1N36T

Structure of the thermus thermophilus 30s ribosomal subunit in the presence of crystallographically disordered codon and near-cognate transfer rna anticodon stem-loop mismatched at the second codon position
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Selection of tRNA by the Ribosome Requires a Transition from an Open to a Closed Form
pubmed doi rcsb
total genus 33
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2002-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 1n36T00
1XNQT 4JI4T 4DR1T 2UUAT 2F4VT 4K0KT 1HNXT 2UXBT 5LMNT 1IBLT 1HR0T 5IWAT 4YY3T 1IBMT 4JI2T 4LF9T 4LFBT 4JI0T 2UUBT 5LMUT 4OX9T 2UXDT 4DV3T 3T1YT 1HNZT 1N34T 4DV2T 2HHHT 4DV1T 4JI7T 1FJGT 4DR2T 3OTOT 2VQFT 4DR6T 4DV5T 3T1HT 1N36T 4JI1T 4LF6T 4B3ST 4JI8T 4LF4T 4NXMT 4GKKT 4DV0T 4LF7T 4DR7T 4JV5T 4DUZT 4B3MT 4DV7T 4DR3T 4JYAT 4LF8T 4X65T 4X66T 4LFAT 2ZM6T 4LFCT 2UXCT 1HNWT 4B3RT 5BR8T 4JI3T 4NXNT 4JI6T 4YHHT 4GKJT 1N33T 1XMOT 2UUCT 1I94T 2UU9T 2E5LT 4LF5T 4DR4T 1J5ET 4DR5T 4AQYT 4B3TT 1XMQT 1XNRT 2VQET 4DV6T 4X64T 1N32T 4X62T 4JI5T 4KHPT 4DUYT 1IBKT 4DV4T
chains in the Genus database with same CATH superfamily
4DR1T 2XASB 2WDRA 4K0KT 3SOLA 2BS3A 3J9X1 4CI2B 3ESLA 3UFEA 4YJ3E 3N9LA 4LMLA 3P8CD 1FEWA 4LFBT 1WRDA 3AE3A 4NPPA 5FXWA 2CRBA 2OV9A 4HWHA 1LRZA 5LCYA 5GONE 4U74A 3AEBA 5FKYA 4IDNA 5ABFA 2KINB 5L4EA 4LMJA 2V7KA 2XZEA 2X9WA 1V9DA 4LF4T 1KNPA 2VASA 2WCAA 1U5PA 4I4TE 3GN5B 4E7SA 2PBIA 1M7KA 3NRXA 4OYKA 4ILAA 2BS4A 3F57A 3ZN1B 2MBGA 5AQVB 4HFVA 4EZ4A 4XAXB 3I9WA 4YHHT 3P4PA 2WAUA 2YK0A 1J5ET 2LSYA 3NRYA 3O1IA 5LBQB 4OHFA 2VL0A 3RX6A 4L5GA 4KMCA 3OJAA 1ZEEA 4X1IE 3UUBA 3RPUA 4MALA 5CGMA 2UXBT 2W2UA 4DMVA 3AE1A 5JREA 5C8YE 3PUSA 3TLWA 2LOPA 2E9XA 3AEFA 4EOZB 1SUMB 2ODUA 2L9QA 1D1AA 2V5CA 5HXSA 3PURA 4ANJA 3O4XE 4BJNA 2XQ5A 2OLTA 3ONXA 4PK5A 3ZEFB 4AXPA 3ZKRA 2FJBA 2D5UA 2XJ7A 2JIWA 2NR4A 1O3XA 3AVRA 2YDSA 5LG4A 2BKOA 5AQOB 4WNKA 4GYSA 3OYXA 2UXCT 4I55E 2JQ9A 2YN6A 3WAJA 1EZ3A 1HX8A 4IDOA 5HEHA 3AB3B 3SFDA 3AA0B 3M3ZB 4ASKA 2XAQB 2BVLA 1UK5A 3FHNA 4Q25A 4AKHA 3LDQB 3ZMTB 4C90A 3EHZA 3UUMA 5LHIB 1US7B 3I0QA 4DR5T 5HYAA 3HKCE 4QH5A 3ZCJA 4GK0E 5E0OA 3CKDA 2YOEA 2RPAA 2JMKA 2XQYA 2NTYA 3SS1A 1W0BA 4PNIA 2JJ9A 1MNEA 2NW9A 3KFWX 4ZS2A 4AQGA 5ABHA 3DJBA 3K3QC 1W09A 1UCUA 3FXEB 2XQ6A 4PJNA 5LJMA 1MMDA 2CLYB 4AKRB 3L8RA 5FY0A 3EAMA 2MYSA 1ZKEA 4X20E 4JI8T 2WM9A 1YD8G 4NXMT 2W67A 4LF7T 1HTJF 4WZXA 4DUZT 1LKXA 2G0UA 4DR3T 1IAPA 5HAXA 1NENA 2YU2A 2IMLA 3HKEE 3AE6A 5CA1E 3ONLC 3HA4A 4UF0B 4AISA 4JI6T 2CWOA 4O8SA 2A3DA 2JPFA 2UUCT 3C4ZA 2E5LT 5IYZE 3TLTA 1MIYA 2X9HA 5F5WA 4QXCB 2DNXA 2KWHA 3N2GE 2E9XB 1HS7A 5ABEA 5JR9C 5AQSB 4BA9A 1T8BA 3P50A 2A72A 4CZZB 1QSDA 3NZPA 4P0AA 4AQFA 3V5UA 4HFCA 2AE9A 3K8PC 2EHOC 3H37A 4X1KE 1BR2A 1E7PA 1YKEB 3VR9A 4HFIA 2PFVA 2WQYA 1WCRA 5A1LA 2KXPB 5FXVA 2D9DA 5H6RB 5ABGA 4U31A 3QUJA 5ETWA 2QVAA 2HHHT 5KXJA 2J1DG 2V6YB 3D0TA 5L3EB 4LF6T 4AI6A 2DL1A 4QXHB 3KV5A 3DTOA 5AQFB 2BVMA 2V5DA 4TWHA 3N9PA 3OKQA 5HCJA 2HPJA 2IAKA 5F3JA 3ETVA 5H6QB 2XHEB 2W61A 