1XZYA

Solution structure of the p30-trans form of alpha hemoglobin stabilizing protein (ahsp)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
b'MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Molecular mechanism of AHSP-mediated stabilization of alpha-hemoglobin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1xzyA00
1W09A 4IDNA 4IDPA 3Q5EA 1Z8UA 3QNUA 1XZYA 1W0AA 3IA3A 4IDQA 4IDOA 3QOFA 3Q5DA 1Y01A 1W0BA 3OVUA 3X1DA
chains in the Genus database with same CATH superfamily
4OYKA 1MIYA 2IC6A 1KNRA 3C4ZA 4AKRB 5IHYA 4DUZT 4JI2T 2BG9C 1XNQT 4O4LE 4ANJA 4A97A 4DV7T 2IHR1 3FZKB 1OEDE 4B3ST 4HFVA 4X62T 3H37A 1HNWT 4B6XA 3FXEB 3GMIA 2X67A 5LB7B 2LEHA 1D1CA 2BKOA 2NWBA 4JI6T 4P0BA 4DMVA 2VKOA 3N9QA 3OKQA 3U3IA 2XQ5A 3O9XA 4CZZB 1HG5A 2WM9A 3BQLA 2CXDA 3PUWF 4KMCA 2E5VA 3UFGA 4AQGA 2JIWA 3K1SA 2DL1A 3AVRA 3CMLA 4NPPA 2E9XB 3EVYA 1Y01A 3C64A 1N36T 2W61A 4EOZB 3PDYA 4DR5T 1WR0A 3PU8A 4QH1A 3NKZA 2JQKA 2XHEB 3EDVA 5LA6E 2VK9A 2K9AA 2PJQA 3KV5A 1WR6A 4JYAT 1L0VA 3RRWA 5FKYA 3Q5XA 2V7IA 3RIFA 3JAFA 1BR1A 4AKLA 5HXRA 2D0UA 2CLYB 1T72A 3X1DA 3AXJB 3IF8B 4GYRA 3GN5A 2E2AA 4PNIA 2JJ9A 3NZPA 2XAHB 3FXDB 4Z91A 4KUMB 1UGOA 4HFIA 4GOUA 2ZM8A 5HAXA 4DIDB 2BS4A 4E7SA 4YFSA 4I55E 4AQFA 4JI7T 5AQSB 4CXXA 2HPLA 3A8YC 2Q9QC 4TV8E 4B3MT 5AQNB 5C8YE 2W00A 3VR9A 1FEWA 4C90A 5DQWA 4HTEA 2MOZA 3ANWA 2UUCT 4PJNA 3DJBA 4ZOLE 3EAMA 1IBKT 3ZYKA 5EK2A 4TNWA 2JPFA 2E5LT 4IREA 1HG2A 2HH7A 3K3OA 2BG9B 3ZJ2A 3ZPOA 3VKHA 3UT5E 4U33A 4EZ4A 3N9LA 3PV0F 4A56A 3LFMA 2WSSV 4LMKA 2VL8A 1EZ3A 1S35A 3CQGB 5LG4A 4UF0A 5CFBA 4IDOA 5JDHA 4HWDA 2H7OA 5L3EB 4O2BE 5LMNT 2PFVA 4CN1A 2IUBA 1G73A 4TZ4C 3AE1A 2VQFT 3ZMSB 4IDZA 4TN7B 3FZHB 1IAPA 3RF1A 3RKGA 5CA1E 2Q9QD 2Z6EA 4EEBA 1WYCA 4DR6T 2XQYA 4F8HA 2WCAA 3CWZB 4CXWA 4OK0A 2XAGB 5LCYA 5CB4E 2CCQA 3NWIA 3R6NA 2VVNA 5FVKA 3PUYF 3GA8A 2IAKA 3PURA 2NTYA 2W4XA 4KHPT 2GK9A 3J7Yq 4MFRA 4DV5T 4J2CA 2WWUA 4DR3T 4HWHA 1WLXA 2X9HA 4X5TA 2E8IA 1OEDA 4ZI7E 2D2SA 3TLWA 5J2TE 2OLTA 4I0UA 3ZLIA 3PUXF 4QX7B 3CIRA 1VRBA 4DUYT 3E08A 2G0UA 2MTQA 4DV3T 2XQ8A 5JDGA 4A5XA 2H7VC 3B13A 4AISA 2VWAA 5FXWA 4ZZCA 3E0ZA 2KNDA 4ILCA 3UFEA 5AQFB 2LSIA 3PTRB 3KV9A 2LM9A 2RPAA 1Y64B 5AQQB 1Z0PA 4LF5T 1VOMA 4AXPA 2Q9QB 2XTLA 4IL4A 2CHNA 2M6IA 5HCMA 3ZC1A 3U78A 4COFA 4TWFA 3Q9DA 4ZHQE 4I50E 3O1JA 5LHHB 1D0YA 5JRCB 3RX6A 5AQGB 2ZM0A 2M67A 3UU6A 2V5DA 4IE5A 5GONE 3RLFF 5EK4A 5AQKB 5FXZA 1HF8A 3VRAA 4H63H 4YLHA 3MZKB 4NXNT 4YJ2E 3AEAA 4X1KE 2YOEA 3AAAB 2KT9A 2IMLA 4MBQA 5JDMA 2VKHA 3KBTA 3P8CD 1CUNA 1M7KA 2QRXA 2DWGA 3N2GE 4O4HE 3W15B 3JAEA 3AA1B 3ZSSA 5JR9A 5CJ5A 1YXRA 3I9WA 5DABA 5L3CB 2A9UA 2K24A 1G8XA 3DP7A 4DV6T 4HFEA 1XMOT 4O8SA 5HEUA 3WI3A 2C5KT 1SA0E 2BVMA 2V1DB 5L2LA 3RQUA 