1FJGT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1fjgT00
1HNZT 4LF8T 1I94T 2UUCT 3T1HT 2UUAT 4DR6T 4DR3T 4B3TT 4LFBT 4DV3T 4DR4T 1N32T 4DR1T 4JYAT 1N33T 2UXDT 1IBLT 4LF5T 1HR0T 1HNXT 4LFCT 5LMUT 3OTOT 4DV4T 4B3ST 4X64T 4DR7T 4LF7T 4LF6T 1FJGT 4X65T 4DUZT 4JI0T 4B3RT 4DUYT 1XNRT 4X62T 4B3MT 4DR2T 1IBMT 4DV6T 2HHHT 4DR5T 4KHPT 2F4VT 4K0KT 2VQET 4JI3T 4JV5T 1J5ET 2UXBT 4LF4T 4AQYT 4DV2T 2UUBT 4NXNT 4OX9T 4DV5T 2UU9T 1IBKT 4DV7T 4LFAT 4X66T 2E5LT 1XMQT 4YHHT 4JI2T 5LMNT 1XNQT 2UXCT 4GKJT 3T1YT 1N36T 4JI1T 4JI4T 4JI6T 2VQFT 1HNWT 4JI8T 5IWAT 4GKKT 4LF9T 5BR8T 1N34T 4YY3T 4JI7T 2ZM6T 4DV1T 1XMOT 4JI5T 4NXMT 4DV0T
chains in the Genus database with same CATH superfamily
2NW9A 3HR0A 3AE3A 1HNZT 1AJ3A 4DIDB 2NW7A 1MMNA 2DCFA 4QXCB 5DQVA 2XASB 1WRDA 2I6HA 5EK2A 4IL9A 4CQIA 4ZI7E 2UUCT 2SPCA 3PUAA 3MJXA 3ZMUB 3T1HT 1KNRA 2Q9QB 3B5MA 5LHGB 2WSSV 1Z0PA 2LOPA 3ZYMA 3AEFA 2XSBA 3O1IA 5AQTB 2V1DB 3GN5A 3RLFF 4HFBA 5L3DB 1T72A 2LM2A 3EABA 4KBMB 2KXPB 2CBIA 3KV6A 3AEBA 2X68A 2XQ8A 4DR4T 4DR1T 2PBIA 3FZKB 3I9YA 3JAFA 4U72A 2MYSA 4JYAT 3UQ7A 4XAXB 4ERRA 1H7CA 2WZIA 4IREA 3AE8A 2BS2A 1OEDA 4GYSA 1HNXT 4LFCT 2QA7A 2H88A 4U33A 2J62A 4G2AA 4HWFA 4ZI3D 3E0ZA 2NTXA 3A7MA 4JLEA 4MLKA 4PK5A 3UU3A 2VL0A 4HWHA 1G73A 3ZMTB 4YLHA 3FB2A 3N2KE 3N9PA 2E2AA 2WDVA 1SUMB 1W0BA 4EZ4A 5DQWA 4COFA 5L4EA 2XAFB 4LF7T 3K8PC 4LF6T 3UFGA 5JR9C 3EI0A 2UXCT 2OV9A 4C90A 5KDMC 2D0TA 4BJMA 2VKOA 5AQRB 4B3RT 3AA1B 3N9MA 3F2EA 4TX5A 4C91A 4BAYB 3FBLA 4CN4A 4EOZB 2JRKA 2X0HA 3K1SA 5H6RB 4DV6T 1IBMT 4AKGA 3G06A 2X9WA 4I4TE 2A3DA 4U7YA 2VURA 5ETWA 3AEDA 4EAHA 3QC9A 2N2NA 5ABFB 2ACZA 2KWIB 3HKBE 3R6NA 3DTOA 3KV9A 4CI3B 2YDQA 2KINB 2LSKA 1T8BA 4IDQA 4NPPA 3RH3A 3EAMA 1GQEA 1DU2A 1J5WA 1LVKA 3AEGA 2ES0A 3KDSE 3QOFA 4WW0A 2WMOA 5FY0A 3ZJ2A 1J5ET 4XZCA 2XY8B 4ZI2C 3JADA 3SWHA 1SA0E 4OYJA 1L0VA 4ILCA 3ZN0B 1IBLT 2XTLA 2WWVA 2J47A 2LKHA 2XUEA 3GMIA 2XHEB 3UUNA 2LOSA 2N1GA 3UUXB 5LXTE 1UGOA 4QWNB 2KT9A 2CLYB 3S4UA 2KNDA 3O1JA 3PUWF 4QXHB 2WDRA 1MMGA 4KUMB 5DABA 2XAJB 3AA7B 4N78D 2K24A 4UV9B 4M1PA 2YU2A 3VU7H 5ABEA 4DV7T 2XQAA 1G8XA 3A8YC 3NVOA 5LB7B 2V26A 2WMNA 3HKDE 3AECA 2WY2A 2I0MA 3L3PA 2WP9A 3ONLC 1J1JA 3TKLB 3K3NA 4YSYA 2KZ7B 3AE5A 4JI2T 4E7ZA 5HEJA 5AQPB 5LMNT 2HPJA 1OWAA 1UX4A 2CXDA 3Q5EA 4OK0A 3X1DA 5KMGP 3O9XA 4ILBA 3MACA 1U5PA 5TAOA 1MIWA 3GN5B 5L3GB 2YINA 4WNKA 4KP3C 2BG9A 3T8OA 4JI6T 2V5CA 2D9DA 4IIJE 2LSJA 1FMVA 2JQ9A 3NZQA 4ASKA 1CUNA 2VL8A 4CXWA 2W67A 3AE6A 3L09A 5BR8T 5CA0E 2EHOA 3RYHE 1YKHB 4O4LE 2M6IA 4ZEYA 2RA1A 3C98B 2K48A 3CMLA 5FP3A 2ACXA 5LHIB 1E1HB 1UCUA 4IDOA 2XJ7A 3RYCE 3ZKRA 2CEAA 2KLQA 2NTYA 3RYIE 2HN2A 1OEDC 5C8YE 5JDNA 3UUMA 2LJLA 2D0UA 3I0QA 3NRYA 1O3XA 4QXBB 3RGLA 5J2TE 1OEDE 2NW8A 4DV0T 4CZZB 2BBJA 1LRZA 4O4HE 4O2BE 3O1HA 2I59A 4P0AA 4AQFA 1IJ5A 3WAJA 1JNRA 2KWHA 2A72A 3LSVA 2JMKA 1LVFA 3FBZA 4IGUA 4I0UA 4YTPA 3H3AA 5J2UE 4L5GA 2ZMAA 4ISSA 2E9XB 4UVBB 4EV6A 1ZP0A 4UELA 3E22E 3NKZA 3Q5WA 3PUSA 4Z91A 1HS7A 2E9XD 2W66A 4PK6A 