4IGUA

Crystal structure of the rgs domain of cg5036
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
137
structure length
137
Chain Sequence
SQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLSRPAAKLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG5036
publication title Double suppression of the G alpha protein activity by RGS proteins
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Signaling protein
total genus 52
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iguA00
2A72A 4L9IA 2DLRA 3C51A 4YHJA 3C4XA 1SHZC 3QC9A 2ACXA 3CX6B 2I59A 4WBOA 1ZV4X 2ES0A 3C4ZA 3C50A 4IGUA 3AB3B 3C4WA 1IAPA 4PNIA 3CX7B 2PBIA 3T8OA 1HTJF 3CX8B 4GOUA 4WNKA
chains in the Genus database with same CATH superfamily
5HXCA 4TNVA 2JQ9A 3RC3A 5L47A 3HL6A 4JV5T 2IHR1 4TV9E 5FKYA 2VWAA 3RPUA 3RRCA 1H7CA 3VR8A 3ZC0A 2HPLA 3FXDB 4KI0F 2JJ9A 2SPCA 4ZXLA 3T8OA 2L9QA 5TAOA 5JR9B 2DCFA 4X5TA 2B76A 1G8XA 3QC9A 4HKAA 1WYBA 2D0TA 3FBZA 3Q9DA 2X0YA 4EZHA 2UXXB 4C90A 2V5CA 4CI2B 3ZYKA 4ILUA 2KINB 4ZS3A 3UULA 3P8CD 2X0HA 4O8SA 1WRDA 2OV9A 3VR9A 5FVKA 1W09A 2KZ7B 5J1GA 5HEOA 4QH5A 5E0OA 4NXNT 4I0UA 5LG3A 2BS2A 2WBLA 3AA6B 3UTKA 4B3ST 3UQ7A 1D0ZA 5FL0A 2IUBA 3QB5A 4UEMA 4EYYR 3ONLC 1VOMA 3EABA 4CXXA 2LE8A 5H6QB 4HFEA 2A3DA 4EAHA 5AQMB 2CBJA 1HNXT 4K0UA 3ZMVB 2M67A 4JI4T 3BQKA 3PUZF 1HFAA 1CUNA 1T8BA 3EI0A 5L2LA 1NEKA 3PUVF 2DI4A 3K3OA 2V7MA 3EDUA 4X62T 5JRCB 4GYSA 2MBGA 2KT9A 2ACXA 4EV6A 1NENA 3PJAA 5LMNT 4KBMB 3O1JA 2VL8A 1AJ3A 4PNIA 3U3IA 4PJNA 2ODVA 4DUZT 4DR4T 2XAJB 2XTLA 4JI7T 3C51A 3B57A 4AKRB 3C4XA 4UV8B 3TLSA 2J62A 3EHZA 1D1BA 4YJ2E 3CPZA 1ZKEA 4FI5A 3QB5K 4I55E 3IF8B 3PU8A 3N9LA 4X64T 3UUBA 2Q9QA 3UUNA 3MK7C 3I9WA 3OYZA 2UXDT 2CLYC 5ABFA 3H37A 1Y01A 3E08A 2CMRA 4HFHA 3ABVA 2I6HA 2XZEA 4CZZB 1D0YA 5M4YA 4ILAA 3RYCE 4DV5T 3NZQA 3I1AA 4GYRA 4MHCA 3T1YT 2D9DA 3LBXA 1T72A 3PV0F 3R6NA 4JI3T 3AEGA 2IAKA 2K5BB 3KV6A 3NRYA 1IJ5A 5L4EA 2K3WA 4XAXB 5FXXA 2V7LA 3TLWA 3M3ZB 5JQGE 4L0RA 3RIFA 5AQFB 2ZM8A 2LRLA 3SFDA 3WAKA 4JEHB 3D0TA 1VCSA 5L3GB 3PUWF 4HFDA 3CX8B 3VKGA 1QUUA 3AAEB 4TWDA 3WAJA 3N9PA 4LMLA 2JRKA 2AE9A 3P4WA 3AAIA 2WDQA 2X0LB 2XQ6A 4U7YA 4LF6T 5DQWA 4HFBA 2N2NA 2W61A 4JI0T 2E9XA 4YXDA 3AVRA 5LYJE 2VK9A 1J5WA 4Z8XA 2P9BA 3ZLIA 2W00A 2L3LA 4LF9T 3OBVE 2XQ8A 4JLEA 2X9YA 3H3AA 1M62A 4YJ3E 5LGUB 4PJLA 4V1Av 3A8YC 2LOSA 3AEEA 5HXHA 5LOVE 3ZJ1A 4TZ4C 1XWMA 2BDEA 4UR9A 3QOFA 2V7KA 2Q9QC 2BS4A 2GK9A 4DR1T 2E8IA 4KX6A 4UVBB 4H9OC 3IA3A 2N1GA 4DVDA 4IDOA 3AE7A 1FJGT 3QK6A 2LLYA 2NP9A 2M6IA 4H9QC 4LFAT 3TLVA 3CX6B 2I59A 4QXBB 4CQIA 2MYSA 5AQPB 5HEGA 2YK0A 4NUUA 2C0SA 1OEDA 4EYUA 5AQHB 4WW0A 2A72A 2UU9T 1UGOA 3IBPA 5JREA 3CQCB 4C91A 4DNDA 1FEWA 3UFEA 5LJNA 3ZKRA 4NXMT 4UIGA 3RIAA 3VU7H 4E7SA 2V7JA 3ZT5A 2Q9QD 3RQUA 3T1HT 3RC8A 1L0VA 1SA0E 2WAUA 1VRBA 1FMVA 4UVCB 5IWAT 5CJ5A 2X9XA 5C8YE 4UVAB 2BKNA 4B6XA 1OXZA 1WR6A 3AA0B 2VL0A 4XBFB 3H3MA 5FXWA 2NW7A 4I4TE 4U74A 4DMWA 2E9XC 2VKJA 1WCRA 2W63A 3A5XA 4GIWA 2K24A 4WBNE 2C5IT 4NPPA 3BQLA 3P4PA 1NAFA 2XM1A 5ABHA 3PUAA 5IYZE 4OYKA 4B3MT 1MNDA 3O4XE 2WZHA 5LG4A 2V1DB 1NWMX 1XNRT 2IDOB 2PG8A 3TKLB 5ABGA 2WU2A 3UU6A 1E1HB 2WS3A 5FXVA 4JI6T 4BJMA 3K3NA 4CN1A 2IC6A 3J7Yq 4TNWA 3RGLA 4QWNB 5LNKA 1MIWA 3KV4A 5LP6E 4XZCA 2KWHA 4HWCA 4CI3B 3AEAA 3FZFB 2IW5B 3MACA 2V26A 4DBRA 3RKOA 2MTQA 1Z8UA 4HWIB 3ZYMA 2W0GA 2XQAA 3HA4A 5LMUT 1S94A 2E9XD 4JEUB 4YFSA 4N78D 2XHEB 2HN1A 3VHLA 4ADZA 3RIUC 3RRWA 3SOLA 2D0UA 5DABA 2BG9B 5L3FB 2XAHB 3O9XA 3J9X1 1XDOA 1SHZC 2V6XA 5CA0E 5HAXA 3CQXC 4Q25A 3GA8A 3N9NA 3OKQA 2ZM6T 2CE7A 3I9YA 2LKHA 3ZSTA 2IMLA 1YD8G 2QRXA 1W9RA 2PFVA 2VKOA 2YINA 3AEDA 4DR7T 2KXPB 4X1KE 2V7IA 1MNEA 3PU3A 1UX5A 3FZMB 4CN4A 4G63A 4TWHA 2KSRA 3ZCJA 2JQKA 3AE9A 2BG9E 3KV5A 2RP4A 4JI8T 3GN5B 2UUBT 4DMVA 3KV9A 1UURA 2QA7A 3AE5A 4ZI3C 2XQYA 4YLHA 4JI5T 5JTGA 1MMNA 2W4XA 4EEBA 4HE8A 3KDSE 5HEJA 4FJOA 2NR4A 2UXCT 2CCQA 4UF0A 3N9MA 5JDQA 1US7B 1R8IA 5JDFA 4OYJA 3HR0A 4P09A 2DLRA 2J4GA 2Y8DA 3FHNA 3FZKB 2QYWA 4YSYA 4CN6A 2X66A 5LBMA 4MLKA 1UK5A 3KBUA 4IGUA 3UU3A 3ZPOA 2HHHT 3LFMA 2EHOB 4EIWA 2XM2A 5LA6E 1HNWT 2UUCT 1DU2A 3SRZA 2LSIA 3ONJA 4U33A 1U5PA 3VRBA 3P50A 4HWFA 1HX1B 4JUYA 4IHJE 4TV8E 4AKGA 3MZKB 3F2EA 4ZI3D 4QXHB 3Q5XA 4LF7T 4IDZA 3ETVA 3BQIA 2W2UA 4QH4A 2H7OA 2XQ5A 3W15B 5AQLB 4CI1B 1MMGA 1WLXA 5HXSA 