3V5SA 3AE5A 2NW8A 1T7SA 4DMWA 4AI6A 3MXZA 4DO0A 3WAJA 1SHZC 3P4SA 3B5MA 3RC8A 4P09A 2ODUA 2NW9A 3JC6D 5ABHA 1GQEA 5FYMA 3CK6A 3QNUA 1U5PA 4YTMA 3AVSA 4CN4A 2KWIB 1LKXA 3RYHE 3AA6B 2L9QA 2I0MA 1ZP0A 5HEGA 3UU5A 4BAYB 3SS1A 2PBIA 1KK7A 4FI5A 1DU2A 3C4XA 2WMNA 5L4HA 1KNPA 2EHOC 1SE7A 2CWYA 2PG8A 3HKBE 4IDPA 5A1LA 2N9DA 5AQVB 2LSYA 4ZI2C 2FBWA 3H3MA 3ZMTB 2E9XD 4M1PA 3N9MA 1J1JA 1UURA 2WZHA 4HFCA 1FJGT 3HKCE 5FY0A 3EDUA 4X1YE 3NZQA 3CPZA 5JTGA 3V5UA 2KLQA 3L8RA 3LG7A 2BZBA 3ZT7A 5JDQA 4MLKA 3HL6A 2WDQA 2RP4A 4L0RA 2MBGA 3RIUA 4H9QC 2CRBA 4BJNA 4YTNA 2K5BB 3ABVA 3AE2A 4QX8B 4YT0A 5C2TA 1US7B 2LSGA 3BK9A 2QYWA 4YJ3E 2ES0A 4U2ZA 2CXLA 5LJNA 3NRXA 2W0GA 5JREA 3CX7B 3KV6A 4CI3B 3QB5K 2YN6A 4WYVA 4GIWA 4H9SE 2NP9A 2LHNA 3RC3A 4EYYR 3UUBA 2JMKA 1D1AA 1LVFA 5ABFB 4U74A 3HKDE 4JI0T 2W62A 2X9XA 5HEJA 4U7IA 3ONXA 2L3LA 3ZMUB 2W67A 3K3NA 2QA7A 2UXXB 2YINA 3IBPA 1OEDC 2WBLA 4BA9A 1OXZA 4UV8B 1WRDA 2ZM6T 2SPCA 3CQXC 2UXBT 4QXHB 2N2NA 3P50A 5FP3A 5LGUB 2VKDA 3CX8B 4ILAA 1ZKEA 2UXNB 4QXCB 3RIAA 5AQIB 4HN9A 3C4WA 3LJCA 2XM1A 2M6BA 3AEFA 3SFDA 5LHGB 3BQKA 5J2UE 5KDMC 1KNZA 5IYZE 4JUYA 3N9OA 3P7IA 1X79A 2Y6XA 2ODVA 4AKGA 4MHCA 1NENA 3EI0A 2EHOB 4X1IE 1Z8UA 1KEYA 2E9XA 3RH3A 3QB5A 2KXPB 2CXFA 1X9BA 4PAGA 1YW0A 4CI1B 4XAXB 3ZT6A 3L3PA 4DR1T 4EYUA 2LRKA 4K0UA 3EUHA 3ETUA 3UUNA 4H9PC 4IL9A 3RKOA 1S94A 5AQPB 1W0AA 4TNVA 2PTFA 3AA0B 3M3ZB 4IGUA 3VHLA 4DBQA 4K0KT 3PUGA 4MALA 2C5IT 3MACA 2UUBT 1MMAA 3AXJA 4V1Av 5JQGE 3RI5A 3C50A 5LP6E 2HN2A 3SWHA 2NW7A 2X9YA 3H3AA 4I43B 4UELA 2CBJA 3ZN1B 3RGLA 5AQUB 2BKPA 2V6XA 4B3TT 5DQVA 3BQIA 5M4YA 4Z90A 3TLSA 4H9RC 3ZCIA 2RA1A 4DV4T 3RHWA 3RQWA 4UXNB 4XBFB 3WAKA 2DNXA 3PUQA 3L39A 5F8PA 3FBLA 4IE7A 3Q5DA 2XASB 2VURA 3KINB 2LKHA 3N5LA 3TLVA 3PE0A 3QUJA 1OEDB 2KSRA 2BG9A 3ZT5A 4AKIA 1BR4A 2C5JA 3AA7B 3K3QC 2XSAA 3CVRA 4PK6A 2V7KA 1N32T 5JVDE 2X51A 3FZMB 2FJDA 1QSDA 3O4XE 1ZHCA 5F3JA 2XSBA 4FJOA 4X20E 3UULA 4E7ZA 2A2FX 3QK6A 1IJ5A 4IE0A 3FZFB 2DCFA 3LBXB 3O1HA 4N78D 2CEAA 2NTXA 2WAUA 3MA9A 1B7TA 3AE6A 5HCJA 4LF7T 1YD8G 4DV1T 5FXXA 4X66T 2FJEA 5AQOB 1D1BA 4LMJA 4ZS2A 4LF9T 4HFDA 4P0AA 1YQ4A 4CQIA 4GYSA 3HA4A 1T8BA 3RYIE 1XWMA 1WFDA 2CPTA 2JRKA 5EK3A 2AE9A 5FMNA 1NWMX 3SRZA 4YHJA 4HKAA 3AEBA 2FUPA 3KVAA 5EZYE 5HYAA 3IHRA 1XZYA 2LOSA 2MAWA 2YDSA 2QGSA 3DTOA 3O1IA 4JI3T 1YKHB 4PK5A 4WNKA 3KBUA 4JI4T 4C91A 1MNEA 2P9BA 4HWCA 2K3WA 5KMGP 3RYFE 3LK42 3QOFA 4JEHB 4ASKA 3F57A 4GK0E 3RRCA 5LXTE 2CHOA 2HN1A 3VU7H 4U72A 3PUZF 3UQ7A 1I94T 2V6YB 4WBNE 4ISTA 4UVBB 2UU9T 1MNDA 1V9DA 1IJ6A 3GWHA 2Q9QA 2FJAA 4BJMA 5L47A 5HWXA 2OV9A 2V7MA 1HX1B 4EB6E 4YSXA 1IZNB 3Q5WA 4QKNA 2CBIA 3IA3A 4UV9B 1HTJF 2KMFA 3AE9A 5H6QB 4ILUA 3OPCA 3ZMVB 1QUUA 4LFBT 3UU8A 5HXHA 1W0BA 4HWIB 