5FL0A 5AQNB 2WM9A 2LHRA 2JPFA 4B3TT 2W61A 4LFBT 2WB5A 1IJ6A 4YSZA 5KXJA 4PK4A 1D1CA 3IA3A 3SFDA 1QLBA 2NWBA 1XZYA 3KBTA 4PFPA 1Y64B 3ZMVB 3P4WA 4BJNA 4ZI3C 4JEUB 5LG4A 4HFCA 1N33T 3IF8B 2W63A 3C4XA 1ZOYA 3M3ZB 4X1KE 4OYKA 4TUYE 1HR0T 4I50E 1MIVA 3VKHA 3Q9DA 4KMCA 3I9WA 2MBGA 2CMRA 2UXNB 3ANWB 2CLYC 2DWGA 4NUUA 4PJMA 5CGMA 4MBQA 2RPAA 3OTOT 4DV4T 4AQFC 3RX6A 1KNPA 3OBVE 4WBOA 5L3BB 4B3ST 3A5XA 5LGUB 2VVNA 2XM1A 2B1EA 2ODUA 3J7Yq 4CXYA 3AE2A 2A2FX 2DLRA 4H9NC 3CX6B 5JQGE 3TLUA 1E2AA 4DMWA 5J0ZA 1XDOA 2AE9A 2R6GF 3EUHA 3RIUA 4X65T 3JC6D 4DUYT 1XNRT 2W0GA 2IC9A 2V6XA 3KV5A 4QX7B 4U31A 5FMNA 4X62T 4B3MT 2EHOD 4HKAA 2IHR1 4E7SA 3LJCA 3UQ4A 3P7IA 3TLWA 3F57A 2L3LA 3BQKA 2CXLA 2V8SV 2Q9QA 3FZMB 3V5SA 3R84B 3OYZA 4KHPT 2WAUA 1BR1A 3ETVA 3RRWA 2IW5B 2Q9QC 4P09A 4TV9E 4O4IE 3P50A 2VQET 4AXPA 4V1Av 4AKIA 3ZPOA 3CK6A 1NAFA 3PUZF 2V7JA 4YJ3E 2XPKA 4I55E 4TN7B 5AQJB 5FXXA 3WI3A 3HL6A 3NBXX 4CI2B 2Z6EA 3PURA 3AVRA 3KV4A 4ILAA 3UU4A 5GONE 3PU3A 3MK7C 1QSDA 3BQLA 1S94A 3MA9A 3Q5XA 3RIUC 4YXDA 5ABFA 3VHLA 5M4YA 3C64A 4YTMA 4L0RA 4OX9T 1KF6A 2QRXA 2CHNA 1T7SA 2MAWA 3AE9A 1IZNB 2HH7A 3FZLB 3UULA 4DV5T 4CN6A 3N5LA 3LK2B 3AVSA 3I1AA 4Q25A 5LJMA 3N9OA 4DV2T 1W09A 1D0XA 1FIOA 2XAHB 5AQVB 4IHJE 2DL1A 4TWDA 1BR0A 2E9XC 4P0BA 2M6BA 2LRLA 4IE4A 4LMKA 2VKJA 2XQYA 3AXJB 3TLTA 4A56A 4UVCB 4F6RC 5ABHA 3ZC0A 1D1BA 4TNWA 2VWAA 1ZEEA 5JDHA 2BVLA 2Y6XA 5JRCA 5AQUB 4U7IA 1YQ4A 3NWIA 4DNDA 2L8KA 3PUGA 4JUYA 4TV8E 2LKGA 1ZKEA 3N9LA 5JDQA 1XNQT 3AXJA 4GKJT 3DJBA 3ONXA 4H9QC 5FKYA 1CHUA 3MXZA 2Q9QD 5AQQB 5FY1A 5C2TA 5HXSA 3B57A 4JI4T 3ZEFB 3IBPA 2IAKA 3VRBA 3LK3B 4JBWF 4UXNB 4AQGA 1VCTA 5L3EB 5IWAT 2IIUA 2ZM2A 1LKXA 4GKKT 4LF9T 1MNEA 2QGSA 3ZJ1A 2H3RA 3LDQB 1N34T 2M67A 3ZYLA 2YDRA 1SHZC 2BS4A 2XQ5A 2YU1A 3SFEA 4JI7T 1X79A 4MFRA 2C5IT 2FJDA 4HE8A 4ZS2A 5J1GA 4DV1T 1XMOT 3EHZA 4FI5A 4ZS3A 3U78A 2WS3A 5JDMA 2CBJA 5KX5E 3ZCIA 4NXMT 2LE8A 1T98A 3ZLIA 4A98A 4Z90A 2KSRA 3H37A 2W62A 4PJNA 1R8IA 5IYZE 3ABVA 3RC3A 3BQIA 4HEAA 5ABGA 1MMAA 1B7TA 2D2SA 4X5TA 4LF8T 3RF1A 3UTKA 5L2LA 3JCFA 5HXCA 2PG8A 4BA9A 5AQOB 2XQ6A 2X9YA 4DR7T 3QUJA 4TWHA 4A97A 2X66A 5F5WA 2OLTA 3CVRA 4EIWA 4U3CA 4KI0F 4ZZBA 4ADZA 4QH5A 3FXEB 4XBFB 3K3OA 1QUUA 2FBWA 2HPLA 3AEEA 2LRKA 3KVAA 3PTRB 4MHCA 4DR3T 3RPUA 3LBXA 5BMVE 3VR9A 4DV3T 1KK7A 1N32T 2IUBA 4O8SA 5DJQC 2BKOA 3AE7A 2MPKA 1W0AA 2V7LA 2GK9A 4ZZCA 2BDEA 2MTQA 5JRCB 4DO0A 2VKHA 2W00A 2UXDT 2YN6A 1MMDA 5HEUA 2JQKA 3AB3B 2BBHA 2FJEA 5FVLA 3FZHB 5JDGA 5JH7E 1SE7A 2LHNA 3SOLA 2E8IA 5HXHA 2BG9E 1WYCA 3EDUA 3N9NA 2X9HA 2BG9B 3LK42 3P4PA 4LMJA 4AIUA 3C4WA 3P4RA 5JR9A 5IUXA 1HFAA 4UIGA 2A9UA 4NIQA 4WZXA 3HKEE 2CRBA 3LG7A 2CWOA 4H9OC 3RI5A 1M7KA 1Z8UA 2WWUA 5LOVE 2MOZA 1FJGT 2Y8DA 3CQGB 3CX8B 3WAKA 5F3JA 2P9BA 2K3WA 5AQFB 5HCJA 5LNKA 2E9XA 2WBLA 2X9XA 4HWDA 2K9AA 4QX8B 5AQMB 3VR8A 4DR2T 1W9RA 3P4SA 1E7PA 2JQQA 2X67A 2PJQA 3P4QA 1FEWA 3UU5A 2ODVA 2BZBA 2LM9A 3HA4A 4OFZA 4TWFA 2CHOA 4YHJA 2LSGA 1BR4A 4AISA 3E08A 3ZSTA 4DMVA 1Y01A 3U3IA 