3CVRA 4QHOA 3LJCA 4I50E 2J47A 1ZV4X 2FJEA 3ZMZB 3K3QC 4AIUA 3UQ4A 3AE4A 2YU2A 2BBHA 2LSJA 3TLTA 1W0AA 3CK6A 2X67A 5AQOB 4ZZBA 1XZYA 3SS1A 2C5JA 4ISTA 1YKEB 3Q5EA 5L3CB 2WMOA 4EZ4A 5AQJB 3RYIE 4HFIA 3UUXB 1U4QA 4P1NA 5CFBA 2XAFB 2X9WA 4KP3C 4LFBT 5F5WA 5FY1A 2Z6EA 5HYAA 4IE0A 1O3XA 4DBQA 2UXNB 4ERRA 3PURA 3NZPA 4U2YA 2ZM0A 1XMQT 1VCTA 5ADXL 4NUVA 4HWHA 4OHFA 3AXJB 2LSKA 1BR1A 1E2AA 2ZM2A 3N2OA 3R84B 3UU4A 2D5UA 4ANJA 4COFA 4O4LE 4PFPA 4EOZB 2R6GF 2CRBA 3F31A 5HWXA 3CWZB 2PBIA 1D1AA 3DJBA 2FJDA 3FBLA 2IC9A 3SFEA 1LVFA 3QNUA 4YHHT 4B3RT 3ZSSA 4WZXA 3RLFF 4OX9T 2V5DA 2YDRA 2FJAA 3AEBA 5JH7E 2LM9A 5L4HA 1IBLT 4O2AE 3JCFA 1LVKA 3ANWB 1KK7A 4B3TT 2DWKA 1HNZT 2L8KA 5AQUB 3TLUA 3ZJ2A 2LEHA 3OVUA 1SUMB 3KFWX 3ZT6A 4ZI7E 3NKZA 4GK0E 2BG9A 4IE7A 3ZYLA 4DR6T 2XPKA 3ZMUB 2CLYB 4DR3T 2CBIA 1D1CA 3UT5E 4ZOLE 3Q5WA 3L8RA 2JMKA 3RYFE 5JR9A 1D0XA 1HG5A 4HGAA 5LHIB 3LK2B 4IE6A 2FBWA 4L5GA 2ACZA 3U78A 3N9OA 3N5LA 5HCJA 4AQGA 3RI5A 4QXCB 2W62A 4AKHA 1CHUA 4Z90A 3PUGA 1WYCA 3E0ZA 4E7ZA 2A9UA 4DV3T 1S35A 4ZEYA 4EEDA 5JDGA 4AXPA 1UUSA 4MALA 2YKSA 2QGSA 1G73A 2BBJA 4HN9A 3PUXF 4IE4A 2BZBA 3N9QA 3MXZA 5AQQB 4KHZF 4H9PC 3LDQB 3MA9A 2CXFA 1B7TA 3CQGB 3NRXA 4IL4A 4TUYE 4LFCT 3RIUA 3PUQA 4M1PA 4DR5T 4TN7B 2WQYA 2VQET 2V6YB 4LF4T 5AQKB 4HFVA 2NW8A 4DR2T 2PTFA 5AQIB 5HWYA 4YSXA 2RPAA 2DL1A 4IDNA 2HPJA 3AVSA 3X1DA 2DNXA 5LGNB 2MAWA 3P4QA 5LGTB 2EHOA 2W66A 4ZS2A 1LRZA 4EB6E 5JRCA 2ES0A 3K1SA 2NTXA 3C98B 2K48A 1KNZA 4O4JE 4EXTA 1IAPA 3N2KE 2LKGA 1T7SA 2JQQA 4L9IA 5J0ZA 2BG9C 2FJBA 2AXDS 1MIVA 2MPKA 2Q9QB 4J2CA 2WM9A 1IJ6A 3HKDE 5ABFB 4K0KT 3NWIA 4I43B 5HXEA 3B13A 4YTPA 5JR9C 5EK4A 3I0OA 4DUYT 2XQ4A 4A56A 2UXBT 1KNRA 1YQ3A 3AE2A 2YU1A 4UV9B 4CXWA 2G0UA 3CX7B 4PJMA 5JVDE 5KMGP 2YOEA 3VRAA 4AKIA 4HFCA 2CEAA 1N36T 3OPCA 2YEVC 3C50A 4GKKT 4YTNA 4O4HE 4DV7T 3OTOT 3MKDA 4ZZCA 3QUJA 4UXNB 2N9DA 4H9NC 4PAGA 3KVBA 1ZEEA 3ZCIA 4DV4T 3UU5A 1UCUA 3HKCE 5AFUL 5AQGB 2XAQB 2NW9A 3RQWA 3PJAJ 3KINB 4DV2T 4U3CA 1SE7A 2CWYA 1HCIA 4H63V 2WSSV 2CHOA 2H88A 4YHJA 1J1JA 2V8SV 4PW8A 4P0BA 1FMWA 3O1IA 2HH7A 4U72A 1JNZA 5LXTE 2H3RA 1IZNB 2F4VT 4X66T 3KBTA 1E7PA 4MBQA 2WU5A 2XY8B 1EZ3A 3LK3B 2W67A 2EHOC 2LOPA 2E9XB 3RF1A 3JADA 4PJJA 4GK5E 5GONE 4QX7B 3AAAB 2WWUA 3ZC1A 1KF6A 4Z91A 3ZN0B 2LHNA 2BKPA 2JQHA 3UFGA 2BVLA 4NIQA 4IL9A 2XSAA 1WR0A 4IDQA 4U7IA 2DWGA 2H89A 5LCYA 1N33T 4ASKA 4YT0A 2WDVA 2LSGA 2XJ7A 2VKHA 1I6ZA 2LRKA 4DV1T 3EDVA 3PE0A 2Y48B 1T98A 4WNKA 1KNPA 3RYHE 2CPTA 3F57A 4TWFA 1GQEA 5FY7A 2E5VA 1IBKT 4H9SE 1QLBA 1HX8A 3C64A 3AB3B 5EK2A 2Y6XA 3G06A 4U31A 4DO0A 3OYXA 4JBWF 1OWAA 2ZLYA 5L3DB 3EAMA 1KEYA 2EHOD 4DV6T 2PJQA 5FL1A 4IDPA 1YQ4A 4AISA 2CA5A 1UX4A 4BAYB 1YKHB 1OEDB 4PK4A 4WYVA 5LHGB 2LM2A 3ZEFB 2NTYA 3JC6C 5FP3A 3LG7A 4AQYT 1Z0PA 3S4UA 2OA5A 3IEEA 2WWVA 5AQVB 3EUHA 3RHWA 4G2AA 5F3JA 3AECA 4ILBA 2V6YA 2FUPA 2DHRA 5DQVA 1QSDA 5LB7B 5AQSB 2H7VC 4ZHQE 4CXYA 4A98A 1MMAA 1IBMT 5F8PA 2WCAA 1XMOT 3V5UA 2YDQA 2CXLA 2E5LT 3UU8A 5H6RB 5FYMA 3RH3A 5AQNB 3L39A 4TX5A 2JMHA 1OEDE 4X1YE 3DP7A 1J5ET 2VQFT 5CB4E 3IHRA 3ONXA 4KHPT 2OLTA 2WP9A 3V5SA 5JDNA 2B1EA 2M6BA 2VURA 3JC6D 3ZN1B 2CXDA 3OJAA 2ODUA 3SWHA 2X68A 4QH1A 3KVAA 3LSVA 3GWHA 2WY2A 2ZMAA 5BR8T 4PK5A 3MJXA 4A5XA 5EZYE 5CA1E 4LMJA 1FIOA 5JDHA 3L09A 2K9AA 4EGWA 5HEUA 3AE8A 4AQFA 5AQTB 1ZOYA 4GOUA 5HXRA 3PDYA 3K8PC 5FY0A 2XAGB 1V9DA 2YDSA 2A2FX 1YXRA 2KNDA 3JAFA 5HEHA 5IHYA 1HS7A 1X79A 4ILCA 2JIWA 2WZIA 2XQ9A 1M7KA 5JDLA 4P0AA 3AA7B 3FB2A 3ZMTB 2XASB 3JAEA 4HWDA 5KX5E 5FMNA 3ETUA 2BVMA 1Y64B 4LF8T 5EK3A 4ISSA 3FZLB 2NWBA 5AQRB 2NOXA 5FXZA 4KMCA 3C4ZA 4AI6A 2HN2A 5J2TE 5FNVE 5ABEA 4UELA 2UUAT 3PUYF 4O4IE 1WFDA 2XSBA 3AE6A 4X20E 4O2BE 3NBXX 1BR4A 1N34T 1KFYA 2KLQA 3M65A 4PFOA 5C2TA 4QKNA 5JDMA 2CHNA 2BKOA 3ESLA 5L3EB 4JYAT 3RX6A 1N32T 4IREA 3GN5A 3PTRB 5KXJA 2C5KT 4YTMA 3BK9A 4UF0B 3ZT7A 3HI2A 4JI1T 3AE1A 1YW0A 2CM0A 5HCMA 1HG2A 3GMIA 3C4WA 2VB6A 3P7IA 4U2ZA 3CIRA 5LHHB 3WI3A 3P4SA 5LJMA 2WMNA 1JNRA 1ZHCA 3B5MA 4OK0A 5DJQC 2RA1A 4AQFC 5CGMA 4H9RC 5C3JA 4HEAA 5FVLA 2D2SA 3LK42 3NVOA 2XQ7A 3DTOA 4ZI2C 3E22E 3Q5DA 2WDRA 4AKLA 3A7MA 2XUEA 1LKXA 1HF8A 3PUSA 4IT4A 5J2UE 1HTJF 4MFRA 2X51A 3P4RA 2XQ3A 4JI2T 4F8HA 4WBOA 4YSZA 3AE3A 4X65T 3N2GE 2LT3A 3RKGA 4BJNA 1XDPA 2E2AA 3UUMA 1I94T 3FXEB 2VKDA 2WB5A 3EVYA 4IE5A 2VASA 2VVNA 3VKHA 4PK6A 4LF5T 3HKEE 2MOZA 2LHRA 3ZMSB 1ZP0A 5BMVE 4ZI2D 2JPFA 2X9HA 4HTEA 4X1IE 4F6RC 2LJLA 3LBXB 2KMFA 3O1HA 4YY3T 1BR0A 4OFZA 1MIYA 4BA9A 1BR2A 3I0QA 3AXJA 2LSYA 2VVSA 4DIDB 2BS3A 4LMKA 5LBQB 2J1DG 3L3PA 4GKJT 1W0BA 5A1LA 1MMDA 4A97A 2I0MA 2YN6A 3AEFA 3Q2MA 4QX8B 2CWOA 1XNQT 3AA1B 3CKDA 1HR0T 5ETWA 2QVAA 5IUXA 3CMLA 3FZHB 3HKBE 4IIJE 1OEDC 5KDMC 4KUMB 1X9BA 4DV0T 2KWIB 3ANWA 5L3BB 4H63H 2IIUA
