1FJGT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1fjgT00
1J5ET 4DV2T 1XMQT 2ZM6T 4DR5T 4LF4T 1XMOT 1N32T 4JI3T 2UUAT 4DR4T 4LFAT 1IBKT 4JI4T 4DV6T 4DR3T 4DV7T 1N34T 1IBMT 4LF9T 3T1HT 1HNXT 4LFCT 4JI8T 4DR1T 4X64T 4JI0T 4DV1T 4YY3T 4K0KT 5BR8T 1FJGT 4X62T 5LMNT 4X66T 1N33T 2UXBT 5IWAT 2VQET 4JI2T 4KHPT 4DV0T 4X65T 1XNRT 4DR2T 4DV3T 2HHHT 2UXDT 4LFBT 4LF8T 5LMUT 3OTOT 4LF5T 4GKKT 3T1YT 1IBLT 4DV5T 4B3ST 4JYAT 4DUYT 4JI1T 4DUZT 4AQYT 1HR0T 2E5LT 1XNQT 4GKJT 4JI7T 2UXCT 4LF7T 4B3TT 4OX9T 4B3RT 1I94T 4LF6T 4YHHT 2UUCT 4DR7T 2UU9T 4NXNT 4B3MT 2VQFT 4JV5T 4NXMT 2F4VT 4JI6T 4DR6T 1HNZT 1HNWT 2UUBT 1N36T 4JI5T 4DV4T
chains in the Genus database with same CATH superfamily
1XMQT 2R6GF 4DIDB 4ZI3D 4WW0A 3FXEB 3E0ZA 3PJAA 4OHFA 5LGUB 5JVDE 4LFAT 5L4EA 2FUPA 2X0LB 2ODVA 1E7PA 5C8YE 1KNZA 3PUQA 2KMFA 3VHLA 3C64A 5CFBA 3Q5WA 5JH7E 4QKNA 5AQGB 1WFDA 4AXPA 3SOLA 4O2BE 2C5IT 4LMKA 3K8PC 2LRLA 4ZOLE 5ABEA 5HYAA 2PJQA 5JRCA 1UK5A 5L3EB 3DP7A 3VR9A 3V5UA 2DL1A 2V8SV 2IIUA 4IDOA 4CXWA 2JQQA 3N2OA 3AB3B 4QH4A 2JMHA 2B76A 2BS2A 3UTKA 2IHR1 4JYAT 3CPZA 4DMWA 3KBTA 3IBPA 5JDMA 2K48A 3ZYKA 3I9WA 2V7IA 1UGOA 4L9IA 1YKEB 2YN6A 4HWHA 2HPJA 4AIUA 2NP9A 4IREA 4GYRA 1T8BA 2F4VT 5LGTB 1NEKA 2V7KA 3LJCA 5J0ZA 3IEEA 2PG8A 2BS4A 4PW8A 2VKHA 3B13A 2M6IA 2H89A 3EI0A 5BMVE 2JQKA 2M67A 5L3DB 2Y48B 1H7CA 4HTEA 2LSYA 3C4XA 2D0TA 4LF9T 1T98A 2V5DA 2QGSA 3N2KE 3MJXA 4DR1T 5GONE 5BR8T 2LSKA 4YSYA 4U72A 4AQFC 2FJEA 3KV5A 1WR6A 4H9SE 1L0VA 2EHOA 3UUMA 3KV4A 4ZS2A 4ZZCA 2N1GA 2I0MA 4H63V 5AQSB 2NOXA 3JCFA 3L09A 2XAGB 4MALA 2J1DG 4KP3C 2EHOC 3K3NA 3AE9A 2BG9C 3QC9A 1FEWA 1OEDA 1HFAA 3ZMUB 3ZMTB 4YHJA 5FY1A 4IIJE 3CQGB 2D2SA 3B5MA 5ADXL 2UXCT 3ZMVB 5ABHA 1OEDC 4LF6T 3UFGA 2XQ6A 3RKGA 2XAFB 2FJDA 2X51A 3NBXX 4IDQA 5HAXA 4NXMT 2CLYC 5LXTE 3KV6A 1LRZA 3K1SA 3UQ7A 1MNDA 3D0TA 3ZPOA 5IUXA 4JI3T 3CQXC 4UR9A 4I43B 2JQ9A 4IGUA 3UU4A 5H6RB 5FXWA 3LK42 1X79A 3HI2A 5LJMA 4C90A 3UQ4A 4XBFB 2W63A 3O1IA 3BQIA 3R84B 2MAWA 1KNRA 3PUXF 2FBWA 2VVNA 4Z90A 3P7IA 4KHPT 2LM2A 4GOUA 4X1YE 2VWAA 1CHUA 4Z91A 1D1CA 4F6RC 1U5PA 1UURA 3TLWA 4LF8T 3EDUA 4JEHB 3AE6A 2OV9A 3EABA 3I0QA 1I6ZA 2LSGA 5JR9A 5HXHA 4PNIA 3VRBA 1UUSA 3VU7H 5FXXA 4UV9B 4ILUA 2CA5A 3F31A 1CUNA 3SFDA 5JR9C 3RHWA 3ETUA 3AE4A 5AQUB 2X9YA 4DV4T 4LF4T 2J47A 2V26A 2VURA 4U31A 4TNWA 4OYKA 2YDQA 3ZC0A 4UELA 4PAGA 3CX7B 4PK5A 5FXZA 2P9BA 4EYUA 1SHZC 2RP4A 2LKGA 5JDQA 2XAHB 4X64T 2XQ4A 3PU8A 3KINB 1MIYA 4NUVA 4O4JE 3AEEA 5IWAT 4LMLA 4JBWF 4DMVA 4IL9A 4I4TE 3P50A 3UUXB 3VKGA 2JQHA 2WZHA 2NW8A 1KEYA 2D9DA 4CI1B 3OJAA 1WCRA 3FZLB 4HWIB 4IDZA 3JC6D 3LG7A 1T7SA 5AQQB 2WU5A 3Q5XA 1D0ZA 5JDFA 3SFEA 3HKBE 3ESLA 3AA1B 1QSDA 3LK3B 4ZI2C 4JV5T 2HN1A 2BG9B 2X9XA 2K9AA 4EZ4A 3P4RA 4UV8B 5IYZE 2CCQA 3AXJB 4P0BA 2XQ7A 2WP9A 2DI4A 2XPKA 2LEHA 1OXZA 3AA7B 1IJ6A 4IE0A 2HPLA 5LG4A 4HKAA 2E5VA 4EV6A 2DNXA 4DV7T 3ZMZB 2WDRA 3QNUA 3RH3A 5KMGP 4YJ2E 2X0YA 2QYWA 2UXBT 1LVFA 1WYCA 3Q5EA 2XHEB 4P0AA 1M7KA 1Y64B 2UXDT 4AI6A 4I0UA 2HH7A 