2W61A

Saccharomyces cerevisiae gas2p apostructure (e176q mutant)
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
480
structure length
470
Chain Sequence
GVSFEKTPAIKIVGNKFFDSESGEQFFIKGIAYQLQRSANGAFETSYIDALADPKICLRDIPFLKMLGVNTLRVYAIDPTKSHDICMEALSAEGMYVLLDLSEPDISINRENPSWDVHIFERYKSVIDAMSSFPNLLGYFAGNQVTNDHTNTFASPFVKAAIRDAKEYISHSNHRKIPVGYSTNDDAMTRDNLARYFVCGDVKADFYGINMYEWCGYSTYGTSGYRERTKEFEGYPIPVFFSEFGCNLVRPRPFTEVSALYGNKMSSVWSGGLAYMYFEEENEYGVVKINDNDGVDILPDFKNLKKEFAKADPKGITEEEYLTAKEPSVECPHIAVGVWEANEKLPETPDRSKCACLDEILPCEIVPFGAESGKYEEYFSYLCSKVDCSDILANGKTGEYGEFSDCSVEQKLSLQLSKLYCKIGANDRHCPLNDKNVYFNLESLQPLTSESICKNVFDSIRNITYNHGDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanisms of Yeast Cell Wall Glucan Remodeling.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Glycoprotein
molecule keywords GLYCOLIPID-ANCHORED SURFACE PROTEIN 2
total genus 164
structure length 470
sequence length 480
ec nomenclature ec 2.4.1.-:
pdb deposition date 2008-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03198 Glyco_hydro_72 Glucanosyltransferase
A PF07983 X8 X8 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1040 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2w61A03
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2w61A01
1HNYA 4UFKA 2NT1A 3RCNA 4U3AA 2CBJA 4DWSB 4N0RA 1XSJA 5GNXA 3WH9A 4FK9A 1XV8A 4QP0A 5M17A 7A3HA 4JKKA 5A6SA 1KWGA 5JUVA 2DGAA 3N17A 1BGGA 3FY1A 3QHOA 1JFHA 2ZWYA 2OYMA 3AOFA 3PZVA 2ZUTA 4CD7A 2E4TA 1B31A 1LWHA 1RH9A 2J8GA 3II1A 1E4NA 3UETA 3ARVA 3JUGA 4J7RA 3SCVA 1NOWA 3L4YA 5I24A 3N18A 3ZO9A 3CHEA 1TVNA 4M56A 1HF6A 4PMNA 2VJXA 1MXDA 3AIQA 2XFRA 1VRXA 3OIHA 4OJYA 5A2CA 1OGGA 4MAVA 3VIJA 1LG1A 3W37A 1GQJA 3W27A 1OCQA 2YL9A 1NM9A 1E4MM 3BCFA 5DT7A 1J0KA 2GK1B 4AISA 4AC1X 4HA4A 1OD8A 2WKGA 3ARSA 3EDJA 3OA5A 2E8YA 1PJ9A 2V5CA 1B2YA 1XD1A 1J12A 1DWIM 3AIRA 3A4AA 2UY2A 1BTCA 5A8OA 2W4XA 3L4TA 2F2HA 3GXFA 3VGHA 3WFLA 2WHKA 1OB0A 2G3IA 1BVNP 4CCDA 1GUVA 1HJSA 4F9JA 2XVGA 3FW6A 1GQLA 3VINA 1SMDA 2BFGA 4HPHA 1BFNA 4BF7A 5I2UA 2YL6A 2C8NA 3NSXA 4ZFMA 5IHRA 5CJ5A 3CHDA 1BYDA 4D72A 3CPUA 4AD1A 3BMWA 2DT2A 3ARWA 2DH3A 3N1AA 3WKZA 3PZMA 4GZJA 5HOSA 5GQBA 2DSVA 4EANA 4U5IA 4AD5A 1HKIA 3CHCA 4AEFA 3ARXA 1F4HA 1M01A 1UQZA 2EPKX 1W1TA 5I3DA 4YHGA 2V3GA 5AYIA 2DSUA 1EO7A 1QHPA 3F5JA 4Q7NA 2J79A 2DSWA 1V6WA 3WDJA 1L8NA 4ZE4A 2PBOA 2VT0A 1W2PA 3TP4A 1C7SA 3EMZA 2E0PA 4OOZA 1CWYA 3LPPA 3CUIA 4TTGA 2EPMX 1OIFA 4OZOA 5FL1A 4DWSA 5I77A 1HJUA 3BAWA 1OD0A 5ECUA 4D6FA 3IJ8A 2UY5A 4JFWA 1MFVA 1G01A 1UWTA 1Q6FA 3VMPA 4GQQA 4QAWA 3UG4A 2JF7A 1CXLA 4JL2A 2J7BA 2CITA 2FHFA 3WEMA 4M24A 1E6RA 5IDIA 3WF4A 3B9EA 3TTQA 4AIOA 1VEPA 2VQUA 5FKYA 3CUHA 3CZEA 2UWFA 3M46A 2ZXAA 4JFVA 7TAAA 2CXGA 3OGRA 3AXIA 4J27A 2VX4A 3M6DA 3RM9A 5AYBA 4A4AA 4B15A 3VIIA 3OLGA 3FXYA 2XWDA 4MDPA 1Q6EA 1JI2A 3D3AA 4WSKA 3AIVA 3GH7A 1KCKA 3ARPA 4KGLA 1W9XA 3IJ7A 2W66A 2B31A 5CXPA 1WAWA 3DYPA 4PMDA 2E40A 3VKKA 5HPCA 4H04A 1MQQA 2ZUVA 3W24A 3B8SA 1JD7A 1UKQA 1XD0A 3CZKA 4TVUA 5A6AA 3MANA 2WBGA 5HNNA 3E1F1 4NF7A 2V3FA 3SCRA 1EDTA 2D3LA 4JCLA 2W91A 4PN2A 1B0IA 2FDMA 2YLAA 3DC0A 5JBFA 3KEHA 4MAZA 1GJUA 2WVVA 2ZX8A 2GUYA 3SCNA 1QI5A 3PZIA 4D1IA 1BG9A 4KH2A 2VX6A 1GOOA 4UZSA 1E55A 3RMEA 2ZXDA 1IZJA 1XSKA 1UYQA 1IZKA 2XVKA 5EFDA 1WZLA 2Y8VA 4TX6A 3PZTA 2BVYA 4YN5A 4DWSC 2X2YA 3DYOA 1EIBA 3A6OA 3DYMA 3WUBA 4U5KA 2BHZA 5JBDA 1BYCA 5E09A 3AROA 4ATWA 1I1WA 3DECA 4W7UA 1GVYA 1W9PA 1BQCA 1OGSA 2XVPA 1V3LA 1FFRA 1K9TA 5GPRA 2JIWA 5CGTA 3IANA 4TXEA 4P8UA 3I3BA 2RGLA 2G8ZA 3W82A 3NSNA 1U30A 2XPKA 4GIAA 4V27A 1H1NA 4PMZA 4LYQA 1K9DA 1WB0A 1DWHM 5DF0A 2OYKA 2DQXA 3FHAA 3AZTA 1C93A 1BYBA 1J0HA 4UCFA 3WFZA 5FOOA 3AMDA 1HJVA 4OKDA 1HKJA 4X0NA 3QHMA 2OWCA 3WEOA 2YOCA 3VM5A 4JIEA 1J0IA 1W1PA 1KBKA 3UEQA 3CZGA 5DO8A 3AS2A 1LJYA 2WWCA 1OM0A 4M81A 3FHQA 3ECQA 3FAXA 4CU8A 4MNMA 3CMGA 3UG3A 1S46A 5D8ZA 3VIHA 4LXFA 1QI3A 3MV11 3VPLA 3CZJA 3U57A 2DT3A 2X0HA 4MJ4A 1TFVA 4U3CA 3TTYA 3KL3A 4HTYA 1FH7A 4JFSA 2WNWA 4J3UA 1ZBKA 1ZL1A 1H5VA 4U31A 2Y24A 2J62A 1DTUA 1EXPA 3VMNA 4UNIA 4GZIA 4Y7EA 2AMGA 1EA9C 2VX5A 5JBEA 4AIEA 2WCAA 3WDQA 3W28A 3A4WA 2ZUSA 1J0ZA 1GOQA 4PBGA 2V3DA 2GJRA 1ZJBA 1ISVA 1E0XA 2JE8A 1PBGA 1W1VA 2WLZA 4AW7A 1RP9A 1QPKA 4JAWA 4CVUA 3VTRA 2YJQA 1EDGA 2ZX5A 4AXNA 3W4RA 2O9PA 2UY3A 4LYPA 1JD9A 3AYRA 2W92A 1MW2A 1FH9A 1UUQA 3WMBA 1XSIA 1UKSA 3OZPA 1E40A 2XJ7A 3CGTA 2AAAA 1J0YA 4CD4A 4U33A 1Q6GA 1KGWA 4E8CA 1QW9A 4B16A 3I3DA 3RDKA 4TX8A 5ABHA 3FAWA 2BV9A 1C90A 4HZ6A 3MUAA 1KXVA 5FD0A 2ZUUA 3K8KA 1OIMA 1TA3A 3T2PA 2YDQA 4BS0A 2EEXA 3MMWA 1E4IA 1JDAA 5A6BD 3WBEA 2VZVA 4MB1A 4TTUA 4PEEA 3POHA 1E6NA 4PTWA 3VGGA 1DWFM 5A3HA 5E0FA 1JDDA 4W86A 6A3HA 2EPOA 3U7VA 1ZBWA 1E6PA 5A95A 3AS3A 2J7FA 2J25A 3W25A 2IXVA 3D5HA 2BY1A 1O7AA 2DSZA 1ESWA 2QPSA 4JZ5A 1NARA 1A47A 3T2OA 3VGFA 4P7LA 4YHEA 3K46A 2Q8XA 2J7HA 1UD6A 1GONA 1UH3A 2EXOA 4QLLA 1JNEA 1PZ3A 2OSXA 1W9UA 4JFUA 3RIKA 2E9MA 4GO8A 3CO4A 3W29A 1BVZA 4HMCA 2GJXA 4IPNB 1UD3A 2D20A 4WJXA 1WPCA 5GNZA 1D2KA 1KFWA 3VIPA 2DIEA 1CGXA 3AYSA 2F8QA 2CBIA 2OWXA 1G94A 1XH2A 1EQCA 4AZ5A 1MW3A 2UY4A 1MQRA 1ZB5A 2DH2A 2YLLA 2F61A 3ZSTA 3G6LA 1HIZA 2FHBA 