chains in the Genus database with same CATH topology
1MMAA 5HXCA 5F8PA 3RC8A 3RC3A 3KFWX 3HL6A 4ZI7E 3V5UA 4GK0E 4TV9E 2VWAA 1SA0E 4IE7A 2CXLA 2WAUA 3RPUA 3ZYLA 3RRCA 1H7CA 3ZC0A 1VRBA 5H6RB 5FYMA 3RH3A 1FMVA 2HPLA 3FXDB 4TX5A 2JJ9A 4UVCB 2JMHA 3ZMUB 2SPCA 2CLYB 2X9XA 4X1YE 3T8OA 2L9QA 5C8YE 4UVAB 3DP7A 4B6XA 1D1CA 5TAOA 3UT5E 5JR9B 4ZOLE 2DCFA 1OXZA 3Q5WA 5CB4E 3IHRA 1WR6A 3ONXA 3AA0B 4XBFB 5FXWA 1G8XA 3QC9A 2NW7A 2JMKA 4HKAA 4I4TE 3RYFE 1WYBA 2D0TA 1D0XA 3FBZA 4U74A 5JR9A 1HG5A 3Q9DA 4DMWA 4EZHA 2E9XC 3V5SA 5JDNA 2UXXB 4HGAA 4C90A 2VKJA 2B1EA 5LHIB 3LK2B 4IE6A 4L5GA 2W63A 4CI2B 3A5XA 3U78A 4GIWA 3N9OA 3N5LA 2K24A 3ZYKA 4AQGA 4WBNE 4ILUA 3JC6D 4QXCB 3ZN1B 2C5IT 2W62A 2KINB 3BQLA 4AKHA 2CXDA 4ZS3A 3UULA 1NAFA 3P8CD 3OJAA 2ODUA 3PUGA 4O8SA 3SWHA 3PUAA 1WRDA 5IYZE 4OYKA 1MNDA 2X68A 3O4XE 3KVAA 1WYCA 3E0ZA 5LG4A 2V1DB 4E7ZA 2KZ7B 5J1GA 3GWHA 1NWMX 2PG8A 3TKLB 1S35A 2ZMAA 1E1HB 5FXVA 5JDGA 4PK5A 3MJXA 5E0OA 4AXPA 4MALA 5EZYE 4BJMA 5CA1E 2WBLA 3K3NA 2QGSA 2IC6A 1G73A 3AA6B 4HN9A 3UTKA 1FIOA 3J7Yq 4IE4A 5JDHA 2BZBA 3L09A 4QWNB 5LNKA 3N9QA 3MXZA 1D0ZA 1MIWA 2K9AA 3KV4A 5LP6E 4XZCA 2KWHA 4UEMA 4CI3B 4H9PC 4EYYR 3MA9A 2IW5B 1VOMA 2CXFA 1B7TA 3MACA 4AQFA 2V26A 4CXXA 3CQGB 3NRXA 2LE8A 5H6QB 4TUYE 4DBRA 3RKOA 2A3DA 4EAHA 2MTQA 4GOUA 5HXRA 3PDYA 3PUQA 4M1PA 3K8PC 5FY0A 4K0UA 3ZYMA 2XAGB 3ZMVB 1V9DA 4TN7B 2M67A 2W0GA 2A2FX 3HA4A 4HFVA 1S94A 2NW8A 3BQKA 2KNDA 2E9XD 4JEUB 5HWYA 5IHYA 1HFAA 4YFSA 1CUNA 2XHEB 4N78D 1HS7A 5L2LA 2HPJA 1X79A 2DI4A 3AVSA 3K3OA 2V7MA 3EDUA 3VHLA 4ADZA 2DNXA 5LGNB 3RRWA 3SOLA 2D0UA 5JDLA 5LGTB 5JRCB 4P0AA 5DABA 3AA7B 5L3FB 2XAHB 2EHOA 4GYSA 2MBGA 3FB2A 3O9XA 4ZS2A 3J9X1 1LRZA 2KT9A 4EB6E 1SHZC 3ZMTB 2XASB 2ACXA 5CA0E 5JRCA 5HAXA 2ES0A 5KX5E 2NTXA 3CQXC 3C98B 2K48A 4KBMB 5FMNA 1KNZA 3ETUA 3O1JA 4O4JE 2BVMA 1Y64B 3GA8A 4EXTA 1IAPA 2VL8A 3N9NA 3OKQA 3N2KE 1AJ3A 4PNIA 5EK3A 2CE7A 3U3IA 4PJNA 2JQQA 2ODVA 2XAJB 4L9IA 2XTLA 3I9YA 4ISSA 1YD8G 3B57A 3C51A 4AKRB 3C4XA 2NWBA 4UV8B 2NOXA 5FXZA 4KMCA 3C4ZA 1D1BA 4AI6A 4YJ2E 3CPZA 5J2TE 1MIVA 5FNVE 2PFVA 2Q9QB 4J2CA 4UELA 2VKOA 2YINA 2KXPB 2WM9A 1ZKEA 4FI5A 1IJ6A 3HKDE 4O4IE 4X1KE 2V7IA 4I55E 3IF8B 3PU8A 3N9LA 1MNEA 2Q9QA 3PU3A 4X20E 1UX5A 3UUNA 4O2BE 3MK7C 3NBXX 4G63A 3I9WA 4I43B 3OYZA 5HXEA 2CLYC 1BR4A 3B13A 3H37A 5JR9C 5EK4A 3ZCJA 2KLQA 3M65A 4PFOA 3KV5A 2RP4A 3GN5B 3I0OA 4QKNA 5JDMA 4DMVA 4A56A 3KV9A 3ESLA 2QA7A 3E08A 5L3EB 2YU1A 4ZI3C 3RX6A 2XQYA 4YLHA 4UV9B 2CMRA 4CXWA 3GN5A 3PTRB 2G0UA 3CX7B 1MMNA 4PJMA 2C5KT 4CZZB 5JVDE 5KMGP 1D0YA 4HE8A 3KDSE 5M4YA 3BK9A 3RYCE 4AKIA 2CEAA 4UF0B 3HI2A 2YEVC 3NZQA 3I1AA 4GYRA 4MHCA 4FJOA 1YW0A 2CM0A 3C50A 2CCQA 4UF0A 1HG2A 3GMIA 3LBXA 3N9MA 3C4WA 4O4HE 5JDQA 3MKDA 3R6NA 2VB6A 1US7B 3P7IA 3QUJA 2IAKA 5JDFA 2K5BB 4UXNB 3KV6A 4OYJA 2N9DA 5LHHB 3NRYA 3WI3A 4H9NC 3HR0A 4P09A 5LJMA 1IJ5A 4PAGA 2DLRA 2Y8DA 3FHNA 3KVBA 1ZEEA 2WMNA 3ZCIA 4XAXB 5FXXA 2V7LA 1UCUA 1ZHCA 2X66A 5LBMA 3HKCE 4MLKA 5AFUL 4L0RA 5JQGE 3KBUA 2ZM8A 2XAQB 2NW9A 4OK0A 5DJQC 2RA1A 3KINB 4IGUA 3WAKA 4AQFC 4JEHB 3D0TA 4H9RC 5L3GB 3ZPOA 4HEAA 3LFMA 2D2SA 2EHOB 4EIWA 3LK42 3CX8B 2CWYA 1HCIA 4H63V 2WSSV 5LA6E 3VKGA 1QUUA 3DTOA 4ZI2C 3E22E 3SRZA 3AAEB 3WAJA 2LSIA 3N9PA 4YHJA 4AKLA 1U5PA 2JRKA 2XUEA 4PW8A 4P0BA 1FMWA 3O1IA 2HH7A 4U72A 4JUYA 3AAIA 4IHJE 4TV8E 5LXTE 2H3RA 1IZNB 1LKXA 4AKGA 1HF8A 3MZKB 3F2EA 4ZI3D 3PUSA 4QXHB 2X0LB 3KBTA 3Q5XA 4MBQA 4IDZA 1EZ3A 3ETVA 5J2UE 1HTJF 3BQIA 2H7OA 3LK3B 4MFRA 5DQWA 3W15B 4CI1B 2EHOC 1MMGA 2LOPA 1WLXA 2N2NA 5HXSA 2E9XB 2X51A 4PJJA 3CVRA 4GK5E 5GONE 4QHOA 3LJCA 2W61A 4I50E 4QX7B 3AAAB 2WWUA 4WBOA 1ZV4X 3ZC1A 3ZMZB 2E9XA 3AVRA 5LYJE 2VK9A 3K3QC 3ZN0B 2LHNA 4Z8XA 2YU2A 2LSJA 2P9BA 2BVLA 3ZLIA 2X67A 2W00A 3N2GE 2LT3A 4BJNA 3SS1A 2C5JA 2L3LA 4ISTA 1YKEB 3UUMA 2DWGA 3OBVE 5L3CB 2WMOA 3FXEB 4JLEA 2VKDA 4IE5A 2X9YA 3EVYA 3H3AA 2VASA 5LCYA 4EZ4A 4YJ3E 5LGUB 4ASKA 