3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
3ZN1A 3CUQA 2OZ6A 1DUXC 4WWCA 4EJTA 3R61A 2YX7A 1IXRC 5HVQC 1SFXA 3K1MA 2DPDA 3NQOA 1U78A 5EEHA 2CYYA 4HX7A 2ESNA 4KUMA 4EJVA 2RKHA 4LB6B 3I54A 1ZN2A 1HKQA 4RAZA 1U3EM 1F5TA 2PQ8A 2YPRA 1I1SA 5LBQA 2P5VA 3HIFA 2OQRA 2LF8A 3VEPA 3JTHA 1WRJA 1OYIA 2M87A 1FYKA 3LA3A 3BDDA 3F72A 2Q0OA 3CUQC 1UB9A 1PUEE 2XAQA 1ZH5A 3DKWA 1BI1A 5CVRA 4UNOA 2QM3A 2OZUA 3M8FA 1SD5A 3RKWA 5E1WA 4NHJA 2O3FA 4EVIA 1Y0UA 3GLXA 3GFIA 2Y75A 2EB7A 3HYIA 4OOIA 5HDNA 2QQAA 2CGPA 4IRGA 2GQQA 2QUFA 3LQRA 2HFHA 1L0OC 1RUOA 2GIVA 4EM2A 4YIFA 4GYGA 2F5DA 1ODDA 5L3GA 4MHGA 5JHUA 4HAMA 3GYHX 1FT9A 4BHPA 2DU9A 1NHAA 3RKXA 5ERIA 4HQMA 3BJ6A 4LK0F 2Y0MA 4N0BA 1E17A 1TBXA 1FSEA 3HSFA 3C7JA 3BP8A 2VT2A 1T98A 6PAXA 2XAGA 4GO1A 1S6LA 4HF2A 4IPAA 3TO6A 2NRAC 4HX8A 1KU7A 3C3WA 4IJAA 3EETA 2A3SA 1U8RA 5TJJA 4FHTA 3KETA 2IT0A 2L3DA 2HYGD 3RKYA 3I0TA 5FLXZ 1S8NA 4KICA 1S7OA 2XIGA 3O6BB 1I5ZA 4ON0A 1UHMA 3HRTA 2IJLA 2RV8A 4OIRF 1SD4A 2V1DA 1XCVA 3O2PE 4GYIA 2ADUA 2Z3YA 1YW9A 1ZGAA 4MQVA 3WODF 4XLPF 2DK5A 5K5OA 1BC7C 2DW4A 2HDCA 3HSEA 3G73A 4ZYEA 2E1CA 5ILVA 4KIGA 3D0SA 5FFZA 2P5LC 2P5KA 5LEKA 4I7HA 5L3BA 4RGRA 4QWQA 2MLKA 3LA7A 2YSRA 2IPQX 3ZMSA 2D2WA 2DTRA 1Z1DA 2MBFA 3K1PA 3GO5A 2YU3A 2XKPA 4CZZA 1JE8A 1HQCA 4BYYA 2VXZA 3BPVA 1GVJA 3RPQA 3F23A 3GVAA 4KIBA 1P2FA 3HTUA 1KU9A 1ZRFA 4ZYDA 3Q5FA 2FNPA 1Z6RA 1OKRA 3KFWX 1SFEA 4ENJA 4IRHA 3ELKA 1MJAA 3OV8A 3KE2A 2P6SA 4CICA 5A2QZ 1HW2A 4M71A 2R7FA 1XMAA 4BHBA 2QQ9A 1JHHA 2P8TA 2MC3A 2QZ8A 2GAUA 1XMKA 5IT3A 1BM9A 4HQEA 2HTJA 5D5WB 4AWXB 1K78B 2WTEA 2J5OA 1O7FA 5J8FA 1EH6A 4LG0A 2ZJ2A 4U0WA 2DQRA 3CTAA 5H6QA 3ECOA 3K1NA 2EV5A 2LDUA 2Y48A 4L18B 1KQ8A 3E6BA 2HWVA 1KU2A 4ZZDA 3CDHA 2DT5A 1YG2A 2DI3A 5BMZA 4LG0B 3JSOA 5A2QK 3WGGA 3FM5A 1ZAOA 1MJ9A 2VC0A 5LGTA 1STZA 4GXOA 4M9SA 1H9TA 3F6OA 1R7JA 2RDPA 4A5MA 5E8IA 1R22A 4WCGA 4S04A 1QBJA 3ABUA 2VONA 4HF0A 1B9NA 3R0JA 3H3ZA 3VOEA 3COAC 1ULYA 4XSXF 1BC8C 3K69A 4IHSA 3REOA 4LK1F 4YFKF 1LDJA 1ZGJA 3HSRA 2DO7A 1IUYA 3G3ZA 4PGHA 2L4AA 4M9ZA 4A6EA 1Z9CA 3IWZA 2CSOA 3CUOA 2STWA 1O3QA 2HKXA 2JT1A 4RB2C 1EV7A 4EGZA 1U5TC 2YX4A 2D1HA 1ZG1A 1IZ1A 4KMFA 1LVAA 4MTEA 3FXUA 2ISYA 1F9NA 3GFMA 5JFRA 1TW3A 4QLCU 5ED4A 2DAOA 5D6EA 5EEGA 2Z99A 3IRRA 4CHUA 5F64A 2KJCA 2VBWA 3K0LA 4ZZLA 4G7ZF 2RGVA 1WSUA 1K79A 3IC7A 3ZMZA 1X3UA 3GUDA 2ZNZA 4ASNA 3RJPA 4LLGF 2HEOA 3KEOA 3GEZA 2R3SA 1YW7A 5J8CA 2FMLA 4F7ZA 5HOOA 3TOBA 3E3VA 4HLXA 4I98B 5LLQA 4HX4A 3EYYA 1FZPB 2MH2A 5E1ZB 1I6XA 3V8LA 1R00A 1FLIA 3KEQA 2EK5A 2OQGA 1D8KA 1FP1D 1XGNA 1QGPA 3L7WA 2VBYA 3RDIA 2XV4S 3HUGA 3QP5A 2UXXA 5JR3A 1R58A 2CFXA 2NYXA 3T8TA 2MD5A 3LSTA 2OBPA 2AXLA 1YS6A 1FC3A 3KP3A 1W5TA 1U5TA 3PQJA 2H09A 4A0YA 4OMYA 3SZPA 2M5WA 4MEXF 1Z91A 2OAZA 4UUVA 1ZYRF 2HGCA 3FXRA 4EM0B 3D5LA 1DP7P 4A12A 3RPUA 2JTVA 1FSHA 1O3TA 3E6MA 4XSZF 4M73A 1B6AA 2KJBA 3FWEA 2OU2A 4R1HA 5HLIA 5JVTA 3L9FA 1FPQA 1BBYA 4JBAA 3V7CA 3B02A 2KIFA 1I27A 1C0WA 3TKYA 2PMHA 4KN7X 2DFIA 4P9FA 5TRDA 4BAYA 1OPCA 4EM1A 4EQQA 4KN4X 5LEJA 1J9IA 4AIHA 5F6FA 2EFQA 1O7LA 2VE9A 4G6DA 1FBQA 2G9WA 1TQMA 3F21A 2IA0A 3IRQA 4EMSA 2OD5A 3F8FA 1DPUA 2A6HF 2CWEA 3TQNA 1LEBA 1KYWA 3MAJA 2DPUA 3TDZC 3R4KA 4H0EA 1B4AA 3LQQA 2GXBA 4N9HA 1W5SA 2GXGA 2L54A 4M74A 5E17F 3F8NA 3HTSB 3KP7A 5CVJA 2PN6A 1FYMA 2EA2A 1BN5A 4ESJA 3LAJA 4EGYA 5CVIA 2CG4A 1IXSB 2A68F 2L02A 2D45A 2ESHA 4HV6A 4EJOA 2QWWA 1V4RA 1P6RA 3I71A 1KU3A 4UVAA 5DUIA 5DCMB 5FB2A 2A69F 5E18F 2NNYA 1YLFA 3TOAA 1FP2A 2KRFA 4BXUA 3E5XA 1QNTA 3GZ6A 3EUHA 2JRTA 1XSXA 1HKSA 1S29A 1UCRA 1Z05A 2ZCWA 5DCMA 1Q1HA 1A04A 4I01A 4Y17A 2NNNA 1TQPA 1BI3A 3V4GA 3ROUA 1LJ9A 4I0AA 3E6CC 1FX7A 3ZMVA 2PEXA 2ZO4A 5D5XB 1RI7A 3LAPA 1YS7A 4M72A 3Q9VA 3QOPA 4HV5A 5DD8A 1UFMA 4PGGA 3FM3A 2QBYB 4S05A 1BJAA 2BEOA 3CO7C 4BH9A 3E5QA 3BWGA 4UVBA 3U2RA 4ENNA 3LFKA 2FEZA 1JXSA 4L9JA 3FMRA 1TLHB 4JK1X 5AIPA 1YQAA 5E8GA 4DQ2A 5HDKA 1JHFA 2YR2A 3ZMTA 3CLOA 1XN7A 1T2KA 3TDUC 1WWXA 2GWRA 4RGSA 2GA2A 1MDMA 4Q5SF 2VN2A 1ONVA 1SFUA 1G3TA 4TV7A 1EH8A 2MH9A 2RNJA 4KA4A 2PI0A 4O5VA 3U9GA 4HBLA 3CJNA 2PJPA 1J59A 1TNTA 1B59A 1SD7A 3ZMDA 3S2WA 5HS8A 1J5YA 2EA4A 