3A 3ARXA 2CU0A 3BAWA 5ECUA 2OO6A 3S1GA 4NZFA 4XZ9A 3I6EA 3MI3A 3LPPA 3VIOA 4LC6A 4JTCA 4K8HA 4D6HA 4O4JE 3DKLA 1GQIA 5DANA 3RX3A 1Y5WA 1SO6A 2XM2A 4D8LA 4OVXA 1E56A 3WF0A 3UFGA 3S1XA 3CV2A 2YXGA 1XLJA 5I3FA 4YPJA 3AE1A 1MZRA 1G0CA 1XGZA 4DIAA 4BWLC 1OBAA 4OV9A 5A6TC 2OMAA 1XPYA 4F8HA 4EAHA 1MUMA 4P7QA 2J7CA 1OGSA 1TE6A 3TQVA 2Y5JA 4QP0A 3CAVA 4CD5A 4XO6A 2F6XA 4W4QA 1W0AA 3NQCA 2PJQA 5E0CA 1OC5A 1S2UA 3SRKA 5FACA 3VDAA 1TPC1 4PFMA 1BQGA 2DSUA 1LRZA 2J74A 4WOZA 4JTEA 3L4TA 2W27A 1L8PA 4P7OA 3STGA 3WUEA 3PJUA 3CKDA 3UUNA 5I78A 4DELA 3QC0A 4HPGA 2DV0A 2B81A 2GVEA 3DN5A 4AD0A 1JIBA 2VC9A 1DIEA 2ZX5A 1IXNA 4H7ZA 1G5AA 1RLDA 3ONBA 4B6XA 3Q45A 3GNOA 4H00A 3M3ZB 3DP7A 3G0UA 1PTGA 4MVAA 2JPFA 3TYDA 3DJBA 3ZYZA 2RP4A 2DSWA 3AFBA 4PMYA 3AC0A 6ENLA 1JGMA 3KE0A 1UWTA 3N9KA 3R0KA 3SECA 2QJJA 2WVSA 3K2GA 1JDEA 3DX5A 1E0WA 3HM7A 1ZOYA 2VCAA 4GYKA 4IG2B 4FI4A 5HNUA 2WMGA 1Z44A 3G1HA 2H9AB 2G4FA 4FNQA 4MB4A 1X1OA 3N9LA 5T9CE 3W7NA 2WJEA 1MSSA 5C7VA 4ADTA 3ZJ6A 1VCVA 3FJNA 3L0GA 2DUXA 4YHJA 2WSPA 4B3ZA 4FZIA 4O8AA 1MUCA 4PUWA 4KCUA 2YDRA 5F7UA 4PBFA 3G0SA 3ZOAA 1QI3A 3QZAA 2Q9QA 1EJRC 1U5HA 3PUVF 4EX4A 5K9DA 2FVKA 4G63A 4PUJA 1KD0A 4OBTA 1TTPA 1W5OA 2IQTA 4O10A 3WK1A 3LFMA 4RZ4A 5D2WA 3I3DA 2UU9T 2CMRA 3SN0A 3AXXA 3UPMA 2PFVA 4JFTA 4Z0SA 3WD2A 3NFUA 2GK9A 3THQA 5AQSB 1WXJA 2ICSA 4GFSA 2JJ9A 1JDCA 1ZP0A 1SFSA 2J7FA 5HUOA 2M67A 4U72A 3LU2A 1XH0A 4BR1A 4GC4A 3OLEA 4CCEA 4KQNA 4IIEA 4UTKA 2LSJA 5EYWA 4HNTA 1XW8A 1HN1A 1EDTA 3KBMA 1R9ZA 3S5SA 4JD4A 1W8GA 1ZY9A 1PWLA 2V6AA 1V3KA 1IIGA 4D6FA 1QCWA 5KETA 3GA8A 3PV0F 2O55A 2QMJA 2X30A 3R7MA 4OHFA 3NEHA 4LYPA 5LGNB 1H5VA 3QVQA 3H2AA 5ETWA 2OPJA 4W85A 3W82A 3L0NA 2HPLA 1DKWA 1RCQA 3FHNA 2XASB 5HQLA 3H3AA 5K4ZA 3B06A 4UCGA 3WL0A 1XF0A 1BLIA 3HURA 2IW5B 4S38A 3O05A 2WBLA 4FEZA 2XN0A 1B5TA 4Y90A 1R2SA 2CC0A 3RAOA 2QYGA 3WZ0E 4MBQA 1W3LA 4R9OA 4B5TA 1D0YA 4AD1A 2W00A 4E4PA 4CN6A 4HA3A 1L0VA 4AXKA 3N1AA 1H51A 4DO6A 2E9MA 2LOPA 3SI9A 4PODA 3SO7A 4LVBA 3LK42 6XIMA 5HXEA 4C6IA 3LXBA 3B5MA 3ZSTA 3AS0A 2XISA 4NYUA 3WNNA 4LOCA 1EA0A 1BQCA 4J2MA 4PMOA 4JNMA 1J96A 2QZRA 5J0ZA 4FX6M 1IIHA 4GQGA 1E1EA 1GOIA 3G0XA 4LUTB 1K9FA 3WYZA 3M0HA 1JCXA 1HX1B 2QCDB 3PPCA 4IE4A 3AHYA 3H4XA 2FJAA 4DY1A 1UASA 1WZKA 1ZS2A 2OFJA 3CB8A 4UTUA 5LKYA 4Y9PA 3VKBA 4LYQA 3GBDA 5JDFA 5CPMA 2EHOC 2K24A 3TNBA 3DDMA 1UKOA 2CZFA 5AKQA 2RKXA 