4PJLA 4V1Av 3VKHA 4PK6A 3RYIE 2LOSA 3HKEE 2MOZA 3UUXB 2LSGA 2LHRA 3ZMSB 5HXHA 1U4QA 5LOVE 2VKHA 2XAFB 2X9WA 3ZJ1A 4TZ4C 2BDEA 3EDVA 4KP3C 3PE0A 2V7KA 2Q9QC 2Y48B 5FY1A 1T98A 4WNKA 2GK9A 2Z6EA 5HYAA 4IE0A 5BMVE 2E8IA 4ZI2D 1O3XA 2JPFA 2X9HA 4HTEA 4UVBB 4H9OC 3RYHE 4X1IE 4DBQA 4F6RC 2N1GA 4DVDA 2LJLA 3F57A 2UXNB 4ERRA 3PURA 3LBXB 5FY7A 3NZPA 4H9SE 2ZM0A 1HX8A 3C64A 2KMFA 3O1HA 3AB3B 5ADXL 4NUVA 5EK2A 1BR0A 2Y6XA 4OHFA 4DO0A 3QK6A 3OYXA 4OFZA 2LSKA 1OWAA 1MIYA 1BR1A 2ZLYA 4BA9A 1BR2A 2NP9A 2ZM2A 5L3DB 3N2OA 2EHOD 4H9QC 2PJQA 3I0QA 3R84B 2D5UA 2LSYA 4ANJA 2CA5A 3CX6B 4O4LE 4PFPA 2I59A 1UX4A 4BAYB 5LBQB 4QXBB 4EOZB 1YKHB 4CQIA 2J1DG 2MYSA 4PK4A 3L3PA 5LHGB 5A1LA 2YK0A 4NUUA 2C0SA 3F31A 5HWXA 3CWZB 1MMDA 3ZEFB 2NTYA 3JC6C 4EYUA 5FP3A 2PBIA 3LG7A 1D1AA 3DJBA 4WW0A 3FBLA 1Z0PA 3S4UA 2A72A 2IC9A 1LVFA 3IBPA 3Q2MA 4QX8B 2CWOA 3AA1B 3CKDA 2OA5A 3IEEA 5JREA 3CQCB 3EUHA 5ETWA 4C91A 4G2AA 4DNDA 5JH7E 5F3JA 1FEWA 3CMLA 3UFEA 5LJNA 2LM9A 4UIGA 2DHRA 4O2AE 5DQVA 1QSDA 1LVKA 3ANWB 1KK7A 3VU7H 3HKBE 3ANWA 4IIJE 2DWKA 2L8KA 4E7SA 2V7JA 2H7VC 4KUMB 5KDMC 4ZHQE 3ZJ2A 2KWIB 2Q9QD 2LEHA 4CXYA 5L3BB 4H63H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A72 A;  4L9I A;  2DLR A;  3C51 A;  4YHJ A;  3C4X A;  1SHZ C;  3QC9 A;  2ACX A;  3CX6 B;  2I59 A;  4WBO A;  1ZV4 X;  2ES0 A;  3C4Z A;  3C50 A;  4IGU A;  3AB3 B;  3C4W A;  1IAP A;  4PNI A;  3CX7 B;  2PBI A;  3T8O A;  1HTJ F;  3CX8 B;  4GOU A;  4WNK A; 
#chains in the Genus database with same CATH topology
 5HXC A;  4TNV A;  2JQ9 A;  3RC3 A;  5L47 A;  3HL6 A;  4JV5 T;  2IHR 1;  4TV9 E;  5FKY A;  2VWA A;  3RPU A;  3RRC A;  1H7C A;  3VR8 A;  3ZC0 A;  2HPL A;  3FXD B;  4KI0 F;  2JJ9 A;  2SPC A;  4ZXL A;  3T8O A;  2L9Q A;  5TAO A;  5JR9 B;  2DCF A;  4X5T A;  2B76 A;  1G8X A;  3QC9 A;  4HKA A;  1WYB A;  2D0T A;  3FBZ A;  3Q9D A;  2X0Y A;  4EZH A;  2UXX B;  4C90 A;  2V5C A;  4CI2 B;  3ZYK A;  4ILU A;  2KIN B;  4ZS3 A;  3UUL A;  3P8C D;  2X0H A;  4O8S A;  1WRD A;  2OV9 A;  3VR9 A;  5FVK A;  1W09 A;  2KZ7 B;  5J1G A;  5HEO A;  4QH5 A;  5E0O A;  4NXN T;  4I0U A;  5LG3 A;  2BS2 A;  2WBL A;  3AA6 B;  3UTK A;  4B3S T;  3UQ7 A;  1D0Z A;  5FL0 A;  2IUB A;  3QB5 A;  4UEM A;  4EYY R;  3ONL C;  1VOM A;  3EAB A;  4CXX A;  2LE8 A;  5H6Q B;  4HFE A;  2A3D A;  4EAH A;  5AQM B;  2CBJ A;  1HNX T;  4K0U A;  3ZMV B;  2M67 A;  4JI4 T;  3BQK A;  3PUZ F;  1HFA A;  1CUN A;  1T8B A;  3EI0 A;  5L2L A;  1NEK A;  3PUV F;  2DI4 A;  3K3O A;  2V7M A;  3EDU A;  4X62 T;  5JRC B;  4GYS A;  2MBG A;  2KT9 A;  2ACX A;  4EV6 A;  1NEN A;  3PJA A;  5LMN T;  4KBM B;  3O1J A;  2VL8 A;  1AJ3 A;  4PNI A;  3U3I A;  4PJN A;  2ODV A;  4DUZ T;  4DR4 T;  2XAJ B;  2XTL A;  4JI7 T;  3C51 A;  3B57 A;  4AKR B;  3C4X A;  4UV8 B;  3TLS A;  2J62 A;  3EHZ A;  1D1B A;  4YJ2 E;  3CPZ A;  1ZKE A;  4FI5 A;  3QB5 K;  4I55 E;  3IF8 B;  3PU8 A;  3N9L A;  4X64 T;  3UUB A;  2Q9Q A;  3UUN A;  3MK7 C;  3I9W A;  3OYZ A;  2UXD T;  2CLY C;  5ABF A;  3H37 A;  1Y01 A;  3E08 A;  2CMR A;  4HFH A;  3ABV A;  2I6H A;  2XZE A;  4CZZ B;  1D0Y A;  5M4Y A;  4ILA A;  3RYC E;  4DV5 T;  3NZQ A;  3I1A A;  4GYR A;  4MHC A;  3T1Y T;  2D9D A;  3LBX A;  1T72 A;  3PV0 F;  3R6N A;  4JI3 T;  3AEG A;  2IAK A;  2K5B B;  3KV6 A;  3NRY A;  1IJ5 A;  5L4E A;  2K3W A;  4XAX B;  5FXX A;  2V7L A;  3TLW A;  3M3Z B;  5JQG E;  4L0R A;  3RIF A;  5AQF B;  2ZM8 A;  2LRL A;  3SFD A;  3WAK A;  4JEH B;  3D0T A;  1VCS A;  5L3G B;  3PUW F;  4HFD A;  3CX8 B;  3VKG A;  1QUU A;  3AAE B;  4TWD A;  3WAJ A;  3N9P A;  4LML A;  2JRK A;  2AE9 A;  3P4W A;  3AAI A;  2WDQ A;  2X0L B;  2XQ6 A;  4U7Y A;  4LF6 T;  5DQW A;  4HFB A;  2N2N A;  2W61 A;  4JI0 T;  2E9X A;  4YXD A;  3AVR A;  5LYJ E;  2VK9 A;  1J5W A;  4Z8X A;  2P9B A;  3ZLI A;  2W00 A;  2L3L A;  4LF9 T;  3OBV E;  2XQ8 A;  4JLE A;  2X9Y A;  3H3A A;  1M62 A;  4YJ3 E;  5LGU B;  4PJL A;  4V1A v;  3A8Y C;  2LOS A;  3AEE A;  5HXH A;  5LOV E;  3ZJ1 A;  4TZ4 C;  1XWM A;  2BDE A;  4UR9 A;  3QOF A;  2V7K A;  2Q9Q C;  2BS4 A;  2GK9 A;  4DR1 T;  2E8I A;  4KX6 A;  4UVB B;  4H9O C;  3IA3 A;  2N1G A;  4DVD A;  4IDO A;  3AE7 A;  1FJG T;  3QK6 A;  2LLY A;  2NP9 A;  2M6I A;  4H9Q C;  4LFA T;  3TLV A;  3CX6 B;  2I59 A;  4QXB B;  4CQI A;  2MYS A;  5AQP B;  5HEG A;  2YK0 A;  4NUU