2XHKA 1OR7A 2COMA 1XGSA 5LHIA 1XCBA 3I4PA 5K1YA 4KT5C 4K2EA 5H20A 2K86A 4WXCA 1Z7UA 2UWMA 3CUQB 1XDUA 2W25A 1IN8A 1USSA 1FNNA 1QQIA 3WTUC 1PP7U 1D3YA 1ZARA 3DFGA 1J0RA 1K78A 2A07F 1ON2A 1VTNC 3KZZA 2F5EA 5DV5A 2ETHA 4ENMA 4WX9A 3IKTA 1P4XA 1LEAA 4RGXA 3GX4X 2W24A 2HZTA 1K7AA 3EYIA 3ISPA 1TQIA 1WKMA 1P92A 4PZJA 4UHTA 1KQ0A 3WTXC 4LLLA 1FY7A 4OU0A 1QO0D 3DPTA 1J7KA 4Z2YA 2BE5F 1YW8A 2XRNA 4U7DA 2D1VA 4P55A 2PG4A 1U6GA 5IT9Z 1GXQA 2KIMA 4CXFA 2FQ3A 3W6JB 3HOTA 1S3JA 3EDPA 2H6BA 2ZKZA 2XAHA 4M9XA 3WGHA 1R36A 1USTA 4XLNF 2G7HA 4IF4A 3WTSC 1CF7A 2KIUA 1H0MA 3ZMUA 2V1UA 5DYMA 3MZHA 1GHCA 1IRFA 2G7UA 2BV6A 1ZLKA 2XUBA 2ZBKA 3BPXA 3DQVC 4D0PA 2FNAA 4OMZA 2IW5A 4Q48A 2VOOA 3P9CA 4Q47A 1LNWA 4HA8A 1BOAA 2ZFWA 3DEUA 1UHWA 3ECHA 3I64A 2O6GE 3F8CA 3WTZA 2GA1A 1T6SA 2XAFA 1OYYA 5CYVA 3WTWC 2HOEA 5D5VB 4UXNA 1HW1A 5K5QA 3FF5A 2FOKA 5L3FA 4A0XA 2V1XA 5D8KB 4KIFA 3FXQA 2FU4A 5DUKA 1HKTA 2M8EA 2ZXJA 5ICCA 4FT8A 2Z33A 1CGPA 2PBIA 1MD0A 4RAYA 4DNCA 1LDDA 1XDSA 1P4WA 4BNCA 3OOPA 2X0LA 2IA1A 2EV0A 1KGSA 4OIPF 1XGMA 1IW7F 2L01A 3IL2A 3B73A 2EWNA 3KP4A 1JGSA 1IN7A 2A5YB 3GWZA 2EFNA 3ABTA 5L3CA 3ZPLA 4ZYGA 1ZLJA 4OIOF 3JW4A 5D8LB 2FXAA 5F1RA 3MQ0A 1YTYA 2VOPA 4KMUX 2EFOA 2LSOA 2IP2A 3R60A 2NS0A 2A61A 4RB1A 1RZ4A 1PP8F 2M30A 1LQ1A 2W85A 2WC2A 3KCCA 1W7PA 4ETSA 2V6CA 3FMSA 2BGCA 2CW0F 1MGTA 2LKPA 1GXPA 4ESFA 5BS6A 4LB5A 1XB4A 3T1BA 4B8XA 2H27A 3O3KA 3JAMZ 1LDKB 3IKVA 2WWYA 1T0FA 3SZTA 3FMQA 4IRIA 5FD6A 3DP7A 4G94A 3V8KA 1TNSA 2DQLA 1R5HA 2M45A 2Z9OA 2DBBA 4E70A 1KA8A 4HZFA 5J6XA 4CYDA 1O3SA 4Y13A 2P7VB 2LF7A 2HR3A 3LWFA 3J81Z 2HQNA 2DK8A 2VBXA 3KLOA 1MKMA 4I02A 3GXOA 3H3UA 5KVRA 1K6OA 4MQ9F 2IA2A 3HRMA 5AONA 2FRHA 1TTYA 4L0YB 4I09A 3RYRA 3QRFF 2W57A 2H6CA 4YG2F 2EFPA 1OMIA 4NQWA 4I2OA 1BIAA 1MZBA 1XGOA 2JPBA 2VODA 3NRVA 1L3LA 1REPC 4WK8F 5DDGA 2O61A 1FYLA 3P9IA 4LFUA 2EV6A 4RS8A 3FX3A 3WE3A 4HW0A 1IN4A 2RQPA 1WI9A 3ERED 3ZN0A 2Z5UA 5LRSA 2FSWA 5FO5A 1O3RA 2JPCA 2RN7A 3SFZA 1HXDA 2WV0A 2RVCA 2QVOA 3F6VA 5LHGA 3U1DA 4L5JA 2OA4A 4CO8A 3LA2A 5ICGA 2O03A 1B9MA 2PLYA 2F2EA 5FFXA 2O0YA 4L5IA 3K2ZA 4P9UA 1IRGA 3HHGA 1SMYF 3V7SA 2VT3A 2ZMEB 2P7CB 1J75A 4Q4ZF 3F3XA 4MTDA 2QBYA 2FA5A 2QQBA 5FD5A 3HOSA 1U2WA 4UV9A 1I1GA 1YFHA 1FBSA 3MFKA 3QPHA 4GGGA 1B1BA 1HBXG 4G7OF 4IXAA 4L9NA 2VC1A 1D8JA 4LJZF 5K5RA 1R1UA 2EJRA 3GFJA 3WU1B 2NAZA 4LMYA 4ESBA 4HF1A 3R0AA 1FOKA 3E97A 3J80Z 2K02A 4O3MA 3RI4A 5BOXA 2V79A 3MZYA 3JTGA 1ZRDA 2ZNYA 2VBZA 3I59B 1XD7A 2QENA 4YFXF 4ENKA 1OYWA 4AD9A 4A6DA 4EJUA 1AWCA 3L2CA 2C6YA 2ACJA 4GCVA 3DPLC 4P96A 1SAXA 3IHUA 2H94A 1P4AA 3FHZA 3HHHA 2STTA 2XKOA 4N9IA 3GW2A 3M8EA 3TGNA 3K9TA 4YFNF 2FBIA 4U0VA 2FBKA 5BPIA 4U88A 5ICFA 2P4WA 3ML6A 3Q9SA 3F22A 4MNUA 3AAFA 5D5UB 4FX0A 2KKOA 3KP5A 3ZP5A 1D5VA 4U7BA 2AS5F 2EFWA 3N97A 1G3WA 2B0LA 2XROA 3TO9A 1W4MA 5FGMA 1E2XA 1R23A 4RB3C 2HYFA 2ELHA 3SXYA 5LGUA 4YIIA 3M1EA 2GZWA 4KYWA 5ILUA 3HRUA 4HYEA 3HRSA 3WTYC 2CO5A 4G6QA 3DV8A 3T5XA 1QZZA 4UVCA 2R7DA 1HSJA 1MJBA 1J2XA 3I59A 3P7NA 2JSCA 4UV8A 1R1VA 1ZG3A 2TDXA 1YO5C 3P9KA 3T8RA 1IN5A 3VB2A 4WXHA 3E6DA 3ZQ7A 3WGIA 4I0BA 5CVUA 2PMUA 2UXNA 2FMYA 1MDMB 1XSVA 3FZVA 4XBFA 1PDNC 2A6EF 5DEQA 1W7PB 4L9VA 4IHTA 1RUNA 4JQFA 2J5PA 4U0YA 3F8BA 2HTSA 1ZG5A 2HKOA 1RNLA 3KLNA 2HQRA 1R5GA 1QPMA 3GF2A 4HOBA 1S7AA 4HLYA 2E1NA 5LGNA 2M1BA 3QPTA 4L9TA 5CJ9A 5L3DA 1SD6A 3RTRA 3BJAA 4EJWA 4CGZA 3MWMA 1IN6A 4O6JA 1TW2A 3J80K 3BZ6A 2F5FA 3R6SA 2XAJA 1T39A 5HS9A 3TO7A 4AIJA 1BIBA 2XASA 4M6XA 4KFCA 3QU3A 4WXDA 3I53A 2K4BA 3BROA 3J7AO 2F5CA 4OIQF 5HDGA 3GZ5A 1ZREA 5ICEA 1IF1A 2BBYA 5KK1A 1AOYA 3SQNA 4KNYA 5H6RA 2Q2EA 2VE8A 3VODA 5LHHA 3GFLA 2BYVE 2PFBA 1H9GA 2X4HA 3WG9A 2XGXA 4WF2A 2K27A 1QZYA 3MEXA 3PFIA 1G3YA 4LLNA 3V8JA 1IXCA 5D4SA 2QLZA 5CLSA 3L09A 4PCQA 3BJOA 1V3FA 2W84A 4HDVA 4HDUA 5L3EA 2FE3A 4RB0A 3QP6A 1YYVA 2UZKA 4R79A 3WU0A 3N4MA 3WE2A 3W6KB 2V9VA 4IVNA 4A0ZA 3KP6A 3E5UA 2ZMEA 5E1XA 3VFZA 1YIOA 3C1DA 5D6FA 4A5NA 4G8XA 3DXJF 5HLGA 4OINF 4MEYF 5JI6A 3QAHA 1ZRCA 4L0ZB 3NEUA 2HS5A 3JSPA 2ISZA 1F4KA 1EH7A 2LNBA 5DD4A 3WTVC 3MCZA 4ZYHA 1WQ2A 3RIRA 1KQ9A 2XVCA 3DF8A 3SHFA 2IVMA 4CDGA 2CQKA 4R8HA 