4IGUA

Crystal structure of the rgs domain of cg5036
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
137
structure length
137
Chain Sequence
SQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLSRPAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG5036
publication title Double suppression of the G alpha protein activity by RGS proteins
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 52
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iguA00
4L9IA 3C4WA 4GOUA 2I59A 3CX8B 1IAPA 3C50A 4PNIA 3CX6B 2ES0A 2PBIA 2A72A 1ZV4X 4WBOA 4WNKA 3C4XA 2DLRA 3T8OA 4IGUA 3C51A 2ACXA 1HTJF 1SHZC 3AB3B 3QC9A 4YHJA 3CX7B 3C4ZA
chains in the Genus database with same CATH superfamily
3EI0A 5HEHA 2XQ6A 3C4WA 3NRXA 2QA7A 1HNZT 3H37A 3RQWA 4OX9T 1IJ6A 2XQYA 3I0OA 2QYWA 1IJ5A 5DQWA 1Y01A 2XSBA 1VRBA 3QC9A 3SFDA 5JR9A 1W09A 3ZCJA 1AJ3A 1U5PA 2X9WA 1O3XA 3CX8B 3OPCA 5JR9B 1WR6A 3RH3A 5ABHA 3AVRA 3MA9A 3QNUA 5HCMA 2H7VC 2GK9A 3RC3A 3RIUC 2L3LA 4UVCB 4TWFA 2PTFA 3P8CD 4DR2T 4QKNA 2VQET 3UT5E 3EAMA 2EHOD 4QXCB 1OWAA 5HXCA 5EZYE 4DV7T 4EXTA 1XMOT 1UX5A 2YDQA 3KBUA 3J7Yq 4NIQA 3LK2B 4ZEYA 5C3JA 2NOXA 4IE6A 4DV4T 2CWYA 4KP3C 2Z6EA 5FL0A 3C4XA 1E7PA 4KHPT 2CEAA 3P4RA 3JCFA 5AQGB 3GWHA 1HS7A 4PAGA 4ZXLA 2BVMA 4DV3T 4U7IA 3ZT7A 2ZM2A 4AQFC 4DUYT 2DWGA 2VKOA 3AE1A 1N34T 5JDLA 2CM0A 2MPKA 1W9RA 3VKHA 2XASB 3ZJ2A 1R8IA 3ZSTA 5LNKA 1JNRA 3KV6A 2I59A 2V6XA 5AFUL 2YINA 3PUZF 3PUWF 5AQUB 3EABA 4QH5A 5AQOB 2WB5A 3KVBA 4LFAT 2IW5B 3P50A 3RI5A 4CXWA 2BKOA 5FXZA 4ZZCA 4X66T 4H9RC 3LBXA 2KMFA 5JQGE 4DV5T 3RQUA 3FXEB 2WU5A 3LBXB 4LF5T 3RIAA 4KBMB 4KMCA 2WCAA 5L47A 3KFWX 4GIWA 2BBHA 2B1EA 3AEFA 2NW9A 2XAFB 2WBLA 4PFPA 1YKHB 2SPCA 4NXMT 3B57A 3HKBE 1MMDA 2DNXA 2DL1A 5L4EA 3HR0A 1HX8A 4U33A 4YHHT 4B3MT 3T1HT 4QXBB 2ZM8A 2CRBA 4L5GA 1KK7A 5FVLA 3AA6B 2W67A 3ANWA 4AKGA 1VCTA 3AVSA 3AAEB 3ANWB 2YN6A 4E7SA 3AE9A 2LT3A 3MXZA 4TN7B 3J9X1 5FL1A 3KVAA 4A98A 4DR7T 1FJGT 2CLYB 4KUMB 2RP4A 2D9DA 2WMOA 4U7YA 4IIJE 3Q5DA 2VL0A 4PJJA 5EK4A 4H9QC 5AQPB 5HEUA 4CI1B 1SE7A 3FBZA 4DIDB 1CUNA 3SFEA 4JI8T 3GN5A 3KV5A 2YKSA 4X65T 1NEKA 3MACA 4TZ4C 3GN5B 5L2LA 4HFEA 5CA1E 3UU3A 3P4QA 4ZI2C 4TUYE 3VKGA 2NW7A 4GKJT 4CXYA 4UVAB 4CQIA 5KMGP 4YXDA 2ES0A 3ETVA 3PJAJ 2K3WA 4XBFB 3A8YC 3ONLC 4ANJA 1D0ZA 2M6BA 5J2UE 3EUHA 3JADA 5AQTB 4QX7B 3SS1A 2D5UA 4ASKA 2WZHA 5IHYA 3PUSA 3CQGB 4AISA 3UU5A 5JDMA 5JDNA 1BR4A 1FIOA 2M6IA 3ABVA 4YLHA 3O1JA 3ZYKA 1M62A 2D2SA 2XQ4A 3FXDB 5L3DB 3B5MA 2NW8A 3QOFA 1QLBA 3EVYA 4ILCA 4JUYA 3M3ZB 3ZC1A 4IDPA 2C5KT 1L0VA 2QRXA 2CXFA 4LF4T 3P4SA 2WMNA 3DTOA 3ONJA 3Q5XA 1XZYA 4I50E 2FJAA 3AAIA 2ACZA 3PUAA 3AE5A 4PJLA 1GQEA 3Q5WA 4U3CA 3RIFA 2UXCT 3ZN0B 4DR6T 2CMRA 3C98B 2PG8A 5JH7E 3EHZA 1UCUA 3BQIA 2VQFT 2E5VA 4EYYR 2E9XA 4LF6T 2HN2A 5KDMC 4YT0A 2UXDT 5LXTE 1MMNA 3IHRA 2E9XB 4XAXB 4DR5T 2YOEA 3OYXA 4DMWA 3NBXX 1HX1B 3S4UA 4DR3T 2K48A 1YD8G 2E8IA 1J1JA 3NWIA 1N36T 3H3AA 2LKHA 4CI2B 2QGSA 1E2AA 1MMGA 3CQCB 2V7JA 2LSYA 4H9NC 3AEEA 5LHIB 5LJNA 2N1GA 1N33T 1G73A 5CB4E 1IBKT 3OKQA 4U31A 2NTXA 5H6QB 4PJNA 4ZZBA 2CXLA 5LCYA 4COFA 3ZT5A 3RC8A 2X68A 4AKRB 1OEDE 4YTNA 3QB5K 4A97A 2YU2A 4JLEA 4ZS3A 2NWBA 4KX6A 4HFBA 1ZKEA 4O4HE 2FJDA 3RYHE 3X1DA 3BK9A 3CX6B 4F8HA 2WAUA 2WQYA 3AA1B 1B7TA 5ABFA 3V5UA 4Z91A 2DCFA 5ABFB 1MIVA 5FMNA 5CGMA 2IAKA 4DV2T 5LA6E 5F3JA 2BG9C 2CXDA 4IREA 5BR8T 5HEJA 5AQKB 3RRWA 4U2ZA 3HKDE 2YDSA 4B3RT 4DV6T 2UXNB 4GOUA 1US7B 4ZI3D 3CKDA 1JNZA 4HWCA 3RYIE 2LKGA 5L3CB 1T98A 3SRZA 4WNKA 2G0UA 4ILBA 3K3NA 2FUPA 5LP6E 3F57A 5HWXA 5AQIB 4JI7T 4EOZB 4BJMA 3NVOA 2W2UA 1YXRA 4UVBB 3TLSA 4ILAA 3HL6A 5LB7B 2DLRA 4CN4A 3KBTA 3N5LA 3BQKA 3OVUA 4Z8XA 1VOMA 3LFMA 3K3OA 4IE0A 4HFDA 1BR1A 2WDVA 1HG5A 3AEDA 3UQ4A 3FZKB 3CK6A 1ZP0A 3AE4A 4IDOA 2E5LT 4DUZT 2X9HA 5JVDE 3UUBA 1I6ZA 5AQVB 4HTEA 3FBLA 5L4HA 1HCIA 2DHRA 4HKAA 3N9LA 2JIWA 2LRLA 1HG2A 1EZ3A 3ZN1B 2LSKA 2VASA 2HN1A 2LOPA 4ZI7E 2CPTA 4U72A 2XAGB 2KNDA 4HWDA 2XZEA 2ODVA 2LEHA 3CVRA 2ZM6T 2V8SV 3H3MA 4BAYB 1X9BA 2Y48B 2WU2A 3PUGA 1YQ4A 2XUEA 3CIRA 4I4TE 2XQ9A 1HNXT 4YJ3E 1MNEA 5BMVE 2JQKA 3V5SA 4HFCA 4FI5A 3E22E 5LHGB 2LJLA 2Q9QC 2JQQA 2RA1A 3E0ZA 3CWZB 5LOVE 4AQYT 5FVKA 4HE8A 1MMAA 2CHOA 4ISSA 3PU3A 4EV6A 2PBIA 2A3DA 3GA8A 4L9IA 5JDHA 3PV0F 2WP9A 1ZEEA 1H7CA 2K24A 2JMKA 2Y6XA 3AEGA 3PJAA 3PTRB 5AQHB 3NKZA 