4CEXC 4PBEA 3W6LA 3VGFA 3CH0A 3BXWA 3T1YT 2XIOA 1M1BA 4IIHA 3ZJ7A 2JF7A 1PKLA 2VCBA 4IX0A 3VDCA 1JZ3A 5HXRA 2B31A 3H2EA 2GOKA 5A94A 4HPJA 2WM0A 1XXXA 1SO3A 3AXIA 2WCSA 2GVYA 4QAWA 4XD4A 4NJHA 3UVAA 4BK9A 4DF0A 3PR2A 1JZ8A 2GDVA 1Q2SA 3TTYA 3D0TA 3FV9A 1GEHA 1XG4A 2Z26A 5F2LA 4LB4A 1A0DA 5HR6A 3W53A 2PDFA 5DQVA 1XIBA 4JI5T 1QPQA 4JYDA 3PUZF 3HG3A 4ZQRA 3TR2A 1NARA 4OE7A 2G3NA 2PC8A 4H6QA 5ADXL 3TR9A 2P88A 2P76A 4P8UA 5PTDA 3M1ZA 3CPZA 4KWVA 3BQIA 3G1DA 4O1BA 4HYRA 1MNDA 5JR9B 1RAKA 2CKRA 1H7CA 3A9BA 3DKJA 2X9YA 4DJDD 3W7JA 1AA1B 3LXCA 1JZ6A 4S3FA 1B9BA 3WDPP 3CEUA 2WDRA 3APGA 3PVFA 3B0YA 1KFYA 5G2IA 4IIJE 2I16A 2VUYA 2OYMA 1ZJIA 3NZQA 3SRHA 1E51A 4WJXA 1I2NA 1E0TA 2Z0IA 2XWEA 1X8FA 3HTWA 1OFPA 4FR6A 4HK7A 3IF8B 5KEZA 2AGKA 3VZYA 1HCIA 1P0NA 1R7OA 2W0GA 1MNZA 4DBSA 3MO4A 1A0EA 1WKEA 6CGTA 3ITCA 2EF9A 2Z1BA 2V2HA 4FNUA 2DPEA 3MT1A 4JQ2A 4MYXA 1XSJA 2Q71A 3U5YA 5AQGB 2UXCT 2QEZA 4U74A 1ZJAA 3W1LA 2X0HA 4XKYA 1EJ7L 1QNPA 2Y5EA 1AW1A 1XR2A 1HUVA 2HTMA 2G95A 1W2VA 4AKGA 2J7GA 3QY7A 1KFCA 4GY0A 1R3TA 3AYRA 3FEMA 2GJLA 1NF0A 5E1QA 1P0BA 2A2IA 1OINA 4RXFA 1V5XA 1W31A 4UIGA 5EGRA 3ABVA 5JH7E 3A5FA 1TMLA 4O19A 3W2UA 2PUZA 3PBVA 4FP1A 1E1CB 3VXGA 2UY4A 4ILUA 1DWAM 5HWYA 4NUUA 4E5TA 2PDLA 1MUWA 1TVPA 1JAEA 1F3XA 2HEJA 1BVNP 1P0DA 4NAEA 4PYSA 1CGXA 1LL4A 3QGAC 2WKGA 3U78A 5HOSA 3T9PA 4PUMA 3EWXA 5T26A 1CX9A 1CECA 2P8CA 4B2DA 1D1BA 3W29A 1MIVA 1UQYA 3EA2A 4LF8T 3BOXA 2CPTA 2JIWA 2X2GA 3AAEB 4GACA 2OOGA 4EPKA 4OKDA 5GQBA 2CXDA 1IHIA 2PGEA 5K9XA 1R3RA 2GQ9A 2Z1XA 4EF8A 2I14A 3P8CD 2IXVA 4PCTA 4XSMA 3ARUA 4FIQA 4C6BA 1ISVA 1OABA 5E0OA 1K9DA 1BFNA 2Z24A 3IJ6A 1PYFA 3QN3A 3MS8A 2VVSA 3UU3A 3MBDA 3ONLC 1FJGT 2VKZG 1RK6A 1TV2A 3MCNA 3WFZA 3HGOA 1ZSXA 4AKRB 3JAFA 3TWBA 1VYPX 3MPGA 2PDKA 1R0MA 4UR8A 3BW3A 1ADSA 1E40A 3OJGA 3CS2A 2ZVIA 4P09A 4RDVA 3W7HA 2FKPA 2BV9A 2OZ8A 3N25A 4R7OA 1B30A 2XZ7A 3C5QA 3CQIA 2X68A 3LBXB 3A22A 3BMVA 1SE7A 2ZZ1A 4FALA 3B8VA 4US5D 1FWTA 3G6LA 4FXJA 1VYRA 4EPBC 5EMKA 1KRCC 1A5BA 1XDMA 3ABZA 4QHRA 1RQBA 2A85A 2WNQA 4C6KA 1C7TA 4GQQA 3FXEB 4JI6T 2QDHA 1VP5A 3F4CA 3ZCJA 3CMGA 1D7FA 2KLQA 1K1DA 3M41A 3SRFA 3VKHA 4NZJA 4DR1T 4YSXA 1R30A 2CZEA 1X97A 4GUGA 5IHSA 2A3BA 1G01A 3RGTA 4I9AA 3WX7A 5D37A 2MBGA 4GXMA 3F4NA 2RUSA 1F73A 2X1UA 3EB4A 3B8WA 3QY6A 3ZMZB 2PA6A 3QLLA 2E77A 3APYA 3AE6A 2DZXA 4HTEA 4JYEA 1K7FA 1V6VA 2JIEA 2Q02A 