1FJGT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1fjgT00
1I94T 1HNWT 5IWAT 4LF9T 4K0KT 4DR6T 4LFCT 1IBKT 4GKKT 3OTOT 4LF8T 2HHHT 4NXNT 1XNRT 4DV7T 4DV6T 4B3MT 4JI5T 1N36T 1HR0T 4JI7T 5LMUT 4LFBT 4LF5T 2F4VT 4DV5T 4LF4T 4DR2T 1IBLT 1N33T 4X66T 4JI8T 4JI0T 4KHPT 4X64T 2UUAT 1XNQT 5BR8T 1N32T 1HNZT 4DV2T 4DR5T 4B3ST 4X65T 4B3TT 2UUBT 4JI4T 1FJGT 4B3RT 1HNXT 4JYAT 1J5ET 4JI3T 3T1HT 4DV0T 4LF7T 4DV3T 2UUCT 4YY3T 4DUYT 4JV5T 2UXBT 4DR1T 2UXCT 5LMNT 2UU9T 4YHHT 2E5LT 4DUZT 1XMOT 3T1YT 2VQET 4LF6T 4DV4T 2VQFT 2ZM6T 2UXDT 4JI2T 1IBMT 4DR7T 1XMQT 4X62T 4GKJT 4JI1T 4NXMT 1N34T 4AQYT 4OX9T 4JI6T 4DR4T 4LFAT 4DV1T 4DR3T
chains in the Genus database with same CATH superfamily
5JTGA 2JQHA 4BA9A 2JMHA 5HXRA 2W62A 4LF8T 2BDEA 4TWHA 4U72A 4L0RA 1UX5A 4TWDA 3UU3A 4LFBT 3RIUA 2Q9QA 5AQSB 5JDQA 3P4SA 5H6QB 3LBXB 4AI6A 1YW0A 4U2YA 3GMIA 4DV2T 4C91A 3LFMA 2UUBT 1FEWA 2WDQA 1KFYA 4MALA 2BS2A 3FXDB 5HEGA 3ZMVB 5LHGB 3AXJA 3A7MA 3UUNA 5ABFA 4E7SA 1QLBA 1WYBA 3OYXA 5ADXL 1NWMX 4C90A 2K5BB 2YINA 5L3EB 4WW0A 2WSSV 2PTFA 3KV6A 4P1NA 3UTKA 2W63A 2PBIA 3RKGA 1IBMT 3MA9A 5AQTB 2Y48B 1J5WA 3N2GE 5AQPB 3ESLA 2X67A 5J2UE 4L5GA 2XQAA 2YDQA 1WRDA 3AE3A 2VWAA 3AAEB 3HKCE 5DABA 2WU2A 4U7IA 1E2AA 3L39A 3CWZB 3RYCE 2K48A 2LSKA 4HKAA 2HHHT 2HH7A 2J47A 5FXZA 5AQIB 1B7TA 4DR2T 2XUEA 4ILUA 4KHPT 3TLTA 4PK6A 5L4EA 4ERRA 2ZLYA 4B6XA 2XHEB 4H63H 3H37A 1OEDE 2JPFA 3AEEA 5FXVA 1M62A 2QYWA 1MNEA 3RPUA 2NR4A 2BKNA 3ZSTA 2BS3A 3VKHA 3I9WA 4AKHA 3IA3A 2DNXA 4GK0E 4O2AE 3OJAA 5FY1A 3EDUA 3TLWA 4U74A 4DMVA 5FYMA 1R8IA 3EAMA 3RQUA 4IE7A 2B76A 2P9BA 3K3OA 3L3PA 4AKLA 4YT0A 2KZ7B 2IAKA 4MFRA 1KNZA 4UELA 4YTMA 4QH4A 3CKDA 2WU5A 4H9SE 1I6ZA 2LT3A 3EI0A 2XAQB 4QKNA 4QXHB 4H9RC 3VRAA 4OYJA 2IC9A 3W15B 3C4XA 3AA6B 2M67A 4EEDA 1ZV4X 2RA1A 1XNRT 4MBQA 3SOLA 1MMAA 3FZFB 3KFWX 1HR0T 5AQFB 5F3JA 2F4VT 3KVAA 4O8SA 3AA1B 2V5CA 4ZI7E 4JEHB 3UU6A 3CPZA 4I0UA 2LM9A 3NRXA 4AXPA 3LK3B 4GYSA 3I1AA 4TNVA 2UXNB 1ZHCA 4KX6A 3RYHE 5L3BB 2V7MA 2PG8A 1IJ6A 4U7YA 5LOVE 2VVNA 3UFGA 3PUVF 4YSZA 5A1LA 4ILBA 2XZEA 4TV8E 3T8OA 3MJXA 5JDMA 5IYZE 3Q2MA 4X62T 4GKJT 4JI1T 3CX7B 2ZM0A 4AQYT 4CI2B 2Q9QB 4N78D 4UVCB 3UU8A 4UR9A 2CXDA 4HFVA 1BR4A 4ZEYA 2XM1A 2NOXA 2LSIA 4WBOA 1HF8A 1O3XA 3CQGB 4X5TA 3N5LA 3RH3A 2W0GA 5C8YE 3C98B 3QOFA 2C5JA 1XWMA 3AXJB 1FMVA 5DQWA 5ABFB 4CN6A 3DP7A 5LHIB 1N33T 3C50A 4O4IE 2LKHA 1MMDA 2WDVA 2J1DG 4DBQA 3C64A 4JBWF 3EHZA 4HFHA 2RP4A 3QNUA 3LK2B 5L47A 2DHRA 3EDVA 3FZLB 3IEEA 4P0AA 3SRZA 4TN7B 1WCRA 4IREA 3PTRB 4G2AA 4KBMB 2W67A 2X0HA 2UXCT 1D0ZA 1W0AA 2XAGB 1T72A 4K0UA 1D1CA 1SUMB 3T1YT 4UF0A 4YFSA 3RGLA 2ZM6T 4DR7T 2NP9A 3UUMA 2OLTA 3CK6A 4EV6A 5IHYA 2BBJA 4PJNA 4NIQA 5FY7A 4I50E 5CA0E 3ZYLA 4CXYA 4BAYB 1T8BA 5L4HA 2X51A 4TZ4C 2DI4A 2WB5A 3AE7A 4QH1A 5AQGB 4LMLA 4B3MT 2GK9A 3NKZA 2X0YA 5JRCA 2CMRA 2LKGA 1N32T 3N9OA 1HNZT 1LRZA 3TLUA 2DWGA 3U3IA 4A97A 2NW8A 1UURA 2ZM8A 2XTLA 3RRCA 1D0YA 4YLHA 3AAIA 2AE9A 2QGSA 2PJQA 2WP9A 3AE2A 3T1HT 3ZC0A 2E5VA 3FZKB 1KF6A 