2MLGA 3BY6A 5BPDA 1G3SA 4KDPA 5FLXK 2K4JA 5HS7A 1ZHFA 4ZH4F 3WTTC 4G9YA 4LD5A 3F8MA 5E20A 3M9AA 4EV0A 1KYZA 5LRRA 3I5UA 3C18A 1HSTA 1BI0A 3KP2A 3RYPA 3V7RA 2IRFG 2MA3A 1FWZA 1RIOH 1IAWA 3JAMK 5DCFA 1U5TB 1G4DA 2FF4A 2K7LA 5BQTA 1R1TA 4XRFA 3IWFA 1Z6TA 3H92A 3PQKA 4AVPA 4G7HF 2E7WA 3BOQA 3ULQB 3J81K 5CVVA 1SMTA 1G6NA 2QYOA 3I58A 3KZYA 5HLHA 1W7PD 4RGUA 1FBUA 1ON1A 1DPRA 1BI2A 4MGRA 4P5OA 4AIKA 2JZYA 2Q8KA 4M6YA 1O57A 2P6TA 2RC4A 5D4RA 4PDKA 1XSDA 3EQLF 4LGWA 2E7XA 2DLLA 4Y15A 2FBHA 4BHCA 2O8XA 2L4MA 1HW5A 5ILSA 1T38A 1F1ZA 5AIQA 4BQAA 1DDNA 3CO6C 1LB2A 4A2UA 5IT9K 4NB5A 4B09A 3QU6A 3M7GA 3L00A 4FX4A 3T0YA 1CF7B
chains in the Genus database with same CATH superfamily
3ZNJ1 3IH4A 2YKSA 2DPJA 2OZ6A 3J81Y 4EJTA 4IR9A 4UEMA 3QO9B 3MFHA 2E60A 3KEYA 1ZV4X 1NK2P 2YX7A 5HVQC 1SFXA 2R7TA 1RU1A 4ZPBA 3JRGA 2WY2A 2HK2A 1U78A 5GTHC 4N41A 2E35A 3CB4A 3T1HJ 2HFNA 4DWIA 2UXDT 5CYMA 1AUSL 2ESNA 4IX7A 1XTZA 4GYSA 3Q0WA 2KRRA 3L39A 4DR7T 3QAUA 3I54A 2OA5A 3TJAA 2XAQB 1SI9A 3SQGA 3K3QC 4D7NA 5HBMA 2R2UA 1SJFA 4GOUA 2CNKB 2UUBT 4WTOB 4X65T 4A8XA 1TP4A 4KKOB 2P5VA 3HIFA 3VEPA 3UT5E 1UPPA 2DHSA 2V26A 4RLEA 1FMVA 1CS4A 1WRJA 2XB0X 1OYIA 1HC8A 1X0PA 3L2VA 2DMNA 4DUZT 2X0LB 2BYCA 3FHNA 3OTEA 2Q0OA 3QIPA 1PUEE 1ZH5A 2ZBIA 3N6LA 1V3ZA 1NO8A 2X0YA 1S6PB 5L1LA 2OZUA 4UVCB 3ZPOA 3IRXB 1YXRA 3JTPA 1IC8A 2IAJB 5H6RB 4GVBA 3SV4A 1NG7A 1MMSA 4ECQA 4DR1J 3CP2A 4DV5F 1UVIA 3GFIA 1JXEA 1DARA 1P8GA 1RWWB 2W66A 3UUBA 2CGPA 5KFXA 1N5YA 4IRGA 1WEZA 1H8AC 3BO3A 4GKJF 4OHFA 2WCXA 2R7XA 1RCXB 2YWGA 2GM4A 4TZ4C 4DO0A 2DOAA 5LJMA 1SANA 4NA3A 4X4VA 4HH0A 3LQRA 2HFHA 1L0OC 3OV7A 1S1WA 2QFJA 4YIFA 2F5DA 5L3GA 5JHUA 1XNRT 3PNYA 2CPTA 1RTDA 4NYZA 2DU9A 2L48A 4BC9A 1VQ5S 3SDEA 4IH5A 4FTHA 5EUHA 5KX5E 4RW8B 3FIWA 3GV7B 2V6YA 2I8DA 3ZQCA 3CJTB 1UZDA 1S48A 4R0EA 4FE7A 1RP5A 2GGPB 2MQMA 2LR8A 2FLLA 4GO1A 1S6LA 1RAGB 1VRTA 1HF0A 2XQ8A 3GG0A 2MLYA 4B1RA 1RDRA 4J9MA 3L7PA 3L7OA 4XN3A 2NRAC 3DOKB 4KRWA 1RE1B 2HQIA 2L8KA 5IHYA 4BDZA 3C2HA 3ITHA 3EETA 3ILOA 2A3SA 1U8RA 5TJJA 2FY1A 1GMWA 2VPRA 3FEXB 5KFUA 2OGUA 5E3LA 4I0UA 3Q22A 1U24A 3I0TA 5FLXZ 4E0DA 2XB2D 2V7KA 1VQMI 2VQEJ 4DU7A 3HR0A 1FD2A 1OJLA 2TRTA 4A8QA 4F3OA 1FRJA 2P9GA 1GVDA 2KZGA 2ZHBA 5FY7A 3HL2A 4DV4F 2YWKA 4GYIA 2XZWA 3W3CA 4MJKA 4IG0A 4BAYB 3UUMA 2D3O1 2BOLA 1VZ0A 2JQQA 3FC9A 1IDZA 4W92B 1YW9A 4XLPF 2BVZA 4RAGA 1V54H 1BC7C 2QT7A 3OW2R 2Z56B 3G73A 3CC2I 3HHEA 1YOVB 3JRBA 4MH8A 4OYJA 5KG1A 1Q53A 1A6QA 1TZLA 2P5LC 5AQPB 4YJ3E 3DNCA 4USVA 3UDCA 2XMJA 2JQKA 3G87A 5A8RA 5E41A 4OYOA 5L3BA 3AE7A 4QWQA 2UXCT 4IRKA 1QLBA 2MW8A 2JJ9A 5HMZA 4CM0A 3ZTRA 2DTRA 3MEDA 2L3LA 2MBFA 4JV5T 3CZ6A 3DOMA 3K1PA 3AQOA 2XKPA 1JE8A 3CCYA 4TYAA 4NUUA 1IO2A 4QZVB 1NEEA 4XLHA 2VKZG 2UUBJ 1X4AA 4HTEA 3F23A 3GVAA 4KIBA 4CN4A 1YQ4A 1R8CA 1U1PA 3RIUC 1P2FA 2DFHA 3KLIA 4ZYDA 4KPYA 1D1CA 4MLOA 4USKA 4RDUA 4JYAF 5DLGA 1SFEA 2HPMA 3D5MA 2CQIA 2HZCA 4IRHA 3ZTPA 4GIWA 1V5FA 2OPPB 3CCVI 5B5EC 1W2IA 1N36T 1R8AA 2IJRA 4M71A 3TA2A 3W8PA 2NVXJ 2QQ9A 2KJWA 1A7GE 1HWIA 2CHNA 3PYFA 2QZ8A 4ELTA 3NAHA 3VWBA 1XMKA 1EAYC 4PRFA 3OL8A 4RW6B 1BM9A 5BYRA 4O3SA 1F9HA 1Z0XA 2W4XA 2HTJA 4IRCA 4TLQA 4AWXB 1C1BA 4UZCA 4HR2A 4L5EA 4J9VA 4EZ9A 3OYBA 4EB6E 3NGDA 2DY9A 3G8TA 2WZHA 4DVDA 1A0OB 2UUCF 4U0WA 2WVFA 4KKOA 2DQRA 3PUSA 3LAKA 2DA1A 2WSEC 2ZOFA 3K1NA 3IGVA 3I0QA 3IN5A 3E6BA 4ZVSB 5L39A 3SS1A 4ZZDA 1XX5A 4O4JE 3NGRA 3CDHA 3E1SA 1YRXA 3S16J 2DWKA 5BMZA 2GJFA 2R7WA 1XEZA 4LG0B 3HPHA 1RJJA 2CQBA 3Q3SA 2MC4A 5J2NA 2VC0A 3WHIA 4DV5T 2F5VA 3H5SA 4DSEA 3D6MB 5DDPC 3I9V2 1RT2A 4NCGB 1H2UX 5GADI 3RLFF 2VONA 1EJ7L 1TWGJ 4HF0A 1LRZA 4BQOA 3NOCA 4YDXA 3LP2A 2XS7A 3E01B 3REOA 2HLUA 4F6RC 3QWPA 2BG9B 1UJ6A 4DN0A 1MBGA 4HFDA 3JYTB 2NW8A 3HSRA 1RWUA 2DO7A 4YN3B 3L4BC 1S9FA 2NSCA 3FSIA 3U1MA 3GP9A 2V4JC 1R49A 2L4AA 1YKEB 4M9ZA 3PW7A 4A6EA 1WR0A 3HKCE 2M3DA 1Z9CA 3RBZA 3IWZA 2CSOA 4X62T 3CUOA 3NP5A 4HN9A 2FVPA 4DUYT 4BS9A 4DR7F 1OCOH 1NDCA 2IM2A 5KG6A 2GVDB 5AE2A 4EGZA 4RB2C 1UA0A 2LH9A 4CA0A 2D69A 1U5TC 2GJIA 2VJJA 1ZG1A 1HPZB 1ZS6A 4UY8T 3NAIA 5KG4A 3GIMA 3QB5A 4KMFA 4NASA 1R0AA 3AA6B 2EZLA 1F9NA 2RQ4A 3GONA 4MIMA 1EZ3A 