A;  2C0S A;  1OED A;  4EYU A;  5AQH B;  4WW0 A;  2A72 A;  2UU9 T;  1UGO A;  3IBP A;  5JRE A;  3CQC B;  4C91 A;  4DND A;  1FEW A;  3UFE A;  5LJN A;  3ZKR A;  4NXM T;  4UIG A;  3RIA A;  3VU7 H;  4E7S A;  2V7J A;  3ZT5 A;  2Q9Q D;  3RQU A;  3T1H T;  3RC8 A;  1L0V A;  1SA0 E;  2WAU A;  1VRB A;  1FMV A;  4UVC B;  5IWA T;  5CJ5 A;  2X9X A;  5C8Y E;  4UVA B;  2BKN A;  4B6X A;  1OXZ A;  1WR6 A;  3AA0 B;  2VL0 A;  4XBF B;  3H3M A;  5FXW A;  2NW7 A;  4I4T E;  4U74 A;  4DMW A;  2E9X C;  2VKJ A;  1WCR A;  2W63 A;  3A5X A;  4GIW A;  2K24 A;  4WBN E;  2C5I T;  4NPP A;  3BQL A;  3P4P A;  1NAF A;  2XM1 A;  5ABH A;  3PUA A;  5IYZ E;  4OYK A;  4B3M T;  1MND A;  3O4X E;  2WZH A;  5LG4 A;  2V1D B;  1NWM X;  1XNR T;  2IDO B;  2PG8 A;  3TKL B;  5ABG A;  2WU2 A;  3UU6 A;  1E1H B;  2WS3 A;  5FXV A;  4JI6 T;  4BJM A;  3K3N A;  4CN1 A;  2IC6 A;  3J7Y q;  4TNW A;  3RGL A;  4QWN B;  5LNK A;  1MIW A;  3KV4 A;  5LP6 E;  4XZC A;  2KWH A;  4HWC A;  4CI3 B;  3AEA A;  3FZF B;  2IW5 B;  3MAC A;  2V26 A;  4DBR A;  3RKO A;  2MTQ A;  1Z8U A;  4HWI B;  3ZYM A;  2W0G A;  2XQA A;  3HA4 A;  5LMU T;  1S94 A;  2E9X D;  4JEU B;  4YFS A;  4N78 D;  2XHE B;  2HN1 A;  3VHL A;  4ADZ A;  3RIU C;  3RRW A;  3SOL A;  2D0U A;  5DAB A;  2BG9 B;  5L3F B;  2XAH B;  3O9X A;  3J9X 1;  1XDO A;  1SHZ C;  2V6X A;  5CA0 E;  5HAX A;  3CQX C;  4Q25 A;  3GA8 A;  3N9N A;  3OKQ A;  2ZM6 T;  2CE7 A;  3I9Y A;  2LKH A;  3ZST A;  2IML A;  1YD8 G;  2QRX A;  1W9R A;  2PFV A;  2VKO A;  2YIN A;  3AED A;  4DR7 T;  2KXP B;  4X1K E;  2V7I A;  1MNE A;  3PU3 A;  1UX5 A;  3FZM B;  4CN4 A;  4G63 A;  4TWH A;  2KSR A;  3ZCJ A;  2JQK A;  3AE9 A;  2BG9 E;  3KV5 A;  2RP4 A;  4JI8 T;  3GN5 B;  2UUB T;  4DMV A;  3KV9 A;  1UUR A;  2QA7 A;  3AE5 A;  4ZI3 C;  2XQY A;  4YLH A;  4JI5 T;  5JTG A;  1MMN A;  2W4X A;  4EEB A;  4HE8 A;  3KDS E;  5HEJ A;  4FJO A;  2NR4 A;  2UXC T;  2CCQ A;  4UF0 A;  3N9M A;  5JDQ A;  1US7 B;  1R8I A;  5JDF A;  4OYJ A;  3HR0 A;  4P09 A;  2DLR A;  2J4G A;  2Y8D A;  3FHN A;  3FZK B;  2QYW A;  4YSY A;  4CN6 A;  2X66 A;  5LBM A;  4MLK A;  1UK5 A;  3KBU A;  4IGU A;  3UU3 A;  3ZPO A;  2HHH T;  3LFM A;  2EHO B;  4EIW A;  2XM2 A;  5LA6 E;  1HNW T;  2UUC T;  1DU2 A;  3SRZ A;  2LSI A;  3ONJ A;  4U33 A;  1U5P A;  3VRB A;  3P50 A;  4HWF A;  1HX1 B;  4JUY A;  4IHJ E;  4TV8 E;  4AKG A;  3MZK B;  3F2E A;  4ZI3 D;  4QXH B;  3Q5X A;  4LF7 T;  4IDZ A;  3ETV A;  3BQI A;  2W2U A;  4QH4 A;  2H7O A;  2XQ5 A;  3W15 B;  5AQL B;  4CI1 B;  1MMG A;  1WLX A;  5HXS A;  3CVR A;  4QHO A;  3LJC A;  4I50 E;  2J47 A;  1ZV4 X;  2FJE A;  3ZMZ B;  3K3Q C;  4AIU A;  3UQ4 A;  3AE4 A;  2YU2 A;  2BBH A;  2LSJ A;  3TLT A;  1W0A A;  3CK6 A;  2X67 A;  5AQO B;  4ZZB A;  1XZY A;  3SS1 A;  2C5J A;  4IST A;  1YKE B;  3Q5E A;  5L3C B;  2WMO A;  4EZ4 A;  5AQJ B;  3RYI E;  4HFI A;  3UUX B;  1U4Q A;  4P1N A;  5CFB A;  2XAF B;  2X9W A;  4KP3 C;  4LFB T;  5F5W A;  5FY1 A;  2Z6E A;  5HYA A;  4IE0 A;  1O3X A;  4DBQ A;  2UXN B;  4ERR A;  3PUR A;  3NZP A;  4U2Y A;  2ZM0 A;  1XMQ T;  1VCT A;  5ADX L;  4NUV A;  4HWH A;  4OHF A;  3AXJ B;  2LSK A;  1BR1 A;  1E2A A;  2ZM2 A;  3N2O A;  3R84 B;  3UU4 A;  2D5U A;  4ANJ A;  4COF A;  4O4L E;  4PFP A;  4EOZ B;  2R6G F;  2CRB A;  3F31 A;  5HWX A;  3CWZ B;  2PBI A;  1D1A A;  3DJB A;  2FJD A;  3FBL A;  2IC9 A;  3SFE A;  1LVF A;  3QNU A;  4YHH T;  4B3R T;  3ZSS A;  4WZX A;  3RLF F;  4OX9 T;  2V5D A;  2YDR A;  2FJA A;  3AEB A;  5JH7 E;  2LM9 A;  5L4H A;  1IBL T;  4O2A E;  3JCF A;  1LVK A;  3ANW B;  1KK7 A;  4B3T T;  2DWK A;  1HNZ T;  2L8K A;  5AQU B;  3TLU A;  3ZJ2 A;  2LEH A;  3OVU A;  1SUM B;  3KFW X;  3ZT6 A;  4ZI7 E;  3NKZ A;  4GK0 E;  2BG9 A;  4IE7 A;  3ZYL A;  4DR6 T;  2XPK A;  3ZMU B;  2CLY B;  4DR3 T;  2CBI A;  1D1C A;  3UT5 E;  4ZOL E;  3Q5W A;  3L8R A;  2JMK A;  3RYF E;  5JR9 A;  1D0X A;  1HG5 A;  4HGA A;  5LHI B;  3LK2 B;  4IE6 A;  2FBW A;  4L5G A;  2ACZ A;  3U78 A;  3N9O A;  3N5L A;  5HCJ A;  4AQG A;  3RI5 A;  4QXC B;  2W62 A;  4AKH A;  1CHU A;  4Z90 A;  3PUG A;  1WYC A;  3E0Z A;  4E7Z A;  2A9U A;  4DV3 T;  1S35 A;  4ZEY A;  4EED A;  5JDG A;  4AXP A;  1UUS A;  4MAL A;  2YKS A;  2QGS A;  1G73 A;  2BBJ A;  4HN9 A;  3PUX F;  4IE4 A;  2BZB A;  3N9Q A;  3MXZ A;  5AQQ B;  4KHZ F;  4H9P C;  3LDQ B;  