1XZYA

Solution structure of the p30-trans form of alpha hemoglobin stabilizing protein (ahsp)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
90
structure length
90
Chain Sequence
MALLKANKDLISAGLKEFSVLLNQQVFNDPLVSEEDMVTVVEDWMNFYINYYRQQVTGEPQERDKALQELRQELNTLANPFLAKYRDFLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Alpha-hemoglobin stabilizing protein
publication title Molecular mechanism of AHSP-mediated stabilization of alpha-hemoglobin
pubmed doi rcsb
source organism Homo sapiens
total genus 26
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2004-11-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.420 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 AHSP 1xzyA00
3IA3A 4IDNA 1XZYA 3X1DA 3Q5EA 1W09A 3QNUA 3QOFA 3Q5DA 4IDQA 1W0BA 4IDOA 1Z8UA 4IDPA 3OVUA 1W0AA 1Y01A
chains in the Genus database with same CATH superfamily
1ZOYA 3X1DA 2WSSV 3LDQB 4JI0T 3ZJ2A 1U4QA 2NP9A 4YSYA 4HFVA 2MBGA 4DR1T 1FIOA 4XZCA 1T72A 3SFEA 2LSYA 4YT0A 3ZJ1A 2XQ4A 1HR0T 3FXEB 1XZYA 2X9XA 4QH5A 3UU5A 5JVDE 2KWIB 5C3JA 5LNKA 3PUWF 4EEBA 2CMRA 3ONXA 2BVMA 2NW9A 1HCIA 1HG5A 4JBWF 3AAIA 2X9HA 3ZT7A 1QUUA 4ILBA 5J0ZA 4HTEA 2YU2A 2WU5A 3JADA 5HXSA 5F3JA 2Y6XA 1NENA 3ZEFB 3AE3A 1T98A 4BJMA 1D1CA 1BR2A 4AI6A 3L8RA 2YK0A 3I0QA 2V7MA 2E8IA 4PJJA 3TLVA 5KX5E 2ODVA 2LSGA 4UIGA 4ZZCA 4DUYT 5LG3A 5C2TA 3RLFF 2E2AA 3VRBA 1N33T 2HN1A 1HS7A 4OYKA 2HH7A 3QNUA 3I9WA 2NR4A 2L8KA 4QWNB 3LBXB 3AEFA 2N9DA 3EDVA 2W0GA 2W67A 2CXFA 4AXPA 2CHOA 5EZYE 1N36T 3ABVA 4TWFA 3MXZA 4EAHA 2I59A 5GONE 3UU8A 3K8PC 4AQFC 2XQ6A 1OEDC 3RKGA 2H88A 2WBLA 2XM2A 1YQ4A 4L0RA 4P09A 5LMUT 4TNVA 4GKKT 1SE7A 5IUXA 3IEEA 1G73A 3V5UA 4JI1T 1D0XA 2K9AA 4O4JE 3N9OA 3QOFA 1IJ6A 5AQUB 3PJAJ 2NW8A 5J2UE 1WYCA 4LMJA 2L9QA 1Y64B 2WB5A 3LK3B 2X0HA 5FXXA 3MKDA 3LSVA 1OEDE 4AIUA 3CX8B 2XY8B 1WR0A 2Y8DA 4BAYB 4TX5A 1YXRA 5FVKA 3TLWA 5FY1A 4DV3T 4LF9T 3AB3B 2PG8A 5HYAA 2G0UA 4PK5A 4JYAT 4AQGA 5KMGP 1KFYA 5FXVA 1H7CA 2CE7A 3R6NA 5ETWA 4IE6A 1SA0E 4LMLA 2BG9C 2K5BB 3PU3A 4EV6A 3ZT5A 2H3RA 4NXMT 2KLQA 5JDGA 4MFRA 1JNZA 2CXDA 2DCFA 2WAUA 2X9YA 3BQKA 3G06A 3KV5A 1YD8G 3HKDE 3UULA 3P4WA 3E22E 4B3MT 3LFMA 1HX8A 4OYJA 1HF8A 3DP7A 5KXJA 2LKGA 2BG9E 4EB6E 4YY3T 3ZMSB 4LF5T 1Z0PA 5LGNB 3I0OA 4H9NC 4UV8B 2JQQA 4HWIB 4OK0A 1J5ET 4UF0B 4HEAA 4B3RT 3H3AA 4L5GA 2VQET 2JIWA 3ZMUB 2D9DA 5HEUA 4NUVA 2LEHA 4HFDA 3LG7A 2IUBA 5L3DB 5AQJB 3AA6B 2K48A 4HFHA 2D2SA 3AEEA 2YOEA 4CZZB 4ERRA 1HNWT 3EVYA 2MOZA 3P4QA 1E7PA 4YTPA 2WP9A 1G8XA 2LHNA 3N5LA 1L0VA 3CWZB 2UU9T 4E7ZA 4KUMB 2UXDT 3UU6A 2LT3A 3VHLA 3DJBA 3AEBA 3ZN0B 1CUNA 1BR4A 3VU7H 3RRCA 3TLSA 3VRAA 4DR7T 1VOMA 4HFBA 2YN6A 2JQHA 3ZSTA 4JEHB 2M6IA 2UXBT 5HXEA 3TLTA 5EK2A 4O4HE 3HKCE 3UTKA 4LF4T 1T8BA 3LBXA 2BS2A 3UU3A 2VKDA 4NUUA 4LF7T 