1FJGT

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotics streptomycin, spectinomycin, and paromomycin
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2000-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1fjgT00
4DR2T 3T1HT 2E5LT 1HR0T 1IBMT 2VQFT 1IBKT 2UXCT 4JI3T 4DV5T 4LF7T 4JI6T 4JI2T 4DUZT 4X64T 4LF5T 1N34T 1HNWT 4K0KT 2UU9T 4JYAT 3OTOT 4DV3T 2UUAT 1N33T 2F4VT 4DV6T 4DV1T 4X62T 4DR1T 2HHHT 4B3RT 4X66T 4JI0T 4B3MT 4AQYT 4LFAT 4NXMT 4DV0T 3T1YT 5LMNT 4LF4T 4GKKT 4NXNT 1XNRT 5BR8T 4X65T 4LFBT 4LF6T 1FJGT 4YHHT 5LMUT 1HNZT 2UXBT 1N36T 4JI5T 1HNXT 4JI7T 4B3TT 2UXDT 1J5ET 1I94T 2VQET 4LFCT 4DR4T 4DUYT 4JI8T 1XMOT 1XMQT 4DR7T 4JV5T 1XNQT 4JI4T 4DR6T 4B3ST 4JI1T 2UUBT 4DV4T 4GKJT 2ZM6T 4LF8T 4OX9T 4KHPT 4DR3T 4DV7T 1IBLT 4DR5T 5IWAT 4YY3T 1N32T 2UUCT 4DV2T 4LF9T
chains in the Genus database with same CATH superfamily
5AQOB 1OXZA 2VKHA 4O4LE 3EDUA 5L4HA 3QB5A 4XZCA 4BA9A 4NPPA 2XQ5A 4JI3T 4DV5T 2H7VC 5FL0A 2BG9E 2LRLA 3MKDA 3HR0A 2XQ9A 4JYAT 4CQIA 1ZHCA 1WR0A 2DL1A 3BQIA 3FZMB 2XQ8A 4IE4A 2YKSA 4LMJA 3RIUC 2E9XB 1YW0A 4B3MT 5ABHA 3B13A 3OVUA 3AE6A 4YXDA 2CRBA 1WLXA 3PE0A 2IMLA 3R84B 2VWAA 4TNVA 3E22E 2I59A 3H37A 5F8PA 4M1PA 1G8XA 1HF8A 4X1YE 2UXNB 2NTXA 4PJMA 3PUAA 2KT9A 5JR9A 2WZIA 2X0YA 4MALA 1W9RA 4TNWA 1H7CA 4P09A 2AE9A 2W66A 3PU8A 4L5GA 2WWUA 4KHPT 4A56A 3H3AA 2WCAA 4JEUB 4I50E 3PJAA 3M3ZB 1D1CA 1HR0T 2KSRA 3E08A 1BR0A 3MXZA 2V5CA 2X67A 1XDOA 4IDZA 2J62A 4I0UA 3UU8A 4QKNA 2Q9QB 2EHOD 2V7MA 2WMNA 1D0XA 4X66T 4EB6E 3CQGB 4JI0T 3PV0F 4FI5A 3L09A 4H9RC 3PUSA 2XQYA 4PJNA 5FXVA 4LF4T 2QA7A 2MPKA 3LK42 2LSYA 3MZKB 4LFBT 3Q5DA 1HNZT 5JRCA 2YU1A 5IUXA 4U2ZA 3B5MA 5HXCA 3FZHB 2XSBA 4XBFB 1HG2A 2KWIB 2LT3A 1MMGA 3CX8B 1MNDA 5LJNA 3NRXA 4AKGA 3LK3B 1XMQT 2E9XA 4UV9B 3KV6A 1WYBA 3QOFA 4ZXLA 4YSXA 3O1JA 4ZEYA 1U4QA 4GK5E 2IC6A 4U31A 4DV2T 3GA8A 4HWFA 2LRKA 2GK9A 1IBMT 2XUEA 5IHYA 4WW0A 2BG9B 2Y6XA 3N2GE 3ZT5A 5CA1E 4LF7T 4HFDA 4XAXB 2XQ7A 4UF0B 2CLYB 4TWHA 3UUNA 1B7TA 3JC6C 3K3QC 4X64T 2X51A 5ABGA 1S94A 2M6IA 2XHEB 4B6XA 2KMFA 2UU9T 5HCMA 1S35A 1UGOA 5J2TE 5L3FB 1HFAA 2XAQB 3ESLA 3OYZA 3IBPA 5FL1A 3TLWA 2A9UA 5L3BB 2H88A 4TWDA 5ETWA 2ZMAA 2PFVA 4IGUA 5BR8T 2JJ9A 3AB3B 3CVRA 2ZM2A 3VHLA 2IC9A 4BJNA 1E7PA 5H6RB 2WZHA 3EAMA 3SFDA 4DUYT 2Q9QA 1QSDA 4ZZBA 2PJQA 3QUJA 2CHNA 5AQTB 4QXBB 4MBQA 3VR8A 3RIAA 1W0AA 2CM0A 2XTLA 3DTOA 4NUVA 3ZPOA 3ZT7A 2H89A 2QYWA 3JCFA 4HFCA 1NENA 2D9DA 1D1AA 4IE0A 4HTEA 4LF9T 2CMRA 3LDQB 3RYHE 2VQFT 2BDEA 4HWDA 3LBXA 2UXCT 1MIYA 5FY1A 2BBHA 3RQUA 4QX8B 4QX7B 4CXWA 2LHNA 2HN2A 3VRAA 5JDNA 3PUGA 5M4YA 5C8YE 3UTKA 1IJ5A 2LOSA 2CXDA 4GK0E 4UR9A 5AQKB 4BJMA 3G06A 2C5JA 4LFAT 2LSJA 4H9OC 4AQFC 3RKGA 5AQJB 2HPLA 1Z8UA 4UF0A 4QWNB 1HCIA 2N2NA 2UXBT 2NWBA 2A2FX 3N2KE 4Q25A 2VASA 3KVAA 1QUUA 3W15B 3DP7A 3ANWB 4KMCA 4DR7T 2WDQA 5LCYA 1M7KA 3UU6A 2SPCA 3LFMA 2ODVA 2P9BA 1UX4A 4IL4A 3K3OA 3NWIA 3I1AA 5EK4A 4YY3T 4O4JE 1KEYA 1YD8G 2E5VA 2E9XD 2DNXA 2WQYA 3T1HT 4Z91A 3IHRA 3VR9A 5HWYA 2NW9A 2E5LT 2BG9C 4P0BA 