4D1JA 2QPUA 2OWWA 1Q6CA 3VIGA 2WM0A 4XZBA 4OUEA 2W67A 1E5NA 3WN6A 2PC8A 4MJ2A 1XH1A 4BQ5A 3VILA 1F4AA 1CBGA 5CPQA 3PZ9A 3MSDA 2V3EA 1QNQA 3WNMA 4NRSA 1NOUA 1FP9A 3RJYA 5I23A 2XUCA 4J3WA 1UZ4A 1GHSA 1DP0A 4J3TA 4GO9A 3T09A 1MQPA 3BSHA 3UERA 2AOSA 4H8UA 3LPFA 4BZYA 2WYSA 3PZUA 1H49A 4WLCA 1VFMA 2OSYA 1GOIA 2VOTA 1CLXA 2PWEA 2E8ZA 3VUPA 2WANA 2TAAA 3KL0A 1ODUA 4PRWA 5I79A 4PMRA 5CGMA 4JHOA 2WMKA 1UKOA 4V28A 2VCCA 4GZEA 2WAGA 1JG9A 4H7VA 4ML4A 3VD4A 3OLEA 2D3NA 2WK2A 3SCSA 5A94A 3VGEA 1C8YA 2CCRA 4UFMA 5LA0A 2WVVB 3WD3A 3ZJ8A 5BROA 6TAAA 4MPKA 4E8DA 1K6AA 1EHNA 1BF2A 1ODZA 1WKYA 3TTSA 3BCDA 3U5UA 4OIFA 1FH8A 4F79A 1WDPA 5FIPA 3OB8A 3WMSA 1WP6A 1UWQA 2WSKA 2XM2A 4ACZA 3RM4A 1M7XA 1XC6A 2QMKA 2J74A 1JFXA 1TCMA 2VZTA 3O6AA 3O2LA 1B3XA 3ARYA 1LF1A 1HVQA 2O9TA 2Y4SA 4P8VA 1FHDA 5A8NA 2G4FA 2D22A 1QI0A 4M82A 4PMVA 4J3VA 3O9NA 4WKHA 5D9NA 1FOBA 1V0KA 2XM1A 1UHVA 3WUFA 1GZJA 1L0PA 3VX0A 3MMDA 1DEDA 1M03A 4CCCA 2WSPA 3GBDA 3T08A 1V02E 3TA9A 5A2BA 3F5LA 2JFEX 5EMYA 2WKLA 4CGTA 2XYLA 3QGVA 5F7UA 1GCYA 3NIYA 3L4WA 5IFPA 1JDCA 5A1AA 2J7DA 2CKSA 2WCSA 1JYWA 4UZUA 1B1YA 4TOQA 1Z32X 3N12A 3ZT5A 3CUGA 1VBRA 1W3KA 1SYTA 5A8MA 2VX7A 2CETA 5C70A 3AXXA 1E71M 2WVUA 2FH8A 4F9DA 1SFSA 4UQEA 3L2LA 2E3ZA 3ZSSA 2BY3A 4AZCB 1ZBVA 2WMJA 3KZSA 4D6EA 2ZX9A 3SCOA 5C8BB 1G0CA 1W1YA 3ZQ9A 3WDPP 4UFIA 5I6SA 1ZJAA 1VAHA 1ISWA 3AHTA 1WZMA 1DHKA 1GJWA 2BXYA 1TVPA 2QV4A 1E9LA 4X9YA 3GXIA 4RE2A 2OSWA 3WD0A 2XG9A 4DWSD 3IAPA 4AZCA 4GPNA 1JIBA 2ZUMA 1E70M 5AC4A 5CLTA 3G6MA 4PMQA 4BQ3A 5BRPA 1UH4A 3GXDA 3WUGA 4EKJA 1V0NA 3AHZA 5HDRA 2GDUA 1FHLA 1NQ6A 5GNYA 1H2JA 2DT1A 4B3KA 4N42A 5FL0A 1H0IA 4UOQA 2VTFA 3TONA 1CZ1A 1GOKA 5IFTA 2WPGA 1EQPA 5D4YA 1EHAA 1A3HA 4LGXA 1B3VA 2QMJA 4HP5A 1HN1A 4CKQA 4BA0A 2DT0A 1GQKA 1ZU8A 4LYRA 3AMGA 5E9AA 2DDXA 1J11A 5E6YA 4E4PA 3NCOA 2BY2A 3M7SA 2ZICA 4ACYA 4FLRA 3ARZA 4B9YA 3K8MA 4MNLA 4F8XA 5CLWA 1MYRA 1H41A 4FLSA 6CGTA 1CECA 2O9OA 1P6WA 1UR0A 3TTOA 1UD2A 2WB5A 5A69A 3AMLA 2EJ1A 4D6CA 1JZ2A 3VGDA 3HN3A 3EMCA 2WBKA 1UR2A 4HU8A 3VIMA 4AZIA 5BYWA 1G9HA 3VU2A 1LL4A 4CUCA 3W26A 5KZ6A 1EO5A 2CPUA 3CHFA 1WZKA 3AS0A 3AQUA 3L4XA 1J18A 2YA2A 1E3XA 4HOWA 3BAIA 1BYAA 1XYFA 3WQ5A 2FGLA 3AMCA 4ATDA 3FN9A 1BAGA 2JEPA 3NSMA 1UWUA 5LYRA 3QOMA 4W84A 3RPMA 1G1YA 1JF5A 3IJ9A 4XUYA 2C0HA 2JF6A 4GI9A 1B3ZA 1CXEA 3SCUA 4WK9A 3N04A 2YBUA 4BQ4A 1SR0A 4IUGA 2VVSA 4M29A 1YHTA 3AISA 4RE4A 4B3LA 1VFOA 4WIWA 4XZWA 4PSRA 5FCZA 3M07A 2VCBA 1E72M 3VO0A 2G3NA 2XSBA 1ISYA 1UOKA 4NI3A 1OBAA 3A3HA 1R8LA 3PBGA 1V6XA 2CKRA 4P7QA 4GI8A 4S3JA 3T2QA 1OWQA 5CSYA 2WZEA 1KGXA 3CMJA 2GK1A 3CUJA 4CD5A 2O92A 4HOZA 1LQ0A 2VVNA 5TD4A 3AMKA 3WQ8A 2X0YA 1H0GA 5CG0A 1RPKA 3L2MA 1JAEA 2XGBA 1I1XA 1WNOA 3PTMA 4Q22A 4JFTA 1LL6A 3ALGA 1QBBA 1QNRA 4MNKA 2YA1A 1LL7A 4QLKA 5D8WA 1QBAA 4XB3A 1C8XA 1RD6A 1K9FA 1WCGA 4PSPA 2ZXQA 3BAYA 3ZJ6A 3VMOA 4MTVA 1EH9A 1ISXA 4MB5A 8A3HA 3GYCA 5A8PA 2V5DA 2HISA 1WE5A 2VI0A 4EE9A 3VNZA 1H3GA 3SCPA 3WSUA 3QHNA 4ZENA 1JXJA 3PZGA 1KB3A 3LPGA 1NWRA 1MFUA 2GJPA 2YKKA 2ZOXA 5M5DA 2X8RA 4U2YA 3SCWA 3AZSA 1IT0A 1W3JA 4DM2A 1ZBCA 3DHUA 4UFLA 4WKFA 4PTXA 1LLOA 4X0VA 2J75A 4Z2LA 4GINA 4AY1A 3VOCA 3OGSA 3WQWA 1AQHA 1AQMA 3LMYA 4WSJA 4W88A 2W62A 3THCA 2WVTA 1Q4NX 1VJZA 4H2CA 1AVAA 2YBTA 2WMGA 3VD7A 2O9RA 3GTNA 1E73M 1E15A 3PTQA 4Z2KA 1KQZA 1HJQA 1DWAM 1W3LA 2A3EA 1RP8A 4A3HA 1QVBA 1XYZA 1JNDA 5A6KA 4F66A 5EBAA 1FFQA 1V6UA 5ABEA 4DUVA 2XGIA 1CLVA 4JL1A 2EBNA 1V3HA 3WQ6A 3WNLA 3W0KA 1W9VA 1QNOA 4JKMA 5BXRA 4PCSA 4D6JA 4QFUA 4ATLA 1CXFA 2ZUNA 3BSGA 1CPUA 2X1IA 4NSBA 1VIWA 1QI4A 2G41A 3SUWA 5A6MA 1JZ5A 4ZXLA 4A3YA 1DWJM 2D0FA 1UZ1A 2WZHA 3UG5A 5A2AA 2XVLA 4H41A 2BHUA 1CEOA 4GQRA 3BLKA 3MMUA 3WNPA 3PZNA 4JCMA 4AYSA 4PMUA 3WH8A 1GOWA 2D1ZA 2Z1SA 4C7FA 3ALFA 3L4ZA 3CLWA 3WD4A 1JYXA 2X09A 1GQIA 3K4AA 1CGTA 1VEMA 1UR9A 4XX6A 1NWTA 3MSGA 5M03A 2BXZA 4WF7A 4AIUA 5HPOA 3WELA 1QNPA 4MB3A 3W81A 4CN1A 1PPIA 3SUVA 2WC3A 5A6JA 4KMQA 2IUZA 3LPOA 3N9KA 3U7BA 1X6LA 2FGZA 3KL5A 1KCLA 3EBVA 4AD4A 3PTKA 1H4PA 1J01A 1OT2A 2G3MA 3BGAA 3L4VA 3OZOA 2YL5A 5I0DA 1HP4A 1CNVA 2FH6A 4CD6A 4D6HA 4QLJA 1K9EA 4MDOA 3AIBA 2WMIA 3WF0A 4RE3A 3DHPA 3W6LA 1CIUA 1Y7VA 4R27A 3VX1A 1HJWA 1UD8A 2VUYA 4HOXA 1UG6A 3EYPA 3SURA 3UR8A 4EAMA 1GNXA 4W8LA 7CGTA 4W7VA 3CZ8A 3SEPA 3OLIA 3GH5A 3PHAA 3GM8A 1C91A 3PN8A 4JKLA 1JL8A 3OBAA 1US2A 1X1NA 4UFHA 1BSIA 2Z1KA 1O6IA 4LX4A 1TG7A 1JZ6A 1V03A 3AXHA 4OBRA 4W5ZA 1QNSA 4CD8A 4J3SA 3K1DA 1CXHA 2CBVA 1EOMA 2EPNA 4PMXA 1PAMA 3MU7A 2OYLA 4H8VA 4ZE5A 2CYGA 1U2YA 4P8XA 3ZT7A 1W9BM 5E70A 1M04A 1JYVA 2J4GA 3VDAA 1QHOA 2ZWZA 1V3JA 4BQ2A 4UQDA 1E6XM 4NZCA 1E43A 3CBWA 1OGBA 3AHVA 3WQVA 4J3XA 1HL9A 2VR5A 4TVCA 4CN4A 1HKKA 3NJ3A 5ABFA 1JZ3A 2XIIA 2A3AA 2BHYA 5D9MA 1NH6A 4W8BA 1KWKA 4CVWA 3VDBA 3WDIA 1R86A 2GSJA 4AD3A 2DSKA 2BVDA 1KQYA 4HU0A 3GNPA 1V08A 1CENA 2A3CA 2IXUA 2CIPA 4HA1A 1R7OA 1GPFA 2PWHA 3W6MA 1VB9A 1PX4A 4L4PA 3WH7A 2PWDA 1C3FA 3GXMA 5BRQA 3BMVA 3BH4A 1B9ZA 2CESA 3NYDA 2XFYA 4C7DA 3QR3A 1XH0A 3TOPA 2J7CA 3N13A 1PZ2A 4ACZB 1WO2A 3IAQA 4PMYA 1IV8A 1JI1A 3SUUA 3VD3A 1UWRA 3SUSA 5DEZA 2VZUA 2HVMA 1V0LA 2WMHA 1ISZA 4W93A 2YA0A 3VNYA 1JAKA 1TE1A 3IK2A 3SIMA 2NT0A 1QOXA 1E6QM 1V3KA 3WDRA 