4IGUA

Crystal structure of the rgs domain of cg5036
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
137
structure length
137
Chain Sequence
SQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLSRPAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords CG5036
publication title Double suppression of the G alpha protein activity by RGS proteins
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 52
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iguA00
2PBIA 3QC9A 3T8OA 1HTJF 3C50A 3C51A 2A72A 4YHJA 4GOUA 4WBOA 3C4ZA 2DLRA 1ZV4X 2I59A 3C4XA 2ACXA 3CX8B 4L9IA 3C4WA 3AB3B 1IAPA 4IGUA 4PNIA 3CX6B 1SHZC 2ES0A 3CX7B 4WNKA
chains in the Genus database with same CATH superfamily
2LM2A 5CA0E 4HFIA 4DR1T 3ZYLA 4X65T 2WM9A 4EV6A 1BR1A 2BG9C 3RIFA 3DJBA 2D2SA 4ZZBA 4CN6A 3AE5A 3OJAA 3RKOA 1XDPA 3LSVA 3QB5A 3AEAA 5J0ZA 2LHRA 5LYJE 2XAGB 4K0KT 2X68A 1MNEA 1IZNB 2W2UA 1KF6A 2SPCA 1IBLT 2Y6XA 2JPFA 5FXVA 4GIWA 3UT5E 1HR0T 2JRKA 5CGMA 4CI1B 5F5WA 3PTRB 4UF0A 2E8IA 4CXWA 5JRCA 4PK4A 2HN2A 2LM9A 4HN9A 3OTOT 3N9MA 1VCTA 4GYRA 4JI2T 4DBRA 4QX7B 1T7SA 3AEDA 3KDSE 1UGOA 4ZS3A 2X66A 1WFDA 3N2OA 2XY8B 1KNPA 4TWFA 3ZT5A 2M67A 2WDVA 3PUAA 4ILCA 3VRBA 3CIRA 4ZI7E 2DI4A 4H63H 5C8YE 2XAQB 3KINB 5AFUL 5AQHB 4CN1A 2AXDS 3T1HT 4NIQA 2IUBA 3PU3A 1IBMT 5AQUB 2CMRA 1J5ET 5FXXA 1KEYA 3FZLB 2UUBT 1MMNA 4OYKA 3QK6A 3ZJ1A 1U5PA 2B1EA 2D0UA 1NENA 2DCFA 3K3OA 3KV9A 4YHHT 3C51A 4UIGA 1R8IA 3ZPOA 3RQWA 2W4XA 3GWHA 2BKPA 3ZLIA 3O1IA 4XZCA 2I59A 4TNVA 4DR3T 2V5DA 3PE0A 5AQGB 2QVAA 3ZSSA 5HEGA 2VKOA 4H9OC 1UCUA 4TUYE 4IDQA 4U31A 2F4VT 1HX8A 1HFAA 4LMLA 2WDRA 4G2AA 3PUZF 5HWXA 4NXNT 5L3BB 1M62A 5HEOA 4HFCA 1UUSA 4G63A 4J2CA 2Q9QC 2E9XD 1W0AA 3UQ7A 3ONLC 5CFBA 4Z91A 3GA8A 2YU2A 2XASB 4BJMA 2IC6A 2PG8A 2LSJA 5FY1A 3RKGA 1YW0A 3ABVA 5LG3A 1I6ZA 3J9X1 4HFVA 1OXZA 2WU2A 2IDOB 4IL4A 4H9NC 3ZMZB 4BAYB 2W66A 3AE8A 2EHOC 3MZKB 5IUXA 2XQ9A 4QH1A 3W15B 3ZSTA 4ZS2A 3OPCA 4DR7T 3ZCIA 3GN5A 2MYSA 4EB6E 3JC6D 2J1DG 5FYMA 3TLVA 2ZMAA 2BG9B 5HEUA 5KDMC 3LDQB 5LCYA 3Q5EA 1DU2A 2DHRA 3IF8B 3AEGA 2UXCT 3ZJ2A 5M4YA 5FNVE 4DR5T 2A9UA 3JAEA 3CQGB 4E7ZA 3O1JA 1N33T 4GOUA 2L8KA 3LBXB 3QOFA 2V7KA 1HCIA 1IAPA 2HHHT 1N32T 3P4RA 2XAJB 3MXZA 4GK0E 4AKRB 1LVFA 4PJLA 3N9PA 4OFZA 5ABEA 2XSBA 4AKIA 1LKXA 4QXHB 3X1DA 3A7MA 2BS2A 3VR8A 5EK3A 3RH3A 3P8CD 2LSYA 5AQQB 3ZT6A 4X1IE 2PTFA 4C91A 3LK3B 5A1LA 4GK5E 4CI3B 4WZXA 5F8PA 4YTNA 1CHUA 2KSRA 4WBOA 1G8XA 3C4XA 5CB4E 4EZHA 4WYVA 3TLUA 3NVOA 2WBLA 4PK6A 4EXTA 4CXXA 4IREA 5ADXL 2KWIB 2CCQA 4Z90A 3C4ZA 4PJJA 2XQYA 3UQ4A 2W00A 3BQIA 3S4UA 5L4HA 3FXEB 2J62A 4AISA 4ZI2D 5DQWA 2XPKA 1E2AA 4UR9A 4ASKA 2XAHB 3FB2A 3IHRA 3AAAB 5J2TE 3F57A 4I55E 1FIOA 2JQQA 2LSIA 4OX9T 2W61A 4DBQA 3D0TA 2BZBA 3KV5A 1HNXT 2LKHA 3AE4A 3EUHA 2H3RA 4YSZA 2Q9QB 4CI2B 1IJ6A 1FEWA 1UK5A 4HFHA 1Z8UA 2ES0A 2V26A 4YSYA 4AKGA 2XQ5A 3RX6A 3ZN1B 5FY7A 2LOSA 3VKHA 2IMLA 5L3EB 3ZC1A 2CPTA 3RRCA 2E9XC 4DMWA 2L3LA 2K24A 5LG4A 3CK6A 5JDGA 4DO0A 4XAXB 4L5GA 4A97A 1LRZA 3H3MA 1LVKA 4PK5A 2X51A 4O4JE 4ZOLE 4X5TA 3EHZA 1IJ5A 4TZ4C 2NW9A 1T8BA 2YDQA 2EHOB 5LMUT 2ACXA 3P50A 2VK9A 3AA6B 2G0UA 3P4SA 3CKDA 1MMDA 1XZYA 5H6QB 5EK4A 2LKGA 1S94A 3SRZA 3V5UA 4I0UA 4DVDA 4F6RC 4P1NA 2XTLA 2YEVC 4PNIA 3ETUA 4DNDA 5ETWA 2CLYC 4B3RT 4HTEA 3JC6C 1UX4A 4ILBA 2A72A 3I1AA 5HXHA 1ZHCA 3KVAA 2YDSA 3RLFF 2ZM8A 2BBJA 1HG2A 3CQXC 2WZHA 2V6YA 3AXJA 4IT4A 2X0HA 3N5LA 4IDPA 2LEHA 4YJ2E 2UXDT 3AVSA 3I0QA 4P0BA 2LHNA 2ZM2A 3NRYA 2FUPA 2YKSA 4YSXA 3A5XA 1WR6A 5ABFA 2BKOA 1V9DA 4CN4A 1X79A 3RI5A 2X0LB 2V7LA 5LMNT 3HKDE 2VASA 4EYUA 4UV8B 3AA7B 5HWYA 3FZMB 2XAFB 1KNZA 3ZMSB 3QB5K 3O9XA 4X66T 4TNWA 5FKYA 3EVYA 2R6GF 3CWZB 3WAJA 4YTPA 3FZFB 5AQLB 1YXRA 3HR0A 3PURA 1OEDE 3CX7B 5L3CB 2XZEA 3FHNA 2MAWA 1N34T 3C50A 1XNQT 3KFWX 3FXDB 2K5BB 2DNXA 1O3XA 2MTQA 3TLWA 5HCMA 3ONXA 3E0ZA 5FVLA 3SS1A 3EDVA 4BJNA 5LBQB 3KV4A 3M65A 5DABA 3ANWB 4C90A 5AQSB 3SOLA 4PJNA 2UUCT 3CX8B 4ZI2C 2YN6A 4JI8T 2XSAA 1ZKEA 2UXNB 1MIYA 3IEEA 4EIWA 5FXZA 2BG9E 4IDZA 1YKHB 4JI3T 2WSSV 3EDUA 2KZ7B 4YY3T 4IE4A 4B6XA 4DV2T 3UUXB 3MACA 4HWHA 2C5KT 2D9DA 2NOXA 4HWIB 3ZCJA 4JI5T 4EEDA 2QA7A 3TLSA 2E9XB 1L0VA 1UX5A 4OYJA 5FL0A 4ZI3D 4NXMT 1NWMX 2C0SA 3RIUA 3SWHA 4U2ZA 3NWIA 4EEBA 1UURA 2NP9A 2YK0A 3OBVE 3ZEFB 4WNKA 2VQET 4U72A 2IIUA 3HI2A 3AVRA 5CJ5A 