1FJGT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1fjgT00
4JI5T 4K0KT 2VQET 4DV3T 4AQYT 2ZM6T 4DR3T 1FJGT 4X65T 2UXCT 4B3RT 4JI0T 4DV6T 4JI8T 4GKKT 4JI2T 4LF6T 2UUBT 4X62T 4LF9T 2UU9T 1I94T 2E5LT 4DR4T 4JI7T 5LMNT 1N34T 4DV5T 4B3TT 4JI3T 4DR7T 3T1YT 3T1HT 2F4VT 2UXDT 2VQFT 4LFBT 4DUYT 1IBKT 1XMQT 1IBLT 5IWAT 4DV2T 4DR1T 4DUZT 4JI6T 2UUAT 4DV4T 2UUCT 4OX9T 4KHPT 2HHHT 4X64T 1HNWT 1HNXT 4DR6T 4DV0T 4JV5T 4NXMT 4JYAT 1HNZT 4JI1T 4LF5T 1J5ET 1HR0T 4DR5T 1XMOT 1XNQT 4DV7T 1N33T 4YY3T 4GKJT 5LMUT 1N36T 1N32T 2UXBT 4LFAT 4LF8T 5BR8T 4LF4T 3OTOT 4B3MT 4YHHT 4B3ST 4JI4T 4LF7T 1XNRT 4DV1T 1IBMT 4X66T 4DR2T 4LFCT 4NXNT
chains in the Genus database with same CATH superfamily
1HG5A 2H88A 4HWFA 4QXHB 4KMCA 2XQ4A 3RIUA 5EK3A 4ERRA 2KMFA 4DR3T 3MACA 1DU2A 4IHJE 3AXJA 3QK6A 3CK6A 4TWHA 2V7JA 4QH5A 3P7IA 3AE7A 4ZI2D 2XAFB 5AQQB 4AKGA 2CWYA 3ONXA 3T8OA 4EGWA 4IL9A 1M7KA 5HXCA 1T7SA 4AKIA 2PG8A 2VKJA 4YTNA 4DR7T 5LG3A 4DIDB 2W62A 3EDUA 1IBLT 2QYWA 2FJAA 4DNDA 2BVMA 2XQ9A 4DV4T 5LCYA 4YHJA 2CHOA 4U74A 5LJNA 4UV8B 2NTYA 5IHYA 3P50A 5AQFB 2DI4A 2M6BA 3ZT5A 4WYVA 4ZI3D 3P4QA 2HPJA 4OK0A 4GKJT 3JC6D 3PDYA 1MMAA 2W00A 4LFAT 2XQAA 2BKNA 4UF0A 1E2AA 1VCSA 4LF4T 3AA6B 1D1CA 1U5PA 3CX7B 2OLTA 3AECA 5J0ZA 2ACZA 4UXNB 2L9QA 2ODUA 2V6YA 3KVAA 3PU8A 1G73A 3PJAJ 4GKKT 3UU4A 2NW8A 4COFA 2XM2A 2VK9A 2PFVA 2XJ7A 2YU2A 2LHRA 5JDQA 4M1PA 5H6RB 2GK9A 3VKGA 4TUYE 3AAAB 3LBXA 5HXHA 2H7OA 2X9XA 5JREA 4DUYT 3RC8A 2LSGA 2XQ6A 5BMVE 3FZLB 3PURA 3JC6C 2WS3A 3OBVE 4PJJA 3AEFA 3LSVA 4JV5T 2Y48B 4EEDA 5C2TA 5F8PA 3M65A 2I0MA 4ZZBA 2I59A 4IL4A 2WDQA 3NBXX 5HEGA 3AB3B 1MNEA 5LMUT 2XSAA 5JVDE 3UUNA 4B6XA 1MIVA 3O4XE 3Q9DA 4AKHA 3AA1B 3PUQA 4N78D 3VR9A 4LF7T 4DV1T 4UEMA 3EAMA 2LJLA 2NP9A 3B5MA 2CXFA 4ADZA 2FJBA 2LRKA 2CLYB 3AE6A 4IE5A 3AA7B 2LT3A 1FIOA 2WU5A 3HR0A 1MMGA 4EYUA 4JI0T 2BVLA 4J2CA 2XM1A 5HCJA 2ACXA 3N2GE 4YJ3E 1W9RA 5DJQC 2W61A 5C3JA 1YW0A 1X9BA 5L2LA 3IA3A 2LSYA 4L5GA 1M62A 1QLBA 2RA1A 3ZCJA 2CA5A 4OYJA 3BQLA 4IDNA 3EUHA 2KZ7B 2M67A 5JR9B 4K0UA 2W63A 2XQYA 2W66A 3RX6A 4HWIB 4H9NC 5JR9C 4OHFA 2LEHA 2K5BB 3GN5A 3FXEB 2XQ7A 1HTJF 4ISTA 2YDRA 5E0OA 2BBJA 3AE5A 4X1IE 3OTOT 2VL0A 5LBMA 3Q5DA 4KP3C 3ANWB 1IBMT 4H63V 3ZYLA 3LG7A 3Q5WA 3X1DA 4KI0F 5ADXL 4DV3T 3JCFA 2V6XA 4UR9A 2CWOA 2QRXA 4DVDA 2K3WA 3EABA 3ZLIA 3RHWA 4HN9A 3I9YA 2ODVA 4P0BA 1HG2A 3R6NA 4JEUB 3BK9A 1AJ3A 2K48A 3N5LA 3I9WA 3N9OA 4TNWA 3RLFF 4HFBA 2G0UA 4IIJE 3ZT6A 4YLHA 1ZHCA 3NKZA 1ZOYA 5L3EB 5L47A 4IDOA 2DHRA 5CB4E 4QHOA 3C4XA 3TKLB 1HNZT 3O9XA 1D1BA 2WB5A 5FKYA 2RPAA 3OVUA 2XQ5A 3QB5K 3K8PC 1HF8A 4U2ZA 3RRWA 2L3LA 3PUSA 2DNXA 5L3BB 1MMNA 1T72A 4IE0A 2WSSV 1MNDA 3O1HA 1UURA 2BG9C 2DWKA 4LMJA 4TWFA 2BDEA 2X67A 5TAOA 4QH1A 4V1Av 2LOSA 1V9DA 5DQVA 3MKDA 5LBQB 2D2SA 2K9AA 4B3RT 1OEDC 3N2KE 3DP7A 1JNZA 1Y01A 1Z8UA 3AE8A 5JRCB 1E7PA 4QX7B 1LVKA 2N2NA 2MPKA 3MA9A 4MLKA 4NIQA 4AKRB 3OPCA 1T98A 2ZM0A 5LGUB 1IBKT 2Q9QD 3K1SA 4AQFA 2IMLA 3QNUA 5DQWA 4JBWF 3FZMB 1FEWA 3PUGA 2RP4A 3RGLA 