5A6LA 1HL8A 3MUZ1 3UCQA 1VFFA 3WENA 5I5RA 4W89A 1MVYA 4FMVA 2XVNA 4IISA 3WD1A 1UR1A 4K68A 1CXIA 1CYGA 3BLPX 4BCEA 1KR1A 3ZT6A 2WMFA 2YDSA 3WIJA 1HT6A 4B9ZA 3NUKA 2W5FA 2CERA 1V6YA 4J28A 2D0GA 1UWSA 2C7FA 1TA3B 3A4XA 1GHRA 3RJXA 1OINA 2CNCA 4P7OA 2DEPA 4TVDA 3THDA 4W85A 4CN6A 2D23A 2PWFA 3KWXA 2VZOA 4PUEA 3EDKA 1VJSA 3MO4A 1DWGM 1AQ0A 4QCFA 3WH6A 3CIVA 2FHCA 2WHLA 2PBGA 1W91A 1UA3A 4Z2JA 3OGVA 1VEOA 4H8HA 3NDYA 1XHGA 1PX8A 4AD2A 2ZIDA 3VIKA 1V02A 5D9OA 3AIWA 3ZOAA 1NWUA 5A8QA 1R87A 2W63A 5BXPA 2YL8A 1BGAA 5M3WA 1VFUA 2G3JA 3WBAA 3SUTA 4MNJA 1OSEA 3EDFA 2Y5EA 2Y8KA 3MUY1 5AC5A 1TUXA 1E1FA 1JYNA 4IPLA 4P8WA 1MWOA 2PB1A 5AY7A 1LWJA 1KGUA 5LA1A 1B3WA 1ITXA 1V3IA 3ZM8A 4W5UA 3L4UA 5DFAA 1XRVA 1GOMA 1HX0A 5CQ1A 1PEZA 3AFBA 3HJEA 3T0AA 3BAXA 1PIFA 3WF2A 4AWEA 1R7AA 2WC4A 2QLYA 1VENA 5KEZA 2GDVA 4UOJA 4Z2HA 1QHZA 3WMCA 1GVIA 1J10A 3EDEA 2W61A 4KWUA 4UOZA 1XCWA 2XTKA 1WDQA 1E0VA 4CU7A 1JZ4A 2E9LA 3N15A 1G5AA 1EDQA 4UQ9A 2WZIA 4HMDA 5JIPA 2JALA 4QCEA 3WUEA 4GI6A 5DMYA 4S3KA 2YDRA 1GW1A 8CGTA 1HJXA 1JZ7A 3WF3A 2WHJA 3AHXA 1E3ZA 1CGYA 1ITCA 2J78A 1N82A 5I78A 4LQ1A 2WC7A 1W9DM 4PMOA 3AZRA 4DUXA 3UESA 2Y2WA 4D6GA 4PYSA 2A3BA 2GJXB 1NWSA 2BY0A 1NOFA 1E1EA 1W2VA 3WF1A 3WNOA 2WHMA 4AZ7A 1YQ2A 5ABFB 1TR1A 3AI0A 1E56A 1W32A 2EQDA 1WZAA 5BCAA 1B90A 1LG2A 2WLYA 4YPJA 1KXTA 5DT5A 3WNKA 3ZJ7A 3VD9A 4W8AA 4AZBA 1CXKA 3WEZA 2VQTA 3PZOA 3MKKA 4URIA 2JIEA 4W87A 1KXHA 4KGJA 5ABGA 3J7HA 4UQCA 2QHAA 4QDMA 5CPTA 1ECEA 1CGVA 2GVYA 1HKMA 3BAKA 1MW1A 3HMCA 1UWIA 3MS8A 4PTVA 5IHSA 3WH5A 1UD4A 5D9PA 4D6IA 1Q6DA 1I75A 2VL4A 4WKAA 1AMYA 4TUFA 2BVTA 4C7GA 1TMQA 4V2XA 1HVXA 4RL3A 1B30A 1TZ7A 3BC9A 1C8QA 4L4OA 1C92A 1HXJA 1UQYA 2DIJA 4NRRA 4M8UA 1J9YA 1NP0A 3B9AA 3ARUA 4R5EA 5E0CA 4W7WA 3WDHA 3T0BA 4U2ZA 1UA7A 2XIBA 2WMIB 3UR7A 5BXTA 3SCQA 1XGZA 2VRKA 3NDZA 4XV0A 2XFFA 3GBEA 1CTNA 3CZLA 4AZHA 1U33A 1H09A 1NP2A 2D0HA 5CPSA 9CGTA 2QF8A 3PZQA 1B3YA 1FP8A 4MB4A 4Z2GA 5HBFA 5CZKA 3ZMRA 5EFFA 2VR4A 3AJ7A 3AICA 3U5YA 2VC9A 2BS9A 1ZS2A 3OLDA 1QI2A 2J7EA 3BAJA 3CTTA 2YIHA 1US3A 2J7GA 4AZGA 4PCTA 1KBBA 5E6ZA 2ZX7A 2ZUWA 1JGIA 4AZ6A 1E4LA 3K8LA 1UKTA 2CHNA 3ARQA 1BLIA 2PWGA 4GXPA 4HZ8A 3FNDA 3ARTA 4GKLA 4AMCA 4UQAA 3RO8A 1JXKA 1BG4A 5LA2A 1EGZA 3EDDA 1J0JA 4DUWA 1FA2A 3GNOA 2VO5A 4OBSA 1VBUA 4D71A 4CU6A 2VMFA 1VF8A 1D7FA 1JZ8A 3ZR6A 2WW5A 5C71A 2VRQA 2XSAA 3T0DA 3W38A 2PI6A 4IM4A 4UR9A 4PUDA 1QW8A 1PIGA 1MW0A 2RGMA 3EMQA 4LPCA 3S2CA 3ZIZA 1M53A 1W3HA 4HPGA 2ZE0A 4AD0A 1V0MA 2WXDM 1XCXA 3RILA 2X05A 3CH9A 1OT1A 1E6ZA 3S6TA 4HA3A 2OLHA 3VGBA 1D3CA 1UH2A 2VNCA 4FLQA 2MANA 4E2OA 1X6NA 1KXQA 3WL1A 1H11A 1BHGA 1R85A 3I3EA 2WCGA 3VVGA 2VCAA 1EOKA 3BXWA 2J77A 2WVSA 3AIEA 1PX3A 3F4VA 4M1RA 2EPLX 1WDSA 2J47A 2WWDA 4ZEPA 4PTMA 4MADA 4HZ7A 4UTFA 4CCEA 4KRTA 3VD5A 1UKPA 5IXEA 3QOKA 3WL0A 1MXGA 5HXMA 2A3HA 3WY1A 3GDBA 1C7TA 1WDRA 5BXSA 2E9BA 2CBUA 4FF5A 2D24A 3CUFA 4KRUA 3GH4A 1E0WA 3ARRA 3AIUA 3MUIA 2VZSA 2GFTA 2VRJA 1E6SM 3AHYA 4UFJA 2XHYA 1V6VA 3SCTA 2EO7A 3GZAA 3WNNA 4P7NA 2BNJA 3F5KA 3VIOA 5JIWA 3POCA 4ZXOA 3KE0A 3ZJKA 3APGA 3HU7A 2NSXA 3B9DA 2ZX6A 2VURA 1JF6A 4UQBA 3N11A 3VM7A 2PF0A 3A47A 4AEEA 4OOUA 3WQ4A 2JEQA 5EB8A 1CDGA 1BPLB 3AS1A 1CGUA 2J8FA 3OG2A 4JHZA 3K4DA 4P7RA 4Z2IA 1SMAA 4EK7A 2D2OA 3GNRA 3WD2A 1HP5A 1V3MA 3VIFA 4M80A 3W53A 4FLOA 2CHOA 4HMEA 3VDHA 1UR8A 1KR0A 1UD5A 2V38A 4D6DA 2DPEA 4DM1A 2ESCA 1CGWA 2ZXBA 1GORA 3RM8A 1UR4A 5CSUA 3ZR5A 5BWFA 2XWEA 2NW0A 3MV01 3VDCA 1E5JA 2CEQA 5A6BA
chains in the Genus database with same CATH superfamily
4KCWA 2K5BB 2V9DA 2VWSA 2OT1A 1YLVA 3BE7A 5JREA 3KVMA 4Y90A 3N17A 3QV9A 1AZ1A 3FJ6A 3DKJA 3DHFA 3R1ZA 3C3NA 1LWHA 1TPH1 1Z8UA 1RH9A 2J8GA 1NF0A 3ARVA 2R1PA 3MJYA 3JUGA 1MIYA 4J7RA 3SCVA 3UF9A 1NOWA 3TC6A 3ZO9A 4ZS2A 3CHEA 1HF6A 5KTLA 3OBEA 1IXOA 4HU3A 1K8XA 5G2HA 3M0KA 1VRXA 3VI2A 4OJYA 3M5YA 3NQ7A 5HCMA 3TCSA 4MAVA 2NW9A 1MEHA 3DFHA 2XQ6A 3U8GA 5FF2A 1XLMA 4I5XA 2JQKA 1S5MA 1J0KA 2GK1B 4C1LA 3ITYA 5JDNA 4ZZ9A 3ANUA 2WKGA 4LV9A 4ZL1A 2E8YA 5T9CE 2FFCA 2V5CA 3AO0A 1A0CA 3A4JA 3AIRA 4N6FA 2MYSA 4KIRA 5H6RB 2W4XA 1N33T 4PUWA 2ZVIA 2BGQA 4R34A 5AOUA 1AW5A 1HJSA 2Q09A 1UWAA 4PJNA 2H6RA 4C6JA 2XVGA 4GYFA 3ZMVB 4HPHA 4UWMA 3L5MA 2BX7A 1IEIA 3FCPA 1PKMA 3EB3A 4A2SA 1WOBA 2C8NA 2IQDA 3IPWA 1QWGA 2LEHA 3CPUA 4B5UA 3CT2A 4KT2A 3M4HA 3UJFA 4BEQA 3N1AA 4QX8B 4PMJA 3N73A 3IACA 4LUSA 3WLNA 4GI4A 4JQAA 3UU6A 2Y48B 3SOLA 5GONE 2GJLA 1VBJA 1HCIA 4L7ZA 3WJSA 1F4HA 1M01A 4ILBA 4HNLA 4YHGA 3T4WA 2WM9A 2V3GA 2DSUA 5LP6E 3VHLA 3C56A 4H9NC 2J79A 3L3PA 3O16A 4XQ6A 1RA0A 3BG3A 3O6YX 1OADA 2DP3A 3ONXA 4QQUA 2VDHA 4ERAA 4ZE4A 3NVDA 3PB2A 1W2PA 4C5YA 1EXBA 4DLFA 3I6TA 2OXNA 4M1BA 4TTGA 2EPMX 2FVMA 1GKQA 2NVCA 4D6FA 3EKZA 3VRAA 2UY5A 1UCWA 4JFWA 1MFVA 1CCWB 1UWTA 3HQ1A 4GK5E 3CVRA 3W74A 2BKNA 2JF7A 3PANA 4JL2A 4IXHA 3PJAA 3QMRA 2PU1A 1CX9A 4JTIA 2VENA 2Z2AA 2W79A 4MUPA 4O4HE 4A3QA 3C4WA 3B9EA 3TTQA 1VEPA 5FEPA 5EL1A 3A5XA 3HA4A 7TAAA 3KP0A 5DBUA 3OGRA 4J27A 2VX4A 3DG7A 1VCTA 5AYBA 5FJUA 3TYEA 1KBLA 4H4IA 3UCCA 2P53A 1WBJA 1XLJA 4Y9PA 4I9AA 5IHYA 4Y6GA 1W9RA 3LXCA 3FVDA 3AIVA 3NWIA 4H3DA 3ARPA 4LNCA 2PLKA 2PODA 5CXPA 2PTXA 3BK9A 3DYPA 5MHBA 1OVDA 1XDOA 3ZMSB 2I16A 