4UEMA 3N2OA 1LKXA 3C4ZA 4G63A 4HFHA 4JYAT 4YSXA 4QH1A 3E08A 3AE7A 5IUXA 3RKGA 3N2KE 2HPJA 2H7OA 4AIUA 1D0XA 4YTPA 2A2FX 1KNRA 4HWIB 2NTYA 4EB6E 2Q9QD 2XQ3A 1LVKA 2WZIA 1W0AA 4DNDA 3R6NA 1XNQT 2KZ7B 5JR9C 4QHOA 3PU8A 3JC6C 5FY1A 2X66A 4IT4A 4E7ZA 5HXEA 2LSJA 4UELA 4I55E 2ACXA 4TNVA 1SHZC 2VKDA 2JQ9A 5DJQC 4HFVA 2WM9A 3RGLA 3L8RA 2WS3A 3UU4A 1XDPA 1UURA 4GK5E 3ESLA 5LBMA 1YW0A 4K0UA 3HKCE 2N9DA 2IIUA 2LM2A 3VR9A 3UULA 3FHNA 5AQNB 4H63H 5HEOA 4H9SE 2PFVA 2BBJA 2BS4A 5HXHA 5AQJB 2K5BB 4UF0A 1QSDA 4K0KT 4WBOA 2P9BA 4HN9A 4B3TT 2JQHA 4UF0B 5IWAT 2X9YA 2V7IA 4U2YA 2W63A 2MTQA 4HFIA 4YY3T 3QUJA 2VURA 1UX4A 3CPZA 5J0ZA 4Q25A 4JEHB 4LF9T 5LBQB 4HWHA 3N9NA 5ETWA 5EK3A 1J5ET 2RPAA 2XAHB 2W61A 5LGNB 2VKHA 3NRYA 4TWHA 3L3PA 2ZLYA 2VKJA 2MYSA 2LRKA 5HYAA 1IZNB 4ISTA 1KF6A 4G2AA 5F5WA 3RYFE 1OEDA 2V7MA 4Z90A 2BS3A 2YK0A 3UQ7A 4JI5T 1OEDB 2OA5A 5M4YA 3PUQA 1WFDA 4YTMA 3I1AA 3B13A 4FJOA 3AEBA 3L09A 4JV5T 4ZI2D 2CBIA 4WBNE 4P09A 4HGAA 3PDYA 1IBLT 3P4PA 2EHOA 3RLFF 2KSRA 5AQLB 5HXSA 5FY0A 3T8OA 2EHOB 2V26A 5FP3A 2UXBT 2VVSA 3RPUA 4DR1T 4DV1T 2V7KA 2WWUA 3VU7H 3GMIA 2CWOA 2C0SA 4GYRA 4NXNT 4DV0T 3MZKB 1LVFA 4DMVA 2LSIA 3LJCA 4IDQA 3UFEA 4AKIA 3W15B 3TKLB 4EGWA 2YU1A 3N9QA 3AB3B 1HF8A 3MJXA 2FBWA 4JEUB 2UXXB 1D1BA 2W0GA 4MALA 5AQRB 4LMJA 3IEEA 2W00A 3QK6A 2CLYC 3DJBA 3TLTA 3RIUA 2XJ7A 4JI6T 2KINB 3KINB 4H63V 5FNVE 5CA0E 3RRCA 2D0TA 5TAOA 2OV9A 5LG4A 5ADXL 3VRAA 3PUXF 1BR0A 1D1AA 4EIWA 2MBGA 2K9AA 2MAWA 4GKKT 2IMLA 5AQQB 2X51A 4ZS2A 4P0BA 2BG9E 2VK9A 3OTOT 2JPFA 4I0UA 2B76A 3TLWA 2H88A 2IHR1 4NUVA 1ZHCA 3AE2A 2NR4A 2A9UA 2AE9A 4X62T 2WY2A 3MK7C 4X1YE 2D0UA 2W66A 5ABGA 1NENA 3A5XA 3PUYF 1CHUA 4A56A 4AQFA 1KNZA 2XHEB 2QVAA 3LK42 1WYBA 4EEBA 1XWMA 3PUVF 4ILUA 3P7IA 4PK6A 4GK0E 5CFBA 1I94T 1MIYA 2XTLA 3FB2A 2XY8B 4O4LE 4LMKA 3PE0A 4UIGA 2WSSV 2VWAA 4AI6A 3C64A 4MFRA 3ZMVB 2X0HA 2XAQB 1IBMT 5JTGA 4X64T 3AXJA 1ZV4X 3SOLA 4DVDA 3AXJB 2BKNA 1Z0PA 1UK5A 2X0YA 4M1PA 3ZYLA 4LF8T 3OBVE 2X0LB 2CA5A 4PNIA 4NUUA 3VRBA 2XM1A 5AQFB 4AKLA 4B6XA 2VL8A 1WCRA 3A7MA 2YEVC 2EHOC 2IC6A 1T8BA 2FJBA 4YSYA 1DU2A 3ZEFB 3NZQA 3RYCE 2L9QA 4L0RA 5HAXA 3WI3A 4LMLA 2XQ8A 5JREA 5L3EB 3IF8B 2X67A 5FXVA 2JRKA 4I43B 4HEAA 4EEDA 2E9XC 2UUAT 1UUSA 4CN6A 3R84B 4IE7A 1WLXA 4PFOA 1FMVA 2J47A 4PK4A 5FY7A 2WWVA 3ZPOA 3TLVA 2V7LA 5C8YE 1U4QA 4O2BE 4O4IE 4AXPA 1J5WA 3IBPA 3DP7A 4X1IE 2ZM0A 2BS2A 3G06A 3AEAA 5FXXA 1HR0T 1G8XA 4TNWA 4ZHQE 4U74A 4JI0T 3O1IA 2IDOB 3QB5A 4EZ4A 4C91A 2YDRA 2E2AA 4O4JE 1D0YA 4TV8E 2V1DB 4V1Av 2XAJB 4OFZA 3RF1A 1YQ3A 4X5TA 5JDFA 2E9XD 5GONE 3EDUA 4UV9B 4BJNA 3EDVA 2KLQA 2V5CA 3AA7B 4UV8B 2WDRA 4IDNA 2HH7A 3UFGA 2XQAA 4LF7T 1IAPA 4IE5A 4TWDA 2H89A 1Y64B 4DBQA 3IA3A 1M7KA 4UXNB 1FMWA 2KWIB 3UUXB 2CE7A 5FKYA 4QH4A 5LYJE 5JDQA 1NWMX 2IC9A 5LJMA 4PW8A 1NAFA 4H9PC 4LFCT 2XQ5A 2UUBT 2W4XA 3KV9A 4MBQA 3NZPA 4JI4T 4N78D 3U3IA 4UR9A 3ZYMA 3FZMB 2L8KA 3MKDA 2LLYA 2X9XA 4LFBT 3WAJA 3AAAB 3FZLB 3AE6A 2OLTA 3I9YA 5F8PA 5L3BB 2CHNA 4YHJA 2J4GA 2J1DG 3K1SA 1SUMB 5HEGA 3U78A 4OYKA 2ODUA 5FXWA 2WDQA 3PURA 2VB6A 3LDQB 5C2TA 4PJMA 5AQSB 1OXZA 5LGUB 5LG3A 4KHZF 2H3RA 5A1LA 3N9MA 4YJ2E 2ZMAA 1WYCA 3ZSSA 4JI2T 3OJAA 3UUNA 4C90A 4DO0A 4GYSA 3UTKA 5J2TE 4MLKA 4P1NA 4YFSA 2BVLA 3ETUA 2KXPB 5KX5E 1S94A 3ZLIA 3CQXC 3ONXA 4EZHA 4YSZA 3ZMZB 1BR2A 3VR8A 4XZCA 3BQLA 1HTJF 4AKHA 5L3GB 3K3QC 4CI3B 2I0MA 1ZOYA 4J2CA 3VHLA 1Z8UA 3JC6D 2UU9T 2JJ9A 4P0AA 1HNWT 1KNPA 4JBWF 2A72A 2LHRA 4ERRA 5DABA 5DQVA 3O4XE 1LRZA 3Q9DA 4H9OC 3AA0B 1KEYA 4OHFA 2V6YA 4QX8B 2AXDS 4EYUA 2FJEA 3N9OA 2V6YB 3K8PC 2F4VT 4KI0F 3ZT6A 1V9DA 5E0OA 4IE4A 4X20E 2BG9A 1MNDA 4IHJE 5ABEA 3KDSE 4PK5A 3LSVA 3CMLA 2BG9B 4A5XA 3LK3B 3HI2A 4IL9A 4TV9E 5L3FB 1W0BA 4TX5A 5HXRA 5J1GA 2BZBA 4B3ST 3TLUA 5LHHB 3AE8A 3LG7A 2DWKA 3FZFB 3OYZA 3RKOA 2W62A 2Y8DA 5HWYA 5AQMB 1QUUA 2XQ7A 4O2AE 3O9XA 4JI3T 2C5IT 4IL4A 3C50A 3UU8A 2V5DA 5LGTB 5KXJA 2N2NA 2J62A 4JI1T 2M67A 4DR4T 2XSAA 3HKEE 3WAKA 1X79A 3D0TA 4HWFA 3M65A 2HPLA 1S35A 3FZHB 4WW0A 5H6RB 5JDGA 1HFAA 3L39A 2CBJA 1SA0E 3ZCIA 2IUBA 3RX6A 1N32T 2LSGA 3Q5EA 1WR0A 3JAEA 3AE3A 3Q2MA 5CJ5A 4IDZA 2C5JA 3P4WA 1FEWA 3N2GE 4OK0A 1UGOA 4EAHA 5LMUT 4ADZA 2JMHA 4QXHB 2NP9A 2I6HA 4ZOLE 4IGUA 2XPKA 1XNRT 1E1HB 3O1HA 4NPPA 4OYJA 1VCSA 1D1CA 2LM9A 1XMQT 3ZC0A 2KWHA 4CXXA 4ZI3C 4WZXA 2MOZA 4CN1A 1KFYA 1XDOA 3UUMA 3C51A 3N9PA 4DBRA 2DI4A 2PJQA 5LMNT 2LE8A 3SWHA 2HHHT 4X1KE 2R6GF 2LHNA 4O8SA 2Q9QA 4QWNB 5JRCA 2Q9QB 1T7SA 1OEDC 5JRCB 3F31A 2VVNA 3ZKRA 1WRDA 1T72A 4MHCA 3ZMTB 3I9WA 2CCQA 3ZMSB 2BKPA 3KV4A 3CX7B 3HA4A 3RHWA 2LOSA 2BDEA 3T1YT 5FYMA 5IYZE 4F6RC 4AQGA 3F2EA 5EK2A 1YKEB 3UU6A 2XM2A 3JAFA 4BA9A 4WYVA 3AECA 2UUCT 3I0QA 1MIWA 2KT9A 3ZMUB 4CZZB 5HCJA 3ZJ1A