2XQ4A 4HWFA 1HNWT 3UU4A 2I6HA 4K0UA 5BR8T 3UU8A 2VL8A 1L0VA 3GWHA 5JQGE 4M1PA 4GKJT 1OWAA 2DCFA 3U78A 4EZHA 4DR4T 1XNRT 2XM2A 2X0HA 2BG9C 2BDEA 2QYWA 3RYIE 2VQET 2LE8A 2YKSA 5CA0E 2L3LA 4PJJA 2DWGA 4DV4T 4DO0A 3EDUA 5L47A 2HN1A 5AQNB 4ZOLE 4HE8A 4QWNB 4EEDA 1HNXT 1WYCA 5F8PA 1G8XA 2DWKA 3RYFE 2V1DB 3VRBA 3UULA 3H3AA 2M6BA 5FP3A 2NOXA 4KI0F 4A56A 1T98A 3C64A 2BBHA 3QK6A 4HWDA 2CXFA 1FJGT 3CX6B 4JLEA 2EHOD 2BKPA 1WFDA 3AECA 4DV5T 4ISSA 4YSZA 4TZ4C 3UUXB 2JQHA 2C0SA 3N9OA 3LJCA 3KV6A 2QA7A 5AQHB 5J1GA 5KMGP 1NAFA 3C50A 2CEAA 2ZM0A 5EK4A 2IW5B 1T72A 4JBWF 5J2TE 4XBFB 2JRKA 4EEBA 4WBOA 1FIOA 4LMKA 1UX5A 4IIJE 2VKHA 4I50E 4P0BA 5JRCA 4NUUA 2FBWA 3ZYMA 4X1YE 5TAOA 5CJ5A 3UT5E 2WMOA 3CPZA 3QB5A 4C91A 5FY7A 3UTKA 3L09A 4HFDA 4TNWA 3K3NA 5AQIB 4CXWA 3ZT5A 2N1GA 4HN9A 3IEEA 5EK3A 3LBXA 3KV4A 1KNZA 4Z8XA 2LLYA 2H88A 4YY3T 3P7IA 5AQUB 5JDHA 2W00A 4NIQA 3AEGA 4PW8A 3IBPA 4KUMB 3UU3A 4MFRA 4DR2T 4IGUA 1OEDB 2LSGA 3PUZF 3PJAA 2VB6A 3ZT6A 3HL6A 3ZCIA 3FZHB 5LNKA 4CQIA 4UV8B 4LF8T 3EUHA 1UX4A 3BK9A 3H3MA 4BAYB 1YW0A 2MTQA 2GK9A 5LBMA 3VU7H 2NP9A 3FBZA 2ZM2A 4H9QC 1WLXA 2ACXA 1FMWA 5HXRA 4TNVA 3KVAA 3QNUA 4PK4A 2V7LA 4U2YA 5J0ZA 4UV9B 2AXDS 3N5LA 3PE0A 3IF8B 1ZHCA 1E2AA 3O1HA 4IL4A 1WR0A 1GQEA 2W63A 3W15B 4EAHA 2K3WA 2WDVA 2XQAA 4DMWA 5BMVE 2K5BB 3NKZA 1J1JA 3BQKA 2X51A 2A9UA 2FJAA 3RYHE 5AQMB 1R8IA 5DQWA 1VOMA 5HWXA 1G73A 4EYUA 2NWBA 3T1YT 3FB2A 2Q9QB 1N34T 2DI4A 4DV2T 4JI7T 2VK9A 4FI5A 2J4GA 3V5SA 4DR6T 2V7MA 3N9MA 4DR7T 2VVSA 1M62A 3VKHA 3SFEA 1Z8UA 2QGSA 1T7SA 4QX8B 5HEUA 4GOUA 3I9YA 3AEDA 1MIWA 2VWAA 2X66A 2IUBA 3P4QA 3AE2A 3KDSE 1JNZA 3N2OA 2LSKA 2XM1A 3TLVA 4IE4A 3PUGA 3CQXC 2WY2A 3HKBE 2XAHB 4QH1A 1XMQT 2J47A 5JR9A 5FVKA 4X64T 3N9NA 4MLKA 1HF8A 1W0AA 1DU2A 4ZZBA 2LM2A 3ZMVB 4OFZA 2A2FX 5FVLA 3LK42 4DVDA 4ZI7E 4ZZCA 4O4LE 3G06A 5FXZA 1IBLT 1AJ3A 3ZPOA 5IWAT 2EHOA 2LEHA 1NWMX 5LG3A 2N9DA 3CVRA 3E0ZA 3AVSA 5LMUT 3L39A 5ABFB 5AQRB 1HNZT 1WR6A 2SPCA 4J2CA 1X79A 5HEJA 4EB6E 4UEMA 4HWIB 3GA8A 4H9SE 2XQ8A 3AE5A 5FYMA 3ZJ2A 3ZT7A 3E08A 2CLYC 2C5IT 4A98A 2CHNA 4WYVA 2LRLA 4B6XA 5L2LA 4LFAT 3AA7B 4JI3T 3DP7A 4JUYA 3JAEA 5AQKB 2DHRA 3Q5XA 1D0ZA 1N33T 1XMOT 3Q9DA 3VR8A 3B57A 4IE6A 1KF6A 4DBQA 5CFBA 4O2BE 3UQ4A 3FZMB 1S94A 2BG9E 4IDZA 3ZC1A 2V6XA 4X62T 2IC9A 2XSBA 2E9XC 4YTNA 2LRKA 2M67A 1HR0T 3C4XA 2E2AA 3MJXA 2VVNA 1HFAA 3X1DA 2IDOB 2WB5A 4LF9T 3U3IA 1UGOA 4WW0A 1BR1A 4H9RC 3UFGA 2UXDT 4OK0A 5L3CB 1W9RA 3PUVF 4HTEA 5LP6E 3VRAA 1KEYA 2LSIA 1IZNB 2YEVC 3RHWA 3C51A 4IT4A 3AA1B 5LYJE 1Z0PA 3AXJA 4JEHB 2CE7A 2BS2A 5L3GB 3E22E 2JQKA 4HFEA 3RIUC 4DBRA 3P4SA 4YTMA 3J7Yq 2XTLA 2ES0A 4CXYA 4QXBB 5LGNB 4MBQA 3UQ7A 3FZLB 3CQCB 2UXXB 3RC3A 2WWVA 5AQLB 4YSXA 2MPKA 1H7CA 2IC6A 1ZP0A 3EI0A 5FMNA 5IUXA 4DV6T 1FMVA 4F6RC 4QHOA 2NTXA 2JMHA 3B5MA 1XNQT 4Z91A 4JI4T 4L0RA 2LT3A 2V7IA 2CWYA 2XPKA 1Y64B 5LGUB 3JAFA 3PUWF 5JDFA 2FJEA 3RIAA 4YLHA 4O4HE 2E9XD 5JDLA 3BQLA 2Y8DA 4ZXLA 3Q2MA 1UUSA 4DV3T 1OEDE 3FXDB 1BR4A 3NVOA 4CN6A 1VCSA 2X68A 3RKOA 1SA0E 4I0UA 2LOSA 2K48A 2E5VA 3PUXF 4H63V 2VKJA 4G2AA 