1QLBA 4DV0T 4PFOA 4O4JE 2N1GA 2LSKA 4LFCT 4PJJA 2XQ6A 2WU2A 1KF6A 1HNZT 3PUSA 4AQFC 3OJAA 5JDNA 4DBRA 3VRBA 4JEUB 3TLUA 3ZJ1A 5FL1A 1MIVA 5FNVE 1UK5A 2CE7A 3T1YT 3ETVA 3SFEA 2LKGA 3PU3A 1I6ZA 4PFPA 1FMVA 2YKSA 4IT4A 4JI1T 4YSZA 3I0QA 2WDVA 3I9YA 4LF8T 5LNKA 2WP9A 4H9NC 2BDEA 2BG9E 2CM0A 1T98A 4JI8T 5HXSA 4U31A 1IBMT 5CGMA 2HHHT 4H9OC 4X65T 1WYBA 2XZEA 2BBJA 3RPUA 3VR8A 4HWFA 4QXBB 1XMQT 3AAIA 3ESLA 4ILBA 2J62A 4NUUA 1E2AA 5AFUL 4AIUA 4ZS3A 4IE4A 2WU5A 5LMUT 5AQRB 2WZIA 4G2AA 2UUAT 2WDRA 4DNDA 3PUVF 3R84B 2W63A 3SOLA 3ZYMA 5JDFA 1VCSA 5FY7A 3CQCB 4ERRA 1HS7A 4JBWF 3AE4A 2EHOD 2HPJA 4GKKT 4KX6A 1CHUA 4NUVA 4U2YA 1WCRA 2OA5A 2LHRA 5LBMA 2XQAA 4TUYE 4ZI2D 4ZZBA 4EIWA 2F4VT 3ZCJA 1XDPA 3FB2A 2LM2A 2J4GA 5KXJA 2IDOB 3AEDA 2WQYA 1E7PA 1HFAA 3LK2B 5DJQC 4TWDA 2CMRA 4Z8XA 3FBZA 3Q2MA 2YK0A 5BR8T 4PJLA 2YDRA 2Y48B 2X0YA 1UX4A 3FZLB 5FXVA 3TKLB 3Q5EA 5L3BB 5F5WA 4HFHA 2JQQA 5CA0E 3GN5B 4HGAA 3OTOT 4WW0A 2XY8B 3UTKA 4NXMT 3UUMA 4UIGA 2ZM2A 2LLYA 3JCFA 1N33T 1NAFA 5IUXA 4ZXLA 1O3XA 5HXCA 2DI4A 2C0SA 2XQ3A 1W09A 1UX5A 1J5ET 1BR2A 4OYJA 4GKJT 2XJ7A 4WZXA 5IWAT 2QVAA 3LSVA 5ABFA 4NIQA 2J1DG 3I1AA 1D0XA 2AXDS 1E1HB 2H88A 3ANWB 1LRZA 4EGWA 2FJBA 1ZV4X 5FY1A 4JI5T 2B1EA 5L3GB 2XPKA 3I0OA 2V8SV 4O4IE 2H89A 5AQTB 2NOXA 1MMGA 3AEEA 2J47A 3B57A 2IIUA 1HR0T 2CWOA 4YXDA 3PJAA 2WB5A 4ISSA 4UR9A 4UF0B 2YU1A 3PUAA 4H63V 5FVLA 3TLTA 4JLEA 4QH5A 3ZYLA 1H7CA 2LT3A 5JR9C 3IEEA 4G63A 5JDLA 4DVDA 5AQMB 3AE8A 4DV2T 4U7YA 4DR4T 4QWNB 2BS3A 4IDNA 5LBQB 1D0ZA 1U4QA 4QH4A 2X68A 3ONJA 2EHOA 2WWVA 2K48A 3L09A 5LHIB 1YKEB 2VQET 2ZMAA 1MMNA 2WMOA 2KZ7B 4AQYT 2LSJA 2LJLA 4I4TE 4PK4A 5L3DB 5LJMA 2D5UA 2H3RA 3C51A 3UUXB 3E22E 2XQ7A 5L3FB 1UCUA 4IIJE 2MYSA 5ADXL 2VVSA 5J1GA 4UVAB 2I59A 3S4UA 2DLRA 3F2EA 4OFZA 4L9IA 4DR7T 5LOVE 3P4QA 2XAJB 4LF4T 2VB6A 1OWAA 5TAOA 3AEGA 3CX6B 2V7LA 3G06A 5HXEA 4YY3T 3MJXA 4KHZF 5JH7E 4ZI3C 2BKNA 4X64T 1FIOA 2X0HA 2V26A 3P4PA 2WS3A 3KV4A 2WY2A 4CI2B 2VKJA 4EEDA 3QC9A 3AE3A 3T8OA 2XUEA 2XM2A 3ZKRA 4UVCB 4HE8A 4B3RT 5ETWA 3P4WA 5AQLB 3AE7A 4DR2T 2XQ4A 1FMWA 1LVKA 1MMDA 3KFWX 3RIUC 5ABGA 5C3JA 2UXDT 2IC9A 3ZMZB 3MK7C 5J0ZA 3EHZA 5E0OA 2VL0A 3NVOA 3C98B 2D0TA 2LE8A 4CXYA 2V7JA 3LDQB 1ZEEA 4GK5E 2IW5B 3N9PA 3A5XA 2X0LB 5AQHB 5LYJE 5H6RB 3ZSTA 3J9X1 5HWYA 1HCIA 3KDSE 2LRLA 4L5GA 2BS2A 4PW8A 4ZI3D 1NEKA 1BR0A 3ZN0B 2R6GF 2L8KA 3ZEFB 5FL0A 5BMVE 5LGNB 1W9RA 3T1HT 1JNRA 3CKDA 3LBXA 5JR9B 2ACZA 1R8IA 4A98A 2CA5A 2W66A 3OYZA 3AAEB 1UUSA 4YSYA 4AKHA 5KX5E 2V5CA 1XDOA 3MKDA 2ACXA 2D9DA 2W2UA 3N2KE 3JC6C 3HI2A 4U3CA 1YQ3A 3P4RA 2VASA 3F31A 5L4EA 3AB3B 4Q25A 3EABA 3ONLC 3ZC0A 5HEHA 3RYCE 4HFBA 3VKGA 4IHJE 1XNRT 3OVUA 3AECA 3PJAJ 5ABEA 4EXTA 4LFAT 2NR4A 3JADA 3N9NA 1VCTA 4CN6A 3UQ4A 