2H89A 5E0OA 4COFA 5JR9A 4AKHA 1YQ4A 4TV8E 2HH7A 3C4WA 3OVUA 2CE7A 3B57A 3RF1A 3UU6A 5JREA 3L3PA 2L9QA 5JDHA 2P9BA 3RIUC 4QH5A 5DQVA 4PFPA 2WU5A 2N1GA 5CA1E 2GK9A 2XM2A 3B13A 2CLYB 4KP3C 3R6NA 4ZXLA 2XQAA 4UV9B 3WAKA 3C98B 1CUNA 4ERRA 3NZPA 3FZKB 4Z8XA 2VB6A 2JQ9A 3T8OA 2WZIA 4QH4A 4O4IE 3PUGA 5LGTB 1J1JA 4LF9T 5HXEA 3N9OA 4H63V 4LF5T 5JDQA 3L8RA 4H9RC 2X9HA 2YOEA 5LP6E 2V7MA 3DP7A 4ILUA 2CWOA 2FJDA 2VVSA 3SFDA 5LHHB 3GMIA 2C5IT 4MLKA 3Q5XA 5LXTE 2LRKA 1GQEA 2JQKA 2HN1A 5HCJA 5TAOA 4MFRA 3RHWA 2RA1A 1Y64B 3PV0F 3ZMUB 4O4LE 4DUYT 2JIWA 4A98A 5LOVE 4I50E 5LJNA 4IHJE 5LHGB 1VRBA 4PAGA 5GONE 3CX6B 2DWKA 4KI0F 1D0YA 3RYHE 4LMJA 4DIDB 2OA5A 2D0TA 4HGAA 4A5XA 5LBMA 1W0BA 2WWUA 2CXLA 3DTOA 2YU1A 5H6RB 3WI3A 5FP3A 3HKEE 1HX1B 3RPUA 2CA5A 3VRAA 4IDOA 1MMAA 2WB5A 3Q2MA 3RYIE 5AQPB 5AQTB 1YD8G 2V6XA 2BS3A 4UF0B 2KINB 5JRCB 4O2BE 3LK2B 4JBWF 3UU5A 2XM1A 2RPAA 3QC9A 5BMVE 1Z0PA 4E7SA 3ZC0A 3LG7A 4I43B 2LE8A 3PJAA 2VURA 5AQIB 4HEAA 2WS3A 5IYZE 3P7IA 4BA9A 3NRXA 2DL1A 4GKJT 4QX8B 2CRBA 4QXCB 3IBPA 3L09A 3HL6A 2PBIA 5AQFB 2UXBT 1HF8A 3PU8A 5AQVB 2VQFT 3LFMA 4U2YA 3BQLA 2NTYA 5JDNA 4K0UA 4U33A 4ADZA 1WCRA 2XUEA 3UUNA 4B3ST 4XBFB 4YTMA 5LA6E 4PW8A 4IE6A 4KMCA 3JADA 1H7CA 2E5VA 1JNRA 3I9WA 1M7KA 1U4QA 3P4PA 1EZ3A 2M6BA 2Y48B 3EI0A 4HE8A 3RC3A 2WDQA 4YJ3E 4KUMB 4ZI3C 3G06A 2KLQA 1BR4A 4U3CA 2V5CA 2K9AA 3MJXA 3UU3A 1QLBA 2WAUA 5DJQC 2I6HA 1MIWA 2CM0A 3ZYMA 2E5LT 2N9DA 4MBQA 1HNZT 4WW0A 3UFEA 1KK7A 4U7IA 4TWDA 5JVDE 3MKDA 3ONJA 3MA9A 4IL9A 2NWBA 3AAIA 1B7TA 3AE2A 3K1SA 2X9YA 4HFEA 4HWDA 4L9IA 1OEDA 2W63A 4HKAA 3MK7C 3AAEB 4KHPT 5HXCA 3ETVA 3RRWA 2E2AA 2UU9T 5ABHA 4NPPA 2BDEA 4LMKA 2DLRA 5AQNB 3HKBE 2XJ7A 2FBWA 4AKLA 4LF4T 5IHYA 3FBZA 2I0MA 2CHOA 3PUVF 4YHJA 2LRLA 1E1HB 5HYAA 3Q5WA 1OEDC 2BKNA 2WMNA 4UVCB 3RYFE 3U78A 3GN5B 1WR0A 2BG9A 4OK0A 2D5UA 4EYYR 4M1PA 2KNDA 3PJAJ 2JQHA 4P0AA 1MNDA 1NEKA 4ANJA 3PUWF 4YLHA 3Q5DA 3AEFA 5C2TA 2LLYA 4HWFA 4A56A 2W0GA 1E7PA 2X0YA 1WYCA 1XWMA 3M3ZB 2J4GA 4UELA 3LBXA 5L3FB 5J1GA 2OV9A 3FBLA 2VKDA 5JDLA 4F8HA 5L47A 5LB7B 4X64T 1FMWA 2ODVA 1G73A 3P4QA 1J5WA 4N78D 2ZM0A 2ODUA 4FI5A 2AE9A 2WCAA 4U74A 3RIAA 4JUYA 4TN7B 2IW5B 5C3JA 4IDNA 1I94T 4NUUA 4CXYA 4H9QC 4KBMB 5KMGP 5LGNB 4ISTA 4DR6T 4B3MT 3UFGA 5JDFA 4L0RA 4DMVA 3L39A 2KT9A 2CEAA 3EABA 4EGWA 4QKNA 3ZT7A 3CPZA 5J2UE 4WBNE 2WQYA 3N9LA 3HKCE 1S35A 4P09A 3AE1A 4OHFA 2NW8A 1ZP0A 3Q9DA 2CHNA 4JYAT 3C64A 4JI4T 2HPLA 3HA4A 1XDOA 3UU8A 4CZZB 2UXXB 4HFBA 2C5JA 2M6IA 4JEHB 4B3TT 5BR8T 2QYWA 2XQ4A 4QWNB 3SFEA 2H7VC 3VKGA 2LJLA 1AJ3A 4DV6T 3UUBA 3AEBA 4I4TE 1XMQT 1VOMA 2LT3A 2W67A 2CBIA 3UULA 2Q9QA 2MBGA 5L3DB 4CQIA 5JTGA 5JQGE 4ZHQE 4GKKT 2UUAT 2ZM6T 4X1YE 4IE7A 5AQMB 1ZEEA 4MALA 5AQRB 3H3AA 1WYBA 3UUMA 2H7OA 5L4EA 2V1DB 4LFAT 5FVKA 3LJCA 1SA0E 3K8PC 3ZN0B 3EAMA 2EHOA 2K48A 2BVMA 1D1AA 4EZ4A 3I0OA 3I9YA 4TX5A 3TKLB 1KFYA 1OEDB 2FJBA 3T1YT 4TWHA 3P4WA 4Q25A 4EAHA 4IE0A 4YT0A 3LK42 5JR9C 5L3GB 5AQOB 4IE5A 3AECA 4HWCA 4PJMA 5AQKB 3ZMTB 1W9RA 5KXJA 2XQ7A 3PUYF 4YXDA 1D0XA 2FJEA 3F2EA 3IA3A 2IAKA 4O8SA 2NTXA 2CXDA 3VR9A 2PJQA 3FZHB 3KBUA 3AE6A 3QNUA 4LF7T 3RQUA 2V6YB 3AXJB 1HTJF 4ZEYA 1W09A 1MIVA 4ISSA 2VL8A 2W62A 3O4XE 4KX6A 1HG5A 4X20E 4UVBB 1FJGT 5JH7E 4DV7T 2YINA 2LSKA 3AB3B 4LFCT 4IGUA 3AE3A 3N9QA 5ABFB 5HXRA 1N36T 1MMGA 2MOZA 4AXPA 3NKZA 5KX5E 1NAFA 2XQ8A 5F3JA 2ACZA 4JI6T 4H9SE 1HNWT 3AA1B 4HFDA 3ZKRA 2WWVA 3RGLA 2XHEB 3OKQA 2JMKA 5EK2A 4IIJE 3E22E 2ZLYA 1YKEB 3NZQA 5LNKA 3AA0B 2QRXA 3R84B 4AQFA 4TV9E 2NW7A 4X1KE 2IHR1 3BQKA 4UXNB 2WY2A 1OWAA 3H37A 5JDMA 1D1BA 2XQ3A 3OYXA 4DV4T 2RP4A 4QHOA 4LF6T 4DV1T 2N2NA 2X67A 3O1HA 1YQ3A 5L2LA 2QGSA 1T98A 3PUSA 5EZYE 2KXPB 3ANWA 4FJOA 4DV5T 2JJ9A 1WLXA 2Z6EA 4AQFC 3A8YC 5HAXA 3NBXX 4X62T 2VKJA 4DR4T 4LFBT 1QUUA 4GYSA 2VKHA 3BK9A 1ZOYA 2V8SV 5FY0A 3KVBA 2WP9A 3VHLA 3E08A 3RYCE 2X9WA 3UU4A 3CVRA 3PUQA 3VU7H 1BR0A 2WMOA 5FXWA 3ZYKA 2J47A 4NUVA 3V5SA 4MHCA 5LGUB 1FMVA 3CMLA 1BR2A 2V7IA 4PFOA 4QXBB 2E9XA 3TLTA 3PUXF 1D1CA 4JEUB 3AE7A 3ESLA 4O2AE 3N2GE 3KV6A 4DUZT 3QUJA 3F31A 4YFSA 1KNRA 3OYZA 4JLEA 1WRDA 1XNRT 2CWYA 2DWGA 3RC8A 4ZZCA 2A3DA 1SUMB 2K3WA 2CBJA 2V7JA 2YDRA 3B5MA 3U3IA 1QSDA 4V1Av 3AEEA 4JV5T 2FJAA 5HEHA 2LOPA 2KWHA 5JR9B 5FMNA 2Y8DA 1X9BA 4LF8T 1US7B 4JI7T 3UTKA 2Q9QD 2VWAA 1HS7A 3N2KE 4O4HE 3J7Yq 2IC9A 3AE9A 5LJMA 2XQ6A 1SE7A 2H88A 2NR4A 3CQCB 2X9XA 2CXFA 1JNZA 5ABGA 4AQYT 2KMFA 4EOZB 2BBHA 4DR2T 5LHIB 1Y01A 3N9NA 4KHZF 4JI1T 3K3QC 5HXSA 2OLTA 2JMHA 4DV0T 1VCSA 5AQJB 4U7YA 2LSGA 4AQGA 1D0ZA 3ZMVB 5IWAT 2BS4A 4JI0T 4UVAB 1T72A 4AI6A 5FL1A 2MPKA 2BVLA 4DV3T 1XMOT 1SHZC 2EHOD 4H9PC 2VVNA 2PFVA 4UEMA 5HEJA 3KBTA 4ILAA 4AIUA 1IBKT 2B76A 3JAFA 3JCFA 1ZV4X 2A2FX 2VL0A 3K3NA 3PDYA 2HPJA