2V7IA 4GIWA 4ASKA 3U78A 3O9XA 3V5SA 3CX7B 4TZ4C 4YT0A 4YHJA 2IIUA 2BZBA 3U3IA 2LKHA 3GWHA 2V1DB 2CWYA 5J1GA 2V6YA 1N33T 4IDQA 1HX8A 4HWIB 5LG3A 3SFEA 2VK9A 4H9QC 2JQHA 4AQYT 1ZEEA 3KV4A 4IE6A 4NXMT 1L0VA 3T1YT 2VVNA 5LMNT 2WU2A 4PNIA 2XQ6A 3ZEFB 4NIQA 5FMNA 3IEEA 4LF6T 5DQVA 3L39A 2JMKA 1MMNA 2HH7A 4MHCA 2OV9A 5L47A 5JQGE 4KUMB 4YSYA 5ABFB 4GOUA 1VCTA 5AQGB 3AEAA 5JREA 5CFBA 1SUMB 2XAHB 3PUWF 2N9DA 4ZS2A 2FBWA 1T72A 3A5XA 3SRZA 2CE7A 3CWZB 2Q9QD 1JNZA 2YDQA 2Y48B 1O3XA 5FY7A 4COFA 3RIUA 2XAFB 3P4SA 2LJLA 1LRZA 1KFYA 2W61A 1YKEB 1MIVA 3ANWA 4JI2T 5ADXL 2DI4A 3OBVE 4LF5T 2CXLA 1SE7A 4CI1B 3FBZA 5C3JA 3F31A 2X0LB 5LHGB 2YU2A 3BK9A 4EEBA 5HYAA 4ZI3D 1WR6A 4UELA 3RX6A 3EABA 4CXXA 2LE8A 4KX6A 2WDRA 2FUPA 3KV5A 4F8HA 2KZ7B 3LK2B 2XM2A 4ILAA 4B3TT 5E0OA 3NVOA 1YQ4A 4YSZA 5ABEA 4BAYB 4U7IA 4JV5T 3NKZA 2Y8DA 4O4HE 2JQ9A 4JI1T 4HEAA 3M65A 5CJ5A 2CA5A 3P4WA 4GYSA 2K9AA 4PK6A 3ZMTB 3QB5K 4U3CA 3SWHA 3EDVA 2JMHA 2E8IA 1Y01A 1US7B 5JTGA 3TKLB 1YQ3A 2W00A 4ILUA 2NOXA 3I9YA 2RA1A 3UQ4A 1WCRA 5HEUA 2CHOA 4HWHA 3TLTA 4IREA 2PBIA 3OYXA 4K0KT 3CQXC 3ETVA 5GONE 2BS3A 2YN6A 2F4VT 4DV6T 2PG8A 2K24A 1HTJF 3A7MA 4ADZA 3NBXX 3P50A 5AQUB 3GN5B 2W2UA 4EXTA 2V7JA 5HCJA 2CWOA 2ZM0A 4YHHT 4PFPA 3RC3A 1WFDA 2YOEA 4OYJA 4X20E 4O4IE 1ZV4X 3N9QA 4WYVA 2WS3A 4A98A 3UU3A 4MFRA 4A5XA 3PDYA 1ZKEA 2NP9A 2YDRA 1OEDE 2BBJA 3PJAJ 3AE8A 4JI4T 4AI6A 3K3NA 3HI2A 3EHZA 2WWVA 4IDPA 3HA4A 4X1IE 3ZC0A 4FJOA 5IYZE 3AE2A 3MA9A 4JUYA 2I0MA 1T7SA 3ZKRA 1YXRA 2CBIA 2C0SA 5AQNB 3UUXB 3D0TA 2HN1A 3RYIE 4P1NA 4HFIA 5JDFA 2L8KA 5CGMA 1HNWT 4OFZA 5JDMA 2M6BA 5DJQC 4JBWF 2X68A 3PUQA 4X62T 5AQPB 3P7IA 2FJBA 3IF8B 3JADA 4NUUA 4ZZCA 4G63A 3AA6B 2W4XA 2L9QA 4UV8B 2V7LA 4AXPA 5JDQA 1N36T 2LEHA 1ZOYA 1HNXT 4JI7T 2Z6EA 4ZI2C 4DVDA 3C98B 5LB7B 2ACXA 5CB4E 4IHJE 4DV4T 5DABA 3UFEA 4LF8T 4DR5T 2XAGB 5HEGA 1UUSA 1D1BA 2VKJA 4ZOLE 4ISSA 3UU4A 2VVSA 4WNKA 2JPFA 5J0ZA 3KVBA 3FHNA 2CXFA 5KDMC 4QXHB 3PUVF 4YTNA 2UUAT 4F6RC 4U33A 3AAEB 4IIJE 2X66A 2KINB 1I6ZA 3EUHA 4B3RT 1XZYA 5LGTB 5EZYE 3C50A 1YKHB 3RC8A 2PTFA 3RKOA 3X1DA 2EHOB 5HEJA 2LSGA 3I0QA 4HN9A 3GMIA 4AKRB 3C4ZA 4IT4A 3JAFA 4UVCB 2WMOA 2VL0A 3O1IA 3E0ZA 1E1HB 2J47A 3H3MA 4IDOA 2A72A 2UXDT 1J5ET 1I94T 3CK6A 2JQQA 4QHOA 2X9WA 2BG9A 5AFUL 4O2AE 3V5UA 2WBLA 2W63A 4YTMA 4IL9A 4CZZB 2LOPA 3RHWA 4HFHA 2BKPA 2MBGA 5AQQB 2ZM6T 1KNPA 2BS2A 2BVLA 2DWKA 5JDLA 3L8RA 2DWGA 5IWAT 4TUYE 2CEAA 3ZT6A 2UXXB 3P4QA 1KNRA 1GQEA 4YLHA 1HG5A 3JC6D 4O2BE 2HPJA 3AA0B 1UCUA 2MYSA 2YINA 1WYCA 1N34T 4P0AA 3ZSSA 3BQLA 3N2OA 3OTOT 4H9NC 3HL6A 2BKOA 2XY8B 3UT5E 3P8CD 1FMWA 5HXEA 3PTRB 1CHUA 2OLTA 4CI3B 5JVDE 4MLKA 1UK5A 3AA1B 5CA0E 2IW5B 1FEWA 4UVAB 4UVBB 3ABVA 4ZI7E 3ZJ1A 3CKDA 5JDGA 1FJGT 3I0OA 3ZC1A 2R6GF 4QXCB 5LG4A 3AEBA 5F5WA 4DR4T 1XWMA 4LMLA 5LXTE 2H7OA 1IZNB 4EZHA 5LA6E 3ONLC 3C4WA 3VKGA 2VB6A 3CX6B 3WAJA 4GKJT 3FZFB 2W67A 4DBQA 4OX9T 3FB2A 2UUCT 4E7SA 4OK0A 2DHRA 3VU7H 3NRYA 1FIOA 4AISA 5L3CB 3UFGA 1NWMX 1VOMA 2D5UA 1MMAA 2K5BB 4JI6T 2B1EA 1OWAA 3PUZF 3RQWA 