chains in the Genus database with same CATH topology
2CE7A 3OYXA 3C4WA 2MTQA 3NRXA 4DMWA 2QA7A 5LYJE 5JDQA 1NWMX 2IC9A 3NBXX 5LJMA 4PW8A 3S4UA 3H37A 2K48A 1NAFA 3QUJA 1UX4A 4H9PC 3CPZA 1YD8G 1IJ6A 2XQYA 2E8IA 3I0OA 4JEHB 5LBQB 1IJ5A 3H3AA 5DQWA 3N9NA 4CI2B 5ETWA 1VRBA 3KV9A 4MBQA 2QGSA 3QC9A 5EK3A 3NZPA 4N78D 3U3IA 5JR9A 1MMGA 3ZYMA 3CQCB 2XAHB 2W61A 2V7JA 3ZCJA 1AJ3A 1U5PA 2X9WA 5LGNB 2LSYA 1O3XA 4H9NC 5LHIB 5LJNA 3CX8B 2L8KA 2VKHA 2N1GA 3NRYA 5JR9B 1WR6A 3RH3A 1G73A 3MKDA 5CB4E 3OKQA 3AVRA 2X9XA 3L3PA 3WAJA 2ZLYA 2VKJA 2NTXA 2MYSA 5H6QB 4PJNA 2CXLA 5LCYA 3AAAB 5HYAA 3RC8A 3MA9A 2X68A 4AKRB 1IZNB 4ISTA 2H7VC 3I9YA 2GK9A 4G2AA 5F8PA 3RC3A 3RYFE 5L3BB 2YU2A 4YHJA 2J1DG 4JLEA 2V7MA 2YK0A 4ZS3A 2L3LA 2NWBA 3U78A 4UVCB 1ZKEA 4O4HE 3P8CD 4OYKA 2OA5A 2ODUA 3RYHE 5M4YA 4QKNA 5FXWA 3PURA 3BK9A 3CX6B 2VB6A 3UT5E 2EHOD 2WAUA 3PUQA 4PJMA 4QXCB 3I1AA 1OXZA 3B13A 5LGUB 3AA1B 4FJOA 1OWAA 5HXCA 2H3RA 5A1LA 1B7TA 3N9MA 4YJ2E 2ZMAA 3L09A 4ZI2D 1WYCA 5EZYE 3V5UA 4EXTA 2DCFA 1UX5A 1MIVA 3KBUA 3OJAA 5FMNA 3J7Yq 2IAKA 4WBNE 3LK2B 4P09A 5LA6E 5F3JA 4HGAA 2CXDA 3UUNA 2NOXA 3PDYA 2EHOA 4IE6A 4C90A 4DO0A 4GYSA 3UTKA 2CWYA 4KP3C 2Z6EA 5HXSA 3C4XA 5FY0A 3T8OA 2EHOB 2V26A 5FP3A 3RRWA 5J2TE 2CEAA 3RPUA 3HKDE 4MLKA 3GWHA 2BVLA 4YFSA 3ETUA 1HS7A 4PAGA 2V7KA 2KXPB 2WWUA 3VU7H 2BVMA 3GMIA 2UXNB 5KX5E 2CWOA 2C0SA 4GYRA 1S94A 4GOUA 1US7B 4ZI3D 3ZLIA 3CQXC 2ZM2A 3CKDA 3ONXA 4EZHA 3MZKB 1LVFA 4AQFC 3ZMZB 1BR2A 2DWGA 4DMVA 2VKOA 3RYIE 2LSIA 5JDLA 3LJCA 2CM0A 5L3CB 3UFEA 4AKIA 1T98A 3VKHA 3SRZA 4WNKA 4XZCA 3W15B 2XASB 3TKLB 3ZJ2A 3BQLA 2G0UA 2YU1A 1HTJF 3K3NA 3N9QA 4AKHA 3AB3B 5L3GB 5LNKA 3K3QC 1HF8A 4CI3B 5LP6E 3F57A 5HWXA 3KV6A 4J2CA 3MJXA 3VHLA 4EOZB 3JC6D 4JEUB 2I59A 2JJ9A 2UXXB 1D1BA 2W0GA 5AFUL 2YINA 4MALA 4P0AA 4BJMA 3IEEA 2W00A 3QK6A 2CLYC 4UVBB 2A72A 3HL6A 2DLRA 3DJBA 2LHRA 4ERRA 2KINB 3KINB 5DABA 3KBTA 5DQVA 3N5LA 4H63V 3BQKA 3KVBA 3O4XE 5FNVE 1LRZA 4Z8XA 5CA0E 2IW5B 3RRCA 1VOMA 4CXWA 3LFMA 2D0TA 3K3OA 3Q9DA 4H9OC 3AA0B 5TAOA 4IE0A 5FXZA 5LG4A 4H9RC 3LBXA 1BR1A 5ADXL 2KMFA 4OHFA 4QX8B 5JQGE 1HG5A 1BR0A 1D1AA 3FXEB 4EIWA 3LBXB 2MBGA 2K9AA 4EYUA 3N9OA 3K8PC 4KBMB 4KMCA 2X51A 4ZS2A 4P0BA 2VK9A 2JPFA 3KFWX 4GIWA 1V9DA 5E0OA 4IE4A 4X20E 2B1EA 2X9HA 4NUVA 1MNDA 5JVDE 1ZHCA 2NW9A 4IHJE 2XAFB 3KDSE 4PK5A 3CMLA 4HTEA 2WBLA 3MK7C 4PFPA 3FBLA 3LK3B 4X1YE 1YKHB 2D0UA 2SPCA 3HI2A 3B57A 3HKBE 1HCIA 1MMDA 4TV9E 2DHRA 4HKAA 2DNXA 5L3FB 3N9LA 4TX5A 5HXRA 5J1GA 2BZBA 3HR0A 3A5XA 1HX8A 1HG2A 1EZ3A 3ZN1B 2LSKA 2VASA 5LHHB 3LG7A 2DWKA 4A56A 4AQFA 1KNZA 2XHEB 4QXBB 3OYZA 2LOPA 2ZM8A 3LK42 4L5GA 1KK7A 3AA6B 3RKOA 4ZI7E 4U72A 1WYBA 3ANWA 4AKGA 2XAGB 2KNDA 2W62A 4ILUA 2Y8DA 3P7IA 4PK6A 4GK0E 5HWYA 2ODVA 3AVSA 2LEHA 3AAEB 3ANWB 1MIYA 2XTLA 1QUUA 4E7SA 3FB2A 4O4LE 3PE0A 2LT3A 3CVRA 4O2AE 4UIGA 3MXZA 4TN7B 3O9XA 2WSSV 2VWAA 3J9X1 3C64A 2C5IT 4AI6A 4MFRA 3ZMVB 2XAQB 3C50A 5LGTB 2N2NA 3KVAA 4BAYB 2Y48B 3PUGA 2M67A 2CLYB 2XUEA 4I4TE 4KUMB 4YJ3E 2RP4A 1ZV4X 1MNEA 3SOLA 5BMVE 4DVDA 3HKEE 3WAKA 1X79A 3D0TA 1Z0PA 3M65A 2WMOA 4M1PA 3ZYLA 3V5SA 2HPLA 1S35A 4IIJE 4WW0A 4FI5A 3E22E 3OBVE 5H6RB 2LJLA 2X0LB 5JDGA 5LHGB 1HFAA 2Q9QC 4PJJA 2CA5A 2JQQA 4PNIA 4NUUA 5EK4A 1SA0E 4H9QC 3ZCIA 2RA1A 3E0ZA 4CI1B 3FBZA 1CUNA 3CWZB 4AKLA 3RX6A 5LOVE 4B6XA 2VL8A 3GN5A 3KV5A 2YEVC 2EHOC 1MMAA 4HE8A 2IC6A 2LSGA 3MACA 3Q2MA 4TZ4C 4IDZA 2C5JA 3GN5B 3PU3A 4ISSA 5L2LA 3ZEFB 2PBIA 5CA1E 3NZQA 2A3DA 3GA8A 3RYCE 4L9IA 1FEWA 4ZI2C 2L9QA 4TUYE 5JDHA 3VKGA 2NW7A 3N2GE 4OK0A 4CXYA 4L0RA 1ZEEA 4UVAB 5HAXA 3WI3A 4EAHA 1H7CA 2K24A 2JMKA 4CQIA 5KMGP 2Y6XA 5JREA 3PTRB 4ADZA 2JMHA 3IF8B 5L3EB 2ES0A 4UEMA 2X67A 5FXVA 3ETVA 4QXHB 4XBFB 2NP9A 2JRKA 4I43B 4ZOLE 4HEAA 4IGUA 2E9XC 1E1HB 3O1HA 3N2OA 1LKXA 4OYJA 4ANJA 3R84B 1D1CA 3C4ZA 1D0ZA 4IE7A 1WLXA 5J2UE 4G63A 4PFOA 1FMVA 2LM9A 4PK4A 5FY7A 3EUHA 3ZC0A 3ZPOA 2KWHA 4QX7B 3SS1A 4CXXA 3E08A 2V7LA 2D5UA 5C8YE 