1R46A 1HKJA 2LLEA 4I43B 3MMUA 2A0NA 3E0VA 1G4TA 1ZP4A 2R9RA 4C6EA 2HVNA 3GHTA 3ARRA 1VFOA 2BDQA 4UF0B 1WKYA 3VGDA 5J8LA 1R3QA 2WY2A 1MW0A 4PR4A 1D0XA 3R12A 3ZJ1A 1FH9A 4A29A 2VWAA 4CUCA 2E9LA 1DJGA 2BVTA 3E2QA 4FLOA 4EIWA 2ZM0A 1PE1A 4GKJT 2GWNA 3BSGA 3LBCA 1ECQA 3A4JA 4K37A 4JXCA 4IMFA 2QUMA 2VNCA 3IIVA 4URIA 1X98A 2O92A 4JEQA 2XGIA 4DJFD 4LVAA 2WZHA 4YN5A 3KZPA 2J7EA 3V5UA 1IZKA 3MKKA 2OT1A 3GXFA 3WDRA 3UD6A 1BGAA 2NW9A 2C5JA 2FUPA 1GOWA 3MTWA 2VEFA 1NOFA 5M3WA 1ODZA 1OYAA 3KX6A 1DJNA 3WJXA 2OZ0A 1AZ2A 1IBMT 1XBVA 5CPLA 5LIYX 3ARYA 2AQOA 5CBBA 4NI8A 4KWUA 3F31A 4ILAA 2OX4A 3CMLA 5G5IA 4UV8B 2CA5A 4LUYA 3D3AA 4WD0A 2V3EA 1YE6A 2MANA 4JDBA 2CEQA 2WW5A 2GYIA 3LBOA 3THUA 4G6CA 4CD4A 3WLIA 1J0YA 3L68A 5H8PA 1B90A 2XHEB 3P5YA 4IMEA 4ENLA 4XZHA 3M5YA 4JFSA 5HMSA 3G5EA 3Q2DA 5LA6E 4OBRA 3CHEA 3MUY1 1X6UA 3WBWA 1TUXA 2OODA 1JUBA 1SFLA 4HJWA 1R85A 5HWJA 3IWPA 4M56A 1GTEA 4RNJA 3ZZ1A 4GI4A 2WHLA 1XUZA 4A5XA 2F38A 5A95A 3ANWA 1UPMB 4LW7A 4ZO9A 4NG3A 2J47A 1LTDA 3AE7A 3L5MA 3GY1A 2WWUA 4PK4A 1DOSA 4RZ6A 2JQXA 1DIKA 1EX1A 2AGTA 3GN5A 1EX5A 4GKKT 3IEBA 5JDNA 4ZO8A 4JFUA 3TNOA 1MRAA 3GIQA 3H53A 3E9AA 4MALA 4Z2IA 2KT9A 3SW6A 5D9NA 1QTWA 1NWTA 5XINA 3KOYA 2NT1A 1XC4A 1ISXA 3GR7A 3IARA 4TMCA 4PMJA 2QPUA 1M41A 4Z17A 4EXAA 4O8RA 2I17A 5JBDA 3CEPA 5C2TA 3NTYA 3HA1A 2GGGA 4UC5A 4ILSA 3NCOA 3H12A 4INFA 2Y61A 1H7WA 3STEA 2VGFA 1J93A 4OBSA 1UUOA 4CNUA 4NIQA 4HQVA 1LOQA 4D6IA 3P3BA 3BMWA 1LG2A 1ZB5A 4DF1A 3HFYA 3UEQA 1TWSA 2UWFA 2I59A 4JTKA 5AYZA 1UR8A 2DUAA 1Q45A 3M0JA 1ITUA 3FBLA 2XQYA 2JKAA 4Q4SA 3L2LA 3SFWA 2IKGA 3SN1A 4EZ4A 3GTHA 2GL5A 2FZDA 1KNZA 1M6JA 4FHAA 1ELSA 2B0MA 1K6WA 3TXVA 4X5TA 5GNYA 1ZCOA 3ARSA 3K8MA 4OZOA 2NWSA 1CLVA 5HXSA 4H8UA 1GTHA 2PF8A 3O6YX 4LJ3A 3P14A 3FIGA 5GNXA 1YQ3A 1W1B1 4US5A 3EB2A 2Z1SA 1UG6A 4IDNA 1FWHC 4BEQA 1XLMA 3P2VA 3FZFB 3BQKA 3IPWA 4AX6A 1D9EA 1E70M 3A23A 1XC6A 5HEJA 5HK4A 2TRSA 4DV0T 3U2EA 4X60A 1KFEA 3V36A 2WSKA 3TA9A 1OEDE 3OLDA 3WAJA 3S0CA 2VASA 4CNPA 2P3EA 1K9EA 4OUIA 1OEPA 3VDGA 1UP3A 4K1WA 4BJMA 4HOZA 4IWWA 1E0VA 1TJPA 2DT0A 5JQ9A 3ITYA 3WF4A 4X20E 1IV8A 3GC4A 2EAWA 3WQEA 2Q9QC 2ZLYA 3HMCA 4DBUA 4YT0A 2V3DA 3O1NA 2PDNA 3BGGA 3QF0A 5CC5A 1E3XA 3H2OA 4MJMA 1FHLA 3VOIA 2PDJA 3ELFA 1VFFA 3SCPA 3G3MA 1FWAC 3UZJA 3QGVA 2HMCA 4JPGA 4UZUA 2G8ZA 3QK6A 4C7DA 4DUXA 2G3IA 1FWSA 6ALDA 1FA2A 4AZ7A 4A35A 3WF1A 3UJ2A 