3MA9 A;  2CXF A;  1B7T A;  3CQG B;  3NRX A;  4IL4 A;  4TUY E;  4LFC T;  3RIU A;  3PUQ A;  4M1P A;  4DR5 T;  4TN7 B;  2WQY A;  2VQE T;  2V6Y B;  4LF4 T;  5AQK B;  4HFV A;  2NW8 A;  4DR2 T;  2PTF A;  5AQI B;  5HWY A;  4YSX A;  2RPA A;  2DL1 A;  4IDN A;  2HPJ A;  3AVS A;  3X1D A;  2DNX A;  5LGN B;  2MAW A;  3P4Q A;  5LGT B;  2EHO A;  2W66 A;  4ZS2 A;  1LRZ A;  4EB6 E;  5JRC A;  2ES0 A;  3K1S A;  2NTX A;  3C98 B;  2K48 A;  1KNZ A;  4O4J E;  4EXT A;  1IAP A;  3N2K E;  2LKG A;  1T7S A;  2JQQ A;  4L9I A;  5J0Z A;  2BG9 C;  2FJB A;  2AXD S;  1MIV A;  2MPK A;  2Q9Q B;  4J2C A;  2WM9 A;  1IJ6 A;  3HKD E;  5ABF B;  4K0K T;  3NWI A;  4I43 B;  5HXE A;  3B13 A;  4YTP A;  5JR9 C;  5EK4 A;  3I0O A;  4DUY T;  2XQ4 A;  4A56 A;  2UXB T;  1KNR A;  1YQ3 A;  3AE2 A;  2YU1 A;  4UV9 B;  4CXW A;  2G0U A;  3CX7 B;  4PJM A;  5JVD E;  5KMG P;  2YOE A;  3VRA A;  4AKI A;  4HFC A;  2CEA A;  1N36 T;  3OPC A;  2YEV C;  3C50 A;  4GKK T;  4YTN A;  4O4H E;  4DV7 T;  3OTO T;  3MKD A;  4ZZC A;  3QUJ A;  4UXN B;  2N9D A;  4H9N C;  4PAG A;  3KVB A;  1ZEE A;  3ZCI A;  4DV4 T;  3UU5 A;  1UCU A;  3HKC E;  5AFU L;  5AQG B;  2XAQ B;  2NW9 A;  3RQW A;  3PJA J;  3KIN B;  4DV2 T;  4U3C A;  1SE7 A;  2CWY A;  1HCI A;  4H63 V;  2WSS V;  2CHO A;  2H88 A;  4YHJ A;  1J1J A;  2V8S V;  4PW8 A;  4P0B A;  1FMW A;  3O1I A;  2HH7 A;  4U72 A;  1JNZ A;  5LXT E;  2H3R A;  1IZN B;  2F4V T;  4X66 T;  3KBT A;  1E7P A;  4MBQ A;  2WU5 A;  2XY8 B;  1EZ3 A;  3LK3 B;  2W67 A;  2EHO C;  2LOP A;  2E9X B;  3RF1 A;  3JAD A;  4PJJ A;  4GK5 E;  5GON E;  4QX7 B;  3AAA B;  2WWU A;  3ZC1 A;  1KF6 A;  4Z91 A;  3ZN0 B;  2LHN A;  2BKP A;  2JQH A;  3UFG A;  2BVL A;  4NIQ A;  4IL9 A;  2XSA A;  1WR0 A;  4IDQ A;  4U7I A;  2DWG A;  2H89 A;  5LCY A;  1N33 T;  4ASK A;  4YT0 A;  2WDV A;  2LSG A;  2XJ7 A;  2VKH A;  1I6Z A;  2LRK A;  4DV1 T;  3EDV A;  3PE0 A;  2Y48 B;  1T98 A;  4WNK A;  1KNP A;  3RYH E;  2CPT A;  3F57 A;  4TWF A;  1GQE A;  5FY7 A;  2E5V A;  1IBK T;  4H9S E;  1QLB A;  1HX8 A;  3C64 A;  3AB3 B;  5EK2 A;  2Y6X A;  3G06 A;  4U31 A;  4DO0 A;  3OYX A;  4JBW F;  1OWA A;  2ZLY A;  5L3D B;  3EAM A;  1KEY A;  2EHO D;  4DV6 T;  2PJQ A;  5FL1 A;  4IDP A;  1YQ4 A;  4AIS A;  2CA5 A;  1UX4 A;  4BAY B;  1YKH B;  1OED B;  4PK4 A;  4WYV A;  5LHG B;  2LM2 A;  3ZEF B;  2NTY A;  3JC6 C;  5FP3 A;  3LG7 A;  4AQY T;  1Z0P A;  3S4U A;  2OA5 A;  3IEE A;  2WWV A;  5AQV B;  3EUH A;  3RHW A;  4G2A A;  5F3J A;  3AEC A;  4ILB A;  2V6Y A;  2FUP A;  2DHR A;  5DQV A;  1QSD A;  5LB7 B;  5AQS B;  2H7V C;  4ZHQ E;  4CXY A;  4A98 A;  1MMA A;  1IBM T;  5F8P A;  2WCA A;  1XMO T;  3V5U A;  2YDQ A;  2CXL A;  2E5L T;  3UU8 A;  5H6R B;  5FYM A;  3RH3 A;  5AQN B;  3L39 A;  4TX5 A;  2JMH A;  1OED E;  4X1Y E;  3DP7 A;  1J5E T;  2VQF T;  5CB4 E;  3IHR A;  3ONX A;  4KHP T;  2OLT A;  2WP9 A;  3V5S A;  5JDN A;  2B1E A;  2M6B A;  2VUR A;  3JC6 D;  3ZN1 B;  2CXD A;  3OJA A;  2ODU A;  3SWH A;  2X68 A;  4QH1 A;  3KVA A;  3LSV A;  3GWH A;  2WY2 A;  2ZMA A;  5BR8 T;  4PK5 A;  3MJX A;  4A5X A;  5EZY E;  5CA1 E;  4LMJ A;  1FIO A;  5JDH A;  3L09 A;  2K9A A;  4EGW A;  5HEU A;  3AE8 A;  4AQF A;  5AQT B;  1ZOY A;  4GOU A;  5HXR A;  3PDY A;  3K8P C;  5FY0 A;  2XAG B;  1V9D A;  2YDS A;  2A2F X;  1YXR A;  2KND A;  3JAF A;  5HEH A;  5IHY A;  1HS7 A;  1X79 A;  4ILC A;  2JIW A;  2WZI A;  2XQ9 A;  1M7K A;  5JDL A;  4P0A A;  3AA7 B;  3FB2 A;  3ZMT B;  2XAS B;  3JAE A;  4HWD A;  5KX5 E;  5FMN A;  3ETU A;  2BVM A;  1Y64 B;  4LF8 T;  5EK3 A;  4ISS A;  3FZL B;  2NWB A;  5AQR B;  2NOX A;  5FXZ A;  4KMC A;  3C4Z A;  4AI6 A;  2HN2 A;  5J2T E;  5FNV E;  5ABE A;  4UEL A;  2UUA T;  3PUY F;  4O4I E;  1WFD A;  2XSB A;  3AE6 A;  4X20 E;  4O2B E;  3NBX X;  1BR4 A;  1N34 T;  1KFY A;  2KLQ A;  3M65 A;  4PFO A;  5C2T A;  4QKN A;  5JDM A;  2CHN A;  2BKO A;  3ESL A;  5L3E B;  4JYA T;  3RX6 A;  1N32 T;  4IRE A;  3GN5 A;  3PTR B;  5KXJ A;  2C5K T;  4YTM A;  3BK9 A;  4UF0 B;  3ZT7 A;  3HI2 A;  4JI1 T;  3AE1 A;  1YW0 A;  2CM0 A;  5HCM A;  1HG2 A;  3GMI A;  3C4W A;  2VB6 A;  3P7I A;  4U2Z A;  3CIR A;  5LHH B;  3WI3 A;  3P4S A;  5LJM A;  2WMN A;  1JNR A;  1ZHC A;  3B5M A;  4OK0 A;  5DJQ C;  2RA1 A;  4AQF C;  5CGM A;  4H9R C;  5C3J A;  4HEA A;  5FVL A;  2D2S A;  3LK4 2;  3NVO A;  2XQ7 A;  