3PE0A 3OYXA 4CXXA 2F4VT 4JI3T 1WFDA 5CA1E 2DI4A 5LBQB 5L3FB 4U2ZA 4TNVA 2VB6A 4YTNA 4JV5T 3J9X1 2OA5A 3CPZA 1WR0A 5AQHB 4ANJA 5FXZA 1YXRA 2BVMA 3RIAA 4LF5T 2UXBT 3NZPA 3JC6C 1KNZA 2G0UA 4DVDA 2JQHA 3AA6B 3ONJA 3ESLA 4QHOA 2B76A 4HWCA 3VKGA 3AAAB 1ZHCA 4IE5A 4H9PC 2CCQA 5C3JA 2BKNA 2WU2A 4H63H 4EB6E 1YKEB 4IDPA 4IE0A 4KHZF 3AEAA 3RQUA 4DBQA 4IDNA 2YK0A 4U74A 4U2YA 2ZM0A 3SRZA 3PJAJ 3OPCA 4GYRA 2CA5A 5FXVA 2RP4A 4AKLA 1HCIA 2XQ4A 3IHRA 4EYYR 1HF8A 5EK4A 5LYJE 5HWYA 3O4XE 1HX1B 1IBKT 3C51A 3W15B 4LFAT 2WU5A 5AQIB 2YDSA 4ZI2D 5EZYE 1JNZA 2J4GA 2VASA 3RQWA 3ZN1B 1XMQT 3ETUA 2XQ7A 2CPTA 4YHHT 1HG2A 3LBXB 2WZHA 3PDYA 4HFIA 5FYMA 1OXZA 5LJNA 3H3MA 3AAEB 2BS3A 2N9DA 3ZT5A 2JIWA 5A1LA 1KEYA 4JI1T 2LT3A 5HEGA 3CX7B 3ANWA 3KFWX 3PJAA 4GIWA 3RKGA 3OJAA 4QH1A 5ADXL 1X9BA 1HNWT 2YOEA 4WYVA 5AQKB 4JI8T 2XSAA 4YSXA 1IAPA 2DWKA 4K0UA 2HN1A 4PW8A 3UU6A 5HXRA 1D0YA 2W2UA 3M65A 3C4ZA 4QKNA 3UT5E 3ZSSA 4ZHQE 4YY3T 4AI6A 4A5XA 2FJAA 3I0OA 5EK3A 4L9IA 3N9QA 1VCSA 5HYAA 4J2CA 3CIRA 2J1DG 2X0LB 1HG5A 2V6YB 1NWMX 5L4HA 2X51A 4JI5T 5FXWA 3L39A 2UXXB 4CI1B 3KVBA 3ZC1A 2XZEA 4CN1A 1I94T 5FY7A 5H6QB 4H9RC 2JMHA 3QB5A 3N2OA 1WR6A 2L9QA 5JTGA 5AQSB 4P1NA 2V6YA 4DBRA 5HEHA 2UUAT 1OEDB 4LMLA 4PFOA 4G63A 5JREA 4IDZA 4DR6T 4MALA 1D0ZA 3FZFB 1EZ3A 3JAEA 5FVKA 5JVDE 4EYUA 4X1IE 4HFEA 3B13A 5HCMA 3QB5K 4AKHA 2ZLYA 2LSYA 2LEHA 5IHYA 3D0TA 3PUYF 1NENA 3NRXA 3RYFE 3UFEA 2EHOB 3PV0F 4OHFA 4KX6A 1VRBA 3OVUA 4PAGA 4EEDA 5HEOA 5LGNB 2V7KA 4X20E 4UV8B 5FNVE 2V7IA 3FXDB 3RHWA 4HGAA 4YT0A 3PUVF 1UX5A 4GK5E 5LMUT 2VKDA 3QNUA 2FJBA 1UK5A 4TZ4C 5CB4E 3ZT6A 3CWZB 2XM2A 1S35A 3C50A 3CQCB 3TLSA 3ZCJA 4X64T 3RC8A 3MZKB 1US7B 2WCAA 2LLYA 2XQ9A 2LSIA 4IE6A 2V7MA 2Y48B 3UU8A 4EXTA 5AFUL 4DUZT 4JI0T 1U4QA 5HWXA 5E0OA 3VRAA 2NR4A 2QVAA 4HFVA 3RRCA 1WYBA 3CKDA 5AQLB 4IE7A 1UURA 5LHHB 4HFHA 1YD8G 3IEEA 3N2GE 1D1AA 4PJLA 4DR5T 4QH4A 1FMWA 2FUPA 3KBUA 4IL4A 2HHHT 3KINB 3PUQA 4GK0E 4JEHB 5F8PA 3ZMSB 3ZT7A 2WDQA 2XQ3A 4K0KT 2NP9A 5LBMA 4O2AE 1YW0A 5CJ5A 4HTEA 1UUSA 3TLVA 3P8CD 2C5KT 2CWYA 4X1YE 2PTFA 5AQGB 4B6XA 5L3CB 4LF4T 5HAXA 4AQYT 1BR2A 1HX8A 4NUVA 1WCRA 4UVAB 3PUXF 5LA6E 3RKOA 2XAGB 3AA0B 3DP7A 3Q2MA 5LP6E 2UUBT 4NXNT 1WLXA 2CE7A 2DHRA 2XAQB 4IT4A 4UR9A 4I43B 4HFDA 2WQYA 2H7OA 2BG9C 3F31A 3UUBA 3AE4A 5LCYA 4WBNE 4AKRB 2D5UA 2KMFA 3AAIA 2UU9T 1VOMA 3GA8A 1MNDA 4UF0B 4EZHA 3K3QC 2AXDS 4PNIA 5JDLA 2NOXA 5LGTB 3HKCE 4X66T 2E5LT 2BKPA 3BK9A 2YKSA 5L47A 3EDVA 2K5BB 2H7VC 5FL1A 4FJOA 1ZV4X 2PFVA 5JR9B 1I6ZA 2C0SA 4ZXLA 2QYWA 1YQ3A 2ZM8A 1V9DA 3PU8A 2IC6A 1HTJF 2VK9A 2C5JA 3FHNA 3Q5DA 4H63V 2IMLA 4ZOLE 4EGWA 5LG3A 3T1YT 1N36T 4UF0A 3RIFA 4ISTA 3CQXC 2JJ9A 4O4JE 1XWMA 2V5DA 2VQFT 3V5UA 4ILUA 1M62A 2YEVC 2ZM6T 2EHOC 3AE1A 4GOUA 4H9SE 1XDPA 3QK6A 3LFMA 3SS1A 1NEKA 3MKDA 2CXFA 4EEBA 2DNXA 2H89A 3GWHA 4F8HA 4Z8XA 2E5VA 4UEMA 2X0YA 2IDOB 5JDFA 2CM0A 3EVYA 3HI2A 4PJJA 4YFSA 4HWIB 3L8RA 3ZYKA 3ZMZB 4HN9A 5HXEA 4YJ2E 5CFBA 3OKQA 1MIYA 2VVSA 2W4XA 1KFYA