2KNDA 2HN1A 4HKAA 4PFPA 4JI1T 1KNZA 2DLRA 3PE0A 4FJOA 4EOZB 3R84B 3OYXA 4X1YE 4I55E 4P09A 2V8SV 4PK4A 1ZP0A 1EZ3A 3A5XA 4PFOA 4E7SA 1UCUA 2YEVC 5HXSA 2LKGA 2IHR1 3D0TA 4B3MT 3GMIA 4HFEA 4WBOA 4O4HE 2D5UA 4U7IA 3RYCE 3AE3A 2EHOD 2JMKA 1OWAA 5F5WA 2J47A 2Q9QB 2K24A 4A98A 3RQWA 4CZZB 4EAHA 3AAEB 4QWNB 5JDHA 1KNRA 3A8YC 3PV0F 2H89A 4X62T 2E5LT 1JNRA 3C64A 4YTPA 1VOMA 2W4XA 1MMDA 2WDVA 5L3CB 4IT4A 4KUMB 5HEHA 3ZT7A 3CPZA 3AE2A 3M3ZB 5DABA 2MAWA 1XZYA 2HH7A 1HNWT 1HNXT 3GA8A 1KK7A 1T8BA 2BG9A 2EHOB 4AISA 3L09A 2CBJA 4JEHB 4YTMA 3E0ZA 1QSDA 3C51A 4AXPA 2KXPB 1OEDA 3UQ4A 5L4EA 1US7B 2AE9A 1FMWA 3AEDA 1XDOA 4TV9E 4X66T 3K3NA 3J9X1 5LJMA 1J5WA 3C50A 2KT9A 3ZMTB 4ANJA 1Z0PA 4CXYA 1D0ZA 3HKEE 1LRZA 2UXXB 3L3PA 4EYYR 2QVAA 4ZI2C 5JH7E 1R8IA 2UU9T 5FMNA 3V5SA 3KINB 3ZN1B 5ABFB 2XAQB 4JLEA 1H7CA 5HWYA 5FNVE 3UT5E 4G63A 3N9LA 3T1HT 3PTRB 3FXDB 2UXDT 3UUXB 2WQYA 3KBUA 2MOZA 2ZM8A 1UX5A 4EZ4A 3IEEA 5L3FB 2CCQA 4JUYA 4JYAT 5CA0E 2PJQA 2DL1A 1HR0T 3NVOA 1XWMA 2VASA 4ZI3C 5LHGB 5AQVB 3AEBA 3HL6A 2SPCA 3MXZA 3K3OA 3C4WA 2IIUA 1MIWA 3TLSA 3UFGA 4UIGA 2XQ8A 2FJDA 4ZS2A 4B3ST 4TX5A 3ABVA 5AQKB 3RYHE 4JI5T 2VB6A 3ZKRA 2C0SA 2FBWA 2J4GA 1NEKA 2YK0A 3CVRA 3QOFA 4DV6T 1NAFA 2H7VC 3CQXC 3ZSTA 4I4TE 5JDNA 4WBNE 4ILBA 4CN4A 2MYSA 1W09A 4JI7T 3CQGB 2VURA 4O2AE 4CI1B 3CX6B 3NRXA 5LG4A 4AKLA 2CLYC 2CMRA 2N1GA 1QUUA 3RI5A 2WY2A 3FB2A 5L4HA 2IC9A 2CHNA 2YDQA 1BR1A 4MHCA 1W0BA 4CN6A 3W15B 5A1LA 4NXMT 3C4ZA 3O1IA 5HCMA 3QB5A 2ZMAA 4ILAA 3UU6A 2N9DA 2IUBA 4YY3T 3GWHA 4HFIA 2UXBT 3LK42 1SUMB 2E9XD 4HGAA 3KV6A 4O4LE 4JI4T 3NRYA 4MBQA 2L8KA 2V7LA 2ZLYA 2JIWA 4YSXA 4PK6A 1U4QA 3EHZA 4GIWA 4HWHA 1IJ6A 2X51A 3J7Yq 1LVFA 3NZQA 2A3DA 3O1JA 1X79A 2HPLA 3VR8A 2E5VA 4UVBB 4LF6T 4I0UA 4HFDA 4AIUA 2X68A 5AQJB 4C91A 4F6RC 3RC3A 2X9YA 4DV5T 5AQMB 4B3TT 5J1GA 5AQRB 4ZZCA 4NUUA 5FYMA 3JAEA 4O4JE 2VQFT 4PNIA 2E9XB 2X66A 5IWAT 5LB7B 3OKQA 3QC9A 2H3RA 2WMNA 5HXRA 4ZHQE 2BKOA 4ZXLA 2C5KT 2HHHT 3ZC0A 4PJLA 5FXZA 5KX5E 5C8YE 4KHZF 4PK5A 2A9UA 1IZNB 4EEBA 1YQ3A 4U7YA 1YKHB 4ASKA 1NENA 1N33T 4XAXB 1GQEA 5BR8T 3P4PA 4BA9A 2W0GA 2BS2A 2NWBA 2XZEA 3RIFA 1HX1B 2JQ9A 1YXRA 5AQIB 3AXJB 4UVCB 2KWIB 3N2OA 5HAXA 3G06A 4HFVA 4CI3B 4JI2T 5FVKA 5L3DB 2XY8B 3LJCA 1HCIA 3RF1A 5HEJA 3Q5XA 5LYJE 2W2UA 3ONLC 2OV9A 3ESLA 3SWHA 5AQUB 5LOVE 5GONE 1UGOA 2JQHA 3L39A 2UUAT 2KWHA 1L0VA 5JR9A 3VHLA 4XZCA 3HKBE 2WCAA 4CI2B 4IE7A 3SRZA 5CGMA 4ILUA 4O4IE 4U3CA 3ZJ2A 4YJ2E 4LF5T 3A7MA 2B76A 1G8XA 5HWXA 1WLXA 1BR4A 5FY0A 1I6ZA 5AQOB 2PTFA 4U31A 3RPUA 3EVYA 3H3AA 1E1HB 4HTEA 2CXDA 4HWCA 3AE4A 4UF0B 3CKDA 3I0QA 3UFEA 4HEAA 3NZPA 4YXDA 3ANWA 3IBPA 1HS7A 3DTOA 3TLUA 5LGNB 2V5CA 1HX8A 1CUNA 3OYZA 4HWDA 1VCTA 2V6YB 3ZN0B 3ZYKA 3FZKB 3HA4A 4ZOLE 2Y6XA 2UXCT 5HXEA 3WAKA 5JDFA 2KLQA 2NOXA 2XPKA 2KSRA 2XAGB 4DO0A 4U33A 3C98B 3B57A 3ZMZB 2YN6A 1KEYA 3PUYF 1OXZA 3B13A 2NW7A 4GYSA 5AQSB 5LA6E 3LBXB 5LGTB 4I43B 2M6IA 3AE9A 3LDQB 3UULA 3F31A 2A2FX 3IF8B 4YSYA 2A72A 2Q9QC 4OYKA 4DV2T 4JI6T 3KFWX 2WAUA 