4IGUA

Crystal structure of the rgs domain of cg5036
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
137
structure length
137
Chain Sequence
b'SQPTLEEIRSWGKSFDKLMKSTAGRKVFQNFLRSEFSEENILFWLACEDLKKENSPELVEEKARLIYEDYISILSPREVSLDSRVREIVNRNMIEPTTHTFDEAQIQIYTLMHRDSYPRFLNSQKFKTLSRPAAKLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CG5036
molecule tags Signaling protein
source organism Drosophila melanogaster
publication title Double suppression of the G alpha protein activity by RGS proteins
pubmed doi rcsb
total genus 52
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00615 RGS Regulator of G protein signaling domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1850 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4iguA00
3CX7B 1IAPA 2I59A 4YHJA 4IGUA 4GOUA 3T8OA 3C4WA 4L9IA 3C50A 4WBOA 3C4ZA 2ES0A 3CX8B 3QC9A 2PBIA 1SHZC 3C4XA 3C51A 2ACXA 3AB3B 3CX6B 1HTJF 2DLRA 2A72A 1ZV4X 4PNIA 4WNKA
chains in the Genus database with same CATH superfamily
2FJEA 3MZKB 2K48A 2EHOA 3CQXC 3KVAA 4DV4T 4MALA 2D9DA 4Z90A 2XM1A 3CK6A 3ONLC 2BS2A 2V6YB 3ZC0A 1YD8G 3IHRA 2H88A 3PURA 4U2ZA 3ONXA 5L2LA 2Q9QA 4WBOA 4CI1B 4QX7B 3T1YT 4LF6T 2DI4A 3CQGB 4H9QC 2M67A 4TV9E 2L8KA 1YKEB 5HEGA 4JBWF 5F3JA 5AQOB 3LK3B 1M62A 2Q9QC 3ZCIA 5LGUB 2X68A 2N2NA 3VR8A 4TV8E 2WCAA 4UIGA 3RYHE 2VURA 2CBIA 1KNRA 4CXXA 1IZNB 1NENA 2IC6A 1YW0A 2KINB 4ZHQE 4IE0A 4L0RA 1UGOA 2KMFA 2WP9A 4UVAB 5FVKA 1QLBA 4EEDA 4JV5T 3ANWB 3EDUA 3AE1A 4TX5A 5AQFB 4H9NC 5FP3A 1IBMT 1MNDA 2VVSA 4FI5A 1D1BA 3KV4A 2E9XC 3AE8A 4AKHA 3KBUA 3F57A 1Y64B 4KUMB 5H6QB 2XPKA 3CX7B 2E8IA 2E9XD 5M4YA 1KEYA 3MXZA 3L09A 5JDNA 2VQFT 4ASKA 1W0AA 2WAUA 3OYXA 2W66A 4MFRA 1XNQT 1ZP0A 2L9QA 2YEVC 4YTPA 2KWHA 3TLTA 4DVDA 3HKCE 3NRYA 2V7MA 4WW0A 5JTGA 5A1LA 2W62A 1M7KA 1W09A 1MMNA 2BDEA 2XQAA 1VCSA 3AE4A 3JADA 4YJ3E 5AQVB 3NVOA 5FVLA 3RKOA 3EI0A 3UUMA 5LP6E 4JI1T 1UUSA 2BVMA 1O3XA 2BKNA 2C5KT 4PJNA 1GQEA 5FXWA 4IDZA 3OPCA 3RQUA 5L47A 2XHEB 1I94T 4CI2B 4GK0E 2A9UA 2DNXA 3BQIA 4WNKA 1IBKT 1MIYA 2D0TA 3QNUA 5LMUT 4XZCA 4YLHA 4YJ2E 4O4LE 2W2UA 3Q5DA 3ZEFB 2VL0A 2WU5A 5AQUB 2UXXB 3FBZA 1IAPA 1VOMA 4HFEA 5F8PA 5ABEA 2NTXA 3RIUA 2CHOA 5CFBA 3KDSE 2N9DA 5EZYE 4I4TE 4HWFA 4TN7B 3AE6A 2E2AA 2M6BA 4IREA 2UXCT 2DL1A 2V6XA 4ILCA 1YKHB 4H63H 4OHFA 4BAYB 4U33A 5JDHA 4XBFB 3DP7A 5LBMA 2XM2A 4IDOA 2I6HA 3AB3B 2BS3A 3CX6B 2V7KA 3N9OA 4EYUA 4WBNE 5LJNA 1N33T 4AIUA 2J47A 4X65T 4JI0T 4ADZA 3RLFF 3RI5A 2L3LA 4AISA 3AEAA 4E7SA 2ODUA 5J1GA 4E7ZA 1X79A 2XAJB 4X5TA 3AXJB 2CMRA 3RC3A 4AKIA 2JMKA 3TLWA 3ANWA 3UU6A 2WDQA 3ZMVB 2C0SA 3UFEA 3I0OA 4X1YE 5DJQC 1OWAA 4QH5A 2NW9A 1E2AA 2X9WA 1HNZT 3FHNA 5KX5E 3ZT7A 1SUMB 4O2BE 3UT5E 4CN4A 3ZLIA 1T7SA 2K9AA 2Q9QD 2I59A 2K5BB 4YXDA 1HF8A 4EGWA 2V7IA 3UU3A 3GN5A 3UTKA 2CLYC 4AQFA 1VCTA 2FJAA 5FY1A 5LHIB 3LBXB 4ZZCA 2CEAA 4TZ4C 3RYFE 3CX8B 2YU1A 5FL0A 4COFA 5LXTE 2LHRA 5JH7E 4ZI2C 4OYKA 4ISTA 3EUHA 3I0QA 4AQFC 2LT3A 2J4GA 4DMWA 3QUJA 1HTJF 1U4QA 5HXCA 1MMDA 2W63A 5CA1E 5ABFB 1HX1B 4X20E 1FJGT 4DV6T 3HL6A 2KNDA 2CLYB 4NUUA 2K3WA 2J1DG 1LKXA 2WSSV 2XSBA 4K0UA 3RRWA 4P0AA 2C5IT 2CRBA 3K3NA 5L3FB 2HN1A 3NWIA 2XQ5A 2UUBT 4EYYR 2IIUA 2IC9A 2PTFA 3RIFA 3AECA 1UURA 3FBLA 4U2YA 3ZT5A 3OTOT 3JAFA 2D5UA 4Z91A 5H6RB 3ZT6A 4TUYE 4U72A 5AQKB 2CE7A 2KWIB 4A97A 2CXFA 5KXJA 5L3CB 3T8OA 4L5GA 3TLSA 1BR0A 1R8IA 3AEEA 2OLTA 3FXDB 3GMIA 4IE6A 3UU4A 3ZKRA 3ZMTB 4DUYT 2VK9A 2X51A 3B57A 5EK4A 1UX5A 2ZMAA 3SRZA 1ZKEA 3VKHA 2LM2A 1W9RA 1J5ET 3ZPOA 5L3GB 2XQ4A 1IBLT 4LMJA 3UU8A 5CA0E 1J5WA 1NEKA 1D0ZA 4Z8XA 3L8RA 2V7LA 1OXZA 4ZXLA 2QYWA 3HI2A 5KMGP 5AQQB 2YDQA 3CVRA 1NAFA 1I6ZA 2XQ7A 3NBXX 3CMLA 3O9XA 3T1HT 4GYRA 2V26A 2JQKA 4PNIA 2WS3A 1D1AA 4PFOA 1W0BA 4NUVA 3AEGA 3SOLA 4WZXA 2H7VC 1MMGA 4GK5E 4LMKA 4DBQA 2W61A 5FXXA 2QRXA 2G0UA 3AAAB 3LK2B 4HFIA 4B3MT 3PUYF 5KDMC 5JR9B 3NZPA 5JDFA 3RH3A 3P4QA 2LRLA 2XQ8A 3C4ZA 3CPZA 1WRDA 4A5XA 5LG4A 1ZOYA 3RGLA 3Q5XA 1HG5A 4CN6A 4EOZB 4DV3T 1XNRT 3IA3A 4QHOA 5LHHB 5HEJA 3LG7A 5J0ZA 1XMOT 2ACXA 4DR6T 1KF6A 3ZJ1A 5AQGB 3Q5EA 1DU2A 3F2EA 2CPTA 4IHJE 5HWXA 2MPKA 4DV1T 2BBHA 4O8SA 2A72A 3P50A 2F4VT 2MYSA 3N9MA 1UX4A 3N2OA 4HEAA 4PK5A 3VU7H 2XY8B 4QH4A 5L4EA 2LSKA 2VWAA 4O2AE 4JYAT 1ZHCA 5AQRB 2UUAT 2YOEA 2W00A 4YFSA 2VQET 2PFVA 2CBJA 2LM9A 3MK7C 4KI0F 2CWYA 2H3RA 2Z6EA 4HFDA 2JIWA 4ZZBA 4OX9T 4PJLA 