3DTO A;  4ZI2 C;  3E22 E;  3Q5D A;  2WDR A;  4AKL A;  3A7M A;  2XUE A;  1LKX A;  1HF8 A;  3PUS A;  4IT4 A;  5J2U E;  1HTJ F;  4MFR A;  2X51 A;  3P4R A;  2XQ3 A;  4JI2 T;  4F8H A;  4WBO A;  4YSZ A;  3AE3 A;  4X65 T;  3N2G E;  2LT3 A;  3RKG A;  4BJN A;  1XDP A;  2E2A A;  3UUM A;  1I94 T;  3FXE B;  2VKD A;  2WB5 A;  3EVY A;  4IE5 A;  2VAS A;  2VVN A;  3VKH A;  4PK6 A;  4LF5 T;  3HKE E;  2MOZ A;  2LHR A;  3ZMS B;  1ZP0 A;  5BMV E;  4ZI2 D;  2JPF A;  2X9H A;  4HTE A;  4X1I E;  4F6R C;  2LJL A;  3LBX B;  2KMF A;  3O1H A;  4YY3 T;  1BR0 A;  4OFZ A;  1MIY A;  4BA9 A;  1BR2 A;  3I0Q A;  3AXJ A;  2LSY A;  2VVS A;  4DID B;  2BS3 A;  4LMK A;  5LBQ B;  2J1D G;  3L3P A;  4GKJ T;  1W0B A;  5A1L A;  1MMD A;  4A97 A;  2I0M A;  2YN6 A;  3AEF A;  3Q2M A;  4QX8 B;  2CWO A;  1XNQ T;  3AA1 B;  3CKD A;  1HR0 T;  5ETW A;  2QVA A;  5IUX A;  3CML A;  3FZH B;  3HKB E;  4IIJ E;  1OED C;  5KDM C;  4KUM B;  1X9B A;  4DV0 T;  2KWI B;  3ANW A;  5L3B B;  4H63 H;  2IIU A; 
#chains in the Genus database with same CATH homology
 1MMA A;  5HXC A;  5F8P A;  3RC8 A;  3RC3 A;  3KFW X;  3HL6 A;  4ZI7 E;  3V5U A;  4GK0 E;  4TV9 E;  2VWA A;  1SA0 E;  4IE7 A;  2CXL A;  2WAU A;  3RPU A;  3ZYL A;  3RRC A;  1H7C A;  3ZC0 A;  1VRB A;  5H6R B;  5FYM A;  3RH3 A;  1FMV A;  2HPL A;  3FXD B;  4TX5 A;  2JJ9 A;  4UVC B;  2JMH A;  3ZMU B;  2SPC A;  2CLY B;  2X9X A;  4X1Y E;  3T8O A;  2L9Q A;  5C8Y E;  4UVA B;  3DP7 A;  4B6X A;  1D1C A;  5TAO A;  3UT5 E;  5JR9 B;  4ZOL E;  2DCF A;  1OXZ A;  3Q5W A;  5CB4 E;  3IHR A;  1WR6 A;  3ONX A;  3AA0 B;  4XBF B;  5FXW A;  1G8X A;  3QC9 A;  2NW7 A;  2JMK A;  4HKA A;  4I4T E;  3RYF E;  1WYB A;  2D0T A;  1D0X A;  3FBZ A;  4U74 A;  5JR9 A;  1HG5 A;  3Q9D A;  4DMW A;  4EZH A;  2E9X C;  3V5S A;  5JDN A;  2UXX B;  4HGA A;  4C90 A;  2VKJ A;  2B1E A;  5LHI B;  3LK2 B;  4IE6 A;  4L5G A;  2W63 A;  4CI2 B;  3A5X A;  3U78 A;  4GIW A;  3N9O A;  3N5L A;  2K24 A;  3ZYK A;  4AQG A;  4WBN E;  4ILU A;  3JC6 D;  4QXC B;  3ZN1 B;  2C5I T;  2W62 A;  2KIN B;  3BQL A;  4AKH A;  2CXD A;  4ZS3 A;  3UUL A;  1NAF A;  3P8C D;  3OJA A;  2ODU A;  3PUG A;  4O8S A;  3SWH A;  3PUA A;  1WRD A;  5IYZ E;  4OYK A;  1MND A;  2X68 A;  3O4X E;  3KVA A;  1WYC A;  3E0Z A;  5LG4 A;  2V1D B;  4E7Z A;  2KZ7 B;  5J1G A;  3GWH A;  1NWM X;  2PG8 A;  3TKL B;  1S35 A;  2ZMA A;  1E1H B;  5FXV A;  5JDG A;  4PK5 A;  3MJX A;  5E0O A;  4AXP A;  4MAL A;  5EZY E;  4BJM A;  5CA1 E;  2WBL A;  3K3N A;  2QGS A;  2IC6 A;  1G73 A;  3AA6 B;  4HN9 A;  3UTK A;  1FIO A;  3J7Y q;  4IE4 A;  5JDH A;  2BZB A;  3L09 A;  4QWN B;  5LNK A;  3N9Q A;  3MXZ A;  1D0Z A;  1MIW A;  2K9A A;  3KV4 A;  5LP6 E;  4XZC A;  2KWH A;  4UEM A;  4CI3 B;  4H9P C;  4EYY R;  3MA9 A;  2IW5 B;  1VOM A;  2CXF A;  1B7T A;  3MAC A;  4AQF A;  2V26 A;  4CXX A;  3CQG B;  3NRX A;  2LE8 A;  5H6Q B;  4TUY E;  4DBR A;  3RKO A;  2A3D A;  4EAH A;  2MTQ A;  4GOU A;  5HXR A;  3PDY A;  3PUQ A;  4M1P A;  3K8P C;  5FY0 A;  4K0U A;  3ZYM A;  2XAG B;  3ZMV B;  1V9D A;  4TN7 B;  2M67 A;  2W0G A;  2A2F X;  3HA4 A;  4HFV A;  1S94 A;  2NW8 A;  3BQK A;  2KND A;  2E9X D;  4JEU B;  5HWY A;  5IHY A;  1HFA A;  4YFS A;  1CUN A;  2XHE B;  4N78 D;  1HS7 A;  5L2L A;  2HPJ A;  1X79 A;  2DI4 A;  3AVS A;  3K3O A;  2V7M A;  3EDU A;  3VHL A;  4ADZ A;  2DNX A;  5LGN B;  3RRW A;  3SOL A;  2D0U A;  5JDL A;  5LGT B;  5JRC B;  4P0A A;  5DAB A;  3AA7 B;  5L3F B;  2XAH B;  2EHO A;  4GYS A;  2MBG A;  3FB2 A;  3O9X A;  4ZS2 A;  3J9X 1;  1LRZ A;  2KT9 A;  4EB6 E;  1SHZ C;  3ZMT B;  2XAS B;  2ACX A;  5CA0 E;  5JRC A;  5HAX A;  2ES0 A;  5KX5 E;  2NTX A;  3CQX C;  3C98 B;  2K48 A;  4KBM B;  5FMN A;  1KNZ A;  3ETU A;  3O1J A;  4O4J E;  2BVM A;  1Y64 B;  3GA8 A;  4EXT A;  1IAP A;  2VL8 A;  3N9N A;  3OKQ A;  3N2K E;  1AJ3 A;  4PNI A;  5EK3 A;  2CE7 A;  3U3I A;  4PJN A;  2JQQ A;  2ODV A;  2XAJ B;  4L9I A;  2XTL A;  3I9Y A;  4ISS A;  1YD8 G;  3B57 A;  3C51 A;  4AKR B;  3C4X A;  2NWB A;  4UV8 B;  2NOX A;  5FXZ A;  4KMC A;  3C4Z A;  1D1B A;  4AI6 A;  4YJ2 E;  3CPZ A;  5J2T E;  1MIV A;  5FNV E;  2PFV A;  2Q9Q B;  4J2C A;  4UEL A;  2VKO A;  2YIN A;  2KXP B;  2WM9 A;  1ZKE A;  4FI5 A;  1IJ6 A;  3HKD E;  4O4I E;  4X1K E;  2V7I A;  4I55 E;  3IF8 B;  3PU8 A;  3N9L A;  1MNE A;  2Q9Q A;  