2CEAA 5FL1A 5LNKA 3PUWF 1XDPA 3MZKB 2BKPA 3F2EA 4E7ZA 4GK5E 4IE4A 5LP6E 3ZMUB 3NWIA 1IJ5A 2CPTA 3SFDA 2UXNB 3BQKA 1YKEB 1KNPA 2HN2A 2FUPA 2CXLA 3E22E 2QA7A 5JDMA 4WNKA 3U78A 2C5JA 4O8SA 5JTGA 3UU3A 5FL0A 2JRKA 1XNRT 1SHZC 2V26A 2BS4A 2EHOC 5AQGB 4PJMA 3VKHA 2LM9A 4Z90A 1WYCA 4KBMB 4DMVA 2WP9A 3SS1A 1UK5A 2VVNA 3VU7H 4KX6A 2VWAA 4PW8A 2XUEA 2JQKA 5JRCA 2KINB 5CA1E 1HFAA 4ILCA 2LSIA 2VVSA 5AQLB 2WM9A 2Y8DA 4HFHA 3L8RA 4TV8E 3AEAA 4C90A 1NWMX 3T1YT 4CXXA 3DJBA 3ZCIA 2C5IT 4MALA 4L0RA 4LFBT 2I6HA 3KV5A 4X5TA 4H9QC 4ZS3A 4KHPT 2WMOA 2WWUA 5FY1A 3Q2MA 3BQIA 2XTLA 3F57A 1J5ET 1W0AA 2YOEA 3CQCB 3SOLA 3QUJA 3GN5B 1MIYA 5EK2A 3ZMSB 3MK7C 4Z8XA 3UTKA 4TN7B 5ETWA 4AI6A 4H9SE 3UQ7A 1D0YA 2LHNA 5H6QB 2PBIA 5EZYE 1YD8G 3ZPOA 2VQET 5J2UE 2ZM6T 2Q9QA 1KF6A 3FBLA 4P1NA 4ZI7E 4YSZA 5HYAA 3RIAA 3V5UA 4JI8T 4BAYB 5J2TE 2V7KA 4BJMA 1B7TA 2CRBA 3N9NA 2WZIA 2YKSA 3ZYMA 1CHUA 3AA0B 2R6GF 4U72A 4IDQA 3PUXF 5CJ5A 5AFUL 3Q5EA 5FP3A 2X0HA 4NPPA 2BG9E 1WR0A 4X1KE 2YU1A 4QH4A 1J1JA 4CN1A 2AXDS 1XMQT 3LK3B 2XASB 2JPFA 5IYZE 2WBLA 4OX9T 4WZXA 5LHHB 1OEDE 4I50E 4DR6T 5FY7A 2WDRA 2EHOA 2X0LB 5ABHA 3PUVF 3RQUA 4A56A 1WFDA 4DR5T 4IDZA 1XMOT 2V7IA 4H9PC 1XNQT 1D1AA 4YFSA 3KVBA 2LRLA 1S94A 3ZJ1A 1WRDA 4CXWA 1N36T 1N32T 3AE1A 3PJAA 3P4SA 1BR2A 4EIWA 4HE8A 3FBZA 3HKCE 4IREA 2XAJB 2MTQA 3AAIA 4AQYT 3RYFE 3KV4A 3H3MA 3ZEFB 5FVLA 3VRBA 4UELA 4F8HA 4LF9T 4QKNA 3AVSA 4EB6E 4LMLA 4QX8B 3TLVA 5M4YA 1D0XA 4U2YA 3CX8B 5ABFA 3RH3A 2X0YA 2WZHA 4JI3T 2LKHA 3P4WA 3RKGA 1SE7A 4EV6A 5L3GB 3VRAA 4DR1T 3CMLA 1FMVA 1SA0E 2XHEB 2ZM2A 4AQFC 4P0AA 2DCFA 2YINA 3UU8A 2J62A 3SFEA 5LXTE 4DV0T 4Q25A 4ISSA 3ETVA 3P8CD 5ABGA 2VL8A 3FZFB 2QGSA 4LMKA 3EI0A 1LKXA 4DV7T 2BS3A 5AQHB 4L9IA 3JAFA 4LF8T 2E9XC 2D9DA 2LSJA 2VKHA 5JQGE 3OJAA 4YHHT 5IUXA 2JQQA 5FXXA 2OA5A 3AEEA 1WYBA 4NXNT 3CIRA 2J1DG 2NR4A 2V5DA 4G2AA 2WWVA 5KMGP 2IDOB 1FJGT 5LHIB 4ZEYA 2D0TA 3FHNA 2BZBA 1KFYA 4TZ4C 3WI3A 2UUBT 4BJNA 2MBGA 2D0UA 1I94T 4FI5A 4GYRA 4WW0A 4DBQA 2LM2A 2P9BA 3I0OA 5LMNT 1N34T 3WAJA 1S35A 2BBHA 3S4UA 4IE6A 3KV9A 5EK4A 2XSBA 2IC6A 2YDSA 3RIUC 2F4VT 1ZV4X 4NUVA 4X20E 3AEGA 4DUZT 3EDVA 3PU3A 2LLYA 2NW9A 2XQ3A 2V7MA 4EZHA 4IGUA 3ZSSA 2BG9B 3HKDE 5AQNB 4H63H 2Z6EA 4Z91A 3RKOA 2B1EA 5JDLA 4IDPA 3N9MA 4UVAB 3MJXA 2E8IA 2LSKA 1IAPA 5AQTB 3ETUA 1OEDB 1WCRA 1VRBA 2CBIA 5HEOA 3UU5A 2DWGA 4CQIA 4TWDA 4PAGA 4QXBB 4H9RC 5F3JA 2X9HA 4QXCB 1UUSA 3TLWA 4A5XA 3PUAA 4DR2T 4LFCT 3U3IA 4GK0E 1UX4A 2W67A 4TNVA 3P4RA 3H37A 4A97A 2NTXA 4EXTA 4K0KT 3AVRA 5FXWA 1YQ4A 4DBRA 3RRCA 1ZEEA 4X65T 4H9OC 4MFRA 1BR0A 2IW5B 3PUZF 2JMHA 5ABEA 4DR4T 2VKDA 5AQPB 3IHRA 5CFBA 4O2BE 3N9PA 3UUBA 4DMWA 2CM0A 3LFMA 2LE8A 2WU2A 3ZMVB 2ES0A 2E9XA 3HI2A 2IAKA 1WR6A 3N9QA 1O3XA 2UUCT 3FZHB 3ONJA 4XBFB 3CWZB 4X64T 5KDMC 3TLTA 1Y64B 4PJNA 2X9WA 3LK2B 3JADA 3E08A 2VKOA 4UV9B 3UUMA 2JJ9A 2XAHB 2E2AA 5KXJA 2CE7A 3KBTA 5JDGA 4GOUA 2LOPA 3K3QC 3ZC1A 3KDSE 5HEUA 4OFZA 3RYIE 1ZKEA 2FJEA 5FXVA 2V1DB 3I1AA 4AQGA 4HFCA 4YT0A