2XASB 2WB1D 2UXCJ 1JGGA 1NDLA 3CIRA 4OI1A 4JI2J 1RTZA 4MALA 2HXIA 1SC3B 5EWGA 4CIOA 4ZZLA 2JC1A 2KRBA 3R6GB 4I68A 4QH1A 4KI0F 3G6ES 3ZMZA 1X3UA 2EBIA 3GUDA 1VFJA 3SDBA 2ZNZA 4ASNA 3P5BP 2D9OA 1N36F 2CPXA 4DSJA 3ZXWA 4F8HA 1FKAF 3BGLA 1YJRA 4F02A 2FMLA 2YDQA 1N33J 4JI3T 5E33A 2KZ7B 4F7ZA 3TOBA 3SQGB 4IHWA 4TNVA 3FBBA 2VG5A 2WMOA 4HX4A 3M8PB 2E9XA 2HQ5A 1I6XA 1OJ4A 5CD4A 4MHCA 3V8LA 4IG0B 1R00A 1FLIA 4V19J 4WFNQ 4Y0FA 2JRKA 1D3WA 2LVWA 3V5RA 5FL0A 2OQGA 1X2NA 3MM6A 3RKOA 2ROEA 4AUKA 5JHFA 2M70A 4CM2A 5DS9A 4CCOA 4FF3A 3C50A 1M62A 2COBA 3KINB 3QZ8A 1F43A 2BRKA 3WQPA 3PRDA 1FKPA 1NPKA 9ATCB 1OISA 2KJVA 3QP5A 1D5YA 1R71A 1YRTA 5JR3A 1LE8A 5HYAA 3DOMB 1EF4A 2R5ZA 5F9LA 2OBPA 2VZ9A 1PIEA 1JJ4A 2YEVC 3W5ZA 1QAJA 2BUNA 4O44A 1ELOA 4C9YA 2JWTA 5ETPA 2YKQA 3AXJA 1H6KX 2VPWB 4DXLA 3PQJA 2BOPA 3M07A 3D5RC 4AIDA 2HNZB 4Y28C 4IEJA 2VKRA 3SZPA 3SCLE 1PKUA 4KX6A 2OAZA 4UUVA 1PC4A 1ZYRF 3D5LA 1N6QA 3Q0VA 2L7ZA 1Q16B 2NW7A 1DP7P 1T9VA 4CZZB 3AOBA 2K3IA 5M5WJ 1B8IA 2AO9A 1FSHA 2J0WA 1N78A 3LK42 4M73A 2KJBA 2X9YA 4HACB 1JT6A 1QY7A 4R1HA 5HLIA 4CCJA 4IO9Q 2WTFA 3AEBA 4G65A 2B9EA 2WAQN 3VAMA 1A5JA 1K4SA 4JBAA 4J9NA 3V7CA 3B02A 5CKTA 1TMMA 3P4RA 4CYCB 4JUZA 3TKYA 2JNJA 4ZVRB 2HMIB 3GA8A 3HOWJ 5KFAA 4K7QA 3GJQB 3ZQQA 1OPCA 3PL8A 2XQ7A 1U1KA 2PI4A 1X1BA 3S1NJ 2WWUA 3FXOA 4IOAF 1CG2A 2JLEA 5B1AH 2E5NA 4UOCA 2BBJA 1FBQA 2G9WA 4CLSA 4GC7A 3OPKA 1B4SA 1MBKA 2R9LA 3S1RJ 4C8LA 5T41A 2KT9A 4EMSA 2OD5A 1NJIT 2CPYA 4F50A 2A6HF 1VJQA 2CWEA 3N9NA 3QMQA 3FZ2A 4UV8B 4IOAQ 2N1GA 2EHOA 2HURA 4OJGA 1KYWA 3MAJA 2DPUA 4PQUB 3DJBA 3OFFA 3TDZC 2HRUA 1FEEA 3W61A 3A8EA 4A98A 1OR7C 4UZBA 2BS2A 2AJ0A 3VGTA 2Y8WA 1I3OB 2BE9B 1VC0A 3MM8B 1D0ZA 4N9HA 3CQGB 1N33T 3B6BA 5FRNA 5F0CA 4M74A 3K7AJ 1U45A 2VICA 2GXAA 3W5XA 5CVJA 4BHQA 5HEOA 3ZSTA 2RHQB 2XGDA 2EA2A 1BN5A 2FVSA 3HGGA 3PFYA 4EGYA 5M2UA 3J80U 2CG4A 4PUSA 2RP4A 4XAKA 4ECVA 5LXTE 1HCIA 4QKNA 2V8HA 3SZGA 4HV6A 3SFGA 4BJMA 2QWWA 3BTIA 2HBQB 1M5OC 1V4RA 1BLUA 3KLHB 4J19A 3I71A 2EQRA 1S35A 1KU3A 3B6CA 5HMXA 5C4JJ 1M1EB 1SKRA 4ZCMA 2E5LJ 3LSHA 2ID3A 2EWHA 3NWGA 1VBXA 4S0MA 2K3KA 2MY8A 3N9UC 4LF1A 2DOFA 1WH5A 1LWFA 2QMUB 3E5XA 3EUHA 1X9BA 3MR2A 3GV5B 4CDIA 4DLGA 1RHUB 1XSXA 3RBDA 4X62J 2HKEA 3GSDA 3TW6A 3WAJA 2ZCWA 5ETOA 4ZJOA 3PY8A 4K0KF 4GK0E 1UW9A 1EA3A 4KY3A 4JP0A 4FCYA 3K4KA 5JJBA 2OKQA 3RJMB 3UDLA 4USJC 1HI8A 4WZMA 1XTAA 2LC2A 1HG2A 1DURA 3KJVB 4JI7T 4BWMA 3LSVA 2HI3A 1GUUA 1S72S 4B3OB 3H2VE 5A8WA 3OWTA 5K7ZA 3TVZA 3OS0A 4WZXA 1W25A 2I2YA 2CQ4A 4ZLPA 2ZO4A 3KYDB 3I5AA 1NSQA 3OSGA 3Q9VA 5HQ8A 1WLXA 2CM0A 1YBUA 3ADAC 5TISC 2EFGA 4ZVUB 1XMQT 1EETB 5DD8A 4ZPWR 3DDIA 2L7MP 1UFMA 4B43A 1N77A 2Y1RI 4DYRA 3MN2A 5JDMA 4X4TA 2B7BB 1VLOA 3E5QA 4FNIA 4OJHA 1H2VZ 2JH3A 3OR2A 3UTKA 3ABKH 1ITPA 2MJNA 1S1UA 4AISA 1U0SA 5FKMA 3FMRA 1TLHB 2P9EA 4PWDB 2X51A 2HDDA 4DU8A 5D15A 5DETA 3GMIA 4E7IA 3NRBA 3BR0A 3NVOA 1BUXA 1Y5IB 2EZHA 2UZAA 2YQ3A 3HHLA 2KVIA 4O44B 5E3QA 2X85A 3MJXA 3HHDA 4YQWA 5HCMA 3OYEA 4DQIA 2W01A 1RADB 4RBTA 3CLOA 1SVDA 4M1PA 1FIOA 3PSFA 1RHMB 4Y2IA 2K7JA 2KT0A 4FNHA 4U8YA 3PNTA 3K8WA 1L0VA 2LXUA 4DZ6A 5LG4A 1VQPS 2VN2A 2AXDS 1ONVA 4FJOA 2DODA 2R7OA 1FOWA 2JA2A 3ZCOA 4C2MA 5JVDE 4P7VA 2KP6A 4O5VA 4O3OA 4HBLA 2G0JA 2PJPA 2DYSH 1S0VA 2CAJA 3MUTP 1NRKA 3GLJA 3ZMDA 1XWLA 1C2PA 2XHKA 4IDOA 2F9JA 1D1UA 1VQ7S 2COMA 2GBYA 4KJZA 5DABA 5B0AA 2X1FA 2XYHB 1XCBA 3R6NA 3TX8A 4FN5A 4KBIA 3Q5DA 2XGPA 3ET6B 3AEFA 2K86A 3GV8B 2ABYA 4XKBA 2IYGA 2J9CA 3G71I 3HDSA 2HGNA 3KHLA 5K8MA 4IOCF 2MAWA 2XLKA 4AXPA 3HFZB 2H7VC 1E1HB 3RW6A 2RS8A 2XMMA 3CJSA 1WJDA 2YH1A 1R8BA 1JUMA 1WI6A 2V7MA 2V8VA 3F0NA 1MMGA 3QSYB 5I3UB 3VPRA 1PP7U 3FK7A 2B5JA 3RB3A 5KG5A 4NC6A 5A6PA 2HZAA 1QE1A 1VTNC 3FQLA 2B43A 2DNOA 4AXIA 1YX5A 1RHKB 3IXQA 3GN5B 2AX1A 2XWXA 2UUTA 5HK4A 4ANCA 4NLSA 2B9WA 2ZJPQ 5LSRA 2KXNB 4GKJT 2AXTC 2CQNA 4WE1B 4K0UA 3DTKA 4DV1T 1V3SA 2YH0A 1DZ5A 1YG0A 4QTRA 1OPIA 1JTYA 2AF6A 4DJBA 5JDQA 3H3MA 4GMKA 4ZC3A 2QO3A 2W2OP 2I5UA 1TVRA 5HXSA 3IO1A 2IMOA 1FY7A 4OU0A 2XI3A 1QO0D 4E2FB 3QC9A 2AEMA 2UUCJ 3QYEA 2BE5F 2XRNA 4U7DA 2D1VA 2PG4A 5IT9Z 2Q9QB 3IG1B 4F7VA 4TQRA 4CCHA 4DPUA 