3PU3 A;  4X20 E;  1UX5 A;  3UUN A;  4O2B E;  3MK7 C;  3NBX X;  4G63 A;  3I9W A;  4I43 B;  3OYZ A;  5HXE A;  2CLY C;  1BR4 A;  3B13 A;  3H37 A;  5JR9 C;  5EK4 A;  3ZCJ A;  2KLQ A;  3M65 A;  4PFO A;  3KV5 A;  2RP4 A;  3GN5 B;  3I0O A;  4QKN A;  5JDM A;  4DMV A;  4A56 A;  3KV9 A;  3ESL A;  2QA7 A;  3E08 A;  5L3E B;  2YU1 A;  4ZI3 C;  3RX6 A;  2XQY A;  4YLH A;  4UV9 B;  2CMR A;  4CXW A;  3GN5 A;  3PTR B;  2G0U A;  3CX7 B;  1MMN A;  4PJM A;  2C5K T;  4CZZ B;  5JVD E;  5KMG P;  1D0Y A;  4HE8 A;  3KDS E;  5M4Y A;  3BK9 A;  3RYC E;  4AKI A;  2CEA A;  4UF0 B;  3HI2 A;  2YEV C;  3NZQ A;  3I1A A;  4GYR A;  4MHC A;  4FJO A;  1YW0 A;  2CM0 A;  3C50 A;  2CCQ A;  4UF0 A;  1HG2 A;  3GMI A;  3LBX A;  3N9M A;  3C4W A;  4O4H E;  5JDQ A;  3MKD A;  3R6N A;  2VB6 A;  1US7 B;  3P7I A;  3QUJ A;  2IAK A;  5JDF A;  2K5B B;  4UXN B;  3KV6 A;  4OYJ A;  2N9D A;  5LHH B;  3NRY A;  3WI3 A;  4H9N C;  3HR0 A;  4P09 A;  5LJM A;  1IJ5 A;  4PAG A;  2DLR A;  2Y8D A;  3FHN A;  3KVB A;  1ZEE A;  2WMN A;  3ZCI A;  4XAX B;  5FXX A;  2V7L A;  1UCU A;  1ZHC A;  2X66 A;  5LBM A;  3HKC E;  4MLK A;  5AFU L;  4L0R A;  5JQG E;  3KBU A;  2ZM8 A;  2XAQ B;  2NW9 A;  4OK0 A;  5DJQ C;  2RA1 A;  3KIN B;  4IGU A;  3WAK A;  4AQF C;  4JEH B;  3D0T A;  4H9R C;  5L3G B;  3ZPO A;  4HEA A;  3LFM A;  2D2S A;  2EHO B;  4EIW A;  3LK4 2;  3CX8 B;  2CWY A;  1HCI A;  4H63 V;  2WSS V;  5LA6 E;  3VKG A;  1QUU A;  3DTO A;  4ZI2 C;  3E22 E;  3SRZ A;  3AAE B;  3WAJ A;  2LSI A;  3N9P A;  4YHJ A;  4AKL A;  1U5P A;  2JRK A;  2XUE A;  4PW8 A;  4P0B A;  1FMW A;  3O1I A;  2HH7 A;  4U72 A;  4JUY A;  3AAI A;  4IHJ E;  4TV8 E;  5LXT E;  2H3R A;  1IZN B;  1LKX A;  4AKG A;  1HF8 A;  3MZK B;  3F2E A;  4ZI3 D;  3PUS A;  4QXH B;  2X0L B;  3KBT A;  3Q5X A;  4MBQ A;  4IDZ A;  1EZ3 A;  3ETV A;  5J2U E;  1HTJ F;  3BQI A;  2H7O A;  3LK3 B;  4MFR A;  5DQW A;  3W15 B;  4CI1 B;  2EHO C;  1MMG A;  2LOP A;  1WLX A;  2N2N A;  5HXS A;  2E9X B;  2X51 A;  4PJJ A;  3CVR A;  4GK5 E;  5GON E;  4QHO A;  3LJC A;  2W61 A;  4I50 E;  4QX7 B;  3AAA B;  2WWU A;  4WBO A;  1ZV4 X;  3ZC1 A;  3ZMZ B;  2E9X A;  3AVR A;  5LYJ E;  2VK9 A;  3K3Q C;  3ZN0 B;  2LHN A;  4Z8X A;  2YU2 A;  2LSJ A;  2P9B A;  2BVL A;  3ZLI A;  2X67 A;  2W00 A;  3N2G E;  2LT3 A;  4BJN A;  3SS1 A;  2C5J A;  2L3L A;  4IST A;  1YKE B;  3UUM A;  2DWG A;  3OBV E;  5L3C B;  2WMO A;  3FXE B;  4JLE A;  2VKD A;  4IE5 A;  2X9Y A;  3EVY A;  3H3A A;  2VAS A;  5LCY A;  4EZ4 A;  4YJ3 E;  5LGU B;  4ASK A;  4PJL A;  4V1A v;  3VKH A;  4PK6 A;  3RYI E;  2LOS A;  3HKE E;  2MOZ A;  3UUX B;  2LSG A;  2LHR A;  3ZMS B;  5HXH A;  1U4Q A;  5LOV E;  2VKH A;  2XAF B;  2X9W A;  3ZJ1 A;  4TZ4 C;  2BDE A;  3EDV A;  4KP3 C;  3PE0 A;  2V7K A;  2Q9Q C;  2Y48 B;  5FY1 A;  1T98 A;  4WNK A;  2GK9 A;  2Z6E A;  5HYA A;  4IE0 A;  5BMV E;  2E8I A;  4ZI2 D;  1O3X A;  2JPF A;  2X9H A;  4HTE A;  4UVB B;  4H9O C;  3RYH E;  4X1I E;  4DBQ A;  4F6R C;  2N1G A;  4DVD A;  2LJL A;  3F57 A;  2UXN B;  4ERR A;  3PUR A;  3LBX B;  5FY7 A;  3NZP A;  4H9S E;  2ZM0 A;  1HX8 A;  3C64 A;  2KMF A;  3O1H A;  3AB3 B;  5ADX L;  4NUV A;  5EK2 A;  1BR0 A;  2Y6X A;  4OHF A;  4DO0 A;  3QK6 A;  3OYX A;  4OFZ A;  2LSK A;  1OWA A;  1MIY A;  1BR1 A;  2ZLY A;  4BA9 A;  1BR2 A;  2NP9 A;  2ZM2 A;  5L3D B;  3N2O A;  2EHO D;  4H9Q C;  2PJQ A;  3I0Q A;  3R84 B;  2D5U A;  2LSY A;  4ANJ A;  2CA5 A;  3CX6 B;  4O4L E;  4PFP A;  2I59 A;  1UX4 A;  4BAY B;  5LBQ B;  4QXB B;  4EOZ B;  1YKH B;  4CQI A;  2J1D G;  2MYS A;  4PK4 A;  3L3P A;  5LHG B;  5A1L A;  2YK0 A;  4NUU A;  2C0S A;  3F31 A;  5HWX A;  3CWZ B;  1MMD A;  3ZEF B;  2NTY A;  3JC6 C;  4EYU A;  5FP3 A;  2PBI A;  3LG7 A;  1D1A A;  3DJB A;  4WW0 A;  3FBL A;  1Z0P A;  3S4U A;  2A72 A;  2IC9 A;  1LVF A;  3IBP A;  3Q2M A;  4QX8 B;  2CWO A;  3AA1 B;  3CKD A;  2OA5 A;  3IEE A;  5JRE A;  3CQC B;  3EUH A;  5ETW A;  4C91 A;  4G2A A;  4DND A;  5JH7 E;  5F3J A;  1FEW A;  3CML A;  3UFE A;  5LJN A;  2LM9 A;  4UIG A;  2DHR A;  4O2A E;  5DQV A;  1QSD A;  1LVK A;  3ANW B;  1KK7 A;  3VU7 H;  3HKB E;  3ANW A;  4IIJ E;  2DWK A;  2L8K A;  4E7S A;  2V7J A;  2H7V C;  4KUM B;  5KDM C;  4ZHQ E;  3ZJ2 A;  2KWI B;  2Q9Q D;  2LEH A;  4CXY A;  5L3B B;  4H63 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...