2BVLA 3PJAA 3RX6A 4DO0A 3KBTA 2KINB 2IC6A 5ETWA 2M6IA 4TV9E 2DWKA 2X0LB 5LBQB 2JIWA 2BG9C 3OPCA 2H7VC 2FJBA 4NXMT 3AECA 4EB6E 2CWOA 2D0TA 4DIDB 1Z8UA 4O4HE 4PNIA 2KSRA 2YEVC 2N9DA 3E22E 4M1PA 1ZEEA 4Z90A 2MOZA 3RYIE 4AKIA 3J7Yq 2LJLA 5AQKB 3I0OA 2W61A 2A3DA 1IBKT 2J62A 1YD8G 1YQ4A 3ZMUB 3ANWA 4ZI3D 4DV7T 3NBXX 4F6RC 4NPPA 2LHNA 5ABHA 1WR6A 3V5UA 3P4RA 2V1DB 2YOEA 4IGUA 3AEGA 2BG9A 2FJEA 2LOSA 4IDQA 3LDQB 2A72A 4B3TT 3AE6A 2XJ7A 5JDGA 1FJGT 3N9LA 5F5WA 4JYAT 1V9DA 3AVRA 3H3MA 1J5ET 1HTJF 2L3LA 2V6YA 4J2CA 3R84B 4ZXLA 4ZS2A 5LMNT 4YHHT 4DUZT 3RYFE 3E0ZA 1UGOA 1S35A 5LHHB 1HG2A 2I0MA 3EUHA 4WNKA 2WMNA 4JI2T 5JDHA 1KNPA 3CVRA 2JRKA 4HGAA 5GONE 2NW7A 1D0XA 3UUBA 2LOPA 3S4UA 5LJNA 3P50A 4BJMA 2YN6A 4CI3B 4KHZF 4ZI3C 4OX9T 4PW8A 3Q5EA 2ODVA 1VOMA 3RKOA 2BBHA 4K0KT 5KDMC 3PUGA 1DU2A 3BK9A 2ACZA 3QC9A 1W9RA 5KMGP 3MK7C 3P7IA 4GK5E 2VKDA 2DCFA 3PU3A 3RIFA 1IAPA 2BKPA 4GOUA 4JI5T 4LF5T 1AJ3A 3VHLA 3FB2A 4X64T 4UXNB 5E0OA 5C2TA 2VURA 4TX5A 4LMKA 2E9XD 5JR9C 4UF0B 2WZIA 3FBLA 3G06A 3AAAB 1X79A 5L3FB 4JI3T 4TNWA 3NWIA 4H9QC 4TUYE 4IT4A 2UUCT 1D1AA 2W2UA 2LSYA 2UXBT 2KT9A 4F8HA 3FXEB 1HG5A 3NRYA 4IDZA 2XASB 1XMOT 2VKOA 4AQFC 1YXRA 2JJ9A 3ETUA 1MMGA 4HEAA 5L3GB 5LG3A 2L9QA 5JR9A 5FXXA 4GIWA 2YDSA 2WZHA 4IDNA 3PUQA 3K8PC 4EZHA 4BJNA 4DR4T 5BMVE 2CE7A 5JH7E 4YJ2E 2K3WA 1ZKEA 4DR3T 2IW5B 2W00A 3KVBA 4DVDA 2XSBA 3O1IA 5ABEA 1N36T 3H3AA 4PAGA 2E9XC 4AQFA 5LMUT 3KBUA 5JQGE 2V6XA 3FBZA 3I9YA 2V7LA 4NUUA 5HXEA 4FI5A 4UEMA 4UV8B 4IE5A 4JI0T 4HTEA 4U2ZA 1GQEA 1FIOA 1OEDC 3FZHB 5AQRB 5DQVA 2MYSA 4QXBB 3SFEA 5KXJA 3MXZA 2IHR1 1MNDA 3OKQA 3NVOA 3N9QA 5L2LA 3LJCA 2VB6A 2XQ5A 4ZZCA 2L8KA 2XAFB 2E9XA 4AKGA 4DV4T 3ANWB 4OFZA 3ZT5A 2LSGA 5AQNB 5AQHB 4PK4A 2QVAA 3AA7B 1OEDA 2CPTA 5JDLA 3PURA 1IZNB 2BG9B 2LHRA 1HCIA 1ZOYA 3UQ7A 2IMLA 4KUMB 4LF9T 2A2FX 2MPKA 4X1KE 2VASA 2HN1A 3ZPOA 3C51A 4EYUA 2C5IT 5LBMA 1NEKA 2VL8A 2XQYA 4DV6T 4Z91A 4JI7T 2V6YB 1BR2A 5EK4A 1MIYA 2LRLA 4YSXA 4A5XA 3X1DA 3F57A 2V7KA 3IHRA 2UUAT 3ZT7A 4I55E 1U4QA 3RC8A 4X1YE 4ILCA 5JVDE 3NZQA 3P4PA 2FBWA 2IDOB 2V7IA 2X68A 3PE0A 3I0QA 4DV0T 5JDNA 5HXHA 2OV9A 1NENA 4YY3T 3GA8A 2YKSA 3TLSA 3KV4A 2WCAA 4O4LE 2BVMA 4TWFA 5AQMB 3PU8A 2NTXA 5EK3A 5DJQC 3MKDA 1G73A 4YJ3E 2WS3A 4U33A 1MIVA 3N9PA 5JREA 4YTNA 5HWYA 2ZM2A 4HFIA 4YXDA 5LXTE 2YK0A 4OK0A 2RPAA 2Y8DA 3HI2A 1JNZA 3N9MA 2EHOD 3F31A 2VL0A 4ASKA 3UU5A 2CEAA 4KMCA 5C3JA 3ZN1B 4HWCA 1EZ3A 4QHOA 3BQIA 1VCTA 4JI8T 3ZYKA 3AE5A 1XNQT 2LE8A 2M6BA 4HWHA 4A98A 4B3ST 2QA7A 4ILAA 1WLXA 2NTYA 2CLYC 4B3RT 3ABVA 3QK6A 1S94A 3CMLA 2XQ9A 3HR0A 4DV3T 5JR9B 5AQVB 2CBJA 5CA1E 3M3ZB 3CQCB 5LG4A 4U3CA 1OWAA 3B57A 4V1Av 1CHUA 5AQQB 4L9IA 4PFPA 4LF6T 3L8RA 3PUZF 3HKEE 5AQJB 4DMWA 2WM9A 4OYKA 3ONLC 2D5UA 2EHOC 4Q25A 2KMFA 3UFEA 3ZMTB 3ZC1A 1US7B 2YU2A 1I94T 1HNWT 3M65A 4XAXB 4LFCT 4IHJE 2PFVA 4YSYA 3K1SA 5LA6E 2K9AA 2XAJB 4JEUB 1BR1A 4EGWA 4HWDA 2V7JA 4EYYR 4CQIA 3ZJ1A 3B5MA 3D0TA 3KV9A 4QX7B 3E08A 1MMNA 2H89A 2KNDA 3OBVE 2G0UA 5FL0A 4P0BA 