2RQCA 1SUQA 3HG9A 1LWFB 2H6BA 2UUBF 4BJTA 2OO4A 3DI6B 2O1PA 4ELVA 3PZPA 3FDYA 1XNRF 4IG3B 2OH2A 2CWKA 3PTWA 3S14J 1USTA 1ZKEA 4GKKF 4XLEA 3AE5A 3WTSC 1HNZJ 3G6XA 4B17A 3ZMUA 3EGVA 4CH1A 3MZHA 2L9NA 3ZJ1A 2I5JA 4H9QC 2YKOA 2BV6A 2DNPA 3MKDA 5DTDA 1ZTWA 1D1AA 2XUBA 5D4OA 4H4OB 3Q8VA 4LR8A 2CJJA 2QGSA 3ESLA 2FNAA 2FJ1A 5HJXA 2IS6A 3KK3A 2B56A 1LNWA 4E7LA 4KHPJ 4Z7CA 1C0TB 5FJ4A 3FB2A 2OSRA 3QJLA 5GAGI 4ZVTB 5KG7A 1CC7A 3C4WA 1HYSA 3HOYJ 2W2UA 2X66A 2K3FA 1N4LA 4J9OA 1UHWA 1QAXA 1Q8BA 1EQMA 3I64A 5KAIC 4F93B 2O6GE 4J37A 1SJRA 2HS0A 4QW8A 4Q7AA 2J9DE 3WTZA 1H7CA 2FUPA 2GA1A 3K5NA 4DR3F 5C2CA 3BCAA 3K70D 2XAFA 4ZPVR 4IZZA 3M6WA 5H9EK 2WQYA 3BKUA 1X1CA 3DLJA 4KGMA 1KHVA 4A0XA 3QAEA 2V1XA 4A8MP 3FXQA 3EX7B 2ACXA 2MABA 3NGUA 3N4WA 2ZM6J 1RABB 2RF2B 4F04B 1CGPA 5DQGA 3UFEA 4DR5T 1RLCL 3T5KA 4RAYA 2WZIA 5LMUF 3I3LA 2A2CA 4EO8A 2N3LA 1A6IA 2NW9A 2XRLA 2GZOA 2CU7A 5J2NB 1SH0A 4LFAJ 1DTTB 2DA4A 3OOPA 4F26A 3EPGA 5JMNA 5KG2A 1ZPWX 1I6JA 3B73A 1T3OA 1JGSA 3DEWA 2QA7A 3SDEB 4YSXA 2Q1LA 3GWZA 2EFNA 2GX8A 3M9MB 3AEEA 5L4HA 2E5LT 4JI8F 4OYAA 3RYHE 2VLAA 2BKPA 3BDEA 5ABEA 1EKRA 4IKAA 1HFEL 4OIOF 3JW4A 2A6OA 4ZVGA 3A2KA 3AVRA 2ECCA 1K47A 3G4SS 1YTYA 3FZFB 2VOPA 2LM2A 2VQFJ 2R4FA 4KMUX 3C2PA 3DBRB 3GMEA 1VGYA 4Q2LA 3MKLA 3O4XE 1CBKA 4ZDOA 5D6GA 3R60A 2C5IT 1ZZFA 1WJBA 2OUGA 1YJNS 1IR0A 3HT3A 4RM2A 4OV1A 3OL7A 5AQFB 2XQ9A 2X3DA 2VFVA 1T05B 3MCMA 3D7SB 4ES2A 4WWSA 1NTCA 4TUYE 4HE8A 2E66A 2MFZA 4M8LA 2PGCA 2BM0A 3AL0B 5B09A 2BGCA 3PYGA 2V5DA 1VC6A 2JEJA 2BZTA 2FB0A 5B1BH 4ESFA 4LB5A 2E9ZA 3NWRA 3T1BA 4C8NA 2JMHA 4B8XA 2UUCT 4A97A 2N82B 3O3KA 3JAMZ 4X4QA 2M2BA 5GADU 4L9IA 4YY3J 2EXUA 4TY8A 3FBZA 1SJ3P 1WDTA 3V8KA 5JQGE 1V55H 3CUNA 2DQLA 2QRRA 3WBZA 2VQLA 4E70A 1V3RA 3PUAA 1KA8A 4X4SA 4AQYT 2CZ4A 3N01A 4YMEA 1XZYA 3ASOH 2NP9A 3J81Z 1ACIA 4FQGA 4RKUC 1XJWB 3SFIA 2SXLA 2VBXA 4CCKA 3M6XA 3MPDA 4EEDA 1DAXA 3VHLA 3AB4B 2H1KA 1TC3C 1U8SA 3GXOA 2ES0A 2HDWA 2J6UA 1T02A 5GVQA 3KLIB 1X9SA 1K6OA 1FJGF 2IA2A 2ZH5A 3U27A 3BTJA 5AONA 4JYAT 2FRHA 3JRDA 1DU2A 1PILA 4P2SA 3LK3B 1NKCA 4FYDA 3MVPA 4L0YB 2FJBA 2HYIB 4LIRA 2DGTA 2QIFA 4I09A 4F3MA 3QBCA 2ZH3A 4ZLLA 2H6CA 3RRKA 2EFPA 2Z30B 1KKHA 4ANJA 5KFMA 1NHKL 3FZMB 2X9XA 3MMBA 1XGOA 2XQ4A 1UP1A 3FRYA 4PKDB 4WK8F 4RBOA 1UZHA 1OCTC 2JN6A 3Q83A 2EV6A 4HW0A 3THPA 2P9BA 1JX4A 2B7CB 3ERED 3EXYA 3FBIB 5B0GA 1HWLA 1HLWA 2R6GF 3AA0B 2L9SA 2BV3A 2KINB 2FSWA 1RGVA 4CLTA 3QJPA 2CE7A 2LY1A 1O3RA 3PO3J 3CCQS 1IBLF 3T9ZA 4FKYA 1SJQA 1S94A 1C0TA 2Y69H 4E7JA 2V7LA 3GLLA 2QVOA 1TR0A 5BYQA 3KMQA 1JIHA 5ICGA 3ZMVB 2DY1A 3R1HA 4II2A 3SMZA 4CO0A 2F6CA 1RXOB 2G9OA 4NXNJ 3IR6B 5IWAF 4RL1A 1NSPA 3RF1A 5L3GB 3SXLA 3UQ4A 1U1QA 4PK4A 3I5BA 3V81B 1WD6A 5KG3A 2ZXHA 1XMOJ 1FE4A 3SCJE 2QSFX 3GTYX 2X6OA 1NSAA 1NK4A 4HWFA 3SIPB 3Q89A 2OEJA 2DJNA 1HFAA 3T1YF 4MTDA 2QBYA 5FD5A 2L7FP 1U2WA 2KRCA 2NYIA 2WWVA 2ZJRF 3OYXA 4L9NA 4E6KG 1QSLA 1GMWD 4LJZF 2KHCA 5FLXU 4QWBA 3GFJA 5KFSA 1N56A 1E6VB 3QOEA 2NAZA 3T1HT 4LMYA 4ESBA 1VIOA 4HF1A 3R0AA 4FYVB 3A4TA 3MAAA 3AFHA 3E97A 2JOQA 2DXIA 3N79A 4NZ0A 1ZR4A 1RWKB 4O3MA 4M95A 2V79A 3ZEFB 1WHUA 4KT6A 4B3MJ 3W9IA 1KK7A 2YU1A 2K48A 4I1TA 4NQWB 4KHPT 3AY0A 3QT5A 3A7MA 1SUQB 1J5EF 5AQGB 5E5NA 4MT1A 5FMNA 4A6DA 2Y1IA 5F8MA 3HSGA 4YY3F 4AKIA 2VK9A 3P4SA 2WU2A 3LUYA 4O4LE 2WDVA 4I6AA 1RAIB 4DOZA 1WACA 4GRIA 3FHZA 4K4UA 4MKAA 1LWEA 4AVZA 4ECUA 4OYXA 2JVOA 2XKOA 2OV7A 1SQFA 4N9IA 3AL0C 2WP9A 5HXEA 4EO6A 3VRBA 1VRTB 5GAEU 3AE9A 2FBIA 4YIRX 3VAKA 1JLQB 2FBKA 4M3DA 1X31C 4ECTA 4DV6J 3G1LA 2N7CA 3FBNB 3DBLB 3F22A 5B0FA 1IN0A 3DN9A 4XKVA 3MECA 5DGBA 4FX0A 4HDGA 4BQQA 3ZP5A 1W36C 1D5VA 2F63A 2LU1A 4U7BA 1I6ZA 4AD6A 1FHTA 2AS5F 3AG3H 4OIXA 3N97A 1RT6B 2NWBA 4URSA 1Q5YA 4I4BA 4JX4A 4ZPTR 1RU2A 1S77D 1DGWY 4ECYA 3ETVA 3R2DJ 4FS1A 1W4MA 3P49B 4IE0A 3ABMH 4FISA 5D4LA 2QYGA 1IWGA 2HYFA 4KO0B 4BLGA 3SXYA 2WVCA 1V9DA 4OYWA 5F3ZA 5EZGA 3M1EA 4CXYA 5LFAA 3I4NJ 3PW2A 3P50A 4ZI2C 4ED4A 3L2UA 3R84B 2YPZA 5HXCA 1R0CB 1NK9A 2GK9A 2CRGA 3QFHA 4V1Ak 3B8HA 5C5JA 5C24A 3MMYB 2ZDOA 2U2FA 7FDRA 2G2ZA 3JAMY 3WC2A 1ETWA 1K0TA 3DV8A 2QKMB 2OI2A 2OTLS 3NWIA 2Z2YB 2E5HA 1WC0A 3SSSA 