2EHHA 1W3IA 2UXDT 1TV5A 3TYCA 2W91A 1VBUA 4FNTA 2W9MA 2JEPA 2WQDA 1QWGA 4PNIA 4HWIB 2H6RA 1MXGA 2XSBA 1VHCA 3QM3A 2BKPA 5A6BA 1WYIA 4MOZA 5FJIA 4BWLA 3ZMTB 3MZNA 1T8QA 1ML1A 4LC8A 2D24A 3P0XA 4UFJA 1EUNA 4UOZA 4V28A 4UVCB 5LMNT 1S39A 4UMAA 1YE4A 3F2BA 2MYSA 1TTQA 2XU2A 1OD8A 4M7SA 1X38A 5EFFA 4HN4A 3AUOA 1KGUA 2BHUA 1YNQA 4WXYA 4XKYB 2XVNA 4MDOA 3RMJA 2ZVRA 3IIXA 4IQEA 4S3GA 5ABFB 2EPHA 2IKHA 5A69A 2QJIA 1DWHM 1LP6A 4IIGA 4HJFA 2WNNA 2FGLA 3CQKA 4G2DA 3URBA 1YDOA 2WWDA 2PDXA 1RQEA 2PDCA 5C9RA 1L9WA 4TX9A 2ZRUA 1BF2A 3UZWA 3P8JA 1RY8A 3C4WA 2IUBA 1AMYA 1IWPA 3ITTA 4LXFA 2WSSV 2RAGA 2CXFA 5AZ0A 4ZZCA 2YLAA 4WGHA 2ANUA 3FJ4A 2PDWA 1R3SA 4YHHT 3KRZA 1EZ2A 1BGGA 2YXXA 4AY1A 1GZ1A 3FGCB 4Q7BA 3W81A 3V0SA 1J8VA 4AKHA 2A3HA 3UU6A 4B5XA 4F3HA 1UIPA 1LVKA 1AODA 4KF1A 1YMYA 2OYLA 4TU1A 4MMWA 1Q5MA 4TZ4C 2YFOA 3KV5A 4WIWA 4ISSA 5LGXA 4X1YE 1WAUA 4NAFB 2ZUVA 4MUPA 1J5SA 3PPFA 3OW1A 3O1IA 5FNVE 1DWGM 2OQLA 1MIWA 4K0KT 3MANA 3CASA 5LOVE 2Q9QB 1RUSA 1QW7A 4ICNA 3W6MA 1TQXA 3QGKC 2E6AA 4IJBA 3HA4A 1XIIA 4GVHA 1WNOA 5E0KA 4V33A 4TQTA 1VBRA 1UMLA 3WQOA 3SDOA 4UR9A 4IPPA 1BXCA 2PD9A 3KVAA 1UIOA 2XFFA 1RA5A 2LHNA 1R9XA 4ATLA 1Y5VA 4UXNB 4MJ2A 1IR1A 1XBYA 3MSRA 4QEEA 3N6JA 3QW3A 1H62A 1LOSA 3QZ6A 4YXDA 1L6WA 3SGGA 4LFBT 3KDOA 3C8FA 3WDHA 3KP1A 4XUGA 4PW8A 1CBGA 2NXHA 3KP0A 3C2YA 4E4UA 3RCNA 2SPCA 3V1PA 2WB5A 2Y0FA 2BVMA 1V03A 1SZRA 3HPZA 3WG6A 2Y63A 3QBUA 2DUZA 1V6UA 3DH7A 1IR2A 4H9YA 4WX2A 2BY2A 1W9PA 2WNWA 2BLEA 4AWSA 4LAZA 1KRBC 2PWFA 4PUNA 2VK9A 1ZTVA 5LYJE 1YADA 1O95A 1PJ9A 1H11A 1UUMA 3F5KA 3LV6A 5AQIB 1F8MA 3PANA 3HKCE 5I09A 1LYXA 1JCTA 5D4YA 5I07A 2AAMA 1X39A 3ITVA 1ZV4X 4QXBB 4GX8A 2G96A 4HPXA 1UR9A 4LSBA 1PEZA 2FVLA 3LHTA 8XIMA 2IPFA 3WQ5A 2NW8A 4MIMA 1HKKA 1P48A 3KL5A 1R8LA 2CWNA 2DT3A 5E09A 4U2YA 2XSXA 5G1MA 5CSUA 4PTWA 2VWTA 2YK0A 3PTDA 4LRSA 4E4FA 5BYWA 5FY1A 5LNRA 4KFOA 2BVDA 3B9NA 2F9RA 2GDUA 2ZXBA 5IDIA 1FBAA 1XBZA 5DRIA 1EYWA 4TVUA 2HXUA 3OZYA 4AZCA 3VILA 4CNTA 2JMKA 3UERA 3GNPA 4PSPA 5KZEA 2I0MA 4PRRA 4R7WA 1QW9A 4TMBA 4LF1A 4HWDA 5BRBA 4GX9A 5HQEA 1WXYA 4O1EA 4WSKA 4UOJA 1GVQA 2VENA 3M5VA 5D9MA 1KF6A 3R6IA 2CBIA 1E9IA 5BMXA 4NF7A 4YVVA 3AZRA 3KS6A 1QU4A 4HFHA 3T0AA 2FB3A 1PKNA 3QMTA 2XQ4A 2VX7A 1QPNA 3ITXA 3CHDA 4NJGA 4A21A 2XVGA 4XQ6A 1OFQA 4Q6XA 1XDJA 1YKEB 2PF0A 1NWUA 3U9IA 1US2A 3H54A 1JPMA 2Z2AA 5CJMA 3GRIA 3N13A 4Q7IA 