chains in the Genus database with same CATH topology
1FIOA 1Y64B 4I4TE 1VOMA 2JQQA 3ZMUB 5CA0E 2LSIA 2LT3A 2W61A 4O4LE 5LOVE 4DBQA 4I50E 3D0TA 2BZBA 3KV5A 3ZYLA 5LJNA 3UULA 2Q9QA 3EUHA 4IHJE 2H3RA 2Q9QB 2MBGA 1IJ6A 4CI2B 2WM9A 5LHGB 1BR1A 5L3DB 1VRBA 1FEWA 4CQIA 3DJBA 2D2SA 4PAGA 5GONE 5JQGE 3CX6B 2ES0A 2V26A 2DWKA 4ZHQE 1D0YA 3RYHE 2OA5A 2D0TA 4HGAA 4AKGA 3RX6A 3OJAA 3ZN1B 5FY7A 3RKOA 5LBMA 4X1YE 2LOSA 2WWUA 3DTOA 2CXLA 3VKHA 2YU1A 4IE7A 5H6RB 5L3EB 3WI3A 3ZC1A 1ZEEA 2LHRA 5LYJE 2XAGB 5FP3A 3RRCA 3HKEE 2E9XC 4DMWA 4MALA 2L3LA 2K24A 5LG4A 3RPUA 2CA5A 3H3AA 1WYBA 2X68A 2H7OA 3UUMA 5JDGA 1MNEA 1MMAA 4DO0A 4XAXB 1IZNB 2V1DB 4L5GA 1LRZA 2SPCA 2Y6XA 2JPFA 1LVKA 4PK5A 5FXVA 4GIWA 3Q2MA 2X51A 3UT5E 3RYIE 3LJCA 2JRKA 1SA0E 4O4JE 4ZOLE 4CI1B 3PTRB 3K8PC 4UF0A 1IJ5A 1YD8G 4TZ4C 3ZN0B 2E8IA 2EHOA 2K48A 2BVMA 4UF0B 2NW9A 4CXWA 5JRCA 2KINB 1D1AA 2EHOB 4PK4A 5JRCB 4EZ4A 2ACXA 2VK9A 3I0OA 3AA6B 2LM9A 3I9YA 4TX5A 3TKLB 4HN9A 4O2BE 3LK2B 2G0UA 3N9MA 3CKDA 4GYRA 1MMDA 4DBRA 4QX7B 5H6QB 5EK4A 3QC9A 4EAHA 5BMVE 1Z0PA 4IE0A 4E7SA 3LG7A 4I43B 3LK42 2LE8A 3KDSE 4ZS3A 3ZC0A 5JR9C 2X66A 5L3GB 4HEAA 1S94A 3N2OA 4IE5A 3SRZA 5IYZE 3P7IA 3V5UA 4PJMA 4BA9A 3ZMTB 3NRXA 4DVDA 2M67A 3PUAA 4F6RC 4ZI7E 2DI4A 4H63H 2XTLA 5C8YE 2XAQB 1D0XA 2YEVC 3KINB 4QX8B 5AFUL 4PNIA 4QXCB 3IBPA 3ETUA 3F2EA 3L09A 3HL6A 4DNDA 2PBIA 5ETWA 2CLYC 3PU3A 2IAKA 4O8SA 4HTEA 2NTXA 3JC6C 1HF8A 3PU8A 1UX4A 2CMRA 2CXDA 2A72A 2PJQA 3I1AA 3LFMA 3KBUA 5FXXA 5HXHA 1ZHCA 3KVAA 3BQLA 2NTYA 5JDNA 1MMNA 4K0UA 4OYKA 4ADZA 2ZM8A 3QK6A 3ZJ1A 1U5PA 2B1EA 2XUEA 2D0UA 3UUNA 4XBFB 1HG2A 3CQXC 5LA6E 2DCFA 3K3OA 3KV9A 4PW8A 3N5LA 2LEHA 4IE6A 1HTJF 4KMCA 3C51A 4UIGA 1MIVA 1H7CA 3ZPOA 3I9WA 1U4QA 4YJ2E 3GWHA 4ISSA 1EZ3A 2Y48B 2VL8A 3ZLIA 3AVSA 2W62A 3I0QA 4P0BA 2LHNA 2ZM2A 3NRYA 3O1IA 1HG5A 3O4XE 4HE8A 4X20E 4KUMB 4XZCA 2I59A 4UVBB 4YJ3E 4ZI3C 3RC3A 5JH7E 2KLQA 2YINA 2LSKA 3A5XA 1BR4A 3AB3B 1WR6A 3PE0A 4IGUA 2K9AA 3MJXA 3N9QA 5HXRA 2WAUA 5DJQC 1V9DA 1MMGA 2MOZA 1X79A 4AXPA 2X0LB 2V7LA 3HKDE 2VKOA 4H9OC 5KX5E 1NAFA 1UCUA 4TUYE 1MIWA 2CM0A 3ZYMA 5F3JA 2VASA 2N9DA 1HX8A 1HFAA 4H9SE 4G2AA 4EYUA 4UV8B 3AA1B 3AA7B 5HWXA 5HWYA 5L3BB 4MBQA 2XAFB 4WW0A 3UFEA 2XHEB 1KNZA 3ZMSB 1KK7A 3OKQA 2JMKA 4G63A 5EK2A 4IIJE 4J2CA 3E22E 2ZLYA 2Q9QC 2E9XD 3O9XA 1YKEB 3NZQA 5LNKA 5JVDE 3MKDA 3AA0B 3EVYA 3MA9A 3CWZB 2NWBA 3AAIA 1B7TA 3WAJA 2X9YA 3R84B 4AQFA 4TV9E 2NW7A 4L9IA 4X1KE 3GA8A 2YU2A 3BQKA 4UXNB 2XASB 3HR0A 3PURA 4BJMA 1OWAA 2W63A 3CX7B 3H37A 4HKAA 5JDMA 3MK7C 1D1BA 3AAEB 5L3CB 2IC6A 3FHNA 2PG8A 2LSJA 5FY1A 3C50A 3KFWX 1YW0A 3OYXA 3FXDB 2RP4A 2K5BB 2DNXA 3ETVA 5HXCA 3RRWA 3J9X1 1O3XA 2MTQA 4HFVA 1OXZA 4QHOA 2BDEA 2DLRA 2N2NA 2X67A 3HKBE 3O1HA 3ONXA 3E0ZA 5L2LA 3SS1A 4H9NC 2QGSA 1T98A 3EDVA 4AKLA 3PUSA 5EZYE 3ZMZB 4BJNA 5LBQB 3KV4A 5IHYA 3M65A 2KXPB 4BAYB 3ANWA 3FBZA 5DABA 4FJOA 3ANWB 4C90A 2EHOC 2JJ9A 1WLXA 2Z6EA 4AQFC 5HAXA 4YHJA 3NBXX 3SOLA 1E1HB 2VKJA 3MZKB 5HYAA 4PJNA 3Q5WA 3W15B 4ZS2A 1QUUA 4GYSA 2WMNA 3CX8B 4UVCB 2VKHA 4ZI2C 3BK9A 3RYFE 3ZCIA 1ZKEA 3U78A 2UXNB 3GN5A 3KVBA 5FY0A 1MIYA 2MYSA 3IEEA 3VHLA 4EB6E 3GN5B 4EIWA 3JC6D 2J1DG 3E08A 2X9WA 5FYMA 3RYCE 3CVRA 5FXZA 4IDZA 2ZMAA 4OK0A 1YKHB 3PUQA 3VU7H 1BR0A 2D5UA 4EYYR 4M1PA 2WSSV 2KNDA 2WMOA 3EDUA 5LCYA 5KDMC 2KZ7B 5FXWA 3ZYKA 1MNDA 4P0AA 2DHRA 3IF8B 4IE4A 4ANJA 4B6XA 4NUVA 3V5SA 4MHCA 4YLHA 1FMVA 3CMLA 3UUXB 5LGUB 3MACA 2C5KT 1BR2A 2NOXA 3ZJ2A 2V7IA 5M4YA 4PFOA 4QXBB 3ZCJA 5FNVE 2E9XA 2QA7A 1D1CA 2E9XB 4JEUB 4A56A 3ESLA 4O2AE 3N2GE 3KV6A 2W0GA 1UX5A 4OYJA 1WYCA 3CQGB 3QUJA 4E7ZA 3F31A 4YFSA 4ZI3D 3O1JA 3OYZA 4UELA 1NWMX 4JLEA 4GOUA 2C0SA 3LBXA 5L3FB 3SWHA 1WRDA 2L8KA 3LBXB 5J1GA 2CWYA 2V7KA 2DWGA 1HCIA 3FBLA 2VKDA 1IAPA 2NP9A 2YK0A 3RC8A 2A3DA 3OBVE 3ZEFB 2XAJB 5JDLA 4WNKA 3MXZA 2V7JA 4U72A 3HI2A 4GK0E 3U3IA 3AVRA 4AKRB 1LVFA 1FMWA 1QSDA 2ODVA 4PJLA 3N9PA 4OFZA 4V1Av 1G73A 4AKIA 1LKXA 4N78D 4QXHB 2ZM0A 5E0OA 2ODUA 5JR9A 2LOPA 4AKHA 2KWHA 5JR9B 5FMNA 2Y8DA 4FI5A 4U74A 4TV8E 5EK3A 2HH7A 3C4WA 4JUYA 2CE7A 1US7B 3B57A 3RH3A 4TN7B 2Q9QD 2VWAA 2IW5B 3UTKA 1HS7A 5JREA 3N2KE 3P8CD 2LSYA 4O4HE 3L3PA 3J7Yq 2L9QA 5JDHA 2IC9A 2P9BA 4NUUA 4X1IE 5DQVA 4C91A 3LK3B 5A1LA 4GK5E 4PFPA 4CI3B 5LJMA 4CXYA 4H9QC 4KBMB 5F8PA 5KMGP 5LGNB 2N1GA 4ISTA 5CA1E 2GK9A 3CQCB 5JDFA 3B13A 2X9XA 2CLYB 2CXFA 4KP3C 4WBOA 1G8XA 3R6NA 4L0RA 2KMFA 4DMVA 4EOZB 3C4XA 4UV9B 5LHIB 5CB4E 3WAKA 3N9NA 4EZHA 3C98B 2KT9A 1CUNA 2CEAA 4ERRA 3NZPA 4QKNA 2WBLA 3K3QC 4Z8XA 3CPZA 2VB6A 4PK6A 4EXTA 5J2UE 3T8OA 4CXXA 4O4IE 4WBNE 5HXSA 3PUGA 2JMHA 2LSGA 3N9LA 3HKCE 5ADXL 4AQGA 1D0ZA 3ZMVB 5LGTB 2KWIB 2CCQA 1S35A 4P09A 4OHFA 4UVAB 3C4ZA 5HXEA 3N9OA 4PJJA 2XQYA 4H63V 4AI6A 2NW8A 3Q9DA 2W00A 2BVLA 5JDQA 3C64A 3BQIA 1SHZC 2EHOD 3S4UA 4H9RC 2HPLA 3HA4A 2X9HA 4H9PC 3FXEB 5LP6E 2V7MA 3DP7A 2PFVA 4ILUA 4UEMA 4ZI2D 3KBTA 2CWOA 4CZZB 2UXXB 5DQWA 2C5JA 4JEHB 5LHHB 1ZV4X 2A2FX 3GMIA 2C5IT 4MLKA 3Q5XA 4QWNB 2XAHB 4ASKA 3FB2A 5LXTE 3IHRA 2H7VC 3AAAB 5TAOA 5J2TE 3K3NA 3VKGA 2LJLA 3PDYA 4MFRA 3F57A 4I55E 2RA1A 2HPJA 1AJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PBI A;  3QC9 A;  3T8O A;  1HTJ F;  3C50 A;  3C51 A;  2A72 A;  4YHJ A;  4GOU A;  4WBO A;  3C4Z A;  2DLR A;  1ZV4 X;  2I59 A;  3C4X A;  2ACX A;  3CX8 B;  4L9I A;  3C4W A;  3AB3 B;  1IAP A;  4IGU A;  4PNI A;  3CX6 B;  1SHZ C;  2ES0 A;  3CX7 B;  4WNK A; 
#chains in the Genus database with same CATH topology
 2LM2 A;  5CA0 E;  4HFI A;  4DR1 T;  3ZYL A;  4X65 T;  2WM9 A;  4EV6 A;  1BR1 A;  2BG9 C;  3RIF A;  3DJB A;  2D2S A;  4ZZB A;  4CN6 A;  3AE5 A;  3OJA A;  3RKO A;  1XDP A;  3LSV A;  3QB5 A;  3AEA A;  5J0Z A;  2LHR A;  5LYJ E;  2XAG B;  4K0K T;  2X68 A;  1MNE A;  1IZN B;  2W2U A;  1KF6 A;  2SPC A;  1IBL T;  2Y6X A;  2JPF A;  5FXV A;  4GIW A;  3UT5 E;  1HR0 T;  2JRK A;  5CGM A;  4CI1 B;  5F5W A;  3PTR B;  4UF0 A;  2E8I A;  4CXW A;  5JRC A;  4PK4 A;  2HN2 A;  2LM9 A;  4HN9 A;  3OTO T;  3N9M A;  1VCT A;  4GYR A;  4JI2 T;  4DBR A;  4QX7 B;  1T7S A;  3AED A;  3KDS E;  1UGO A;  4ZS3 A;  2X66 A;  1WFD A;  3N2O A;  2XY8 B;  1KNP A;  4TWF A;  3ZT5 A;  2M67 A;  2WDV A;  3PUA A;  4ILC A;  3VRB A;  3CIR A;  4ZI7 E;  2DI4 A;  4H63 H;  5C8Y E;  2XAQ B;  3KIN B;  5AFU L;  5AQH B;  4CN1 A;  2AXD S;  3T1H T;  4NIQ A;  2IUB A;  3PU3 A;  1IBM T;  5AQU B;  2CMR A;  1J5E T;  5FXX A;  1KEY A;  3FZL B;  2UUB T;  1MMN A;  4OYK A;  3QK6 A;  3ZJ1 A;  1U5P A;  2B1E A;  2D0U A;  1NEN A;  2DCF A;  3K3O A;  3KV9 A;  4YHH T;  3C51 A;  4UIG A;  1R8I A;  3ZPO A;  3RQW A;  2W4X A;  3GWH A;  2BKP A;  3ZLI A;  3O1I A;  4XZC A;  2I59 A;  4TNV A;  4DR3 T;  2V5D A;  3PE0 A;  5AQG B;  2QVA A;  3ZSS A;  5HEG A;  2VKO A;  4H9O C;  1UCU A;  4TUY E;  4IDQ A;  4U31 A;  2F4V T;  1HX8 A;  1HFA A;  4LML A;  2WDR A;  4G2A A;  3PUZ F;  5HWX A;  4NXN T;  5L3B B;  1M62 A;  5HEO A;  4HFC A;  1UUS A;  4G63 A;  4J2C A;  2Q9Q C;  2E9X D;  1W0A A;  3UQ7 A;  3ONL C;  5CFB A;  4Z91 A;  3GA8 A;  2YU2 A;  2XAS B;  4BJM A;  2IC6 A;  2PG8 A;  2LSJ A;  5FY1 A;  3RKG A;  1YW0 A;  3ABV A;  5LG3 A;  1I6Z A;  3J9X 1;  4HFV A;  1OXZ A;  2WU2 A;  2IDO B;  4IL4 A;  4H9N C;  3ZMZ B;  4BAY B;  2W66 A;  3AE8 A;  2EHO C;  3MZK B;  5IUX A;  2XQ9 A;  4QH1 A;  3W15 B;  3ZST A;  4ZS2 A;  3OPC A;  4DR7 T;  3ZCI A;  3GN5 A;  2MYS A;  4EB6 E;  3JC6 D;  2J1D G;  5FYM A;  3TLV A;  2ZMA A;  2BG9 B;  5HEU A;  5KDM C;  3LDQ B;  5LCY A;  3Q5E A;  1DU2 A;  2DHR A;  3IF8 B;  3AEG A;  2UXC T;  3ZJ2 A;  5M4Y A;  5FNV E;  4DR5 T;  2A9U A;  3JAE A;  3CQG B;  4E7Z A;  3O1J A;  1N33 T;  4GOU A;  2L8K A;  3LBX B;  3QOF A;  2V7K A;  1HCI A;  1IAP A;  2HHH T;  1N32 T;  3P4R A;  2XAJ B;  3MXZ A;  4GK0 E;  4AKR B;  1LVF A;  4PJL A;  3N9P A;  4OFZ A;  5ABE A;  2XSB A;  4AKI A;  1LKX A;  4QXH B;  3X1D A;  3A7M A;  2BS2 A;  3VR8 A;  5EK3 A;  3RH3 A;  3P8C D;  2LSY A;  5AQQ B;  3ZT6 A;  4X1I E;  2PTF A;  4C91 A;  3LK3 B;  5A1L A;  4GK5 E;  4CI3 B;  4WZX A;  5F8P A;  4YTN A;  1CHU A;  2KSR A;  4WBO A;  1G8X A;  3C4X A;  5CB4 E;  4EZH A;  4WYV A;  3TLU A;  3NVO A;  2WBL A;  4PK6 A;  4EXT A;  4CXX A;  4IRE A;  5ADX L;  2KWI B;  2CCQ A;  4Z90 A;  3C4Z A;  4PJJ A;  2XQY A;  3UQ4 A;  2W00 A;  3BQI A;  3S4U A;  