1Z0PA 4O4JE 2EHOA 2XQ4A 1G8XA 3IF8B 4LF7T 3JAFA 2IUBA 1OEDB 1XDOA 2HPLA 4CZZB 3WAJA 4AIUA 1SE7A 5HYAA 4I43B 1OXZA 2YDRA 3AE8A 1HS7A 1UX4A 4EEBA 4XZCA 2VQET 2VQFT 3O1JA 2C0SA 3RRWA 3UUXB 3MACA 4HFDA 4H63V 4WZXA 2LEHA 2SPCA 3K3NA 3PUSA 3ZLIA 4EXTA 3KDSE 4AQGA 2XPKA 3AEAA 3ZT6A 1UK5A 5LGTB 4LFAT 4ZHQE 4MLKA 3IBPA 5FP3A 4AISA 3ZEFB 2WWVA 4GKKT 2FJAA 2XQ8A 3OTOT 3ONXA 2XY8B 2X9YA 2DLRA 1XZYA 1KK7A 5HXCA 3VR8A 3JADA 4X66T 2KWIB 1M7KA 5LCYA 5BR8T 5CJ5A 2IIUA 2V5DA 4AKRB 4IE0A 2MTQA 4H9NC 5J0ZA 2VVSA 4HN9A 4FJOA 5AQUB 4E7ZA 1WYCA 3N2OA 2V8SV 1T98A 4HWIB 4G63A 3N9NA 2H7OA 3AB3B 3ZJ2A 5H6RB 4EOZB 5M4YA 2QRXA 2XAHB 3AEFA 4EAHA 5HEUA 3QB5K 1H7CA 2WY2A 2CXLA 5FVLA 2N2NA 4COFA 3DTOA 3ZCJA 4YHJA 3JCFA 4IDPA 3KINB 4OHFA 3ZYMA 4ISSA 3GN5A 4IL9A 4EIWA 5LGNB 3ETVA 3QUJA 2XM2A 3HL6A 1BR0A 1WR0A 4HFEA 2CBIA 3Q5WA 2WWUA 3ZKRA 5JRCB 4LF4T 1KNRA 3JC6D 3AVSA 2H88A 4EZ4A 1QSDA 4HE8A 3CX8B 3PJAJ 5LB7B 2BKOA 4YTPA 2WAUA 5HWXA 2XSAA 2MBGA 3RQWA 1IJ5A 3HKBE 3RI5A 5FXWA 2AXDS 1HNXT 3KV5A 1Y64B 4PK5A 2CM0A 5JDFA 3HA4A 3RF1A 4JV5T 2NW9A 4ISTA 3AEDA 2CLYB 3ZCIA 3TKLB 3AA0B 3FHNA 3N2KE 2C5KT 2FJDA 5CGMA 2VKHA 2LRKA 2K24A 1YQ3A 3UT5E 3BQKA 1ZP0A 5FL1A 2NWBA 4HFCA 5LP6E 2B1EA 2WQYA 3LG7A 4WBNE 1J1JA 3EVYA 5EK2A 5LYJE 3PV0F 2I6HA 3Q5XA 2XQ7A 1UCUA 1JNRA 3VRBA 4UVAB 4NUVA 3JC6C 2H3RA 4KP3C 4QX8B 4NXNT 2EHOB 2XQ3A 2A9UA 3U78A 1E1HB 5HEJA 3P4QA 2V26A 1T7SA 3AE1A 5FNVE 4QXCB 4DV5T 5HAXA 4P09A 4O2BE 4H9PC 1IBLT 3B13A 2Z6EA 1VCSA 5KX5E 1SHZC 3FZMB 5FY0A 4ADZA 1NAFA 1KEYA 3AEBA 4X65T 3WAKA 4CXXA 3DJBA 3C4WA 5EZYE 4ANJA 4CXWA 1HFAA 4UVBB 2BS4A 4X1IE 3SFDA 3R6NA 2D9DA 3JAEA 4DUYT 2OA5A 2MAWA 3LBXA 2UU9T 2JQ9A 3ZMZB 2KWHA 2CHOA 1L0VA 5LGUB 2CRBA 1LVFA 3LK42 3VR9A 3O9XA 4JUYA 3CIRA 3SS1A 3UULA 4ZOLE 4UV9B 2CA5A 5IUXA 3Q9DA 4PJMA 2YU1A 2E2AA 1YKHB 5HEOA 3PUAA 4U31A 2UXXB 4PJJA 4DNDA 4ZI2D 3OVUA 1SA0E 4QH5A 3ONJA 2KLQA 4DR6T 2WBLA 4ZS3A 4JLEA 2ZMAA 3PUWF 2J4GA 4QWNB 5CB4E 1D1BA 2X9HA 2HPJA 2LLYA 4MHCA 2LSJA 2R6GF 3QB5A 3RLFF 4PFOA 4CN1A 2D2SA 1QUUA 3RC3A 3MZKB 3ZN0B 3SWHA 4DR5T 4GYRA 4IL4A 5TAOA 2X9XA 3BQLA 1FMWA 5AFUL 4JI4T 2BZBA 5AQOB 1VRBA 1U5PA 5J1GA 3A5XA 4H9OC 3O4XE 3RHWA 5F8PA 2I59A 5FMNA 1WFDA 4DR1T 3EABA 3P8CD 2E5LT 3GN5B 1HX8A 1W0BA 3PUYF 3Q5DA 3AE4A 5HXSA 2X66A 1X9BA 3GWHA 3PDYA 3V5SA 2BG9E 2JQQA 4ZI2C 1XMQT 1Y01A 2FUPA 3LSVA 2W66A 5L3DB 2JMKA 3ZMSB 3L09A 1N34T 2DL1A 2Q9QD 2WMOA 3UU4A 3A8YC 2ACXA 1XDPA 3VU7H 1LVKA 3PUXF 5J2TE 3UQ4A 3F2EA 4XBFB 2W4XA 2VKJA 2CWYA 4DBRA 5AQLB 5FVKA 2XQ6A 5IWAT 3O1HA 4HWFA 2VK9A 5HCJA 3RIAA 2HN2A 3VKGA 3OYZA 1E7PA 3P4WA 4I4TE 3NZPA 1YKEB 5FKYA 1W09A 4LMJA 2CCQA 2ES0A 4X20E 2LM2A 5HEHA 3K3QC 3WI3A 5LJMA 4IDOA 2Y6XA 3AE9A 2N1GA 4KI0F 2JQKA 4A56A 4WYVA 1CUNA 5HCMA 4PJLA 4IE6A 4IE4A 5CFBA 2ODUA 2D0UA 1LKXA 2E9XB 3C4ZA 3TLVA 1HX1B 3CQXC 4CI1B 2WDRA 2CXFA 3RIUC 2Q9QC 3CX6B 4HFBA 3ZSSA 5LNKA 2E8IA 5ABGA 3J9X1 2UXDT 4UIGA 2CHNA 4Z8XA 5L3CB 1MIWA 4ZZBA 2X9WA 2KXPB 4CN4A 4JI6T 1UUSA 4IIJE 3HKDE 4DV1T