2VK9A 2W0GA 3AEDA 2CM0A 2I6HA 4IE7A 4TN7B 1WLXA 3RIAA 5HWXA 3RKOA 1NENA 4NUUA 3QK6A 1ZOYA 3HA4A 4K0UA 4O4HE 2X0HA 4GK0E 2VB6A 2NTXA 4U33A 2V7MA 2CEAA 4U7IA 5J2UE 3F57A 2L8KA 1WRDA 4KI0F 2OLTA 1MIVA 1HNWT 2UUBT 3E22E 4PJJA 4HFVA 4TWDA 4HEAA 3H3MA 2WWVA 3AAAB 4YSZA 1NWMX 3OPCA 4DR4T 2BZBA 3ZYMA 3RQWA 2WS3A 5HXRA 1J5WA 3HL6A 2LE8A 4A98A 1HS7A 3M3ZB 5LMNT 1G73A 5DABA 1UX5A 3CQCB 3GN5B 2XTLA 3OKQA 2W62A 2N9DA 2YU2A 2XM1A 2MYSA 3MA9A 3VKHA 3N9QA 3QB5K 3FZMB 4OYJA 4QWNB 2WY2A 2XZEA 1FIOA 4CI3B 4GYSA 2WDVA 3PJAJ 1YXRA 4UVBB 4QX7B 4EYYR 4HFEA 2QVAA 4YT0A 3J7Yq 5HCJA 4DUZT 2XQ5A 2EHOD 2WU2A 1XNQT 5LP6E 4CN1A 3LBXB 2WM9A 3G06A 3C51A 5E0OA 3OYXA 3MKDA 1V9DA 1G8XA 3U3IA 1M62A 1W0BA 4EEBA 5J2TE 1J5ET 5AQIB 2W67A 5L47A 4ASKA 5EK3A 5FVKA 3FB2A 4AKLA 3AAEB 5LHGB 2E2AA 3NKZA 4UF0B 1N34T 3NZPA 5LBQB 3JADA 4ILAA 3FXDB 3CX6B 2CXFA 3CX8B 4UEMA 4X62T 2E8IA 3U78A 4P1NA 1MNEA 2ZLYA 4WZXA 1Z8UA 5LOVE 4V1Av 1HTJF 3ZYLA 3HKCE 5L3GB 1QLBA 3KBUA 4BAYB 3WAJA 2LJLA 2H3RA 4CI2B 2BKPA 4QXCB 1UX4A 2LOPA 4M1PA 3O9XA 3I9YA 3N9OA 4C91A 2E9XA 2V7JA 2NW9A 3FZHB 4E7SA 4DV5T 3A5XA 1T72A 2A2FX 4IE6A 3HKDE 3OVUA 2KT9A 2Q9QA 2ZM2A 4PK6A 5FY7A 4GIWA 4B6XA 2XQ9A 3F2EA 2BDEA 4B3TT 5H6QB 2E9XC 5FNVE 1LVKA 3C98B 4PJLA 2WDQA 4I55E 3LDQB 2LHNA 3O1HA 2Q9QC 4H9OC 1EZ3A 5DQVA 3MXZA 3Q5DA 3X1DA 5KDMC 4O4IE 4IE5A 5ABFA 4DV6T 4YFSA 3ONJA 3AAIA 2BS3A 2IAKA 2L9QA 1SE7A 4DV1T 4K0KT 1FJGT 3ZT5A 5DQWA 1SUMB 1ZKEA 5HEJA 2ES0A 4DO0A 5JDNA 3W15B 1ZV4X 4PFOA 2XSAA 5ETWA 1S94A 3RGLA 4DNDA 4UIGA 5EK2A 4KUMB 4TUYE 2FJAA 4EIWA 4CN4A 4GKKT 2QA7A 3ZJ2A 3RIUA 3PV0F 2B1EA 4P09A 5AQRB 4GKJT 4HFBA 2KSRA 4LF7T 4I50E 1I94T 3Q9DA 1VCSA 4DBRA 3P4SA 2CWYA 4HGAA 2X68A 2JMKA 1HNZT 3RPUA 3UUBA 4XZCA 4FJOA 3ZT7A 3ZT6A 2JJ9A 4U3CA 1YQ4A 2V6YA 2UUAT 4ZI2D 1XZYA 2PTFA 2W00A 3RI5A 5F3JA 4Z8XA 2VL8A 5HWYA 5LGNB 3VR8A 2H7VC 2G0UA 4IDNA 3EAMA 4UVCB 3PUSA 4LFCT 1UCUA 3UT5E 4YXDA 5FMNA 4HFDA 1HCIA 2V6XA 3KVAA 3NZQA 5JRCB 4ZXLA 3H37A 4IL4A 4IT4A 3AE5A 3QOFA 4ADZA 2J62A 4TNVA 3JAFA 2XAJB 4PJMA 4HN9A 4MFRA 3N5LA 4U2YA 1WR0A 1GQEA 4YJ3E 2Z6EA 4TV8E 5AQOB 2C5JA 2XUEA 4QX8B 3AE3A 4KX6A 2V1DB 4X1IE 3UFEA 3RQUA 4FI5A 2JIWA 4QHOA 2VVSA 2LLYA 4NXNT 3FBLA 4LMJA 4HFCA 4A56A 2ZMAA 3CKDA 2XJ7A 3PUGA 3BQKA 4CZZB 4OFZA 2WMNA 4HFHA 3GA8A 1AJ3A 1MMDA 1D1AA 3AEBA 4UVAB 5AQJB 2ACXA 1Z0PA 5F5WA 3AE1A 3CMLA 5KXJA 3WI3A 3K3OA 2EHOB 2XASB 2GK9A 3T1HT 1HNXT 2K3WA 1O3XA 5L2LA 2H7OA 4WNKA 4BJMA 1VRBA 5HXEA 5EK4A 2WWUA 1XDOA 3FZFB 3V5SA 1OEDB 2UXXB 1E2AA 4U2ZA 4PJNA 4ERRA 1NAFA 2N2NA 2W66A 4DVDA 4E7ZA 3SS1A 3RC8A 2CLYB 5AQKB 3AE8A 4ANJA 1BR2A 4ILCA 2XY8B 2IC9A 2BG9E 4J2CA 1VCTA 3RX6A 5HEHA 2IC6A 3IA3A 5AFUL 3UU6A 4OX9T 4YHHT 2UUCT 2DLRA 5FKYA 3NWIA 4IHJE 4B3MT 5TAOA 2NR4A 4JLEA 3TLVA 2DHRA 1YD8G 3RYIE 5LJNA 1SA0E 4JI5T 5L4HA 1U4QA 1BR4A 4HE8A 4ZI7E 2OA5A 4NIQA 3MZKB 3O1JA 3ABVA 2IW5B 3AE2A 4YTNA 3P4WA 5JREA 3EHZA 4DR3T 5C3JA 3T8OA 3I0OA 1D0YA 2D0UA 4AKRB 3MK7C 2ODUA 3E08A 3LSVA 3AEAA 1HX8A 5LA6E 4EAHA 4YSXA 4UXNB 