4ASKA 4ZI3C 2MOZA 5IHYA 1U4QA 3PUSA 3CQGB 3N2KE 2HPJA 4O2BE 2H7OA 1D0XA 3UUMA 5JDMA 2A2FX 1BR4A 5JDNA 1FIOA 2NTYA 3C51A 4O4IE 4EB6E 4AXPA 3N9PA 2Q9QD 3IBPA 1LVKA 4DBRA 3DP7A 4DNDA 3R6NA 2DI4A 4X1IE 2ZM0A 4YLHA 3O1JA 2KZ7B 5JR9C 4QHOA 5FXXA 2PJQA 3PU8A 1G8XA 4ZHQE 2LE8A 3JC6C 3ZYKA 3SWHA 5FY1A 2X66A 4E7ZA 5HXEA 4X1KE 4U74A 2D2SA 2LHNA 3O1IA 2LSJA 4UELA 4I55E 4EZ4A 4C91A 3FXDB 2ACXA 4O8SA 5L3DB 1SHZC 2Q9QA 4QWNB 4O4JE 1D0YA 2NW8A 4TV8E 5JRCA 2VKDA 3EVYA 5DJQC 4HFVA 2Q9QB 2V1DB 2WM9A 4JUYA 4V1Av 2XAJB 3ZC1A 2C5KT 5JRCB 4OFZA 3F31A 2CXFA 2WMNA 3DTOA 1WRDA 5JDFA 2E9XD 3Q5XA 4I50E 5GONE 3EDUA 4MHCA 3AAIA 4UV9B 3ZMTB 4BJNA 3PUAA 3I9WA 2CCQA 3EDVA 3ZMSB 4PJLA 3KV4A 2KLQA 4GK5E 3ESLA 3CX7B 3HA4A 3Q5WA 5LBMA 3ZN0B 1YW0A 3AA7B 2CMRA 4UV8B 2LOSA 2BDEA 4K0UA 5FYMA 3HKCE 2N9DA 2HH7A 3C98B 5IYZE 2PG8A 3UULA 1IAPA 3FHNA 4IE5A 4F6RC 5JH7E 4H63H 1UCUA 4H9SE 3BQIA 2PFVA 3F2EA 4AQGA 5HXHA 5EK2A 4EYYR 1YKEB 1Y64B 2E9XA 2K5BB 4UF0A 1QSDA 5KDMC 4WBOA 2P9BA 4HN9A 5LXTE 1MMNA 3IHRA 4BA9A 4DBQA 2E9XB 4UF0B 4XAXB 4UXNB 1FMWA 2KWIB 3I0QA 1MIWA 2KT9A 3ZMUB 4CZZB 2X9YA 3UUXB 2V7IA 2W63A 3ZJ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9I A;  3C4W A;  4GOU A;  2I59 A;  3CX8 B;  1IAP A;  3C50 A;  4PNI A;  3CX6 B;  2ES0 A;  2PBI A;  2A72 A;  1ZV4 X;  4WBO A;  4WNK A;  3C4X A;  2DLR A;  3T8O A;  4IGU A;  3C51 A;  2ACX A;  1HTJ F;  1SHZ C;  3AB3 B;  3QC9 A;  4YHJ A;  3CX7 B;  3C4Z A; 
#chains in the Genus database with same CATH topology
 3EI0 A;  5HEH A;  2XQ6 A;  3C4W A;  3NRX A;  2QA7 A;  1HNZ T;  3H37 A;  3RQW A;  4OX9 T;  1IJ6 A;  2XQY A;  3I0O A;  2QYW A;  1IJ5 A;  5DQW A;  1Y01 A;  2XSB A;  1VRB A;  3QC9 A;  3SFD A;  5JR9 A;  1W09 A;  3ZCJ A;  1AJ3 A;  1U5P A;  2X9W A;  1O3X A;  3CX8 B;  3OPC A;  5JR9 B;  1WR6 A;  3RH3 A;  5ABH A;  3AVR A;  3MA9 A;  3QNU A;  5HCM A;  2H7V C;  2GK9 A;  3RC3 A;  3RIU C;  2L3L A;  4UVC B;  4TWF A;  2PTF A;  3P8C D;  4DR2 T;  4QKN A;  2VQE T;  3UT5 E;  3EAM A;  2EHO D;  4QXC B;  1OWA A;  5HXC A;  5EZY E;  4DV7 T;  4EXT A;  1XMO T;  1UX5 A;  2YDQ A;  3KBU A;  3J7Y q;  4NIQ A;  3LK2 B;  4ZEY A;  5C3J A;  2NOX A;  4IE6 A;  4DV4 T;  2CWY A;  4KP3 C;  2Z6E A;  5FL0 A;  3C4X A;  1E7P A;  4KHP T;  2CEA A;  3P4R A;  3JCF A;  5AQG B;  3GWH A;  1HS7 A;  4PAG A;  4ZXL A;  2BVM A;  4DV3 T;  4U7I A;  3ZT7 A;  2ZM2 A;  4AQF C;  4DUY T;  2DWG A;  2VKO A;  3AE1 A;  1N34 T;  5JDL A;  2CM0 A;  2MPK A;  1W9R A;  3VKH A;  2XAS B;  3ZJ2 A;  1R8I A;  3ZST A;  5LNK A;  1JNR A;  3KV6 A;  2I59 A;  2V6X A;  5AFU L;  2YIN A;  3PUZ F;  3PUW F;  5AQU B;  3EAB A;  4QH5 A;  5AQO B;  2WB5 A;  3KVB A;  4LFA T;  2IW5 B;  3P50 A;  3RI5 A;  4CXW A;  2BKO A;  5FXZ A;  4ZZC A;  4X66 T;  4H9R C;  3LBX A;  2KMF A;  5JQG E;  4DV5 T;  3RQU A;  3FXE B;  2WU5 A;  3LBX B;  4LF5 T;  3RIA A;  4KBM B;  4KMC A;  2WCA A;  5L47 A;  3KFW X;  4GIW A;  2BBH A;  2B1E A;  3AEF A;  2NW9 A;  2XAF B;  2WBL A;  4PFP A;  1YKH B;  2SPC A;  4NXM T;  3B57 A;  3HKB E;  1MMD A;  2DNX A;  2DL1 A;  5L4E A;  3HR0 A;  1HX8 A;  4U33 A;  4YHH T;  4B3M T;  3T1H T;  4QXB B;  2ZM8 A;  2CRB A;  4L5G A;  1KK7 A;  5FVL A;  3AA6 B;  2W67 A;  3ANW A;  4AKG A;  1VCT A;  3AVS A;  3AAE B;  3ANW B;  2YN6 A;  4E7S A;  3AE9 A;  2LT3 A;  3MXZ A;  4TN7 B;  3J9X 1;  5FL1 A;  3KVA A;  4A98 A;  4DR7 T;  1FJG T;  2CLY B;  4KUM B;  2RP4 A;  2D9D A;  2WMO A;  4U7Y A;  4IIJ E;  3Q5D A;  2VL0 A;  4PJJ A;  5EK4 A;  4H9Q C;  5AQP B;  5HEU A;  4CI1 B;  1SE7 A;  3FBZ A;  4DID B;  1CUN A;  3SFE A;  4JI8 T;  3GN5 A;  3KV5 A;  2YKS A;  4X65 T;  1NEK A;  3MAC A;  4TZ4 C;  3GN5 B;  5L2L A;  4HFE A;  5CA1 E;  3UU3 A;  3P4Q A;  4ZI2 C;  4TUY E;  3VKG A;  2NW7 A;  4GKJ T;  4CXY A;  4UVA B;  4CQI A;  5KMG P;  4YXD A;  2ES0 A;  3ETV A;  3PJA J;  2K3W A;  4XBF B;  3A8Y C;  3ONL C;  4ANJ A;  1D0Z A;  2M6B A;  5J2U E;  3EUH A;  3JAD A;  5AQT B;  4QX7 B;  3SS1 A;  2D5U A;  4ASK A;  2WZH A;  5IHY A;  3PUS A;  3CQG B;  4AIS A;  3UU5 A;  5JDM A;  5JDN A;  1BR4 A;  1FIO A;  2M6I A;  3ABV A;  4YLH A;  3O1J A;  3ZYK A;  1M62 A;  2D2S A;  2XQ4 A;  3FXD B;  5L3D B;  3B5M A;  2NW8 A;  3QOF A;  1QLB A;  3EVY A;  4ILC A;  4JUY A;  3M3Z B;  3ZC1 A;  4IDP A;  2C5K T;  1L0V A;  2QRX A;  2CXF A;  4LF4 T;  3P4S A;  2WMN A;  3DTO