chains in the Genus database with same CATH topology
4JI5T 4K0KT 2VQET 4DV3T 4AQYT 2ZM6T 4DR3T 1FJGT 4X65T 2UXCT 4B3RT 4JI0T 4DV6T 4JI8T 4GKKT 4JI2T 4LF6T 2UUBT 4X62T 4LF9T 2UU9T 1I94T 2E5LT 4DR4T 4JI7T 5LMNT 1N34T 4DV5T 4B3TT 4JI3T 4DR7T 3T1YT 3T1HT 2F4VT 2UXDT 2VQFT 4LFBT 4DUYT 1IBKT 1XMQT 1IBLT 5IWAT 4DV2T 4DR1T 4DUZT 4JI6T 2UUAT 4DV4T 2UUCT 4OX9T 4KHPT 2HHHT 4X64T 1HNWT 1HNXT 4DR6T 4DV0T 4JV5T 4NXMT 4JYAT 1HNZT 4JI1T 4LF5T 1J5ET 1HR0T 4DR5T 1XMOT 1XNQT 4DV7T 1N33T 4YY3T 4GKJT 5LMUT 1N36T 1N32T 2UXBT 4LFAT 4LF8T 5BR8T 4LF4T 3OTOT 4B3MT 4YHHT 4B3ST 4JI4T 4LF7T 1XNRT 4DV1T 1IBMT 4X66T 4DR2T 4LFCT 4NXNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 T;  4K0K T;  2VQE T;  4DV3 T;  4AQY T;  2ZM6 T;  4DR3 T;  1FJG T;  4X65 T;  2UXC T;  4B3R T;  4JI0 T;  4DV6 T;  4JI8 T;  4GKK T;  4JI2 T;  4LF6 T;  2UUB T;  4X62 T;  4LF9 T;  2UU9 T;  1I94 T;  2E5L T;  4DR4 T;  4JI7 T;  5LMN T;  1N34 T;  4DV5 T;  4B3T T;  4JI3 T;  4DR7 T;  3T1Y T;  3T1H T;  2F4V T;  2UXD T;  2VQF T;  4LFB T;  4DUY T;  1IBK T;  1XMQ T;  1IBL T;  5IWA T;  4DV2 T;  4DR1 T;  4DUZ T;  4JI6 T;  2UUA T;  4DV4 T;  2UUC T;  4OX9 T;  4KHP T;  2HHH T;  4X64 T;  1HNW T;  1HNX T;  4DR6 T;  4DV0 T;  4JV5 T;  4NXM T;  4JYA T;  1HNZ T;  4JI1 T;  4LF5 T;  1J5E T;  1HR0 T;  4DR5 T;  1XMO T;  1XNQ T;  4DV7 T;  1N33 T;  4YY3 T;  4GKJ T;  5LMU T;  1N36 T;  1N32 T;  2UXB T;  4LFA T;  4LF8 T;  5BR8 T;  4LF4 T;  3OTO T;  4B3M T;  4YHH T;  4B3S T;  4JI4 T;  4LF7 T;  1XNR T;  4DV1 T;  1IBM T;  4X66 T;  4DR2 T;  4LFC T;  4NXN T; 
#chains in the Genus database with same CATH topology
 1HG5 A;  2H88 A;  4HWF A;  4QXH B;  4KMC A;  2XQ4 A;  3RIU A;  5EK3 A;  4ERR A;  2KMF A;  4DR3 T;  3MAC A;  1DU2 A;  4IHJ E;  3AXJ A;  3QK6 A;  3CK6 A;  4TWH A;  2V7J A;  4QH5 A;  3P7I A;  3AE7 A;  4ZI2 D;  2XAF B;  5AQQ B;  4AKG A;  2CWY A;  3ONX A;  3T8O A;  4EGW A;  4IL9 A;  1M7K A;  5HXC A;  1T7S A;  4AKI A;  2PG8 A;  2VKJ A;  4YTN A;  4DR7 T;  5LG3 A;  4DID B;  2W62 A;  3EDU A;  1IBL T;  2QYW A;  2FJA A;  4DND A;  2BVM A;  2XQ9 A;  4DV4 T;  5LCY A;  4YHJ A;  2CHO A;  4U74 A;  5LJN A;  4UV8 B;  2NTY A;  5IHY A;  3P50 A;  5AQF B;  2DI4 A;  2M6B A;  3ZT5 A;  4WYV A;  4ZI3 D;  3P4Q A;  2HPJ A;  4OK0 A;  4GKJ T;  3JC6 D;  3PDY A;  1MMA A;  2W00 A;  4LFA T;  2XQA A;  2BKN A;  4UF0 A;  1E2A A;  1VCS A;  4LF4 T;  3AA6 B;  1D1C A;  1U5P A;  3CX7 B;  2OLT A;  3AEC A;  5J0Z A;  2ACZ A;  4UXN B;  2L9Q A;  2ODU A;  2V6Y A;  3KVA A;  3PU8 A;  1G73 A;  3PJA J;  4GKK T;  3UU4 A;  2NW8 A;  4COF A;  2XM2 A;  2VK9 A;  2PFV A;  2XJ7 A;  2YU2 A;  2LHR A;  5JDQ A;  4M1P A;  5H6R B;  2GK9 A;  3VKG A;  4TUY E;  3AAA B;  3LBX A;  5HXH A;  2H7O A;  2X9X A;  5JRE A;  4DUY T;  3RC8 A;  2LSG A;  2XQ6 A;  5BMV E;  3FZL B;  3PUR A;  3JC6 C;  2WS3 A;  3OBV E;  4PJJ A;  3AEF A;  3LSV A;  4JV5 T;  2Y48 B;  4EED A;  5C2T A;  5F8P A;  3M65 A;  2I0M A;  4ZZB A;  2I59 A;  4IL4 A;  2WDQ A;  3NBX X;  5HEG A;  3AB3 B;  1MNE A;  5LMU