2BKNA 2G0UA 4H63H 2FJEA 3LJCA 1J5WA 2V7KA 3C4XA 5LHIB 2NW8A 2WM9A 4DO0A 4PAGA 1JNRA 4OYKA 4H9PC 3KINB 1T98A 2RPAA 3C64A 3TLVA 2C5KT 2EHOC 3ZCIA 4N78D 2QRXA 3QC9A 1VRBA 2NW7A 3T8OA 1UURA 3CPZA 3MK7C 4L9IA 3ZYMA 3AECA 2ES0A 2JIWA 4ANJA 3RI5A 1OEDC 4AKIA 5LNKA 5L3DB 3HKCE 4LMKA 4OHFA 5HEHA 3N9OA 4DR6T 2KNDA 4KP3C 4GYRA 2MOZA 5JRCB 3PURA 1N32T 2H3RA 2V8SV 2K3WA 4DR2T 1BR1A 4HFEA 3RRCA 1FMVA 2MTQA 2D2SA 3I9WA 4HFBA 3N9NA 3UUBA 1MIWA 3FBLA 4QH5A 1R8IA 2X0HA 3MACA 5AQRB 3ZN1B 4CN4A 4I43B 2ACZA 2IHR1 3LG7A 5EK2A 3Q5EA 3PU3A 1KK7A 4JEHB 3FXEB 1X9BA 4HGAA 5J2UE 3AEDA 3RF1A 3P4PA 5ABFA 2M67A 4TV8E 4AKHA 3AXJB 2WSSV 4X1KE 5L3EB 4GKKT 4EIWA 3UUMA 5LMUT 2BS4A 4YTPA 3ZYKA 4JLEA 4ILCA 3AA7B 4KHZF 4H63V 3MJXA 3F2EA 2XJ7A 3N9PA 4LFCT 4DMVA 3AE3A 5LYJE 3Q9DA 4O8SA 4G2AA 5LGUB 1SA0E 4DMWA 1E2AA 2BVMA 2UUBT 5FVLA 3AEEA 2XZEA 2KLQA 3TLUA 3RH3A 1KF6A 2WP9A 2CCQA 5HAXA 1MNEA 5FVKA 4E7ZA 1ZP0A 4IE5A 3R6NA 3O1HA 4EEDA 3AEFA 3VKHA 4U7YA 5JR9C 5HEOA 3TLSA 2K48A 2X9YA 4YJ2E 4DUZT 3UQ7A 5LHHB 2LHRA 3AVSA 1LKXA 4I55E 2LKGA 3OKQA 3AVRA 2VKDA 3AEGA 1DU2A 2ZM8A 1KNZA 4ISTA 5AQSB 5KMGP 3LBXB 4TWFA 4X5TA 2QGSA 4DV0T 4DBRA 1BR4A 4U72A 4NXNT 2IDOB 4I4TE 1EZ3A 1MMDA 5LBMA 4TX5A 4CN1A 1M62A 2XAJB 5AQLB 3EVYA 2KWHA 1AJ3A 4L0RA 4AQGA 2D0TA 2ODUA 4IDNA 2N1GA 2WAUA 5FXZA 4U74A 3RGLA 4UEMA 3P4RA 3LSVA 1XMOT 2OA5A 2B76A 3FXDB 5AQHB 4EGWA 4EV6A 3AXJA 5BMVE 3S4UA 2W62A 3AE9A 1D0YA 2VL8A 4AKLA 2XSAA 3OPCA 2J4GA 4IE7A 2YDSA 2AXDS 3RYFE 3ZSTA 2E9XC 2X9XA 3GN5A 1IBKT 3CMLA 2DCFA 4CN6A 4HFVA 5HWXA 3RLFF 3F57A 3HKBE 3IA3A 3ZJ2A 4PK4A 2NTYA 4PFOA 3RYCE 4HWCA 3QK6A 5FXXA 2V6XA 5FKYA 4EOZB 5EK3A 1IAPA 1CUNA 4DR1T 3Q2MA 3ZCJA 5KXJA 3AAIA 4AQFA 4ILBA 5LOVE 4ZS3A 1IJ6A 5AQIB 3ZN0B 2XPKA 4C90A 4X65T 1QLBA 2DLRA 4DNDA 5LBQB 3KFWX 2WDVA 3NZPA 2D0UA 4EYUA 3L3PA 2V26A 2V6YB 3SOLA 4U2YA 3J7Yq 1XDPA 4H9SE 2JQKA 3CQCB 3ETUA 3N5LA 3KV9A 1XNQT 1WRDA 1VCSA 2FJDA 1UX5A 2V5DA 2WU5A 4B3ST 4PK5A 3O4XE 5AQMB 4ZHQE 2IUBA 1X79A 4PW8A 5AQFB 2E2AA 5KX5E 1OEDB 4K0UA 5FY0A 1NEKA 5TAOA 2C5IT 3N9LA 5HXRA 5LP6E 2Q9QC 3ONXA 2LSKA 2XQAA 3OJAA 3AE7A 5L2LA 4J2CA 5LGNB 4Z90A 3ZMZB 2XQ4A 5FP3A 2LSIA 3EI0A 1HS7A 4KBMB 1D0ZA 3A8YC 4EAHA 4EZ4A 3AE1A 4HKAA 1V9DA 5AQVB 2NR4A 3NZQA 2QVAA 3UU5A 4EYYR 3CIRA 2HHHT 2XQ3A 2X9HA 1HX1B 3Q5WA 3KBUA 4YFSA 4ZI3C 5L3GB 4KI0F 1NAFA 2I6HA 1XNRT 2XASB 3PUYF 2XM1A 2YK0A 4V1Av 4PJLA 4ZI2D 4JI5T 2LM2A 5A1LA 3DJBA 2VQET 3ZYLA 1Z0PA 4JI8T 5HXHA 3PUXF 4ERRA 5DQWA 4QH4A 5JDHA 3VRBA 2A3DA 2CLYC 4HE8A 3WAKA 1LVKA 4DV7T 1T8BA 3HKDE 1IBLT 1W09A 2KXPB 3RRWA 4WBNE 2IAKA 3K1SA 3QNUA 4DIDB 1U5PA 4PJJA 3ZLIA 3ONJA 4UXNB 2FJAA 1SHZC 5C2TA 3ZMSB 3B57A 2EHOA 2JRKA 3RPUA 2J1DG 4C91A 2L3LA 5FXWA 3FZLB 5HXSA 4QH1A 3JAEA 4AIUA 2WB5A 4TN7B 4DV3T 3WI3A 2LLYA 5JH7E 4DV1T 1OEDA 3KBTA 2VKOA 5JR9B 5FYMA 3FZKB 3HKEE 5F3JA 2RP4A 2VURA 3Q5XA 1G73A 2CBJA 3UULA 5FNVE 2LM9A 3C51A 4WBOA 2WY2A 3ZMUB 3AAAB 2ZLYA 3K8PC 3RIFA 1W0BA 3J9X1 3AE5A 5H6QB 1BR2A 4A97A 2W0GA 4UIGA 3SS1A 1J1JA 4TV9E 2CPTA 2YEVC 3AE4A 3KDSE 4Z8XA 3ZMVB 2MAWA 4CXYA 1Y64B 4YJ3E 3BQKA 5L4EA 4DR3T 3N9MA 4WZXA 4CI2B 5LJMA 1LVFA