4EXTA 3WAKA 4ILBA 2B76A 1JNRA 3GN5A 5JDGA 3AAIA 4B3RT 2Y48B 2KWIB 2W0GA 4IDPA 2CA5A 2B1EA 3LK2B 3SWHA 4O4IE 2LKGA 3EDVA 4O4JE 2XQ7A 4AQYT 1NEKA 4IHJE 2X67A 4U3CA 5JTGA 1MIVA 4KHPT 4G63A 4ISTA 5LHHB 4EV6A 3FZKB 3UUNA 4YFSA 3ANWA 3MXZA 2WP9A 4AKGA 3KVBA 2MAWA 2PJQA 3Q5WA 3ETUA 3NBXX 3CWZB 1XDOA 5LHGB 5KDMC 1D0YA 5ADXL 2W62A 2UUBT 2M6IA 3FBLA 2KSRA 2CXDA 1CUNA 2Z6EA 3N9QA 4JEUB 2IHR1 4PFPA 1MNDA 2WU2A 3K3OA 5HXHA 2W66A 2W4XA 5IHYA 3RRCA 3AAAB 4ILCA 1I6ZA 2R6GF 2WSSV 1OEDC 3KINB 3AE4A 2X0LB 3RH3A 3ZSTA 1HG2A 4OYJA 2LHNA 3KV9A 4HEAA 2WZIA 3OBVE 2VKDA 2XAJB 3ZMSB 4PFOA 3ZMZB 4AIUA 4U7IA 3HR0A 3ZSSA 2HPLA 4I43B 5KX5E 4P09A 2D2SA 1QLBA 3UU6A 4H9PC 5LXTE 1XZYA 2UUAT 1Y01A 4DNDA 5DQVA 2CHOA 4YT0A 5LJNA 2YINA 1IBMT 1D1CA 3CK6A 4ZS3A 2WBLA 3QB5K 2XSAA 3CQGB 3OTOT 4UXNB 2Q9QC 3R84B 4JI1T 5LA6E 3AE8A 2H3RA 4PJLA 3B13A 4TWFA 4GKKT 5HCMA 4HFBA 3PU3A 5HEOA 1IJ6A 4GYRA 3MKDA 2C5JA 4UVAB 3PJAJ 1MMGA 4YTPA 5J2UE 2DLRA 4A97A 5L4HA 3LFMA 3ANWB 4QH4A 5JRCB 4ZI3C 4UF0A 5L3DB 3O9XA 4KP3C 3PUAA 3T8OA 2X9XA 1B7TA 4UR9A 4CXXA 3F2EA 5LB7B 5C2TA 4JI5T 4IL9A 4TWDA 2ZM8A 3RF1A 4ZHQE 3K1SA 3AE9A 3LBXB 3AEEA 2CXLA 4F8HA 2N2NA 4AKLA 2LSJA 5LMNT 3ZC0A 2WDQA 4PK6A 4JI2T 4TV9E 4A5XA 1YXRA 3BQIA 3RC8A 2D0TA 4JI0T 4GK5E 3RLFF 2V8SV 2LKHA 4OX9T 3A7MA 3ZYLA 2PG8A 2XQ9A 3A8YC 2WU5A 1XWMA 5FXXA 2X9YA 4B3ST 2V6YA 3AAEB 4IREA 4PAGA 2BBJA 2WMNA 3MK7C 1HX1B 4CI3B 3RGLA 5M4YA 2I0MA 3TLUA 2ZLYA 4DV7T 4JYAT 4L9IA 3RI5A 1XDPA 2J62A 3RIUA 4LFCT 2Q9QD 3JC6C 2RA1A 4P1NA 2WWUA 3NZQA 4H9OC 3F31A 3OYZA 2L8KA 3PDYA 3S4UA 4B3TT 5AFUL 3UU5A 1CHUA 3PUYF 2ODVA 2XAGB 5HXCA 4NUVA 3A5XA 5L3BB 3JADA 3PUQA 4ZEYA 2P9BA 4DUYT 4UVCB 4MHCA 3P4WA 1MMNA 4ZI3D 3ZN0B 2IIUA 3L3PA 4EIWA 3IA3A 1KNRA 2ZMAA 3GMIA 3OPCA 5FL0A 2H7OA 2BG9A 3RKGA 4KX6A 4CN4A 4CN1A 4YJ2E 3VHLA 5FL1A 5JVDE 3LK3B 3IHRA 4O2AE 3ABVA 4U7YA 3ONJA 1VCTA 2WZHA 4BJMA 3Q5DA 2KT9A 4DV1T 5DJQC 3EABA 2NW7A 2K9AA 3T1HT 2XQ3A 4KHZF 5JDQA 4IE5A 2C5KT 3LSVA 2OA5A 4ZI2C 2KNDA 3R6NA 4N78D 5EK2A 1D1BA 5C3JA 2KLQA 2XY8B 3ZJ1A 3RQWA 2CM0A 4HKAA 3I1AA 4HWCA 5AQPB 1E1HB 4UVBB 2ZM6T 3AE7A 4UELA 4YXDA 2KMFA 3I0OA 4QKNA 1ZV4X 3MACA 1UURA 1SE7A 1LVFA 4COFA 4NXNT 1KK7A 1VRBA 4GIWA 3CMLA 1I94T 3KBTA 4FJOA 3CX8B 5JR9B 3ZYKA 3JC6D 3TLSA 3JCFA 2CBIA 2MOZA 3AEAA 4V1Av 4HFHA 5EZYE 3PU8A 2CMRA 4IE0A 3AA6B 3OVUA 2QRXA 3HI2A 3HKDE 2PTFA 1KFYA 3WI3A 1J5WA 3QC9A 4QX7B 4IE7A 2EHOB 2YU1A 5JH7E 3LG7A 5DABA 1YQ4A 2HH7A 1HG5A 3P4RA 4TUYE 3Q5EA 4KBMB 2WS3A 4ADZA 3VKGA 5LOVE 2K24A 2CCQA 4U72A 3MA9A 5HWYA 3RRWA 3EVYA 4TV8E 5LGTB 1QUUA 1YQ3A 1ZOYA 2VQFT 5AQTB 2BKNA 1BR0A 1OEDA 1U4QA 4JV5T 2V26A 1D0XA 4U2ZA 2LHRA 2Y6XA 3O1JA 4EYYR 2BZBA 3ZLIA 4X66T 2YDRA 3FZFB 1SHZC 4XZCA 2FJDA 4ZI2D 2X0YA 4TX5A 3M65A 4E7ZA 2BG9B 5FY1A 2RP4A 4ERRA 2UU9T 4LF5T 1MMAA 5HXEA 2CPTA 1YKHB 5FNVE 1X9BA 5AQJB 1N32T 3C98B 2LJLA 2I59A 4HGAA 1IBKT 3NWIA 5CB4E 2NW8A 3ZMUB 1S35A 2FUPA 3SRZA 2UXNB 3RIFA 3C4WA 2F4VT 5HEGA 3CIRA 1LVKA 2VKOA 5JDMA 5AQGB 1IJ5A 4AQFC 5JDNA 5L3FB 4ILUA 3RQUA 4DIDB 2HN2A 3KBUA 1OXZA 3PV0F 2XAFB 3TKLB 2VURA 2D0UA 1WYBA 4TN7B 2JQQA 2Q9QA 3CX7B 4IDQA 5AQQB 3AXJB 1N36T 4PJMA 3MZKB 4Z90A 4DV0T 4WBNE 4B3MT 4AKIA 4H63H 4X65T 2E8IA 2LM9A 1HCIA 4YHJA 4YSYA 4UIGA 4X5TA 2H7VC 2YDQA 4CI1B 4U33A 3RYCE 4EGWA 2ACZA 3PTRB 2CBJA 3QOFA 2XUEA 2V7JA 2KZ7B 3N2KE 4H9NC 2H89A