T;  2XSA A;  5JVD E;  3UUN A;  4B6X A;  1MIV A;  3O4X E;  3Q9D A;  4AKH A;  3AA1 B;  3PUQ A;  4N78 D;  3VR9 A;  4LF7 T;  4DV1 T;  4UEM A;  3EAM A;  2LJL A;  2NP9 A;  3B5M A;  2CXF A;  4ADZ A;  2FJB A;  2LRK A;  2CLY B;  3AE6 A;  4IE5 A;  3AA7 B;  2LT3 A;  1FIO A;  2WU5 A;  3HR0 A;  1MMG A;  4EYU A;  4JI0 T;  2BVL A;  4J2C A;  2XM1 A;  5HCJ A;  2ACX A;  3N2G E;  4YJ3 E;  1W9R A;  5DJQ C;  2W61 A;  5C3J A;  1YW0 A;  1X9B A;  5L2L A;  3IA3 A;  2LSY A;  4L5G A;  1M62 A;  1QLB A;  2RA1 A;  3ZCJ A;  2CA5 A;  4OYJ A;  3BQL A;  4IDN A;  3EUH A;  2KZ7 B;  2M67 A;  5JR9 B;  4K0U A;  2W63 A;  2XQY A;  2W66 A;  3RX6 A;  4HWI B;  4H9N C;  5JR9 C;  4OHF A;  2LEH A;  2K5B B;  3GN5 A;  3FXE B;  2XQ7 A;  1HTJ F;  4IST A;  2YDR A;  5E0O A;  2BBJ A;  3AE5 A;  4X1I E;  3OTO T;  2VL0 A;  5LBM A;  3Q5D A;  4KP3 C;  3ANW B;  1IBM T;  4H63 V;  3ZYL A;  3LG7 A;  3Q5W A;  3X1D A;  4KI0 F;  5ADX L;  4DV3 T;  3JCF A;  2V6X A;  4UR9 A;  2CWO A;  2QRX A;  4DVD A;  2K3W A;  3EAB A;  3ZLI A;  3RHW A;  4HN9 A;  3I9Y A;  2ODV A;  4P0B A;  1HG2 A;  3R6N A;  4JEU B;  3BK9 A;  1AJ3 A;  2K48 A;  3N5L A;  3I9W A;  3N9O A;  4TNW A;  3RLF F;  4HFB A;  2G0U A;  4IIJ E;  3ZT6 A;  4YLH A;  1ZHC A;  3NKZ A;  1ZOY A;  5L3E B;  5L47 A;  4IDO A;  2DHR A;  5CB4 E;  4QHO A;  3C4X A;  3TKL B;  1HNZ T;  3O9X A;  1D1B A;  2WB5 A;  5FKY A;  2RPA A;  3OVU A;  2XQ5 A;  3QB5 K;  3K8P C;  1HF8 A;  4U2Z A;  3RRW A;  2L3L A;  3PUS A;  2DNX A;  5L3B B;  1MMN A;  1T72 A;  4IE0 A;  2WSS V;  1MND A;  3O1H A;  1UUR A;  2BG9 C;  2DWK A;  4LMJ A;  4TWF A;  2BDE A;  2X67 A;  5TAO A;  4QH1 A;  4V1A v;  2LOS A;  1V9D A;  5DQV A;  3MKD A;  5LBQ B;  2D2S A;  2K9A A;  4B3R T;  1OED C;  3N2K E;  3DP7 A;  1JNZ A;  1Y01 A;  1Z8U A;  3AE8 A;  5JRC B;  1E7P A;  4QX7 B;  1LVK A;  2N2N A;  2MPK A;  3MA9 A;  4MLK A;  4NIQ A;  4AKR B;  3OPC A;  1T98 A;  2ZM0 A;  5LGU B;  1IBK T;  2Q9Q D;  3K1S A;  4AQF A;  2IML A;  3QNU A;  5DQW A;  4JBW F;  3FZM B;  1FEW A;  3PUG A;  2RP4 A;  3RGL A;  2KND A;  2HN1 A;  4HKA A;  4PFP A;  4JI1 T;  1KNZ A;  2DLR A;  3PE0 A;  4FJO A;  4EOZ B;  3R84 B;  3OYX A;  4X1Y E;  4I55 E;  4P09 A;  2V8S V;  4PK4 A;  1ZP0 A;  1EZ3 A;  3A5X A;  4PFO A;  4E7S A;  1UCU A;  2YEV C;  5HXS A;  2LKG A;  2IHR 1;  3D0T A;  4B3M T;  3GMI A;  4HFE A;  4WBO A;  4O4H E;  2D5U A;  4U7I A;  3RYC E;  3AE3 A;  2EHO D;  2JMK A;  1OWA A;  5F5W A;  2J47 A;  2Q9Q B;  2K24 A;  4A98 A;  3RQW A;  4CZZ B;  4EAH A;  3AAE B;  4QWN B;  5JDH A;  1KNR A;  3A8Y C;  3PV0 F;  2H89 A;  4X62 T;  2E5L T;  1JNR A;  3C64 A;  4YTP A;  1VOM A;  2W4X A;  1MMD A;  2WDV A;  5L3C B;  4IT4 A;  4KUM B;  5HEH A;  3ZT7 A;  3CPZ A;  3AE2 A;  3M3Z B;  5DAB A;  2MAW A;  1XZY A;  2HH7 A;  1HNW T;  1HNX T;  3GA8 A;  1KK7 A;  1T8B A;  2BG9 A;  2EHO B;  4AIS A;  3L09 A;  2CBJ A;  4JEH B;  4YTM A;  3E0Z A;  1QSD A;  3C51 A;  4AXP A;  2KXP B;  1OED A;  3UQ4 A;  5L4E A;  1US7 B;  2AE9 A;  1FMW A;  3AED A;  1XDO A;  