5JRCA 2A72A 4EZHA 4O2AE 3HR0A 1JNZA 4YHHT 1N34T 2KINB 3D0TA 4TX5A 4QHOA 3K8PC 4ADZA 1AJ3A 4IE6A 2E9XC 3FHNA 2JQHA 2YEVC 1SUMB 3NRYA 2YU2A 2I6HA 2Y8DA 1M62A 2JQ9A 4IDQA 2A3DA 4PJMA 3UU4A 4KI0F 1J5WA 1KFYA 2XAQB 1MIWA 2V6YA 2XAFB 4TV9E 3NBXX 3HKEE 2BBHA 2DWKA 1IBLT 4OX9T 4EV6A 3KVBA 1ZOYA 3UU3A 3A7MA 4P1NA 2XQ9A 4HEAA 2LOPA 2CLYC 4WBOA 3LK3B 3OBVE 4LF6T 4ZEYA 3M65A 4EAHA 4YTPA 2ZLYA 4TWHA 4LMLA 5LG3A 5AQJB 4KP3C 5LGTB 4UEMA 3N2OA 2X9WA 2MPKA 2KWHA 2JMHA 2UXCT 1HX8A 2DHRA 2YDQA 1HNXT 3OYXA 2BVLA 5HEOA 2X66A 4JV5T 4KBMB 4F6RC 4XZCA 4OHFA 2B76A
chains in the Genus database with same CATH topology
1W09A 4IDNA 4IDPA 3Q5EA 1Z8UA 3QNUA 1XZYA 1W0AA 3IA3A 4IDQA 4IDOA 3QOFA 3Q5DA 1Y01A 1W0BA 3OVUA 3X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W09 A;  4IDN A;  4IDP A;  3Q5E A;  1Z8U A;  3QNU A;  1XZY A;  1W0A A;  3IA3 A;  4IDQ A;  4IDO A;  3QOF A;  3Q5D A;  1Y01 A;  1W0B A;  3OVU A;  3X1D A; 
#chains in the Genus database with same CATH topology
 4OYK A;  1MIY A;  2IC6 A;  1KNR A;  3C4Z A;  4AKR B;  5IHY A;  4DUZ T;  4JI2 T;  2BG9 C;  1XNQ T;  4O4L E;  4ANJ A;  4A97 A;  4DV7 T;  2IHR 1;  3FZK B;  1OED E;  4B3S T;  4HFV A;  4X62 T;  3H37 A;  1HNW T;  4B6X A;  3FXE B;  3GMI A;  2X67 A;  5LB7 B;  2LEH A;  1D1C A;  2BKO A;  2NWB A;  4JI6 T;  4P0B A;  4DMV A;  2VKO A;  3N9Q A;  3OKQ A;  3U3I A;  2XQ5 A;  3O9X A;  4CZZ B;  1HG5 A;  2WM9 A;  3BQL A;  2CXD A;  3PUW F;  4KMC A;  2E5V A;  3UFG A;  4AQG A;  2JIW A;  3K1S A;  2DL1 A;  3AVR A;  3CML A;  4NPP A;  2E9X B;  3EVY A;  1Y01 A;  3C64 A;  1N36 T;  2W61 A;  4EOZ B;  3PDY A;  4DR5 T;  1WR0 A;  3PU8 A;  4QH1 A;  3NKZ A;  2JQK A;  2XHE B;  3EDV A;  5LA6 E;  2VK9 A;  2K9A A;  2PJQ A;  3KV5 A;  1WR6 A;  4JYA T;  1L0V A;  3RRW A;  5FKY A;  3Q5X A;  2V7I A;  3RIF A;  3JAF A;  1BR1 A;  4AKL A;  5HXR A;  2D0U A;  2CLY B;  1T72 A;  3X1D A;  3AXJ B;  3IF8 B;  4GYR A;  3GN5 A;  2E2A A;  4PNI A;  2JJ9 A;  3NZP A;  2XAH B;  3FXD B;  4Z91 A;  4KUM B;  1UGO A;  4HFI A;  4GOU A;  2ZM8 A;  5HAX A;  4DID B;  2BS4 A;  4E7S A;  4YFS A;  4I55 E;  4AQF A;  4JI7 T;  5AQS B;  4CXX A;  2HPL A;  3A8Y C;  2Q9Q C;  4TV8 E;  4B3M T;  5AQN B;  5C8Y E;  2W00 A;  3VR9 A;  1FEW A;  4C90 A;  5DQW A;  4HTE A;  2MOZ A;  3ANW A;  2UUC T;  4PJN A;  3DJB A;  4ZOL E;  3EAM A;  1IBK T;  3ZYK A;  5EK2 A;  4TNW A;  2JPF A;  2E5L T;  4IRE A;  1HG2 A;  2HH7 A;  3K3O A;  2BG9 B;  3ZJ2 A;  3ZPO A;  3VKH A;  3UT5 E;  4U33 A;  4EZ4 A;  3N9L A;  3PV0 F;  4A56 A;  3LFM A;  2WSS V;  4LMK A;  2VL8 A;  1EZ3 A;  1S35 A;  3CQG B;  5LG4 A;  4UF0 A;  5CFB A;  4IDO A;  5JDH A;  4HWD A;  2H7O A;  5L3E B;  4O2B E;  5LMN T;  2PFV A;  4CN1 A;  2IUB A;  1G73 A;  4TZ4 C;  