chains in the Genus database with same CATH topology
1HNZT 4LF8T 1I94T 2UUCT 3T1HT 2UUAT 4DR6T 4DR3T 4B3TT 4LFBT 4DV3T 4DR4T 1N32T 4DR1T 4JYAT 1N33T 2UXDT 1IBLT 4LF5T 1HR0T 1HNXT 4LFCT 5LMUT 3OTOT 4DV4T 4B3ST 4X64T 4DR7T 4LF7T 4LF6T 1FJGT 4X65T 4DUZT 4JI0T 4B3RT 4DUYT 1XNRT 4X62T 4B3MT 4DR2T 1IBMT 4DV6T 2HHHT 4DR5T 4KHPT 2F4VT 4K0KT 2VQET 4JI3T 4JV5T 1J5ET 2UXBT 4LF4T 4AQYT 4DV2T 2UUBT 4NXNT 4OX9T 4DV5T 2UU9T 1IBKT 4DV7T 4LFAT 4X66T 2E5LT 1XMQT 4YHHT 4JI2T 5LMNT 1XNQT 2UXCT 4GKJT 3T1YT 1N36T 4JI1T 4JI4T 4JI6T 2VQFT 1HNWT 4JI8T 5IWAT 4GKKT 4LF9T 5BR8T 1N34T 4YY3T 4JI7T 2ZM6T 4DV1T 1XMOT 4JI5T 4NXMT 4DV0T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNZ T;  4LF8 T;  1I94 T;  2UUC T;  3T1H T;  2UUA T;  4DR6 T;  4DR3 T;  4B3T T;  4LFB T;  4DV3 T;  4DR4 T;  1N32 T;  4DR1 T;  4JYA T;  1N33 T;  2UXD T;  1IBL T;  4LF5 T;  1HR0 T;  1HNX T;  4LFC T;  5LMU T;  3OTO T;  4DV4 T;  4B3S T;  4X64 T;  4DR7 T;  4LF7 T;  4LF6 T;  1FJG T;  4X65 T;  4DUZ T;  4JI0 T;  4B3R T;  4DUY T;  1XNR T;  4X62 T;  4B3M T;  4DR2 T;  1IBM T;  4DV6 T;  2HHH T;  4DR5 T;  4KHP T;  2F4V T;  4K0K T;  2VQE T;  4JI3 T;  4JV5 T;  1J5E T;  2UXB T;  4LF4 T;  4AQY T;  4DV2 T;  2UUB T;  4NXN T;  4OX9 T;  4DV5 T;  2UU9 T;  1IBK T;  4DV7 T;  4LFA T;  4X66 T;  2E5L T;  1XMQ T;  4YHH T;  4JI2 T;  5LMN T;  1XNQ T;  2UXC T;  4GKJ T;  3T1Y T;  1N36 T;  4JI1 T;  4JI4 T;  4JI6 T;  2VQF T;  1HNW T;  4JI8 T;  5IWA T;  4GKK T;  4LF9 T;  5BR8 T;  1N34 T;  4YY3 T;  4JI7 T;  2ZM6 T;  4DV1 T;  1XMO T;  4JI5 T;  4NXM T;  4DV0 T; 
#chains in the Genus database with same CATH topology
 2NW9 A;  3HR0 A;  3AE3 A;  1HNZ T;  1AJ3 A;  4DID B;  2NW7 A;  1MMN A;  2DCF A;  4QXC B;  5DQV A;  2XAS B;  1WRD A;  2I6H A;  5EK2 A;  4IL9 A;  4CQI A;  4ZI7 E;  2UUC T;  2SPC A;  3PUA A;  3MJX A;  3ZMU B;  3T1H T;  1KNR A;  2Q9Q B;  3B5M A;  5LHG B;  2WSS V;  1Z0P A;  2LOP A;  3ZYM A;  3AEF A;  2XSB A;  3O1I A;  5AQT B;  2V1D B;  3GN5 A;  3RLF F;  4HFB A;  5L3D B;  1T72 A;  2LM2 A;  3EAB A;  4KBM B;  2KXP B;  2CBI A;  3KV6 A;  3AEB A;  2X68 A;  2XQ8 A;  4DR4 T;  4DR1 T;  2PBI A;  3FZK B;  3I9Y A;  3JAF A;  4U72 A;  2MYS A;  4JYA T;  3UQ7 A;  4XAX B;  4ERR A;  1H7C A;  2WZI A;  4IRE A;  3AE8 A;  2BS2 A;  1OED A;  4GYS A;  1HNX T;  4LFC T;  2QA7 A;  2H88 A;  4U33 A;  2J62 A;  4G2A A;  4HWF A;  4ZI3 D;  3E0Z A;  2NTX A;  3A7M A;  4JLE A;  4MLK A;  4PK5 A;  3UU3 A;  2VL0 A;  4HWH A;  1G73 A;  3ZMT B;  4YLH A;  3FB2 A;  3N2K E;  3N9P A;  2E2A A;  2WDV A;  1SUM B;  1W0B A;  4EZ4 A;  5DQW A;  4COF A;  5L4E A;  2XAF B;  4LF7 T;  3K8P C;  4LF6 T;  3UFG A;  5JR9 C;  3EI0 A;  2UXC T;  2OV9 A;  4C90 A;  5KDM C;  2D0T A;  4BJM A;  2VKO A;  5AQR B;  4B3R T;  3AA1 B;  3N9M A;  3F2E A;  4TX5 A;  4C91 A;  4BAY B;  3FBL A;  4CN4 A;  4EOZ B;  2JRK A;  2X0H A;  3K1S A;  5H6R B;  4DV6 T;  1IBM T;  4AKG A;  3G06 A;  2X9W A;  4I4T E;  2A3D A;  4U7Y A;  2VUR A;  5ETW A;  3AED A;  4EAH A;  3QC9 A;  2N2N A;  5ABF B;  2ACZ A;  2KWI B;  3HKB E;  3R6N A;  3DTO A;  3KV9 A;  4CI3 B;  2YDQ A;  2KIN B;  2LSK A;  1T8B A;  4IDQ A;  4NPP A;  3RH3 A;  3EAM A;  1GQE A;  1DU2 A;  1J5W A;  1LVK A;  3AEG A;  2ES0 A;  3KDS E;  3QOF A;  4WW0 A;  2WMO A;  5FY0 A;  3ZJ2 A;  1J5E T;  4XZC A;  2XY8 B;  4ZI2 C;  3JAD A;  3SWH A;  1SA0 E;  4OYJ A;  1L0V A;  4ILC A;  3ZN0 B;  1IBL T;  2XTL A;  2WWV A;  2J47 A;  2LKH A;  2XUE A;  3GMI A;  2XHE B;  3UUN A;  2LOS A;  2N1G A;  3UUX B;  5LXT E;  1UGO A;  4QWN B;  2KT9 A;  2CLY B;  3S4U A;  2KND A;  3O1J A;  3PUW F;  4QXH B;  2WDR A;  1MMG A;  4KUM B;  5DAB A;  2XAJ B;  3AA7 B;  4N78 D;  2K24 A;  4UV9 B;  4M1P A;  2YU2 A;  3VU7 H;  5ABE A;  4DV7 T;  2XQA A;  1G8X A;  3A8Y C;  3NVO A;  5LB7 B;  2V26 A;  2WMN A;  3HKD E;  3AEC A;  2WY2 A;  2I0M A;  3L3P A;  2WP9 A;  3ONL C;  1J1J A;  3TKL B;  3K3N A;  4YSY A;  2KZ7 B;  3AE5 A;  4JI2 T;  4E7Z A;  5HEJ A;  5AQP B;  5LMN T;  2HPJ A;  1OWA A;  1UX4 A;  2CXD A;  3Q5E A;  4OK0 A;  3X1D A;  5KMG P;  3O9X A;  4ILB A;  3MAC A;  1U5P A;  5TAO A;  1MIW A;  3GN5 B;  5L3G B;  2YIN A;  4WNK A;  4KP3 C;  2BG9 A;  3T8O A;  4JI6 T;  2V5C A;  2D9D A;  4IIJ E;  2LSJ A;  1FMV A;  2JQ9 A;  3NZQ A;  4ASK A;  1CUN A;  2VL8 A;  4CXW A;  2W67 A;  3AE6 A;  3L09 A;  5BR8 T;  5CA0 E;  2EHO A;  3RYH E;  1YKH B;  4O4L E;  2M6I A;  4ZEY A;  2RA1 A;  3C98 B;  2K48 A;  3CML A;  5FP3 A;  2ACX A;  5LHI B;  1E1H B;  1UCU A;  4IDO A;  2XJ7 A;  3RYC E;  3ZKR A;  2CEA A;  2KLQ A;  2NTY A;  3RYI E;  2HN2 A;  1OED C;  5C8Y E;  5JDN A;  3UUM A;  2LJL A;  2D0U A;  3I0Q A;  3NRY A;  1O3X A;  4QXB B;  3RGL A;  5J2T E;  1OED E;  2NW8 A;  4DV0 T;  4CZZ B;  2BBJ A;  1LRZ A;  4O4H E;  4O2B E;  3O1H A;  2I59 A;  4P0A A;  4AQF A;  1IJ5 A;  3WAJ A;  1JNR A;  2KWH A;  2A72 A;  3LSV A;  2JMK A;  1LVF A;  3FBZ A;  4IGU A;  4I0U A;  4YTP A;  3H3A A;  5J2U E;  4L5G A;  2ZMA A;  4ISS A;  2E9X B;  4UVB B;  4EV6 A;  1ZP0 A;  4UEL A;  3E22 E;  3NKZ A;  3Q5W A;  3PUS A;  4Z91 A;  1HS7 A;  2E9X D;  2W66 A;  4PK6 A;  5FL0 A;  5AQN B;  2WM9 A;  2LHR A;  2JPF A;  4B3T T;  2W61 A;  4LFB T;  2WB5 A;  1IJ6 A;  4YSZ A;  5KXJ A;  4PK4 A;  1D1C A;  3IA3 A;  3SFD A;  1QLB A;  2NWB A;  1XZY A;  3KBT A;  4PFP A;  1Y64 B;  3ZMV B;  3P4W A;  4BJN A;  4ZI3 C;  4JEU B;  5LG4 A;  4HFC A;  1N33 T;  3IF8 B;  2W63 A;  3C4X A;  1ZOY A;  3M3Z B;  4X1K E;  4OYK A;  4TUY E;  1HR0 T;  4I50 E;  1MIV A;  3VKH A;  3Q9D A;  4KMC A;  3I9W A;  2MBG A;  2CMR A;  2UXN B;  3ANW B;  2CLY C;  2DWG A;  4NUU A;  4PJM A;  5CGM A;  4MBQ A;  2RPA A;  3OTO T;  4DV4 T;  4AQF C;  3RX6 A;  1KNP A;  3OBV E;  4WBO A;  5L3B B;  4B3S T;  3A5X A;  5LGU B;  2VVN A;  2XM1 A;  2B1E A;  2ODU A;  3J7Y q;  4CXY A;  3AE2 A;  2A2F X;  2DLR A;  4H9N C;  3CX6 B;  5JQG E;  3TLU A;  1E2A A;  4DMW A;  5J0Z A;  1XDO A;  2AE9 A;  2R6G F;  3EUH A;  3RIU A;  4X65 T;  3JC6 D;  4DUY T;  1XNR T;  2W0G A;  2IC9 A;  2V6X A;  3KV5 A;  4QX7 B;  4U31 A;  5FMN A;  4X62 T;  4B3M T;  