5AHEA 3VKKA 1H7CA 4I9TA 3W24A 1JD7A 3PFMA 3CZKA 3USZA 1MXSA 3PBVA 3P74A 3TN4A 3N34A 4TMCA 2D3LA 3APTA 3HR0A 4YY3T 2C0AA 5LNWA 5D2TA 5JBFA 4YVXA 4XAYA 2BODX 1QI5A 3PZIA 2CLMA 3CPRA 4JY8A 3T8QA 4KH2A 1GOOA 4UZSA 4P09A 2Y8DA 4TV6A 4C1KA 2FJEA 1IZKA 4UMAA 4FNQA 1WZLA 4O4WA 4YN5A 1EIBA 2C5KT 1AK5A 1J8VA 4ATWA 1GVEA 1I1WA 5G2IA 2D73A 4C6LA 1S5TA 3R12A 1W9PA 4L9IA 3W1QA 5GPRA 2JIWA 3EWDA 3IANA 3BICA 1W1IE 2IIUA 1KFLA 2RGLA 1XNRT 2YDAA 2G8ZA 3W82A 3NSNA 4WY0F 2XPKA 2OO6A 3M0JA 4B5VA 4HN8A 4B92A 4PULA 3G24A 1DWHM 5DF0A 2OYKA 5C2GA 4HGAA 1KC7A 4C91A 2ZC1A 1C93A 3ZMTB 1QDSA 3PJXA 1OK4A 3AMDA 4HVXA 4Q8TA 4HWCA 3FEQA 3H24A 3QHMA 2X2GA 3TLQA 3VM5A 3W1RA 4JIEA 1J0IA 3P14A 5IOBA 3PUDA 3G18A 2ZA3A 3HKDE 1KEYA 3AS2A 3MP4A 1HG2A 2OT0A 1H7OA 3V7PA 1Q6QA 1GQNA 4QH1A 4MNMA 3SO7A 2X16A 3FDGA 3GVWA 2J6VA 2Y7EA 1XUUA 5D8ZA 2WP9A 4BAYB 5LMUT 2Z4GA 2PDIA 3EDVA 2X0HA 2DT3A 4QRNA 4WX2A 4JFSA 2IPWA 2W00A 3ZC1A 4J3UA 1GW9A 1ZBKA 3GSMA 2Y24A 5JDHA 1DTUA 1FWGC 4QE5A 3O3RA 4L1XA 5FVKA 5G4EA 3WAJA 1EB3A 1DIDA 4AEOA 3E9AA 1AG1O 1BXBA 1R2SA 3HG5A 3RR4A 4XKMA 2KWIB 1ADOA 2GJRA 2V3DA 4HHLA 1E0XA 3KBJA 5HUPA 1PBGA 2Z26A 5J04A 2RHGA 4YNGA 3ZS4A 1Q7MA 2Z24A 3V35A 5FJRA 1ZP0A 3VNDA 2W92A 5K7JA 3MHUA 3WMBA 2PJQA 5TNVA 4LMJA 3OZPA 3NQMA 1GT8A 3CGTA 3Q5WA 2OGYA 2IMRA 2NWSA 4HFIA 1XIEA 1KGWA 3UY7A 3ZLFA 4IL0A 4B16A 5C9WA 3FAWA 3T78A 1LYXA 2ZM6T 1UBPC 2BSLA 4OFCA 3TYBA 1VGAA 2GQ3A 5ECVA 5FD0A 2ZUUA 3AXJB 3ZWTA 4BS0A 1Q85A 1E4IA 4DO6A 2Z1XA 3S47A 5A6BD 1PTDA 2PC4A 3HKCE 1HTJF 2ZFAA 2VZVA 1Q5MA 1EJTC 3POHA 2Z0IA 3I68A 3EXRA 1MIVA 2JQQA 1AA1B 1G7UA 3TFCA 1F7BA 2TSYA 1O95A 2QJGA 3U7VA 4IGUA 1E6PA 1TQXA 2J25A 2J1DG 2IXVA 1O7AA 2DSZA 4JZ5A 3UUXB 1NARA 1A47A 2XU2A 1PYFA 4UC5A 2Q8XA 4O10A 1KD0A 1GONA 1UH3A 3KV4A 3KV6A 3SFDA 4QLLA 1ZALA 4NHVA 5D38A 2E9MA 2E9XC 3IIZA 3GNNA 3PBWA 2WM1A 5EPDA 5HQLA 4H6EA 4HMCA 4F2UA 2GJXA 3IIXA 1FWTA 2D20A 4EOZB 5F5WA 1RALA 5FXWA 2YCIX 2F8QA 4OQVA 4AKGA 2IKJA 3ZYLA 2OWXA 4H63V 1G94A 1XH2A 2BBFA 1EQCA 1UP2A 1BRLB 1QXLA 2ZA1A 4JYAT 2YLLA 3EX1A 4FNPA 1HIZA 4ZI7E 1PWLA 4C6DA 4HSNA 3CB8A 2OWWA 4B4HA 4U72A 2E09A 2XAGB 3IVTA 4B3ZA 3VE9A 4IE7A 1XH1A 4BQ5A 5HANA 1DJIA 2E5CA 5C7HA 2EF9A 1CBGA 1S2CA 3PZ9A 4O0ZA 5ETWA 4K1GA 1O4UA 1KRBC 1LQ2A 1UP0A 3LK6A 1FP9A 4N4PA 3REQA 3GZ3A 4HKAA 2XUCA 3NZ1A 1UZ4A 2ABBA 3OVPA 1MQPA 3BSHA 4H8UA 4KRZA 2WYSA 1N8IA 3PU8A 2OSYA 4RZ4A 1I8JA 3LSBA 2NZLA 1OCJA 4UTMA 3TLUA 3C3UA 3KV9A 3DI0A 1L2QA 2PDUA 2OLSA 2L3LA 4S2BA 2WSYA 3DDMA 4JHOA 2WMKA 4V28A 4GX8A 1U5JA 2VCCA 4PUMA 1N2VA 3UUNA 3S83A 3KLKA 2D5UA 4ML4A 3S5SA 2LT3A 3VD4A 4HWHA 3KBWA 1DBTA 3OLEA 3UW6A 1GTHA 4QSFA 4O17A 2WSRA 4ZB0A 3R11A 2Y7DA 3FA5A 2CCRA 3KTSA 3GQYA 4UTKA 1HR0T 1H1ZA 1F9CA 2H7OA 4GHRA 4O8AA 5BROA 3KRSA 4I5UA 4NX5A 4PB4A 1WKYA 3BCDA 3U5UA 3M43A 4E3VA 1ZUAX 5ADXL 3RX4A 2I5GA 1RBLA 2XM2A 2WSKA 4MZ1A 3UZWA 5CGQA 4G7FA 2PRMA 4A3RA 5D2YA 1EX1A 3MW7A 2VZTA 4WOZA 3O6AA 1B3XA 3GFXA 3OBVE 3O6DA 3UGRA 3ARYA 4PZVA 5HJLA 4D8ZA 2YR1A 2ZC8A 2Y4SA 1GEHA 4F0LA 5A8NA 4JTDA 3HKBE 1U22A 3S9IA 1FQ0A 4WKHA 4S39A 1FOBA 2XM1A 1NQKA 4GY0A 3LZ5A 1L0PA 3IEEA 1DEDA 1M03A 4CCCA 3NL6A 4L4LA 5CC6A 2WSPA 5M2FX 1PIIA 3W07A 3GFYA 5A2BA 4JI8T 4PFOA 3HGJA 2XN0A 4UXDA 4P0BA 3IARA 4CGTA 2XYLA 5KZMA 4YTNA 1XFBA 2QIIA 3NIYA 1XWMA 3L4WA 3EZ4A 3V18A 2J7DA 4YFSA 3NURA 1JYWA 3PTDA 4I8YA 1KTBA 5FY0A 2OQLA 1I0BA 3ZT5A 3AWOA 2ADAA 4JN8A 3CUGA 1S2WA 1SW7A 1SYTA 3FV9A 2VX7A 1YNQA 5C70A 5BR8T 1R47A 3AXXA 1ZQ5A 3P7YA 5CC3A 4IX2A 2LKGA 2FH8A 2UU9T 4F40A 3GHRA 2GVLA 4D6EA 3P4QA 2DZWA 2OKOA 4IF2A 4ZQRA 1YE6A 3U78A 4A35A 5I6SA 1FX6A 1YPFA 3AHTA 3B0VC 2WJFA 1EGMA 3CIRA 1VOMA 1RJPA 4XKYB 3ANWA 2KZHA 5FAJA 4GY1A 3TYAA 1TVPA 3V0TA 4Z08A 3GXIA 1VPXA 3QEZA 3MBDA 3QOFA 4X5TA 2RKXA 2CXFA 3UBPC 3IAPA 3JR2A 2EJAA 4GPNA 1JIBA 1E70M 1G7VA 3C4UA 5AQGB 5CLTA 3G6MA 4L80A 3GK0A 3CL6A 5BRPA 1EZ3A 1I4NA 3WO8A 4JHMA 3K2GA 2OOFA 4EKJA 5AQHB 2RUSA 2GDUA 1JQXA 5D2VA 3ITGA 2DT1A 1OF6A 4IICA 4B3KA 2X0SA 2QT3A 1XIGA 3UZXA 1PE1A 3DTOA 1EQPA 5D4YA 1EHAA 2VQET 1FDYA 4LGXA 4HP5A 4XIMA 1SJDA 2WNZA 3TMQA 1QO2A 3V36A 1XWYA 1IJ5A 3MYPA 2BS3A 5E9AA 3EX2A 5E6YA 2Y61A 3L21A 4E4PA 3M7SA 4HNNA 1Q6RA 4XAFA 4IHJE 3N4EA 6CGTA 3GC4A 4F0RA 5A69A 3ETUA 1FVPA 2EJ1A 3ABQA 4KWOA 3LMZA 3B8VA 2WBKA 2XUEA 4HYVA 4XAZA 1DJNA 1O12A 3N3TA 3SJ3A 1IAPA 3UFYA 2QUUA 1P6BA 3S1WA 3N2KE 1WR0A 4E2DA 1X7FA 1ZV4X 3W7EA 1J79A 1EO5A 2CPUA 1WZKA 4JQ2A 5AC6A 1AJ3A 5DQPA 4LAMA 4IDOA 4E2VA 2HXTA 4KHZF 2CXEA 1OX4B 1DJQA 3FYOA 3GR7A 3JZUA 4F6RC 1XICA 4PK6A 1BAGA 2A3LA 4UTWC 2JEPA 2L9QA 3V75A 3QGKC 3LZ3A 3IJ9A 4XUYA 5C55A 4O19A 4FXSA 3ETVA 3B40A 4MPQA 3SCUA 1WX0A 1FWNA 4BQ4A 3BV7A 4DJDA 3R79A 2Q9QD 4IUGA 1W3IA 1OYCA 5DXYA 4H19A 1TWWA 3RYHE 4BJMA 5IDZA 4PSRA 3B04A 2ZYFA 2WWVA 4EGWA 4OHFA 1GVFA 1W0MA 4YLWA 4NI3A 1OBAA 4HWFA 4ORIA 1UUMA 1R8LA 3NL5A 5LG4A 3E02A 3OVGA 1VQTA 4P7QA 5KITA 3C52A 3BL3A 4ZI3C 5BMXA 5KETA 1B4EA 1OWQA 5H2ZA 4ZO6A 2V2DA 2X68A 2DW7A 3NQ2A 3WQOA 4NJKA 1TJRA 2LE8A 2O92A 3BQLA 1WXZA 2A0NA 3HJZA 1RPKA 3L2MA 3LRLA 3IJDA 4G56A 4Q22A 1QBBA 1QNRA 4MNKA 3UCDA 2JKEA 3SRZA 1R0MA 4YU1A 5AZ0A 2Z6IA 3LHWA 4H9PC 1RY8A 1J5WA 3CT7A 4GYJA 3K3OA 1RK6A 3VMOA 4MTVA 1GG0A 3CNYA 1MNZA 4PR4A 