2L3LA 5FXVA 5HEOA 5CJ5A 4TWHA 5CA0E 5AQHB 5LG3A 1XNRT 3ZJ1A 4CN6A 4Q25A 4DV3T 4U74A 5JDHA 5JR9B 1HG5A 1X9BA 2KLQA 4KBMB 2CXLA 1ZEEA 2FJBA 3UU8A 2KXPB 2LKHA 4B3ST 1KFYA 4MLKA 1IZNB 1W0AA 4COFA 3LK2B 3UU5A 2BBJA 2CBJA 5IHYA 3PUZF 3ZN0B 2V5CA 4ISTA 2DWGA 2VQFT 2KINB 3NVOA 4EB6E 4JI6T 3C50A 2E9XD 2LOSA 4HFIA 1N36T 5LCYA 4QXBB 2AE9A 2KNDA 4HWCA 1XMOT 3ZLIA 3EDVA 4WBOA 1N32T 5FY0A 2BVMA 2Q9QD 1HG2A 5FL1A 3ZN1B 2IMLA 4TX5A 2BVLA 3O4XE 4JI4T 3OYZA 3DJBA 3ETVA 3OBVE 2XM2A 2ACZA 4ZZBA 2HN2A 5KX5E 4H9QC 2VKOA 4X66T 1LKXA 3ZC1A 4JI2T 3N2GE 5FP3A 2XQ8A 2I59A 4H9RC 2KWHA 4ZHQE 3AECA 3J9X1 4TZ4C 5LB7B 4H63H 3A8YC 4BJNA 3N9NA 1YKHB 5HEGA 5LHIB 2CHOA 2LSIA 5AQNB 2VKDA 5JQGE 3P4PA 4AKIA 3T1YT 2CRBA 2MTQA 5JDLA 5FL0A 1S35A 2A72A 2IUBA 4L5GA 4DUYT 3CK6A 2LT3A 3FHNA 2E5LT 5AQMB 2X9WA 2CE7A 2M6BA 3PTRB 2YOEA 3KFWX 2XQAA 4DR7T 4AQFA 3SWHA 3NRYA 4G2AA 4ZI3C 2WB5A 1QUUA 3JAEA 2Y6XA 2LHRA 2W2UA 3ONXA 4DR5T 2H88A 5ABGA 4EEDA 3HR0A 3N9PA 3KV9A 4QH5A 4PFPA 2BG9A 3TKLB 1JNRA 5DJQC 3AXJA 1DU2A 4O2AE 3L3PA 1IBMT 2QRXA 1XWMA 3QUJA 1N33T 2SPCA 3VRAA 4H9NC 1KK7A 2NW7A 2CBIA 4X65T 3RYFE 2WMOA 4ZEYA 5LHHB 4CXYA 2YK0A 4A5XA 3N9MA 4X1KE 4N78D 4JUYA 3AA6B 3SRZA 1Y01A 5HXCA 5LMUT 1YW0A 3RYHE 5CGMA 3PE0A 3K3QC 1R8IA 3UULA 1IBLT 3WAKA 3AVRA 3CVRA 3ONLC 3ANWB 5JTGA 3TLUA 2PBIA 3HKEE 5EZYE 2V7LA 3DTOA 2KZ7B 1HR0T 3ZMSB 3RRWA 3AE7A 2C0SA 2WBLA 4B3RT 2YDSA 2WAUA 3FZKB 2YEVC 2XQYA 1MMAA 2UU9T 4AISA 3M65A 1MIWA 3ZEFB 3P8CD 5AQFB 1YQ3A 4DR6T 2W4XA 4XAXB 4OK0A 3BQLA 5HEUA 5C2TA 3R6NA 4IE4A 3GWHA 2ZM6T 4GK5E 3A7MA 4A97A 4EZHA 3RIUC 1US7B 1XDPA 4F8HA 2WSSV 1JNZA 4O4LE 3BK9A 1B7TA 3FBZA 2UXNB 2AXDS 4HWDA 2RA1A 5L3BB 3C4ZA 3PDYA 3AEFA 2BKNA 3EVYA 2MBGA 2VQET 3C4WA 1ZHCA 2J4GA 3RC3A 2RPAA 2CMRA 2KWIB 4AKHA 5L3CB 4DV0T 2DWKA 2MPKA 1MMNA 4NPPA 3GN5A 4LFBT 3LFMA 2ZM8A 2DCFA 5J1GA 1W9RA 3KVBA 1BR0A 1WYBA 3KDSE 3ZCJA 2NTYA 3IF8B 4O8SA 4TWFA 2JRKA 3N9LA 2VL0A 2W61A 3AVSA 4KHZF 4MBQA 1MMGA 4ILBA 3RF1A 1IAPA 2PFVA 5HXSA 4X20E 2K24A 3LBXA 2LRKA 3QB5A 3L8RA 3AEGA 1E1HB 2LM9A 5HCMA 2CXDA 2LSJA 3CIRA 2YDRA 2XSBA 4AKGA 3PU3A 2X9HA 4H9PC 2ZM0A 2XAQB 3UU3A 4X5TA 4YTPA 2YKSA 4JI8T 4WYVA 3ZSTA 2C5KT 3UUNA 4BA9A 4ISSA 4HWFA 2Y8DA 4UF0A 5L3FB 3TLSA 2WZIA 2CPTA 2E9XB 4IDPA 5LBMA 2CWOA 2BBHA 2K5BB 3I1AA 3RLFF 5AQTB 4DR2T 2X67A 3MACA 2BKOA 4ZS3A 2VKJA 2Q9QB 4LF5T 3GMIA 4QH1A 3Q2MA 4JEUB 3TLTA 1FMVA 3ZSSA 3NRXA 4WBNE 5M4YA 4CQIA 3CWZB 5FVLA 4JI1T 4QXHB 3ZKRA 3PUAA 1D0XA 3RRCA 4AQYT 4CXXA 1IJ5A 4JI7T 4KMCA 2A9UA 3B57A 4G63A 4EGWA 2D5UA 3ZCIA 2A3DA 5CB4E 2XQ3A 4YTMA 5FYMA 2CHNA 3P4QA 3RYCE 2WQYA 1HF8A 5ABFB 5CA1E 5A1LA 4DV2T 5AQVB 4L0RA 1J1JA 1ZP0A 3PUVF 1OWAA 1OEDE 1IBKT 4JI0T 4YY3T 1W09A 2MOZA 5AQPB 3AA0B 1FMWA 4EXTA 2YU1A 1HX1B 4TV9E 4EOZB 3PURA 5JDGA 4U7YA 1VOMA 1KNPA 4YLHA 2HHHT 1D1BA 3IHRA 4AQGA 3OTOT 3ANWA 3JC6C 3L39A 4MHCA 3H3AA 3S4UA 2NWBA 4DBQA 1KF6A 2WCAA 2VASA 2X66A 1BR1A 2IDOB 2V6YB 3EUHA 3RIFA 2JPFA 4PK4A 2YINA 5F8PA 5LYJE 3PUYF 5AQLB 5LNKA 3PUWF