5HCMA 3FB2A 5ETWA 4GKJT 4KHPT 3M3ZB 2WQYA 2CCQA 4KMCA 4UEMA 5HXRA 4A56A 3F31A 1YQ4A 3KV5A 2M6IA 5HXEA 1CHUA 3ONJA 1XDOA 3I9WA 2JQHA 2K24A 4YSYA 5LHGB 1CUNA 2BKOA 2IHR1 2LKGA 5JDMA 1HNXT 3OYZA 4TWDA 4DV0T 2XQYA 4ERRA 1FMVA 4H9RC 2VASA 4IT4A 3PUSA 4HWDA 4PJJA 2GK9A 1G73A 3WI3A 5AQPB 5BMVE 3SWHA 3KBTA 2V8SV 4AQYT 3AAIA 5FMNA 4NXNT 1H7CA 3PDYA 2WBLA 4QXBB 2R6GF 2HN2A 4B3RT 3AEDA 2BG9C 2QVAA 3PJAJ 3AA6B 1T72A 3CQCB 3Q2MA 2ACZA 2JJ9A 3O1IA 3QB5K 5FY7A 4V1Av 3HKBE 2WDVA 2X0LB 2MTQA 5DQWA 5JREA 3RIUC 4IGUA 2NW8A 4UF0B 1JNRA 2IUBA 1IJ5A 2XQ9A 2HPLA 3JAEA 3AE7A 3R84B 2RPAA 1Z8UA 4ZOLE 3E08A 5AQHB 4AKRB 2IW5B 2LOSA 3G06A 1ZEEA 4N78D 3X1DA 3C98B 1MIWA 2B76A 1HCIA 2EHOC 2PBIA 2RA1A 2ZM8A 2BG9E 3AA0B 2E9XB 2W0GA 3C51A 2V5CA 3OVUA 2UXDT 2XQ3A 4I0UA 2X9XA 3PUQA 4M1PA 5JVDE 4EZHA 2N1GA 5AFUL 2VVNA 3WAJA 2LRKA 4LF5T 3FZLB 4U7IA 3KFWX 4CZZB 3M65A 2WZIA 2BG9B 4ZI3D 2NP9A 2WMOA 4KHZF 5IHYA 4DO0A 5LNKA 4DUZT 3RKGA 4YTNA 1XZYA 2Y8DA 4ILBA 1WLXA 4I55E 1HNWT 5HXSA 3PUZF 3KVBA 2UUCT 2ODVA 4EXTA 4GIWA 3PUVF 3N9PA 2WWUA 4TWHA 5LJMA 4A98A 3SFDA 3HKDE 4CQIA 4ZI2D 4B3TT 2EHOB 4MBQA 2BG9A 4HFCA 1D0YA 4JLEA 2X66A 4XAXB 2VKHA 5DABA 1KK7A 2ES0A 2BZBA 3RRCA 3VRBA 1V9DA 2V1DB 3Q5WA 2V5DA 3QC9A 5FXVA 3W15B 5C2TA 4JI5T 4DR3T 5BR8T 2AXDS 3FZKB 3LFMA 3KV9A 1BR1A 2CXLA 1US7B 3DTOA 5LBQB 5JDLA 3WAKA 4CXWA 2J62A 2KZ7B 1JNZA 1J1JA 1YQ3A 4DV2T 3ZSTA 3AAEB 2XAFB 5LGNB 3UFGA 4I43B 2H7OA 2XSAA 3EHZA 4LFAT 3QB5A 4C90A 2ZLYA 5AQSB 5HYAA 3BQKA 4LFCT 2JPFA 3FZFB 2YN6A 2KT9A 4YHJA 4TNWA 5L4HA 3GWHA 3ESLA 3P4WA 4KBMB 3IF8B 3UUXB 3ZYLA 4HKAA 4C91A 2FBWA 5ADXL 4YHHT 4G2AA 4F6RC 2YDSA 2JQ9A 5IWAT 4U7YA 1E7PA 2LSGA 1S35A 3TKLB 4BJNA 2Q9QB 4MLKA 4K0KT 3VKGA 3PTRB 1S94A 4IL4A 3MACA 3EABA 3ZYMA 3FZMB 3UUNA 4QH1A 2KXPB 1WCRA 5IUXA 5JR9C 5L3EB 4YSZA 4O4IE 1KFYA 5HEOA 4P09A 4IDQA 4J2CA 1Y01A 3ZSSA 4DR7T 3D0TA 4Q25A 3R6NA 5EK2A 2XQ6A 2MBGA 3ZC1A 3PUGA 4JI7T 3FXEB 4LF4T 2VKOA 3TLUA 3KV6A 4YT0A 3GA8A 4EAHA 3RYCE 5AQTB 2BKPA 1MNEA 2CA5A 3E0ZA 5L3DB 3LK42 4B3ST 4UV8B 2LKHA 2QA7A 1MIVA 2I0MA 4CXYA 2YK0A 3I1AA 4DNDA 2B1EA 3OJAA 3C4WA 2NW7A 3ZN0B 1SA0E 5HEUA 1IJ6A 4H63V 2LHNA 3ZMUB 4G63A 5LA6E 4EIWA 3H37A 2KLQA 3P7IA 3ZCJA 3PV0F 5E0OA 2NOXA 1WFDA 2X0YA 2XAQB 3L3PA 3ETVA 2WY2A 5TAOA 2QGSA 1KNPA 3EDVA 2AE9A 3AEBA 4TWFA 4OYJA 3N9LA 4U31A 5HXHA 5HEHA 3RYIE 3N2KE 1L0VA 3SS1A 2LSIA 2NR4A 4I50E 2XAHB 3IEEA 2PG8A 2XJ7A 5AQJB 5IYZE 3PE0A 2KSRA 2UXNB 2Y6XA 1B7TA 1EZ3A 4AXPA 3TLVA 2DWKA 5JDGA 3O1HA 2YINA 2LLYA 4DV5T 3K8PC 2VB6A 3AE2A 2W67A 3LBXA 3S4UA 3V5UA 5FYMA 4KP3C 5ABHA 3J7Yq 4ZI3C 2E5LT 4YSXA 4HFHA 3AE5A 5C8YE 5CB4E 4LF7T 3H3MA 5FKYA 3ZJ2A 3RPUA 1FMWA 3PUXF 3IBPA 3JCFA 3MA9A 4EEBA 4HWHA 1OEDC 5J2TE 4DV7T 3JC6C 4ZEYA 5LG3A 3PUWF 3RIAA 3PUAA 2LSJA 4X1IE 5HAXA 2FJDA 3GN5B 2CXDA 4HFVA 4P0BA 2A3DA 2EHOD 4OFZA 4EZ4A 3E22E 5HCJA 2XUEA 3AVRA 5L3BB 3K3QC 3L39A 3AVSA 5AQLB 4B6XA 4ANJA 4DR5T 2WM9A 4HE8A 4MHCA 4QXCB 3CWZB 3HA4A 4LMLA 5LB7B 3N9QA 3N5LA 1NWMX 3P4PA 1D0XA 4QX8B 3J9X1 3C64A 3VHLA 1D1CA 5EK3A 4UXNB 4HFBA 1QSDA 4YTMA 3BK9A 3EVYA 4HN9A 2Y48B 2IMLA 1AJ3A 1LRZA 4PK4A 5LYJE 5LCYA 3B5MA 2LJLA 4L9IA 4TNVA 2SPCA 3SFEA 2YKSA 2MAWA 4IE5A 2ZM0A 4DR1T 2DHRA 5GONE 2YDRA 4O4JE 3CKDA 2CM0A 1HG2A 4AKLA 2IDOB 1SHZC 3B13A 2NWBA 3N2GE 3UQ4A 2DWGA 3C4XA 2BVLA 4JI3T 3ABVA 3LSVA 4UR9A 1XDPA 1LVFA 3ZYKA 4DBRA 4JI4T 3N9NA 4X64T 3ETUA 4H9SE 5ABGA 2D2SA 5F5WA 4PK6A 4IE7A 4LF8T 3K3OA 4NIQA 3EAMA 1HX8A 4QXHB 3JC6D 2X67A 3BQLA 4UELA 5CGMA 5DQVA 1ZV4X 4JI2T 3U78A 1KNZA 1VRBA 3MKDA 2XASB 2WU2A 4JI6T 4AI6A 4OK0A 1WR6A 3FZHB 3AXJA 1QUUA 5LOVE 2WWVA 2LE8A 3RQWA 4AKGA 2C5JA 3C50A 4QWNB 5FL1A 4IIJE 1HR0T 2HH7A 4YY3T 2RP4A 2XAGB 2PJQA 4ILUA 1BR4A 4GYSA 3MJXA 4UV9B 4X66T 2JRKA 4UVBB 2XTLA 2UU9T 4NXMT 4X1KE 1Z0PA 1UCUA 1WYCA 5AQNB 4DIDB 3NRXA 4ISSA 2DLRA 4LF9T 4JEHB 3V5SA 2WMNA 1E1HB 3P4SA 2IAKA 3P4RA 2HPJA 3PU8A 3RHWA 3A7MA 3ZMZB 4IL9A 2A2FX 4PW8A 3A8YC 4QKNA 2E5VA 2WB5A 3I9YA 3VR9A 2OA5A 4HTEA 4HWCA 4UVCB 4EV6A 1N34T 5ABFA 3KINB 2JMHA 2WDRA 4U74A 3K1SA 4BJMA 4CI3B 1N32T 4ZS2A 2FUPA 5FY0A 3AA7B 2FJBA 1OEDE 2BBJA 2LEHA 2V6YA 1XWMA 2BS4A 2H89A 2YU2A 3UUBA 2NTYA 2CHNA 3O4XE 2ZM6T 3AA1B 3A5XA 4X62T 4IDNA 2WZHA 3PJAA 4ILAA 4PJMA 1G8XA 4PAGA 1U5PA 1LVKA 2X9HA 4HWIB 5FNVE 2ZM2A 4NPPA 2OV9A 3QOFA 3OKQA 2JQQA 1OEDB 3U3IA 4H9PC 4AQGA 1FEWA 2MOZA 5FXZA 3ZMSB 4ZI7E 2D0UA 3UULA 3H3AA 3RC8A 5LGTB 5LMNT 4JI8T 3AEFA 1N36T 1WR0A 3RF1A 1HFAA 3Q9DA 2UXBT 2X9YA 2VKJA 3OBVE 3ZN1B 2LOPA 2V7JA 2X0HA 5CJ5A 1OEDA 4ZS3A 1WYBA 4DR4T 5JRCA 3CIRA 4JEUB 4O4HE 3UU5A 5AQIB 4F8HA 3RX6A 4GOUA 1FIOA 2VL8A 1BR2A 4U3CA 5HWYA 4WYVA 1X9BA 1YXRA 3DJBA 3LDQB 4JUYA 1XMQT 1T8BA 1T98A 3AE3A 2VKDA 3P8CD 3HKEE 2P9BA 3AE9A 3PU3A 4FJOA 4IE4A 4PFPA 4LFBT 2XZEA 4UF0A 4GKKT 5JRCB 4KX6A 4BA9A 4CN1A 1MMAA 5C3JA 4EB6E 5J2UE 3HR0A 3O1JA 2DCFA 3UQ7A 4HGAA 1HS7A 4IDPA 5JR9A 5JDQA 2W4XA 1UK5A 4P1NA 1SE7A 2LSYA 3LJCA 2E9XA 5JQGE 4DMVA 2HHHT 3QK6A 3VRAA 5AQMB 3NKZA 3NZQA 2CWOA 4DR2T 4H9OC
chains in the Genus database with same CATH topology
3MZKB 2K48A 2EHOA 3CQXC 3KVAA 4MALA 3ZC0A 1YD8G 3IHRA 5L2LA 3PURA 3ONXA 2Q9QA 4WBOA 4CI1B 4QX7B 2DI4A 3CQGB 4H9QC 2M67A 4TV9E 2L8KA 1YKEB 5F3JA 3ZCIA 3LK3B 2Q9QC 5LGUB 2X68A 2N2NA 4CXXA 4TV8E 4UIGA 3RYHE 4DBQA 1IZNB 2IC6A 2KINB 1YW0A 4ZHQE 4IE0A 4L0RA 2KMFA 4UVAB 3ANWB 3EDUA 4TX5A 4H9NC 5FP3A 1MNDA 4FI5A 1D1BA 3KV4A 2E9XC 4AKHA 3KBUA 3F57A 1Y64B 4KUMB 5H6QB 3CX7B 2E8IA 2E9XD 5M4YA 3MXZA 3L09A 4ASKA 2WAUA 3OYXA 4MFRA 2L9QA 2YEVC 2KWHA 4DVDA 3HKCE 3NRYA 2V7MA 4WW0A 5A1LA 2W62A 2BDEA 1MMNA 4YJ3E 3RKOA 3UUMA 5LP6E 2BVMA 2C5KT 1O3XA 4PJNA 5JDNA 5FXWA 4IDZA 2XHEB 4CI2B 4GK0E 2DNXA 3BQIA 4WNKA 1MIYA 2D0TA 4XZCA 4YLHA 4YJ2E 4O4LE 3ZEFB 3FBZA 2UXXB 1IAPA 1VOMA 5F8PA 2NTXA 3KDSE 2N9DA 5EZYE 4I4TE 4TN7B 1YKHB 4H63H 4OHFA 4BAYB 5JDHA 4XBFB 3DP7A 5LBMA 3N9OA 3AB3B 4WBNE 3CX6B 2V7KA 4EYUA 5LJNA 4ADZA 4E7SA 2L3LA 4E7ZA 2ODUA 5J1GA 1X79A 2XAJB 4AKIA 2CMRA 3RC3A 2JMKA 3ANWA 3ZMVB 2C0SA 3UFEA 3I0OA 4X1YE 5DJQC 1OWAA 2NW9A 2X9WA 3FHNA 5KX5E 4O2BE 3ZLIA 2K9AA 2Q9QD 2I59A 2K5BB 1HF8A 2V7IA 3GN5A 3UTKA 2CLYC 4AQFA 5FY1A 5LHIB 3LBXB 2CEAA 4TZ4C 3RYFE 3CX8B 2YU1A 5LXTE 2LHRA 5JH7E 4ZI2C 4OYKA 4ISTA 3EUHA 3I0QA 4AQFC 2LT3A 4DMWA 3QUJA 1HTJF 1U4QA 5HXCA 1MMDA 2W63A 5CA1E 4X20E 3HL6A 2KNDA 2CLYB 4NUUA 2J1DG 1LKXA 2WSSV 4K0UA 3RRWA 4P0AA 2C5IT 3K3NA 5L3FB 4EYYR 2IC9A 3FBLA 2D5UA 5H6RB 4TUYE 4U72A 5L3CB 2CE7A 2KWIB 2CXFA 3T8OA 4L5GA 1BR0A 3FXDB 4IE6A 3GMIA 3ZMTB 2VK9A 2X51A 3B57A 5EK4A 1UX5A 2ZMAA 3SRZA 1ZKEA 3ZPOA 5L3GB 5CA0E 1D0ZA 4Z8XA 2V7LA 1OXZA 3HI2A 5KMGP 3CVRA 1NAFA 3NBXX 3CMLA 3O9XA 4GYRA 2V26A 4PNIA 1D1AA 4PFOA 4NUVA 3SOLA 2H7VC 1MMGA 4GK5E 2W61A 5FXXA 3LK2B 2G0UA 3AAAB 5JR9B 3NZPA 5JDFA 3RH3A 3C4ZA 3CPZA 1WRDA 5LG4A 3Q5XA 1HG5A 4EOZB 5LHHB 4QHOA 3LG7A 2ACXA 3ZJ1A 3F2EA 5HWXA 4IHJE 4O8SA 2A72A 2MYSA 3N9MA 1UX4A 3N2OA 4HEAA 4PK5A 3VU7H 2LSKA 2VWAA 4O2AE 1ZHCA 2W00A 4YFSA 2PFVA 2LM9A 3MK7C 2CWYA 2H3RA 2Z6EA 4PJLA 3FB2A 5ETWA 4KMCA 2CCQA 4UEMA 5HXRA 4A56A 3F31A 3KV5A 5HXEA 3I9WA 2K24A 5LHGB 1CUNA 5JDMA 3OYZA 2XQYA 4ERRA 1FMVA 4H9RC 2VASA 3PUSA 4PJJA 3WI3A 2GK9A 1G73A 5BMVE 3SWHA 3KBTA 3AAIA 5FMNA 1H7CA 3PDYA 2WBLA 4QXBB 3AA6B 3CQCB 3Q2MA 5FY7A 2JJ9A 3O1IA 4V1Av 3HKBE 5JREA 2X0LB 2MTQA 5DQWA 4IGUA 2NW8A 4UF0B 3R84B 1IJ5A 5KDMC 2HPLA 4AKRB 4ZOLE 3E08A 2IW5B 2LOSA 1ZEEA 4N78D 3C98B 2ZM8A 1MIWA 1HCIA 2EHOC 2PBIA 2RA1A 3AA0B 3UUNA 2E9XB 2W0GA 3C51A 2X9XA 3PUQA 4M1PA 5JVDE 4EZHA 2N1GA 5AFUL 3WAJA 3KFWX 4CZZB 3M65A 4ZI3D 2NP9A 2WMOA 4DO0A 5IHYA 5LNKA 2Y8DA 1WLXA 4I55E 5HXSA 3KVBA 2ODVA 4EXTA 4GIWA 3N9PA 2WWUA 5LJMA 4ZI2D 3HKDE 4CQIA 2EHOB 4MBQA 4XAXB 1D0YA 4JLEA 2X66A 3RRCA 2VKHA 5DABA 1KK7A 2ES0A 2BZBA 4AXPA 1V9DA 2V1DB 3Q5WA 3QC9A 5FXVA 3W15B 3LFMA 3KV9A 1BR1A 2CXLA 1US7B 3DTOA 5LBQB 5JDLA 3WAKA 4CXWA 2KZ7B 3AAEB 2XAFB 5LGNB 4I43B 2H7OA 4C90A 2ZLYA 5HYAA 3BQKA 2JPFA 2KT9A 4YHJA 3GWHA 3ESLA 4KBMB 3IF8B 3UUXB 3ZYLA 4HKAA 4C91A 5ADXL 4G2AA 4F6RC 2LSGA 1S35A 3TKLB 4BJNA 2Q9QB 4MLKA 3VKGA 3PTRB 1S94A 3MACA 3ZYMA 2KXPB 5L3EB 5JR9C 4O4IE 4P09A 4J2CA 3D0TA 5EK2A 3R6NA 2MBGA 3ZC1A 3PUGA 3FXEB 2VKOA 3KV6A 3GA8A 4EAHA 3RYCE 1MNEA 2CA5A 3E0ZA 5L3DB 3LK42 4UV8B 2QA7A 1MIVA 4CXYA 2YK0A 3I1AA 4DNDA 2B1EA 3OJAA 3C4WA 2NW7A 3ZN0B 1SA0E 1IJ6A 4H63V 2LHNA 3ZMUB 4G63A 5LA6E 4EIWA 3H37A 2KLQA 3P7IA 3ZCJA 5E0OA 2NOXA 2XAQB 3L3PA 3ETVA 5TAOA 2QGSA 3EDVA 4OYJA 3N9LA 5HXHA 3RYIE 3N2KE 3SS1A 2LSIA 4I50E 2XAHB 3IEEA 2PG8A 5IYZE 3PE0A 2UXNB 2Y6XA 1B7TA 1EZ3A 2DWKA 5JDGA 3O1HA 2YINA 3K8PC 2VB6A 3LBXA 3S4UA 3V5UA 5FYMA 4KP3C 3J7Yq 4ZI3C 5C8YE 5CB4E 3ZJ2A 3RPUA 1FMWA 3IBPA 3MA9A 5J2TE 3JC6C 3PUAA 2LSJA 4X1IE 5HAXA 3GN5B 2CXDA 4HFVA 4P0BA 2A3DA 2EHOD 4OFZA 4EZ4A 3E22E 2XUEA 3AVRA 5L3BB 