2CBJA 4DUZT 3CPZA 4PW8A 2ACXA 1J5WA 3CIRA 1ZEEA 2LM9A 4MHCA 2VL0A 5JDHA 2KWHA 2D5UA 3RYCE 2E9XA 5IHYA 4M1PA 4UVBB 3C98B 3R84B 3HA4A 4WBOA 4FJOA 4X1KE 1FJGT 3L09A 4F8HA 5HEGA 5LJNA 3RYFE 3Q5DA 4JEUB 3RYHE 4PFPA 3OTOT 5AQNB 4CN6A 5BMVE 4PNIA 2X51A 3GN5A 4A98A 3QC9A 3CVRA 5DJQC 4UR9A 2BZBA 3GA8A 3UUMA 3CX7B 3PUSA 3UUNA 2A2FX 2XSAA 4HKAA 2VKOA 3RIFA 3EI0A 5JR9A 2HPLA 1WLXA 2YDSA 5HEOA 4DO0A 2M67A 5EK3A 3AAAB 3F31A 4YHHT 1KNZA 2LHRA 2XQAA 3ANWB 4IE5A 4ZI3D 3ZCIA 4XBFB 5FNVE 2FBWA 2LLYA 4OFZA 3RC3A 3NKZA 5KDMC 3BK9A 3FXDB 3A8YC 1HNZT 2VB6A 2IW5B 4KBMB 3KV9A 5HEHA 3N9PA 5LYJE 5AQMB 4DR5T 3PUQA 3ZCJA 2H7VC 5JDNA 4DV6T 5ABGA 2RA1A 3Q5WA 2V8SV 4LF6T 1MIVA 2PBIA 2DHRA 2XJ7A 4EZ4A 4KHPT 1X79A 1HG2A 2JPFA 5CB4E 3AVSA 1UX5A 2FUPA 1VCSA 1XMOT 4ZOLE 1IJ5A 5IWAT 3NRYA 4PAGA 4X1YE 2A9UA 3AE1A 3RIAA 5L3CB 3MZKB 1UUSA 2NTXA 4X1IE 2BKPA 3WI3A 3AE5A 4TNWA 3FBZA 3N9LA 2BKNA 4IDNA 4GIWA 2RP4A 3W15B 4IE0A 2NOXA 4H9OC 2DLRA 1XWMA 2AXDS 3MK7C 4ZI7E 1BR1A 1MIYA 2MTQA 3K1SA 2HHHT 3FZFB 4JI5T 4F6RC 4WYVA 1B7TA 2ZM2A 3N2KE 3RIUC 4Q25A 2ZM0A 2E9XD 4IREA 3AE9A 4I0UA 2V7JA 3RQWA 5JH7E 2FJEA 4H9RC 4BA9A 1XMQT 2GK9A 3PURA 4QX7B 3EUHA 4ZS2A 2V6YB 2VK9A 4TV8E 4BJNA 2CA5A 1S94A 4IDPA 4TZ4C 1T7SA 2ODUA 4IE4A 3H37A 3RX6A 3J9X1 2JMKA 5JTGA 4YJ3E 5ABEA 1X9BA 2C0SA 1EZ3A 2FJDA 1OWAA 3HL6A 3QK6A 2WM9A 3I9YA 3N9MA 4JI3T 5LCYA 5HWYA 4I50E 1KNPA 4DV7T 4O8SA 2KT9A 1GQEA 1QSDA 3CKDA 2JQ9A 4IHJE 2PFVA 4U74A 3KBUA 2ACZA 1I94T 4U33A 3OKQA 4AQYT 2K24A 4ASKA 4CXYA 2LRLA 4U72A 3EHZA 2X68A 3AE2A 1WR6A 2MPKA 3HI2A 3RF1A 1E2AA 3UFEA 4I43B 2JRKA 3PU8A 1FMVA 3T1HT 3KV6A 2LKHA 3AA0B 5HCJA 2VURA 2QYWA 4DV5T 5LHHB 2XZEA 3ANWA 4JI6T 2WDRA 2MAWA 2CXLA 3AXJB 4K0KT 3D0TA 4JI2T 2K3WA 2E9XB 2JMHA 3ZYKA 1BR0A 4NXNT 5CA0E 2DWGA 5FKYA 4U2ZA 2BKOA 3P50A 5CFBA 4IIJE 4C91A 5H6QB 3VR8A 1WYBA 2W62A 4G63A 4HN9A 2XTLA 5DABA 2XQ7A 1XDPA 2IAKA 4HWCA 3GN5B 4YJ2E 1HX1B 3N2OA 3SWHA 2LM2A 3T1YT 5F5WA 4UV9B 2P9BA 5J2TE 3AE7A 1VRBA 1LVFA 3B5MA 5JR9B 2AE9A 1YW0A 3FHNA 4B6XA 3LJCA 5J1GA 2VVSA 4O2AE 4U2YA 4ZI2D 4GK5E 3ZKRA 3KFWX 2EHOA 4G2AA 4H9QC 3ZC1A 4DNDA 2I6HA 3IBPA 2CWOA 2PJQA 2IDOB 3O1HA 4KHZF 4OX9T 2V26A 4AKLA 3PUAA 2YEVC 2KMFA 3MJXA 3ONJA 1E1HB 1DU2A 5FVLA 4I55E 2A72A 4ISSA 4UELA 5AQOB 4X62T 1D0ZA 2JQKA 1KF6A 3P4RA 4ZZBA 3C4XA 4I4TE 4DIDB 3NRXA 5LB7B 3SS1A 2KZ7B 5H6RB 4UVAB 3FZKB 2V6YA 3RI5A 4P0AA 4HGAA 2H7OA 4GOUA 1IBKT 4QXHB 1XDOA 4JLEA 3LK42 2QRXA 4HFEA 3PJAA 5FY0A 5FMNA 1D1AA 4OHFA 5EK4A 5JDFA 2Q9QD 3Q2MA 2X0YA 2PTFA 1IZNB 1WRDA 4DV1T 5LMNT 3ZN1B 3ETUA 3NVOA 4YHJA 3PUGA 1MNEA 2NW7A 4E7SA 3JAEA 2WDVA 5JRCB 4AKIA 5HEJA 4IDOA 4IL9A 1QLBA 3RKOA 2V1DB 1AJ3A 2H89A 2WS3A 4YTMA 4C90A 5FL0A 2L3LA 2ZM8A 3JC6C 3K3QC 3U78A 3AEAA 3QB5K 4H9SE 1YKHB 1MMAA 2QA7A 4GK0E 3O1IA 3IHRA 4TWDA 