chains in the Genus database with same CATH topology
1J5ET 4DV2T 1XMQT 2ZM6T 4DR5T 4LF4T 1XMOT 1N32T 4JI3T 2UUAT 4DR4T 4LFAT 1IBKT 4JI4T 4DV6T 4DR3T 4DV7T 1N34T 1IBMT 4LF9T 3T1HT 1HNXT 4LFCT 4JI8T 4DR1T 4X64T 4JI0T 4DV1T 4YY3T 4K0KT 5BR8T 1FJGT 4X62T 5LMNT 4X66T 1N33T 2UXBT 5IWAT 2VQET 4JI2T 4KHPT 4DV0T 4X65T 1XNRT 4DR2T 4DV3T 2HHHT 2UXDT 4LFBT 4LF8T 5LMUT 3OTOT 4LF5T 4GKKT 3T1YT 1IBLT 4DV5T 4B3ST 4JYAT 4DUYT 4JI1T 4DUZT 4AQYT 1HR0T 2E5LT 1XNQT 4GKJT 4JI7T 2UXCT 4LF7T 4B3TT 4OX9T 4B3RT 1I94T 4LF6T 4YHHT 2UUCT 4DR7T 2UU9T 4NXNT 4B3MT 2VQFT 4JV5T 4NXMT 2F4VT 4JI6T 4DR6T 1HNZT 1HNWT 2UUBT 1N36T 4JI5T 4DV4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J5E T;  4DV2 T;  1XMQ T;  2ZM6 T;  4DR5 T;  4LF4 T;  1XMO T;  1N32 T;  4JI3 T;  2UUA T;  4DR4 T;  4LFA T;  1IBK T;  4JI4 T;  4DV6 T;  4DR3 T;  4DV7 T;  1N34 T;  1IBM T;  4LF9 T;  3T1H T;  1HNX T;  4LFC T;  4JI8 T;  4DR1 T;  4X64 T;  4JI0 T;  4DV1 T;  4YY3 T;  4K0K T;  5BR8 T;  1FJG T;  4X62 T;  5LMN T;  4X66 T;  1N33 T;  2UXB T;  5IWA T;  2VQE T;  4JI2 T;  4KHP T;  4DV0 T;  4X65 T;  1XNR T;  4DR2 T;  4DV3 T;  2HHH T;  2UXD T;  4LFB T;  4LF8 T;  5LMU T;  3OTO T;  4LF5 T;  4GKK T;  3T1Y T;  1IBL T;  4DV5 T;  4B3S T;  4JYA T;  4DUY T;  4JI1 T;  4DUZ T;  4AQY T;  1HR0 T;  2E5L T;  1XNQ T;  4GKJ T;  4JI7 T;  2UXC T;  4LF7 T;  4B3T T;  4OX9 T;  4B3R T;  1I94 T;  4LF6 T;  4YHH T;  2UUC T;  4DR7 T;  2UU9 T;  4NXN T;  4B3M T;  2VQF T;  4JV5 T;  4NXM T;  2F4V T;  4JI6 T;  4DR6 T;  1HNZ T;  1HNW T;  2UUB T;  1N36 T;  4JI5 T;  4DV4 T; 
#chains in the Genus database with same CATH topology
 1XMQ T;  2R6G F;  4DID B;  4ZI3 D;  4WW0 A;  3FXE B;  3E0Z A;  3PJA A;  4OHF A;  5LGU B;  5JVD E;  4LFA T;  5L4E A;  2FUP A;  2X0L B;  2ODV A;  1E7P A;  5C8Y E;  1KNZ A;  3PUQ A;  2KMF A;  3VHL A;  3C64 A;  5CFB A;  3Q5W A;  5JH7 E;  4QKN A;  5AQG B;  1WFD A;  4AXP A;  3SOL A;  4O2B E;  2C5I T;  4LMK A;  3K8P C;  2LRL A;  4ZOL E;  5ABE A;  5HYA A;  2PJQ A;  5JRC A;  1UK5 A;  5L3E B;  3DP7 A;  3VR9 A;  3V5U A;  2DL1 A;  2V8S V;  2IIU A;  4IDO A;  4CXW A;  2JQQ A;  3N2O A;  3AB3 B;  4QH4 A;  2JMH A;  2B76 A;  2BS2 A;  3UTK A;  2IHR 1;  4JYA T;  3CPZ A;  4DMW A;  3KBT A;  3IBP A;  5JDM A;  2K48 A;  3ZYK A;  3I9W A;  2V7I A;  1UGO A;  4L9I A;  1YKE B;  2YN6 A;  4HWH A;  2HPJ A;  4AIU A;  2NP9 A;  4IRE A;  4GYR A;  1T8B A;  2F4V T;  5LGT B;  1NEK A;  2V7K A;  3LJC A;  5J0Z A;  3IEE A;  2PG8 A;  2BS4 A;  4PW8 A;  2VKH A;  3B13 A;  2M6I A;  2H89 A;  3EI0 A;  5BMV E;  2JQK A;  2M67 A;  5L3D B;  2Y48 B;  1H7C A;  4HTE A;  2LSY A;  3C4X A;  2D0T A;  4LF9 T;  1T98 A;  2V5D A;  2QGS A;  3N2K E;  3MJX A;  4DR1 T;  5GON E;  5BR8 T;  2LSK A;  4YSY A;  4U72 A;  4AQF C;  2FJE A;  3KV5 A;  1WR6 A;  4H9S E;  1L0V A;  2EHO A;  3UUM A;  3KV4 A;  4ZS2 A;  4ZZC A;  2N1G A;  2I0M A;  4H63 V;  5AQS B;  2NOX A;  3JCF A;  3L09 A;  2XAG B;  4MAL A;  2J1D G;  4KP3 C;  2EHO C;  3K3N A;  3AE9 A;  2BG9 C;  3QC9 A;  1FEW A;  1OED