5L4H A;  3FXE B;  2J62 A;  4AIS A;  4ZI2 D;  5DQW A;  2XPK A;  1E2A A;  4UR9 A;  4ASK A;  2XAH B;  3FB2 A;  3IHR A;  3AAA B;  5J2T E;  3F57 A;  4I55 E;  1FIO A;  2JQQ A;  2LSI A;  4OX9 T;  2W61 A;  4DBQ A;  3D0T A;  2BZB A;  3KV5 A;  1HNX T;  2LKH A;  3AE4 A;  3EUH A;  2H3R A;  4YSZ A;  2Q9Q B;  4CI2 B;  1IJ6 A;  1FEW A;  1UK5 A;  4HFH A;  1Z8U A;  2ES0 A;  2V26 A;  4YSY A;  4AKG A;  2XQ5 A;  3RX6 A;  3ZN1 B;  5FY7 A;  2LOS A;  3VKH A;  2IML A;  5L3E B;  3ZC1 A;  2CPT A;  3RRC A;  2E9X C;  4DMW A;  2L3L A;  2K24 A;  5LG4 A;  3CK6 A;  5JDG A;  4DO0 A;  4XAX B;  4L5G A;  4A97 A;  1LRZ A;  3H3M A;  1LVK A;  4PK5 A;  2X51 A;  4O4J E;  4ZOL E;  4X5T A;  3EHZ A;  1IJ5 A;  4TZ4 C;  2NW9 A;  1T8B A;  2YDQ A;  2EHO B;  5LMU T;  2ACX A;  3P50 A;  2VK9 A;  3AA6 B;  2G0U A;  3P4S A;  3CKD A;  1MMD A;  1XZY A;  5H6Q B;  5EK4 A;  2LKG A;  1S94 A;  3SRZ A;  3V5U A;  4I0U A;  4DVD A;  4F6R C;  4P1N A;  2XTL A;  2YEV C;  4PNI A;  3ETU A;  4DND A;  5ETW A;  2CLY C;  4B3R T;  4HTE A;  3JC6 C;  1UX4 A;  4ILB A;  2A72 A;  3I1A A;  5HXH A;  1ZHC A;  3KVA A;  2YDS A;  3RLF F;  2ZM8 A;  2BBJ A;  1HG2 A;  3CQX C;  2WZH A;  2V6Y A;  3AXJ A;  4IT4 A;  2X0H A;  3N5L A;  4IDP A;  2LEH A;  4YJ2 E;  2UXD T;  3AVS A;  3I0Q A;  4P0B A;  2LHN A;  2ZM2 A;  3NRY A;  2FUP A;  2YKS A;  4YSX A;  3A5X A;  1WR6 A;  5ABF A;  2BKO A;  1V9D A;  4CN4 A;  1X79 A;  3RI5 A;  2X0L B;  2V7L A;  5LMN T;  3HKD E;  2VAS A;  4EYU A;  4UV8 B;  3AA7 B;  5HWY A;  3FZM B;  2XAF B;  1KNZ A;  3ZMS B;  3QB5 K;  3O9X A;  4X66 T;  4TNW A;  5FKY A;  3EVY A;  2R6G F;  3CWZ B;  3WAJ A;  4YTP A;  3FZF B;  5AQL B;  1YXR A;  3HR0 A;  3PUR A;  1OED E;  3CX7 B;  5L3C B;  2XZE A;  3FHN A;  2MAW A;  1N34 T;  3C50 A;  1XNQ T;  3KFW X;  3FXD B;  2K5B B;  2DNX A;  1O3X A;  2MTQ A;  3TLW A;  5HCM A;  3ONX A;  3E0Z A;  5FVL A;  3SS1 A;  3EDV A;  4BJN A;  5LBQ B;  3KV4 A;  3M65 A;  5DAB A;  3ANW B;  4C90 A;  5AQS B;  3SOL A;  4PJN A;  2UUC T;  3CX8 B;  4ZI2 C;  2YN6 A;  4JI8 T;  2XSA A;  1ZKE A;  2UXN B;  1MIY A;  3IEE A;  4EIW A;  5FXZ A;  2BG9 E;  4IDZ A;  1YKH B;  4JI3 T;  2WSS V;  3EDU A;  2KZ7 B;  4YY3 T;  4IE4 A;  4B6X A;  4DV2 T;  3UUX B;  3MAC A;  4HWH A;  2C5K T;  2D9D A;  2NOX A;  4HWI B;  3ZCJ A;  4JI5 T;  4EED A;  2QA7 A;  3TLS A;  2E9X B;  1L0V A;  1UX5 A;  4OYJ A;  5FL0 A;  4ZI3 D;  4NXM T;  1NWM X;  2C0S A;  3RIU A;  3SWH A;  4U2Z A;  3NWI A;  4EEB A;  1UUR A;  2NP9 A;  2YK0 A;  3OBV E;  3ZEF B;  4WNK A;  2VQE T;  4U72 A;  2IIU A;  3HI2 A;  3AVR A;  5CJ5 A;  2H89 A;  5E0O A;  4COF A;  5JR9 A;  4AKH A;  1YQ4 A;  4TV8 E;  2HH7 A;  3C4W A;  3OVU A;  2CE7 A;  3B57 A;  3RF1 A;  3UU6 A;  5JRE A;  3L3P A;  2L9Q A;  5JDH A;  2P9B A;  3RIU C;  4QH5 A;  5DQV A;  4PFP A;  2WU5 A;  2N1G A;  5CA1 E;  2GK9 A;  2XM2 A;  3B13 A;  2CLY B;  4KP3 C;  3R6N A;  4ZXL A;  2XQA A;  4UV9 B;  3WAK A;  3C98 B;  1CUN A;  4ERR A;  3NZP A;  3FZK B;  4Z8X A;  2VB6 A;  2JQ9 A;  3T8O A;  2WZI A;  4QH4 A;  4O4I E;  3PUG A;  5LGT B;  1J1J A;  4LF9 T;  5HXE A;  3N9O A;  4H63 V;  4LF5 T;  5JDQ A;  3L8R A;  4H9R C;  2X9H A;  2YOE A;  5LP6 E;  2V7M A;  3DP7 A;  4ILU A;  2CWO A;  2FJD A;  2VVS A;  3SFD A;  5LHH B;  3GMI A;  2C5I T;  4MLK A;  3Q5X A;  5LXT E;  2LRK A;  1GQE A;  2JQK A;  2HN1 A;  5HCJ A;  5TAO A;  4MFR A;  3RHW A;  2RA1 A;  1Y64 B;  3PV0 F;  3ZMU B;  4O4L E;  4DUY T;  2JIW A;  4A98 A;  5LOV E;  4I50 E;  5LJN A;  4IHJ E;  5LHG B;  1VRB A;  4PAG A;  5GON E;  3CX6 B;  2DWK A;  4KI0 F;  1D0Y A;  3RYH E;  4LMJ A;  4DID B;  2OA5 A;  2D0T A;  4HGA A;  4A5X A;  5LBM A;  1W0B A;  2WWU A;  2CXL A;  3DTO A;  2YU1 A;  5H6R B;  3WI3 A;  5FP3 A;  3HKE E;  1HX1 B;  3RPU A;  2CA5 A;  3VRA A;  4IDO A;  1MMA A;  2WB5 A;  3Q2M A;  3RYI E;  5AQP B;  5AQT B;  1YD8 G;  2V6X A;  2BS3 A;  4UF0 B;  2KIN B;  5JRC B;  4O2B E;  3LK2 B;  4JBW F;  3UU5 A;  2XM1 A;  2RPA A;  3QC9 A;  5BMV E;  1Z0P A;  4E7S A;  3ZC0 A;  3LG7 A;  4I43 B;  2LE8 A;  3PJA A;  2VUR A;  5AQI B;  4HEA A;  2WS3 A;  5IYZ E;  3P7I A;  4BA9 A;  3NRX A;  2DL1 A;  4GKJ T;  4QX8 B;  2CRB A;  4QXC B;  3IBP A;  3L09 A;  3HL6 A;  2PBI A;  5AQF B;  2UXB T;  1HF8 A;  3PU8 A;  5AQV B;  2VQF T;  3LFM A;  4U2Y A;  3BQL A;  2NTY A;  5JDN A;  4K0U A;  4U33 A;  4ADZ A;  1WCR