3HKEE 4B3ST 2BDEA 4HFIA 3ZMVB 4LF8T 3K3OA 5L3EB 3AVRA 3RRWA 2WZIA 5LBMA 2ES0A 4UEMA 5L3GB 5DQWA 4X65T 3BQIA 2CLYB 2BVLA 4ANJA 3MA9A 3AXJA 1YQ3A 3ESLA 4JUYA 1NEKA 1WCRA 3FZLB 2EHOD 4X66T 1LVKA 1U5PA 1HTJF 4EYUA 2J4GA 4IT4A 2X66A 3T8OA 2NWBA 4PK6A 2ZLYA 1VCTA 4Z8XA 3GMIA 3EABA 1HFAA 2DL1A 4CI3B 2XAQB 2Q9QB 1M7KA 1D1BA 5JREA 4HFCA 4KX6A 3UU4A 4ZS3A 4DVDA 2D0TA 2E5LT 4GYRA 2V7IA 3RGLA 3HR0A 4CN1A 4WBNE 3N9NA 5AQVB 4JV5T 4K0UA 1MMGA 3CK6A 4HWDA 4QH1A 3CX6B 3M3ZB 3C50A 1UX4A 4CN4A 4FI5A 2BBHA 4LFCT 3CQGB 4IDQA 1UK5A 3RHWA 3DTOA 5AQHB 1LKXA 2HPJA 3M65A 2J47A 1M62A 5L4HA 2LOPA 2KINB 4CQIA 4EOZB 3E08A 1MIWA 2YDRA 5IYZE 3PTRB 2IIUA 5LHGB 2C5KT 2OA5A 3F57A 3HKBE 1FMWA 2CCQA 3RQUA 4H63V 3K3NA 3AA7B 3Q5XA 1US7B 4CI1B 2W2UA 2UXCT 3Q9DA 2EHOB 4PFOA 3AE8A 4PJMA 3AECA 5JDMA 3FB2A 4AQFA 1OEDA 5AFUL 5C8YE 2V7KA 4P1NA 3KV4A 3PUVF 5JRCA 5L3FB 3OYZA 4QH4A 3WAKA 3P8CD 3TKLB 2XM1A 2WMNA 2E9XC 3ZYLA 5HWXA 4QXBB 4CI2B 4GKJT 4UXNB 3P4SA 4L9IA 3NWIA 4AKHA 4WNKA 3SOLA 5FL1A 1KK7A 5DQVA 1NWMX 3PV0F 5HXRA 1W09A 2VKHA 3KDSE 4ADZA 4PJNA 1N34T 3SRZA 1HNXT 3IA3A 2Y48B 3RH3A 3CQCB 4EYYR 3KINB 5AQTB 4DMVA 2FJAA 5M4YA 3KVAA 3A7MA 1MNDA 2UXXB 4YSZA 2BS4A 1W0BA 2YU1A 3P4PA 4A56A 2ZMAA 2WWUA 2XAGB 2HN2A 1OXZA 5JR9C 2LSJA 2BG9A 2I0MA 4YFSA 2BS3A 1WFDA 3IF8B 4ILUA 3O1JA 1ZHCA 4YSXA 4YXDA 3CMLA 5L3BB 2W66A 4LFAT 3UQ7A 3OYXA 1D0YA 4DR4T 4EGWA 4HWHA 3S4UA 3OBVE 1MMDA 3EAMA 4O4IE 4IGUA 4DR3T 2SPCA 4V1Av 4U7IA 5L47A 3O9XA 4HE8A 4YLHA 2VL8A 5AQPB 4X5TA 4MBQA 2Z6EA 2XSBA 2ZM6T 2Q9QA 5CGMA 1J1JA 3AA1B 4JI8T 4HWFA 2C5IT 3FBLA 3PE0A 4COFA 3NBXX 4ISTA 2WMOA 3VKHA 4JI7T 5AQFB 4AISA 3EDUA 1Y01A 4EEDA 4AKGA 2IC9A 2V5CA 1W0AA 3WAJA 5FYMA 1UURA 4U31A 5ABFA 4EIWA 2UXNB 3J7Yq 1Z8UA 2CPTA 2CBIA 2WCAA 3B13A 5LGUB 2CRBA 2XHEB 4MLKA 4P0BA 4GYSA 3B57A 5LGTB 5L2LA 2N1GA 5HXCA 3OVUA 2CWYA 5CJ5A 1S35A 1I6ZA 5E0OA 3PUXF 4DBQA 4ZI2C 3N9QA 2NTYA 5AQGB 2OLTA 4TWHA 4QHOA 2IMLA 5LA6E 2FJBA 2OV9A 3L39A 3QB5A 5F8PA 5FY7A 4IL4A 4WZXA 2W63A 1SUMB 2CLYC 1MMNA 4IE7A 3C51A 4Z90A 2KSRA 2V6XA 1XNQT 2MYSA 5JDQA 1ZKEA 5AQRB 2W00A 5FXZA 5AQSB 2B76A 2VWAA 4DV4T 4NIQA 4UVCB 1YKEB 1NAFA 2A3DA 4DR6T 4ZEYA 3AE4A 2WQYA 4DV0T 5ADXL 3FZMB 2IC6A 2YDQA 2XQYA 2DNXA 3OPCA 1LRZA 5AQLB 3KVBA 3LK2B 4TN7B 3UQ4A 2WZHA 2DI4A 4N78D 4O2BE 3NZPA 2Q9QC 2LRKA 2XQ5A 3KBTA 1IAPA 3JAFA 3UFGA 2CM0A 4ILAA 1OEDB 3F2EA 2QGSA 2R6GF 1IBLT 2XPKA 5AQKB 4AKRB 4WW0A 4CXXA 2YKSA 4Z91A 2LOSA 3UUBA 4DV2T 3VR9A 3PUYF 4IDZA 4QXCB 4KI0F 5AQQB 2E5VA 3NZQA 3H3MA 2WY2A 4ZXLA 3ZMZB 3MACA 4QKNA 4A97A 5L4EA 3PDYA 5HCMA 2WDQA 2QVAA 3JC6D 2VKJA 2X0LB 3VKGA 2XASB 2V5DA 4PK4A 3I1AA 5JDLA 5FP3A 4CXWA 1SHZC 2KXPB 2RPAA 2CEAA 3PUZF 4JI4T 4DR2T 2BG9B 5HXHA 4X20E 3C64A 1UGOA 4QX8B 2W61A 2EHOC 2B1EA 3RIUA 4DMWA 2M6BA 2DWKA 5AQIB 3Q5EA 5LHIB 