chains in the Genus database with same CATH topology
1XNQT 4JI4T 4DR1T 2UUAT 2F4VT 4K0KT 1HNXT 2UXBT 5LMNT 1IBLT 1HR0T 5IWAT 4YY3T 1IBMT 4JI2T 4LF9T 4LFBT 4JI0T 2UUBT 5LMUT 4OX9T 2UXDT 4DV3T 3T1YT 1HNZT 1N34T 4DV2T 2HHHT 4DV1T 4JI7T 1FJGT 4DR2T 3OTOT 2VQFT 4DR6T 4DV5T 3T1HT 1N36T 4JI1T 4LF6T 4B3ST 4JI8T 4LF4T 4NXMT 4GKKT 4DV0T 4LF7T 4DR7T 4JV5T 4DUZT 4B3MT 4DV7T 4DR3T 4JYAT 4LF8T 4X65T 4X66T 4LFAT 2ZM6T 4LFCT 2UXCT 1HNWT 4B3RT 5BR8T 4JI3T 4NXNT 4JI6T 4YHHT 4GKJT 1N33T 1XMOT 2UUCT 1I94T 2UU9T 2E5LT 4LF5T 4DR4T 1J5ET 4DR5T 4AQYT 4B3TT 1XMQT 1XNRT 2VQET 4DV6T 4X64T 1N32T 4X62T 4JI5T 4KHPT 4DUYT 1IBKT 4DV4T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNQ T;  4JI4 T;  4DR1 T;  2UUA T;  2F4V T;  4K0K T;  1HNX T;  2UXB T;  5LMN T;  1IBL T;  1HR0 T;  5IWA T;  4YY3 T;  1IBM T;  4JI2 T;  4LF9 T;  4LFB T;  4JI0 T;  2UUB T;  5LMU T;  4OX9 T;  2UXD T;  4DV3 T;  3T1Y T;  1HNZ T;  1N34 T;  4DV2 T;  2HHH T;  4DV1 T;  4JI7 T;  1FJG T;  4DR2 T;  3OTO T;  2VQF T;  4DR6 T;  4DV5 T;  3T1H T;  1N36 T;  4JI1 T;  4LF6 T;  4B3S T;  4JI8 T;  4LF4 T;  4NXM T;  4GKK T;  4DV0 T;  4LF7 T;  4DR7 T;  4JV5 T;  4DUZ T;  4B3M T;  4DV7 T;  4DR3 T;  4JYA T;  4LF8 T;  4X65 T;  4X66 T;  4LFA T;  2ZM6 T;  4LFC T;  2UXC T;  1HNW T;  4B3R T;  5BR8 T;  4JI3 T;  4NXN T;  4JI6 T;  4YHH T;  4GKJ T;  1N33 T;  1XMO T;  2UUC T;  1I94 T;  2UU9 T;  2E5L T;  4LF5 T;  4DR4 T;  1J5E T;  4DR5 T;  4AQY T;  4B3T T;  1XMQ T;  1XNR T;  2VQE T;  4DV6 T;  4X64 T;  1N32 T;  4X62 T;  4JI5 T;  4KHP T;  4DUY T;  1IBK T;  4DV4 T; 
#chains in the Genus database with same CATH topology
 4DR1 T;  2XAS B;  2WDR A;  4K0K T;  3SOL A;  2BS3 A;  3J9X 1;  4CI2 B;  3ESL A;  3UFE A;  4YJ3 E;  3N9L A;  4LML A;  3P8C D;  1FEW A;  4LFB T;  1WRD A;  3AE3 A;  4NPP A;  5FXW A;  2CRB A;  2OV9 A;  4HWH A;  1LRZ A;  5LCY A;  5GON E;  4U74 A;  3AEB A;  5FKY A;  4IDN A;  5ABF A;  2KIN B;  5L4E A;  4LMJ A;  2V7K A;  2XZE A;  2X9W A;  1V9D A;  4LF4 T;  1KNP A;  2VAS A;  2WCA A;  1U5P A;  4I4T E;  3GN5 B;  4E7S A;  2PBI A;  1M7K A;  3NRX A;  4OYK A;  4ILA A;  2BS4 A;  3F57 A;  3ZN1 B;  2MBG A;  5AQV B;  4HFV A;  4EZ4 A;  4XAX B;  3I9W A;  4YHH T;  3P4P A;  2WAU A;  2YK0 A;  1J5E T;  2LSY A;  3NRY A;  3O1I A;  5LBQ B;  4OHF A;  2VL0 A;  3RX6 A;  4L5G A;  4KMC A;  3OJA A;  1ZEE A;  4X1I E;  3UUB A;  3RPU A;  4MAL A;  5CGM A;  2UXB T;  2W2U A;  4DMV A;  3AE1 A;  5JRE A;  5C8Y E;  3PUS A;  3TLW A;  2LOP A;  2E9X A;  3AEF A;  4EOZ B;  1SUM B;  2ODU A;  2L9Q A;  1D1A A;  2V5C A;  5HXS A;  3PUR A;  4ANJ A;  3O4X E;  4BJN A;  2XQ5 A;  2OLT A;  3ONX A;  4PK5 A;  3ZEF B;  4AXP A;  3ZKR A;  2FJB A;  2D5U A;  2XJ7 A;  2JIW A;  2NR4 A;  1O3X A;  3AVR A;  2YDS A;  5LG4 A;  2BKO A;  5AQO B;  4WNK A;  