2EHO D;  4HKA A;  2IHR 1;  4E7S A;  3LJC A;  3UQ4 A;  3P7I A;  3TLW A;  3F57 A;  2L3L A;  3BQK A;  2CXL A;  2V8S V;  2Q9Q A;  3FZM B;  3V5S A;  3R84 B;  3OYZ A;  4KHP T;  2WAU A;  1BR1 A;  3ETV A;  3RRW A;  2IW5 B;  2Q9Q C;  4P09 A;  4TV9 E;  4O4I E;  3P50 A;  2VQE T;  4AXP A;  4V1A v;  4AKI A;  3ZPO A;  3CK6 A;  1NAF A;  3PUZ F;  2V7J A;  4YJ3 E;  2XPK A;  4I55 E;  4TN7 B;  5AQJ B;  5FXX A;  3WI3 A;  3HL6 A;  3NBX X;  4CI2 B;  2Z6E A;  3PUR A;  3AVR A;  3KV4 A;  4ILA A;  3UU4 A;  5GON E;  3PU3 A;  3MK7 C;  1QSD A;  3BQL A;  1S94 A;  3MA9 A;  3Q5X A;  3RIU C;  4YXD A;  5ABF A;  3VHL A;  5M4Y A;  3C64 A;  4YTM A;  4L0R A;  4OX9 T;  1KF6 A;  2QRX A;  2CHN A;  1T7S A;  2MAW A;  3AE9 A;  1IZN B;  2HH7 A;  3FZL B;  3UUL A;  4DV5 T;  4CN6 A;  3N5L A;  3LK2 B;  3AVS A;  3I1A A;  4Q25 A;  5LJM A;  3N9O A;  4DV2 T;  1W09 A;  1D0X A;  1FIO A;  2XAH B;  5AQV B;  4IHJ E;  2DL1 A;  4TWD A;  1BR0 A;  2E9X C;  4P0B A;  2M6B A;  2LRL A;  4IE4 A;  4LMK A;  2VKJ A;  2XQY A;  3AXJ B;  3TLT A;  4A56 A;  4UVC B;  4F6R C;  5ABH A;  3ZC0 A;  1D1B A;  4TNW A;  2VWA A;  1ZEE A;  5JDH A;  2BVL A;  2Y6X A;  5JRC A;  5AQU B;  4U7I A;  1YQ4 A;  3NWI A;  4DND A;  2L8K A;  3PUG A;  4JUY A;  4TV8 E;  2LKG A;  1ZKE A;  3N9L A;  5JDQ A;  1XNQ T;  3AXJ A;  4GKJ T;  3DJB A;  3ONX A;  4H9Q C;  5FKY A;  1CHU A;  3MXZ A;  2Q9Q D;  5AQQ B;  5FY1 A;  5C2T A;  5HXS A;  3B57 A;  4JI4 T;  3ZEF B;  3IBP A;  2IAK A;  3VRB A;  3LK3 B;  4JBW F;  4UXN B;  4AQG A;  1VCT A;  5L3E B;  5IWA T;  2IIU A;  2ZM2 A;  1LKX A;  4GKK T;  4LF9 T;  1MNE A;  2QGS A;  3ZJ1 A;  2H3R A;  3LDQ B;  1N34 T;  2M67 A;  3ZYL A;  2YDR A;  1SHZ C;  2BS4 A;  2XQ5 A;  2YU1 A;  3SFE A;  4JI7 T;  1X79 A;  4MFR A;  2C5I T;  2FJD A;  4HE8 A;  4ZS2 A;  5J1G A;  4DV1 T;  1XMO T;  3EHZ A;  4FI5 A;  4ZS3 A;  3U78 A;  2WS3 A;  5JDM A;  2CBJ A;  5KX5 E;  3ZCI A;  4NXM T;  2LE8 A;  1T98 A;  3ZLI A;  4A98 A;  4Z90 A;  2KSR A;  3H37 A;  2W62 A;  4PJN A;  1R8I A;  5IYZ E;  3ABV A;  3RC3 A;  3BQI A;  4HEA A;  5ABG A;  1MMA A;  1B7T A;  2D2S A;  4X5T A;  4LF8 T;  3RF1 A;  3UTK A;  5L2L A;  3JCF A;  5HXC A;  2PG8 A;  4BA9 A;  5AQO B;  2XQ6 A;  2X9Y A;  4DR7 T;  3QUJ A;  4TWH A;  4A97 A;  2X66 A;  5F5W A;  2OLT A;  3CVR A;  4EIW A;  4U3C A;  4KI0 F;  4ZZB A;  4ADZ A;  4QH5 A;  3FXE B;  4XBF B;  3K3O A;  1QUU A;  2FBW A;  2HPL A;  3AEE A;  2LRK A;  3KVA A;  3PTR B;  4MHC A;  4DR3 T;  3RPU A;  3LBX A;  5BMV E;  3VR9 A;  4DV3 T;  1KK7 A;  1N32 T;  2IUB A;  4O8S A;  5DJQ C;  2BKO A;  3AE7 A;  2MPK A;  1W0A A;  2V7L A;  2GK9 A;  4ZZC A;  2BDE A;  2MTQ A;  5JRC B;  4DO0 A;  2VKH A;  2W00 A;  2UXD T;  2YN6 A;  1MMD A;  5HEU A;  2JQK A;  3AB3 B;  2BBH A;  2FJE A;  5FVL A;  3FZH B;  5JDG A;  5JH7 E;  1SE7 A;  2LHN A;  3SOL A;  2E8I A;  5HXH A;  2BG9 E;  1WYC A;  3EDU A;  3N9N A;  2X9H A;  2BG9 B;  3LK4 2;  3P4P A;  4LMJ A;  4AIU A;  3C4W A;  3P4R A;  5JR9 A;  5IUX A;  1HFA A;  4UIG A;  2A9U A;  4NIQ A;  4WZX A;  3HKE E;  2CRB A;  3LG7 A;  2CWO A;  4H9O C;  3RI5 A;  1M7K A;  1Z8U A;  2WWU A;  5LOV E;  2MOZ A;  1FJG T;  2Y8D A;  3CQG B;  3CX8 B;  3WAK A;  5F3J A;  2P9B A;  2K3W A;  5AQF B;  5HCJ A;  5LNK A;  2E9X A;  2WBL A;  2X9X A;  4HWD A;  2K9A A;  4QX8 B;  5AQM B;  3VR8 A;  4DR2 T;  1W9R A;  3P4S A;  1E7P A;  2JQQ A;  2X67 A;  2PJQ A;  3P4Q A;  1FEW A;  3UU5 A;  2ODV A;  2BZB A;  2LM9 A;  3HA4 A;  4OFZ A;  4TWF A;  2CHO A;  4YHJ A;  2LSG A;  1BR4 A;  4AIS A;  3E08 A;  3ZST A;  4DMV A;  1Y01 A;  3U3I A;  3PE0 A;  3OYX A;  4CXX A;  2F4V T;  4JI3 T;  1WFD A;  5CA1 E;  2DI4 A;  5LBQ B;  5L3F B;  4U2Z A;  4TNV A;  2VB6 A;  4YTN A;  4JV5 T;  3J9X 1;  2OA5 A;  3CPZ A;  1WR0 A;  5AQH B;  4ANJ A;  5FXZ A;  1YXR A;  2BVM A;  3RIA A;  4LF5 T;  2UXB T;  3NZP A;  3JC6 C;  1KNZ A;  2G0U A;  4DVD A;  2JQH A;  3AA6 B;  3ONJ A;  3ESL A;  4QHO A;  2B76 A;  4HWC A;  3VKG A;  3AAA B;  1ZHC A;  4IE5 A;  4H9P C;  2CCQ A;  5C3J A;  2BKN A;  2WU2 A;  4H63 H;  4EB6 E;  1YKE B;  4IDP A;  4IE0 A;  4KHZ F;  3AEA A;  3RQU A;  4DBQ A;  4IDN A;  2YK0 A;  4U74 A;  4U2Y A;  2ZM0 A;  3SRZ A;  3PJA J;  3OPC A;  4GYR A;  2CA5 A;  5FXV A;  2RP4 A;  4AKL A;  1HCI A;  2XQ4 A;  3IHR A;  4EYY R;  1HF8 A;  5EK4 A;  5LYJ E;  5HWY A;  3O4X E;  1HX1 B;  1IBK T;  3C51 A;  3W15 B;  4LFA T;  2WU5 A;  5AQI B;  2YDS A;  4ZI2 D;  5EZY E;  1JNZ A;  2J4G A;  2VAS A;  3RQW A;  3ZN1 B;  1XMQ T;  3ETU A;  2XQ7 A;  2CPT A;  4YHH T;  1HG2 A;  3LBX B;  2WZH A;  3PDY A;  4HFI A;  5FYM A;  1OXZ A;  5LJN A;  3H3M A;  3AAE B;  2BS3 A;  2N9D A;  3ZT5 A;  2JIW A;  5A1L A;  1KEY A;  4JI1 T;  2LT3 A;  5HEG A;  3CX7 B;  3ANW A;  3KFW X;  3PJA A;  4GIW A;  3RKG A;  3OJA A;  4QH1 A;  5ADX L;  1X9B A;  1HNW T;  2YOE A;  4WYV A;  5AQK B;  4JI8 T;  2XSA A;  4YSX A;  1IAP A;  2DWK A;  4K0U A;  2HN1 A;  4PW8 A;  3UU6 A;  5HXR A;  1D0Y A;  2W2U A;  3M65 A;  3C4Z A;  4QKN A;  3UT5 E;  3ZSS A;  4ZHQ E;  4YY3 T;  4AI6 A;  4A5X A;  2FJA A;  3I0O A;  5EK3 A;  4L9I A;  3N9Q A;  1VCS A;  5HYA A;  4J2C A;  3CIR A;  2J1D G;  2X0L B;  1HG5 A;  2V6Y B;  1NWM X;  5L4H A;  2X51 A;  4JI5 T;  5FXW A;  3L39 A;  2UXX B;  4CI1 B;  3KVB A;  3ZC1 A;  2XZE A;  4CN1 A;  1I94 T;  5FY7 A;  5H6Q B;  4H9R C;  2JMH A;  3QB5 A;  3N2O A;  1WR6 A;  2L9Q A;  5JTG A;  5AQS B;  4P1N A;  2V6Y A;  4DBR A;  5HEH A;  2UUA T;  1OED B;  4LML A;  4PFO A;  4G63 A;  5JRE A;  4IDZ A;  4DR6 T;  4MAL A;  1D0Z A;  3FZF B;  1EZ3 A;  3JAE A;  5FVK A;  5JVD E;  4EYU A;  4X1I E;  4HFE A;  3B13 A;  5HCM A;  3QB5 K;  4AKH A;  2ZLY A;  2LSY A;  2LEH A;  5IHY A;  3D0T A;  3PUY F;  1NEN A;  3NRX A;  3RYF E;  3UFE A;  2EHO B;  3PV0 F;  4OHF A;  4KX6 A;  1VRB A;  3OVU A;  4PAG A;  4EED A;  5HEO A;  5LGN B;  2V7K A;  4X20 E;  4UV8 B;  5FNV E;  2V7I A;  3FXD B;  3RHW A;  4HGA A;  4YT0 A;  3PUV F;  1UX5 A;  4GK5 E;  5LMU T;  2VKD A;  3QNU A;  2FJB A;  1UK5 A;  4TZ4 C;  5CB4 E;  3ZT6 A;  3CWZ B;  2XM2 A;  1S35 A;  3C50 A;  