3AE1 A;  2VQF T;  3ZMS B;  4IDZ A;  4TN7 B;  3FZH B;  1IAP A;  3RF1 A;  3RKG A;  5CA1 E;  2Q9Q D;  2Z6E A;  4EEB A;  1WYC A;  4DR6 T;  2XQY A;  4F8H A;  2WCA A;  3CWZ B;  4CXW A;  4OK0 A;  2XAG B;  5LCY A;  5CB4 E;  2CCQ A;  3NWI A;  3R6N A;  2VVN A;  5FVK A;  3PUY F;  3GA8 A;  2IAK A;  3PUR A;  2NTY A;  2W4X A;  4KHP T;  2GK9 A;  3J7Y q;  4MFR A;  4DV5 T;  4J2C A;  2WWU A;  4DR3 T;  4HWH A;  1WLX A;  2X9H A;  4X5T A;  2E8I A;  1OED A;  4ZI7 E;  2D2S A;  3TLW A;  5J2T E;  2OLT A;  4I0U A;  3ZLI A;  3PUX F;  4QX7 B;  3CIR A;  1VRB A;  4DUY T;  3E08 A;  2G0U A;  2MTQ A;  4DV3 T;  2XQ8 A;  5JDG A;  4A5X A;  2H7V C;  3B13 A;  4AIS A;  2VWA A;  5FXW A;  4ZZC A;  3E0Z A;  2KND A;  4ILC A;  3UFE A;  5AQF B;  2LSI A;  3PTR B;  3KV9 A;  2LM9 A;  2RPA A;  1Y64 B;  5AQQ B;  1Z0P A;  4LF5 T;  1VOM A;  4AXP A;  2Q9Q B;  2XTL A;  4IL4 A;  2CHN A;  2M6I A;  5HCM A;  3ZC1 A;  3U78 A;  4COF A;  4TWF A;  3Q9D A;  4ZHQ E;  4I50 E;  3O1J A;  5LHH B;  1D0Y A;  5JRC B;  3RX6 A;  5AQG B;  2ZM0 A;  2M67 A;  3UU6 A;  2V5D A;  4IE5 A;  5GON E;  3RLF F;  5EK4 A;  5AQK B;  5FXZ A;  1HF8 A;  3VRA A;  4H63 H;  4YLH A;  3MZK B;  4NXN T;  4YJ2 E;  3AEA A;  4X1K E;  2YOE A;  3AAA B;  2KT9 A;  2IML A;  4MBQ A;  5JDM A;  2VKH A;  3KBT A;  3P8C D;  1CUN A;  1M7K A;  2QRX A;  2DWG A;  3N2G E;  4O4H E;  3W15 B;  3JAE A;  3AA1 B;  3ZSS A;  5JR9 A;  5CJ5 A;  1YXR A;  3I9W A;  5DAB A;  5L3C B;  2A9U A;  2K24 A;  1G8X A;  3DP7 A;  4DV6 T;  4HFE A;  1XMO T;  4O8S A;  5HEU A;  3WI3 A;  2C5K T;  1SA0 E;  2BVM A;  2V1D B;  5L2L A;  3RQU A;  3V5S A;  3AE5 A;  2NW8 A;  1T7S A;  4DMW A;  4AI6 A;  3MXZ A;  4DO0 A;  3WAJ A;  1SHZ C;  3P4S A;  3B5M A;  3RC8 A;  4P09 A;  2ODU A;  2NW9 A;  3JC6 D;  5ABH A;  1GQE A;  5FYM A;  3CK6 A;  3QNU A;  1U5P A;  4YTM A;  3AVS A;  4CN4 A;  2KWI B;  1LKX A;  3RYH E;  3AA6 B;  2L9Q A;  2I0M A;  1ZP0 A;  5HEG A;  3UU5 A;  4BAY B;  3SS1 A;  2PBI A;  1KK7 A;  4FI5 A;  1DU2 A;  3C4X A;  2WMN A;  5L4H A;  1KNP A;  2EHO C;  1SE7 A;  2CWY A;  2PG8 A;  3HKB E;  4IDP A;  5A1L A;  2N9D A;  5AQV B;  2LSY A;  4ZI2 C;  2FBW A;  3H3M A;  3ZMT B;  2E9X D;  4M1P A;  3N9M A;  1J1J A;  1UUR A;  2WZH A;  4HFC A;  1FJG T;  3HKC E;  5FY0 A;  3EDU A;  4X1Y E;  3NZQ A;  3CPZ A;  5JTG A;  3V5U A;  2KLQ A;  3L8R A;  3LG7 A;  2BZB A;  3ZT7 A;  5JDQ A;  4MLK A;  3HL6 A;  2WDQ A;  2RP4 A;  4L0R A;  2MBG A;  3RIU A;  4H9Q C;  2CRB A;  4BJN A;  4YTN A;  2K5B B;  3ABV A;  3AE2 A;  4QX8 B;  4YT0 A;  5C2T A;  1US7 B;  2LSG A;  3BK9 A;  2QYW A;  4YJ3 E;  2ES0 A;  4U2Z A;  2CXL A;  5LJN A;  3NRX A;  2W0G A;  5JRE A;  3CX7 B;  3KV6 A;  4CI3 B;  3QB5 K;  2YN6 A;  4WYV A;  4GIW A;  4H9S E;  2NP9 A;  2LHN