A;  3ONJ A;  3Q5X A;  1XZY A;  4I50 E;  2FJA A;  3AAI A;  2ACZ A;  3PUA A;  3AE5 A;  4PJL A;  1GQE A;  3Q5W A;  4U3C A;  3RIF A;  2UXC T;  3ZN0 B;  4DR6 T;  2CMR A;  3C98 B;  2PG8 A;  5JH7 E;  3EHZ A;  1UCU A;  3BQI A;  2VQF T;  2E5V A;  4EYY R;  2E9X A;  4LF6 T;  2HN2 A;  5KDM C;  4YT0 A;  2UXD T;  5LXT E;  1MMN A;  3IHR A;  2E9X B;  4XAX B;  4DR5 T;  2YOE A;  3OYX A;  4DMW A;  3NBX X;  1HX1 B;  3S4U A;  4DR3 T;  2K48 A;  1YD8 G;  2E8I A;  1J1J A;  3NWI A;  1N36 T;  3H3A A;  2LKH A;  4CI2 B;  2QGS A;  1E2A A;  1MMG A;  3CQC B;  2V7J A;  2LSY A;  4H9N C;  3AEE A;  5LHI B;  5LJN A;  2N1G A;  1N33 T;  1G73 A;  5CB4 E;  1IBK T;  3OKQ A;  4U31 A;  2NTX A;  5H6Q B;  4PJN A;  4ZZB A;  2CXL A;  5LCY A;  4COF A;  3ZT5 A;  3RC8 A;  2X68 A;  4AKR B;  1OED E;  4YTN A;  3QB5 K;  4A97 A;  2YU2 A;  4JLE A;  4ZS3 A;  2NWB A;  4KX6 A;  4HFB A;  1ZKE A;  4O4H E;  2FJD A;  3RYH E;  3X1D A;  3BK9 A;  3CX6 B;  4F8H A;  2WAU A;  2WQY A;  3AA1 B;  1B7T A;  5ABF A;  3V5U A;  4Z91 A;  2DCF A;  5ABF B;  1MIV A;  5FMN A;  5CGM A;  2IAK A;  4DV2 T;  5LA6 E;  5F3J A;  2BG9 C;  2CXD A;  4IRE A;  5BR8 T;  5HEJ A;  5AQK B;  3RRW A;  4U2Z A;  3HKD E;  2YDS A;  4B3R T;  4DV6 T;  2UXN B;  4GOU A;  1US7 B;  4ZI3 D;  3CKD A;  1JNZ A;  4HWC A;  3RYI E;  2LKG A;  5L3C B;  1T98 A;  3SRZ A;  4WNK A;  2G0U A;  4ILB A;  3K3N A;  2FUP A;  5LP6 E;  3F57 A;  5HWX A;  5AQI B;  4JI7 T;  4EOZ B;  4BJM A;  3NVO A;  2W2U A;  1YXR A;  4UVB B;  3TLS A;  4ILA A;  3HL6 A;  5LB7 B;  2DLR A;  4CN4 A;  3KBT A;  3N5L A;  3BQK A;  3OVU A;  4Z8X A;  1VOM A;  3LFM A;  3K3O A;  4IE0 A;  4HFD A;  1BR1 A;  2WDV A;  1HG5 A;  3AED A;  3UQ4 A;  3FZK B;  3CK6 A;  1ZP0 A;  3AE4 A;  4IDO A;  2E5L T;  4DUZ T;  2X9H A;  5JVD E;  3UUB A;  1I6Z A;  5AQV B;  4HTE A;  3FBL A;  5L4H A;  1HCI A;  2DHR A;  4HKA A;  3N9L A;  2JIW A;  2LRL A;  1HG2 A;  1EZ3 A;  3ZN1 B;  2LSK A;  2VAS A;  2HN1 A;  2LOP A;  4ZI7 E;  2CPT A;  4U72 A;  2XAG B;  2KND A;  4HWD A;  2XZE A;  2ODV A;  2LEH A;  3CVR A;  2ZM6 T;  2V8S V;  3H3M A;  4BAY B;  1X9B A;  2Y48 B;  2WU2 A;  3PUG A;  1YQ4 A;  2XUE A;  3CIR A;  4I4T E;  2XQ9 A;  1HNX T;  4YJ3 E;  1MNE A;  5BMV E;  2JQK A;  3V5S A;  4HFC A;  4FI5 A;  3E22 E;  5LHG B;  2LJL A;  2Q9Q C;  2JQQ A;  2RA1 A;  3E0Z A;  3CWZ B;  5LOV E;  4AQY T;  5FVK A;  4HE8 A;  1MMA A;  2CHO A;  4ISS A;  3PU3 A;  4EV6 A;  2PBI A;  2A3D A;  3GA8 A;  4L9I A;  5JDH A;  3PV0 F;  2WP9 A;  1ZEE A;  1H7C A;  2K24 A;  2JMK A;  2Y6X A;  3AEG A;  3PJA A;  3PTR B;  5AQH B;  3NKZ A;  4UEM A;  3N2O A;  1LKX A;  3C4Z A;  4G63 A;  4HFH A;  4JYA T;  4YSX A;  4QH1 A;  3E08 A;  3AE7 A;  5IUX A;  3RKG A;  3N2K E;  2HPJ A;  2H7O A;  4AIU A;  1D0X A;  4YTP A;  2A2F X;  1KNR A;  4HWI B;  2NTY A;  4EB6 E;  2Q9Q D;  2XQ3 A;  1LVK A;  2WZI A;  1W0A A;  4DND A;  3R6N A;  1XNQ T;  2KZ7 B;  5JR9 C;  4QHO A;  3PU8 A;  3JC6 C;  5FY1 A;  2X66 A;  4IT4 A;  4E7Z A;  5HXE A;  2LSJ A;  4UEL A;  4I55 E;  2ACX A;  4TNV A;  1SHZ C;  2VKD A;  2JQ9 A;  5DJQ C;  4HFV A;  2WM9 A;  3RGL A;  3L8R A;  2WS3 A;  3UU4 A;  1XDP A;  1UUR A;  4GK5 E;  3ESL A;  5LBM A;  1YW0 A;  4K0U A;  3HKC E;  2N9D A;  2IIU A;  2LM2 A;  3VR9 A;  3UUL A;  3FHN A;  5AQN B;  4H63 H;  5HEO A;  4H9S E;  2PFV A;  2BBJ A;  2BS4 A;  5HXH A;  5AQJ B;  2K5B B;  4UF0 A;  1QSD A;  4K0K T;  4WBO A;  2P9B A;  4HN9 A;  4B3T T;  2JQH A;  4UF0 B;  5IWA T;  2X9Y A;  2V7I A;  4U2Y A;  2W63 A;  2MTQ A;  4HFI A;  4YY3 T;  3QUJ A;  2VUR A;  1UX4 A;  3CPZ A;  5J0Z A;  4Q25 A;  4JEH B;  4LF9 T;  5LBQ B;  4HWH A;  3N9N A;  5ETW A;  5EK3 A;  1J5E T;  2RPA A;  2XAH B;  2W61 A;  5LGN B;  2VKH A;  3NRY A;  4TWH A;  3L3P A;  2ZLY A;  2VKJ A;  2MYS A;  2LRK A;  5HYA A;  1IZN B;  4IST A;  1KF6 A;  4G2A A;  5F5W A;  3RYF E;  1OED A;  2V7M A;  4Z90 A;  2BS3 A;  2YK0 A;  3UQ7 A;  4JI5 T;  1OED B;  2OA5 A;  5M4Y A;  3PUQ A;  1WFD A;  4YTM A;  3I1A A;  3B13 A;  4FJO A;  3AEB A;  3L09 A;  4JV5 T;  4ZI2 D;  2CBI A;  4WBN E;  4P09 A;  4HGA A;  3PDY A;  1IBL T;  3P4P A;  2EHO A;  3RLF F;  2KSR A;  5AQL B;  5HXS A;  5FY0 A;  3T8O A;  2EHO B;  2V26 A;  5FP3 A;  2UXB T;  2VVS A;  3RPU A;  4DR1 T;  4DV1 T;  2V7K A;  2WWU A;  3VU7 H;  3GMI A;  2CWO A;  2C0S A;  4GYR A;  4NXN T;  4DV0 T;  3MZK