3K3QC 4B6XA 3AVSA 4ANJA 2WM9A 4HE8A 4MHCA 4QXCB 3CWZB 3HA4A 3N9QA 3N5LA 1NWMX 3J9X1 1D0XA 4QX8B 3VHLA 3C64A 1D1CA 5EK3A 4UXNB 1QSDA 3BK9A 3EVYA 4HN9A 2Y48B 1AJ3A 1LRZA 4PK4A 5LYJE 5LCYA 2LJLA 4L9IA 2SPCA 4IE5A 2ZM0A 2DHRA 5GONE 4O4JE 3CKDA 2CM0A 1HG2A 4AKLA 4CI3B 1SHZC 3B13A 2NWBA 3N2GE 3VKHA 2DWGA 3C4XA 2BVLA 1LVFA 3ZYKA 4DBRA 3N9NA 3ETUA 4H9SE 2D2SA 4PK6A 4IE7A 3K3OA 1HX8A 4QXHB 3JC6D 2X67A 3BQLA 4UELA 5DQVA 1ZV4X 3U78A 1KNZA 1VRBA 3MKDA 2XASB 4AI6A 4OK0A 1WR6A 1QUUA 5LOVE 2LE8A 4AKGA 2C5JA 3C50A 4QWNB 4IIJE 2HH7A 2RP4A 2XAGB 2PJQA 4ILUA 1BR4A 4GYSA 3MJXA 4UV9B 2JRKA 4UVBB 2XTLA 4X1KE 1Z0PA 1UCUA 1WYCA 3NRXA 4ISSA 2DLRA 4JEHB 3V5SA 2WMNA 1E1HB 2IAKA 2HPJA 3PU8A 3ZMZB 2A2FX 4PW8A 4QKNA 3I9YA 2OA5A 4HTEA 4UVCB 3KINB 2JMHA 4U74A 4BJMA 4ZS2A 5FY0A 3AA7B 2LEHA 3UT5E 2YU2A 2NTYA 3O4XE 3AA1B 3A5XA 4PJMA 1G8XA 4PAGA 1U5PA 1LVKA 2X9HA 5FNVE 2ZM2A 3OKQA 2JQQA 3U3IA 4H9PC 4AQGA 1FEWA 2MOZA 5FXZA 3ZMSB 4ZI7E 2D0UA 3UULA 3H3AA 3RC8A 5LGTB 1HFAA 3Q9DA 2X9YA 2VKJA 3OBVE 3ZN1B 2LOPA 2V7JA 4ZS3A 1WYBA 5JRCA 4JEUB 4O4HE 3RX6A 4GOUA 1FIOA 2VL8A 1BR2A 5HWYA 4JUYA 3DJBA 1T98A 2VKDA 3P8CD 3HKEE 2P9BA 4IE4A 3PU3A 4FJOA 4PFPA 4UF0A 5JRCB 4BA9A 1MMAA 5J2UE 4EB6E 3HR0A 3O1JA 2DCFA 1HS7A 4HGAA 5JR9A 5JDQA 2LSYA 3LJCA 2E9XA 5JQGE 4DMVA 3QK6A 3NZQA 2CWOA 4H9OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CX7 B;  1IAP A;  2I59 A;  4YHJ A;  4IGU A;  4GOU A;  3T8O A;  3C4W A;  4L9I A;  3C50 A;  4WBO A;  3C4Z A;  2ES0 A;  3CX8 B;  3QC9 A;  2PBI A;  1SHZ C;  3C4X A;  3C51 A;  2ACX A;  3AB3 B;  3CX6 B;  1HTJ F;  2DLR A;  2A72 A;  1ZV4 X;  4PNI A;  4WNK A; 
#chains in the Genus database with same CATH topology
 2FJE A;  3MZK B;  2K48 A;  2EHO A;  3CQX C;  3KVA A;  4DV4 T;  4MAL A;  2D9D A;  4Z90 A;  2XM1 A;  3CK6 A;  3ONL C;  2BS2 A;  2V6Y B;  3ZC0 A;  1YD8 G;  3IHR A;  2H88 A;  3PUR A;  4U2Z A;  3ONX A;  5L2L A;  2Q9Q A;  4WBO A;  4CI1 B;  4QX7 B;  3T1Y T;  4LF6 T;  2DI4 A;  3CQG B;  4H9Q C;  2M67 A;  4TV9 E;  2L8K A;  1YKE B;  5HEG A;  4JBW F;  5F3J A;  5AQO B;  3LK3 B;  1M62 A;  2Q9Q C;  3ZCI A;  5LGU B;  2X68 A;  2N2N A;  3VR8 A;  4TV8 E;  2WCA A;  4UIG A;  3RYH E;  2VUR A;  2CBI A;  1KNR A;  4CXX A;  1IZN B;  1NEN A;  2IC6 A;  1YW0 A;  2KIN B;  4ZHQ E;  4IE0 A;  4L0R A;  1UGO A;  2KMF A;  2WP9 A;  4UVA B;  5FVK A;  1QLB A;  4EED A;  4JV5 T;  3ANW B;  3EDU A;  3AE1 A;  4TX5 A;  5AQF B;  4H9N C;  5FP3 A;  1IBM T;  1MND A;  2VVS A;  4FI5 A;  1D1B A;  3KV4 A;  2E9X C;  3AE8 A;  4AKH A;  3KBU A;  3F57 A;  1Y64 B;  4KUM B;  5H6Q B;  2XPK A;  3CX7 B;  2E8I A;  2E9X D;  5M4Y A;  1KEY A;  3MXZ A;  3L09 A;  5JDN A;  2VQF T;  4ASK A;  1W0A A;  2WAU A;  3OYX A;  2W66 A;  4MFR A;  1XNQ T;  1ZP0 A;  2L9Q A;  2YEV C;  4YTP A;  2KWH A;  3TLT A;  4DVD A;  3HKC E;  3NRY A;  2V7M A;  4WW0 A;  5JTG A;  5A1L A;  2W62 A;  1M7K A;  1W09 A;  1MMN A;  2BDE A;  2XQA A;  1VCS A;  3AE4 A;  3JAD A;  4YJ3 E;  5AQV B;  3NVO A;  5FVL A;  3RKO A;  3EI0 A;  3UUM A;  5LP6 E;  4JI1 T;  1UUS A;  2BVM A;  1O3X A;  2BKN A;  2C5K T;  4PJN A;  1GQE A;  5FXW A;  4IDZ A;  3OPC A;  3RQU A;  5L47 A;  2XHE B;  1I94 T;  4CI2 B;  4GK0 E;  2A9U A;  2DNX A;  3BQI A;  4WNK A;  1IBK T;  1MIY A;  2D0T A;  3QNU A;  5LMU T;  4XZC A;  4YLH A;  4YJ2 E;  4O4L E;  2W2U A;  3Q5D A;  3ZEF B;  2VL0 A;  2WU5 A;  5AQU B;  2UXX B;  3FBZ A;  1IAP A;  1VOM A;  4HFE A;  5F8P A;  5ABE A;  2NTX A;  3RIU A;  2CHO A;  5CFB A;  3KDS E;  2N9D A;  5EZY E;  4I4T E;  4HWF A;  4TN7 B;  3AE6 A;  2E2A A;  2M6B A;  4IRE A;  2UXC T;  2DL1 A;  2V6X A;  4ILC A;  1YKH B;  4H63 H;  4OHF A;  4BAY B;  4U33 A;  5JDH A;  4XBF B;  3DP7 A;  5LBM A;  2XM2 A;  4IDO A;  2I6H A;  3AB3 B;  2BS3 A;  3CX6 B;  2V7K A;  3N9O A;  4EYU A;  4WBN E;  5LJN A;  1N33 T;  4AIU A;  2J47 A;  4X65 T;  4JI0 T;  4ADZ A;  3RLF F;  3RI5 A;  2L3L A;  4AIS A;  3AEA A;  4E7S A;  2ODU A;  5J1G A;  4E7Z A;  1X79 A;  2XAJ B;  4X5T A;  3AXJ B;  2CMR A;  3RC3 A;  4AKI A;  2JMK A;  3TLW A;  3ANW A;  3UU6 A;  2WDQ A;  3ZMV B;  2C0S A;  3UFE A;  3I0O A;  4X1Y E;  5DJQ C;  1OWA A;  4QH5 A;  2NW9 A;  1E2A A;  2X9W A;  1HNZ T;  3FHN A;  5KX5 E;  3ZT7 A;  1SUM B;  4O2B E;  3UT5 E;  4CN4 A;  3ZLI A;  1T7S A;  2K9A A;  2Q9Q D;  2I59 A;  2K5B B;  4YXD A;  1HF8 A;  4EGW A;  2V7I A;  3UU3 A;  3GN5 