chains in the Genus database with same CATH topology
1I94T 1HNWT 5IWAT 4LF9T 4K0KT 4DR6T 4LFCT 1IBKT 4GKKT 3OTOT 4LF8T 2HHHT 4NXNT 1XNRT 4DV7T 4DV6T 4B3MT 4JI5T 1N36T 1HR0T 4JI7T 5LMUT 4LFBT 4LF5T 2F4VT 4DV5T 4LF4T 4DR2T 1IBLT 1N33T 4X66T 4JI8T 4JI0T 4KHPT 4X64T 2UUAT 1XNQT 5BR8T 1N32T 1HNZT 4DV2T 4DR5T 4B3ST 4X65T 4B3TT 2UUBT 4JI4T 1FJGT 4B3RT 1HNXT 4JYAT 1J5ET 4JI3T 3T1HT 4DV0T 4LF7T 4DV3T 2UUCT 4YY3T 4DUYT 4JV5T 2UXBT 4DR1T 2UXCT 5LMNT 2UU9T 4YHHT 2E5LT 4DUZT 1XMOT 3T1YT 2VQET 4LF6T 4DV4T 2VQFT 2ZM6T 2UXDT 4JI2T 1IBMT 4DR7T 1XMQT 4X62T 4GKJT 4JI1T 4NXMT 1N34T 4AQYT 4OX9T 4JI6T 4DR4T 4LFAT 4DV1T 4DR3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I94 T;  1HNW T;  5IWA T;  4LF9 T;  4K0K T;  4DR6 T;  4LFC T;  1IBK T;  4GKK T;  3OTO T;  4LF8 T;  2HHH T;  4NXN T;  1XNR T;  4DV7 T;  4DV6 T;  4B3M T;  4JI5 T;  1N36 T;  1HR0 T;  4JI7 T;  5LMU T;  4LFB T;  4LF5 T;  2F4V T;  4DV5 T;  4LF4 T;  4DR2 T;  1IBL T;  1N33 T;  4X66 T;  4JI8 T;  4JI0 T;  4KHP T;  4X64 T;  2UUA T;  1XNQ T;  5BR8 T;  1N32 T;  1HNZ T;  4DV2 T;  4DR5 T;  4B3S T;  4X65 T;  4B3T T;  2UUB T;  4JI4 T;  1FJG T;  4B3R T;  1HNX T;  4JYA T;  1J5E T;  4JI3 T;  3T1H T;  4DV0 T;  4LF7 T;  4DV3 T;  2UUC T;  4YY3 T;  4DUY T;  4JV5 T;  2UXB T;  4DR1 T;  2UXC T;  5LMN T;  2UU9 T;  4YHH T;  2E5L T;  4DUZ T;  1XMO T;  3T1Y T;  2VQE T;  4LF6 T;  4DV4 T;  2VQF T;  2ZM6 T;  2UXD T;  4JI2 T;  1IBM T;  4DR7 T;  1XMQ T;  4X62 T;  4GKJ T;  4JI1 T;  4NXM T;  1N34 T;  4AQY T;  4OX9 T;  4JI6 T;  4DR4 T;  4LFA T;  4DV1 T;  4DR3 T; 
#chains in the Genus database with same CATH topology
 5JTG A;  2JQH A;  4BA9 A;  2JMH A;  5HXR A;  2W62 A;  4LF8 T;  2BDE A;  4TWH A;  4U72 A;  4L0R A;  1UX5 A;  4TWD A;  3UU3 A;  4LFB T;  3RIU A;  2Q9Q A;  5AQS B;  5JDQ A;  3P4S A;  5H6Q B;  3LBX B;  4AI6 A;  1YW0 A;  4U2Y A;  3GMI A;  4DV2 T;  4C91 A;  3LFM A;  2UUB T;  1FEW A;  2WDQ A;  1KFY A;  4MAL A;  2BS2 A;  3FXD B;  5HEG A;  3ZMV B;  5LHG B;  3AXJ A;  3A7M A;  3UUN A;  5ABF A;  4E7S A;  1QLB A;  1WYB A;  3OYX A;  5ADX L;  1NWM X;  4C90 A;  2K5B B;  2YIN A;  5L3E B;  4WW0 A;  2WSS V;  2PTF A;  3KV6 A;  4P1N A;  3UTK A;  2W63 A;  2PBI A;  3RKG A;  1IBM T;  3MA9 A;  5AQT B;  2Y48 B;  1J5W A;  3N2G E;  5AQP B;  3ESL A;  2X67 A;  5J2U E;  4L5G A;  2XQA A;  2YDQ A;  1WRD A;  3AE3 A;  2VWA A;  3AAE B;  3HKC E;  5DAB A;  2WU2 A;  4U7I A;  1E2A A;  3L39 A;  3CWZ B;  3RYC E;  2K48 A;  2LSK A;  4HKA A;  2HHH T;  2HH7 A;  2J47 A;  5FXZ A;  5AQI B;  1B7T A;  4DR2 T;  2XUE A;  4ILU A;  4KHP T;  3TLT A;  4PK6 A;  5L4E A;  4ERR A;  2ZLY A;  4B6X A;  2XHE B;  4H63 H;  3H37 A;  1OED E;  2JPF A;  3AEE A;  5FXV A;  1M62 A;  2QYW A;  1MNE A;  3RPU A;  2NR4 A;  2BKN A;  3ZST A;  2BS3 A;  3VKH A;  3I9W A;  4AKH A;  3IA3 A;  2DNX A;  4GK0 E;  4O2A E;  3OJA A;  5FY1 A;  3EDU A;  3TLW A;  4U74 A;  4DMV A;  5FYM A;  1R8I A;  3EAM A;  3RQU A;  4IE7 A;  2B76 A;  2P9B A;  3K3O A;  3L3P A;  4AKL A;  4YT0 A;  2KZ7 B;  2IAK