3AEEA 3LS9A 2V5DA 1JGMA 2VOMA 4JYDA 4DPPA 2NR4A 1A5OC 3AYVA 4CNSA 4EE9A 3VNZA 3W00A 3WSUA 4ZENA 4KCUA 3NQ6A 3SJNA 4NZ5A 1KM5A 4XZCA 3LCXA 2YKKA 2ZOXA 1MNDA 3OZYA 4U2YA 1Z0PA 3WLJA 3BLDA 2Q9QA 1SZNA 1TPDA 4IT1A 3LSCA 4XBJA 4XUGA 3R10A 4Z2LA 4DR4T 5CEWA 1AQHA 4EPEC 1QTWA 4LVBA 4HFBA 2PDNA 3LV5A 4HYRA 4BI7A 4B5XA 3THCA 2WVTA 4GVGA 4XVEA 4HKPA 4JDBA 3CUXA 4MKVA 4OHQA 3GTNA 2UXXB 3AU2A 3THQA 1D3HA 1TB3A 1RP8A 4A3HA 4S3AA 1DXIA 4LAKA 5KZDA 1JNDA 4F66A 2YN6A 4LF7T 3NA8A 1F8IA 5FXXA 2P10A 3TX9A 4NL1A 1IWAA 1LT8A 3ELFA 1AJZA 3GDLA 4MZYA 3J9X1 1CLVA 1W9VA 2P3ZA 2WJDA 4QFUA 3NRXA 3ZCJA 1TELA 4TZ4C 3GWHA 1JCLA 2M6BA 3MMTA 4RE0A 3BSGA 1CPUA 2WZTA 1XPGA 4WOQA 3ZKRA 1DQXA 1VIWA 4OVXA 3WQGA 3OQ8A 4MY8A 5A6MA 4OV9A 3W2KA 5CZSA 4ZXLA 4A3YA 1IXPA 1DWJM 3BURA 2WZHA 4WDXA 4HFVA 1X8CA 2H3BA 3BLKA 3MMUA 4ZB2A 1OCBA 3RLFF 3SI9A 5FNVE 4IT4A 3S6DA 2A9UA 3WD4A 3PWGA 2GSHA 3M7WA 3KVJA 1QFEA 1R38A 3UR2A 2OX1A 3K4AA 4XX6A 1NWTA 3MSGA 2AAMA 3A3XA 3W2LA 5HPOA 3PWIA 1QNPA 4MB3A 3RU8X 1GGOA 3W81A 3PNUA 4LVDA 1XCFA 5A6JA 3I9WA 3LPOA 3N9KA 3MCMA 3AALA 1YDYA 3KL5A 5DMNA 1XYMA 2DJLA 2J6XA 1H4PA 1DU2A 2HH7A 5BNKA 4P2VA 3OZOA 2YL5A 2G3FA 2IAKA 1REQA 4K6AA 1HNXT 4DAIA 4O1DA 3LG7A 4QLJA 2B76A 1KM3A 2J9XA 3N6HA 1K9EA 1T99A 3AIBA 4JS3A 4JIIX 3WQFA 2PFVA 4AQYT 2D0UA 5K4ZA 3W6LA 4RW3A 3TKLB 3CQIA 3NZPA 4QXCB 1Y7VA 3VX1A 3B8DA 1LUCA 3SURA 3UJSA 5A5WA 1GNXA 2UBPC 5HYAA 3FKRA 4XWUA 5EMMA 3HB9A 4Z1DA 2IPJA 4XD3A 3PHAA 3VZYA 1JL8A 4JKLA 2GVGA 5C7VA 4UFHA 5J8LA 1JZ6A 4KERA 4ML9A 3TLLA 3AXJA 4ZGYA 3SSZA 2VC6A 3UU4A 4TNWA 3BUVA 3QFWA 4JTRA 2B1EA 4L64A 1WKEA 1QNSA 1W1ZA 2PFHA 4F0SA 1TV3A 3UU3A 1XG3A 4FSAA 1V6TA 4KBXA 3UVIA 3QKZA 4H7ZA 1PAMA 3KBUA 2OYLA 4F0KA 3QFEA 3EVYA 3K1SA 2CYGA 3ZT7A 3R8GA 1HX1B 1JYVA 2EGZA 2MUCA 2Q9QB 4JICA 4M5PA 4BJHA 4NZCA 1E43A 2HN2A 4TV5A 4EXBA 3E3HA 3CBWA 5I3JA 3AHVA 3KCJA 3Q4DA 2XIIA 2A3AA 5ENLA 2BHYA 2TYSA 2R24A 3MCOA 3GA8A 4L9ZA 2LOSA 5C3JA 4X61A 4CXYA 1R86A 2PP1A 1Y64B 2DSKA 3IK4A 4G7EB 4NVTA 2BXVA 4HHMA 6REQA 3UXKA 2YCLB 1IXQA 4DV7T 1Q66A 2IXUA 3GW3A 4YTTA 2INZA 3CL7A 4JEUB 3QW4B 4HA1A 2PWHA 3W6MA 3PAOA 4JIHA 2ONEA 3CWHA 3ABOA 3EWUA 1RY0A 4LFCT 3LK2B 1G73A 4KFNA 3GFZA 5L4EA 2J7CA 3NQAA 4WNKA 3GTXA 4ACZB 4DNHA 4PMYA 3R0DA 3PB0A 2Y0FA 1JI1A 1B54A 2O7SA 1C8VA 3SUUA 5AYYA 5DEZA 2VDIA 3HPZA 2HVMA 3LYEA 5HAXA 1KBIA 1V0LA 4W93A 5LGUB 4QJ3B 1A4LA 2Y5JA 2DUXA 1K8YA 5HMDA 1P0NA 1Q65A 4RPPA 3N2OA 2IKHA 2WDVA 3QMSA 1NFBA 1HL8A 3UCQA 3WENA 3G1XA 4QXHB 5I5RA 4W89A 1MVYA 4IISA 3UFEA 2Q3RA 3SRDA 3I0QA 1UR1A 1ZAJA 3C5QA 4PJJA 4K68A 3MI6A 1KR1A 1OFBA 4K8GA 1AW2A 1HT6A 3W9ZA 3FZFB 5AECA 3QGAC 3BQKA 2DCFA 5H6HA 3SWHA 1J5ET 3N14A 2D0GA 4GRSA 2C7FA 1GHRA 1XIIA 4FOUA 3RJXA 3GO2A 3IA3A 1SSGA 2CNCA 2VL0A 1KKOA 4P7OA 2VEPA 4MY1A 4LU0A 4TVDA 4XISA 4CN6A 1FTXA 1VJSA 3MO4A 1DWGM 1YXYA 4QCFA 3VZXA 4IPIA 2FHCA 3PULA 2WAUA 2PBGA 2WHLA 7REQB 4H8HA 2NV9A 1RV8A 1M5WA 1XDMA 3NDYA 3PUAA 2HNEA 4RDYA 4JI4T 3SADA 3LN3A 3AIWA 2QDHA 3M1ZA 4DRSA 3TQKA 2ATMA 2PRLA 2HE5A 5HJYA 4MIMA 1E1CA 1RK5A 3H2MA 1VFUA 3VNLA 3WBYA 1TE6A 3SUTA 1J2WA 5AC5A 2RH9A 1TUXA 1E1FA 3SFWA 1JYNA 4HCDA 4P8WA 4IFKB 2PB1A 5LIWX 1F8MA 1ITXA 1V3IA 4BR1A 2N1GA 3OW1A 4W5UA 3JRKA 2PBIA 2E1DA 3H6OA 1Z8AA 3GB6A 5CQ1A 4AC7C 3A7MA 4GCAA 3T0AA 1PIFA 1R7AA 3ORWA 3ATZA 3M65A 3R58A 2NQJA 1HKWA 4MLKA 1GG1A 4UOJA 4HPXA 1KFEA 1GVIA 4KWUA 4UOZA 1XCWA 3KV5A 3WLSA 3MHFA 2VM8A 2KLQA 3FXGA 4EEBA 4HMDA 1EYWA 3FXEB 1TKKA 4QCEA 3TVAA 3K3QC 2Y7GA 4GI6A 4ADSA 5DMYA 4S3KA 3CXOA 1HJXA 2WHJA 1E3ZA 3ISIX 2UXNB 2BDEA 4UMCA 3AE8A 4GMEA 1X39A 4NJJA 4LQ1A 2VWTA 4PMOA 4JV5T 3AZRA 6REQB 4S3EA 3LHUA 1IZNB 4O28A 2GJXB 1NWSA 3JZEA 4OECA 2V5JA 1NOFA 3TV8A 1MUWA 4KI0F 5AFUL 1UW9A 4OK0A 2WHMA 1POKA 2YXXA 4UCGA 4AZ7A 1YQ2A 3N9SA 1EYEA 1TR1A 2VQFT 1E56A 3KLLA 1B90A 1SHZC 4YPJA 2KXPB 1R46A 2VP8A 1KXTA 4AB4A 1O94A 4MM1A 1F76A 1JUBA 4JI0T 4YMZA 3VAVA 3T8LA 1CI1A 2VQTA 3PZOA 3LI0A 1QPQA 4X1YE 3H53A 3OTOT 3ZVHA 1C9DA 5FEXA 5FMNA 3KVKA 4HJWA 1Q2RA 1JDFA 3FA3A 3JVAA 3B9NA 3LFMA 3HMCA 3N9NA 2ZZ7A 4PUKA 3W1XA 3ESLA 3S5ZA 2M67A 1UD4A 5D9PA 3DESA 3E0FA 1UCUA 2VL4A 2BVTA 1IBMT 4V2XA 3BQIA 5FF4A 4IL9A 4AIBA 2WU2A 1T0OA 4LAZA 3BC9A 3H70A 3UZJA 4WD0A 3DBPA 1NWMX 4C6EA 1I2QA 3NM3A 5L9FA 4R3UA 3DBNA 1J9YA 1W0AA 3DCPA 4DV3T 4DBEA 5E0CA 3BLEA 3I1AA 3O1JA 4H9QC 4YJ5A 5JDLA 1J6OA 4W9TA 4AF0B 1UA7A 1OFAA 4C6OA 3NPXA 2XIBA 2HSAA 1XGZA 3NDZA 2A4AA 4DBSA 3RRCA 3ABSA 3AE5A 4J9JA 1VCVA 1NJJA 3P6LA 3WG6A 5U4NA 2ZLYA 1U33A 2PD5A 4XSLA 1H09A 1NP2A 2OEJA 3IRSA 3UJRA 2D0HA 3GXTA 1G4TA 1UK5A 3PZQA 4R7OA 2B0MA 1WDWA 5KZEA 3SY8A 1NSJA 3Q5EA 5HBFA 3ZMRA 5EFFA 4DJED 1X9BA 3S2NA 2A7PA 2VC9A 4QH4A 1OC7A 2BS9A 3W1LA 1ZS2A 2LSJA 4LT9A 2J7EA 1GK8A 3IBPA 3PUZF 2Y63A 3XINA 1JGIA 3EX6A 1E4LA 1UKTA 4M6QA 5HWJA 3UXIA 4HZ8A 4KBMB 2N2NA 3STFA 3Q45A 3GVRA 2LM9A 7ENLA 5AVNA 4DUWA 2PDMA 3GNOA 3QM3A 1VBUA 2XQ7A 2VMFA 1YXRA 2YGYA 4O1BA 2DU2A 5E1QA 2QPXA 2QAPA 3N9LA 3ZR6A 1JZ8A 5L2LA 2VRQA 3VKAA 5GVJA 1TWSA 4S38A 2PA6A 2ZZ4A 3C0JA 2YYUA 5AQPB 4IUOA 3W38A 2VEMA 3LENA 4RNJA 1L0VA 3NQDA 1PIGA 1S39A 4LPCA 1M53A 4QITA 4HPGA 1M9HA 2RDTA 3TNBA 4GYSA 4EF8A 4GCXA 3S6TA 1BXNA 3G1RA 2OLHA 1VP5A 4QEEA 4GKJT 2NWBA 3E0WA 1IGWA 