chains in the Genus database with same CATH topology
4DR2T 3T1HT 2E5LT 1HR0T 1IBMT 2VQFT 1IBKT 2UXCT 4JI3T 4DV5T 4LF7T 4JI6T 4JI2T 4DUZT 4X64T 4LF5T 1N34T 1HNWT 4K0KT 2UU9T 4JYAT 3OTOT 4DV3T 2UUAT 1N33T 2F4VT 4DV6T 4DV1T 4X62T 4DR1T 2HHHT 4B3RT 4X66T 4JI0T 4B3MT 4AQYT 4LFAT 4NXMT 4DV0T 3T1YT 5LMNT 4LF4T 4GKKT 4NXNT 1XNRT 5BR8T 4X65T 4LFBT 4LF6T 1FJGT 4YHHT 5LMUT 1HNZT 2UXBT 1N36T 4JI5T 1HNXT 4JI7T 4B3TT 2UXDT 1J5ET 1I94T 2VQET 4LFCT 4DR4T 4DUYT 4JI8T 1XMOT 1XMQT 4DR7T 4JV5T 1XNQT 4JI4T 4DR6T 4B3ST 4JI1T 2UUBT 4DV4T 4GKJT 2ZM6T 4LF8T 4OX9T 4KHPT 4DR3T 4DV7T 1IBLT 4DR5T 5IWAT 4YY3T 1N32T 2UUCT 4DV2T 4LF9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR2 T;  3T1H T;  2E5L T;  1HR0 T;  1IBM T;  2VQF T;  1IBK T;  2UXC T;  4JI3 T;  4DV5 T;  4LF7 T;  4JI6 T;  4JI2 T;  4DUZ T;  4X64 T;  4LF5 T;  1N34 T;  1HNW T;  4K0K T;  2UU9 T;  4JYA T;  3OTO T;  4DV3 T;  2UUA T;  1N33 T;  2F4V T;  4DV6 T;  4DV1 T;  4X62 T;  4DR1 T;  2HHH T;  4B3R T;  4X66 T;  4JI0 T;  4B3M T;  4AQY T;  4LFA T;  4NXM T;  4DV0 T;  3T1Y T;  5LMN T;  4LF4 T;  4GKK T;  4NXN T;  1XNR T;  5BR8 T;  4X65 T;  4LFB T;  4LF6 T;  1FJG T;  4YHH T;  5LMU T;  1HNZ T;  2UXB T;  1N36 T;  4JI5 T;  1HNX T;  4JI7 T;  4B3T T;  2UXD T;  1J5E T;  1I94 T;  2VQE T;  4LFC T;  4DR4 T;  4DUY T;  4JI8 T;  1XMO T;  1XMQ T;  4DR7 T;  4JV5 T;  1XNQ T;  4JI4 T;  4DR6 T;  4B3S T;  4JI1 T;  2UUB T;  4DV4 T;  4GKJ T;  2ZM6 T;  4LF8 T;  4OX9 T;  4KHP T;  4DR3 T;  4DV7 T;  1IBL T;  4DR5 T;  5IWA T;  4YY3 T;  1N32 T;  2UUC T;  4DV2 T;  4LF9 T; 
#chains in the Genus database with same CATH topology
 5AQO B;  1OXZ A;  2VKH A;  4O4L E;  3EDU A;  5L4H A;  3QB5 A;  4XZC A;  4BA9 A;  4NPP A;  2XQ5 A;  4JI3 T;  4DV5 T;  2H7V C;  5FL0 A;  2BG9 E;  2LRL A;  3MKD A;  3HR0 A;  2XQ9 A;  4JYA T;  4CQI A;  1ZHC A;  1WR0 A;  2DL1 A;  3BQI A;  3FZM B;  2XQ8 A;  4IE4 A;  2YKS A;  4LMJ A;  3RIU C;  2E9X B;  1YW0 A;  4B3M T;  5ABH A;  3B13 A;  3OVU A;  3AE6 A;  4YXD A;  2CRB A;  1WLX A;  3PE0 A;  2IML A;  3R84 B;  2VWA A;  4TNV A;  3E22 E;  2I59 A;  3H37 A;  5F8P A;  4M1P A;  1G8X A;  1HF8 A;  4X1Y E;  2UXN B;  2NTX A;  4PJM A;  3PUA A;  2KT9 A;  5JR9 A;  2WZI A;  2X0Y A;  4MAL A;  1W9R A;  4TNW A;  1H7C A;  4P09 A;  2AE9 A;  2W66 A;  3PU8 A;  4L5G A;  2WWU A;  4KHP T;  4A56 A;  3H3A A;  2WCA A;  4JEU B;  4I50 E;  3PJA A;  3M3Z B;  1D1C A;  1HR0 T;  2KSR A;  3E08 A;  1BR0 A;  3MXZ A;  2V5C A;  2X67 A;  1XDO A;  4IDZ A;  2J62 A;  4I0U A;  3UU8 A;  4QKN A;  2Q9Q B;  2EHO D;  2V7M A;  2WMN A;  1D0X A;  4X66 T;  4EB6 E;  3CQG B;  4JI0 T;  3PV0 F;  4FI5 A;  3L09 A;  4H9R C;  3PUS A;  2XQY A;  4PJN A;  5FXV A;  4LF4 T;  2QA7 A;  2MPK A;  3LK4 2;  2LSY A;  3MZK B;  4LFB T;  3Q5D A;  1HNZ T;  5JRC A;  2YU1 A;  5IUX A;  4U2Z A;  3B5M A;  5HXC A;  3FZH B;  2XSB A;  4XBF B;  1HG2 A;  2KWI B;  2LT3 A;  1MMG A;  3CX8 B;  1MND A;  5LJN A;  