A;  3RC3 A;  4EYY R;  3UUB A;  2JMK A;  1D1A A;  1LVF A;  5ABF B;  4U74 A;  3HKD E;  4JI0 T;  2W62 A;  2X9X A;  5HEJ A;  4U7I A;  3ONX A;  2L3L A;  3ZMU B;  2W67 A;  3K3N A;  2QA7 A;  2UXX B;  2YIN A;  3IBP A;  1OED C;  2WBL A;  4BA9 A;  1OXZ A;  4UV8 B;  1WRD A;  2ZM6 T;  2SPC A;  3CQX C;  2UXB T;  4QXH B;  2N2N A;  3P50 A;  5FP3 A;  5LGU B;  2VKD A;  3CX8 B;  4ILA A;  1ZKE A;  2UXN B;  4QXC B;  3RIA A;  5AQI B;  4HN9 A;  3C4W A;  3LJC A;  2XM1 A;  2M6B A;  3AEF A;  3SFD A;  5LHG B;  3BQK A;  5J2U E;  5KDM C;  1KNZ A;  5IYZ E;  4JUY A;  3N9O A;  3P7I A;  1X79 A;  2Y6X A;  2ODV A;  4AKG A;  4MHC A;  1NEN A;  3EI0 A;  2EHO B;  4X1I E;  1Z8U A;  1KEY A;  2E9X A;  3RH3 A;  3QB5 A;  2KXP B;  2CXF A;  1X9B A;  4PAG A;  1YW0 A;  4CI1 B;  4XAX B;  3ZT6 A;  3L3P A;  4DR1 T;  4EYU A;  2LRK A;  4K0U A;  3EUH A;  3ETU A;  3UUN A;  4H9P C;  4IL9 A;  3RKO A;  1S94 A;  5AQP B;  1W0A A;  4TNV A;  2PTF A;  3AA0 B;  3M3Z B;  4IGU A;  3VHL A;  4DBQ A;  4K0K T;  3PUG A;  4MAL A;  2C5I T;  3MAC A;  2UUB T;  1MMA A;  3AXJ A;  4V1A v;  5JQG E;  3RI5 A;  3C50 A;  5LP6 E;  2HN2 A;  3SWH A;  2NW7 A;  2X9Y A;  3H3A A;  4I43 B;  4UEL A;  2CBJ A;  3ZN1 B;  3RGL A;  5AQU B;  2BKP A;  2V6X A;  4B3T T;  5DQV A;  3BQI A;  5M4Y A;  4Z90 A;  3TLS A;  4H9R C;  3ZCI A;  2RA1 A;  4DV4 T;  3RHW A;  3RQW A;  4UXN B;  4XBF B;  3WAK A;  2DNX A;  3PUQ A;  3L39 A;  5F8P A;  3FBL A;  4IE7 A;  3Q5D A;  2XAS B;  2VUR A;  3KIN B;  2LKH A;  3N5L A;  3TLV A;  3PE0 A;  3QUJ A;  1OED B;  2KSR A;  2BG9 A;  3ZT5 A;  4AKI A;  1BR4 A;  2C5J A;  3AA7 B;  3K3Q C;  2XSA A;  3CVR A;  4PK6 A;  2V7K A;  1N32 T;  5JVD E;  2X51 A;  3FZM B;  2FJD A;  1QSD A;  3O4X E;  1ZHC A;  5F3J A;  2XSB A;  4FJO A;  4X20 E;  3UUL A;  4E7Z A;  2A2F X;  3QK6 A;  1IJ5 A;  4IE0 A;  3FZF B;  2DCF A;  3LBX B;  3O1H A;  4N78 D;  2CEA A;  2NTX A;  2WAU A;  3MA9 A;  1B7T A;  3AE6 A;  5HCJ A;  4LF7 T;  1YD8 G;  4DV1 T;  5FXX A;  4X66 T;  2FJE A;  5AQO B;  1D1B A;  4LMJ A;  4ZS2 A;  4LF9 T;  4HFD A;  4P0A A;  1YQ4 A;  4CQI A;  4GYS A;  3HA4 A;  1T8B A;  3RYI E;  1XWM A;  1WFD A;  2CPT A;  2JRK A;  5EK3 A;  2AE9 A;  5FMN A;  1NWM X;  3SRZ A;  4YHJ A;  4HKA A;  3AEB A;  2FUP A;  3KVA A;  5EZY E;  5HYA A;  3IHR A;  1XZY A;  2LOS A;  2MAW A;  2YDS A;  2QGS A;  3DTO A;  3O1I A;  4JI3 T;  1YKH B;  4PK5 A;  4WNK A;  3KBU A;  4JI4 T;  4C91 A;  1MNE A;  2P9B A;  4HWC A;  2K3W A;  5KMG P;  3RYF E;  3LK4 2;  3QOF A;  4JEH B;  4ASK A;  3F57 A;  4GK0 E;  3RRC A;  5LXT E;  2CHO A;  2HN1 A;  3VU7 H;  4U72 A;  3PUZ F;  3UQ7 A;  1I94 T;  2V6Y B;  4WBN E;  4IST A;  4UVB B;  2UU9 T;  1MND A;  1V9D A;  1IJ6 A;  3GWH A;  2Q9Q A;  2FJA A;  4BJM A;  5L47 A;  5HWX