3LERA 3W7QA 5B7YA 2CCQA 1IT7A 4FLQA 2G50A 3WJZA 4E2OA 1X6NA 4B90A 1AD4A 3VVGA 4MUZA 5DN1A 1CUNA 1WV2A 2HWGA 2XH7A 3ITTA 4REQA 5T9BG 3P50A 3WQDA 9XIMA 2J77A 1IEVA 2HS8A 1PX3A 3L09A 4GGBA 3EDUA 1EJSC 5HXCA 1MMAA 2J47A 4RW5A 4DR5T 1P7TA 1SGJA 3T6CA 5TQLA 1T8XA 1B7TA 3VD5A 1LWIA 4WSHA 4LYKA 1EEXA 3WL0A 4FX7A 2PDFA 3W6YA 1C7TA 3W1AA 4IQJA 3CUFA 3LY0A 3KRBA 1E0WA 3MUIA 1TIWA 4JXCA 3LXBA 2DZVA 2GFTA 1E6SM 1JEZA 3SCTA 3GZAA 1ZKEA 3M6YA 1NY1A 1XX1A 1JNRA 3BZGA 2PURA 3VIOA 3BQ6A 4ZXOA 4DBDA 3KE0A 3P5ZA 2HN1A 1S2TA 3TYUA 1W8SA 1BR0A 3AEFA 1Q6OA 1R9ZA 1L2UA 1JF6A 4GC3A 4UQBA 3PUXF 3VM7A 4NYUA 3B97A 4L61A 4ENLA 1X8FA 4GJIA 3JCFA 2QVNA 4QE4A 4UTLA 5EY5A 2JEQA 4L9YA 3IV8A 2UXCT 1CDGA 1BPLB 3UG8A 3CC1A 3EHZA 5FACA 2VEGA 1AH0A 1QLBA 2CRBA 2IDOB 1SMAA 2D2OA 3GNRA 2IW0A 1A80A 3EOOA 1HL2A 1KM4A 1IEXA 4M80A 4IGSA 4FLOA 1U5PA 1UR8A 2XZ9A 4GNKB 5F3JA 2DPEA 4M0XA 4HTBA 3URQA 1ZENA 1EJRC 1CGWA 1RA5A 2QGHA 3ZR5A 3UJ2A 4ZSUA 3VDCA 4DR6T 3SN0A 3R2GA 2NT1A 3RCNA 4E2BA 4U3AA 2CBJA 5GNXA 3WH9A 4E8GA 3KXQA 5K9XA 2JK2A 4JKKA 1KWGA 4UIOA 5JUVA 1PCKA 5CSRA 1ZNNA 2LSIA 3W7JA 2HVNA 3M64A 2OYMA 2DQWA 4PB3A 2E4TA 4RDZA 4DO4A 3IGUA 4XO7A 2Z00A 2PF8A 4GLEA 2A2IA 1F2JA 3E08A 1NIUA 3QVQA 1XMOT 3TQVA 2A2FX 1SQ7A 1LBFA 1X6UA 3GAKA 3N3MA 1RR2A 2J8TA 2R91A 4Y8EA 2NXIA 1WR6A 2Y7FA 3OIHA 3GD6A 1TIMA 2PWUA 1HNWT 5A2CA 1OGGA 3VIJA 1AMKA 2JKPA 1OCQA 4MLRA 4XBKA 4AC1X 3H2OA 3C50A 3DX5A 1OD8A 3ARSA 3OA5A 3P3BA 4AVNA 1PJ9A 5LXTE 3GC2A 5E0OA 4E7SA 3UWZA 1GKRA 3ITOA 4REQB 2PTZA 1E9ZB 1BVNP 2ZADA 4F9JA 3FW6A 1GQLA 3UWYA 1YADA 2ACSA 3LTYA 3NEHA 1XBZA 1BFNA 4M6VA 3AE2A 2Z27A 5I2UA 2YL6A 4RCXA 4IWWA 3VKGA 3KX6A 4ZFMA 4A56A 5HXRA 3TK7A 2V8SV 3MUXA 2V6YB 5CJ5A 3CHDA 1BYDA 4D72A 1H7PA 4KIEA 4AD1A 3BMWA 3LCLA 2OELA 3WKZA 4O0QA 2OLAA 1FMWA 2QCDA 2DSVA 1QUUA 3VR9A 4U5IA 4R7WA 2OZTA 4AD5A 1HKIA 4AEFA 4X2PA 1FJGT 5FY1A 1UQZA 1MRQA 1W1TA 5I3DA 3W85A 1ZAIA 3P8IA 2QUNA 3FVMA 4KETA 3RKGA 3SQMA 3WK3A 2ICSA 1QHPA 4DZ5A 2KWHA 4LBUA 4Q7NA 5J5RA 3V3WA 4MG4A 4FNRA 1XIFA 1ZJHA 3DKLA 1V7AA 3WDJA 2Z2UA 3TP4A 1C7SA 3IIPA 4Q4PA 4OOZA 1CWYA 4GX9A 2ISWA 4OZOA 5KMGP 2F6UA 3QXBA 4DWSA 5I77A 3E2QA 3BAWA 1OD0A 1OHLA 1WUEA 4XZLX 3IJ8A 1P0DA 3QC9A 1G01A 5J2UE 4LF1A 4QAIA 4KWVA 3QQ1A 1Q6FA 4GQQA 4DF1A 4LUJA 4TWHA 1A5NC 3Q94A 3UG4A 2QRXA 1C9WA 1J5SA 1CXLA 2J7BA 1NDWA 3ZWSA 4Y96A 3E49A 3WEMA 4DJFA 1K4GA 3MA8A 4M24A 1E6RA 5IDIA 3D0TA 5FKYA 3OQEA 1MRAA 4PBFA 4X63A 3M46A 1I2PA 2ZXAA 4JFVA 3W22A 2CXGA 3QV7A 1Z69A 3AXIA 3RM9A 3M6DA 4A4AA 5AQJB 3OLGA 3VNMA 3MB9A 1XI3A 2HPMA 4D9PA 5MF5A 2RDWA 3E2SA 4KFOA 2CWYA 1LM1A 2PDBA 2CLEA 2I17A 5D04C 1KCKA 1W9XA 1A5KC 2OZ3A 1LLZA 2ZM2A 3O8AA 3FB2A 3BV4A 2R1KA 4PMDA 1NAL1 5HPCA 2G4JA 2PDXA 4O8SA 1MQQA 3NDOA 4DIAA 2ZUVA 2NTXA 2VFEA 3OBKA 4NQ1A 9XIAA 3RX3A 4TVUA 4I6VA 3W1NA 5A6AA 4ICCX 2WBGA 3TSDA 4A22A 4AYGA 3ES8A 3E1F1 2V82A 3HGRA 1V51A 3C2OA 4ZOEA 2V3FA 1QOPA 3W7NA 3IF8B 1BKHA 1CT5A 2FDMA 5HEHA 3P82A 3EPOA 4DJDC 2ZX8A 1W3TA 2GUYA 3N4FA 3CO8A 1Y5XA 1TPWA 2Q8LA 3RMEA 4KS0A 2DL1A 1UYQA 5EFDA 3PZTA 3NG3A 4DWSC 2X2YA 3DYOA 5CZ0A 4XIAA 3WUBA 5LGNB 4U5KA 4O1FA 4B2DD 5JTGA 4DJDD 4PBEA 2XVPA 2BLEA 3ABXA 4P8UA 3EPNA 4ADUA 3I3BA 3MPGA 4DWDA 3W71A 3CWNA 2YZRA 1TPFA 4HN9A 3HPAA 4GIAA 5D37A 3I0OA 1H1NA 4V27A 4PMZA 3VK5A 3GY1A 3QSTA 2ODUA 1L9WA 5FJTA 2PGRA 3AZTA 4UCFA 5FOOA 3M0VA 4LEQA 3ZN1B 3VE7A 1BR2A 1HKJA 3WEOA 2HPLA 2YOCA 3HMJG 2X1TA 1W1PA 3UA3A 2AL2A 1UURA 3H7VA 1LJYA 3CAWA 2H7VC 1OM0A 1XKJA 3TCEA 3FAXA 4CU8A 3CMGA 3QPZA 3R6NA 1AH4A 2BBHA 1KNZA 3MV11 3VPLA 3NXFA 4GK8A 4FIQA 1F07A 1PTAA 4A05A 3U57A 3GMIA 2BZBA 3T07A 3TQ0A 1YW0A 1Z3NA 2A6NA 3AXMA 2WNWA 2JMHA 1ZL1A 1H5VA 5LBQB 2OPJA 2SFPA 1AUSL 3CV6A 4H7CA 3URBA 4IP4A 5JVLA 3DOPA 2AQOA 4E0CA 4Y7EA 3H26A 3LCFA 1SA0E 1EUNA 5JBEA 2KINB 3NXLA 3W7DA 2XQYA 4HNCA 1OABA 1GOQA 5G1YA 1DJWA 3WLOA 2JE8A 1W1VA 3KHDA 1QPKA 2CHRA 4JAWA 4JN6A 4XBSA 4K37A 4MF4A 4YSZA 3W4RA 3QKEA 4LYPA 1JD9A 2WO5A 2OLTA 1QWKA 1YBQA 5BZAA 3BDKA 3FLUA 4O12A 3AA7B 4DZIA 3IUHA 1E40A 4GXWA 2EHOD 1GJPA 4ZZCA 5H8MA 4CD4A 4EIVA 2PLMA 2N9DA 1IIHA 1S35A 4BWLC 1QW9A 4ZB5A 2QGYA 4TX8A 4X66T 5ABHA 1C90A 4HZ6A 1G4SA 1A4MA 4HT3A 4N9CA 3MUAA 3VYLA 4WY0A 4S1FA 1KXVA 2VGBA 3SECA 1FWRA 3T2PA 3DJBA 2YSWA 2EEXA 3DFPA 3MMWA 4BEUA 3L8RA 2KZ7B 4Y9AA 3UWVA 1XLFA 4YJ2E 4PEEA 5T91A 3ERPA 3CQ0A 5LGXA 3KUMA 1WKFA 3TW6A 4PTWA 1DWFM 4FI5A 4Z0JA 5LNVA 3M0XA 1GWJA 2IPFA 1AL7A 3W2UA 2DZXA 3I7QA 4NJHA 1JRCA 2QPSA 4AQFC 1XPYA 3I7RA 3PG8A 1EJ7L 3MZNA 3T2OA 3VGFA 4P7LA 3W7CA 3WK2A 3NAVA 3NVTA 2X42A 2V7LA 1UD6A 4K1WA 1ITUA 3C51A 5I02A 4O52A 3RIKA 3K5XA 2VFHA 2ZM8A 1ZHAA 4GO8A 4I55E 3W29A 5H8PA 3KOWA 3ANWB 4RUBA 1WKDA 4U10A 1M65A 3V4BA 3H7UA 1D2KA 5C9XA 1A0DA 1KFWA 2DIEA 3VOHA 3CEPA 4PE8A 3PUVF 2GGEA 5JR9A 2Q01A 4KEMA 1XG4A 4ASKA 4ILUA 1MQRA 2DH2A 3LBCA 2X51A 2CW6A 4Q6JA 2GWNA 4ZBCA 3G6LA 3O9XA 4D1JA 3NPVA 3P4SA 2B4GA 1IWPA 3RYSA 4XZBA 1EJXC 1MNSA 3WN6A 2PC8A 4HIBA 3JS3A 5KSWA 4QNEA 3PPHA 1HX8A 1XGEA 5CPQA 3WLKX 3U9IA 4KMCA 3WNMA 1SZFA 5LHHB 2AE9A 3ZMZB 1XP3A 4J3TA 3FYYA 4GO9A 5A8GA 3T09A 4PCFA 4J35A 4NY2A 4CQAA 2WY2A 3UERA 3BSMA 4YT0A 3LPFA 3PTRB 3DENA 4BZYA 2YCLA 1TWIA 3UR5A 3PZUA 4O1CA 1D1AA 1VFMA 2C79A 4WLCA 