A;  4MFR A;  1KNZ A;  4UEL A;  4YTM A;  4QH4 A;  3CKD A;  2WU5 A;  4H9S E;  1I6Z A;  2LT3 A;  3EI0 A;  2XAQ B;  4QKN A;  4QXH B;  4H9R C;  3VRA A;  4OYJ A;  2IC9 A;  3W15 B;  3C4X A;  3AA6 B;  2M67 A;  4EED A;  1ZV4 X;  2RA1 A;  1XNR T;  4MBQ A;  3SOL A;  1MMA A;  3FZF B;  3KFW X;  1HR0 T;  5AQF B;  5F3J A;  2F4V T;  3KVA A;  4O8S A;  3AA1 B;  2V5C A;  4ZI7 E;  4JEH B;  3UU6 A;  3CPZ A;  4I0U A;  2LM9 A;  3NRX A;  4AXP A;  3LK3 B;  4GYS A;  3I1A A;  4TNV A;  2UXN B;  1ZHC A;  4KX6 A;  3RYH E;  5L3B B;  2V7M A;  2PG8 A;  1IJ6 A;  4U7Y A;  5LOV E;  2VVN A;  3UFG A;  3PUV F;  4YSZ A;  5A1L A;  4ILB A;  2XZE A;  4TV8 E;  3T8O A;  3MJX A;  5JDM A;  5IYZ E;  3Q2M A;  4X62 T;  4GKJ T;  4JI1 T;  3CX7 B;  2ZM0 A;  4AQY T;  4CI2 B;  2Q9Q B;  4N78 D;  4UVC B;  3UU8 A;  4UR9 A;  2CXD A;  4HFV A;  1BR4 A;  4ZEY A;  2XM1 A;  2NOX A;  2LSI A;  4WBO A;  1HF8 A;  1O3X A;  3CQG B;  4X5T A;  3N5L A;  3RH3 A;  2W0G A;  5C8Y E;  3C98 B;  3QOF A;  2C5J A;  1XWM A;  3AXJ B;  1FMV A;  5DQW A;  5ABF B;  4CN6 A;  3DP7 A;  5LHI B;  1N33 T;  3C50 A;  4O4I E;  2LKH A;  1MMD A;  2WDV A;  2J1D G;  4DBQ A;  3C64 A;  4JBW F;  3EHZ A;  4HFH A;  2RP4 A;  3QNU A;  3LK2 B;  5L47 A;  2DHR A;  3EDV A;  3FZL B;  3IEE A;  4P0A A;  3SRZ A;  4TN7 B;  1WCR A;  4IRE A;  3PTR B;  4G2A A;  4KBM B;  2W67 A;  2X0H A;  2UXC T;  1D0Z A;  1W0A A;  2XAG B;  1T72 A;  4K0U A;  1D1C A;  1SUM B;  3T1Y T;  4UF0 A;  4YFS A;  3RGL A;  2ZM6 T;  4DR7 T;  2NP9 A;  3UUM A;  2OLT A;  3CK6 A;  4EV6 A;  5IHY A;  2BBJ A;  4PJN A;  4NIQ A;  5FY7 A;  4I50 E;  5CA0 E;  3ZYL A;  4CXY A;  4BAY B;  1T8B A;  5L4H A;  2X51 A;  4TZ4 C;  2DI4 A;  2WB5 A;  3AE7 A;  4QH1 A;  5AQG B;  4LML A;  4B3M T;  2GK9 A;  3NKZ A;  2X0Y A;  5JRC A;  2CMR A;  2LKG A;  1N32 T;  3N9O A;  1HNZ T;  1LRZ A;  3TLU A;  2DWG A;  3U3I A;  4A97 A;  2NW8 A;  1UUR A;  2ZM8 A;  2XTL A;  3RRC A;  1D0Y A;  4YLH A;  3AAI A;  2AE9 A;  2QGS A;  2PJQ A;  2WP9 A;  3AE2 A;  3T1H T;  3ZC0 A;  2E5V A;  3FZK B;  1KF6 A;  2BVL A;  3PJA A;  3RX6 A;  4DO0 A;  3KBT A;  2KIN B;  2IC6 A;  5ETW A;  2M6I A;  4TV9 E;  2DWK A;  2X0L B;  5LBQ B;  2JIW A;  2BG9 C;  3OPC A;  2H7V C;  2FJB A;  4NXM T;  3AEC A;  4EB6 E;  2CWO A;  2D0T A;  4DID B;  1Z8U A;  4O4H E;  4PNI A;  2KSR A;  2YEV C;  2N9D A;  3E22 E;  4M1P A;  1ZEE A;  4Z90 A;  2MOZ A;  3RYI E;  4AKI A;  3J7Y q;  2LJL A;  5AQK B;  3I0O A;  2W61 A;  2A3D A;  1IBK T;  2J62 A;  1YD8 G;  1YQ4 A;  3ZMU B;  3ANW A;  4ZI3 D;  4DV7 T;  3NBX X;  4F6R C;  4NPP A;  2LHN A;  5ABH A;  1WR6 A;  3V5U A;  3P4R A;  2V1D B;  2YOE A;  4IGU A;  3AEG A;  2BG9 A;  2FJE A;  2LOS A;  4IDQ A;  3LDQ B;  2A72 A;  4B3T T;  3AE6 A;  2XJ7 A;  5JDG A;  1FJG T;  3N9L A;  5F5W A;  4JYA T;  1V9D A;  3AVR A;  3H3M A;  1J5E T;  1HTJ F;  2L3L A;  2V6Y A;  4J2C A;  3R84 B;  4ZXL A;  4ZS2 A;  5LMN T;  4YHH T;  4DUZ T;  3RYF E;  3E0Z A;  1UGO A;  1S35 A;  5LHH B;  1HG2 A;  2I0M A;  3EUH A;  4WNK A;  2WMN A;  