B;  1LVF A;  4DMV A;  2LSI A;  3LJC A;  4IDQ A;  3UFE A;  4AKI A;  3W15 B;  3TKL B;  4EGW A;  2YU1 A;  3N9Q A;  3AB3 B;  1HF8 A;  3MJX A;  2FBW A;  4JEU B;  2UXX B;  1D1B A;  2W0G A;  4MAL A;  5AQR B;  4LMJ A;  3IEE A;  2W00 A;  3QK6 A;  2CLY C;  3DJB A;  3TLT A;  3RIU A;  2XJ7 A;  4JI6 T;  2KIN B;  3KIN B;  4H63 V;  5FNV E;  5CA0 E;  3RRC A;  2D0T A;  5TAO A;  2OV9 A;  5LG4 A;  5ADX L;  3VRA A;  3PUX F;  1BR0 A;  1D1A A;  4EIW A;  2MBG A;  2K9A A;  2MAW A;  4GKK T;  2IML A;  5AQQ B;  2X51 A;  4ZS2 A;  4P0B A;  2BG9 E;  2VK9 A;  3OTO T;  2JPF A;  4I0U A;  2B76 A;  3TLW A;  2H88 A;  2IHR 1;  4NUV A;  1ZHC A;  3AE2 A;  2NR4 A;  2A9U A;  2AE9 A;  4X62 T;  2WY2 A;  3MK7 C;  4X1Y E;  2D0U A;  2W66 A;  5ABG A;  1NEN A;  3A5X A;  3PUY F;  1CHU A;  4A56 A;  4AQF A;  1KNZ A;  2XHE B;  2QVA A;  3LK4 2;  1WYB A;  4EEB A;  1XWM A;  3PUV F;  4ILU A;  3P7I A;  4PK6 A;  4GK0 E;  5CFB A;  1I94 T;  1MIY A;  2XTL A;  3FB2 A;  2XY8 B;  4O4L E;  4LMK A;  3PE0 A;  4UIG A;  2WSS V;  2VWA A;  4AI6 A;  3C64 A;  4MFR A;  3ZMV B;  2X0H A;  2XAQ B;  1IBM T;  5JTG A;  4X64 T;  3AXJ A;  1ZV4 X;  3SOL A;  4DVD A;  3AXJ B;  2BKN A;  1Z0P A;  1UK5 A;  2X0Y A;  4M1P A;  3ZYL A;  4LF8 T;  3OBV E;  2X0L B;  2CA5 A;  4PNI A;  4NUU A;  3VRB A;  2XM1 A;  5AQF B;  4AKL A;  4B6X A;  2VL8 A;  1WCR A;  3A7M A;  2YEV C;  2EHO C;  2IC6 A;  1T8B A;  2FJB A;  4YSY A;  1DU2 A;  3ZEF B;  3NZQ A;  3RYC E;  2L9Q A;  4L0R A;  5HAX A;  3WI3 A;  4LML A;  2XQ8 A;  5JRE A;  5L3E B;  3IF8 B;  2X67 A;  5FXV A;  2JRK A;  4I43 B;  4HEA A;  4EED A;  2E9X C;  2UUA T;  1UUS A;  4CN6 A;  3R84 B;  4IE7 A;  1WLX A;  4PFO A;  1FMV A;  2J47 A;  4PK4 A;  5FY7 A;  2WWV A;  3ZPO A;  3TLV A;  2V7L A;  5C8Y E;  1U4Q A;  4O2B E;  4O4I E;  4AXP A;  1J5W A;  3IBP A;  3DP7 A;  4X1I E;  2ZM0 A;  2BS2 A;  3G06 A;  3AEA A;  5FXX A;  1HR0 T;  1G8X A;  4TNW A;  4ZHQ E;  4U74 A;  4JI0 T;  3O1I A;  2IDO B;  3QB5 A;  4EZ4 A;  4C91 A;  2YDR A;  2E2A A;  4O4J E;  1D0Y A;  4TV8 E;  2V1D B;  4V1A v;  2XAJ B;  4OFZ A;  3RF1 A;  1YQ3 A;  4X5T A;  5JDF A;  2E9X D;  5GON E;  3EDU A;  4UV9 B;  4BJN A;  3EDV A;  2KLQ A;  2V5C A;  3AA7 B;  4UV8 B;  2WDR A;  4IDN A;  2HH7 A;  3UFG A;  2XQA A;  4LF7 T;  1IAP A;  4IE5 A;  4TWD A;  2H89 A;  1Y64 B;  4DBQ A;  3IA3 A;  1M7K A;  4UXN B;  1FMW A;  2KWI B;  3UUX B;  2CE7 A;  5FKY A;  4QH4 A;  5LYJ E;  5JDQ A;  1NWM X;  2IC9 A;  5LJM A;  4PW8 A;  1NAF A;  4H9P C;  4LFC T;  2XQ5 A;  2UUB T;  2W4X A;  3KV9 A;  4MBQ A;  3NZP A;  4JI4 T;  4N78 D;  3U3I A;  4UR9 A;  3ZYM A;  3FZM B;  2L8K A;  3MKD A;  2LLY A;  2X9X A;  4LFB T;  3WAJ A;  3AAA B;  3FZL B;  3AE6 A;  2OLT A;  3I9Y A;  5F8P A;  5L3B B;  2CHN A;  4YHJ A;  2J4G A;  2J1D G;  3K1S A;  1SUM B;  5HEG A;  3U78 A;  4OYK A;  2ODU A;  5FXW A;  2WDQ A;  3PUR A;  2VB6 A;  3LDQ B;  5C2T A;  4PJM A;  5AQS B;  1OXZ A;  5LGU B;  5LG3 A;  4KHZ F;  2H3R A;  5A1L A;  3N9M A;  4YJ2 E;  2ZMA A;  1WYC A;  3ZSS A;  4JI2 T;  3OJA A;  3UUN A;  4C90 A;  4DO0 A;  4GYS A;  3UTK A;  5J2T E;  4MLK A;  4P1N A;  4YFS A;  2BVL A;  3ETU A;  2KXP B;  5KX5 E;  1S94 A;  3ZLI A;  3CQX C;  3ONX A;  4EZH A;  4YSZ A;  3ZMZ B;  1BR2 A;  3VR8 A;  4XZC A;  3BQL A;  1HTJ F;  4AKH A;  5L3G B;  3K3Q C;  4CI3 B;  2I0M A;  1ZOY A;  4J2C A;  3VHL A;  1Z8U A;  3JC6 D;  2UU9 T;  2JJ9 A;  4P0A A;  1HNW T;  1KNP A;  4JBW F;  2A72 A;  2LHR A;  4ERR A;  5DAB A;  5DQV A;  3O4X E;  1LRZ A;  3Q9D A;  4H9O C;  3AA0 B;  1KEY A;  4OHF A;  2V6Y A;  4QX8 B;  2AXD S;  4EYU A;  2FJE A;  3N9O A;  2V6Y B;  3K8P C;  2F4V T;  4KI0 F;  3ZT6 A;  1V9D A;  5E0O A;  4IE4 A;  4X20 E;  2BG9 A;  1MND A;  4IHJ E;  5ABE A;  3KDS E;  4PK5 A;  3LSV A;  3CML A;  2BG9 B;  4A5X A;  3LK3 B;  3HI2 A;  4IL9 A;  4TV9 E;  5L3F B;  1W0B A;  4TX5 A;  5HXR A;  5J1G A;  2BZB A;  4B3S T;  3TLU A;  5LHH B;  3AE8 A;  3LG7 A;  2DWK A;  3FZF B;  3OYZ A;  3RKO A;  2W62 A;  2Y8D A;  5HWY A;  5AQM B;  1QUU A;  2XQ7 A;  4O2A E;  3O9X A;  4JI3 T;  2C5I T;  4IL4 A;  3C50 A;  3UU8 A;  2V5D A;  5LGT B;  5KXJ A;  2N2N A;  2J62 A;  4JI1 T;  2M67 A;  4DR4 T;  2XSA A;  3HKE E;  3WAK A;  1X79 A;  3D0T A;  4HWF A;  3M65 A;  2HPL A;  1S35 A;  3FZH B;  4WW0 A;  5H6R B;  5JDG A;  1HFA A;  3L39 A;  2CBJ A;  1SA0 E;  3ZCI