3AEGA 2JJ9A 1IBMT 5HAXA 5FXWA 4O4LE 2UUAT 4PJLA 3RPUA 4DBRA 2XAFB 3OJAA 1ZP0A 4XAXB 3RC8A 2XUEA 2X9WA 3QUJA 3ETVA 3TLUA 4YTNA 1KEYA 3JCFA 4KP3C 5CA1E 2N2NA 2V7LA 3FZHB 2WWVA 4TV9E 5TAOA 4ZI3C 2LE8A 4B3TT 4J2CA 3A5XA 3UUXB 2XAHB 5ABFB 2VASA 5LXTE 1JNRA 4LMKA 4EXTA 2D0UA 3ONLC 5LP6E 3AE6A 3SFDA 4EZHA 1CHUA 1N32T 4ZHQE 3O4XE 3AAEB 3C4ZA 2X67A 4H9PC 4ILCA 2LSIA 2XQ9A 2C5JA 5BR8T 3BQLA 1KNRA 3ZT6A 3C4WA 4MALA 2J1DG 3L3PA 1FEWA 1UCUA 2IHR1 3RYIE 2W4XA 3AEDA 3V5SA 5JQGE 4KMCA 2XAJB 5ABHA 2KNDA 3CQXC 2XQ8A 1XNRT 2XQ3A 3GWHA 3ZC0A 2UUCT 1W9RA 2VQFT 3E0ZA 2BBJA 4TUYE 2VVNA 2F4VT 4NPPA 4U7YA 2J62A 3ZYMA 4UF0A 2UUBT 1ZV4X 4X64T 3U3IA 4A5XA 2LJLA 1O3XA 5A1LA 3ZPOA 5LJMA 2LSKA 2WU2A 3ZMTB 5LG4A 5LBQB 4H63H 5LOVE 3P7IA 2CHNA 3UT5E 4U3CA 3N2GE 1V9DA 2YINA 4LFBT 1R8IA 3ZLIA 3ZSSA
chains in the Genus database with same CATH topology
3IA3A 4IDNA 1XZYA 3X1DA 3Q5EA 1W09A 3QNUA 3QOFA 3Q5DA 4IDQA 1W0BA 4IDOA 1Z8UA 4IDPA 3OVUA 1W0AA 1Y01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IA3 A;  4IDN A;  1XZY A;  3X1D A;  3Q5E A;  1W09 A;  3QNU A;  3QOF A;  3Q5D A;  4IDQ A;  1W0B A;  4IDO A;  1Z8U A;  4IDP A;  3OVU A;  1W0A A;  1Y01 A; 
#chains in the Genus database with same CATH topology
 1ZOY A;  3X1D A;  2WSS V;  3LDQ B;  4JI0 T;  3ZJ2 A;  1U4Q A;  2NP9 A;  4YSY A;  4HFV A;  2MBG A;  4DR1 T;  1FIO A;  4XZC A;  1T72 A;  3SFE A;  2LSY A;  4YT0 A;  3ZJ1 A;  2XQ4 A;  1HR0 T;  3FXE B;  1XZY A;  2X9X A;  4QH5 A;  3UU5 A;  5JVD E;  2KWI B;  5C3J A;  5LNK A;  3PUW F;  4EEB A;  2CMR A;  3ONX A;  2BVM A;  2NW9 A;  1HCI A;  1HG5 A;  4JBW F;  3AAI A;  2X9H A;  3ZT7 A;  1QUU A;  4ILB A;  5J0Z A;  4HTE A;  2YU2 A;  2WU5 A;  3JAD A;  5HXS A;  5F3J A;  2Y6X A;  1NEN A;  3ZEF B;  3AE3 A;  1T98 A;  4BJM A;  1D1C A;  1BR2 A;  4AI6 A;  3L8R A;  2YK0 A;  3I0Q A;  2V7M A;  2E8I A;  4PJJ A;  3TLV A;  5KX5 E;  2ODV A;  2LSG A;  4UIG A;  4ZZC A;  4DUY T;  5LG3 A;  5C2T A;  3RLF F;  2E2A A;  3VRB A;  1N33 T;  2HN1 A;  1HS7 A;  4OYK A;  2HH7 A;  3QNU A;  3I9W A;  2NR4 A;  2L8K A;  4QWN B;  3LBX B;  3AEF A;  2N9D A;  3EDV A;  2W0G A;  2W67 A;  2CXF A;  4AXP A;  2CHO A;  5EZY E;  1N36 T;  3ABV A;  4TWF A;  3MXZ A;  4EAH A;  2I59 A;  5GON E;  3UU8 A;  3K8P C;  4AQF C;  2XQ6 A;  1OED C;  3RKG A;  2H88 A;  2WBL A;  2XM2 A;  1YQ4 A;  4L0R A;  4P09 A;  5LMU T;  4TNV A;  4GKK T;  1SE7 A;  5IUX A;  3IEE A;  1G73 A;  3V5U A;  4JI1 T;  1D0X A;  2K9A A;  4O4J E;  3N9O A;  3QOF A;  1IJ6 A;  5AQU B;  3PJA J;  2NW8 A;  5J2U E;  1WYC A;  4LMJ A;  2L9Q A;  1Y64 B;  2WB5 A;  3LK3 B;  2X0H A;  5FXX A;  3MKD A;  3LSV A;  1OED E;  4AIU A;  3CX8 B;  2XY8 B;  1WR0 A;  2Y8D A;  4BAY B;  4TX5 A;  1YXR A;  5FVK A;  3TLW A;  5FY1 A;  4DV3 T;  4LF9 T;  3AB3 B;  2PG8 