3NRX A;  4AKG A;  3LK3 B;  1XMQ T;  2E9X A;  4UV9 B;  3KV6 A;  1WYB A;  3QOF A;  4ZXL A;  4YSX A;  3O1J A;  4ZEY A;  1U4Q A;  4GK5 E;  2IC6 A;  4U31 A;  4DV2 T;  3GA8 A;  4HWF A;  2LRK A;  2GK9 A;  1IBM T;  2XUE A;  5IHY A;  4WW0 A;  2BG9 B;  2Y6X A;  3N2G E;  3ZT5 A;  5CA1 E;  4LF7 T;  4HFD A;  4XAX B;  2XQ7 A;  4UF0 B;  2CLY B;  4TWH A;  3UUN A;  1B7T A;  3JC6 C;  3K3Q C;  4X64 T;  2X51 A;  5ABG A;  1S94 A;  2M6I A;  2XHE B;  4B6X A;  2KMF A;  2UU9 T;  5HCM A;  1S35 A;  1UGO A;  5J2T E;  5L3F B;  1HFA A;  2XAQ B;  3ESL A;  3OYZ A;  3IBP A;  5FL1 A;  3TLW A;  2A9U A;  5L3B B;  2H88 A;  4TWD A;  5ETW A;  2ZMA A;  2PFV A;  4IGU A;  5BR8 T;  2JJ9 A;  3AB3 B;  3CVR A;  2ZM2 A;  3VHL A;  2IC9 A;  4BJN A;  1E7P A;  5H6R B;  2WZH A;  3EAM A;  3SFD A;  4DUY T;  2Q9Q A;  1QSD A;  4ZZB A;  2PJQ A;  3QUJ A;  2CHN A;  5AQT B;  4QXB B;  4MBQ A;  3VR8 A;  3RIA A;  1W0A A;  2CM0 A;  2XTL A;  3DTO A;  4NUV A;  3ZPO A;  3ZT7 A;  2H89 A;  2QYW A;  3JCF A;  4HFC A;  1NEN A;  2D9D A;  1D1A A;  4IE0 A;  4HTE A;  4LF9 T;  2CMR A;  3LDQ B;  3RYH E;  2VQF T;  2BDE A;  4HWD A;  3LBX A;  2UXC T;  1MIY A;  5FY1 A;  2BBH A;  3RQU A;  4QX8 B;  4QX7 B;  4CXW A;  2LHN A;  2HN2 A;  3VRA A;  5JDN A;  3PUG A;  5M4Y A;  5C8Y E;  3UTK A;  1IJ5 A;  2LOS A;  2CXD A;  4GK0 E;  4UR9 A;  5AQK B;  4BJM A;  3G06 A;  2C5J A;  4LFA T;  2LSJ A;  4H9O C;  4AQF C;  3RKG A;  5AQJ B;  2HPL A;  1Z8U A;  4UF0 A;  4QWN B;  1HCI A;  2N2N A;  2UXB T;  2NWB A;  2A2F X;  3N2K E;  4Q25 A;  2VAS A;  3KVA A;  1QUU A;  3W15 B;  3DP7 A;  3ANW B;  4KMC A;  4DR7 T;  2WDQ A;  5LCY A;  1M7K A;  3UU6 A;  2SPC A;  3LFM A;  2ODV A;  2P9B A;  1UX4 A;  4IL4 A;  3K3O A;  3NWI A;  3I1A A;  5EK4 A;  4YY3 T;  4O4J E;  1KEY A;  1YD8 G;  2E5V A;  2E9X D;  2DNX A;  2WQY A;  3T1H T;  4Z91 A;  3IHR A;  3VR9 A;  5HWY A;  2NW9 A;  2E5L T;  2BG9 C;  4P0B A;  2V7I A;  4GIW A;  4ASK A;  3U78 A;  3O9X A;  3V5S A;  3CX7 B;  4TZ4 C;  4YT0 A;  4YHJ A;  2IIU A;  2BZB A;  3U3I A;  2LKH A;  3GWH A;  2V1D B;  2CWY A;  5J1G A;  2V6Y A;  1N33 T;  4IDQ A;  1HX8 A;  4HWI B;  5LG3 A;  3SFE A;  2VK9 A;  4H9Q C;  2JQH A;  4AQY T;  1ZEE A;  3KV4 A;  4IE6 A;  4NXM T;  1L0V A;  3T1Y T;  2VVN A;  5LMN T;  2WU2 A;  4PNI A;  2XQ6 A;  3ZEF B;  4NIQ A;  5FMN A;  3IEE A;  4LF6 T;  5DQV A;  3L39 A;  2JMK A;  1MMN A;  2HH7 A;  4MHC A;  2OV9 A;  5L47 A;  5JQG E;  4KUM B;  4YSY A;  5ABF B;  4GOU A;  1VCT A;  5AQG B;  3AEA A;  5JRE A;  5CFB A;  1SUM B;  2XAH B;  3PUW F;  2N9D A;  4ZS2 A;  2FBW A;  1T72 A;  3A5X A;  3SRZ A;  2CE7 A;  3CWZ B;  2Q9Q D;  1JNZ A;  2YDQ A;  2Y48 B;  1O3X A;  5FY7 A;  4COF A;  3RIU A;  2XAF B;  3P4S A;  2LJL A;  1LRZ A;  1KFY A;  2W61 A;  1YKE B;  1MIV A;  3ANW A;  4JI2 T;  5ADX L;  2DI4 A;  3OBV E;  4LF5 T;  2CXL A;  1SE7 A;  4CI1 B;  3FBZ A;  5C3J A;  3F31 A;  2X0L B;  5LHG B;  2YU2 A;  3BK9 A;  4EEB A;  5HYA A;  4ZI3 D;  1WR6 A;  4UEL A;  3RX6 A;  3EAB A;  4CXX A;  2LE8 A;  4KX6 A;  2WDR A;  2FUP A;  