3AAAB 2VD9A 4M1RA 3AXMA 3W25A 3L2IA 1KCXA 2H89A 1MNSA 1UWUA 3OIXA 1I1WA 1G4SA 1TPDA 3CH9A 2YCJA 2XAHB 4ZQMA 3LTPA 4CLMA 4NP7A 3K8KA 5FXVA 4V1Av 4D6JA 5JBEA 5E6YA 4MFDA 4HP5A 1BG9A 5CCZA 3SFDA 1E1CA 5FI8A 4XAXB 1DHPA 4R88A 2QVNA 4UCFA 1C93A 3R10A 4RNHA 2CLYC 1S46A 2PGWA 3PB0A 5EKYA 1FTXA 4Z2GA 1PL9A 3WNPA 2IIUA 1TWZA 1GVOA 4ORMA 3AWOA 4MPQA 4GVGA 1EUAA 1SHZC 4AD3A 1NQ6A 1W17A 2BOGX 2HZGA 4UVBB 1AD4A 3S47A 1MI3A 4TVDA 4LB3A 4NXSA 2TYSA 1IWAA 3D0CA 2PBGA 2HN2A 3MMDA 3NXFA 3G06A 3ZLFA 4QJ5B 4H19A 4AVOA 5EBAA 4IDOA 4YTRA 3OJAA 3VNZA 3BG3A 4LYKA 4WRHA 3OYXA 2G3MA 2BB0A 4DZAA 3CNYA 4KW2A 3LNMA 1UBPC 3EXSA 3U57A 3UF9A 3OU8A 1LQAA 5FOOA 5T9BG 1T5AA 1TX2A 4RZ5A 2F7FA 3LNPA 4O11A 1UWAA 3M6YA 5MKGA 1E4LA 3P4WA 1VIZA 3DOPA 3IANA 4DPQA 3BICA 5LXXA 1AW5A 1WBHA 3TV8A 4GYRA 3QOKA 3TXZA 4YIWA 1UR2A 5I3GA 3R89A 4N02A 5LNKA 2DGAA 4LFCT 1MZHA 3NL5A 3H2MA 1XISA 2JRKA 3NPVA 1GQNA 2Z7GA 4F48A 1B0IA 1LQ2A 1YW1A 1ADDA 4X1KE 3BLDA 2FFIA 3E12A 4AB4A 2O9OA 3LDQB 2WS3A 5REQA 3MA9A 3HG4A 3HI2A 3JZUA 2M6IA 4P8WA 4H9NC 4US6A 2W61A 3GSMA 1V02E 4GINA 4W7VA 1H7OA 4WGXA 3F5LA 4I3GA 3GU9A 4RXGA 3U3HA 2VZOA 1KR0A 2BS3A 4LY8A 4DV5T 4ZTXA 1ME8A 3UGVA 3DENA 4QITA 1GOXA 1J10A 3LENA 1QAPA 4PMRA 3RMEA 3ETVA 1SO5A 5KDMC 1M5WA 1WE5A 1EBGA 2CLLA 1GWJA 4ZFCA 3P4QA 3HKEE 5CC3A 4LVGA 3Q58A 3CLMA 4V15A 3AEGA 3ABSA 3I7SA 3BSMA 5AQLB 4AHPA 1A5CA 2D2SA 1CDGA 2WC3A 4E0CA 1HXJA 1ZJBA 3NWRA 1MMAA 2BY3A 2VGGA 3DERA 3J7HA 1BHGA 3K4DA 2WBKA 1XIDA 3R0DA 3JAEA 2OQYA 3ITLA 1SSGA 2ZRZA 3UYCA 2C0SA 2W66A 4GQ0A 1DE6A 4H9VA 4GE8A 2BODX 3VC6A 1J11A 4TO8A 3CMFA 4CQBA 1A5OC 4CNOA 2IS7A 4DWSC 3L4VA 4H9XA 4YLWA 5C9WA 3UXIA 4PB4A 1XS2A 4B5WA 1R87A 4S3JA 3V0TA 3FEQA 1E4MM 1M68A 1MEHA 3GNDA 1UC5A 5LIWX 4JAWA 2XTKA 5DQWA 3C86A 4HTYA 3K8PC 2I7GA 2EG8A 2VC5A 2O9TA 2V6YB 1MW3A 1SW3A 2V3FA 3UYIA 1EBHA 5CPNA 4DIDB 4MWAA 1LZOA 3QKEA 2JQ9A 1S2TA 3DU0A 4NXMT 3T1GA 1UMYA 2PTWA 2DLRA 1W9RA 2XIIA 3CXOA 4PMQA 3QJAA 1UP2A 4N7QA 2WM1A 4PTDA 4GO9A 4ES4A 5IM51 1WRDA 1G9HA 5CEWA 5L2LA 1MQPA 3BK0A 1KXHA 3PFMA 3OG3A 1EB3A 1EIXA 4GNVA 3AO0A 1Z3NA 3KINB 5DT7A 3NGJA 1QFEA 2VL4A 5E70A 1GG1A 4DB7A 1XH1A 4AU0A 1XIEA 3NQ7A 5A5WA 1Z6KA 4LPCA 2AL1A 3NXLA 1BEUA 3CV1A 1W1IE 2F4VT 1YTDA 2QMKA 5GNZA 4XBSA 3ANUA 5A8PA 1D0ZA 3N2OA 5EB8A 1UCUA 2OELA 4HA4A 3KOXA 3PUQA 3TLUA 3PJAJ 1KBKA 2VFDA 3NR0A 5D8WA 4JCLA 3RPDA 1QHZA 3OHMB 