A;  5HYA A;  2G0U A;  4PK5 A;  4JYA T;  4AQG A;  5KMG P;  1KFY A;  5FXV A;  1H7C A;  2CE7 A;  3R6N A;  5ETW A;  4IE6 A;  1SA0 E;  4LML A;  2BG9 C;  2K5B B;  3PU3 A;  4EV6 A;  3ZT5 A;  2H3R A;  4NXM T;  2KLQ A;  5JDG A;  4MFR A;  1JNZ A;  2CXD A;  2DCF A;  2WAU A;  2X9Y A;  3BQK A;  3G06 A;  3KV5 A;  1YD8 G;  3HKD E;  3UUL A;  3P4W A;  3E22 E;  4B3M T;  3LFM A;  1HX8 A;  4OYJ A;  1HF8 A;  3DP7 A;  5KXJ A;  2LKG A;  2BG9 E;  4EB6 E;  4YY3 T;  3ZMS B;  4LF5 T;  1Z0P A;  5LGN B;  3I0O A;  4H9N C;  4UV8 B;  2JQQ A;  4HWI B;  4OK0 A;  1J5E T;  4UF0 B;  4HEA A;  4B3R T;  3H3A A;  4L5G A;  2VQE T;  2JIW A;  3ZMU B;  2D9D A;  5HEU A;  4NUV A;  2LEH A;  4HFD A;  3LG7 A;  2IUB A;  5L3D B;  5AQJ B;  3AA6 B;  2K48 A;  4HFH A;  2D2S A;  3AEE A;  2YOE A;  4CZZ B;  4ERR A;  1HNW T;  3EVY A;  2MOZ A;  3P4Q A;  1E7P A;  4YTP A;  2WP9 A;  1G8X A;  2LHN A;  3N5L A;  1L0V A;  3CWZ B;  2UU9 T;  4E7Z A;  4KUM B;  2UXD T;  3UU6 A;  2LT3 A;  3VHL A;  3DJB A;  3AEB A;  3ZN0 B;  1CUN A;  1BR4 A;  3VU7 H;  3RRC A;  3TLS A;  3VRA A;  4DR7 T;  1VOM A;  4HFB A;  2YN6 A;  2JQH A;  3ZST A;  4JEH B;  2M6I A;  2UXB T;  5HXE A;  3TLT A;  5EK2 A;  4O4H E;  3HKC E;  3UTK A;  4LF4 T;  1T8B A;  3LBX A;  2BS2 A;  3UU3 A;  2VKD A;  4NUU A;  4LF7 T;  2CBJ A;  4DUZ T;  3CPZ A;  4PW8 A;  2ACX A;  1J5W A;  3CIR A;  1ZEE A;  2LM9 A;  4MHC A;  2VL0 A;  5JDH A;  2KWH A;  2D5U A;  3RYC E;  2E9X A;  5IHY A;  4M1P A;  4UVB B;  3C98 B;  3R84 B;  3HA4 A;  4WBO A;  4FJO A;  4X1K E;  1FJG T;  3L09 A;  4F8H A;  5HEG A;  5LJN A;  3RYF E;  3Q5D A;  4JEU B;  3RYH E;  4PFP A;  3OTO T;  5AQN B;  4CN6 A;  5BMV E;  4PNI A;  2X51 A;  3GN5 A;  4A98 A;  3QC9 A;  3CVR A;  5DJQ C;  4UR9 A;  2BZB A;  3GA8 A;  3UUM A;  3CX7 B;  3PUS A;  3UUN A;  2A2F X;  2XSA A;  4HKA A;  2VKO A;  3RIF A;  3EI0 A;  5JR9 A;  2HPL A;  1WLX A;  2YDS A;  5HEO A;  4DO0 A;  2M67 A;  5EK3 A;  3AAA B;  3F31 A;  4YHH T;  1KNZ A;  2LHR A;  2XQA A;  3ANW B;  4IE5 A;  4ZI3 D;  3ZCI A;  4XBF B;  5FNV E;  2FBW A;  2LLY A;  4OFZ A;  3RC3 A;  3NKZ A;  5KDM C;  3BK9 A;  3FXD B;  3A8Y C;  1HNZ T;  2VB6 A;  2IW5 B;  4KBM B;  3KV9 A;  5HEH A;  3N9P A;  5LYJ E;  5AQM B;  4DR5 T;  3PUQ A;  3ZCJ A;  2H7V C;  5JDN A;  4DV6 T;  5ABG A;  2RA1 A;  3Q5W A;  2V8S V;  4LF6 T;  1MIV A;  2PBI A;  2DHR A;  2XJ7 A;  4EZ4 A;  4KHP T;  1X79 A;  1HG2 A;  2JPF A;  5CB4 E;  3AVS A;  1UX5 A;  2FUP A;  1VCS A;  1XMO T;  4ZOL E;  1IJ5 A;  5IWA T;  3NRY A;  4PAG A;  4X1Y E;  2A9U A;  3AE1 A;  3RIA A;  5L3C B;  3MZK B;  1UUS A;  2NTX A;  4X1I E;  2BKP A;  3WI3 A;  3AE5 A;  4TNW A;  3FBZ A;  3N9L A;  2BKN A;  4IDN A;  4GIW A;  2RP4 A;  3W15 B;  4IE0 A;  2NOX A;  4H9O C;  2DLR A;  1XWM A;  2AXD S;  3MK7 C;  4ZI7 E;  1BR1 A;  1MIY