A;  1HFA A;  3ZMU B;  3ZMT B;  4YHJ A;  5FY1 A;  4IIJ E;  3CQG B;  2D2S A;  3B5M A;  5ADX L;  2UXC T;  3ZMV B;  5ABH A;  1OED C;  4LF6 T;  3UFG A;  2XQ6 A;  3RKG A;  2XAF B;  2FJD A;  2X51 A;  3NBX X;  4IDQ A;  5HAX A;  4NXM T;  2CLY C;  5LXT E;  3KV6 A;  1LRZ A;  3K1S A;  3UQ7 A;  1MND A;  3D0T A;  3ZPO A;  5IUX A;  4JI3 T;  3CQX C;  4UR9 A;  4I43 B;  2JQ9 A;  4IGU A;  3UU4 A;  5H6R B;  5FXW A;  3LK4 2;  1X79 A;  3HI2 A;  5LJM A;  4C90 A;  3UQ4 A;  4XBF B;  2W63 A;  3O1I A;  3BQI A;  3R84 B;  2MAW A;  1KNR A;  3PUX F;  2FBW A;  2VVN A;  4Z90 A;  3P7I A;  4KHP T;  2LM2 A;  4GOU A;  4X1Y E;  2VWA A;  1CHU A;  4Z91 A;  1D1C A;  4F6R C;  1U5P A;  1UUR A;  3TLW A;  4LF8 T;  3EDU A;  4JEH B;  3AE6 A;  2OV9 A;  3EAB A;  3I0Q A;  1I6Z A;  2LSG A;  5JR9 A;  5HXH A;  4PNI A;  3VRB A;  1UUS A;  3VU7 H;  5FXX A;  4UV9 B;  4ILU A;  2CA5 A;  3F31 A;  1CUN A;  3SFD A;  5JR9 C;  3RHW A;  3ETU A;  3AE4 A;  5AQU B;  2X9Y A;  4DV4 T;  4LF4 T;  2J47 A;  2V26 A;  2VUR A;  4U31 A;  4TNW A;  4OYK A;  2YDQ A;  3ZC0 A;  4UEL A;  4PAG A;  3CX7 B;  4PK5 A;  5FXZ A;  2P9B A;  4EYU A;  1SHZ C;  2RP4 A;  2LKG A;  5JDQ A;  2XAH B;  4X64 T;  2XQ4 A;  3PU8 A;  3KIN B;  1MIY A;  4NUV A;  4O4J E;  3AEE A;  5IWA T;  4LML A;  4JBW F;  4DMV A;  4IL9 A;  4I4T E;  3P50 A;  3UUX B;  3VKG A;  2JQH A;  2WZH A;  2NW8 A;  1KEY A;  2D9D A;  4CI1 B;  3OJA A;  1WCR A;  3FZL B;  4HWI B;  4IDZ A;  3JC6 D;  3LG7 A;  1T7S A;  5AQQ B;  2WU5 A;  3Q5X A;  1D0Z A;  5JDF A;  3SFE A;  3HKB E;  3ESL A;  3AA1 B;  1QSD A;  3LK3 B;  4ZI2 C;  4JV5 T;  2HN1 A;  2BG9 B;  2X9X A;  2K9A A;  4EZ4 A;  3P4R A;  4UV8 B;  5IYZ E;  2CCQ A;  3AXJ B;  4P0B A;  2XQ7 A;  2WP9 A;  2DI4 A;  2XPK A;  2LEH A;  1OXZ A;  3AA7 B;  1IJ6 A;  4IE0 A;  2HPL A;  5LG4 A;  4HKA A;  2E5V A;  4EV6 A;  2DNX A;  4DV7 T;  3ZMZ B;  2WDR A;  3QNU A;  3RH3 A;  5KMG P;  4YJ2 E;  2X0Y A;  2QYW A;  2UXB T;  1LVF A;  1WYC A;  3Q5E A;  2XHE B;  4P0A A;  1M7K A;  1Y64 B;  2UXD T;  4AI6 A;  4I0U A;  2HH7 A;  2VK9 A;  2W0G A;  3AED A;  2CM0 A;  2I6H A;  4IE7 A;  4TN7 B;  1WLX A;  3RIA A;  5HWX A;  3RKO A;  1NEN A;  4NUU A;  3QK6 A;  1ZOY A;  3HA4 A;  4K0U A;  4O4H E;  2X0H A;  4GK0 E;  2VB6 A;  2NTX A;  4U33 A;  2V7M A;  2CEA A;  4U7I A;  5J2U E;  3F57 A;  2L8K A;  1WRD A;  4KI0 F;  2OLT A;  1MIV A;  1HNW T;  2UUB T;  3E22 E;  4PJJ A;  4HFV A;  4TWD A;  4HEA A;  3H3M A;  2WWV A;  3AAA B;  4YSZ A;  1NWM X;  3OPC A;  4DR4 T;  2BZB A;  3ZYM A;  3RQW A;  2WS3 A;  5HXR A;  1J5W A;  3HL6 A;  2LE8 A;  4A98 A;  1HS7 A;  3M3Z B;  5LMN T;  1G73 A;  5DAB A;  1UX5 A;  3CQC B;  3GN5 B;  2XTL A;  3OKQ A;  2W62 A;  2N9D A;  2YU2 A;  2XM1 A;  2MYS A;  3MA9 A;  3VKH A;  3N9Q A;  3QB5 K;  3FZM B;  4OYJ A;  4QWN B;  2WY2 A;  2XZE A;  1FIO A;  4CI3 B;  4GYS A;  2WDV A;  3PJA J;  1YXR A;  4UVB B;  4QX7 B;  4EYY R;  4HFE A;  2QVA A;  4YT0 A;  3J7Y q;  5HCJ A;  4DUZ T;  2XQ5 A;  2EHO D;  2WU2 A;  1XNQ T;  5LP6 E;  4CN1 A;  