2VOTA 4JHZA 4O2AE 4GYJA 3N2XA 2YCKX 3FFSA 3KUMA 1XYFA 2ZE3A 4J3SA 4LUJA 3A3WA 4AAJA 5FXXA 4O18A 3DIPA 1R86A 3CWOX 3QY8A 4IQLA 3MP4A 1XLFA 1IF2A 3D6NA 4QSFA 2PE4A 1K7EA 5GPRA 4ZQCA 4XZIA 1T41A 1SJAA 3LGGA 4N42A 5LGZA 2QDEA 4LWWA 4WOQA 3KV4A 3BC9A 3N12A 3RYHE 3CAQA 3W02A 4TIMA 3ZT6A 3NL6A 4AF0A 1MMNA 3PWGA 4V2XA 1IEQA 2GQ8A 5LXEA 4DYEA 4WCJA 3UA3A 4UWMA 5D2XA 4LF4T 1CXHA 4XSLA 1ZU8A 4AZGA 1QT1A 5L3FB 3E22E 3W72A 3FA3A 1G8XA 2Y4SA 2CYGA 1HX8A 3CUGA 4FSAA 5MF5A 4V1YA 3SY1A 4AKLA 1FWCC 1IWBA 2JALA 4XAZA 1MEIA 3UJEA 4RE3A 4D1JA 3BLFA 3S2JA 3GIPA 3EXRA 5DX7A 1RZMA 4O28A 2VDGA 3MU7A 3TWAA 5TAOA 4XZWA 4IL4A 2LJLA 1V3IA 2VL0A 3B8UA 4N4QA 1DL3A 3KOFA 1MDLA 3VVGA 2FTYA 1IEVA 3KM8A 2BZNA 4RPPA 3PJTA 1QDSA 4LF7T 4MDPA 3DFQA 3BPWA 4JI0T 3W74A 2ZUTA 1KQZA 2QS8A 4M1PA 4FNRA 3FZKB 3CVRA 3NDOA 3AYTA 2CHOA 4IF2A 4A97A 2QIWA 3WDJA 3F4VA 1O3XA 3JS3A 4IIBA 4QE4A 3VIMA 3PP7A 2J27A 1CXEA 5DABA 5J2TE 4D6CA 1ZBVA 4L9IA 1OT2A 4JV5T 1XYCA 2Z1VA 1XINA 3YPIA 3KWSA 3A13A 4Q8QA 3ABRA 3J9X1 2DZAA 2DZVA 1BYAA 5HYAA 2OU4A 1FCBA 3KBJA 3G2GA 5IWAT 2B1EA 2BVYA 2OG9A 2V67A 1EGMA 1HO1A 4Q22A 2YL5A 1UJPA 2ZX6A 4E8CA 3ES7A 4K3ZA 3O1JA 2XZ9A 5EK3A 2C6QA 3R6NA 3VGEA 5BW6A 4IT1A 1U4QA 4J40A 1A50A 2DEPA 4XTDA 2QULA 1LLZA 2A7RA 3W15B 3TSMA 1CTNA 1Y01A 1J5ET 3UT5E 2VWSA 3PG8A 2IC6A 4BI7A 4C65A 4H83A 1KM4A 1ME9A 3VDBA 2CZ5A 3FAWA 3WKZA 2J8GA 2W4XA 1ME7A 4ZVJA 3C2RA 3HFTA 2Y8KA 5AHEA 3LCFA 2YEVC 5FIPA 1KBLA 3AICA 3DC8A 3WDIA 4YLHA 4F40A 4UTLA 1JFHA 5JDQA 3C98B 1WZAA 4C6CA 5BWFA 4QBXA 5A2BA 4O4HE 1TKKA 5DELA 4KIEA 2WMFA 4GNKB 2FZ8A 3P60A 2NX9A 2XQ5A 2X41A 4FLSA 3TROA 3W28A 2N2NA 3T07A 2GFTA 5I23A 1F6YA 2QXWA 3PUOA 1PZ0A 1GOMA 1UR1A 1PZ1A 3QSRA 2NLYA 3H4GA 1W5MA 3GDBA 4A22A 2GPTA 4EPEC 3RNDA 2YA2A 1T7LA 3ERPA 4UOQA 2CLKA 3PZVA 2HCVA 1CCWB 3G1FA 4ALDA 1WFDA 2V7KA 4Y9OA 4RUBA 3H70A 4TTUA 4IICA 4HK5A 5BRQA 3WQ8A 3TW6A 2C18A 2TMDA 2YBTA 4W89A 2H8XA 1EGZA 4A05A 3CC1A 3PTMA 1DTNA 3R43A 5E5CA 4OGZA 4AHOA 2FTPA 3IHRA 4GH1A 1K6AA 1HF6A 2J7HA 3Q4DA 4QISA 4Z2JA 1YXYA 4O16A 4FA3A 4MLKA 5FL0A 1UKQA 2YL8A 4GYPA 3II1A 2XTLA 3EWDA 2A72A 1ZEEA 1NF7A 1PCKA 1EIBA 1AZ1A 4GGHA 5EMMA 4DUOA 5I77A 1KA9F 3PUAA 2CBUA 3TN4A 2F8QA 1V6YA 5I3IA 3TK7A 4UQDA 5HANA 1XX1A 3O4XE 3A3HA 4D6GA 3W88A 3OGRA 1US0A 1FP8A 1VR6A 4HU0A 5JBFA 3G1SA 2FGBA 2CLFA 4DO5A 3NSXA 4MWAE 5C8BB 4TV8E 3MMWA 2DT2A 3M7SA 3CTLA 3QTGA 