A;  2MTQ A;  3K1S A;  2HHH T;  3FZF B;  4JI5 T;  4F6R C;  4WYV A;  1B7T A;  2ZM2 A;  3N2K E;  3RIU C;  4Q25 A;  2ZM0 A;  2E9X D;  4IRE A;  3AE9 A;  4I0U A;  2V7J A;  3RQW A;  5JH7 E;  2FJE A;  4H9R C;  4BA9 A;  1XMQ T;  2GK9 A;  3PUR A;  4QX7 B;  3EUH A;  4ZS2 A;  2V6Y B;  2VK9 A;  4TV8 E;  4BJN A;  2CA5 A;  1S94 A;  4IDP A;  4TZ4 C;  1T7S A;  2ODU A;  4IE4 A;  3H37 A;  3RX6 A;  3J9X 1;  2JMK A;  5JTG A;  4YJ3 E;  5ABE A;  1X9B A;  2C0S A;  1EZ3 A;  2FJD A;  1OWA A;  3HL6 A;  3QK6 A;  2WM9 A;  3I9Y A;  3N9M A;  4JI3 T;  5LCY A;  5HWY A;  4I50 E;  1KNP A;  4DV7 T;  4O8S A;  2KT9 A;  1GQE A;  1QSD A;  3CKD A;  2JQ9 A;  4IHJ E;  2PFV A;  4U74 A;  3KBU A;  2ACZ A;  1I94 T;  4U33 A;  3OKQ A;  4AQY T;  2K24 A;  4ASK A;  4CXY A;  2LRL A;  4U72 A;  3EHZ A;  2X68 A;  3AE2 A;  1WR6 A;  2MPK A;  3HI2 A;  3RF1 A;  1E2A A;  3UFE A;  4I43 B;  2JRK A;  3PU8 A;  1FMV A;  3T1H T;  3KV6 A;  2LKH A;  3AA0 B;  5HCJ A;  2VUR A;  2QYW A;  4DV5 T;  5LHH B;  2XZE A;  3ANW A;  4JI6 T;  2WDR A;  2MAW A;  2CXL A;  3AXJ B;  4K0K T;  3D0T A;  4JI2 T;  2K3W A;  2E9X B;  2JMH A;  3ZYK A;  1BR0 A;  4NXN T;  5CA0 E;  2DWG A;  5FKY A;  4U2Z A;  2BKO A;  3P50 A;  5CFB A;  4IIJ E;  4C91 A;  5H6Q B;  3VR8 A;  1WYB A;  2W62 A;  4G63 A;  4HN9 A;  2XTL A;  5DAB A;  2XQ7 A;  1XDP A;  2IAK A;  4HWC A;  3GN5 B;  4YJ2 E;  1HX1 B;  3N2O A;  3SWH A;  2LM2 A;  3T1Y T;  5F5W A;  4UV9 B;  2P9B A;  5J2T E;  3AE7 A;  1VRB A;  1LVF A;  3B5M A;  5JR9 B;  2AE9 A;  1YW0 A;  3FHN A;  4B6X A;  3LJC A;  5J1G A;  2VVS A;  4O2A E;  4U2Y A;  4ZI2 D;  4GK5 E;  3ZKR A;  3KFW X;  2EHO A;  4G2A A;  4H9Q C;  3ZC1 A;  4DND A;  2I6H A;  3IBP A;  2CWO A;  2PJQ A;  2IDO B;  3O1H A;  4KHZ F;  4OX9 T;  2V26 A;  4AKL A;  3PUA A;  2YEV C;  2KMF A;  3MJX A;  3ONJ A;  1E1H B;  1DU2 A;  5FVL A;  4I55 E;  2A72 A;  4ISS A;  4UEL A;  5AQO B;  4X62 T;  1D0Z A;  2JQK A;  1KF6 A;  3P4R A;  4ZZB A;  3C4X A;  4I4T E;  4DID B;  3NRX A;  5LB7 B;  3SS1 A;  2KZ7 B;  5H6R B;  4UVA B;  3FZK B;  2V6Y A;  3RI5 A;  4P0A A;  4HGA A;  2H7O A;  4GOU A;  1IBK T;  4QXH B;  1XDO A;  4JLE A;  3LK4 2;  2QRX A;  4HFE A;  3PJA A;  5FY0 A;  5FMN A;  1D1A A;  4OHF A;  5EK4 A;  5JDF A;  2Q9Q D;  3Q2M A;  2X0Y A;  2PTF A;  1IZN B;  1WRD A;  4DV1 T;  5LMN T;  3ZN1 B;  3ETU A;  3NVO A;  4YHJ A;  3PUG A;  1MNE A;  2NW7 A;  4E7S A;  3JAE A;  2WDV A;  5JRC B;  4AKI A;  5HEJ A;  4IDO A;  4IL9 A;  1QLB A;  3RKO A;  2V1D B;  1AJ3 A;  2H89 A;  2WS3 A;  4YTM A;  4C90 A;  5FL0 A;  2L3L A;  2ZM8 A;  3JC6 C;  3K3Q C;  3U78 A;  3AEA A;  3QB5 K;  4H9S E;  1YKH B;  1MMA A;  2QA7 A;  4GK0 E;  3O1I A;  3IHR A;  4TWD A;  3HKE E;  4B3S T;  2BDE A;  4HFI A;  3ZMV B;  4LF8 T;  3K3O A;  5L3E B;  3AVR A;  3RRW A;  2WZI A;  