A;  2OV9 A;  2V7M A;  1HX1 B;  4EB6 E;  4YSX A;  1IZN B;  3Q5W A;  4QKN A;  2CBI A;  3IA3 A;  4UV9 B;  1HTJ F;  2KMF A;  3AE9 A;  5H6Q B;  4ILU A;  3OPC A;  3ZMV B;  1QUU A;  4LFB T;  3UU8 A;  5HXH A;  1W0B A;  4HWI B;  1QLB A;  4DV0 T;  4PFO A;  4O4J E;  2N1G A;  2LSK A;  4LFC T;  4PJJ A;  2XQ6 A;  2WU2 A;  1KF6 A;  1HNZ T;  3PUS A;  4AQF C;  3OJA A;  5JDN A;  4DBR A;  3VRB A;  4JEU B;  3TLU A;  3ZJ1 A;  5FL1 A;  1MIV A;  5FNV E;  1UK5 A;  2CE7 A;  3T1Y T;  3ETV A;  3SFE A;  2LKG A;  3PU3 A;  1I6Z A;  4PFP A;  1FMV A;  2YKS A;  4IT4 A;  4JI1 T;  4YSZ A;  3I0Q A;  2WDV A;  3I9Y A;  4LF8 T;  5LNK A;  2WP9 A;  4H9N C;  2BDE A;  2BG9 E;  2CM0 A;  1T98 A;  4JI8 T;  5HXS A;  4U31 A;  1IBM T;  5CGM A;  2HHH T;  4H9O C;  4X65 T;  1WYB A;  2XZE A;  2BBJ A;  3RPU A;  3VR8 A;  4HWF A;  4QXB B;  1XMQ T;  3AAI A;  3ESL A;  4ILB A;  2J62 A;  4NUU A;  1E2A A;  5AFU L;  4AIU A;  4ZS3 A;  4IE4 A;  2WU5 A;  5LMU T;  5AQR B;  2WZI A;  4G2A A;  2UUA T;  2WDR A;  4DND A;  3PUV F;  3R84 B;  2W63 A;  3SOL A;  3ZYM A;  5JDF A;  1VCS A;  5FY7 A;  3CQC B;  4ERR A;  1HS7 A;  4JBW F;  3AE4 A;  2EHO D;  2HPJ A;  4GKK T;  4KX6 A;  1CHU A;  4NUV A;  4U2Y A;  1WCR A;  2OA5 A;  2LHR A;  5LBM A;  2XQA A;  4TUY E;  4ZI2 D;  4ZZB A;  4EIW A;  2F4V T;  3ZCJ A;  1XDP A;  3FB2 A;  2LM2 A;  2J4G A;  5KXJ A;  2IDO B;  3AED A;  2WQY A;  1E7P A;  1HFA A;  3LK2 B;  5DJQ C;  4TWD A;  2CMR A;  4Z8X A;  3FBZ A;  3Q2M A;  2YK0 A;  5BR8 T;  4PJL A;  2YDR A;  2Y48 B;  2X0Y A;  1UX4 A;  3FZL B;  5FXV A;  3TKL B;  3Q5E A;  5L3B B;  5F5W A;  4HFH A;  2JQQ A;  5CA0 E;  3GN5 B;  4HGA A;  3OTO T;  4WW0 A;  2XY8 B;  3UTK A;  4NXM T;  3UUM A;  4UIG A;  2ZM2 A;  2LLY A;  3JCF A;  1N33 T;  1NAF A;  5IUX A;  4ZXL A;  1O3X A;  5HXC A;  2DI4 A;  2C0S A;  2XQ3 A;  1W09 A;  1UX5 A;  1J5E T;  1BR2 A;  4OYJ A;  4GKJ T;  2XJ7 A;  4WZX A;  5IWA T;  2QVA A;  3LSV A;  5ABF A;  4NIQ A;  2J1D G;  3I1A A;  1D0X A;  2AXD S;  1E1H B;  2H88 A;  3ANW B;  1LRZ A;  4EGW A;  2FJB A;  1ZV4 X;  5FY1 A;  4JI5 T;  2B1E A;  5L3G B;  2XPK A;  3I0O A;  2V8S V;  4O4I E;  2H89 A;  5AQT B;  2NOX A;  1MMG A;  3AEE A;  2J47 A;  3B57 A;  2IIU A;  1HR0 T;  2CWO A;  4YXD A;  3PJA A;  2WB5 A;  4ISS A;  4UR9 A;  4UF0 B;  2YU1 A;  3PUA A;  4H63 V;  5FVL A;  3TLT A;  4JLE A;  4QH5 A;  3ZYL A;  1H7C A;  2LT3 A;  5JR9 C;  3IEE A;  4G63 A;  5JDL A;  4DVD A;  5AQM B;  3AE8 A;  4DV2 T;  4U7Y A;  4DR4 T;  4QWN B;  2BS3 A;  4IDN A;  5LBQ B;  1D0Z A;  1U4Q A;  4QH4 A;  2X68 A;  3ONJ A;  2EHO A;  2WWV A;  2K48 A;  3L09 A;  5LHI B;  1YKE B;  2VQE T;  2ZMA A;  1MMN A;  2WMO A;  2KZ7 B;  4AQY T;  2LSJ A;  2LJL A;  4I4T E;  4PK4 A;  5L3D B;  5LJM A;  2D5U A;  