3LBX B;  2WM9 A;  3G06 A;  3C51 A;  5E0O A;  3OYX A;  3MKD A;  1V9D A;  1G8X A;  3U3I A;  1M62 A;  1W0B A;  4EEB A;  5J2T E;  1J5E T;  5AQI B;  2W67 A;  5L47 A;  4ASK A;  5EK3 A;  5FVK A;  3FB2 A;  4AKL A;  3AAE B;  5LHG B;  2E2A A;  3NKZ A;  4UF0 B;  1N34 T;  3NZP A;  5LBQ B;  3JAD A;  4ILA A;  3FXD B;  3CX6 B;  2CXF A;  3CX8 B;  4UEM A;  4X62 T;  2E8I A;  3U78 A;  4P1N A;  1MNE A;  2ZLY A;  4WZX A;  1Z8U A;  5LOV E;  4V1A v;  1HTJ F;  3ZYL A;  3HKC E;  5L3G B;  1QLB A;  3KBU A;  4BAY B;  3WAJ A;  2LJL A;  2H3R A;  4CI2 B;  2BKP A;  4QXC B;  1UX4 A;  2LOP A;  4M1P A;  3O9X A;  3I9Y A;  3N9O A;  4C91 A;  2E9X A;  2V7J A;  2NW9 A;  3FZH B;  4E7S A;  4DV5 T;  3A5X A;  1T72 A;  2A2F X;  4IE6 A;  3HKD E;  3OVU A;  2KT9 A;  2Q9Q A;  2ZM2 A;  4PK6 A;  5FY7 A;  4GIW A;  4B6X A;  2XQ9 A;  3F2E A;  2BDE A;  4B3T T;  5H6Q B;  2E9X C;  5FNV E;  1LVK A;  3C98 B;  4PJL A;  2WDQ A;  4I55 E;  3LDQ B;  2LHN A;  3O1H A;  2Q9Q C;  4H9O C;  1EZ3 A;  5DQV A;  3MXZ A;  3Q5D A;  3X1D A;  5KDM C;  4O4I E;  4IE5 A;  5ABF A;  4DV6 T;  4YFS A;  3ONJ A;  3AAI A;  2BS3 A;  2IAK A;  2L9Q A;  1SE7 A;  4DV1 T;  4K0K T;  1FJG T;  3ZT5 A;  5DQW A;  1SUM B;  1ZKE A;  5HEJ A;  2ES0 A;  4DO0 A;  5JDN A;  3W15 B;  1ZV4 X;  4PFO A;  2XSA A;  5ETW A;  1S94 A;  3RGL A;  4DND A;  4UIG A;  5EK2 A;  4KUM B;  4TUY E;  2FJA A;  4EIW A;  4CN4 A;  4GKK T;  2QA7 A;  3ZJ2 A;  3RIU A;  3PV0 F;  2B1E A;  4P09 A;  5AQR B;  4GKJ T;  4HFB A;  2KSR A;  4LF7 T;  4I50 E;  1I94 T;  3Q9D A;  1VCS A;  4DBR A;  3P4S A;  2CWY A;  4HGA A;  2X68 A;  2JMK A;  1HNZ T;  3RPU A;  3UUB A;  4XZC A;  4FJO A;  3ZT7 A;  3ZT6 A;  2JJ9 A;  4U3C A;  1YQ4 A;  2V6Y A;  2UUA T;  4ZI2 D;  1XZY A;  2PTF A;  2W00 A;  3RI5 A;  5F3J A;  4Z8X A;  2VL8 A;  5HWY A;  5LGN B;  3VR8 A;  2H7V C;  2G0U A;  4IDN A;  3EAM A;  4UVC B;  3PUS A;  4LFC T;  1UCU A;  3UT5 E;  4YXD A;  5FMN A;  4HFD A;  1HCI A;  2V6X A;  3KVA A;  3NZQ A;  5JRC B;  4ZXL A;  3H37 A;  4IL4 A;  4IT4 A;  3AE5 A;  3QOF A;  4ADZ A;  2J62 A;  4TNV A;  3JAF A;  2XAJ B;  4PJM A;  4HN9 A;  4MFR A;  3N5L A;  4U2Y A;  1WR0 A;  1GQE A;  4YJ3 E;  2Z6E A;  4TV8 E;  5AQO B;  2C5J A;  2XUE A;  4QX8 B;  3AE3 A;  4KX6 A;  2V1D B;  4X1I E;  3UFE A;  3RQU A;  4FI5 A;  2JIW A;  4QHO A;  2VVS A;  2LLY A;  4NXN T;  3FBL A;  4LMJ A;  4HFC A;  4A56 A;  2ZMA A;  3CKD A;  2XJ7 A;  3PUG A;  3BQK A;  4CZZ B;  4OFZ A;  2WMN A;  4HFH A;  3GA8 A;  1AJ3 A;  1MMD A;  1D1A A;  3AEB A;  4UVA B;  5AQJ B;  2ACX A;  1Z0P A;  5F5W A;  3AE1 A;  3CML A;  5KXJ A;  3WI3 A;  3K3O A;  2EHO B;  2XAS B;  2GK9 A;  3T1H T;  1HNX T;  2K3W A;  1O3X A;  5L2L A;  2H7O A;  4WNK A;  4BJM A;  1VRB A;  5HXE A;  5EK4 A;  2WWU A;  1XDO A;  3FZF B;  3V5S A;  1OED B;  2UXX B;  1E2A A;  4U2Z A;  4PJN A;  4ERR A;  1NAF A;  2N2N A;  2W66 A;  4DVD A;  4E7Z A;  3SS1 A;  3RC8 A;  2CLY B;  5AQK B;  3AE8 A;  4ANJ A;  1BR2 A;  4ILC A;  2XY8 B;  2IC9 A;  2BG9 E;  4J2C A;  1VCT A;  3RX6 