4GYS A;  3OYX A;  2UXC T;  4I55 E;  2JQ9 A;  2YN6 A;  3WAJ A;  1EZ3 A;  1HX8 A;  4IDO A;  5HEH A;  3AB3 B;  3SFD A;  3AA0 B;  3M3Z B;  4ASK A;  2XAQ B;  2BVL A;  1UK5 A;  3FHN A;  4Q25 A;  4AKH A;  3LDQ B;  3ZMT B;  4C90 A;  3EHZ A;  3UUM A;  5LHI B;  1US7 B;  3I0Q A;  4DR5 T;  5HYA A;  3HKC E;  4QH5 A;  3ZCJ A;  4GK0 E;  5E0O A;  3CKD A;  2YOE A;  2RPA A;  2JMK A;  2XQY A;  2NTY A;  3SS1 A;  1W0B A;  4PNI A;  2JJ9 A;  1MNE A;  2NW9 A;  3KFW X;  4ZS2 A;  4AQG A;  5ABH A;  3DJB A;  3K3Q C;  1W09 A;  1UCU A;  3FXE B;  2XQ6 A;  4PJN A;  5LJM A;  1MMD A;  2CLY B;  4AKR B;  3L8R A;  5FY0 A;  3EAM A;  2MYS A;  1ZKE A;  4X20 E;  4JI8 T;  2WM9 A;  1YD8 G;  4NXM T;  2W67 A;  4LF7 T;  1HTJ F;  4WZX A;  4DUZ T;  1LKX A;  2G0U A;  4DR3 T;  1IAP A;  5HAX A;  1NEN A;  2YU2 A;  2IML A;  3HKE E;  3AE6 A;  5CA1 E;  3ONL C;  3HA4 A;  4UF0 B;  4AIS A;  4JI6 T;  2CWO A;  4O8S A;  2A3D A;  2JPF A;  2UUC T;  3C4Z A;  2E5L T;  5IYZ E;  3TLT A;  1MIY A;  2X9H A;  5F5W A;  4QXC B;  2DNX A;  2KWH A;  3N2G E;  2E9X B;  1HS7 A;  5ABE A;  5JR9 C;  5AQS B;  4BA9 A;  1T8B A;  3P50 A;  2A72 A;  4CZZ B;  1QSD A;  3NZP A;  4P0A A;  4AQF A;  3V5U A;  4HFC A;  2AE9 A;  3K8P C;  2EHO C;  3H37 A;  4X1K E;  1BR2 A;  1E7P A;  1YKE B;  3VR9 A;  4HFI A;  2PFV A;  2WQY A;  1WCR A;  5A1L A;  2KXP B;  5FXV A;  2D9D A;  5H6R B;  5ABG A;  4U31 A;  3QUJ A;  5ETW A;  2QVA A;  2HHH T;  5KXJ A;  2J1D G;  2V6Y B;  3D0T A;  5L3E B;  4LF6 T;  4AI6 A;  2DL1 A;  4QXH B;  3KV5 A;  3DTO A;  5AQF B;  2BVM A;  2V5D A;  4TWH A;  3N9P A;  3OKQ A;  5HCJ A;  2HPJ A;  2IAK A;  5F3J A;  3ETV A;  5H6Q B;  2XHE B;  2W61 A;  2XQ4 A;  4HWF A;  1HNW T;  3UU4 A;  2I6H A;  4K0U A;  5BR8 T;  3UU8 A;  2VL8 A;  1L0V A;  3GWH A;  5JQG E;  4M1P A;  4GKJ T;  1OWA A;  2DCF A;  3U78 A;  4EZH A;  4DR4 T;  1XNR T;  2XM2 A;  2X0H A;  2BG9 C;  2BDE A;  2QYW A;  3RYI E;  2VQE T;  2LE8 A;  2YKS A;  5CA0 E;  2L3L A;  4PJJ A;  2DWG A;  4DV4 T;  4DO0 A;  3EDU A;  5L47 A;  2HN1 A;  5AQN B;  4ZOL E;  4HE8 A;  4QWN B;  4EED A;  1HNX T;  1WYC A;  5F8P A;  1G8X A;  2DWK A;  3RYF E;  2V1D B;  3VRB A;  3UUL A;  3H3A A;  2M6B A;  5FP3 A;  2NOX A;  4KI0 F;  4A56 A;  1T98 A;  3C64 A;  2BBH A;  3QK6 A;  4HWD A;  2CXF A;  1FJG T;  3CX6 B;  4JLE A;  2EHO D;  2BKP A;  1WFD A;  3AEC A;  4DV5 T;  4ISS A;  4YSZ A;  4TZ4 C;  3UUX B;  2JQH A;  2C0S A;  3N9O A;  3LJC A;  3KV6 A;  2QA7 A;  5AQH B;  5J1G A;  5KMG P;  1NAF A;  3C50 A;  2CEA A;  2ZM0 A;  5EK4 A;  2IW5 B;  1T72 A;  4JBW F;  5J2T E;  4XBF B;  2JRK A;  4EEB A;  4WBO A;  1FIO A;  4LMK A;  1UX5 A;  4IIJ E;  2VKH A;  4I50 E;  4P0B A;  5JRC A;  4NUU A;  2FBW A;  3ZYM A;  4X1Y E;  5TAO A;  5CJ5 A;  3UT5 E;  2WMO A;  3CPZ A;  3QB5 A;  4C91 A;  5FY7 A;  3UTK A;  3L09 A;  4HFD A;  4TNW A;  3K3N A;  5AQI B;  4CXW A;  3ZT5 A;  2N1G A;  4HN9 A;  3IEE A;  5EK3 A;  3LBX A;  3KV4 A;  1KNZ A;  4Z8X A;  2LLY A;  2H88 A;  4YY3 T;  3P7I A;  5AQU B;  5JDH A;  2W00 A;  4NIQ A;  3AEG A;  4PW8 A;  3IBP A;  4KUM B;  3UU3 