4JN7A 2ZM8A 1SO4A 5AB3A 4ICMA 4YJ5A 3G8EA 4CQIA 1I1XA 3S2NA 3ZWTA 4I9TA 1OCBA 4UEMA 1ZBKA 1H5YA 1TJ2A 1A53A 1T0OA 3T05A 4QXHB 3C2OA 2PDPA 3P50A 4RDYA 4ZOCA 1QHOA 2DSZA 3A8YC 3VR9A 3VABA 2Z6JA 4L4MA 2DQXA 3GXTA 4L65A 3SADA 3RGLA 3GC5A 3LV5A 4UFIA 4ZO7A 3VOHA 3AA1B 2QDDA 2FH6A 1QHPA 2YCLA 1SZGA 3WF2A 3ESLA 2PAJA 1ZL1A 3AROA 2LHRA 1G94A 3Q5XA 1VCSA 4AZHA 5IRPA 1V02A 4JIIX 1Y65A 3DG3A 4LT9A 4UFLA 3DECA 4NZ4A 3U7BA 2XYLA 3MI6A 4HTBA 4Q4OA 1JPHA 1E1FA 1KCZA 3A7MA 1V6WA 2Z1WA 1JULA 3NPUA 2YSWA 3MUIA 4UELA 3WBYA 1DWFM 3R2GA 3S1UA 1GVFA 4NKCA 3WNMA 3KTSA 2WVVB 3GHRA 4QDMA 2H3BA 1C7SA 1OF6A 3HF3A 3OZPA 3UQ7A 3N6HA 3KVLA 2KSRA 1H0IA 5HBFA 2NQ9A 1HKIA 4ZSUA 1CB7B 3UCDA 3OO2A 4A98A 4MHCA 2ALDA 4WKAA 2BMBA 2GVLA 3UUBA 3FAXA 4R34A 2VP8A 3VNIA 1NU5A 1S38A 3LPOA 1HG5A 2X42A 4JTSA 5LBMA 2ZWYA 1WR6A 3VZZA 2PI6A 4H7VA 2PDHA 3QTPA 1PDZA 4YYCA 3T42A 1FMWA 3M46A 1JD7A 4MKSA 5D09A 2PWDA 3FYOA 1TRIA 2W2UA 4IM4A 2GGEA 3OA3A 1PHQA 3EVYA 2VX4A 3PZTA 4E3VA 4WDWA 1CHUA 4P7NA 3OVPA 4C6MA 3UTKA 5LCYA 4HNOA 2WV8A 4JKKA 2VCCA 1I75A 3I7QA 1OWAA 4MZ8A 4MLRA 5M1TA 1ZQ5A 3AMLA 3MKCA 1OEDC 2R1NA 2XQ3A 4UMBA 1DE5A 2NUXA 1PKMA 3K3NA 4P0AA 4J1OA 5FF3A 3WY1A 4CU6A 3RF1A 3RUBL 3GHUA 4HKPA 1ECEA 4DMWA 2DSKA 3WLHA 1LBFA 3ZYLA 4JHMA 2XIMA 1D1AA 1VRDA 1XD0A 1PX8A 3WNOA 1E6XM 3TLQA 2CRBA 3VKGA 1GVIA 4GGBA 4C1LA 5LNUA 4W7WA 1EEPA 3GUGA 3G6MA 2GSEA 1IZNB 1W2PA 2GSJA 3VNKA 3RU6A 4W87A 1Q85A 4XD5A 4HNUA 4CD8A 3REQA 2ZFAA 3RK8A 4GC3A 5AFUL 3L9CA 4O0QA 4KEMA 4RE0A 4JI8T 7REQB 2YZ5A 2ATMA 4P5UA 2I1OA 3K8LA 4YJ2E 4Q8UA 4GFIA 3E08A 2FHFA 1NSJA 3TN3A 3T44A 2REQB 3S46A 3QHOA 4DI8A 4FX7A 5AN7A 3V5CA 4KX6A 1Z41A 2ZRVA 5CJ5A 5LHEA 2DW6A 4IPNB 1XSKA 4HWFA 2QCFA 3LY0A 5DMLA 2CETA 3WD3A 3I68A 3WLQA 2WCAA 3VM7A 2E09A 3SCTA 4JTDA 4NPPA 4YXGA 4ERIA 1AUSL 3H24A 3QW4B 4EOZB 2PDIA 1GYNA 2IAKA 4TV6A 2HH7A 2FJKA 2Y7DA 3CB3A 3HB9A 4PN2A 3F1QA 3H2FA 4WJEA 5GONE 3I9WA 5I7GA 3ZKRA 3MCOA 4JKMA 4D8ZA 5F3JA 5D33A 4XVEA 1XH2A 4JI4T 4J2CA 1OADA 1H7RA 2PPGA 4ZO6A 3FB2A 3PWIA 3AXJB 1JNZA 3PSWA 3BCJA 5C8YE 4JN6A 1RP8A 4ML9A 1WDDA 3QMSA 3NVTA 4HFDA 2PWEA 3CQCB 1UD2A 4M6UA 1E9ZB 3VKAA 2QCLA 4GXPA 4L9YA 3GKAA 1GPWA 1YTKA 4GZ7A 5AC4A 3E0WA 2EPOA 2ZRXA 4WY0A 4H2HA 3L5LA 4HZMA 2ACQA 4ZQOA 4PJMA 5AC8A 3EX6A 2VT0A 4F66A 1LLOA 4FNSA 2FZMA 3KL3A 3UFYA 3HL6A 1VGAA 4HNLA 1AJZA 2WBGA 3SEPA 3RXZA 5G4HC 3BV4A 1OY0A 4S3CA 