4JI2 T;  5JDH A;  1KNP A;  3CVR A;  2JRK A;  4HGA A;  5GON E;  2NW7 A;  1D0X A;  3UUB A;  2LOP A;  3S4U A;  5LJN A;  3P50 A;  4BJM A;  2YN6 A;  4CI3 B;  4KHZ F;  4ZI3 C;  4OX9 T;  4PW8 A;  3Q5E A;  2ODV A;  1VOM A;  3RKO A;  2BBH A;  4K0K T;  5KDM C;  3PUG A;  1DU2 A;  3BK9 A;  2ACZ A;  3QC9 A;  1W9R A;  5KMG P;  3MK7 C;  3P7I A;  4GK5 E;  2VKD A;  2DCF A;  3PU3 A;  3RIF A;  1IAP A;  2BKP A;  4GOU A;  4JI5 T;  4LF5 T;  1AJ3 A;  3VHL A;  3FB2 A;  4X64 T;  4UXN B;  5E0O A;  5C2T A;  2VUR A;  4TX5 A;  4LMK A;  2E9X D;  5JR9 C;  4UF0 B;  2WZI A;  3FBL A;  3G06 A;  3AAA B;  1X79 A;  5L3F B;  4JI3 T;  4TNW A;  3NWI A;  4H9Q C;  4TUY E;  4IT4 A;  2UUC T;  1D1A A;  2W2U A;  2LSY A;  2UXB T;  2KT9 A;  4F8H A;  3FXE B;  1HG5 A;  3NRY A;  4IDZ A;  2XAS B;  1XMO T;  2VKO A;  4AQF C;  1YXR A;  2JJ9 A;  3ETU A;  1MMG A;  4HEA A;  5L3G B;  5LG3 A;  2L9Q A;  5JR9 A;  5FXX A;  4GIW A;  2YDS A;  2WZH A;  4IDN A;  3PUQ A;  3K8P C;  4EZH A;  4BJN A;  4DR4 T;  5BMV E;  2CE7 A;  5JH7 E;  4YJ2 E;  2K3W A;  1ZKE A;  4DR3 T;  2IW5 B;  2W00 A;  3KVB A;  4DVD A;  2XSB A;  3O1I A;  5ABE A;  1N36 T;  3H3A A;  4PAG A;  2E9X C;  4AQF A;  5LMU T;  3KBU A;  5JQG E;  2V6X A;  3FBZ A;  3I9Y A;  2V7L A;  4NUU A;  5HXE A;  4FI5 A;  4UEM A;  4UV8 B;  4IE5 A;  4JI0 T;  4HTE A;  4U2Z A;  1GQE A;  1FIO A;  1OED C;  3FZH B;  5AQR B;  5DQV A;  2MYS A;  4QXB B;  3SFE A;  5KXJ A;  3MXZ A;  2IHR 1;  1MND A;  3OKQ A;  3NVO A;  3N9Q A;  5L2L A;  3LJC A;  2VB6 A;  2XQ5 A;  4ZZC A;  2L8K A;  2XAF B;  2E9X A;  4AKG A;  4DV4 T;  3ANW B;  4OFZ A;  3ZT5 A;  2LSG A;  5AQN B;  5AQH B;  4PK4 A;  2QVA A;  3AA7 B;  1OED A;  2CPT A;  5JDL A;  3PUR A;  1IZN B;  2BG9 B;  2LHR A;  1HCI A;  1ZOY A;  3UQ7 A;  2IML A;  4KUM B;  4LF9 T;  2A2F X;  2MPK A;  4X1K E;  2VAS A;  2HN1 A;  3ZPO A;  3C51 A;  4EYU A;  2C5I T;  5LBM A;  1NEK A;  2VL8 A;  2XQY A;  4DV6 T;  4Z91 A;  4JI7 T;  2V6Y B;  1BR2 A;  5EK4 A;  1MIY A;  2LRL A;  4YSX A;  4A5X A;  3X1D A;  3F57 A;  2V7K A;  3IHR A;  2UUA T;  3ZT7 A;  4I55 E;  1U4Q A;  3RC8 A;  4X1Y E;  4ILC A;  5JVD E;  3NZQ A;  3P4P A;  2FBW A;  2IDO B;  2V7I A;  2X68 A;  3PE0 A;  3I0Q A;  4DV0 T;  5JDN A;  5HXH A;  2OV9 A;  1NEN A;  4YY3 T;  3GA8 A;  2YKS A;  3TLS A;  3KV4 A;  2WCA A;  4O4L E;  2BVM A;  4TWF A;  5AQM B;  3PU8 A;  2NTX A;  5EK3 A;  5DJQ C;  3MKD A;  1G73 A;  4YJ3 E;  2WS3 A;  4U33 A;  1MIV A;  3N9P A;  5JRE A;  4YTN A;  5HWY A;  2ZM2 A;  4HFI A;  4YXD A;  5LXT E;  2YK0 A;  4OK0 A;  2RPA A;  2Y8D A;  3HI2 A;  1JNZ A;  3N9M A;  2EHO D;  3F31 A;  2VL0 A;  4ASK A;  3UU5 A;  2CEA A;  4KMC A;  5C3J A;  3ZN1 B;  4HWC A;  1EZ3 A;  4QHO A;  3BQI A;  1VCT A;  4JI8 T;  3ZYK A;  3AE5 A;  1XNQ T;  2LE8 A;  2M6B A;  4HWH A;  4A98 A;  4B3S T;  2QA7 A;  4ILA A;  1WLX A;  2NTY A;  2CLY C;  4B3R T;  3ABV A;  3QK6 A;  1S94 A;  3CML A;  2XQ9 A;  3HR0 A;  4DV3 T;  5JR9 B;  5AQV B;  2CBJ A;  5CA1 E;  3M3Z B;  3CQC B;  5LG4 A;  4U3C A;  1OWA