5LBM A;  2ES0 A;  4UEM A;  5L3G B;  5DQW A;  4X65 T;  3BQI A;  2CLY B;  2BVL A;  4ANJ A;  3MA9 A;  3AXJ A;  1YQ3 A;  3ESL A;  4JUY A;  1NEK A;  1WCR A;  3FZL B;  2EHO D;  4X66 T;  1LVK A;  1U5P A;  1HTJ F;  4EYU A;  2J4G A;  4IT4 A;  2X66 A;  3T8O A;  2NWB A;  4PK6 A;  2ZLY A;  1VCT A;  4Z8X A;  3GMI A;  3EAB A;  1HFA A;  2DL1 A;  4CI3 B;  2XAQ B;  2Q9Q B;  1M7K A;  1D1B A;  5JRE A;  4HFC A;  4KX6 A;  3UU4 A;  4ZS3 A;  4DVD A;  2D0T A;  2E5L T;  4GYR A;  2V7I A;  3RGL A;  3HR0 A;  4CN1 A;  4WBN E;  3N9N A;  5AQV B;  4JV5 T;  4K0U A;  1MMG A;  3CK6 A;  4HWD A;  4QH1 A;  3CX6 B;  3M3Z B;  3C50 A;  1UX4 A;  4CN4 A;  4FI5 A;  2BBH A;  4LFC T;  3CQG B;  4IDQ A;  1UK5 A;  3RHW A;  3DTO A;  5AQH B;  1LKX A;  2HPJ A;  3M65 A;  2J47 A;  1M62 A;  5L4H A;  2LOP A;  2KIN B;  4CQI A;  4EOZ B;  3E08 A;  1MIW A;  2YDR A;  5IYZ E;  3PTR B;  2IIU A;  5LHG B;  2C5K T;  2OA5 A;  3F57 A;  3HKB E;  1FMW A;  2CCQ A;  3RQU A;  4H63 V;  3K3N A;  3AA7 B;  3Q5X A;  1US7 B;  4CI1 B;  2W2U A;  2UXC T;  3Q9D A;  2EHO B;  4PFO A;  3AE8 A;  4PJM A;  3AEC A;  5JDM A;  3FB2 A;  4AQF A;  1OED A;  5AFU L;  5C8Y E;  2V7K A;  4P1N A;  3KV4 A;  3PUV F;  5JRC A;  5L3F B;  3OYZ A;  4QH4 A;  3WAK A;  3P8C D;  3TKL B;  2XM1 A;  2WMN A;  2E9X C;  3ZYL A;  5HWX A;  4QXB B;  4CI2 B;  4GKJ T;  4UXN B;  3P4S A;  4L9I A;  3NWI A;  4AKH A;  4WNK A;  3SOL A;  5FL1 A;  1KK7 A;  5DQV A;  1NWM X;  3PV0 F;  5HXR A;  1W09 A;  2VKH A;  3KDS E;  4ADZ A;  4PJN A;  1N34 T;  3SRZ A;  1HNX T;  3IA3 A;  2Y48 B;  3RH3 A;  3CQC B;  4EYY R;  3KIN B;  5AQT B;  4DMV A;  2FJA A;  5M4Y A;  3KVA A;  3A7M A;  1MND A;  2UXX B;  4YSZ A;  2BS4 A;  1W0B A;  2YU1 A;  3P4P A;  4A56 A;  2ZMA A;  2WWU A;  2XAG B;  2HN2 A;  1OXZ A;  5JR9 C;  2LSJ A;  2BG9 A;  2I0M A;  4YFS A;  2BS3 A;  1WFD A;  3IF8 B;  4ILU A;  3O1J A;  1ZHC A;  4YSX A;  4YXD A;  3CML A;  5L3B B;  2W66 A;  4LFA T;  3UQ7 A;  3OYX A;  1D0Y A;  4DR4 T;  4EGW A;  4HWH A;  3S4U A;  3OBV E;  1MMD A;  3EAM A;  4O4I E;  4IGU A;  4DR3 T;  2SPC A;  4V1A v;  4U7I A;  5L47 A;  3O9X A;  4HE8 A;  4YLH A;  2VL8 A;  5AQP B;  4X5T A;  4MBQ A;  2Z6E A;  2XSB A;  2ZM6 T;  2Q9Q A;  5CGM A;  1J1J A;  3AA1 B;  4JI8 T;  4HWF A;  2C5I T;  3FBL A;  3PE0 A;  4COF A;  3NBX X;  4IST A;  2WMO A;  3VKH A;  4JI7 T;  5AQF B;  4AIS A;  3EDU A;  1Y01 A;  4EED A;  4AKG A;  2IC9 A;  2V5C A;  1W0A A;  3WAJ A;  5FYM A;  1UUR A;  4U31 A;  5ABF A;  4EIW A;  2UXN B;  3J7Y q;  1Z8U A;  2CPT A;  2CBI A;  2WCA A;  3B13 A;  5LGU B;  2CRB A;  2XHE B;  4MLK A;  4P0B A;  4GYS A;  3B57 A;  5LGT B;  5L2L A;  2N1G A;  5HXC A;  3OVU A;  2CWY A;  5CJ5 A;  1S35 A;  1I6Z A;  5E0O A;  3PUX F;  4DBQ A;  4ZI2 C;  3N9Q A;  2NTY A;  5AQG B;  2OLT A;  4TWH A;  4QHO A;  