3KV5 A;  4F8H A;  2KZ7 B;  3LK2 B;  2XM2 A;  4ILA A;  4B3T T;  5E0O A;  3NVO A;  1YQ4 A;  4YSZ A;  5ABE A;  4BAY B;  4U7I A;  4JV5 T;  3NKZ A;  2Y8D A;  4O4H E;  2JQ9 A;  4JI1 T;  4HEA A;  3M65 A;  5CJ5 A;  2CA5 A;  3P4W A;  4GYS A;  2K9A A;  4PK6 A;  3ZMT B;  3QB5 K;  4U3C A;  3SWH A;  3EDV A;  2JMH A;  2E8I A;  1Y01 A;  1US7 B;  5JTG A;  3TKL B;  1YQ3 A;  2W00 A;  4ILU A;  2NOX A;  3I9Y A;  2RA1 A;  3UQ4 A;  1WCR A;  5HEU A;  2CHO A;  4HWH A;  3TLT A;  4IRE A;  2PBI A;  3OYX A;  4K0K T;  3CQX C;  3ETV A;  5GON E;  2BS3 A;  2YN6 A;  2F4V T;  4DV6 T;  2PG8 A;  2K24 A;  1HTJ F;  3A7M A;  4ADZ A;  3NBX X;  3P50 A;  5AQU B;  3GN5 B;  2W2U A;  4EXT A;  2V7J A;  5HCJ A;  2CWO A;  2ZM0 A;  4YHH T;  4PFP A;  3RC3 A;  1WFD A;  2YOE A;  4OYJ A;  4X20 E;  4O4I E;  1ZV4 X;  3N9Q A;  4WYV A;  2WS3 A;  4A98 A;  3UU3 A;  4MFR A;  4A5X A;  3PDY A;  1ZKE A;  2NP9 A;  2YDR A;  1OED E;  2BBJ A;  3PJA J;  3AE8 A;  4JI4 T;  4AI6 A;  3K3N A;  3HI2 A;  3EHZ A;  2WWV A;  4IDP A;  3HA4 A;  4X1I E;  3ZC0 A;  4FJO A;  5IYZ E;  3AE2 A;  3MA9 A;  4JUY A;  2I0M A;  1T7S A;  3ZKR A;  1YXR A;  2CBI A;  2C0S A;  5AQN B;  3UUX B;  3D0T A;  2HN1 A;  3RYI E;  4P1N A;  4HFI A;  5JDF A;  2L8K A;  5CGM A;  1HNW T;  4OFZ A;  5JDM A;  2M6B A;  5DJQ C;  4JBW F;  2X68 A;  3PUQ A;  4X62 T;  5AQP B;  3P7I A;  2FJB A;  3IF8 B;  3JAD A;  4NUU A;  4ZZC A;  4G63 A;  3AA6 B;  2W4X A;  2L9Q A;  4UV8 B;  2V7L A;  4AXP A;  5JDQ A;  1N36 T;  2LEH A;  1ZOY A;  1HNX T;  4JI7 T;  2Z6E A;  4ZI2 C;  4DVD A;  3C98 B;  5LB7 B;  2ACX A;  5CB4 E;  4IHJ E;  4DV4 T;  5DAB A;  3UFE A;  4LF8 T;  4DR5 T;  2XAG B;  5HEG A;  1UUS A;  1D1B A;  2VKJ A;  4ZOL E;  4ISS A;  3UU4 A;  2VVS A;  4WNK A;  2JPF A;  5J0Z A;  3KVB A;  3FHN A;  2CXF A;  5KDM C;  4QXH B;  3PUV F;  4YTN A;  2UUA T;  4F6R C;  4U33 A;  3AAE B;  4IIJ E;  2X66 A;  2KIN B;  1I6Z A;  3EUH A;  4B3R T;  1XZY A;  5LGT B;  5EZY E;  3C50 A;  1YKH B;  3RC8 A;  2PTF A;  3RKO A;  3X1D A;  2EHO B;  5HEJ A;  2LSG A;  3I0Q A;  4HN9 A;  3GMI A;  4AKR B;  3C4Z A;  4IT4 A;  3JAF A;  4UVC B;  2WMO A;  2VL0 A;  3O1I A;  3E0Z A;  1E1H B;  2J47 A;  3H3M A;  4IDO A;  2A72 A;  2UXD T;  1J5E T;  1I94 T;  3CK6 A;  2JQQ A;  4QHO A;  2X9W A;  2BG9 A;  5AFU L;  4O2A E;  3V5U A;  2WBL A;  2W63 A;  4YTM A;  4IL9 A;  4CZZ B;  2LOP A;  3RHW A;  4HFH A;  2BKP A;  2MBG A;  5AQQ B;  2ZM6 T;  1KNP A;  2BS2 A;  2BVL A;  2DWK A;  5JDL A;  3L8R A;  2DWG A;  5IWA T;  4TUY E;  2CEA A;  3ZT6 A;  2UXX B;  3P4Q A;  1KNR A;  1GQE A;  4YLH A;  1HG5 A;  3JC6 D;  4O2B E;  2HPJ A;  3AA0 B;  1UCU A;  2MYS A;  2YIN A;  1WYC A;  1N34 T;  4P0A A;  3ZSS A;  3BQL A;  3N2O A;  3OTO T;  4H9N C;  3HL6 A;  2BKO A;  2XY8 B;  3UT5 E;  3P8C D;  1FMW A;  5HXE A;  3PTR B;  1CHU A;  2OLT A;  4CI3 B;  5JVD E;  4MLK A;  1UK5 A;  3AA1 B;  5CA0 E;  2IW5 B;  1FEW A;  4UVA B;  4UVB B;  3ABV A;  4ZI7 E;  3ZJ1 A;  3CKD A;  5JDG A;  1FJG T;  3I0O A;  3ZC1 A;  2R6G F;  4QXC B;  5LG4 A;  3AEB A;  