A;  3B57 A;  4V1A v;  1CHU A;  5AQQ B;  4L9I A;  4PFP A;  4LF6 T;  3L8R A;  3PUZ F;  3HKE E;  5AQJ B;  4DMW A;  2WM9 A;  4OYK A;  3ONL C;  2D5U A;  2EHO C;  4Q25 A;  2KMF A;  3UFE A;  3ZMT B;  3ZC1 A;  1US7 B;  2YU2 A;  1I94 T;  1HNW T;  3M65 A;  4XAX B;  4LFC T;  4IHJ E;  2PFV A;  4YSY A;  3K1S A;  5LA6 E;  2K9A A;  2XAJ B;  4JEU B;  1BR1 A;  4EGW A;  4HWD A;  2V7J A;  4EYY R;  4CQI A;  3ZJ1 A;  3B5M A;  3D0T A;  3KV9 A;  4QX7 B;  3E08 A;  1MMN A;  2H89 A;  2KND A;  3OBV E;  2G0U A;  5FL0 A;  4P0B A;  1Z0P A;  4O4J E;  2EHO A;  2XQ4 A;  1G8X A;  3IF8 B;  4LF7 T;  3JAF A;  2IUB A;  1OED B;  1XDO A;  2HPL A;  4CZZ B;  3WAJ A;  4AIU A;  1SE7 A;  5HYA A;  4I43 B;  1OXZ A;  2YDR A;  3AE8 A;  1HS7 A;  1UX4 A;  4EEB A;  4XZC A;  2VQE T;  2VQF T;  3O1J A;  2C0S A;  3RRW A;  3UUX B;  3MAC A;  4HFD A;  4H63 V;  4WZX A;  2LEH A;  2SPC A;  3K3N A;  3PUS A;  3ZLI A;  4EXT A;  3KDS E;  4AQG A;  2XPK A;  3AEA A;  3ZT6 A;  1UK5 A;  5LGT B;  4LFA T;  4ZHQ E;  4MLK A;  3IBP A;  5FP3 A;  4AIS A;  3ZEF B;  2WWV A;  4GKK T;  2FJA A;  2XQ8 A;  3OTO T;  3ONX A;  2XY8 B;  2X9Y A;  2DLR A;  1XZY A;  1KK7 A;  5HXC A;  3VR8 A;  3JAD A;  4X66 T;  2KWI B;  1M7K A;  5LCY A;  5BR8 T;  5CJ5 A;  2IIU A;  2V5D A;  4AKR B;  4IE0 A;  2MTQ A;  4H9N C;  5J0Z A;  2VVS A;  4HN9 A;  4FJO A;  5AQU B;  4E7Z A;  1WYC A;  3N2O A;  2V8S V;  1T98 A;  4HWI B;  4G63 A;  3N9N A;  2H7O A;  3AB3 B;  3ZJ2 A;  5H6R B;  4EOZ B;  5M4Y A;  2QRX A;  2XAH B;  3AEF A;  4EAH A;  5HEU A;  3QB5 K;  1H7C A;  2WY2 A;  2CXL A;  5FVL A;  2N2N A;  4COF A;  3DTO A;  3ZCJ A;  4YHJ A;  3JCF A;  4IDP A;  3KIN B;  4OHF A;  3ZYM A;  4ISS A;  3GN5 A;  4IL9 A;  4EIW A;  5LGN B;  3ETV A;  3QUJ A;  2XM2 A;  3HL6 A;  1BR0 A;  1WR0 A;  4HFE A;  2CBI A;  3Q5W A;  2WWU A;  3ZKR A;  5JRC B;  4LF4 T;  1KNR A;  3JC6 D;  3AVS A;  2H88 A;  4EZ4 A;  1QSD A;  4HE8 A;  3CX8 B;  3PJA J;  5LB7 B;  2BKO A;  4YTP A;  2WAU A;  5HWX A;  2XSA A;  2MBG A;  3RQW A;  1IJ5 A;  3HKB E;  3RI5 A;  5FXW A;  2AXD S;  1HNX T;  3KV5 A;  1Y64 B;  4PK5 A;  2CM0 A;  5JDF A;  3HA4 A;  3RF1 A;  4JV5 T;  2NW9 A;  4IST A;  3AED A;  2CLY B;  3ZCI A;  3TKL B;  3AA0 B;  3FHN A;  3N2K E;  2C5K T;  2FJD A;  5CGM A;  2VKH A;  2LRK A;  2K24 A;  1YQ3 A;  3UT5 E;  3BQK A;  1ZP0 A;  5FL1 A;  2NWB A;  4HFC A;  5LP6 E;  2B1E A;  2WQY A;  3LG7 A;  4WBN E;  1J1J A;  3EVY A;  5EK2 A;  5LYJ E;  3PV0 F;  2I6H A;  3Q5X A;  2XQ7 A;  1UCU A;  1JNR A;  3VRB A;  4UVA B;  4NUV A;  3JC6 C;  2H3R A;  4KP3 C;  4QX8 B;  4NXN T;  2EHO B;  2XQ3 A;  2A9U A;  3U78 A;  1E1H B;  5HEJ A;  3P4Q A;  2V26 A;  1T7S A;  3AE1 A;  5FNV E;  4QXC B;  4DV5 T;  5HAX A;  4P09 A;  4O2B E;  4H9P C;  1IBL T;  3B13 A;  2Z6E A;  1VCS A;  5KX5 E;  1SHZ C;  3FZM B;  5FY0 A;  4ADZ A;  1NAF A;  1KEY A;  3AEB A;  4X65 T;  3WAK A;  4CXX A;  3DJB A;  3C4W A;  5EZY E;  4ANJ A;  4CXW A;  1HFA A;  4UVB B;  2BS4 A;  4X1I E;  3SFD A;  3R6N A;  2D9D A;  3JAE A;  4DUY T;  