A;  4MFR A;  4DR2 T;  4IGU A;  1OED B;  2LSG A;  3PUZ F;  3PJA A;  2VB6 A;  3ZT6 A;  3HL6 A;  3ZCI A;  3FZH B;  5LNK A;  4CQI A;  4UV8 B;  4LF8 T;  3EUH A;  1UX4 A;  3BK9 A;  3H3M A;  4BAY B;  1YW0 A;  2MTQ A;  2GK9 A;  5LBM A;  3VU7 H;  2NP9 A;  3FBZ A;  2ZM2 A;  4H9Q C;  1WLX A;  2ACX A;  1FMW A;  5HXR A;  4TNV A;  3KVA A;  3QNU A;  4PK4 A;  2V7L A;  4U2Y A;  5J0Z A;  4UV9 B;  2AXD S;  3N5L A;  3PE0 A;  3IF8 B;  1ZHC A;  1E2A A;  3O1H A;  4IL4 A;  1WR0 A;  1GQE A;  2W63 A;  3W15 B;  4EAH A;  2K3W A;  2WDV A;  2XQA A;  4DMW A;  5BMV E;  2K5B B;  3NKZ A;  1J1J A;  3BQK A;  2X51 A;  2A9U A;  2FJA A;  3RYH E;  5AQM B;  1R8I A;  5DQW A;  1VOM A;  5HWX A;  1G73 A;  4EYU A;  2NWB A;  3T1Y T;  3FB2 A;  2Q9Q B;  1N34 T;  2DI4 A;  4DV2 T;  4JI7 T;  2VK9 A;  4FI5 A;  2J4G A;  3V5S A;  4DR6 T;  2V7M A;  3N9M A;  4DR7 T;  2VVS A;  1M62 A;  3VKH A;  3SFE A;  1Z8U A;  2QGS A;  1T7S A;  4QX8 B;  5HEU A;  4GOU A;  3I9Y A;  3AED A;  1MIW A;  2VWA A;  2X66 A;  2IUB A;  3P4Q A;  3AE2 A;  3KDS E;  1JNZ A;  3N2O A;  2LSK A;  2XM1 A;  3TLV A;  4IE4 A;  3PUG A;  3CQX C;  2WY2 A;  3HKB E;  2XAH B;  4QH1 A;  1XMQ T;  2J47 A;  5JR9 A;  5FVK A;  4X64 T;  3N9N A;  4MLK A;  1HF8 A;  1W0A A;  1DU2 A;  4ZZB A;  2LM2 A;  3ZMV B;  4OFZ A;  2A2F X;  5FVL A;  3LK4 2;  4DVD A;  4ZI7 E;  4ZZC A;  4O4L E;  3G06 A;  5FXZ A;  1IBL T;  1AJ3 A;  3ZPO A;  5IWA T;  2EHO A;  2LEH A;  1NWM X;  5LG3 A;  2N9D A;  3CVR A;  3E0Z A;  3AVS A;  5LMU T;  3L39 A;  5ABF B;  5AQR B;  1HNZ T;  1WR6 A;  2SPC A;  4J2C A;  1X79 A;  5HEJ A;  4EB6 E;  4UEM A;  4HWI B;  3GA8 A;  4H9S E;  2XQ8 A;  3AE5 A;  5FYM A;  3ZJ2 A;  3ZT7 A;  3E08 A;  2CLY C;  2C5I T;  4A98 A;  2CHN A;  4WYV A;  2LRL A;  4B6X A;  5L2L A;  4LFA T;  3AA7 B;  4JI3 T;  3DP7 A;  4JUY A;  3JAE A;  5AQK B;  2DHR A;  3Q5X A;  1D0Z A;  1N33 T;  1XMO T;  3Q9D A;  3VR8 A;  3B57 A;  4IE6 A;  1KF6 A;  4DBQ A;  5CFB A;  4O2B E;  3UQ4 A;  3FZM B;  1S94 A;  2BG9 E;  4IDZ A;  3ZC1 A;  2V6X A;  4X62 T;  2IC9 A;  2XSB A;  2E9X C;  4YTN A;  2LRK A;  2M67 A;  1HR0 T;  3C4X A;  2E2A A;  3MJX A;  2VVN A;  1HFA A;  3X1D A;  2IDO B;  2WB5 A;  4LF9 T;  3U3I A;  1UGO A;  4WW0 A;  1BR1 A;  4H9R C;  3UFG A;  2UXD T;  4OK0 A;  5L3C B;  1W9R A;  3PUV F;  4HTE A;  5LP6 E;  3VRA A;  1KEY A;  2LSI A;  1IZN B;  2YEV C;  3RHW A;  3C51 A;  4IT4 A;  3AA1 B;  5LYJ E;  1Z0P A;  3AXJ A;  4JEH B;  2CE7 A;  2BS2 A;  5L3G B;  3E22 E;  2JQK A;  4HFE A;  3RIU C;  4DBR A;  3P4S A;  4YTM A;  3J7Y q;  2XTL A;  2ES0 A;  4CXY A;  4QXB B;  5LGN B;  4MBQ A;  3UQ7 A;  3FZL B;  3CQC B;  2UXX B;  3RC3 A;  2WWV A;  5AQL B;  4YSX A;  2MPK A;  1H7C A;  2IC6 A;  1ZP0 A;  3EI0 A;  5FMN A;  5IUX A;  4DV6 T;  1FMV A;  4F6R C;  4QHO A;  2NTX A;  2JMH A;  3B5M A;  1XNQ T;  4Z91 A;  4JI4 T;  4L0R A;  2LT3 A;  2V7I A;  2CWY A;  2XPK A;  1Y64 B;  5LGU B;  3JAF A;  3PUW F;  5JDF A;  2FJE A;  3RIA A;  4YLH A;  4O4H E;  2E9X D;  5JDL A;  3BQL A;  2Y8D A;  4ZXL A;  3Q2M A;  1UUS A;  4DV3 T;  1OED E;  3FXD B;  1BR4 