A;  3UTK A;  2CLY C;  4AQF A;  1VCT A;  2FJA A;  5FY1 A;  5LHI B;  3LBX B;  4ZZC A;  2CEA A;  4TZ4 C;  3RYF E;  3CX8 B;  2YU1 A;  5FL0 A;  4COF A;  5LXT E;  2LHR A;  5JH7 E;  4ZI2 C;  4OYK A;  4IST A;  3EUH A;  3I0Q A;  4AQF C;  2LT3 A;  2J4G A;  4DMW A;  3QUJ A;  1HTJ F;  1U4Q A;  5HXC A;  1MMD A;  2W63 A;  5CA1 E;  5ABF B;  1HX1 B;  4X20 E;  1FJG T;  4DV6 T;  3HL6 A;  2KND A;  2CLY B;  4NUU A;  2K3W A;  2J1D G;  1LKX A;  2WSS V;  2XSB A;  4K0U A;  3RRW A;  4P0A A;  2C5I T;  2CRB A;  3K3N A;  5L3F B;  2HN1 A;  3NWI A;  2XQ5 A;  2UUB T;  4EYY R;  2IIU A;  2IC9 A;  2PTF A;  3RIF A;  3AEC A;  1UUR A;  3FBL A;  4U2Y A;  3ZT5 A;  3OTO T;  3JAF A;  2D5U A;  4Z91 A;  5H6R B;  3ZT6 A;  4TUY E;  4U72 A;  5AQK B;  2CE7 A;  2KWI B;  4A97 A;  2CXF A;  5KXJ A;  5L3C B;  3T8O A;  4L5G A;  3TLS A;  1BR0 A;  1R8I A;  3AEE A;  2OLT A;  3FXD B;  3GMI A;  4IE6 A;  3UU4 A;  3ZKR A;  3ZMT B;  4DUY T;  2VK9 A;  2X51 A;  3B57 A;  5EK4 A;  1UX5 A;  2ZMA A;  3SRZ A;  1ZKE A;  3VKH A;  2LM2 A;  1W9R A;  1J5E T;  3ZPO A;  5L3G B;  2XQ4 A;  1IBL T;  4LMJ A;  3UU8 A;  5CA0 E;  1J5W A;  1NEK A;  1D0Z A;  4Z8X A;  3L8R A;  2V7L A;  1OXZ A;  4ZXL A;  2QYW A;  3HI2 A;  5KMG P;  5AQQ B;  2YDQ A;  3CVR A;  1NAF A;  1I6Z A;  2XQ7 A;  3NBX X;  3CML A;  3O9X A;  3T1H T;  4GYR A;  2V26 A;  2JQK A;  4PNI A;  2WS3 A;  1D1A A;  4PFO A;  1W0B A;  4NUV A;  3AEG A;  3SOL A;  4WZX A;  2H7V C;  1MMG A;  4GK5 E;  4LMK A;  4DBQ A;  2W61 A;  5FXX A;  2QRX A;  2G0U A;  3AAA B;  3LK2 B;  4HFI A;  4B3M T;  3PUY F;  5KDM C;  5JR9 B;  3NZP A;  5JDF A;  3RH3 A;  3P4Q A;  2LRL A;  2XQ8 A;  3C4Z A;  3CPZ A;  1WRD A;  4A5X A;  5LG4 A;  1ZOY A;  3RGL A;  3Q5X A;  1HG5 A;  4CN6 A;  4EOZ B;  4DV3 T;  1XNR T;  3IA3 A;  4QHO A;  5LHH B;  5HEJ A;  3LG7 A;  5J0Z A;  1XMO T;  2ACX A;  4DR6 T;  1KF6 A;  3ZJ1 A;  5AQG B;  3Q5E A;  1DU2 A;  3F2E A;  2CPT A;  4IHJ E;  5HWX A;  2MPK A;  4DV1 T;  2BBH A;  4O8S A;  2A72 A;  3P50 A;  2F4V T;  2MYS A;  3N9M A;  1UX4 A;  3N2O A;  4HEA A;  4PK5 A;  3VU7 H;  2XY8 B;  4QH4 A;  5L4E A;  2LSK A;  2VWA A;  4O2A E;  4JYA T;  1ZHC A;  5AQR B;  2UUA T;  2YOE A;  2W00 A;  4YFS A;  2VQE T;  2PFV A;  2CBJ A;  2LM9 A;  3MK7 C;  4KI0 F;  2CWY A;  2H3R A;  2Z6E A;  4HFD A;  2JIW A;  4ZZB A;  4OX9 T;  4PJL A;  5HCM A;  3FB2 A;  5ETW A;  4GKJ T;  4KHP T;  3M3Z B;  2WQY A;  2CCQ A;  4KMC A;  4UEM A;  5HXR A;  4A56 A;  3F31 A;  1YQ4 A;  3KV5 A;  2M6I A;  5HXE A;  1CHU A;  3ONJ A;  1XDO A;  3I9W A;  2JQH A;  2K24 A;  4YSY A;  5LHG B;  1CUN A;  2BKO A;  2IHR 1;  2LKG A;  5JDM A;  1HNX T;  3OYZ A;  4TWD A;  4DV0 T;  2XQY A;  4ERR A;  1FMV A;  4H9R C;  2VAS A;  4IT4 A;  3PUS A;  4HWD A;  4PJJ A;  2GK9 A;  1G73 A;  3WI3 A;  5AQP B;  5BMV E;  3SWH A;  3KBT A;  2V8S V;  4AQY T;  3AAI A;  5FMN A;  4NXN T;  1H7C A;  3PDY A;  2WBL A;  4QXB B;  2R6G F;  2HN2 A;  4B3R T;  3AED A;  2BG9 C;  2QVA A;  3PJA J;  3AA6 B;  1T72 A;  3CQC B;  3Q2M A;  2ACZ A;  2JJ9 A;  3O1I A;  3QB5 K;  5FY7 A;  4V1A v;  3HKB E;  2WDV A;  2X0L B;  2MTQ A;  5DQW A;  5JRE A;  3RIU C;  4IGU A;  2NW8 A;  4UF0 B;  1JNR A;  2IUB A;  1IJ5 A;  2XQ9 A;  2HPL A;  3JAE A;  3AE7 A;  3R84 B;  2RPA A;  1Z8U A;  4ZOL E;  3E08 A;  5AQH B;  4AKR B;  2IW5 B;  2LOS A;  3G06 A;  1ZEE A;  4N78 D;  3X1D A;  3C98 B;  1MIW A;  2B76 A;  1HCI A;  2EHO C;  2PBI A;  2RA1 A;  2ZM8 A;  2BG9 E;  3AA0 B;  2E9X B;  2W0G A;  3C51 A;  2V5C A;  3OVU A;  2UXD T;  2XQ3 A;  4I0U A;  2X9X A;  3PUQ A;  4M1P A;  5JVD E;  4EZH A;  2N1G A;  5AFU L;  2VVN A;  3WAJ A;  2LRK A;  4LF5 T;  3FZL B;  4U7I A;  3KFW X;  4CZZ B;  3M65 A;  2WZI A;  2BG9 B;  4ZI3 D;  2NP9 A;  2WMO A;  4KHZ F;  5IHY A;  4DO0 A;  5LNK A;  4DUZ T;  3RKG A;  4YTN A;  1XZY A;  2Y8D A;  4ILB A;  1WLX A;  4I55 E;  1HNW T;  5HXS A;  3PUZ F;  3KVB A;  2UUC T;  2ODV A;  4EXT A;  4GIW A;  3PUV F;  3N9P A;  2WWU A;  4TWH A;  5LJM A;  4A98 A;  3SFD A;  3HKD E;  4CQI A;  4ZI2 D;  4B3T T;  2EHO B;  4MBQ A;  2BG9 A;  4HFC A;  1D0Y A;  4JLE A;  2X66 A;  4XAX B;  2VKH A;  5DAB A;  1KK7 A;  2ES0 A;  2BZB A;  3RRC A;  3VRB A;  1V9D A;  2V1D B;  3Q5W A;  2V5D A;  3QC9 A;  5FXV A;  3W15 B;  5C2T A;  4JI5 T;  4DR3 T;  5BR8 T;  2AXD S;  3FZK B;  3LFM A;  3KV9 A;  1BR1 A;  2CXL A;  1US7 B;  3DTO A;  5LBQ B;  5JDL A;  3WAK