2PWEA 4RR4A 2E8ZA 1OEPA 1EBGA 2I5IA 2TAAA 1HNZT 2ZBTA 3KL0A 4PRWA 3TXZA 3UY8A 4JIRA 5CGMA 1W1B1 2VL8A 5LZLA 2WAGA 1JG9A 1K02A 1NEYA 1I2NA 2B7PA 3PNZA 1YKEB 2YX0A 3VGEA 5LA0A 4Q4OA 3M0IA 4GE8A 3O1IA 1AODA 2WVVB 4GYRA 2QDEA 3RO6A 5D02A 1V77A 3ZJ8A 1EHNA 1K77A 2GQ9A 3BG9A 3MXZA 1DJZA 4OIFA 2PU0A 1FH8A 1SO4A 4GXMA 2WOQA 1DL3A 4NAFA 3OB8A 3BG5A 3WMSA 3ZN0B 1WP6A 4ACZA 1TPEA 3WBXA 1SM9A 3OODA 2REQA 1XC6A 2XHEB 1M3UA 1WQ5A 2QMKA 1VBHA 2J74A 1TCMA 2HV5A 3O2LA 3PY2A 1YDVA 1LF1A 4GD0A 1TO3A 2PTWA 1H1YA 3KINB 4PMVA 4J3VA 2NSOA 3O9NA 3GKAA 4HFDA 1GZJA 1R3VA 3ANYA 3I9YA 3D3FA 1V5XA 3KVLA 3Q65A 1KO0A 3GBDA 3T08A 2VFIA 3W15B 3F5LA 2JFEX 5EMYA 2H3RA 4M7SA 5I09A 1KK7A 3PSWA 3PM6A 2C71A 5HMEA 5IYZE 4DI9A 5CFBA 3CV1A 5A1AA 1D9EA 2CKSA 2PDCA 4UVCB 1MO0A 1FKXA 3I10A 2R8WA 4JUYA 4Q8PA 2E9XB 5CSSA 4CEUC 2MBGA 1VBRA 5J1GA 4DR3T 1W3KA 3IJQA 4Z1AA 3TYDA 2CETA 4AFYA 2ZE3A 1MEIA 1SFSA 4UQEA 2E3ZA 3HV9A 1ZBVA 2BG5A 2WMJA 3DGRA 3KZSA 2QCFA 2ZX9A 5LNRA 2WQYA 4PGLA 4MWAC 1A5MC 2ZZ5A 4B4FA 3ZQ9A 3OJAA 1ISWA 2H9AA 4M3PA 3W7PA 1WZMA 4V1YA 3EKGA 4LB3A 3N2GE 3RLUA 2QV4A 3GG0A 3LNMA 3VCRA 4O1EA 4RE2A 4L1GA 3WD0A 2OR2A 1KLZA 3E0VA 1W1A1 4TU1A 3RMJA 1K8ZA 4AVOA 2IUBA 1W3NA 4AZCA 2W0UA 1NAFA 2ISDA 3FHNA 5TBOA 3Q37A 1UH4A 3TROA 3WUGA 3AHZA 5HDRA 3NL2A 1H2JA 4B5SA 3RQWA 3K30A 2ISFA 1YIXA 1H0IA 4UOQA 3TONA 1CZ1A 5IFTA 1I0DA 1GVQA 2FTWA 3STEA 1BKSA 5FI8A 4JOMA 1X1ZA 1HN1A 3UWQA 4Q32A 4BA0A 1YEYA 1GQKA 4MKSA 1NU5A 2DDXA 5LNUA 1J11A 4O15A 1ADSA 3NCOA 2BY2A 4QIUA 2ZICA 5DQVA 4ACYA 2XH4A 5KX5E 1FWSA 4TNVA 1MYRA 2LM2A 4FLSA 4ZFCA 5JVDE 4HFEA 3FZLB 2FTYA 3W7KA 2WB5A 5JDQA 4D6CA 1TPVA 3GC5A 1JZ2A 3HN3A 3EMCA 3QN3A 1UR2A 4HU8A 4KFPA 3NQFA 3M44A 3VIMA 1ONWA 1U1JA 3L7RA 3R25A 1N32T 3TZFA 5TAOA 3E5PA 3O4XE 1ZOYA 5CA0E 5CPLA 1F3XA 3A12A 1ICQA 4DN1A 4LFAT 3CHVA 2QVAA 3A23A 1T8QA 3L4XA 3UPMA 4FOJA 4LUTB 3LQLA 2H8XA 1XYFA 3WQ5A 2OX4A 1XLIA 3N6QA 4ATDA 4YTPA 3V1PA 3O7UA 1UWUA 1KW1A 1YYAA 4FXJA 4J4KA 1PTGA 3FGCB 2QJNA 2C0HA 5CPMA 2JF6A 4GI9A 2BTMA 3M5ZA 1NVMA 3FA4A 3N04A 3PG9A 3A13A 3GXNA 4EPKA 3RHWA 5FXZA 1REQB 3PSVA 2VVSA 2DZPA 1YHTA 3AISA 3QZAA 4ERRA 4B3LA 2BG9B 1O3XA 1PDZA 4WIWA 4OX9T 3M07A 3IS4A 1E72M 2XH0A 3VO0A 2G3NA 2XSBA 3OVRA 1ISYA 4LW7A 1JCMP 4CQIA 1UOKA 2E6DA 1ALDA 1Y5VA 1S5VA 1FHUA 2XQ9A 2Q9QC 3PBGA 3T1HT 2OODA 3IRDA 3NR0A 1RPXA 1RLCL 3S4TA 4PJLA 3TIMA 1IGSA 1ZCCA 4GI8A 4ZO9A 5CSYA 4H9ZA 3CMJA 2QVHA 3CWOX 5LNSA 4B6XA 4HOZA 4IE4A 3S5NA 1HGYA 5TD4A 3AMKA 2WNNA 4Q3MA 4WBOA 1TV8A 3FSUA 4G1KA 3O1HA 1UROA 2XQ5A 4JD4A 2DY3A 4ZHQE 4IP7A 5BMVE 4O14A 1YNPA 4ZI2C 4BF5A 1BR4A 3TXVA 3WQPA 1LL7A 4QLKA 2YEVC 2H89A 3N4AA 2KNDA 4WXYA 3CB3A 4XD6A 1K9FA 1IHIA 4PSPA 3BOFA 4MWAA 4K2SA 3CLMA 2G0UA 1E7PA 1EH9A 4MB5A 8A3HA 2QGSA 5A8PA 3UD6A 2HISA 5EYWA 5EBUA 4NXNT 2E28A 1H3GA 4H9OC 4E5TA 3QHNA 3KDSE 2Y70A 3B13A 1JXJA 3PZGA 3I6RA 4RXFA 1B57A 1NWRA 2QJMA 4B5WA 4F2TA 2XINA 2X8RA 3HQPA 2A79A 3G77A 3AZSA 1IT0A 4DM2A 3CAQA 4UFLA 4PTXA 5AQVB 4JIPA 4WUIA 3VOCA 1P5BA 1WRDA 3FEMA 3PUGA 3LMYA 2W62A 1Q4NX 1VJZA 4H2CA 4C6PA 2YBTA 3BOXA 2E67A 1VYRA 3CJPA 1TV7A 2WMGA 1OWAA 2O9RA 4JY9A 1E73M 2C0SA 3IUIA 2PSNA 2A3EA 4JQ1A 1EEPA 3P80A 4CQBA 1JVNA 2WMNA 4ZQPA 4XAXB 3AAEB 1MEWA 1V6UA 1IR1A 2ACXA 1RCXB 2KX9A 1GYMA 4C1NB 2Y85A 5E9XA 1XISA 2G37A 2WQDA 1V3HA 3WQ6A 4QR6A 1Z42A 5BXRA 4PCSA 4WRHA 3DG6A 4I6KA 2V7KA 1TTIA 1CXFA 3CKDA 2QJHA 2X1IA 4EVZA 2OQYA 3DIPA 5D2XA 1QI4A 4GACA 2HBVA 2G41A 3SUWA 2ZZ6A 4GQBA 2FJDA 3P67A 2OOGA 3NQVA 4UVAB 1EWDA 4UUIA 3AAIA 4H41A 4GQRA 1LT7A 5D2WA 4NXMT 3PZNA 4JCMA 3AE1A 3G06A 3UXAA 5LIYX 3TAOA 4ALDA 1TCDA 3SB0A 4C7FA 1YMYA 3L4ZA 3CLWA 1JYXA 4MGGA 3TDFA 3QJAA 2X09A 1DJGA 1XXXA 2LRLA 2VKOA 4ERGA 3WQEA 4CN1A 2BG9A 3SUVA 1GVOA 3P62A 2ATSA 2F2KA 4RNHA 2CLKA 3LHVA 2IUZA 1I6ZA 3U7BA 2FGZA 4CEXC 4AU0A 3OJGA 5FJJA 3PTKA 3KS5A 3S4UA 3KBSA 1OT2A 1ML1A 2OA5A 2ANUA 4TQTA 1T7LA 3BGAA 3L4VA 5I0DA 5AQOB 3DERA 2JQ9A 1F05A 3N2TA 3RC8A 1FHVA 5GJNA 2OV9A 1N36T 3M5XA 5EK4A 2XN1A 3DHPA 1MMDA 1KV8A 3M0ZA 1ZEEA 1KNRA 1QAPA 5J2TE 1UG6A 3EYPA 4XAGA 3EOEA 1OQFA 3RRXA 3LX9A 4KEZA 2XASB 7CGTA 1ZRQA 5FA5A 2BZNA 3SEPA 5D33A 2Z1WA 2CXDA 3T40A 4F0HA 3LBXB 2I56A 3GM8A 4LRTA 1C91A 3PN8A 3RLVA 4DO5A 1W31A 3B4UA 3UWWA 2GYIA 4QROA 4WJEA 4LX4A 2BOEX 4TMBA 1TG7A 2V67A 5REQA 2OO0A 4F2BA 4KUMB 3AXHA 3W72A 2MTQA 3B8UA 4XAPA 3K1DA 1XLEA 4EWND 1CXHA 5H1WA 1EOMA 4WVXA 3GLCA 4XO6A 2D2JA 5FSDC 1FWCC 2QR6A 3SFEA 4I0UA 5E70A 1JCNA 1M04A 2J4GA 3MJMA 3RXZA 1I6NA 3VDAA 2ZWZA 5C2XA 1E6XM 5HMFA 5HCJA 4LV4A 5XIAA 1SJAA 1VCSA 2GGHA 1EX5A 4L6OA 2C6QA 4AKLA 3V1HA 1KM0A 2HVOA 4PCPA 4LCRA 1FCUA 4US6A 3QYSA 1FWHC 1NH6A 4UTTC 4W8BA 2IC6A 4LUIA 3VDBA 4OGZA 1XBVA 3WDIA 3N9OA 2HROA 3BJSA 3EOLA 2BVDA 2J88A 4HU0A 5LHFA 3GNPA 1V08A 2WQPA 2NUXA 1C29A 3FDKA 2DIKA 3CIWA 3EOUA 4K39A 2UUAT 2JKAA 1VZWA 1GPFA 4NZ4A 1PX4A 2E9XD 2PWDA 4S23A 1UJPA 4JTAA 4DVDA 5BRQA 3REQB 1TJ1A 1GOXA 1B9ZA 2CESA 1X96A 2XFWA 1TUFA 3FSTA 4S3GA 3TOPA 4RKAA 1HUVA 1IV8A 2WMHA 1ISZA 5HWYA 2YA0A 2V5LA 1JAKA 3W84A 3IK2A 1DQUA 1UMLA 2PMQA 3C2RA 3H37A 3VR8A 2I5QA 4WHBA 3WDRA 3ZYMA 2V68A 3KW3A 2GQAA 1VFLA 1VFFA 1EUAA 2VFFA 5AFDA 4J5NA 1WDDA 4IPPA 3W7IA 3KZPA 3URAA 4IQDA 1CXIA 3MZKB 4YWSA 5JH7E 