A;  2XUE A;  3UUN A;  4B3S T;  4XBF B;  4YTM A;  5LA6 E;  4PW8 A;  4IE6 A;  4KMC A;  3JAD A;  1H7C A;  2E5V A;  1JNR A;  3I9W A;  1M7K A;  1U4Q A;  3P4P A;  1EZ3 A;  2M6B A;  2Y48 B;  3EI0 A;  4HE8 A;  3RC3 A;  2WDQ A;  4YJ3 E;  4KUM B;  4ZI3 C;  3G06 A;  2KLQ A;  1BR4 A;  4U3C A;  2V5C A;  2K9A A;  3MJX A;  3UU3 A;  1QLB A;  2WAU A;  5DJQ C;  2I6H A;  1MIW A;  2CM0 A;  3ZYM A;  2E5L T;  2N9D A;  4MBQ A;  1HNZ T;  4WW0 A;  3UFE A;  1KK7 A;  4U7I A;  4TWD A;  5JVD E;  3MKD A;  3ONJ A;  3MA9 A;  4IL9 A;  2NWB A;  3AAI A;  1B7T A;  3AE2 A;  3K1S A;  2X9Y A;  4HFE A;  4HWD A;  4L9I A;  1OED A;  2W63 A;  4HKA A;  3MK7 C;  3AAE B;  4KHP T;  5HXC A;  3ETV A;  3RRW A;  2E2A A;  2UU9 T;  5ABH A;  4NPP A;  2BDE A;  4LMK A;  2DLR A;  5AQN B;  3HKB E;  2XJ7 A;  2FBW A;  4AKL A;  4LF4 T;  5IHY A;  3FBZ A;  2I0M A;  2CHO A;  3PUV F;  4YHJ A;  2LRL A;  1E1H B;  5HYA A;  3Q5W A;  1OED C;  2BKN A;  2WMN A;  4UVC B;  3RYF E;  3U78 A;  3GN5 B;  1WR0 A;  2BG9 A;  4OK0 A;  2D5U A;  4EYY R;  4M1P A;  2KND A;  3PJA J;  2JQH A;  4P0A A;  1MND A;  1NEK A;  4ANJ A;  3PUW F;  4YLH A;  3Q5D A;  3AEF A;  5C2T A;  2LLY A;  4HWF A;  4A56 A;  2W0G A;  1E7P A;  2X0Y A;  1WYC A;  1XWM A;  3M3Z B;  2J4G A;  4UEL A;  3LBX A;  5L3F B;  5J1G A;  2OV9 A;  3FBL A;  2VKD A;  5JDL A;  4F8H A;  5L47 A;  5LB7 B;  4X64 T;  1FMW A;  2ODV A;  1G73 A;  3P4Q A;  1J5W A;  4N78 D;  2ZM0 A;  2ODU A;  4FI5 A;  2AE9 A;  2WCA A;  4U74 A;  3RIA A;  4JUY A;  4TN7 B;  2IW5 B;  5C3J A;  4IDN A;  1I94 T;  4NUU A;  4CXY A;  4H9Q C;  4KBM B;  5KMG P;  5LGN B;  4IST A;  4DR6 T;  4B3M T;  3UFG A;  5JDF A;  4L0R A;  4DMV A;  3L39 A;  2KT9 A;  2CEA A;  3EAB A;  4EGW A;  4QKN A;  3ZT7 A;  3CPZ A;  5J2U E;  4WBN E;  2WQY A;  3N9L A;  3HKC E;  1S35 A;  4P09 A;  3AE1 A;  4OHF A;  2NW8 A;  1ZP0 A;  3Q9D A;  2CHN A;  4JYA T;  3C64 A;  4JI4 T;  2HPL A;  3HA4 A;  1XDO A;  3UU8 A;  4CZZ B;  2UXX B;  4HFB A;  2C5J A;  2M6I A;  4JEH B;  4B3T T;  5BR8 T;  2QYW A;  2XQ4 A;  4QWN B;  3SFE A;  2H7V C;  3VKG A;  2LJL A;  1AJ3 A;  4DV6 T;  3UUB A;  3AEB A;  4I4T E;  1XMQ T;  1VOM A;  2LT3 A;  2W67 A;  2CBI A;  3UUL A;  2Q9Q A;  2MBG A;  5L3D B;  4CQI A;  5JTG A;  5JQG E;  4ZHQ E;  4GKK T;  2UUA T;  2ZM6 T;  4X1Y E;  4IE7 A;  5AQM B;  1ZEE A;  4MAL A;  5AQR B;  3H3A A;  1WYB A;  3UUM A;  2H7O A;  5L4E A;  2V1D B;  4LFA T;  5FVK A;  3LJC A;  1SA0 E;  3K8P C;  3ZN0 B;  3EAM A;  2EHO A;  2K48 A;  2BVM A;  1D1A A;  4EZ4 A;  3I0O A;  3I9Y A;  4TX5 A;  3TKL B;  1KFY A;  1OED B;  2FJB A;  3T1Y T;  4TWH A;  3P4W A;  4Q25 A;  4EAH A;  4IE0 A;  4YT0 A;  3LK4 2;  5JR9 C;  5L3G B;  5AQO B;  4IE5 A;  3AEC A;  4HWC A;  4PJM A;  5AQK B;  3ZMT B;  1W9R A;  5KXJ A;  2XQ7 A;  3PUY F;  4YXD A;  1D0X A;  2FJE A;  3F2E A;  3IA3 A;  2IAK A;  4O8S A;  2NTX A;  2CXD A;  3VR9 A;  2PJQ A;  3FZH B;  3KBU A;  3AE6 A;  3QNU A;  4LF7 T;  3RQU A;  2V6Y B;  3AXJ B;  1HTJ F;  4ZEY A;  1W09 A;  1MIV A;  4ISS A;  2VL8 A;  2W62 A;  3O4X E;  4KX6 A;  1HG5 A;  4X20 E;  4UVB B;  1FJG T;  5JH7 E;  4DV7 T;  2YIN A;  2LSK A;  3AB3 B;  4LFC T;  4IGU A;  3AE3 A;  3N9Q A;  5ABF B;  5HXR A;  1N36 T;  1MMG A;  2MOZ A;  4AXP A;  3NKZ A;  5KX5 E;  1NAF A;  2XQ8 A;  5F3J A;  2ACZ A;  4JI6 T;  4H9S E;  1HNW T;  3AA1 B;  4HFD A;  3ZKR A;  2WWV A;  3RGL A;  2XHE B;  3OKQ A;  2JMK A;  5EK2 A;  4IIJ E;  3E22 E;  2ZLY A;  1YKE B;  3NZQ A;  5LNK A;  3AA0 B;  2QRX A;  3R84 B;  4AQF A;  4TV9 E;  2NW7 A;  4X1K E;  2IHR 1;  3BQK A;  4UXN B;  2WY2 A;  1OWA A;  3H37 A;  5JDM A;  1D1B A;  2XQ3 A;  3OYX A;  4DV4 T;  2RP4 A;  4QHO A;  4LF6 T;  4DV1 T;  2N2N A;  2X67 A;  3O1H A;  1YQ3 A;  5L2L A;  2QGS A;  1T98 A;  3PUS A;  5EZY E;  2KXP B;  3ANW A;  4FJO A;  4DV5 T;  2JJ9 A;  1WLX A;  2Z6E A;  4AQF C;  3A8Y C;  5HAX A;  3NBX X;  4X62 T;  2VKJ A;  4DR4 T;  4LFB T;  1QUU A;  4GYS A;  2VKH A;  3BK9 A;  1ZOY A;  2V8S V;  5FY0 A;  3KVB A;  2WP9 A;  3VHL A;  3E08 A;  3RYC E;  2X9W A;  3UU4 A;  3CVR A;  3PUQ A;  3VU7 H;  1BR0 A;  2WMO A;  5FXW A;  3ZYK A;  2J47 A;  4NUV A;  3V5S A;  4MHC A;  5LGU B;  1FMV A;  3CML A;  1BR2 A;  2V7I A;  4PFO A;  4QXB B;  2E9X A;  3TLT A;  3PUX F;  1D1C A;  4JEU B;  3AE7 A;  3ESL A;  4O2A E;  3N2G E;  3KV6 A;  4DUZ T;  3QUJ A;  3F31 