A;  3NVO A;  4CN6 A;  1VCS A;  2X68 A;  3RKO A;  1SA0 E;  4I0U A;  2LOS A;  2K48 A;  2E5V A;  3PUX F;  4H63 V;  2VKJ A;  4G2A A;  4EXT A;  3WAK A;  4ILB A;  2B76 A;  1JNR A;  3GN5 A;  5JDG A;  3AAI A;  4B3R T;  2Y48 B;  2KWI B;  2W0G A;  4IDP A;  2CA5 A;  2B1E A;  3LK2 B;  3SWH A;  4O4I E;  2LKG A;  3EDV A;  4O4J E;  2XQ7 A;  4AQY T;  1NEK A;  4IHJ E;  2X67 A;  4U3C A;  5JTG A;  1MIV A;  4KHP T;  4G63 A;  4IST A;  5LHH B;  4EV6 A;  3FZK B;  3UUN A;  4YFS A;  3ANW A;  3MXZ A;  2WP9 A;  4AKG A;  3KVB A;  2MAW A;  2PJQ A;  3Q5W A;  3ETU A;  3NBX X;  3CWZ B;  1XDO A;  5LHG B;  5KDM C;  1D0Y A;  5ADX L;  2W62 A;  2UUB T;  2M6I A;  3FBL A;  2KSR A;  2CXD A;  1CUN A;  2Z6E A;  3N9Q A;  4JEU B;  2IHR 1;  4PFP A;  1MND A;  2WU2 A;  3K3O A;  5HXH A;  2W66 A;  2W4X A;  5IHY A;  3RRC A;  3AAA B;  4ILC A;  1I6Z A;  2R6G F;  2WSS V;  1OED C;  3KIN B;  3AE4 A;  2X0L B;  3RH3 A;  3ZST A;  1HG2 A;  4OYJ A;  2LHN A;  3KV9 A;  4HEA A;  2WZI A;  3OBV E;  2VKD A;  2XAJ B;  3ZMS B;  4PFO A;  3ZMZ B;  4AIU A;  4U7I A;  3HR0 A;  3ZSS A;  2HPL A;  4I43 B;  5KX5 E;  4P09 A;  2D2S A;  1QLB A;  3UU6 A;  4H9P C;  5LXT E;  1XZY A;  2UUA T;  1Y01 A;  4DND A;  5DQV A;  2CHO A;  4YT0 A;  5LJN A;  2YIN A;  1IBM T;  1D1C A;  3CK6 A;  4ZS3 A;  2WBL A;  3QB5 K;  2XSA A;  3CQG B;  3OTO T;  4UXN B;  2Q9Q C;  3R84 B;  4JI1 T;  5LA6 E;  3AE8 A;  2H3R A;  4PJL A;  3B13 A;  4TWF A;  4GKK T;  5HCM A;  4HFB A;  3PU3 A;  5HEO A;  1IJ6 A;  4GYR A;  3MKD A;  2C5J A;  4UVA B;  3PJA J;  1MMG A;  4YTP A;  5J2U E;  2DLR A;  4A97 A;  5L4H A;  3LFM A;  3ANW B;  4QH4 A;  5JRC B;  4ZI3 C;  4UF0 A;  5L3D B;  3O9X A;  4KP3 C;  3PUA A;  3T8O A;  2X9X A;  1B7T A;  4UR9 A;  4CXX A;  3F2E A;  5LB7 B;  5C2T A;  4JI5 T;  4IL9 A;  4TWD A;  2ZM8 A;  3RF1 A;  4ZHQ E;  3K1S A;  3AE9 A;  3LBX B;  3AEE A;  2CXL A;  4F8H A;  2N2N A;  4AKL A;  2LSJ A;  5LMN T;  3ZC0 A;  2WDQ A;  4PK6 A;  4JI2 T;  4TV9 E;  4A5X A;  1YXR A;  3BQI A;  3RC8 A;  2D0T A;  4JI0 T;  4GK5 E;  3RLF F;  2V8S V;  2LKH A;  4OX9 T;  3A7M A;  3ZYL A;  2PG8 A;  2XQ9 A;  3A8Y C;  2WU5 A;  1XWM A;  5FXX A;  2X9Y A;  4B3S T;  2V6Y A;  3AAE B;  4IRE A;  4PAG A;  2BBJ A;  2WMN A;  3MK7 C;  1HX1 B;  4CI3 B;  3RGL A;  5M4Y A;  2I0M A;  3TLU A;  2ZLY A;  4DV7 T;  4JYA T;  4L9I A;  3RI5 A;  1XDP A;  2J62 A;  3RIU A;  4LFC T;  2Q9Q D;  3JC6 C;  2RA1 A;  4P1N A;  2WWU A;  3NZQ A;  4H9O C;  3F31 A;  3OYZ A;  2L8K A;  3PDY A;  3S4U A;  4B3T T;  5AFU L;  3UU5 A;  1CHU A;  3PUY F;  2ODV A;  2XAG B;  5HXC A;  4NUV A;  3A5X A;  5L3B B;  3JAD A;  3PUQ A;  4ZEY A;  2P9B A;  4DUY T;  4UVC B;  4MHC A;  3P4W A;  1MMN A;  4ZI3 D;  3ZN0 B;  2IIU A;  3L3P A;  4EIW A;  3IA3 A;  1KNR A;  2ZMA A;  3GMI A;  3OPC A;  5FL0 A;  2H7O A;  2BG9 A;  3RKG A;  4KX6 A;  4CN4 A;  4CN1 A;  4YJ2 E;  3VHL A;  5FL1 A;  5JVD E;  3LK3 B;  3IHR A;  4O2A E;  3ABV A;  4U7Y A;  3ONJ A;  1VCT A;  2WZH A;  4BJM A;  3Q5D A;  2KT9 A;  4DV1 T;  5DJQ C;  3EAB A;  2NW7 A;  2K9A A;  3T1H T;  2XQ3 A;  4KHZ F;  