2OA5 A;  2MAW A;  3LBX A;  2UU9 T;  2JQ9 A;  3ZMZ B;  2KWH A;  2CHO A;  1L0V A;  5LGU B;  2CRB A;  1LVF A;  3LK4 2;  3VR9 A;  3O9X A;  4JUY A;  3CIR A;  3SS1 A;  3UUL A;  4ZOL E;  4UV9 B;  2CA5 A;  5IUX A;  3Q9D A;  4PJM A;  2YU1 A;  2E2A A;  1YKH B;  5HEO A;  3PUA A;  4U31 A;  2UXX B;  4PJJ A;  4DND A;  4ZI2 D;  3OVU A;  1SA0 E;  4QH5 A;  3ONJ A;  2KLQ A;  4DR6 T;  2WBL A;  4ZS3 A;  4JLE A;  2ZMA A;  3PUW F;  2J4G A;  4QWN B;  5CB4 E;  1D1B A;  2X9H A;  2HPJ A;  2LLY A;  4MHC A;  2LSJ A;  2R6G F;  3QB5 A;  3RLF F;  4PFO A;  4CN1 A;  2D2S A;  1QUU A;  3RC3 A;  3MZK B;  3ZN0 B;  3SWH A;  4DR5 T;  4GYR A;  4IL4 A;  5TAO A;  2X9X A;  3BQL A;  1FMW A;  5AFU L;  4JI4 T;  2BZB A;  5AQO B;  1VRB A;  1U5P A;  5J1G A;  3A5X A;  4H9O C;  3O4X E;  3RHW A;  5F8P A;  2I59 A;  5FMN A;  1WFD A;  4DR1 T;  3EAB A;  3P8C D;  2E5L T;  3GN5 B;  1HX8 A;  1W0B A;  3PUY F;  3Q5D A;  3AE4 A;  5HXS A;  2X66 A;  1X9B A;  3GWH A;  3PDY A;  3V5S A;  2BG9 E;  2JQQ A;  4ZI2 C;  1XMQ T;  1Y01 A;  2FUP A;  3LSV A;  2W66 A;  5L3D B;  2JMK A;  3ZMS B;  3L09 A;  1N34 T;  2DL1 A;  2Q9Q D;  2WMO A;  3UU4 A;  3A8Y C;  2ACX A;  1XDP A;  3VU7 H;  1LVK A;  3PUX F;  5J2T E;  3UQ4 A;  3F2E A;  4XBF B;  2W4X A;  2VKJ A;  2CWY A;  4DBR A;  5AQL B;  5FVK A;  2XQ6 A;  5IWA T;  3O1H A;  4HWF A;  2VK9 A;  5HCJ A;  3RIA A;  2HN2 A;  3VKG A;  3OYZ A;  1E7P A;  3P4W A;  4I4T E;  3NZP A;  1YKE B;  5FKY A;  1W09 A;  4LMJ A;  2CCQ A;  2ES0 A;  4X20 E;  2LM2 A;  5HEH A;  3K3Q C;  3WI3 A;  5LJM A;  4IDO A;  2Y6X A;  3AE9 A;  2N1G A;  4KI0 F;  2JQK A;  4A56 A;  4WYV A;  1CUN A;  5HCM A;  4PJL A;  4IE6 A;  4IE4 A;  5CFB A;  2ODU A;  2D0U A;  1LKX A;  2E9X B;  3C4Z A;  3TLV A;  1HX1 B;  3CQX C;  4CI1 B;  2WDR A;  2CXF A;  3RIU C;  2Q9Q C;  3CX6 B;  4HFB A;  3ZSS A;  5LNK A;  2E8I A;  5ABG A;  3J9X 1;  2UXD T;  4UIG A;  2CHN A;  4Z8X A;  5L3C B;  1MIW A;  4ZZB A;  2X9W A;  2KXP B;  4CN4 A;  4JI6 T;  1UUS A;  4IIJ E;  3HKD E;  4DV1 T; 
#chains in the Genus database with same CATH homology
 1I94 T;  1HNW T;  5IWA T;  4LF9 T;  4K0K T;  4DR6 T;  4LFC T;  1IBK T;  4GKK T;  3OTO T;  4LF8 T;  2HHH T;  4NXN T;  1XNR T;  4DV7 T;  4DV6 T;  4B3M T;  4JI5 T;  1N36 T;  1HR0 T;  4JI7 T;  5LMU T;  4LFB T;  4LF5 T;  2F4V T;  4DV5 T;  4LF4 T;  4DR2 T;  1IBL T;  1N33 T;  4X66 T;  4JI8 T;  4JI0 T;  4KHP T;  4X64 T;  2UUA T;  1XNQ T;  5BR8 T;  1N32 T;  1HNZ T;  4DV2 T;  4DR5 T;  4B3S T;  4X65 T;  4B3T T;  2UUB T;  4JI4 T;  1FJG T;  4B3R T;  1HNX T;  4JYA T;  1J5E T;  4JI3 T;  3T1H T;  4DV0 T;  4LF7 T;  4DV3 T;  2UUC T;  4YY3 T;  4DUY T;  4JV5 T;  2UXB T;  4DR1 T;  2UXC T;  5LMN T;  2UU9 T;  4YHH T;  2E5L T;  4DUZ T;  1XMO T;  3T1Y T;  2VQE T;  4LF6 T;  4DV4 T;  2VQF T;  2ZM6 T;  2UXD T;  4JI2 T;  1IBM T;  4DR7 T;  1XMQ T;  4X62 T;  4GKJ T;  4JI1 T;  4NXM T;  1N34 T;  4AQY T;  4OX9 T;  4JI6 T;  4DR4 T;  4LFA T;  4DV1 T;  4DR3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...