A;  4YFS A;  1KNR A;  3OYZ A;  4JLE A;  1WRD A;  1XNR T;  2CWY A;  2DWG A;  3RC8 A;  4ZZC A;  2A3D A;  1SUM B;  2K3W A;  2CBJ A;  2V7J A;  2YDR A;  3B5M A;  3U3I A;  1QSD A;  4V1A v;  3AEE A;  4JV5 T;  2FJA A;  5HEH A;  2LOP A;  2KWH A;  5JR9 B;  5FMN A;  2Y8D A;  1X9B A;  4LF8 T;  1US7 B;  4JI7 T;  3UTK A;  2Q9Q D;  2VWA A;  1HS7 A;  3N2K E;  4O4H E;  3J7Y q;  2IC9 A;  3AE9 A;  5LJM A;  2XQ6 A;  1SE7 A;  2H88 A;  2NR4 A;  3CQC B;  2X9X A;  2CXF A;  1JNZ A;  5ABG A;  4AQY T;  2KMF A;  4EOZ B;  2BBH A;  4DR2 T;  5LHI B;  1Y01 A;  3N9N A;  4KHZ F;  4JI1 T;  3K3Q C;  5HXS A;  2OLT A;  2JMH A;  4DV0 T;  1VCS A;  5AQJ B;  4U7Y A;  2LSG A;  4AQG A;  1D0Z A;  3ZMV B;  5IWA T;  2BS4 A;  4JI0 T;  4UVA B;  1T72 A;  4AI6 A;  5FL1 A;  2MPK A;  2BVL A;  4DV3 T;  1XMO T;  1SHZ C;  2EHO D;  4H9P C;  2VVN A;  2PFV A;  4UEM A;  5HEJ A;  3KBT A;  4ILA A;  4AIU A;  1IBK T;  2B76 A;  3JAF A;  3JCF A;  1ZV4 X;  2A2F X;  2VL0 A;  3K3N A;  3PDY A;  2HPJ A; 
#chains in the Genus database with same CATH homology
 1FIO A;  1Y64 B;  4I4T E;  1VOM A;  2JQQ A;  3ZMU B;  5CA0 E;  2LSI A;  2LT3 A;  2W61 A;  4O4L E;  5LOV E;  4DBQ A;  4I50 E;  3D0T A;  2BZB A;  3KV5 A;  3ZYL A;  5LJN A;  3UUL A;  2Q9Q A;  3EUH A;  4IHJ E;  2H3R A;  2Q9Q B;  2MBG A;  1IJ6 A;  4CI2 B;  2WM9 A;  5LHG B;  1BR1 A;  5L3D B;  1VRB A;  1FEW A;  4CQI A;  3DJB A;  2D2S A;  4PAG A;  5GON E;  5JQG E;  3CX6 B;  2ES0 A;  2V26 A;  2DWK A;  4ZHQ E;  1D0Y A;  3RYH E;  2OA5 A;  2D0T A;  4HGA A;  4AKG A;  3RX6 A;  3OJA A;  3ZN1 B;  5FY7 A;  3RKO A;  5LBM A;  4X1Y E;  2LOS A;  2WWU A;  3DTO A;  2CXL A;  3VKH A;  2YU1 A;  4IE7 A;  5H6R B;  5L3E B;  3WI3 A;  3ZC1 A;  1ZEE A;  2LHR A;  5LYJ E;  2XAG B;  5FP3 A;  3RRC A;  3HKE E;  2E9X C;  4DMW A;  4MAL A;  2L3L A;  2K24 A;  5LG4 A;  3RPU A;  2CA5 A;  3H3A A;  1WYB A;  2X68 A;  2H7O A;  3UUM A;  5JDG A;  1MNE A;  1MMA A;  4DO0 A;  4XAX B;  1IZN B;  2V1D B;  4L5G A;  1LRZ A;  2SPC A;  2Y6X A;  2JPF A;  1LVK A;  4PK5 A;  5FXV A;  4GIW A;  3Q2M A;  2X51 A;  3UT5 E;  3RYI E;  3LJC A;  2JRK A;  1SA0 E;  4O4J E;  4ZOL E;  4CI1 B;  3PTR B;  3K8P C;  4UF0 A;  1IJ5 A;  1YD8 G;  4TZ4 C;  3ZN0 B;  2E8I A;  2EHO A;  2K48 A;  2BVM A;  4UF0 B;  2NW9 A;  4CXW A;  5JRC A;  2KIN B;  1D1A A;  2EHO B;  4PK4 A;  5JRC B;  4EZ4 A;  2ACX A;  2VK9 A;  3I0O A;  3AA6 B;  2LM9 A;  3I9Y A;  4TX5 A;  3TKL B;  4HN9 A;  4O2B E;  3LK2 B;  2G0U A;  3N9M A;  3CKD A;  4GYR A;  1MMD A;  4DBR A;  4QX7 B;  5H6Q B;  5EK4 A;  3QC9 A;  4EAH A;  5BMV E;  1Z0P A;  4IE0 A;  4E7S A;  3LG7 A;  4I43 B;  3LK4 2;  2LE8 A;  3KDS E;  4ZS3 A;  3ZC0 A;  5JR9 C;  2X66 A;  5L3G B;  4HEA A;  1S94 A;  3N2O A;  4IE5 A;  3SRZ A;  5IYZ E;  3P7I A;  3V5U A;  4PJM A;  4BA9 A;  3ZMT B;  3NRX A;  4DVD A;  2M67 A;  3PUA A;  4F6R C;  4ZI7 E;  2DI4 A;  4H63 H;  2XTL A;  5C8Y E;  2XAQ B;  1D0X A;  2YEV C;  3KIN B;  4QX8 B;  5AFU L;  4PNI A;  4QXC B;  3IBP A;  3ETU A;  3F2E A;  3L09 A;  3HL6 A;  4DND A;  2PBI A;  5ETW A;  2CLY C;  3PU3 A;  2IAK A;  4O8S A;  4HTE A;  2NTX A;  3JC6 C;  1HF8 A;  3PU8 A;  1UX4 A;  2CMR A;  2CXD A;  2A72 A;  2PJQ A;  3I1A A;  3LFM A;  3KBU A;  5FXX A;  5HXH A;  1ZHC A;  3KVA A;  3BQL A;  2NTY A;  5JDN A;  1MMN A;  4K0U A;  4OYK A;  4ADZ A;  2ZM8 A;  3QK6 A;  3ZJ1 A;  1U5P A;  2B1E A;  2XUE A;  2D0U A;  3UUN A;  4XBF B;  1HG2 A;  3CQX C;  5LA6 E;  2DCF A;  3K3O A;  3KV9 A;  4PW8 A;  3N5L A;  2LEH A;  4IE6 A;  1HTJ F;  4KMC A;  3C51 A;  4UIG A;  1MIV A;  1H7C A;  3ZPO A;  3I9W A;  1U4Q A;  4YJ2 E;  3GWH A;  4ISS A;  1EZ3 A;  2Y48 B;  2VL8 A;  3ZLI A;  3AVS A;  2W62 A;  3I0Q A;  4P0B A;  2LHN A;  2ZM2 A;  3NRY A;  3O1I A;  1HG5 A;  3O4X E;  4HE8 A;  4X20 E;  4KUM B;  4XZC A;  2I59 A;  4UVB B;  4YJ3 E;  4ZI3 C;  3RC3 A;  5JH7 E;  2KLQ A;  2YIN A;  2LSK A;  3A5X A;  1BR4 A;  3AB3 B;  1WR6 A;  3PE0 A;  4IGU A;  2K9A A;  3MJX A;  3N9Q A;  5HXR A;  2WAU A;  5DJQ C;  1V9D A;  1MMG A;  2MOZ A;  1X79 A;  4AXP A;  2X0L B;  2V7L A;  3HKD E;  2VKO A;  4H9O C;  5KX5 E;  1NAF A;  1UCU A;  4TUY E;  1MIW A;  2CM0 A;  3ZYM A;  5F3J A;  2VAS A;  2N9D A;  1HX8 A;  1HFA A;  4H9S E;  4G2A A;  4EYU A;  4UV8 B;  3AA1 B;  3AA7 B;  5HWX A;  5HWY A;  5L3B B;  4MBQ A;  2XAF B;  4WW0 A;  3UFE A;  2XHE