5JDQ A;  4IE5 A;  2C5K T;  3LSV A;  2OA5 A;  4ZI2 C;  2KND A;  3R6N A;  4N78 D;  5EK2 A;  1D1B A;  5C3J A;  2KLQ A;  2XY8 B;  3ZJ1 A;  3RQW A;  2CM0 A;  4HKA A;  3I1A A;  4HWC A;  5AQP B;  1E1H B;  4UVB B;  2ZM6 T;  3AE7 A;  4UEL A;  4YXD A;  2KMF A;  3I0O A;  4QKN A;  1ZV4 X;  3MAC A;  1UUR A;  1SE7 A;  1LVF A;  4COF A;  4NXN T;  1KK7 A;  1VRB A;  4GIW A;  3CML A;  1I94 T;  3KBT A;  4FJO A;  3CX8 B;  5JR9 B;  3ZYK A;  3JC6 D;  3TLS A;  3JCF A;  2CBI A;  2MOZ A;  3AEA A;  4V1A v;  4HFH A;  5EZY E;  3PU8 A;  2CMR A;  4IE0 A;  3AA6 B;  3OVU A;  2QRX A;  3HI2 A;  3HKD E;  2PTF A;  1KFY A;  3WI3 A;  1J5W A;  3QC9 A;  4QX7 B;  4IE7 A;  2EHO B;  2YU1 A;  5JH7 E;  3LG7 A;  5DAB A;  1YQ4 A;  2HH7 A;  1HG5 A;  3P4R A;  4TUY E;  3Q5E A;  4KBM B;  2WS3 A;  4ADZ A;  3VKG A;  5LOV E;  2K24 A;  2CCQ A;  4U72 A;  3MA9 A;  5HWY A;  3RRW A;  3EVY A;  4TV8 E;  5LGT B;  1QUU A;  1YQ3 A;  1ZOY A;  2VQF T;  5AQT B;  2BKN A;  1BR0 A;  1OED A;  1U4Q A;  4JV5 T;  2V26 A;  1D0X A;  4U2Z A;  2LHR A;  2Y6X A;  3O1J A;  4EYY R;  2BZB A;  3ZLI A;  4X66 T;  2YDR A;  3FZF B;  1SHZ C;  4XZC A;  2FJD A;  4ZI2 D;  2X0Y A;  4TX5 A;  3M65 A;  4E7Z A;  2BG9 B;  5FY1 A;  2RP4 A;  4ERR A;  2UU9 T;  4LF5 T;  1MMA A;  5HXE A;  2CPT A;  1YKH B;  5FNV E;  1X9B A;  5AQJ B;  1N32 T;  3C98 B;  2LJL A;  2I59 A;  4HGA A;  1IBK T;  3NWI A;  5CB4 E;  2NW8 A;  3ZMU B;  1S35 A;  2FUP A;  3SRZ A;  2UXN B;  3RIF A;  3C4W A;  2F4V T;  5HEG A;  3CIR A;  1LVK A;  2VKO A;  5JDM A;  5AQG B;  1IJ5 A;  4AQF C;  5JDN A;  5L3F B;  4ILU A;  3RQU A;  4DID B;  2HN2 A;  3KBU A;  1OXZ A;  3PV0 F;  2XAF B;  3TKL B;  2VUR A;  2D0U A;  1WYB A;  4TN7 B;  2JQQ A;  2Q9Q A;  3CX7 B;  4IDQ A;  5AQQ B;  3AXJ B;  1N36 T;  4PJM A;  3MZK B;  4Z90 A;  4DV0 T;  4WBN E;  4B3M T;  4AKI A;  4H63 H;  4X65 T;  2E8I A;  2LM9 A;  1HCI A;  4YHJ A;  4YSY A;  4UIG A;  4X5T A;  2H7V C;  2YDQ A;  4CI1 B;  4U33 A;  3RYC E;  4EGW A;  2ACZ A;  3PTR B;  2CBJ A;  3QOF A;  2XUE A;  2V7J A;  2KZ7 B;  3N2K E;  4H9N C;  2H89 A; 
#chains in the Genus database with same CATH homology
 1XNQ T;  4JI4 T;  4DR1 T;  2UUA T;  2F4V T;  4K0K T;  1HNX T;  2UXB T;  5LMN T;  1IBL T;  1HR0 T;  5IWA T;  4YY3 T;  1IBM T;  4JI2 T;  4LF9 T;  4LFB T;  4JI0 T;  2UUB T;  5LMU T;  4OX9 T;  2UXD T;  4DV3 T;  3T1Y T;  1HNZ T;  1N34 T;  4DV2 T;  2HHH T;  4DV1 T;  4JI7 T;  1FJG T;  4DR2 T;  3OTO T;  2VQF T;  4DR6 T;  4DV5 T;  3T1H T;  1N36 T;  4JI1 T;  4LF6 T;  4B3S T;  4JI8 T;  4LF4 T;  4NXM T;  4GKK T;  4DV0 T;  4LF7 T;  4DR7 T;  4JV5 T;  4DUZ T;  4B3M T;  4DV7 T;  4DR3 T;  4JYA T;  4LF8 T;  4X65 T;  4X66 T;  4LFA T;  2ZM6 T;  4LFC T;  2UXC T;  1HNW T;  4B3R T;  5BR8 T;  4JI3 T;  4NXN T;  4JI6 T;  4YHH T;  4GKJ T;  1N33 T;  1XMO T;  2UUC T;  1I94 T;  2UU9 T;  2E5L T;  4LF5 T;  4DR4 T;  1J5E T;  4DR5 T;  4AQY T;  4B3T T;  1XMQ T;  1XNR T;  2VQE T;  4DV6 T;  4X64 T;  1N32 T;  4X62 T;  4JI5 T;  4KHP T;  4DUY T;  1IBK T;  4DV4 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...