A;  2IUB A;  3RX6 A;  1N32 T;  2LSG A;  3Q5E A;  1WR0 A;  3JAE A;  3AE3 A;  3Q2M A;  5CJ5 A;  4IDZ A;  2C5J A;  3P4W A;  1FEW A;  3N2G E;  4OK0 A;  1UGO A;  4EAH A;  5LMU T;  4ADZ A;  2JMH A;  4QXH B;  2NP9 A;  2I6H A;  4ZOL E;  4IGU A;  2XPK A;  1XNR T;  1E1H B;  3O1H A;  4NPP A;  4OYJ A;  1VCS A;  1D1C A;  2LM9 A;  1XMQ T;  3ZC0 A;  2KWH A;  4CXX A;  4ZI3 C;  4WZX A;  2MOZ A;  4CN1 A;  1KFY A;  1XDO A;  3UUM A;  3C51 A;  3N9P A;  4DBR A;  2DI4 A;  2PJQ A;  5LMN T;  2LE8 A;  3SWH A;  2HHH T;  4X1K E;  2R6G F;  2LHN A;  4O8S A;  2Q9Q A;  4QWN B;  5JRC A;  2Q9Q B;  1T7S A;  1OED C;  5JRC B;  3F31 A;  2VVN A;  3ZKR A;  1WRD A;  1T72 A;  4MHC A;  3ZMT B;  3I9W A;  2CCQ A;  3ZMS B;  2BKP A;  3KV4 A;  3CX7 B;  3HA4 A;  3RHW A;  2LOS A;  2BDE A;  3T1Y T;  5FYM A;  5IYZ E;  4F6R C;  4AQG A;  3F2E A;  5EK2 A;  1YKE B;  3UU6 A;  2XM2 A;  3JAF A;  4BA9 A;  4WYV A;  3AEC A;  2UUC T;  3I0Q A;  1MIW A;  2KT9 A;  3ZMU B;  4CZZ B;  5HCJ A;  3ZJ1 A; 
#chains in the Genus database with same CATH homology
 2CE7 A;  3OYX A;  3C4W A;  2MTQ A;  3NRX A;  4DMW A;  2QA7 A;  5LYJ E;  5JDQ A;  1NWM X;  2IC9 A;  3NBX X;  5LJM A;  4PW8 A;  3S4U A;  3H37 A;  2K48 A;  1NAF A;  3QUJ A;  1UX4 A;  4H9P C;  3CPZ A;  1YD8 G;  1IJ6 A;  2XQY A;  2E8I A;  3I0O A;  4JEH B;  5LBQ B;  1IJ5 A;  3H3A A;  5DQW A;  3N9N A;  4CI2 B;  5ETW A;  1VRB A;  3KV9 A;  4MBQ A;  2QGS A;  3QC9 A;  5EK3 A;  3NZP A;  4N78 D;  3U3I A;  5JR9 A;  1MMG A;  3ZYM A;  3CQC B;  2XAH B;  2W61 A;  2V7J A;  3ZCJ A;  1AJ3 A;  1U5P A;  2X9W A;  5LGN B;  2LSY A;  1O3X A;  4H9N C;  5LHI B;  5LJN A;  3CX8 B;  2L8K A;  2VKH A;  2N1G A;  3NRY A;  5JR9 B;  1WR6 A;  3RH3 A;  1G73 A;  3MKD A;  5CB4 E;  3OKQ A;  3AVR A;  2X9X A;  3L3P A;  3WAJ A;  2ZLY A;  2VKJ A;  2NTX A;  2MYS A;  5H6Q B;  4PJN A;  2CXL A;  5LCY A;  3AAA B;  5HYA A;  3RC8 A;  3MA9 A;  2X68 A;  4AKR B;  1IZN B;  4IST A;  2H7V C;  3I9Y A;  2GK9 A;  4G2A A;  5F8P A;  3RC3 A;  3RYF E;  5L3B B;  2YU2 A;  4YHJ A;  2J1D G;  4JLE A;  2V7M A;  2YK0 A;  4ZS3 A;  2L3L A;  2NWB A;  3U78 A;  4UVC B;  1ZKE A;  4O4H E;  3P8C D;  4OYK A;  2OA5 A;  2ODU A;  3RYH E;  5M4Y A;  4QKN A;  5FXW A;  3PUR A;  3BK9 A;  3CX6 B;  2VB6 A;  3UT5 E;  2EHO D;  2WAU A;  3PUQ A;  4PJM A;  4QXC B;  3I1A A;  1OXZ A;  3B13 A;  5LGU B;  3AA1 B;  4FJO A;  1OWA A;  5HXC A;  2H3R A;  5A1L A;  1B7T A;  3N9M A;  4YJ2 E;  2ZMA A;  3L09 A;  4ZI2 D;  1WYC A;  5EZY E;  3V5U A;  4EXT A;  2DCF A;  1UX5 A;  1MIV A;  3KBU A;  3OJA A;  5FMN A;  3J7Y q;  2IAK A;  4WBN E;  3LK2 B;  4P09 A;  5LA6 E;  5F3J A;  4HGA A;  2CXD A;  3UUN A;  2NOX A;  3PDY A;  2EHO A;  4IE6 A;  4C90 A;  4DO0 A;  4GYS A;  3UTK A;  2CWY A;  4KP3 C;  2Z6E A;  5HXS A;  3C4X A;  5FY0 A;  3T8O A;  2EHO B;  2V26 A;  5FP3 A;  3RRW A;  5J2T E;  2CEA A;  3RPU A;  3HKD E;  4MLK A;  3GWH A;  2BVL A;  4YFS A;  3ETU A;  1HS7 A;  4PAG A;  2V7K A;  2KXP B;  2WWU A;  3VU7 H;  2BVM A;  3GMI A;  2UXN B;  5KX5 E;  2CWO A;  2C0S A;  4GYR A;  1S94 A;  4GOU A;  1US7 B;  4ZI3 D;  3ZLI A;  3CQX C;  2ZM2 A;  3CKD A;  3ONX A;  4EZH A;  3MZK B;  1LVF A;  4AQF C;  3ZMZ B;  1BR2 A;  2DWG A;  4DMV A;  2VKO A;  3RYI E;  2LSI A;  5JDL A;  3LJC A;  2CM0 A;  5L3C B;  3UFE A;  4AKI A;  1T98 A;  3VKH A;  3SRZ A;  4WNK A;  4XZC A;  3W15 B;  2XAS B;  3TKL B;  3ZJ2 A;  3BQL A;  2G0U A;  2YU1 A;  1HTJ F;  3K3N A;  3N9Q A;  4AKH A;  3AB3 B;  5L3G B;  5LNK A;  3K3Q C;  1HF8 A;  4CI3 B;  5LP6 E;  3F57 A;  5HWX A;  3KV6 A;  4J2C A;  3MJX A;  3VHL A;  4EOZ B;  3JC6 D;  4JEU B;  2I59 A;  2JJ9 A;  2UXX B;  1D1B A;  2W0G A;  5AFU L;  2YIN A;  4MAL A;  4P0A A;  4BJM A;  3IEE A;  2W00 A;  3QK6 A;  2CLY C;  4UVB B;  2A72 A;  3HL6 A;  2DLR A;  3DJB A;  2LHR A;  4ERR A;  2KIN B;  3KIN B;  5DAB A;  3KBT A;  5DQV A;  3N5L A;  4H63 V;  3BQK A;  3KVB A;  3O4X E;  5FNV E;  1LRZ A;  4Z8X A;  5CA0 E;  2IW5 B;  3RRC A;  1VOM A;  4CXW A;  3LFM A;  2D0T A;  3K3O A;  3Q9D A;  4H9O C;  3AA0 B;  5TAO A;  4IE0 A;  5FXZ A;  5LG4 A;  4H9R C;  3LBX A;  1BR1 A;  5ADX L;  2KMF A;  4OHF A;  4QX8 B;  5JQG E;  1HG5 A;  1BR0 A;  1D1A A;  3FXE B;  4EIW A;  3LBX B;  2MBG A;  2K9A A;  4EYU A;  3N9O A;  3K8P C;  4KBM B;  4KMC A;  2X51 A;  4ZS2 A;  4P0B A;  2VK9 A;  2JPF A;  3KFW