1NDKA 4UVCA 1Y1WJ 2NOJB 3ZZRA 2A2FX 1Q81T 2VVNA 2X3GA 4QYRA 1M5KC 4DPXA 3KV9A 2X6XA 3TW0A 3MD3A 2HHHF 2X1AA 4KUMB 1MN7A 1T3NA 1E3OC 4XIUA 1RESA 3GTMJ 1H7XA 3A01B 1ZG3A 2JL9A 2TDXA 1GH8A 3X1DA 2DGVA 3T41A 3P9KA 2V0NA 2IMLA 2I0MA 3TUZC 1YBAA 2XYPB 3VB2A 4HH1A 2QV6A 1Y8RB 2CLYB 2D9PA 1DHMA 2P2CB 4CH7A 3SV3A 1AKHB 2CVIA 3KLFA 4C3HJ 3O2IA 2L3MA 2ZVSA 1NK8A 2A1BA 2ZMEC 1NLKL 2LSJA 2HRYA 3CQXC 4XONA 4LFAF 4PPZA 4GRSA 3A3PB 4W90B 1PDNC 2YBVA 3CDWA 4L9VA 2BG9A 1URNA 4ZTFA 1RHJB 1T0FC 1N88A 1RUNA 3NBXX 4LSLB 4XDCA 3SI8A 3VAGA 4XICA 4GKJJ 2J5PA 4CO3A 3EZUA 1FFGB 2DHRA 5J2TE 2HKOA 4DSFA 1RNLA 2ID6A 4MO7A 4JYAJ 5HP1B 2L9VA 3GF2A 3W8GA 1HNXJ 5GMDA 2M1BA 5CJ9A 2GJ2A 2HNHA 3B78A 3TW7A 3MWMA 1IN6A 5JR9A 2V6EA 4B44A 5HNHA 4O6JA 3R6SA 4B9VA 5FD1A 4AIJA 4WU3A 3TP3A 2X9DA 1WJAA 4BKXA 4F4AA 5E2QA 3OYHA 1BIBA 2XASA 4IH7A 4ZVPB 4WK1A 4ZITA 5HMYA 2M52A 4DR6T 2OMOA 3HEFA 2B76A 2H1YA 3TNVA 4WXDA 3ENVA 3MAHA 4IFVA 4YB5A 4MKVA 5D4NA 3PIPQ 4OIQF 1CEZA 3GZ5A 3QK6A 1ZREA 3RQUA 3GN5A 4NWBA 1EP4A 1UAWA 3BPSP 2EIJH 5HQLA 2OEMA 2UXXB 1X1DA 1TL3A 2GQCA 4I6ZA 3D28A 3LSPA 2VE8A 1XMBA 4C3MA 3C6TA 5LHHA 1JLBB 2BYVE 3TL4X 3EVYA 1H9GA 2X4HA 1RAAB 1Z4UA 1XR6A 1G3YA 1YGYA 4DV4J 2UVWA 1IBKJ 4CXXA 4U33A 2HPIA 1FFWB 3NG8A 3A5XA 1SVMA 3SYTA 2OTJI 3OYNA 2RQQA 2KB2A 4OI6A 4F4XA 2J76E 1KONA 3AD7C 4NUVA 4WKYA 4J00A 2H88A 5L3EA 1KD1T 4I6YA 2N3OA 1Y9OA 1NK6A 3G82A 2UZKA 4I43B 1XQIA 3PRBA 4P2FA 1FIAA 1WI8A 2OCEA 2QFIA 3VCDA 4X66F 2V9VA 1Q1KA 3BT9A 3HSZA 4TYBA 5THWA 3KP6A 1VCSA 2ZMEA 2K3WA 2W0GA 3M30A 5E1XA 3VFZA 4DL7A 1QVGR 1MSEC 4XQFA 3C1DA 4B9SA 4B3AA 2IM0A 4O3QA 1Q7LB 3ZMZB 3R2CJ 3EDQB 1ZRCA 2W82A 2BJ1A 2PMZN 4M5HA 2D2SA 2F5GA 4TLRA 1WJCA 2OPRA 1S4EA 5AXNA 3MCZA 1L3KA 4Q2MA 3ZOBA 3KVBA 3KUEA 2N2NA 1YDLA 1YJNI 4PWDA 2GLOA 3SHFA 4BXFA 2CQKA 3MM9A 2PFDA 4PXBA 4K4VA 3LA0A 2DHHA 2D3UA 5IFMA 1G3SA 2G13A 1R6YA 5JDGA 4CZCA 3CK6A 4OL8A 1OQ3A 4FP9A 2KG1A 3HOZJ 4FYXB 3HKDE 2E36A 1SKSA 4QIWD 3F8MA 4PWUA 5E20A 1HG5A 2VDHA 1HLVA 2UV8A 3FXJA 4EV0A 4DR5J 4ZVEA 2BOAA 1W5CC 3KNAA 5K14B 3BR9A 5CD4H 2A3JA 3C18A 4C90A 1D0EA 1BI0A 2EILH 4MKYA 4DLEA 4RLQA 3RYPA 1X8DA 3QB5K 1UEUA 3V7RA 2HBRB 5IYCJ 2QQ8A 3H9GA 4C97A 2MA3A 5K5MA 1IAWA 3JAMK 3E01A 4O2AE 3QIPB 2Q1ZB 5JVHQ 4KGKA 1G4DA 2FF4A 2PMZD 4XRFA 4LIWA 3PJ9A 3IWFA 3BQ0A 1CJUA 2VI6A 4NLVA 1R9TJ 5AXKA 3LP1B 4NLYA 1ZQ3P 2GHPA 5M4YA 3IS9B 1N32J 3ZO7A 1IBKT 5E79C 4LF6F 2E7WA 4P10A 3ULQB 4ZS2A 1X4EA 1Q8LA 1YJUA 2HVRA 2PI5A 4DR6J 4ES3A 3OHBA 4WBOA 4P5OA 4AIKA 2IW5B 4IOBA 2X1BA 2I1RA 4DV3J 4M6YA 3MKWB 1ZM3A 2KXFA 3QGHA 2D5VA 2CMRA 3PR4A 3C4ZA 3IP4B 1Y00A 3C4XA 1OSCA 4RWWA 5DS7A 4IHVA 2W48A 4IUFA 4U7IA 2FBHA 2O8XA 5HP1A 5F0WA 3MFIA 2MZRA 1F1ZA 1YK9A 3CJTA 2NREA 4IDKB 4RPFA 2AMCB 4A2UA 2C2MB 4P6QA 4MIWA 5LSLA 2MJUA 3VQTA 3L00A 3L1PA 4R8UB 4FVCA 2MYFA 1CF7B 2DWGA 1HNWJ 3PFOA 1NB7A 4UY8I 4XORA 3UI3A 4M5MA 3R61A 1SL1A 4A3EJ 4NCAA 3K1MA 2DPDA 1W0TA 3NQOA 2KNDA 5AXMA 5EEHA 5IC6B 3DRPA 2LMDA 4IR1A 3K89A 4LB6B 2EI5A 1HKQA 4YHHJ 4LRAA 2IYIA 3U1NA 3R5JB 1U1OA 1KFSA 2YPRA 1IVZA 1I1SA 4L76A 1TL3B 1HX1B 4N7TA 3JTHA 5J47A 3LA3A 4YHJA 3H2UB 3KK2A 2WSSV 3IBCB 2XAQA 1F2HA 5HBMB 5KFQA 5CVRA 1BI1A 4UNOA 2QYWA 3TYTA 5J2PA 3M8FA 1B72A 1RAJA 3T5JA 3P4PA 2XTJP 4BY7J 1PAUB 5GMEA 4B3TF 4A8SA 2YWFA 4XIDA 4IHJE 5IY5H 2AZ1A 4EVIA 1HR0F 3W62A 3HYIA 4OOIA 1ZELA 4FZVA 3ABVA 4F67A 2J9DA 4JEHB 3OR2B 3MHYA 5C42A 2QUFA 4LRFA 1N32T 1Y3KA 2IC6A 4EM2A 3JSMA 4ZVFA 1ODDA 3BF4A 3HJFA 4DR4F 4MHGA 1RYRA 1Y01A 4M63A 2M88A 2R8GA 2Y1JA 3OSNA 2W2NP 4M3BA 2Z57B 2W2PP 2H8WA 4HQMA 2DR8A 1HI0P 3BJ6A 2CADA 2POKA 4LK0F 4O4GB 3W9HA 4JLEA 3GIIA 4P71A 4KAIA 3B5MA 2VT2A 3CPWR 2G1HA 4NNJA 3OTCA 3TRGA 4OI2A 2CQGA 1G6BA 4HF2A 3TEGA 1Z2LA 1X19A 1OQ6A 1FX2A 3TO6A 3A3NB 5E3MA 1FJGT 1GV5A 1QD1A 4HX8A 4MFBA 1GT8A 4X1KE 4IJAA 1VQ7I 3LDQB 2IRUA 3TJ9A 3I87A 3RAXA 4J91A 4MAKA 4H9SE 4FHTA 3ZC1A 1ZETA 2IT0A 3G8QA 1EJ9A 3KLGA 4LF6J 4HSTA 2B8QA 2HYGD 3RKYA 1S8NA 2HSEB 3NKYA 4KICA 2BANA 4AQYF 1LXJA 2FJAA 1OWXA 2ZM6T 2NPFA 3O6BB 4HFIA 2WB1A 3OYJA 4LOCA 1UHMA 3HRTA 2DH9A 2IJLA 4ES1A 4G12A 5J1EB 1LK5A 2RSQA 2R8IA 1NZ8A 4N8OA 3MCSA 3T5LA 3CCVS 3PUZF 3LSJA 