A;  4CXW A;  2J62 A;  2KZ7 B;  1JNZ A;  1J1J A;  1YQ3 A;  4DV2 T;  3ZST A;  3AAE B;  2XAF B;  5LGN B;  3UFG A;  4I43 B;  2H7O A;  2XSA A;  3EHZ A;  4LFA T;  3QB5 A;  4C90 A;  2ZLY A;  5AQS B;  5HYA A;  3BQK A;  4LFC T;  2JPF A;  3FZF B;  2YN6 A;  2KT9 A;  4YHJ A;  4TNW A;  5L4H A;  3GWH A;  3ESL A;  3P4W A;  4KBM B;  3IF8 B;  3UUX B;  3ZYL A;  4HKA A;  4C91 A;  2FBW A;  5ADX L;  4YHH T;  4G2A A;  4F6R C;  2YDS A;  2JQ9 A;  5IWA T;  4U7Y A;  1E7P A;  2LSG A;  1S35 A;  3TKL B;  4BJN A;  2Q9Q B;  4MLK A;  4K0K T;  3VKG A;  3PTR B;  1S94 A;  4IL4 A;  3MAC A;  3EAB A;  3ZYM A;  3FZM B;  3UUN A;  4QH1 A;  2KXP B;  1WCR A;  5IUX A;  5JR9 C;  5L3E B;  4YSZ A;  4O4I E;  1KFY A;  5HEO A;  4P09 A;  4IDQ A;  4J2C A;  1Y01 A;  3ZSS A;  4DR7 T;  3D0T A;  4Q25 A;  3R6N A;  5EK2 A;  2XQ6 A;  2MBG A;  3ZC1 A;  3PUG A;  4JI7 T;  3FXE B;  4LF4 T;  2VKO A;  3TLU A;  3KV6 A;  4YT0 A;  3GA8 A;  4EAH A;  3RYC E;  5AQT B;  2BKP A;  1MNE A;  2CA5 A;  3E0Z A;  5L3D B;  3LK4 2;  4B3S T;  4UV8 B;  2LKH A;  2QA7 A;  1MIV A;  2I0M A;  4CXY A;  2YK0 A;  3I1A A;  4DND A;  2B1E A;  3OJA A;  3C4W A;  2NW7 A;  3ZN0 B;  1SA0 E;  5HEU A;  1IJ6 A;  4H63 V;  2LHN A;  3ZMU B;  4G63 A;  5LA6 E;  4EIW A;  3H37 A;  2KLQ A;  3P7I A;  3ZCJ A;  3PV0 F;  5E0O A;  2NOX A;  1WFD A;  2X0Y A;  2XAQ B;  3L3P A;  3ETV A;  2WY2 A;  5TAO A;  2QGS A;  1KNP A;  3EDV A;  2AE9 A;  3AEB A;  4TWF A;  4OYJ A;  3N9L A;  4U31 A;  5HXH A;  5HEH A;  3RYI E;  3N2K E;  1L0V A;  3SS1 A;  2LSI A;  2NR4 A;  4I50 E;  2XAH B;  3IEE A;  2PG8 A;  2XJ7 A;  5AQJ B;  5IYZ E;  3PE0 A;  2KSR A;  2UXN B;  2Y6X A;  1B7T A;  1EZ3 A;  4AXP A;  3TLV A;  2DWK A;  5JDG A;  3O1H A;  2YIN A;  2LLY A;  4DV5 T;  3K8P C;  2VB6 A;  3AE2 A;  2W67 A;  3LBX A;  3S4U A;  3V5U A;  5FYM A;  4KP3 C;  5ABH A;  3J7Y q;  4ZI3 C;  2E5L T;  4YSX A;  4HFH A;  3AE5 A;  5C8Y E;  5CB4 E;  4LF7 T;  3H3M A;  5FKY A;  3ZJ2 A;  3RPU A;  1FMW A;  3PUX F;  3IBP A;  3JCF A;  3MA9 A;  4EEB A;  4HWH A;  1OED C;  5J2T E;  4DV7 T;  3JC6 C;  4ZEY A;  5LG3 A;  3PUW F;  3RIA A;  3PUA A;  2LSJ A;  4X1I E;  5HAX A;  2FJD A;  3GN5 B;  2CXD A;  4HFV A;  4P0B A;  2A3D A;  2EHO D;  4OFZ A;  4EZ4 A;  3E22 E;  5HCJ A;  2XUE A;  3AVR A;  5L3B B;  3K3Q C;  3L39 A;  3AVS A;  5AQL B;  4B6X A;  4ANJ A;  4DR5 T;  2WM9 A;  4HE8 A;  4MHC A;  4QXC B;  3CWZ B;  3HA4 A;  4LML A;  5LB7 B;  3N9Q A;  3N5L A;  1NWM X;  3P4P A;  1D0X A;  4QX8 B;  3J9X 1;  3C64 A;  3VHL A;  1D1C A;  5EK3 A;  4UXN B;  4HFB A;  1QSD A;  4YTM A;  3BK9 A;  3EVY A;  4HN9 A;  2Y48 B;  2IML A;  1AJ3 A;  1LRZ A;  4PK4 A;  5LYJ E;  5LCY A;  3B5M A;  2LJL A;  4L9I A;  4TNV A;  2SPC A;  3SFE A;  2YKS A;  2MAW A;  4IE5 A;  2ZM0 A;  4DR1 T;  2DHR A;  5GON E;  2YDR A;  4O4J E;  3CKD A;  2CM0 A;  1HG2 A;  4AKL A;  2IDO B;  1SHZ C;  3B13 A;  2NWB A;  3N2G E;  3UQ4 A;  2DWG A;  3C4X A;  2BVL A;  4JI3 T;  3ABV A;  3LSV A;  4UR9 A;  1XDP A;  1LVF A;  3ZYK A;  4DBR A;  4JI4 T;  3N9N A;  4X64 T;  3ETU A;  4H9S E;  5ABG A;  2D2S A;  5F5W A;  4PK6 A;  4IE7 A;  4LF8 T;  3K3O A;  4NIQ A;  3EAM A;  1HX8 A;  4QXH B;  3JC6 D;  2X67 A;  3BQL A;  4UEL A;  5CGM A;  5DQV A;  1ZV4 X;  4JI2 T;  3U78 A;  1KNZ A;  1VRB A;  3MKD A;  2XAS B;  2WU2 A;  4JI6 T;  4AI6 A;  4OK0 A;  1WR6 A;  3FZH B;  3AXJ A;  1QUU A;  5LOV E;  2WWV A;  2LE8 A;  3RQW A;  4AKG A;  2C5J A;  3C50 A;  4QWN B;  5FL1 A;  4IIJ E;  1HR0 T;  2HH7 A;  4YY3 T;  2RP4 A;  2XAG B;  2PJQ A;  4ILU A;  1BR4 A;  4GYS A;  3MJX A;  4UV9 B;  4X66 T;  2JRK A;  4UVB B;  2XTL A;  2UU9 T;  4NXM T;  4X1K E;  1Z0P A;  1UCU A;  1WYC A;  5AQN B;  4DID B;  3NRX A;  4ISS A;  2DLR A;  4LF9 T;  4JEH B;  3V5S A;  2WMN A;  1E1H B;  3P4S A;  2IAK A;  3P4R A;  2HPJ A;  3PU8 A;  3RHW A;  3A7M A;  3ZMZ B;  4IL9 A;  2A2F X;  4PW8 A;  3A8Y C;  4QKN A;  2E5V A;  2WB5 A;  3I9Y A;  3VR9 A;  2OA5 A;  4HTE A;  4HWC A;  4UVC B;  4EV6 A;  1N34 T;  5ABF A;  3KIN B;  2JMH A;  2WDR A;  4U74 A;  3K1S A;  4BJM A;  4CI3 B;  1N32 T;  4ZS2 A;  2FUP A;  5FY0 A;  3AA7 B;  2FJB A;  1OED E;  2BBJ A;  2LEH A;  2V6Y A;  1XWM A;  2BS4 A;  2H89 A;  2YU2 A;  3UUB A;  2NTY A;  2CHN A;  3O4X E;  2ZM6 T;  3AA1 B;  3A5X A;  4X62 T;  4IDN A;  2WZH A;  3PJA A;  4ILA A;  4PJM A;  1G8X A;  4PAG A;  1U5P A;  1LVK A;  2X9H A;  4HWI B;  5FNV