2IML A;  5LA6 E;  2FJB A;  2OV9 A;  3L39 A;  3QB5 A;  5F8P A;  5FY7 A;  4IL4 A;  4WZX A;  2W63 A;  1SUM B;  2CLY C;  1MMN A;  4IE7 A;  3C51 A;  4Z90 A;  2KSR A;  2V6X A;  1XNQ T;  2MYS A;  5JDQ A;  1ZKE A;  5AQR B;  2W00 A;  5FXZ A;  5AQS B;  2B76 A;  2VWA A;  4DV4 T;  4NIQ A;  4UVC B;  1YKE B;  1NAF A;  2A3D A;  4DR6 T;  4ZEY A;  3AE4 A;  2WQY A;  4DV0 T;  5ADX L;  3FZM B;  2IC6 A;  2YDQ A;  2XQY A;  2DNX A;  3OPC A;  1LRZ A;  5AQL B;  3KVB A;  3LK2 B;  4TN7 B;  3UQ4 A;  2WZH A;  2DI4 A;  4N78 D;  4O2B E;  3NZP A;  2Q9Q C;  2LRK A;  2XQ5 A;  3KBT A;  1IAP A;  3JAF A;  3UFG A;  2CM0 A;  4ILA A;  1OED B;  3F2E A;  2QGS A;  2R6G F;  1IBL T;  2XPK A;  5AQK B;  4AKR B;  4WW0 A;  4CXX A;  2YKS A;  4Z91 A;  2LOS A;  3UUB A;  4DV2 T;  3VR9 A;  3PUY F;  4IDZ A;  4QXC B;  4KI0 F;  5AQQ B;  2E5V A;  3NZQ A;  3H3M A;  2WY2 A;  4ZXL A;  3ZMZ B;  3MAC A;  4QKN A;  4A97 A;  5L4E A;  3PDY A;  5HCM A;  2WDQ A;  2QVA A;  3JC6 D;  2VKJ A;  2X0L B;  3VKG A;  2XAS B;  2V5D A;  4PK4 A;  3I1A A;  5JDL A;  5FP3 A;  4CXW A;  1SHZ C;  2KXP B;  2RPA A;  2CEA A;  3PUZ F;  4JI4 T;  4DR2 T;  2BG9 B;  5HXH A;  4X20 E;  3C64 A;  1UGO A;  4QX8 B;  2W61 A;  2EHO C;  2B1E A;  3RIU A;  4DMW A;  2M6B A;  2DWK A;  5AQI B;  3Q5E A;  5LHI B;  3AEG A;  2JJ9 A;  1IBM T;  5HAX A;  5FXW A;  4O4L E;  2UUA T;  4PJL A;  3RPU A;  4DBR A;  2XAF B;  3OJA A;  1ZP0 A;  4XAX B;  3RC8 A;  2XUE A;  2X9W A;  3QUJ A;  3ETV A;  3TLU A;  4YTN A;  1KEY A;  3JCF A;  4KP3 C;  5CA1 E;  2N2N A;  2V7L A;  3FZH B;  2WWV A;  4TV9 E;  5TAO A;  4ZI3 C;  2LE8 A;  4B3T T;  4J2C A;  3A5X A;  3UUX B;  2XAH B;  5ABF B;  2VAS A;  5LXT E;  1JNR A;  4LMK A;  4EXT A;  2D0U A;  3ONL C;  5LP6 E;  3AE6 A;  3SFD A;  4EZH A;  1CHU A;  1N32 T;  4ZHQ E;  3O4X E;  3AAE B;  3C4Z A;  2X67 A;  4H9P C;  4ILC A;  2LSI A;  2XQ9 A;  2C5J A;  5BR8 T;  3BQL A;  1KNR A;  3ZT6 A;  3C4W A;  4MAL A;  2J1D G;  3L3P A;  1FEW A;  1UCU A;  2IHR 1;  3RYI E;  2W4X A;  3AED A;  3V5S A;  5JQG E;  4KMC A;  2XAJ B;  5ABH A;  2KND A;  3CQX C;  2XQ8 A;  1XNR T;  2XQ3 A;  3GWH A;  3ZC0 A;  2UUC T;  1W9R A;  2VQF T;  3E0Z A;  2BBJ A;  4TUY E;  2VVN A;  2F4V T;  4NPP A;  4U7Y A;  2J62 A;  3ZYM A;  4UF0 A;  2UUB T;  1ZV4 X;  4X64 T;  3U3I A;  4A5X A;  2LJL A;  1O3X A;  5A1L A;  3ZPO A;  5LJM A;  2LSK A;  2WU2 A;  3ZMT B;  5LG4 A;  5LBQ B;  4H63 H;  5LOV E;  3P7I A;  2CHN A;  3UT5 E;  4U3C A;  3N2G E;  1V9D A;  2YIN A;  4LFB T;  1R8I A;  3ZLI A;  3ZSS A; 
#chains in the Genus database with same CATH homology
 3IA3 A;  4IDN A;  1XZY A;  3X1D A;  3Q5E A;  1W09 A;  3QNU A;  3QOF A;  3Q5D A;  4IDQ A;  1W0B A;  4IDO A;  1Z8U A;  4IDP A;  3OVU A;  1W0A A;  1Y01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...