1DLOB 2DW4A 4JI0T 5IOLA 3HSEA 3LP1A 4ZYEA 5KHDA 2BXYA 2I59A 5FFZA 1HNWT 2FHJA 4E4HA 3KG4A 4MKBA 4Y2KA 4G1IA 2QL9B 3FSXA 4URGA 1MSWD 4IL6C 4RNOA 3IS9A 3ZSSA 2ZH4A 3M8WA 1OEDC 1Z1DA 1N5QA 1N54B 3MEEB 4P2MA 3GO5A 2BEFA 3FVYA 1HQCA 1NM2A 1HQUB 5E3RA 1H2TZ 4E7ZA 1LPQA 5D77A 3RPQA 3TQ1A 1QLNA 1WSRA 1UVMA 2HNYA 3HTUA 1S1VB 3O1LA 1KU9A 4PYAA 4NZ7A 1VOMA 1PCAA 3PJAA 4ENJA 2V68A 4KMCA 3ELKA 3OYZA 3R8YA 4OJ1A 5DM7Q 1IKWA 3GYNA 3CCQI 2HOSA 1TL4A 2LEAA 4LF9J 1BC6A 3C98B 4MFEA 1S72I 2GIFA 2FHJD 2LKHA 5C3EJ 1XMAA 4BHBA 3W64A 2CJXB 2MC3A 1D8ZA 2CPEA 3VYUB 2HZDA 1POGA 1BQNA 2A6TA 3BH6B 4NMXA 2OIHA 2YUSA 3FMWA 3V2UC 4CTAA 5IT3A 3CO0P 4RW9A 1XNQJ 2OD6A 1VQMS 2HFVA 3EABA 2XM3A 4B3TJ 4NXMF 4C8OA 4NIQA 2VPZB 3OSFA 4IQ4A 3N0VA 2HQCA 4TX5A 4IFYA 2HQAA 4O23A 3VYSB 2H5JB 2HHQA 2W7PA 3CTAA 3HPOA 3M9OB 2DCEA 2ZZNA 2KHDA 4PJJA 2MKCA 2LDUA 4ILUA 2DJWA 2HWVA 3IFEA 1KU2A 4WFAQ 3DLHA 4ZEYA 5L3BB 5B0EA 3TARA 1S79A 4UUTA 1YG2A 2HWHA 2IGKA 1R0BG 4EZ6A 1RA7A 1WSVA 2G2OA 3WGGA 1TKTB 2HQGA 1ZAOA 1MJ9A 3N5LA 3FKBA 4KE5A 3KK2B 2XY8B 2V7FA 5LGTA 4AL6A 4GXOA 4M9SA 3O1JA 4DQQA 2YPYA 3HA4A 3IG1A 3MD2A 3B82A 3DXBA 4OLOA 4K4YA 1M1KT 3CMMA 1W09A 2ACZA 2FYXA 4CNZA 5HATA 3R0JA 2M9KA 3DLEB 4DX5A 3CMLA 1J2VA 2NVQJ 1LFBA 2QYCA 3COAC 3AA7B 2MTLA 2NLWA 3CF5Q 2LTPA 4IHSA 2MZSA 3H7HB 1AXQA 1LE8B 5DQWA 3NCRA 4HVZA 4I2PA 2MBGA 3K70C 2LQBA 3RZOJ 3OUYA 1X5PA 1IUYA 3PG9A 2KM8C 4TWFA 3NWTA 4PGHA 4LF5J 3OHAA 1NG6A 2BG9C 2EBEA 3QZ7A 2PE8A 2FY8A 5DO2A 1UAAA 4F91B 2HK3A 1OEDA 1EHWA 2EG1A 4XLAA 4Q25A 5GPCA 4L75A 1JLAA 3ZFVA 2HKXA 3VZHA 1EV7A 2CEAA 3VF0B 4DFMA 2YX4A 2J6SA 4O4GA 1IZ1A 4PAGA 4JI0F 2X1EA 5D4PA 1BOBA 3LTOA 2P81A 2OTJS 2YVSA 5JFRA 4EYYR 3DMJB 4ER8A 2RKIA 4QLCU 5J2QB 5ABFB 3OJUA 4J9SA 1OCZH 2FHKA 2N7YA 2DAOA 3D5SC 2Z99A 2LHNA 1H73A 3UWTA 3OL3A 3MURP 3G4SI 4DR2F 1GTEA 1HBNA 3SFUA 4DJAA 4RMNA 3PU3A 1T7PA 4G7ZF 2PG8A 2FJAB 2LRKA 1IKXB 4Q0BA 2XHCA 2H3EB 2B3TB 2FUG9 2CW8A 2K9LA 3H5NA 2HEOA 2ZWOA 3FGVA 2DPIA 2MG4A 3KEOA 4JI6F 2R3SA 1YLXA 5KFLA 1SL2A 1NXIA 4PG8A 3LPEA 2R8JA 4DV3F 4KHPF 4A48A 4HLXA 4ZCIA 1N52B 2HS4A 2KQRA 1U8WA 2OELA 3TLTA 3K8PC 2ME0A 5KOXA 3I82A 4OFZA 3EYYA 1FZPB 2GFFA 4OYIA 4HL9A 2NYHA 2DD8S 4K59A 5C8YE 3K4LA 2VA2A 5I42B 3C14A 4IT4A 4HFBA 5F8LA 1D8KA 2KMUA 3SCKE 5J40A 1A31A 2K8GA 2JVRA 4X6AJ 3UUNA 5EGOB 3L7WA 5A8KA 2VBYA 1A35A 3RDIA 3NS7B 3AB2B 3NZPA 4ED5A 2CV0A 2UXXA 2U1AA 5DZ6A 4WXWA 2QN6B 2Y9HA 3UVJB 2Q9QA 1EKEA 1IKYB 2CFXA 1JLBA 1MBHA 3MM6B 3T8TA 3IUOA 2EW9A 1XG1A 4DSLA 2AXLA 3I4HX 3M05A 5AQQB 3NNCA 1TU0B 4QXHB 1AZSB 2H09A 4OAYA 2ZE2B 2AW0A 4QYZJ 3LWLA 1O51A 4KH0B 3AAEB 4MEXF 3ZQHA 3KNGA 4DV5J 4BBYA 4HT7A 4CTAB 2MQOA 4IDPA 4USWA 3OR2C 4A12A 2YNHA 2LQJA 2V4RA 3BG5A 3PIOF 4DV1F 1NHVA 4DHVA 1B6AA 3FWEA 3G6EI 3GTPJ 2DRAA 3LG7A 2OU2A 1Y4ZB 5JVTA 3L9FA 1FPQA 5EZHA 2H1LA 1BBYA 3M30B 4AKLA 1FTTA 1I27A 2E9XB 1X4GA 3C2GA 4V2GA 2KZVA 1C0WA 3VR1A 2Z16A 4MFBB 2IGOA 2PMHA 4F4WA 4O4HE 2OTLI 2LYVA 2VKDA 3VHQA 3HVTB 4LVNP 3E51A 1NEKA 4AIHA 5F6FA 2VD3A 5EEAA 2Y3YA 4HNVA 4LF5F 1TQMA 4NXMT 4Z90A 2IA0A 1VLYA 5LGTB 2IJFA 3MTKA 3SFEA 4QHOA 1ZOTA 4YR2A 4Y52J 5F0UA 6FD1A 1VBZA 4ED0A 2QLFB 1NJYA 1MH3A 2MHNA 4JI1F 3DHWC 4JI4F 4H0EA 2VUMJ 1RT5B 1UVNA 3M4OJ 2V9PA 3OOUA 4KR0B 2BY2A 2Q2EB 1WJ5A 3TVYA 1BGXT 3K10A 3I4MJ 5C25B 2GXGA 4I56A 2XB5A 2L54A 3K2AA 1IAPA 2EHOB 3F8NA 3TANA 3HTSB 3GJTB 1YJ9S 3M8JA 2DOEA 2X1GA 3KHGA 2V2VA 2PN6A 4HFEA 1ZAWA 2AEJA 2NQPA 3ANWA 3MEGB 4OAZA 4UOGA 5AQKB 1XIQA 2JX2A 2MZQA 1IXSB 2X67A 1HQUA 2PD1A 4GKKJ 2VHGA 3UN2A 4OHYA 3HKBE 4QPOA 1K1SA 1P6RA 4WP9A 3ZYMA 1BQMA 4CYCA 4H4MA 4UOFA 1WUUA 4CO1A 3G71S 5DUIA 1J27A 5DCMB 3J7A1 3UW1A 3K17A 3CJKA 1L5UA 5EHHA 5FLVA 4D5CA 2E9XC 3EXCX 3FCHA 4BXUA 2WK4A 3JRIA 4RW8A 1HD0A 1TUGB 1NZAA 4PSWA 4OZ5A 4NEZA 2ZBQA 3H42A 1JKQC 4BS2A 1PYTA 1HHTP 1Z2ZA 4A8OA 4DBRA 1UCRA 4AYBA 1G4CA 1SC1B 1OCPA 3MXZA 1A04A 3V81A 1KBRA 1ETVA 4I01A 3BCBA 2GMHA 3ESWB 2ZUGA 2WVBA 3DOKA 2ADBA 1TQPA 3BQLA 4A8FA 3B6AA 1BI3A 3BLYA 3ET6A 1I3QJ 2BJ7A 3ROUA 2UU9F 2I8EA 3PFEA 5DM6Q 4O0NA 1LJ9A 4I0AA 4WIIA 3OXGA 1UWAA 4N76A 3ONQA 2BX6A 5E3OA 3ZZUA 2PEXA 2R0QC 4X4PA 5LHHB 3FNNA 4D3GA 1FVQA 5F8IA 