E;  2ZM2 A;  4NPP A;  2OV9 A;  3QOF A;  3OKQ A;  2JQQ A;  1OED B;  3U3I A;  4H9P C;  4AQG A;  1FEW A;  2MOZ A;  5FXZ A;  3ZMS B;  4ZI7 E;  2D0U A;  3UUL A;  3H3A A;  3RC8 A;  5LGT B;  5LMN T;  4JI8 T;  3AEF A;  1N36 T;  1WR0 A;  3RF1 A;  1HFA A;  3Q9D A;  2UXB T;  2X9Y A;  2VKJ A;  3OBV E;  3ZN1 B;  2LOP A;  2V7J A;  2X0H A;  5CJ5 A;  1OED A;  4ZS3 A;  1WYB A;  4DR4 T;  5JRC A;  3CIR A;  4JEU B;  4O4H E;  3UU5 A;  5AQI B;  4F8H A;  3RX6 A;  4GOU A;  1FIO A;  2VL8 A;  1BR2 A;  4U3C A;  5HWY A;  4WYV A;  1X9B A;  1YXR A;  3DJB A;  3LDQ B;  4JUY A;  1XMQ T;  1T8B A;  1T98 A;  3AE3 A;  2VKD A;  3P8C D;  3HKE E;  2P9B A;  3AE9 A;  3PU3 A;  4FJO A;  4IE4 A;  4PFP A;  4LFB T;  2XZE A;  4UF0 A;  4GKK T;  5JRC B;  4KX6 A;  4BA9 A;  4CN1 A;  1MMA A;  5C3J A;  4EB6 E;  5J2U E;  3HR0 A;  3O1J A;  2DCF A;  3UQ7 A;  4HGA A;  1HS7 A;  4IDP A;  5JR9 A;  5JDQ A;  2W4X A;  1UK5 A;  4P1N A;  1SE7 A;  2LSY A;  3LJC A;  2E9X A;  5JQG E;  4DMV A;  2HHH T;  3QK6 A;  3VRA A;  5AQM B;  3NKZ A;  3NZQ A;  2CWO A;  4DR2 T;  4H9O C; 
#chains in the Genus database with same CATH homology
 3MZK B;  2K48 A;  2EHO A;  3CQX C;  3KVA A;  4MAL A;  3ZC0 A;  1YD8 G;  3IHR A;  5L2L A;  3PUR A;  3ONX A;  2Q9Q A;  4WBO A;  4CI1 B;  4QX7 B;  2DI4 A;  3CQG B;  4H9Q C;  2M67 A;  4TV9 E;  2L8K A;  1YKE B;  5F3J A;  3ZCI A;  3LK3 B;  2Q9Q C;  5LGU B;  2X68 A;  2N2N A;  4CXX A;  4TV8 E;  4UIG A;  3RYH E;  4DBQ A;  1IZN B;  2IC6 A;  2KIN B;  1YW0 A;  4ZHQ E;  4IE0 A;  4L0R A;  2KMF A;  4UVA B;  3ANW B;  3EDU A;  4TX5 A;  4H9N C;  5FP3 A;  1MND A;  4FI5 A;  1D1B A;  3KV4 A;  2E9X C;  4AKH A;  3KBU A;  3F57 A;  1Y64 B;  4KUM B;  5H6Q B;  3CX7 B;  2E8I A;  2E9X D;  5M4Y A;  3MXZ A;  3L09 A;  4ASK A;  2WAU A;  3OYX A;  4MFR A;  2L9Q A;  2YEV C;  2KWH A;  4DVD A;  3HKC E;  3NRY A;  2V7M A;  4WW0 A;  5A1L A;  2W62 A;  2BDE A;  1MMN A;  4YJ3 E;  3RKO A;  3UUM A;  5LP6 E;  2BVM A;  2C5K T;  1O3X A;  4PJN A;  5JDN A;  5FXW A;  4IDZ A;  2XHE B;  4CI2 B;  4GK0 E;  2DNX A;  3BQI A;  4WNK A;  1MIY A;  2D0T A;  4XZC A;  4YLH A;  4YJ2 E;  4O4L E;  3ZEF B;  3FBZ A;  2UXX B;  1IAP A;  1VOM A;  5F8P A;  2NTX A;  3KDS E;  2N9D A;  5EZY E;  4I4T E;  4TN7 B;  1YKH B;  4H63 H;  4OHF A;  4BAY B;  5JDH A;  4XBF B;  3DP7 A;  5LBM A;  3N9O A;  3AB3 B;  4WBN E;  3CX6 B;  2V7K A;  4EYU A;  5LJN A;  4ADZ A;  4E7S A;  2L3L A;  4E7Z A;  2ODU A;  5J1G A;  1X79 A;  2XAJ B;  4AKI A;  2CMR A;  3RC3 A;  2JMK A;  3ANW A;  3ZMV B;  2C0S A;  3UFE A;  3I0O A;  4X1Y E;  5DJQ C;  1OWA A;  2NW9 A;  2X9W A;  3FHN A;  5KX5 E;  4O2B E;  3ZLI A;  2K9A A;  2Q9Q D;  2I59 A;  2K5B B;  1HF8 A;  2V7I A;  3GN5 A;  3UTK A;  2CLY C;  4AQF A;  5FY1 A;  5LHI B;  3LBX B;  2CEA A;  4TZ4 C;  3RYF E;  3CX8 B;  2YU1 A;  5LXT E;  2LHR A;  5JH7 E;  4ZI2 C;  4OYK A;  4IST A;  3EUH A;  3I0Q A;  4AQF C;  2LT3 A;  4DMW A;  3QUJ A;  1HTJ F;  1U4Q A;  5HXC A;  1MMD A;  2W63 A;  5CA1 E;  4X20 E;  3HL6 A;  2KND A;  2CLY B;  4NUU A;  2J1D G;  1LKX A;  2WSS V;  4K0U A;  3RRW A;  4P0A A;  2C5I T;  3K3N A;  5L3F B;  4EYY R;  2IC9 A;  3FBL A;  2D5U A;  5H6R B;  4TUY E;  4U72 A;  5L3C B;  2CE7 A;  2KWI B;  2CXF A;  3T8O A;  4L5G A;  1BR0 A;  3FXD B;  4IE6 A;  3GMI A;  3ZMT B;  2VK9 A;  2X51 A;  3B57 A;  5EK4 A;  1UX5 A;  2ZMA A;  3SRZ A;  1ZKE A;  3ZPO A;  5L3G B;  5CA0 E;  1D0Z A;  4Z8X A;  2V7L A;  1OXZ A;  3HI2 A;  5KMG P;  3CVR A;  1NAF A;  3NBX X;  3CML A;  3O9X A;  4GYR A;  2V26 A;  4PNI A;  1D1A A;  4PFO A;  4NUV A;  3SOL A;  2H7V C;  1MMG A;  4GK5 E;  2W61 A;  5FXX A;  3LK2 B;  2G0U A;  3AAA B;  5JR9 B;  3NZP A;  5JDF A;  3RH3 A;  3C4Z A;  3CPZ A;  1WRD A;  5LG4 A;  3Q5X A;  1HG5 A;  4EOZ B;  5LHH B;  4QHO A;  3LG7 A;  2ACX A;  3ZJ1 A;  3F2E A;  5HWX A;  4IHJ E;  4O8S A;  2A72 A;  2MYS A;  3N9M A;  1UX4 A;  3N2O A;  4HEA A;  4PK5 A;  3VU7 H;  2LSK A;  2VWA A;  4O2A E;  1ZHC A;  2W00 A;  4YFS A;  2PFV A;  2LM9 A;  3MK7 C;  2CWY A;  2H3R A;  2Z6E A;  4PJL A;  3FB2 A;  5ETW A;  4KMC A;  2CCQ A;  4UEM A;  5HXR A;  4A56 A;  3F31 A;  3KV5 A;  5HXE A;  3I9W A;  2K24 A;  5LHG B;  1CUN A;  5JDM A;  3OYZ A;  2XQY A;  4ERR A;  1FMV A;  4H9R C;  2VAS A;  3PUS A;  4PJJ A;  3WI3 A;  2GK9 A;  1G73 A;  5BMV E;  3SWH A;  3KBT A;  3AAI A;  5FMN A;  1H7C A;  3PDY A;  2WBL A;  4QXB