1V93A 4LS0A 3UVAA 1XS2A 2WMFA 2YDSA 1R8IA 4Y9NA 4GUJA 4ONVA 2PGFA 4A21A 2W5FA 5AQIB 2CERA 2A1YA 1SO3A 1TA3B 3BGGA 1ADDA 3A4XA 3UXDA 3Q2MA 3QZEA 1OINA 3TW9A 1HF8A 1S5WA 1DKWA 2DEPA 3THDA 2D23A 5FAGA 3KWXA 1SW0A 2BP1A 3N9QA 3N2MA 5SWUA 3QC3A 2X9HA 3L12A 3BANA 1VEOA 3QR1A 1OX4A 4DEFA 4LUYA 2D2SA 2WPBA 1DXEA 3MTWA 4AD2A 2ZIDA 2P8CA 3VIKA 5D9OA 4EWJA 2E77A 1YBQB 1NWUA 5AQRB 5IBXA 2W63A 1OYBA 1P4CA 3K13A 2YL8A 3DFOA 3CK6A 3W7HA 5HXSA 1BGAA 5M3WA 2G3JA 4G2AA 4Z0SA 1PL9A 4A97A 1HW6A 2Y5EA 3MUY1 4IPLA 1MWOA 1LWJA 1KGUA 3T4CA 3IJIA 1Y65A 1PKYA 3C2EA 1KFCA 3L4UA 4UBPC 4XZIA 4YTUA 3GDMA 4E7ZA 1PEZA 3CS2A 3HJEA 5LGTB 1L6WA 3GIQA 4AWEA 2Y89A 4OE7A 3GR4A 4UTWA 3NM1A 2QLYA 1VENA 5FP3A 4LFYA 4Z2HA 4KKXA 3EI0A 4NZ3A 1QHZA 3F2CA 1I45A 3EDEA 2GZXA 4RX0A 4NKCA 2P1FA 1XRTA 3UJEA 4KPLA 5EU9A 5L47A 2R82A 1SFLA 3N15A 3MY9A 3W7GA 1J93A 3UGVA 2JALA 1M7OA 2V26A 3P7IA 1K7FA 5LMNT 1XC4A 3NWRA 4HWIB 1D3GA 3LDQB 2YDRA 4IMGA 4JGDA 3GHSA 4GQGA 2JJ9A 4ADZA 3W7RA 2XAQB 4LF5T 5CG7A 1MUMA 1KFJA 1W9DM 4YTQA 1PHWA 2X41A 3GHUA 4XKYA 4JTFA 2Y2WA 4D6GA 4AY7A 2CLYB 4CNOA 2FZNA 3V5FA 3AU6A 3WF1A 2DVXA 3QR0A 4N4QA 3QSRA 5ABFB 4NXSA 2TRSA 1XQLA 3AI0A 1W32A 1LRZA 1IIGA 3KBMA 4DHGA 3S3GA 4OU1A 4N6EA 1FKWA 4XVDA 4WZHA 4FZIA 3FX4A 5JDGA 1YPIA 4UIGA 4CXXA 4W8AA 5LIKX 2FBWA 4GKKT 1CXKA 1E0UA 5HJXA 5I06A 4W87A 4HNVA 3KWSA 5I3FA 1MSSA 2CE7A 1ECQA 3SGUA 5ABGA 5AQLB 5J5DA 1TPC1 3J7HA 3EA2A 2ABAA 5AQNB 4UQCA 3PURA 2PS2A 4QDMA 3LA4A 5CPTA 4GNJA 1HKMA 1JPDX 2BS4A 1MW1A 3T9PA 2QIWA 4EXTA 2XZ7A 1FCQA 1QW7A 3VXGA 3QLDA 4D6IA 2CZDA 1Q6DA 4GQ0A 1AMYA 4TUFA 3P4RA 2YU2A 2E5LT 3B8WA 3PBMA 4Z1BA 3LRMA 4X60A 4RL3A 4BJNA 5EZYE 5DX7A 1C8QA 4L4OA 1C92A 1HXJA 1XRFA 1OXZA 1AW1A 3OIXA 2VD8A 5TF0A 3H23A 5CCZA 1L6YA 3PBUA 2DIJA 3TNOA 3CAVA 4M8UA 3ARUA 4JTJA 4X3ZA 3RG6A 4R5EA 3WDHA 4JTGA 3S2MA 1X7IA 3VKDA 4LAUA 4UTUA 2F4VT 1AH3A 4XV0A 2BKOA 1HFAA 2V30A 2XFFA 1TSIA 3TH6A 2ZM0A 5KXJA 2FKPA 1LROA 3HGOA 1QASA 1U5HA 3FJ4A 5G4WA 3WLPA 4NIQA 2QULA 2YCJA 1ZHCA 2DORA 3C64A 5CPSA 1OFDA 3L5LA 9CGTA 4ZCWA 2QF8A 3WAKA 3MHGA 1KBJA 4YL2A 4FS9A 4HHPA 5CZKA 1WBHA 3CYVA 3AICA 4O8RA 4IE0A 2X1RA 3V16A 2HCVA 2NV2A 1UJQA 3LLFA 1UMYA 1KBBA 1EC9A 2NXGA 5E6ZA 5BW6A 5HQMA 2NX9A 2ZX7A 4ZQMA 4AZ6A 3K8LA 1MUCA 2CHNA 2RFGA 1BLIA 1FWDC 1MDLA 3FNDA 3PWAA 4GKLA 3HL6A 2NW7A 3RO8A 3LRKA 4NILA 2CZFA 4IPJA 2F7FA 1UBSA 5XIMA 5PTDA 3U2OA 5FESA 4Q4RA 4D71A 4CU6A 1VF8A 1D7FA 1KRAC 2G97A 3UZ5A 4B5NA 5C71A 2XSAA 1FBAA 3T0DA 2BOFX 2PI6A 3SBFA 1QW8A 1WYCA 3EMQA 2RGMA 2QEZA 4LANA 2ZE0A 4AD0A 2WXDM 2OZ0A 3RILA 2TPSA 2EHOC 2C1IA 4PK5A 3IGHX 4ERIA 3RX6A 1E6ZA 1Y0EA 3ZYKA 2PCQA 1D3CA 4QHOA 2EHOA 4GUFA 1Y8BA 1UH2A 3TN6A 1PZ1A 3N29A 2MANA 3VOJA 4C1NA 1JRBA 4O2BE 1T5AA 3W2JA 3C6CA 1YW1A 1DTNA 2QKFA 3ZLGA 1OZQA 4O4VA 5LOVE 1LBLA 2VK9A 4V15A 4C6QA 2IQ0A 3T8OA 3OEXA 3G1HA 5LYJE 3PP7A 1VLWA 4UF0B 3KTCA 4HZ7A 3SQSA 4UTFA 4G2DA 2L8KA 4KRTA 1UKPA 5IXEA 3QOKA 5HXMA 2A3HA 3WY1A 3TQPA 2A6LA 1WDRA 5BXSA 2E9BA 2CBUA 2X9YA 4KRUA 4LALA 3LI1A 5F4XA 1A5SA 2ZZ1A 3QNUA 3DI1A 3M9YA 4INFA 2XHYA 4UR8A 2EO7A 2R6OA 3VOGA 4O4JE 2BNJA 3F5KA 5JIWA 3L65A 2D69A 2FIQA 2E25A 1O60A 1CLKA 4K3ZA 2NSXA 3B9DA 3NBXX 2ZX6A 1XLCA 1J2BA 1SZEA 1RCOB 1Q7QA 1Q8AA 5I3IA 3EAMA 4Q8MA 1S3HA 4B91A 1J1JA 2JPFA 2C18A 4COFA 4MHBA 3AS1A 4X65T 1CGUA 2J8FA 1IR2A 5FF7A 3K4DA 4JX4A 1MMNA 3M41A 3SGGA 3L0NA 2A21A 2PEVA 2JBMA 3STPA 4J2MA 2CHOA 6ENLA 2LSYA 3GU2A 4HGXA 1SW3A 3NRYA 4DM1A 3LTPA 4IL2A 4IMFA 2WU5A 1KM2A 1UR4A 5I03A 4JTLA 4EV6A 1Q4WA 2PRHA 4JYFA 5A6BA 1HNYA 4UFKA 3RPUA 1XMQT 1KRMA 4NPPA 1XSJA 3HG3A 5LB7B 1FXPA 1XV8A 4FK9A 4QP0A 5M17A 3BGJA 4HZMA 4MJMA 5A6SA 2OMAA 3L2IA 1JNZA 2DGAA 1P6CA 1O68A 7XIMA 3RIFA 3QHOA 3CQJA 4GYPA 4KWSA 3AOFA 4EXQA 4CD7A 4LOCA 5AYXA 1LRQA 1XW8A 1SUXA 5BOOA 1E4NA 3B9OA 3NL3A 1NF7A 3DEQA 4MLJA 3AE3A 3RCMA 1G4PA 3NZQA 2FPTA 2NQHA 3N18A 2HQAA 1DXFA 1TVNA 4NX0A 4PMNA 3QB5A 3OVQA 5AHLA 3R0KA 2HRWA 3H7RA 1S2AA 4IDZA 4MYAA 5BMWA 4H6RA 2J24A 1XZYA 2O4QA 1FEWA 4LCSA 2VGIA 3B0PA 4NAEB 1LG1A 3W27A 4R9XA 4R53A 3HBLA 1NM9A 1E4MM 3BCFA 5DT7A 5AQQB 2D0TA 3E0LA 4AISA 1K4HA 4OYKA 1ZY9A 4HA4A 3G2GA 5EK3A 3EDJA 3THAA 1US7B 3QZ6A 5I7GA 1B2YA 4B2DA 4B3TT 2UY2A 2BOGX 1GYNA 5A8OA 3OO2A 5K9DA 2QJIA 2F2HA 3SGZA 5A1LA 3NFUA 3PJAJ 1NFGA 2XH2A 2WHKA 2SPCA 2G3IA 2OFJA 3GU9A 5C6MA 2NQ9A 2J66A 3VC5A 1H5YA 3VINA 3IEBA 1UOZA 3CWZB 1HO4A 1EC8A 2VC7A 2PG8A 4ISSA 3KBVA 2K24A 3RKOA 3STGA 4BF7A 1U4QA 4HNTA 4IIBA 2PTFA 4JBWF 5IHRA 3C86A 2HK1A 3RNDA 4ECLA 5AN7A 4KP3C 1XFCA 4S3CA 4MVAA 1DOSA 3E12A 4XZHA 2C1HA 2DT2A 4FNSA 2DH3A 4DZHA 4GZJA 5HOSA 4YVVA 1KTNA 4EANA 3SZ8A 4OT7A 1YE4A 3ARXA 4MKNA 2H9AB 3PE0A 4ROQA 3MO7A 1X38A 2GWGA 2ACZA 3F1QA 5AYIA 1EO7A 1QCWA 3F5JA 1LUCB 2Y6ZA 2DSWA 2ODVA 2OB3A 2P0OA 4JEHB 4GKTA 1L8NA 1ICSA 2PBOA 3CPZA 3BJTA 2E0PA 5HAOA 3GNXA 3TJIA 4FJOA 2ZRWA 4E38A 2G0WA 2X40A 2IMLA 4LVAA 1YNYA 3H2CA 3F4DA 2PDJA 2C1GA 2FJKA 1QK0A 4FXFA 4JTCA 4MFEA 3TZNA 3CU2A 1A0EA 2QCMA 1BWKA 3WI3A 4LNYA 3E74A 3QTGA 3FZHB 2CITA 4AWSA 4CI2B 4N7QA 1KFBA 2OCZA 3WF4A 5ABTA 4AIOA 2QDDA 2VQUA 3CUHA 3CZEA 3NNTA 1UIPA 2UWFA 3GAYA 3BWWA 2FZ9A 1UIOA 1ZZMA 4Y9OA 1IEQA 3HA1A 2E7FA 3P93A 4B15A 3K1GA 3D0CA 3O06A 3VIIA 2LRKA 2FDS