4TV9 E;  4X66 T;  3K3N A;  3J9X 1;  5LJM A;  1J5W A;  3C50 A;  2KT9 A;  3ZMT B;  4ANJ A;  1Z0P A;  4CXY A;  1D0Z A;  3HKE E;  1LRZ A;  2UXX B;  3L3P A;  4EYY R;  2QVA A;  4ZI2 C;  5JH7 E;  1R8I A;  2UU9 T;  5FMN A;  3V5S A;  3KIN B;  3ZN1 B;  5ABF B;  2XAQ B;  4JLE A;  1H7C A;  5HWY A;  5FNV E;  3UT5 E;  4G63 A;  3N9L A;  3T1H T;  3PTR B;  3FXD B;  2UXD T;  3UUX B;  2WQY A;  3KBU A;  2MOZ A;  2ZM8 A;  1UX5 A;  4EZ4 A;  3IEE A;  5L3F B;  2CCQ A;  4JUY A;  4JYA T;  5CA0 E;  2PJQ A;  2DL1 A;  1HR0 T;  3NVO A;  1XWM A;  2VAS A;  4ZI3 C;  5LHG B;  5AQV B;  3AEB A;  3HL6 A;  2SPC A;  3MXZ A;  3K3O A;  3C4W A;  2IIU A;  1MIW A;  3TLS A;  3UFG A;  4UIG A;  2XQ8 A;  2FJD A;  4ZS2 A;  4B3S T;  4TX5 A;  3ABV A;  5AQK B;  3RYH E;  4JI5 T;  2VB6 A;  3ZKR A;  2C0S A;  2FBW A;  2J4G A;  1NEK A;  2YK0 A;  3CVR A;  3QOF A;  4DV6 T;  1NAF A;  2H7V C;  3CQX C;  3ZST A;  4I4T E;  5JDN A;  4WBN E;  4ILB A;  4CN4 A;  2MYS A;  1W09 A;  4JI7 T;  3CQG B;  2VUR A;  4O2A E;  4CI1 B;  3CX6 B;  3NRX A;  5LG4 A;  4AKL A;  2CLY C;  2CMR A;  2N1G A;  1QUU A;  3RI5 A;  2WY2 A;  3FB2 A;  5L4H A;  2IC9 A;  2CHN A;  2YDQ A;  1BR1 A;  4MHC A;  1W0B A;  4CN6 A;  3W15 B;  5A1L A;  4NXM T;  3C4Z A;  3O1I A;  5HCM A;  3QB5 A;  2ZMA A;  4ILA A;  3UU6 A;  2N9D A;  2IUB A;  4YY3 T;  3GWH A;  4HFI A;  2UXB T;  3LK4 2;  1SUM B;  2E9X D;  4HGA A;  3KV6 A;  4O4L E;  4JI4 T;  3NRY A;  4MBQ A;  2L8K A;  2V7L A;  2ZLY A;  2JIW A;  4YSX A;  4PK6 A;  1U4Q A;  3EHZ A;  4GIW A;  4HWH A;  1IJ6 A;  2X51 A;  3J7Y q;  1LVF A;  3NZQ A;  2A3D A;  3O1J A;  1X79 A;  2HPL A;  3VR8 A;  2E5V A;  4UVB B;  4LF6 T;  4I0U A;  4HFD A;  4AIU A;  2X68 A;  5AQJ B;  4C91 A;  4F6R C;  3RC3 A;  2X9Y A;  4DV5 T;  5AQM B;  4B3T T;  5J1G A;  5AQR B;  4ZZC A;  4NUU A;  5FYM A;  3JAE A;  4O4J E;  2VQF T;  4PNI A;  2E9X B;  2X66 A;  5IWA T;  5LB7 B;  3OKQ A;  3QC9 A;  2H3R A;  2WMN A;  5HXR A;  4ZHQ E;  2BKO A;  4ZXL A;  2C5K T;  2HHH T;  3ZC0 A;  4PJL A;  5FXZ A;  5KX5 E;  5C8Y E;  4KHZ F;  4PK5 A;  2A9U A;  1IZN B;  4EEB A;  1YQ3 A;  4U7Y A;  1YKH B;  4ASK A;  1NEN A;  1N33 T;  4XAX B;  1GQE A;  5BR8 T;  3P4P A;  4BA9 A;  2W0G A;  2BS2 A;  2NWB A;  2XZE A;  3RIF A;  1HX1 B;  2JQ9 A;  1YXR A;  5AQI B;  3AXJ B;  4UVC B;  2KWI B;  3N2O A;  5HAX A;  3G06 A;  4HFV A;  4CI3 B;  4JI2 T;  5FVK A;  5L3D B;  2XY8 B;  3LJC A;  1HCI A;  3RF1 A;  5HEJ A;  3Q5X A;  5LYJ E;  2W2U A;  3ONL C;  2OV9 A;  3ESL A;  3SWH A;  5AQU B;  5LOV E;  5GON E;  1UGO A;  2JQH A;  3L39 A;  2UUA T;  2KWH A;  1L0V A;  5JR9 A;  3VHL A;  4XZC A;  3HKB E;  2WCA A;  4CI2 B;  4IE7 A;  3SRZ A;  5CGM A;  4ILU A;  4O4I E;  4U3C A;  3ZJ2 A;  4YJ2 E;  4LF5 T;  3A7M A;  2B76 A;  1G8X A;  5HWX A;  1WLX A;  1BR4 A;  5FY0 A;  1I6Z A;  5AQO B;  2PTF A;  4U31 A;  3RPU A;  3EVY A;  3H3A A;  1E1H B;  4HTE A;  2CXD A;  4HWC A;  3AE4 A;  4UF0 B;  3CKD A;  3I0Q A;  3UFE A;  4HEA A;  3NZP A;  4YXD A;  3ANW A;  3IBP A;  1HS7 A;  3DTO