B;  3AA6 B;  3CQC B;  3Q2M A;  5FY7 A;  2JJ9 A;  3O1I A;  4V1A v;  3HKB E;  5JRE A;  2X0L B;  2MTQ A;  5DQW A;  4IGU A;  2NW8 A;  4UF0 B;  3R84 B;  1IJ5 A;  5KDM C;  2HPL A;  4AKR B;  4ZOL E;  3E08 A;  2IW5 B;  2LOS A;  1ZEE A;  4N78 D;  3C98 B;  2ZM8 A;  1MIW A;  1HCI A;  2EHO C;  2PBI A;  2RA1 A;  3AA0 B;  3UUN A;  2E9X B;  2W0G A;  3C51 A;  2X9X A;  3PUQ A;  4M1P A;  5JVD E;  4EZH A;  2N1G A;  5AFU L;  3WAJ A;  3KFW X;  4CZZ B;  3M65 A;  4ZI3 D;  2NP9 A;  2WMO A;  4DO0 A;  5IHY A;  5LNK A;  2Y8D A;  1WLX A;  4I55 E;  5HXS A;  3KVB A;  2ODV A;  4EXT A;  4GIW A;  3N9P A;  2WWU A;  5LJM A;  4ZI2 D;  3HKD E;  4CQI A;  2EHO B;  4MBQ A;  4XAX B;  1D0Y A;  4JLE A;  2X66 A;  3RRC A;  2VKH A;  5DAB A;  1KK7 A;  2ES0 A;  2BZB A;  4AXP A;  1V9D A;  2V1D B;  3Q5W A;  3QC9 A;  5FXV A;  3W15 B;  3LFM A;  3KV9 A;  1BR1 A;  2CXL A;  1US7 B;  3DTO A;  5LBQ B;  5JDL A;  3WAK A;  4CXW A;  2KZ7 B;  3AAE B;  2XAF B;  5LGN B;  4I43 B;  2H7O A;  4C90 A;  2ZLY A;  5HYA A;  3BQK A;  2JPF A;  2KT9 A;  4YHJ A;  3GWH A;  3ESL A;  4KBM B;  3IF8 B;  3UUX B;  3ZYL A;  4HKA A;  4C91 A;  5ADX L;  4G2A A;  4F6R C;  2LSG A;  1S35 A;  3TKL B;  4BJN A;  2Q9Q B;  4MLK A;  3VKG A;  3PTR B;  1S94 A;  3MAC A;  3ZYM A;  2KXP B;  5L3E B;  5JR9 C;  4O4I E;  4P09 A;  4J2C A;  3D0T A;  5EK2 A;  3R6N A;  2MBG A;  3ZC1 A;  3PUG A;  3FXE B;  2VKO A;  3KV6 A;  3GA8 A;  4EAH A;  3RYC E;  1MNE A;  2CA5 A;  3E0Z A;  5L3D B;  3LK4 2;  4UV8 B;  2QA7 A;  1MIV A;  4CXY A;  2YK0 A;  3I1A A;  4DND A;  2B1E A;  3OJA A;  3C4W A;  2NW7 A;  3ZN0 B;  1SA0 E;  1IJ6 A;  4H63 V;  2LHN A;  3ZMU B;  4G63 A;  5LA6 E;  4EIW A;  3H37 A;  2KLQ A;  3P7I A;  3ZCJ A;  5E0O A;  2NOX A;  2XAQ B;  3L3P A;  3ETV A;  5TAO A;  2QGS A;  3EDV A;  4OYJ A;  3N9L A;  5HXH A;  3RYI E;  3N2K E;  3SS1 A;  2LSI A;  4I50 E;  2XAH B;  3IEE A;  2PG8 A;  5IYZ E;  3PE0 A;  2UXN B;  2Y6X A;  1B7T A;  1EZ3 A;  2DWK A;  5JDG A;  3O1H A;  2YIN A;  3K8P C;  2VB6 A;  3LBX A;  3S4U A;  3V5U A;  5FYM A;  4KP3 C;  3J7Y q;  4ZI3 C;  5C8Y E;  5CB4 E;  3ZJ2 A;  3RPU A;  1FMW A;  3IBP A;  3MA9 A;  5J2T E;  3JC6 C;  3PUA A;  2LSJ A;  4X1I E;  5HAX A;  3GN5 B;  2CXD A;  4HFV A;  4P0B A;  2A3D A;  2EHO D;  4OFZ A;  4EZ4 A;  3E22 E;  2XUE A;  3AVR A;  5L3B B;  3K3Q C;  4B6X A;  3AVS A;  4ANJ A;  2WM9 A;  4HE8 A;  4MHC A;  4QXC B;  3CWZ B;  3HA4 A;  3N9Q A;  3N5L A;  1NWM X;  3J9X 1;  1D0X A;  4QX8 B;  3VHL A;  3C64 A;  1D1C A;  5EK3 A;  4UXN B;  1QSD A;  3BK9 A;  3EVY A;  4HN9 A;  2Y48 B;  1AJ3 A;  1LRZ A;  4PK4 A;  5LYJ E;  5LCY A;  2LJL A;  4L9I A;  2SPC A;  4IE5 A;  2ZM0 A;  2DHR A;  5GON E;  4O4J E;  3CKD A;  2CM0 A;  1HG2 A;  4AKL A;  4CI3 B;  1SHZ C;  3B13 A;  2NWB A;  3N2G E;  3VKH A;  2DWG A;  3C4X A;  2BVL A;  1LVF A;  3ZYK A;  4DBR A;  3N9N A;  3ETU A;  4H9S E;  2D2S A;  4PK6 A;  4IE7 A;  3K3O A;  1HX8 A;  4QXH B;  3JC6 D;  2X67 A;  3BQL A;  4UEL A;  5DQV A;  1ZV4 X;  3U78 A;  1KNZ A;  1VRB A;  3MKD A;  2XAS B;  4AI6 A;  4OK0 A;  1WR6 A;  1QUU A;  5LOV E;  2LE8 A;  4AKG A;  2C5J A;  3C50 A;  4QWN B;  4IIJ E;  2HH7 A;  2RP4 A;  2XAG B;  2PJQ A;  4ILU A;  1BR4 A;  4GYS A;  3MJX A;  4UV9 B;  2JRK A;  4UVB B;  2XTL A;  4X1K E;  1Z0P A;  1UCU A;  1WYC A;  3NRX A;  4ISS A;  2DLR A;  4JEH B;  3V5S A;  2WMN A;  1E1H B;  2IAK A;  2HPJ A;  3PU8 A;  3ZMZ B;  2A2F X;  4PW8 A;  4QKN A;  3I9Y A;  2OA5 A;  4HTE A;  4UVC B;  3KIN B;  2JMH A;  4U74 A;  4BJM A;  4ZS2 A;  5FY0 A;  3AA7 B;  2LEH A;  3UT5 E;  2YU2 A;  2NTY A;  3O4X E;  3AA1 B;  3A5X A;  4PJM A;  1G8X A;  4PAG A;  1U5P A;  1LVK A;  2X9H A;  5FNV E;  2ZM2 A;  3OKQ A;  2JQQ A;  3U3I A;  4H9P C;  4AQG A;  1FEW A;  2MOZ A;  5FXZ A;  3ZMS B;  4ZI7 E;  2D0U A;  3UUL A;  3H3A A;  3RC8 A;  5LGT B;  1HFA A;  3Q9D A;  2X9Y A;  2VKJ A;  3OBV E;  3ZN1 B;  2LOP A;  2V7J A;  4ZS3 A;  1WYB A;  5JRC A;  4JEU B;  4O4H E;  3RX6 A;  4GOU A;  1FIO A;  2VL8 A;  1BR2 A;  5HWY A;  4JUY A;  3DJB A;  1T98 A;  2VKD A;  3P8C D;  3HKE E;  2P9B A;  4IE4 A;  3PU3 A;  4FJO A;  4PFP A;  4UF0 A;  5JRC B;  4BA9 A;  1MMA A;  5J2U E;  4EB6 E;  3HR0 A;  3O1J A;  2DCF A;  1HS7 A;  4HGA A;  5JR9 A;  5JDQ A;  2LSY A;  3LJC A;  2E9X A;  5JQG E;  4DMV A;  3QK6 A;  3NZQ A;  2CWO A;  4H9O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...