X;  4GIW A;  1V9D A;  5E0O A;  4IE4 A;  4X20 E;  2B1E A;  2X9H A;  4NUV A;  1MND A;  5JVD E;  1ZHC A;  2NW9 A;  4IHJ E;  2XAF B;  3KDS E;  4PK5 A;  3CML A;  4HTE A;  2WBL A;  3MK7 C;  4PFP A;  3FBL A;  3LK3 B;  4X1Y E;  1YKH B;  2D0U A;  2SPC A;  3HI2 A;  3B57 A;  3HKB E;  1HCI A;  1MMD A;  4TV9 E;  2DHR A;  4HKA A;  2DNX A;  5L3F B;  3N9L A;  4TX5 A;  5HXR A;  5J1G A;  2BZB A;  3HR0 A;  3A5X A;  1HX8 A;  1HG2 A;  1EZ3 A;  3ZN1 B;  2LSK A;  2VAS A;  5LHH B;  3LG7 A;  2DWK A;  4A56 A;  4AQF A;  1KNZ A;  2XHE B;  4QXB B;  3OYZ A;  2LOP A;  2ZM8 A;  3LK4 2;  4L5G A;  1KK7 A;  3AA6 B;  3RKO A;  4ZI7 E;  4U72 A;  1WYB A;  3ANW A;  4AKG A;  2XAG B;  2KND A;  2W62 A;  4ILU A;  2Y8D A;  3P7I A;  4PK6 A;  4GK0 E;  5HWY A;  2ODV A;  3AVS A;  2LEH A;  3AAE B;  3ANW B;  1MIY A;  2XTL A;  1QUU A;  4E7S A;  3FB2 A;  4O4L E;  3PE0 A;  2LT3 A;  3CVR A;  4O2A E;  4UIG A;  3MXZ A;  4TN7 B;  3O9X A;  2WSS V;  2VWA A;  3J9X 1;  3C64 A;  2C5I T;  4AI6 A;  4MFR A;  3ZMV B;  2XAQ B;  3C50 A;  5LGT B;  2N2N A;  3KVA A;  4BAY B;  2Y48 B;  3PUG A;  2M67 A;  2CLY B;  2XUE A;  4I4T E;  4KUM B;  4YJ3 E;  2RP4 A;  1ZV4 X;  1MNE A;  3SOL A;  5BMV E;  4DVD A;  3HKE E;  3WAK A;  1X79 A;  3D0T A;  1Z0P A;  3M65 A;  2WMO A;  4M1P A;  3ZYL A;  3V5S A;  2HPL A;  1S35 A;  4IIJ E;  4WW0 A;  4FI5 A;  3E22 E;  3OBV E;  5H6R B;  2LJL A;  2X0L B;  5JDG A;  5LHG B;  1HFA A;  2Q9Q C;  4PJJ A;  2CA5 A;  2JQQ A;  4PNI A;  4NUU A;  5EK4 A;  1SA0 E;  4H9Q C;  3ZCI A;  2RA1 A;  3E0Z A;  4CI1 B;  3FBZ A;  1CUN A;  3CWZ B;  4AKL A;  3RX6 A;  5LOV E;  4B6X A;  2VL8 A;  3GN5 A;  3KV5 A;  2YEV C;  2EHO C;  1MMA A;  4HE8 A;  2IC6 A;  2LSG A;  3MAC A;  3Q2M A;  4TZ4 C;  4IDZ A;  2C5J A;  3GN5 B;  3PU3 A;  4ISS A;  5L2L A;  3ZEF B;  2PBI A;  5CA1 E;  3NZQ A;  2A3D A;  3GA8 A;  3RYC E;  4L9I A;  1FEW A;  4ZI2 C;  2L9Q A;  4TUY E;  5JDH A;  3VKG A;  2NW7 A;  3N2G E;  4OK0 A;  4CXY A;  4L0R A;  1ZEE A;  4UVA B;  5HAX A;  3WI3 A;  4EAH A;  1H7C A;  2K24 A;  2JMK A;  4CQI A;  5KMG P;  2Y6X A;  5JRE A;  3PTR B;  4ADZ A;  2JMH A;  3IF8 B;  5L3E B;  2ES0 A;  4UEM A;  2X67 A;  5FXV A;  3ETV A;  4QXH B;  4XBF B;  2NP9 A;  2JRK A;  4I43 B;  4ZOL E;  4HEA A;  4IGU A;  2E9X C;  1E1H B;  3O1H A;  3N2O A;  1LKX A;  4OYJ A;  4ANJ A;  3R84 B;  1D1C A;  3C4Z A;  1D0Z A;  4IE7 A;  1WLX A;  5J2U E;  4G63 A;  4PFO A;  1FMV A;  2LM9 A;  4PK4 A;  5FY7 A;  3EUH A;  3ZC0 A;  3ZPO A;  2KWH A;  4QX7 B;  3SS1 A;  4CXX A;  3E08 A;  2V7L A;  2D5U A;  5C8Y E;  4ASK A;  4ZI3 C;  2MOZ A;  5IHY A;  1U4Q A;  3PUS A;  3CQG B;  3N2K E;  2HPJ A;  4O2B E;  2H7O A;  1D0X A;  3UUM A;  5JDM A;  2A2F X;  1BR4 A;  5JDN A;  1FIO A;  2NTY A;  3C51 A;  4O4I E;  4EB6 E;  4AXP A;  3N9P A;  2Q9Q D;  3IBP A;  1LVK A;  4DBR A;  3DP7 A;  4DND A;  3R6N A;  2DI4 A;  4X1I E;  2ZM0 A;  4YLH A;  3O1J A;  2KZ7 B;  5JR9 C;  4QHO A;  5FXX A;  2PJQ A;  3PU8 A;  1G8X A;  4ZHQ E;  2LE8 A;  3JC6 C;  3ZYK A;  3SWH A;  5FY1 A;  2X66 A;  4E7Z A;  5HXE A;  4X1K E;  4U74 A;  2D2S A;  2LHN A;  3O1I A;  2LSJ A;  4UEL A;  4I55 E;  4EZ4 A;  4C91 A;  3FXD B;  2ACX A;  4O8S A;  5L3D B;  1SHZ C;  2Q9Q A;  4QWN B;  4O4J E;  1D0Y A;  2NW8 A;  4TV8 E;  5JRC A;  2VKD A;  3EVY A;  5DJQ C;  4HFV A;  2Q9Q B;  2V1D B;  2WM9 A;  4JUY A;  4V1A v;  2XAJ B;  3ZC1 A;  2C5K T;  5JRC B;  4OFZ A;  3F31 A;  2CXF A;  2WMN A;  3DTO A;  1WRD A;  5JDF A;  2E9X D;  3Q5X A;  4I50 E;  5GON E;  3EDU A;  4MHC A;  3AAI A;  4UV9 B;  3ZMT B;  4BJN A;  3PUA A;  3I9W A;  2CCQ A;  3EDV A;  3ZMS B;  4PJL A;  3KV4 A;  2KLQ A;  4GK5 E;  3ESL A;  3CX7 B;  3HA4 A;  3Q5W A;  5LBM A;  3ZN0 B;  1YW0 A;  3AA7 B;  2CMR A;  4UV8 B;  2LOS A;  2BDE A;  4K0U A;  5FYM A;  3HKC E;  2N9D A;  2HH7 A;  3C98 B;  5IYZ E;  2PG8 A;  3UUL A;  1IAP A;  3FHN A;  4IE5 A;  4F6R C;  5JH7 E;  4H63 H;  1UCU A;  4H9S E;  3BQI A;  2PFV A;  3F2E A;  4AQG A;  5HXH A;  5EK2 A;  4EYY R;  1YKE B;  1Y64 B;  2E9X A;  2K5B B;  4UF0 A;  1QSD A;  5KDM C;  4WBO A;  2P9B A;  4HN9 A;  5LXT E;  1MMN A;  3IHR A;  4BA9 A;  4DBQ A;  2E9X B;  4UF0 B;  4XAX B;  4UXN B;  1FMW A;  2KWI B;  3I0Q A;  1MIW A;  2KT9 A;  3ZMU B;  4CZZ B;  2X9Y A;  3UUX B;  2V7I A;  2W63 A;  3ZJ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...