5F5W A;  4DR4 T;  1XWM A;  4LML A;  5LXT E;  2H7O A;  1IZN B;  4EZH A;  5LA6 E;  3ONL C;  3C4W A;  3VKG A;  2VB6 A;  3CX6 B;  3WAJ A;  4GKJ T;  3FZF B;  2W67 A;  4DBQ A;  4OX9 T;  3FB2 A;  2UUC T;  4E7S A;  4OK0 A;  2DHR A;  3VU7 H;  3NRY A;  1FIO A;  4AIS A;  5L3C B;  3UFG A;  1NWM X;  1VOM A;  2D5U A;  1MMA A;  2K5B B;  4JI6 T;  2B1E A;  1OWA A;  3PUZ F;  3RQW A;  2BKN A;  2G0U A;  4H63 H;  2FJE A;  3LJC A;  1J5W A;  2V7K A;  3C4X A;  5LHI B;  2NW8 A;  2WM9 A;  4DO0 A;  4PAG A;  1JNR A;  4OYK A;  4H9P C;  3KIN B;  1T98 A;  2RPA A;  3C64 A;  3TLV A;  2C5K T;  2EHO C;  3ZCI A;  4N78 D;  2QRX A;  3QC9 A;  1VRB A;  2NW7 A;  3T8O A;  1UUR A;  3CPZ A;  3MK7 C;  4L9I A;  3ZYM A;  3AEC A;  2ES0 A;  2JIW A;  4ANJ A;  3RI5 A;  1OED C;  4AKI A;  5LNK A;  5L3D B;  3HKC E;  4LMK A;  4OHF A;  5HEH A;  3N9O A;  4DR6 T;  2KND A;  4KP3 C;  4GYR A;  2MOZ A;  5JRC B;  3PUR A;  1N32 T;  2H3R A;  2V8S V;  2K3W A;  4DR2 T;  1BR1 A;  4HFE A;  3RRC A;  1FMV A;  2MTQ A;  2D2S A;  3I9W A;  4HFB A;  3N9N A;  3UUB A;  1MIW A;  3FBL A;  4QH5 A;  1R8I A;  2X0H A;  3MAC A;  5AQR B;  3ZN1 B;  4CN4 A;  4I43 B;  2ACZ A;  2IHR 1;  3LG7 A;  5EK2 A;  3Q5E A;  3PU3 A;  1KK7 A;  4JEH B;  3FXE B;  1X9B A;  4HGA A;  5J2U E;  3AED A;  3RF1 A;  3P4P A;  5ABF A;  2M67 A;  4TV8 E;  4AKH A;  3AXJ B;  2WSS V;  4X1K E;  5L3E B;  4GKK T;  4EIW A;  3UUM A;  5LMU T;  2BS4 A;  4YTP A;  3ZYK A;  4JLE A;  4ILC A;  3AA7 B;  4KHZ F;  4H63 V;  3MJX A;  3F2E A;  2XJ7 A;  3N9P A;  4LFC T;  4DMV A;  3AE3 A;  5LYJ E;  3Q9D A;  4O8S A;  4G2A A;  5LGU B;  1SA0 E;  4DMW A;  1E2A A;  2BVM A;  2UUB T;  5FVL A;  3AEE A;  2XZE A;  2KLQ A;  3TLU A;  3RH3 A;  1KF6 A;  2WP9 A;  2CCQ A;  5HAX A;  1MNE A;  5FVK A;  4E7Z A;  1ZP0 A;  4IE5 A;  3R6N A;  3O1H A;  4EED A;  3AEF A;  3VKH A;  4U7Y A;  5JR9 C;  5HEO A;  3TLS A;  2K48 A;  2X9Y A;  4YJ2 E;  4DUZ T;  3UQ7 A;  5LHH B;  2LHR A;  3AVS A;  1LKX A;  4I55 E;  2LKG A;  3OKQ A;  3AVR A;  2VKD A;  3AEG A;  1DU2 A;  2ZM8 A;  1KNZ A;  4IST A;  5AQS B;  5KMG P;  3LBX B;  4TWF A;  4X5T A;  2QGS A;  4DV0 T;  4DBR A;  1BR4 A;  4U72 A;  4NXN T;  2IDO B;  4I4T E;  1EZ3 A;  1MMD A;  5LBM A;  4TX5 A;  4CN1 A;  1M62 A;  2XAJ B;  5AQL B;  3EVY A;  2KWH A;  1AJ3 A;  4L0R A;  4AQG A;  2D0T A;  2ODU A;  4IDN A;  2N1G A;  2WAU A;  5FXZ A;  4U74 A;  3RGL A;  4UEM A;  3P4R A;  3LSV A;  1XMO T;  2OA5 A;  2B76 A;  3FXD B;  5AQH B;  4EGW A;  4EV6 A;  3AXJ A;  5BMV E;  3S4U A;  2W62 A;  3AE9 A;  1D0Y A;  2VL8 A;  4AKL A;  2XSA A;  3OPC A;  2J4G A;  4IE7 A;  2YDS A;  2AXD S;  3RYF E;  3ZST A;  2E9X C;  2X9X A;  3GN5 A;  1IBK T;  3CML A;  2DCF A;  4CN6 A;  4HFV A;  5HWX A;  3RLF F;  3F57 A;  3HKB E;  3IA3 A;  3ZJ2 A;  4PK4 A;  2NTY A;  4PFO A;  3RYC E;  4HWC A;  3QK6 A;  5FXX A;  2V6X A;  5FKY A;  4EOZ B;  5EK3 A;  1IAP A;  1CUN A;  4DR1 T;  3Q2M A;  3ZCJ A;  5KXJ A;  3AAI A;  4AQF A;  4ILB A;  5LOV E;  4ZS3 A;  1IJ6 A;  5AQI B;  3ZN0 B;  2XPK A;  4C90 A;  4X65 T;  