3CQC B;  3TLS A;  3ZCJ A;  4X64 T;  3RC8 A;  3MZK B;  1US7 B;  2WCA A;  2LLY A;  2XQ9 A;  2LSI A;  4IE6 A;  2V7M A;  2Y48 B;  3UU8 A;  4EXT A;  5AFU L;  4DUZ T;  4JI0 T;  1U4Q A;  5HWX A;  5E0O A;  3VRA A;  2NR4 A;  2QVA A;  4HFV A;  3RRC A;  1WYB A;  3CKD A;  5AQL B;  4IE7 A;  1UUR A;  5LHH B;  4HFH A;  1YD8 G;  3IEE A;  3N2G E;  1D1A A;  4PJL A;  4DR5 T;  4QH4 A;  1FMW A;  2FUP A;  3KBU A;  4IL4 A;  2HHH T;  3KIN B;  3PUQ A;  4GK0 E;  4JEH B;  5F8P A;  3ZMS B;  3ZT7 A;  2WDQ A;  2XQ3 A;  4K0K T;  2NP9 A;  5LBM A;  4O2A E;  1YW0 A;  5CJ5 A;  4HTE A;  1UUS A;  3TLV A;  3P8C D;  2C5K T;  2CWY A;  4X1Y E;  2PTF A;  5AQG B;  4B6X A;  5L3C B;  4LF4 T;  5HAX A;  4AQY T;  1BR2 A;  1HX8 A;  4NUV A;  1WCR A;  4UVA B;  3PUX F;  5LA6 E;  3RKO A;  2XAG B;  3AA0 B;  3DP7 A;  3Q2M A;  5LP6 E;  2UUB T;  4NXN T;  1WLX A;  2CE7 A;  2DHR A;  2XAQ B;  4IT4 A;  4UR9 A;  4I43 B;  4HFD A;  2WQY A;  2H7O A;  2BG9 C;  3F31 A;  3UUB A;  3AE4 A;  5LCY A;  4WBN E;  4AKR B;  2D5U A;  2KMF A;  3AAI A;  2UU9 T;  1VOM A;  3GA8 A;  1MND A;  4UF0 B;  4EZH A;  3K3Q C;  2AXD S;  4PNI A;  5JDL A;  2NOX A;  5LGT B;  3HKC E;  4X66 T;  2E5L T;  2BKP A;  3BK9 A;  2YKS A;  5L47 A;  3EDV A;  2K5B B;  2H7V C;  5FL1 A;  4FJO A;  1ZV4 X;  2PFV A;  5JR9 B;  1I6Z A;  2C0S A;  4ZXL A;  2QYW A;  1YQ3 A;  2ZM8 A;  1V9D A;  3PU8 A;  2IC6 A;  1HTJ F;  2VK9 A;  2C5J A;  3FHN A;  3Q5D A;  4H63 V;  2IML A;  4ZOL E;  4EGW A;  5LG3 A;  3T1Y T;  1N36 T;  4UF0 A;  3RIF A;  4IST A;  3CQX C;  2JJ9 A;  4O4J E;  1XWM A;  2V5D A;  2VQF T;  3V5U A;  4ILU A;  1M62 A;  2YEV C;  2ZM6 T;  2EHO C;  3AE1 A;  4GOU A;  4H9S E;  1XDP A;  3QK6 A;  3LFM A;  3SS1 A;  1NEK A;  3MKD A;  2CXF A;  4EEB A;  2DNX A;  2H89 A;  3GWH A;  4F8H A;  4Z8X A;  2E5V A;  4UEM A;  2X0Y A;  2IDO B;  5JDF A;  2CM0 A;  3EVY A;  3HI2 A;  4PJJ A;  4YFS A;  4HWI B;  3L8R A;  3ZYK A;  3ZMZ B;  4HN9 A;  5HXE A;  4YJ2 E;  5CFB A;  3OKQ A;  1MIY A;  2VVS A;  2W4X A;  1KFY A; 
#chains in the Genus database with same CATH homology
 1HNZ T;  4LF8 T;  1I94 T;  2UUC T;  3T1H T;  2UUA T;  4DR6 T;  4DR3 T;  4B3T T;  4LFB T;  4DV3 T;  4DR4 T;  1N32 T;  4DR1 T;  4JYA T;  1N33 T;  2UXD T;  1IBL T;  4LF5 T;  1HR0 T;  1HNX T;  4LFC T;  5LMU T;  3OTO T;  4DV4 T;  4B3S T;  4X64 T;  4DR7 T;  4LF7 T;  4LF6 T;  1FJG T;  4X65 T;  4DUZ T;  4JI0 T;  4B3R T;  4DUY T;  1XNR T;  4X62 T;  4B3M T;  4DR2 T;  1IBM T;  4DV6 T;  2HHH T;  4DR5 T;  4KHP T;  2F4V T;  4K0K T;  2VQE T;  4JI3 T;  4JV5 T;  1J5E T;  2UXB T;  4LF4 T;  4AQY T;  4DV2 T;  2UUB T;  4NXN T;  4OX9 T;  4DV5 T;  2UU9 T;  1IBK T;  4DV7 T;  4LFA T;  4X66 T;  2E5L T;  1XMQ T;  4YHH T;  4JI2 T;  5LMN T;  1XNQ T;  2UXC T;  4GKJ T;  3T1Y T;  1N36 T;  4JI1 T;  4JI4 T;  4JI6 T;  2VQF T;  1HNW T;  4JI8 T;  5IWA T;  4GKK T;  4LF9 T;  5BR8 T;  1N34 T;  4YY3 T;  4JI7 T;  2ZM6 T;  4DV1 T;  1XMO T;  4JI5 T;  4NXM T;  4DV0 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...