A;  5HEH A;  2IC6 A;  3IA3 A;  5AFU L;  3UU6 A;  4OX9 T;  4YHH T;  2UUC T;  2DLR A;  5FKY A;  3NWI A;  4IHJ E;  4B3M T;  5TAO A;  2NR4 A;  4JLE A;  3TLV A;  2DHR A;  1YD8 G;  3RYI E;  5LJN A;  1SA0 E;  4JI5 T;  5L4H A;  1U4Q A;  1BR4 A;  4HE8 A;  4ZI7 E;  2OA5 A;  4NIQ A;  3MZK B;  3O1J A;  3ABV A;  2IW5 B;  3AE2 A;  4YTN A;  3P4W A;  5JRE A;  3EHZ A;  4DR3 T;  5C3J A;  3T8O A;  3I0O A;  1D0Y A;  2D0U A;  4AKR B;  3MK7 C;  2ODU A;  3E08 A;  3LSV A;  3AEA A;  1HX8 A;  5LA6 E;  4EAH A;  4YSX A;  4UXN B;  2L3L A;  5FXV A;  5HEO A;  5CJ5 A;  4TWH A;  5CA0 E;  5AQH B;  5LG3 A;  1XNR T;  3ZJ1 A;  4CN6 A;  4Q25 A;  4DV3 T;  4U74 A;  5JDH A;  5JR9 B;  1HG5 A;  1X9B A;  2KLQ A;  4KBM B;  2CXL A;  1ZEE A;  2FJB A;  3UU8 A;  2KXP B;  2LKH A;  4B3S T;  1KFY A;  4MLK A;  1IZN B;  1W0A A;  4COF A;  3LK2 B;  3UU5 A;  2BBJ A;  2CBJ A;  5IHY A;  3PUZ F;  3ZN0 B;  2V5C A;  4IST A;  2DWG A;  2VQF T;  2KIN B;  3NVO A;  4EB6 E;  4JI6 T;  3C50 A;  2E9X D;  2LOS A;  4HFI A;  1N36 T;  5LCY A;  4QXB B;  2AE9 A;  2KND A;  4HWC A;  1XMO T;  3ZLI A;  3EDV A;  4WBO A;  1N32 T;  5FY0 A;  2BVM A;  2Q9Q D;  1HG2 A;  5FL1 A;  3ZN1 B;  2IML A;  4TX5 A;  2BVL A;  3O4X E;  4JI4 T;  3OYZ A;  3DJB A;  3ETV A;  3OBV E;  2XM2 A;  2ACZ A;  4ZZB A;  2HN2 A;  5KX5 E;  4H9Q C;  2VKO A;  4X66 T;  1LKX A;  3ZC1 A;  4JI2 T;  3N2G E;  5FP3 A;  2XQ8 A;  2I59 A;  4H9R C;  2KWH A;  4ZHQ E;  3AEC A;  3J9X 1;  4TZ4 C;  5LB7 B;  4H63 H;  3A8Y C;  4BJN A;  3N9N A;  1YKH B;  5HEG A;  5LHI B;  2CHO A;  2LSI A;  5AQN B;  2VKD A;  5JQG E;  3P4P A;  4AKI A;  3T1Y T;  2CRB A;  2MTQ A;  5JDL A;  5FL0 A;  1S35 A;  2A72 A;  2IUB A;  4L5G A;  4DUY T;  3CK6 A;  2LT3 A;  3FHN A;  2E5L T;  5AQM B;  2X9W A;  2CE7 A;  2M6B A;  3PTR B;  2YOE A;  3KFW X;  2XQA A;  4DR7 T;  4AQF A;  3SWH A;  3NRY A;  4G2A A;  4ZI3 C;  2WB5 A;  1QUU A;  3JAE A;  2Y6X A;  2LHR A;  2W2U A;  3ONX A;  4DR5 T;  2H88 A;  5ABG A;  4EED A;  3HR0 A;  3N9P A;  3KV9 A;  4QH5 A;  4PFP A;  2BG9 A;  3TKL B;  1JNR A;  5DJQ C;  3AXJ A;  1DU2 A;  4O2A E;  3L3P A;  1IBM T;  2QRX A;  1XWM A;  3QUJ A;  1N33 T;  2SPC A;  3VRA A;  4H9N C;  1KK7 A;  2NW7 A;  2CBI A;  4X65 T;  3RYF E;  2WMO A;  4ZEY A;  5LHH B;  4CXY A;  2YK0 A;  4A5X A;  3N9M A;  4X1K E;  4N78 D;  4JUY A;  3AA6 B;  3SRZ A;  1Y01 A;  5HXC A;  5LMU T;  1YW0 A;  3RYH E;  5CGM A;  3PE0 A;  3K3Q C;  1R8I A;  3UUL A;  1IBL T;  3WAK A;  3AVR A;  3CVR A;  3ONL C;  3ANW B;  5JTG A;  3TLU A;  2PBI A;  3HKE E;  5EZY E;  2V7L A;  3DTO A;  2KZ7 B;  1HR0 T;  3ZMS B;  3RRW A;  3AE7 A;  2C0S A;  2WBL A;  4B3R T;  2YDS A;  2WAU A;  3FZK B;  2YEV C;  2XQY A;  1MMA A;  2UU9 T;  4AIS A;  3M65 A;  1MIW A;  3ZEF B;  3P8C D;  5AQF B;  1YQ3 A;  4DR6 T;  2W4X A;  4XAX B;  4OK0 A;  3BQL A;  5HEU A;  5C2T A;  3R6N A;  4IE4 A;  3GWH A;  2ZM6 T;  4GK5 E;  3A7M A;  4A97 A;  4EZH A;  3RIU C;  1US7 B;  1XDP A;  4F8H A;  2WSS V;  1JNZ A;  4O4L E;  3BK9 A;  1B7T A;  3FBZ A;  