A;  3TLU A;  5LGN B;  2V5C A;  1HX8 A;  1CUN A;  3OYZ A;  4HWD A;  1VCT A;  2V6Y B;  3ZN0 B;  3ZYK A;  3FZK B;  3HA4 A;  4ZOL E;  2Y6X A;  2UXC T;  5HXE A;  3WAK A;  5JDF A;  2KLQ A;  2NOX A;  2XPK A;  2KSR A;  2XAG B;  4DO0 A;  4U33 A;  3C98 B;  3B57 A;  3ZMZ B;  2YN6 A;  1KEY A;  3PUY F;  1OXZ A;  3B13 A;  2NW7 A;  4GYS A;  5AQS B;  5LA6 E;  3LBX B;  5LGT B;  4I43 B;  2M6I A;  3AE9 A;  3LDQ B;  3UUL A;  3F31 A;  2A2F X;  3IF8 B;  4YSY A;  2A72 A;  2Q9Q C;  4OYK A;  4DV2 T;  4JI6 T;  3KFW X;  2WAU A;  2CEA A;  5FL1 A;  5LNK A;  3PUW F;  1XDP A;  3MZK B;  2BKP A;  3F2E A;  4E7Z A;  4GK5 E;  4IE4 A;  5LP6 E;  3ZMU B;  3NWI A;  1IJ5 A;  2CPT A;  3SFD A;  2UXN B;  3BQK A;  1YKE B;  1KNP A;  2HN2 A;  2FUP A;  2CXL A;  3E22 E;  2QA7 A;  5JDM A;  4WNK A;  3U78 A;  2C5J A;  4O8S A;  5JTG A;  3UU3 A;  5FL0 A;  2JRK A;  1XNR T;  1SHZ C;  2V26 A;  2BS4 A;  2EHO C;  5AQG B;  4PJM A;  3VKH A;  2LM9 A;  4Z90 A;  1WYC A;  4KBM B;  4DMV A;  2WP9 A;  3SS1 A;  1UK5 A;  2VVN A;  3VU7 H;  4KX6 A;  2VWA A;  4PW8 A;  2XUE A;  2JQK A;  5JRC A;  2KIN B;  5CA1 E;  1HFA A;  4ILC A;  2LSI A;  2VVS A;  5AQL B;  2WM9 A;  2Y8D A;  4HFH A;  3L8R A;  4TV8 E;  3AEA A;  4C90 A;  1NWM X;  3T1Y T;  4CXX A;  3DJB A;  3ZCI A;  2C5I T;  4MAL A;  4L0R A;  4LFB T;  2I6H A;  3KV5 A;  4X5T A;  4H9Q C;  4ZS3 A;  4KHP T;  2WMO A;  2WWU A;  5FY1 A;  3Q2M A;  3BQI A;  2XTL A;  3F57 A;  1J5E T;  1W0A A;  2YOE A;  3CQC B;  3SOL A;  3QUJ A;  3GN5 B;  1MIY A;  5EK2 A;  3ZMS B;  3MK7 C;  4Z8X A;  3UTK A;  4TN7 B;  5ETW A;  4AI6 A;  4H9S E;  3UQ7 A;  1D0Y A;  2LHN A;  5H6Q B;  2PBI A;  5EZY E;  1YD8 G;  3ZPO A;  2VQE T;  5J2U E;  2ZM6 T;  2Q9Q A;  1KF6 A;  3FBL A;  4P1N A;  4ZI7 E;  4YSZ A;  5HYA A;  3RIA A;  3V5U A;  4JI8 T;  4BAY B;  5J2T E;  2V7K A;  4BJM A;  1B7T A;  2CRB A;  3N9N A;  2WZI A;  2YKS A;  3ZYM A;  1CHU A;  3AA0 B;  2R6G F;  4U72 A;  4IDQ A;  3PUX F;  5CJ5 A;  5AFU L;  3Q5E A;  5FP3 A;  2X0H A;  4NPP A;  2BG9 E;  1WR0 A;  4X1K E;  2YU1 A;  4QH4 A;  1J1J A;  4CN1 A;  2AXD S;  1XMQ T;  3LK3 B;  2XAS B;  2JPF A;  5IYZ E;  2WBL A;  4OX9 T;  4WZX A;  5LHH B;  1OED E;  4I50 E;  4DR6 T;  5FY7 A;  2WDR A;  2EHO A;  2X0L B;  5ABH A;  3PUV F;  3RQU A;  4A56 A;  1WFD A;  4DR5 T;  4IDZ A;  1XMO T;  2V7I A;  4H9P C;  1XNQ T;  1D1A A;  4YFS A;  3KVB A;  2LRL A;  1S94 A;  3ZJ1 A;  1WRD A;  4CXW A;  1N36 T;  1N32 T;  3AE1 A;  3PJA A;  3P4S A;  1BR2 A;  4EIW A;  4HE8 A;  3FBZ A;  3HKC E;  4IRE A;  2XAJ B;  2MTQ A;  3AAI A;  4AQY T;  3RYF E;  3KV4 A;  3H3M A;  3ZEF B;  5FVL A;  3VRB A;  4UEL A;  4F8H A;  4LF9 T;  4QKN A;  3AVS A;  4EB6 E;  4LML A;  4QX8 B;  3TLV A;  5M4Y A;  1D0X A;  4U2Y A;  3CX8 B;  5ABF A;  3RH3 A;  2X0Y A;  2WZH A;  4JI3 T;  2LKH A;  3P4W A;  3RKG A;  1SE7 A;  4EV6 A;  5L3G B;  3VRA A;  4DR1 T;  3CML A;  1FMV A;  1SA0 E;  2XHE B;  2ZM2 A;  4AQF C;  4P0A A;  2DCF A;  2YIN A;  3UU8 A;  2J62 A;  3SFE A;  5LXT E;  4DV0 T;  4Q25 A;  