2HPJA 3UR2A 4QJ1A 1ICSA 1J0HA 5IUXA 3O3RA 4M24A 2R8WA 3AEBA 4C6JA 3LYEA 1TPUA 2UV8G 2C1IA 3QPEA 4GPNA 1L8NA 3VCCA 4AKIA 3OPSA 3O15A 3TTEA 2Q9QD 2ZUNA 3M0IA 4CNNA 3HJZA 3USBA 4FAMA 4GKTA 5AQKB 3CYJA 1W1YA 3O1HA 3HJEA 1WYCA 1XFCA 2NWRA 5LIUX 1GYMA 2PZ0A 4OYKA 2CZVA 3WMBA 1O5XA 3IA3A 1EXBA 3R11A 3WLOA 2NTXA 5BMVE 5FP3A 2NXGA 3LI1A 2QA7A 2ONEA 1VEMA 3VCRA 5GJMA 3E02A 3UBPC 5ABGA 3W2KA 2W5FA 3CL6A 3P67A 3Q67A 4GIWA 2E9XA 3URQA 1Z42A 1ITQA 4FK9A 5HCMA 1M7XA 5KITA 5IXEA 1PVNA 3U6WA 4L1WA 5CSSA 5JTGA 1DEDA 1VFUA 4O15A 2WM9A 4N4PA 3I65A 4Z1AA 5HEGA 3U3IA 1AVAA 1XDLA 4D6EA 4L4PA 1IGWA 5CB4E 1W32A 3QPZA 3HPXA 3MSYA 2HPIA 2E68A 2A3CA 3EPNA 3PC0A 3TN5A 1I6NA 4FI5A 2XFYA 3MP5A 3QHMA 3MV01 4C5YA 2JBMA 4ZS2A 3H55A 2ISWA 2UXBT 4X2RA 3CYVA 1UCWA 2GWGA 3KTXA 4XAYA 3CM4A 2BBHA 4WZHA 1BD0A 2DZTA 4MGGA 2NWBA 2WJDA 1UWQA 2YLLA 3WJWA 1IGSA 2VR2A 2YDSA 2XVKA 1E2AA 4GIRA 1BR2A 1OIFA 3PN8A 3RQUA 4UTTC 2X16A 4Z2KA 1FWDC 2LEHA 4H8HA 3BANA 4AQFA 1K4HA 1FKWA 2W6RA 2GUYA 3FA4A 3FGCA 1R7AA 2QCHA 3L4YA 4PAGA 3AZTA 1EGVA 3ZMSB 1FH8A 3AISA 3RIFA 1WDPA 3BCDA 1PBGA 4W7UA 7TAAA 1WOBA 3DYMA 2PSNA 2YKKA 1E5JA 3ARQA 3W71A 5H6HA 3SS1A 2PU0A 4DYJA 3VIHA 3W22A 4PJLA 3F2DA 3MY9A 3BH4A 1AK5A 4DX3A 1OYCA 3BG5A 3LHYA 2GJPA 5J5RA 4G8TA 1SVDA 4AEEA 1KBIA 3BAXA 2ISFA 1D7KA 4JUYA 3R94A 4LU0A 4Q4RA 1KEYA 3CUJA 1QWKA 4ECLA 3KOWA 1NELA 3AMKA 5JDHA 4JDYA 5LB7B 5J1GA 2OWWA 2KNDA 4JTFA 1KGWA 3N34A 1ICQA 1YPXA 2QGSA 4QSHA 2B7QA 4Q6JA 1FQ0A 2QJMA 3TKLB 2YCEA 4GKLA 4JS3A 1GKRA 2PURA 3EA1A 1R3WA 3NG3A 4GBUA 1DIDA 4XB3A 1WUFA 1Q65A 1H7XA 2NXIA 1V0MA 2XH4A 1BR0A 3RH3A 2Q3OA 1M03A 3P7IA 2CLIA 4O1AA 2VYOA 3WJYA 4AX7A 3DFOA 5D30A 1U22A 2ZDSA 3IVSA 2IQ0A 1A3HA 4DZIA 3KVMA 5CZJA 1BWLA 3EKZA 3CQ0A 5IBXC 2OA5A 5B7YA 3AHZA 3UJSA 3P6LA 4AVFA 1TUFA 3PJXA 3WD0A 1SJCA 3REQB 3WQCA 3R1ZA 3V1HA 3D3FA 4AWTA 3UUMA 1DQWA 1XLDA 4BQ4A 2XQ9A 1K8YA 3GXMA 4GZJA 2V1DB 4LF5T 3M64A 3S42A 3BJSA 2H9AA 4FX8A 6REQA 5F4SA 1RK5A 3FX4A 3H6OA 1EP1A 1CXKA 1OEDA 2PB1A 3MUAA 3TLLA 2B4GA 5DT5A 2GJRA 3MDWA 2NT0A 1XKYA 4PMNA 1UZHA 1Y64B 4RPQA 2ZX9A 3OBVE 2QCCA 2VZVA 4O4LE 3N9OA 3IGXA 3B0VC 3PPHA 4HMDA 4C1KA 2JF6A 2DWGA 1NOUA 4RE4A 1PZ3A 3OVRA 4IE0A 3HN3A 1ITXA 3N2CA 3OVUA 2BVWA 5A6AA 2LSYA 3PWAA 1WO2A 2V30A 3N4EA 2BP1A 3LHUA 1A5AA 4JZ5A 2UUCT 2ZOXA 3D46A 3CQGB 2WQYA 1AJ0A 1S5NA 4RJEA 1H1YA 3PFRA 4Q4QA 4O4WA 4AW7A 3T08A 3DFN