B;  1KNZ A;  3ZMS B;  1KK7 A;  3OKQ A;  2JMK A;  4G63 A;  5EK2 A;  4IIJ E;  4J2C A;  3E22 E;  2ZLY A;  2Q9Q C;  2E9X D;  3O9X A;  1YKE B;  3NZQ A;  5LNK A;  5JVD E;  3MKD A;  3AA0 B;  3EVY A;  3MA9 A;  3CWZ B;  2NWB A;  3AAI A;  1B7T A;  3WAJ A;  2X9Y A;  3R84 B;  4AQF A;  4TV9 E;  2NW7 A;  4L9I A;  4X1K E;  3GA8 A;  2YU2 A;  3BQK A;  4UXN B;  2XAS B;  3HR0 A;  3PUR A;  4BJM A;  1OWA A;  2W63 A;  3CX7 B;  3H37 A;  4HKA A;  5JDM A;  3MK7 C;  1D1B A;  3AAE B;  5L3C B;  2IC6 A;  3FHN A;  2PG8 A;  2LSJ A;  5FY1 A;  3C50 A;  3KFW X;  1YW0 A;  3OYX A;  3FXD B;  2RP4 A;  2K5B B;  2DNX A;  3ETV A;  5HXC A;  3RRW A;  3J9X 1;  1O3X A;  2MTQ A;  4HFV A;  1OXZ A;  4QHO A;  2BDE A;  2DLR A;  2N2N A;  2X67 A;  3HKB E;  3O1H A;  3ONX A;  3E0Z A;  5L2L A;  3SS1 A;  4H9N C;  2QGS A;  1T98 A;  3EDV A;  4AKL A;  3PUS A;  5EZY E;  3ZMZ B;  4BJN A;  5LBQ B;  3KV4 A;  5IHY A;  3M65 A;  2KXP B;  4BAY B;  3ANW A;  3FBZ A;  5DAB A;  4FJO A;  3ANW B;  4C90 A;  2EHO C;  2JJ9 A;  1WLX A;  2Z6E A;  4AQF C;  5HAX A;  4YHJ A;  3NBX X;  3SOL A;  1E1H B;  2VKJ A;  3MZK B;  5HYA A;  4PJN A;  3Q5W A;  3W15 B;  4ZS2 A;  1QUU A;  4GYS A;  2WMN A;  3CX8 B;  4UVC B;  2VKH A;  4ZI2 C;  3BK9 A;  3RYF E;  3ZCI A;  1ZKE A;  3U78 A;  2UXN B;  3GN5 A;  3KVB A;  5FY0 A;  1MIY A;  2MYS A;  3IEE A;  3VHL A;  4EB6 E;  3GN5 B;  4EIW A;  3JC6 D;  2J1D G;  3E08 A;  2X9W A;  5FYM A;  3RYC E;  3CVR A;  5FXZ A;  4IDZ A;  2ZMA A;  4OK0 A;  1YKH B;  3PUQ A;  3VU7 H;  1BR0 A;  2D5U A;  4EYY R;  4M1P A;  2WSS V;  2KND A;  2WMO A;  3EDU A;  5LCY A;  5KDM C;  2KZ7 B;  5FXW A;  3ZYK A;  1MND A;  4P0A A;  2DHR A;  3IF8 B;  4IE4 A;  4ANJ A;  4B6X A;  4NUV A;  3V5S A;  4MHC A;  4YLH A;  1FMV A;  3CML A;  3UUX B;  5LGU B;  3MAC A;  2C5K T;  1BR2 A;  2NOX A;  3ZJ2 A;  2V7I A;  5M4Y A;  4PFO A;  4QXB B;  3ZCJ A;  5FNV E;  2E9X A;  2QA7 A;  1D1C A;  2E9X B;  4JEU B;  4A56 A;  3ESL A;  4O2A E;  3N2G E;  3KV6 A;  2W0G A;  1UX5 A;  4OYJ A;  1WYC A;  3CQG B;  3QUJ A;  4E7Z A;  3F31 A;  4YFS A;  4ZI3 D;  3O1J A;  3OYZ A;  4UEL A;  1NWM X;  4JLE A;  4GOU A;  2C0S A;  3LBX A;  5L3F B;  3SWH A;  1WRD A;  2L8K A;  3LBX B;  5J1G A;  2CWY A;  2V7K A;  2DWG A;  1HCI A;  3FBL A;  2VKD A;  1IAP A;  2NP9 A;  2YK0 A;  3RC8 A;  2A3D A;  3OBV E;  3ZEF B;  2XAJ B;  5JDL A;  4WNK A;  3MXZ A;  2V7J A;  4U72 A;  3HI2 A;  4GK0 E;  3U3I A;  3AVR A;  4AKR B;  1LVF A;  1FMW A;  1QSD A;  2ODV A;  4PJL A;  3N9P A;  4OFZ A;  4V1A v;  1G73 A;  4AKI A;  1LKX A;  4N78 D;  4QXH B;  2ZM0 A;  5E0O A;  2ODU A;  5JR9 A;  2LOP A;  4AKH A;  2KWH A;  5JR9 B;  5FMN A;  2Y8D A;  4FI5 A;  4U74 A;  4TV8 E;  5EK3 A;  2HH7 A;  3C4W A;  4JUY A;  2CE7 A;  1US7 B;  3B57 A;  3RH3 A;  4TN7 B;  2Q9Q D;  2VWA A;  2IW5 B;  3UTK A;  1HS7 A;  5JRE A;  3N2K E;  3P8C D;  2LSY A;  4O4H E;  3L3P A;  3J7Y q;  2L9Q A;  5JDH A;  2IC9 A;  2P9B A;  4NUU A;  4X1I E;  5DQV A;  4C91 A;  3LK3 B;  5A1L A;  4GK5 E;  4PFP A;  4CI3 B;  5LJM A;  4CXY A;  4H9Q C;  4KBM B;  5F8P A;  5KMG P;  5LGN B;  2N1G A;  4IST A;  5CA1 E;  2GK9 A;  3CQC B;  5JDF A;  3B13 A;  2X9X A;  2CLY B;  2CXF A;  4KP3 C;  4WBO A;  1G8X A;  3R6N A;  4L0R A;  2KMF A;  4DMV A;  4EOZ B;  3C4X A;  4UV9 B;  5LHI B;  5CB4 E;  3WAK A;  3N9N A;  4EZH A;  3C98 B;  2KT9 A;  1CUN A;  2CEA A;  4ERR A;  3NZP A;  4QKN A;  2WBL A;  3K3Q C;  4Z8X A;  3CPZ A;  2VB6 A;  4PK6 A;  4EXT A;  5J2U E;  3T8O A;  4CXX A;  4O4I E;  4WBN E;  5HXS A;  3PUG A;  2JMH A;  2LSG A;  3N9L A;  3HKC E;  5ADX L;  4AQG A;  1D0Z A;  3ZMV B;  5LGT B;  2KWI B;  2CCQ A;  1S35 A;  4P09 A;  4OHF A;  4UVA B;  3C4Z A;  5HXE A;  3N9O A;  4PJJ A;  2XQY A;  4H63 V;  4AI6 A;  2NW8 A;  3Q9D A;  2W00 A;  2BVL A;  5JDQ A;  3C64 A;  3BQI A;  1SHZ C;  2EHO D;  3S4U A;  4H9R C;  2HPL A;  3HA4 A;  2X9H A;  4H9P C;  3FXE B;  5LP6 E;  2V7M A;  3DP7 A;  2PFV A;  4ILU A;  4UEM A;  4ZI2 D;  3KBT A;  2CWO A;  4CZZ B;  2UXX B;  5DQW A;  2C5J A;  4JEH B;  5LHH B;  1ZV4 X;  2A2F X;  3GMI A;  2C5I T;  4MLK A;  3Q5X A;  4QWN B;  2XAH B;  4ASK A;  3FB2 A;  5LXT E;  3IHR A;  2H7V C;  3AAA B;  5TAO A;  5J2T E;  3K3N A;  3VKG A;  2LJL A;  3PDY A;  4MFR A;  3F57 A;  4I55 E;  2RA1 A;  2HPJ A;  1AJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...