1QLB A;  2DLR A;  4DND A;  5LBQ B;  3KFW X;  2WDV A;  3NZP A;  2D0U A;  4EYU A;  3L3P A;  2V26 A;  2V6Y B;  3SOL A;  4U2Y A;  3J7Y q;  1XDP A;  4H9S E;  2JQK A;  3CQC B;  3ETU A;  3N5L A;  3KV9 A;  1XNQ T;  1WRD A;  1VCS A;  2FJD A;  1UX5 A;  2V5D A;  2WU5 A;  4B3S T;  4PK5 A;  3O4X E;  5AQM B;  4ZHQ E;  2IUB A;  1X79 A;  4PW8 A;  5AQF B;  2E2A A;  5KX5 E;  1OED B;  4K0U A;  5FY0 A;  1NEK A;  5TAO A;  2C5I T;  3N9L A;  5HXR A;  5LP6 E;  2Q9Q C;  3ONX A;  2LSK A;  2XQA A;  3OJA A;  3AE7 A;  5L2L A;  4J2C A;  5LGN B;  4Z90 A;  3ZMZ B;  2XQ4 A;  5FP3 A;  2LSI A;  3EI0 A;  1HS7 A;  4KBM B;  1D0Z A;  3A8Y C;  4EAH A;  4EZ4 A;  3AE1 A;  4HKA A;  1V9D A;  5AQV B;  2NR4 A;  3NZQ A;  2QVA A;  3UU5 A;  4EYY R;  3CIR A;  2HHH T;  2XQ3 A;  2X9H A;  1HX1 B;  3Q5W A;  3KBU A;  4YFS A;  4ZI3 C;  5L3G B;  4KI0 F;  1NAF A;  2I6H A;  1XNR T;  2XAS B;  3PUY F;  2XM1 A;  2YK0 A;  4V1A v;  4PJL A;  4ZI2 D;  4JI5 T;  2LM2 A;  5A1L A;  3DJB A;  2VQE T;  3ZYL A;  1Z0P A;  4JI8 T;  5HXH A;  3PUX F;  4ERR A;  5DQW A;  4QH4 A;  5JDH A;  3VRB A;  2A3D A;  2CLY C;  4HE8 A;  3WAK A;  1LVK A;  4DV7 T;  1T8B A;  3HKD E;  1IBL T;  1W09 A;  2KXP B;  3RRW A;  4WBN E;  2IAK A;  3K1S A;  3QNU A;  4DID B;  1U5P A;  4PJJ A;  3ZLI A;  3ONJ A;  4UXN B;  2FJA A;  1SHZ C;  5C2T A;  3ZMS B;  3B57 A;  2EHO A;  2JRK A;  3RPU A;  2J1D G;  4C91 A;  2L3L A;  5FXW A;  3FZL B;  5HXS A;  4QH1 A;  3JAE A;  4AIU A;  2WB5 A;  4TN7 B;  4DV3 T;  3WI3 A;  2LLY A;  5JH7 E;  4DV1 T;  1OED A;  3KBT A;  2VKO A;  5JR9 B;  5FYM A;  3FZK B;  3HKE E;  5F3J A;  2RP4 A;  2VUR A;  3Q5X A;  1G73 A;  2CBJ A;  3UUL A;  5FNV E;  2LM9 A;  3C51 A;  4WBO A;  2WY2 A;  3ZMU B;  3AAA B;  2ZLY A;  3K8P C;  3RIF A;  1W0B A;  3J9X 1;  3AE5 A;  5H6Q B;  1BR2 A;  4A97 A;  2W0G A;  4UIG A;  3SS1 A;  1J1J A;  4TV9 E;  2CPT A;  2YEV C;  3AE4 A;  3KDS E;  4Z8X A;  3ZMV B;  2MAW A;  4CXY A;  1Y64 B;  4YJ3 E;  3BQK A;  5L4E A;  4DR3 T;  3N9M A;  4WZX A;  4CI2 B;  5LJM A;  1LVF A; 
#chains in the Genus database with same CATH homology
 4DR2 T;  3T1H T;  2E5L T;  1HR0 T;  1IBM T;  2VQF T;  1IBK T;  2UXC T;  4JI3 T;  4DV5 T;  4LF7 T;  4JI6 T;  4JI2 T;  4DUZ T;  4X64 T;  4LF5 T;  1N34 T;  1HNW T;  4K0K T;  2UU9 T;  4JYA T;  3OTO T;  4DV3 T;  2UUA T;  1N33 T;  2F4V T;  4DV6 T;  4DV1 T;  4X62 T;  4DR1 T;  2HHH T;  4B3R T;  4X66 T;  4JI0 T;  4B3M T;  4AQY T;  4LFA T;  4NXM T;  4DV0 T;  3T1Y T;  5LMN T;  4LF4 T;  4GKK T;  4NXN T;  1XNR T;  5BR8 T;  4X65 T;  4LFB T;  4LF6 T;  1FJG T;  4YHH T;  5LMU T;  1HNZ T;  2UXB T;  1N36 T;  4JI5 T;  1HNX T;  4JI7 T;  4B3T T;  2UXD T;  1J5E T;  1I94 T;  2VQE T;  4LFC T;  4DR4 T;  4DUY T;  4JI8 T;  1XMO T;  1XMQ T;  4DR7 T;  4JV5 T;  1XNQ T;  4JI4 T;  4DR6 T;  4B3S T;  4JI1 T;  2UUB T;  4DV4 T;  4GKJ T;  2ZM6 T;  4LF8 T;  4OX9 T;  4KHP T;  4DR3 T;  4DV7 T;  1IBL T;  4DR5 T;  5IWA T;  4YY3 T;  1N32 T;  2UUC T;  4DV2 T;  4LF9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...