4ISS A;  3ETV A;  3P8C D;  5ABG A;  2VL8 A;  3FZF B;  2QGS A;  4LMK A;  3EI0 A;  1LKX A;  4DV7 T;  2BS3 A;  5AQH B;  4L9I A;  3JAF A;  4LF8 T;  2E9X C;  2D9D A;  2LSJ A;  2VKH A;  5JQG E;  3OJA A;  4YHH T;  5IUX A;  2JQQ A;  5FXX A;  2OA5 A;  3AEE A;  1WYB A;  4NXN T;  3CIR A;  2J1D G;  2NR4 A;  2V5D A;  4G2A A;  2WWV A;  5KMG P;  2IDO B;  1FJG T;  5LHI B;  4ZEY A;  2D0T A;  3FHN A;  2BZB A;  1KFY A;  4TZ4 C;  3WI3 A;  2UUB T;  4BJN A;  2MBG A;  2D0U A;  1I94 T;  4FI5 A;  4GYR A;  4WW0 A;  4DBQ A;  2LM2 A;  2P9B A;  3I0O A;  5LMN T;  1N34 T;  3WAJ A;  1S35 A;  2BBH A;  3S4U A;  4IE6 A;  3KV9 A;  5EK4 A;  2XSB A;  2IC6 A;  2YDS A;  3RIU C;  2F4V T;  1ZV4 X;  4NUV A;  4X20 E;  3AEG A;  4DUZ T;  3EDV A;  3PU3 A;  2LLY A;  2NW9 A;  2XQ3 A;  2V7M A;  4EZH A;  4IGU A;  3ZSS A;  2BG9 B;  3HKD E;  5AQN B;  4H63 H;  2Z6E A;  4Z91 A;  3RKO A;  2B1E A;  5JDL A;  4IDP A;  3N9M A;  4UVA B;  3MJX A;  2E8I A;  2LSK A;  1IAP A;  5AQT B;  3ETU A;  1OED B;  1WCR A;  1VRB A;  2CBI A;  5HEO A;  3UU5 A;  2DWG A;  4CQI A;  4TWD A;  4PAG A;  4QXB B;  4H9R C;  5F3J A;  2X9H A;  4QXC B;  1UUS A;  3TLW A;  4A5X A;  3PUA A;  4DR2 T;  4LFC T;  3U3I A;  4GK0 E;  1UX4 A;  2W67 A;  4TNV A;  3P4R A;  3H37 A;  4A97 A;  2NTX A;  4EXT A;  4K0K T;  3AVR A;  5FXW A;  1YQ4 A;  4DBR A;  3RRC A;  1ZEE A;  4X65 T;  4H9O C;  4MFR A;  1BR0 A;  2IW5 B;  3PUZ F;  2JMH A;  5ABE A;  4DR4 T;  2VKD A;  5AQP B;  3IHR A;  5CFB A;  4O2B E;  3N9P A;  3UUB A;  4DMW A;  2CM0 A;  3LFM A;  2LE8 A;  2WU2 A;  3ZMV B;  2ES0 A;  2E9X A;  3HI2 A;  2IAK A;  1WR6 A;  3N9Q A;  1O3X A;  2UUC T;  3FZH B;  3ONJ A;  4XBF B;  3CWZ B;  4X64 T;  5KDM C;  3TLT A;  1Y64 B;  4PJN A;  2X9W A;  3LK2 B;  3JAD A;  3E08 A;  2VKO A;  4UV9 B;  3UUM A;  2JJ9 A;  2XAH B;  2E2A A;  5KXJ A;  2CE7 A;  3KBT A;  5JDG A;  4GOU A;  2LOP A;  3K3Q C;  3ZC1 A;  3KDS E;  5HEU A;  4OFZ A;  3RYI E;  1ZKE A;  2FJE A;  5FXV A;  2V1D B;  3I1A A;  4AQG A;  4HFC A;  4YT0 A; 
#chains in the Genus database with same CATH homology
 4JI5 T;  4K0K T;  2VQE T;  4DV3 T;  4AQY T;  2ZM6 T;  4DR3 T;  1FJG T;  4X65 T;  2UXC T;  4B3R T;  4JI0 T;  4DV6 T;  4JI8 T;  4GKK T;  4JI2 T;  4LF6 T;  2UUB T;  4X62 T;  4LF9 T;  2UU9 T;  1I94 T;  2E5L T;  4DR4 T;  4JI7 T;  5LMN T;  1N34 T;  4DV5 T;  4B3T T;  4JI3 T;  4DR7 T;  3T1Y T;  3T1H T;  2F4V T;  2UXD T;  2VQF T;  4LFB T;  4DUY T;  1IBK T;  1XMQ T;  1IBL T;  5IWA T;  4DV2 T;  4DR1 T;  4DUZ T;  4JI6 T;  2UUA T;  4DV4 T;  2UUC T;  4OX9 T;  4KHP T;  2HHH T;  4X64 T;  1HNW T;  1HNX T;  4DR6 T;  4DV0 T;  4JV5 T;  4NXM T;  4JYA T;  1HNZ T;  4JI1 T;  4LF5 T;  1J5E T;  1HR0 T;  4DR5 T;  1XMO T;  1XNQ T;  4DV7 T;  1N33 T;  4YY3 T;  4GKJ T;  5LMU T;  1N36 T;  1N32 T;  2UXB T;  4LFA T;  4LF8 T;  5BR8 T;  4LF4 T;  3OTO T;  4B3M T;  4YHH T;  4B3S T;  4JI4 T;  4LF7 T;  1XNR T;  4DV1 T;  1IBM T;  4X66 T;  4DR2 T;  4LFC T;  4NXN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...