2H3R A;  3C51 A;  3UUX B;  3E22 E;  2XQ7 A;  5L3F B;  1UCU A;  4IIJ E;  2MYS A;  5ADX L;  2VVS A;  5J1G A;  4UVA B;  2I59 A;  3S4U A;  2DLR A;  3F2E A;  4OFZ A;  4L9I A;  4DR7 T;  5LOV E;  3P4Q A;  2XAJ B;  4LF4 T;  2VB6 A;  1OWA A;  5TAO A;  3AEG A;  3CX6 B;  2V7L A;  3G06 A;  5HXE A;  4YY3 T;  3MJX A;  4KHZ F;  5JH7 E;  4ZI3 C;  2BKN A;  4X64 T;  1FIO A;  2X0H A;  2V26 A;  3P4P A;  2WS3 A;  3KV4 A;  2WY2 A;  4CI2 B;  2VKJ A;  4EED A;  3QC9 A;  3AE3 A;  3T8O A;  2XUE A;  2XM2 A;  3ZKR A;  4UVC B;  4HE8 A;  4B3R T;  5ETW A;  3P4W A;  5AQL B;  3AE7 A;  4DR2 T;  2XQ4 A;  1FMW A;  1LVK A;  1MMD A;  3KFW X;  3RIU C;  5ABG A;  5C3J A;  2UXD T;  2IC9 A;  3ZMZ B;  3MK7 C;  5J0Z A;  3EHZ A;  5E0O A;  2VL0 A;  3NVO A;  3C98 B;  2D0T A;  2LE8 A;  4CXY A;  2V7J A;  3LDQ B;  1ZEE A;  4GK5 E;  2IW5 B;  3N9P A;  3A5X A;  2X0L B;  5AQH B;  5LYJ E;  5H6R B;  3ZST A;  3J9X 1;  5HWY A;  1HCI A;  3KDS E;  2LRL A;  4L5G A;  2BS2 A;  4PW8 A;  4ZI3 D;  1NEK A;  1BR0 A;  3ZN0 B;  2R6G F;  2L8K A;  3ZEF B;  5FL0 A;  5BMV E;  5LGN B;  1W9R A;  3T1H T;  1JNR A;  3CKD A;  3LBX A;  5JR9 B;  2ACZ A;  1R8I A;  4A98 A;  2CA5 A;  2W66 A;  3OYZ A;  3AAE B;  1UUS A;  4YSY A;  4AKH A;  5KX5 E;  2V5C A;  1XDO A;  3MKD A;  2ACX A;  2D9D A;  2W2U A;  3N2K E;  3JC6 C;  3HI2 A;  4U3C A;  1YQ3 A;  3P4R A;  2VAS A;  3F31 A;  5L4E A;  3AB3 B;  4Q25 A;  3EAB A;  3ONL C;  3ZC0 A;  5HEH A;  3RYC E;  4HFB A;  3VKG A;  4IHJ E;  1XNR T;  3OVU A;  3AEC A;  3PJA J;  5ABE A;  4EXT A;  4LFA T;  2NR4 A;  3JAD A;  3N9N A;  1VCT A;  4CN6 A;  3UQ4 A;  5JRC A;  2A72 A;  4EZH A;  4O2A E;  3HR0 A;  1JNZ A;  4YHH T;  1N34 T;  2KIN B;  3D0T A;  4TX5 A;  4QHO A;  3K8P C;  4ADZ A;  1AJ3 A;  4IE6 A;  2E9X C;  3FHN A;  2JQH A;  2YEV C;  1SUM B;  3NRY A;  2YU2 A;  2I6H A;  2Y8D A;  1M62 A;  2JQ9 A;  4IDQ A;  2A3D A;  4PJM A;  3UU4 A;  4KI0 F;  1J5W A;  1KFY A;  2XAQ B;  1MIW A;  2V6Y A;  2XAF B;  4TV9 E;  3NBX X;  3HKE E;  2BBH A;  2DWK A;  1IBL T;  4OX9 T;  4EV6 A;  3KVB A;  1ZOY A;  3UU3 A;  3A7M A;  4P1N A;  2XQ9 A;  4HEA A;  2LOP A;  2CLY C;  4WBO A;  3LK3 B;  3OBV E;  4LF6 T;  4ZEY A;  3M65 A;  4EAH A;  4YTP A;  2ZLY A;  4TWH A;  4LML A;  5LG3 A;  5AQJ B;  4KP3 C;  5LGT B;  4UEM A;  3N2O A;  2X9W A;  2MPK A;  2KWH A;  2JMH A;  2UXC T;  1HX8 A;  2DHR A;  2YDQ A;  1HNX T;  3OYX A;  2BVL A;  5HEO A;  2X66 A;  4JV5 T;  4KBM B;  4F6R C;  4XZC A;  4OHF A;  2B76 A; 
#chains in the Genus database with same CATH homology
 1W09 A;  4IDN A;  4IDP A;  3Q5E A;  1Z8U A;  3QNU A;  1XZY A;  1W0A A;  3IA3 A;  4IDQ A;  4IDO A;  3QOF A;  3Q5D A;  1Y01 A;  1W0B A;  3OVU A;  3X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...