2UXN B;  2AXD S;  4HWD A;  2RA1 A;  5L3B B;  3C4Z A;  3PDY A;  3AEF A;  2BKN A;  3EVY A;  2MBG A;  2VQE T;  3C4W A;  1ZHC A;  2J4G A;  3RC3 A;  2RPA A;  2CMR A;  2KWI B;  4AKH A;  5L3C B;  4DV0 T;  2DWK A;  2MPK A;  1MMN A;  4NPP A;  3GN5 A;  4LFB T;  3LFM A;  2ZM8 A;  2DCF A;  5J1G A;  1W9R A;  3KVB A;  1BR0 A;  1WYB A;  3KDS E;  3ZCJ A;  2NTY A;  3IF8 B;  4O8S A;  4TWF A;  2JRK A;  3N9L A;  2VL0 A;  2W61 A;  3AVS A;  4KHZ F;  4MBQ A;  1MMG A;  4ILB A;  3RF1 A;  1IAP A;  2PFV A;  5HXS A;  4X20 E;  2K24 A;  3LBX A;  2LRK A;  3QB5 A;  3L8R A;  3AEG A;  1E1H B;  2LM9 A;  5HCM A;  2CXD A;  2LSJ A;  3CIR A;  2YDR A;  2XSB A;  4AKG A;  3PU3 A;  2X9H A;  4H9P C;  2ZM0 A;  2XAQ B;  3UU3 A;  4X5T A;  4YTP A;  2YKS A;  4JI8 T;  4WYV A;  3ZST A;  2C5K T;  3UUN A;  4BA9 A;  4ISS A;  4HWF A;  2Y8D A;  4UF0 A;  5L3F B;  3TLS A;  2WZI A;  2CPT A;  2E9X B;  4IDP A;  5LBM A;  2CWO A;  2BBH A;  2K5B B;  3I1A A;  3RLF F;  5AQT B;  4DR2 T;  2X67 A;  3MAC A;  2BKO A;  4ZS3 A;  2VKJ A;  2Q9Q B;  4LF5 T;  3GMI A;  4QH1 A;  3Q2M A;  4JEU B;  3TLT A;  1FMV A;  3ZSS A;  3NRX A;  4WBN E;  5M4Y A;  4CQI A;  3CWZ B;  5FVL A;  4JI1 T;  4QXH B;  3ZKR A;  3PUA A;  1D0X A;  3RRC A;  4AQY T;  4CXX A;  1IJ5 A;  4JI7 T;  4KMC A;  2A9U A;  3B57 A;  4G63 A;  4EGW A;  2D5U A;  3ZCI A;  2A3D A;  5CB4 E;  2XQ3 A;  4YTM A;  5FYM A;  2CHN A;  3P4Q A;  3RYC E;  2WQY A;  1HF8 A;  5ABF B;  5CA1 E;  5A1L A;  4DV2 T;  5AQV B;  4L0R A;  1J1J A;  1ZP0 A;  3PUV F;  1OWA A;  1OED E;  1IBK T;  4JI0 T;  4YY3 T;  1W09 A;  2MOZ A;  5AQP B;  3AA0 B;  1FMW A;  4EXT A;  2YU1 A;  1HX1 B;  4TV9 E;  4EOZ B;  3PUR A;  5JDG A;  4U7Y A;  1VOM A;  1KNP A;  4YLH A;  2HHH T;  1D1B A;  3IHR A;  4AQG A;  3OTO T;  3ANW A;  3JC6 C;  3L39 A;  4MHC A;  3H3A A;  3S4U A;  2NWB A;  4DBQ A;  1KF6 A;  2WCA A;  2VAS A;  2X66 A;  1BR1 A;  2IDO B;  2V6Y B;  3EUH A;  3RIF A;  2JPF A;  4PK4 A;  2YIN A;  5F8P A;  5LYJ E;  3PUY F;  5AQL B;  5LNK A;  3PUW F; 
#chains in the Genus database with same CATH homology
 1J5E T;  4DV2 T;  1XMQ T;  2ZM6 T;  4DR5 T;  4LF4 T;  1XMO T;  1N32 T;  4JI3 T;  2UUA T;  4DR4 T;  4LFA T;  1IBK T;  4JI4 T;  4DV6 T;  4DR3 T;  4DV7 T;  1N34 T;  1IBM T;  4LF9 T;  3T1H T;  1HNX T;  4LFC T;  4JI8 T;  4DR1 T;  4X64 T;  4JI0 T;  4DV1 T;  4YY3 T;  4K0K T;  5BR8 T;  1FJG T;  4X62 T;  5LMN T;  4X66 T;  1N33 T;  2UXB T;  5IWA T;  2VQE T;  4JI2 T;  4KHP T;  4DV0 T;  4X65 T;  1XNR T;  4DR2 T;  4DV3 T;  2HHH T;  2UXD T;  4LFB T;  4LF8 T;  5LMU T;  3OTO T;  4LF5 T;  4GKK T;  3T1Y T;  1IBL T;  4DV5 T;  4B3S T;  4JYA T;  4DUY T;  4JI1 T;  4DUZ T;  4AQY T;  1HR0 T;  2E5L T;  1XNQ T;  4GKJ T;  4JI7 T;  2UXC T;  4LF7 T;  4B3T T;  4OX9 T;  4B3R T;  1I94 T;  4LF6 T;  4YHH T;  2UUC T;  4DR7 T;  2UU9 T;  4NXN T;  4B3M T;  2VQF T;  4JV5 T;  4NXM T;  2F4V T;  4JI6 T;  4DR6 T;  1HNZ T;  1HNW T;  2UUB T;  1N36 T;  4JI5 T;  4DV4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...