2LSYA 4M72A 4KHZF 4YHHT 1HD1A 3QOPA 1U4BA 3MKYB 2KTQA 1GFWB 4K8RA 4L3NA 3KMSA 4PGGA 4AQFC 3FM3A 3MPYA 1BJAA 2HHUA 4BH9A 1W26A 5FP3A 3J7Yq 2E2IJ 2Y2ZA 1OQYA 2BE7D 4DYQA 1G2EA 2EBGA 2B9SA 5J2MA 3QLHA 4M5NA 1EETA 3MM7B 4JK1X 4NE9C 3O8HA 2W2MP 3WX4A 5AIPA 5EX0A 1YQAA 4MK7A 1IKYA 2PX9A 3UCZP 4TNWA 1HA1A 3GTLJ 1SIZA 4LF9T 2Z58B 5K8NA 1JXLA 5DQHA 3D2WA 4DDFA 4ZN3A 1B72B 2VUGA 5ETMA 1E3HA 2C1EB 2YKMB 2YR2A 1BQXA 2EPIA 5LXYA 2RJZA 1HW9A 2ZE2A 3PTRB 2PDAA 3BBFA 4PXDA 4CQIA 3TDUC 2XAGB 1UURA 3BBBA 1WWXA 2N4DA 2GWRA 3RQWA 3PRVA 2DR7A 2WCAA 2J7UA 2GA2A 3RRHA 1MDMA 4PXEA 4OQJA 2VFTA 3AE6A 2E1MB 5D0GA 2YKNA 2CBJA 2O67A 1VRQC 2RNJA 4ID5B 3CE8A 5HXHA 1UEVA 3CJNA 4TVAB 4XRSA 1J59A 1SD7A 4PW8A 3ZMUB 1J5YA 2EA4A 5JXSA 4DR7J 4C8KA 2CCQA 2EINH 4CCNA 1S59A 2KDOA 3CQCB 3JAMU 4TKTA 2MD0A 3LOUA 1P6TA 2GHVC 4KT5C 3P7IA 4K2EA 5LGNB 1HIYA 2Q6CA 3MUMP 5H20A 1W0AA 4ZS3A 3CJ8A 4GO5X 2DDAA 3BQ2A 2XGQA 2M4GA 2ACYA 4J9RA 2UWMA 4Z2XA 4LFBJ 3GILA 3CUQB 2DMUA 4UUSB 4HLBA 3Q9DA 2A0FB 3RGLA 2DJIA 1USSA 1FNNA 1QQIA 1PBUA 5AQSB 4J90A 5HODA 3WIUA 1ZARA 4UXNB 3QGPA 4C0BA 1KSPA 3K5MA 4F2SA 3DFGA 2W1BA 1J0RA 4XPCA 2WOMB 1K78A 2A07F 3DBHB 2VKJA 2PEBA 1R8HA 1ON2A 3HXMA 2XAFB 2C42A 2DMPA 2E5IA 2GVZA 2W8LA 2AYGA 3IKTA 4CT9A 5K20B 4CI2B 1LEAA 4G6TB 2RHSB 2VKHA 4TN7B 5JREA 5AJ3F 2LKXA 3PEJA 5H6QB 2IS4A 2W24A 2HZTA 2NXNB 4B48A 4AQFA 1K7AA 2DNKA 3EYIA 3AAWB 3Q5EA 3ISPA 1ZEEA 4DFKA 1TQIA 4EGWA 3A01A 2KISA 4PZJA 4JI4T 4UHTA 1RBLA 3R9LA 3V4IB 3CCUI 1TWFJ 1W7WA 4GVLA 2C3YA 2VH7A 3T1YJ 3DPTA 3BG6A 3UUXB 2Q79A 1CHUA 3IWNC 4Z2YA 1JKHB 3Q8QB 4K4WA 2LBFB 1YW8A 2DGOA 2CDQA 2IIHA 3VYTB 2DRBA 2L0KA 5SUHA 3OR1C 1GXQA 2L9WA 4PG6A 4QR0A 2FQ3A 3W6JB 1WWHA 3HOTA 5FDLA 3W9JA 3C15A 3EDPA 2ALZA 3ZMTB 1K8AT 2FHMA 2UXCF 2XAHA 1WC5A 5FVLA 3EM1A 4K5RA 3HI2A 3Q0UA 1HPZA 1A9NB 5F8GA 3OL4A 2NUHA 1WG1A 4JV5J 4B3RF 3J81j 1CF7A 2E71A 2DNGA 3C64A 5DYMA 1GHCA 2R7VA 2PSZA 3BR3A 3RB4A 3HFKA 3JRAA 1X4PA 4DUYJ 2ZBKA 1HF8A 3BPXA 3DQVC 4N8NA 4D0PA 2H7OA 4HTJA 1RTHB 1OMSA 3MMAA 2D9DA 1FE0A 2QSWA 4OI4A 2QEXI 2GAHC 3UD4P 2R8KA 2EC2A 1RBAA 1ETYA 1RAHB 4HA8A 3I6PA 1JLGB 1BOAA 5HAOA 2ZFWA 4UB6C 2K2PA 1B0PA 4U8VA 1BQNB 5JVGQ 2ZJRQ 3L3CA 4B3SJ 4DV7T 3AG4H 3RR8A 4NA2A 4YEAA 1S7EA 2RNGA 4KHRA 4PR6A 4P1WA 1LW0A 4KO0A 2M3AA 2RPAA 4DMWA 5D5VB 1HYSB 4A3KJ 2DGWA 1HNXT 1FCAA 3CCJS 3R7NB 3KKFA 5J2MB 5K5QA 4UIGA 2V69A 2FOKA 1SL0A 3LSRA 3MCOA 4WYWA 1RR7A 1M5PC 1UWBB 5LYJE 1IBCB 3QRQA 4FT8A 1XC5A 2W8KA 2XBPA 1X5SA 2Z33A 5CZVA 4DUTA 3EGNA 2V5CA 4R0JA 3MCNA 2PBIA 2UV1A 1KOOA 3UNYA 2WAUA 1S9HA 1XDSA 2CPJA 2RB7A 3C66A 1WVRA 1P4WA 2ZKTA 2KFNA 3K7RA 4MMOA 2X0LA 1EQ0A 4EU0A 1KGSA 2DT9A 2Y30A 5DZ7A 3K3OA 1IW7F 2L01A 5CPRB 4CSWA 4TU9A 3ZZYA 4KTQA 2Z2LA 4KSEB 3L8RA 3MZ8A 4C3IJ 2QLBB 4U87A 2YKNB 1Q8KA 3IM8A 1SA0E 4UY85 3ZPLA 4YDDB 5L2LA 4OYBA 2B63J 1WC3A 1IR2A 4KYZA 2RQMA 1TTHB 1U1NA 2ASDA 4TWHA 3K57A 5D8LB 1HBOB 3PR5B 1QUVA 5F1RA 4RUHA 2EH3A 2CQCA 4NL5A 4USIA 2CQ2A 4ED3A 3RRCA 1HHSA 2IP2A 2WONA 2CNOB 1QVFR 2RMLA 2M34A 2X0HA 5D0RA 2EZKA 1PVEA 2L9RA 3KCCA 4ETSA 3M6UA 1UUSA 2V6CA 4H63H 5HQMA 2F3JA 2QTWA 1GAOA 2DIVA 5DG8A 3SSRA 2ZM8A 1WOSA 2ODUA 2LKPA 2MY7A 2H4YB 1FF2A 5BS6A 1VS3A 1XB4A 2BZ2A 4A8WA 3ERMA 3FMQA 3M9NB 4QIGA 4X1IE 1SJ1A 4DV7J 4CYUB 4X1EA 1HARA 5EK4A 1N5SA 1SB6A 4DNDA 3BKTA 2KFDA 1R5HA 5IP7J 3U7JA 2OD4A 2Z9OA 4DV1J 1QHGA 1PAEX 3EGZA 3H9JA 1R4MB 4IFVB 2JRMA 3KTQA 1F5CA 3FQKA 2HR3A 2LSIA 4I50E 4KFBB 2QSHX 3G06A 4V1Av 5JLXA 4BGDA 3KLOA 2W1OA 3RQ4A 2HAFA 1MKMA 1NNDA 2Z1DA 3POTA 3OIQA 4FDFA 1Y0HA 1OS5A 4IE4A 1E6VA 2VPLA 1SKUB 4YEJA 1B99A 2YK0A 5FYMA 5EG0A 3CJ3A 3K59A 5SZTA 1I5OB 2OMLA 1NDPA 5BJRA 1RC9A 1UVKA 2ZBPA 3RYRA 3ETMA 4DL5A 4U7UD 2W57A 4YG2F 5HN0A 3UFGA 3KLEB 1OMIA 4EI2A 4NQWA 4I2OA 4XZCA 3H37A 1NK3P 4KP3C 2CQ0A 1GEHA 1UJ8A 2JPBA 4C3JJ 4ZDNA 1HMVA 3RX6A 1OCCH 2VODA 1VI7A 5DDGA 2O61A 3N9LA 1FTCA 1ZM9A 3SFDA 5ABGA 1IN4A 2RQPA 3DLKB 5J1PA 2AX0A 1SVLA 2JVHA 1VQPI 1AZSA 3ZN0A 3IA0A 1JLGA 1MG7A 4CO4A 1T94A 3CJ4A 3IP0A 1BWEA 1RTJB 4CLKA 3V6DA 3MF5A 3HGYA 3UU5A 3ZYKA 1KR4A 4W4MA 1YBTA 2H54B 1NH7A 1HXDA 1HNZF 4EXTA 2WV0A 3E3XA 5C3JA 1RHQB 2MMYA 4BE1A 1K73T 1FFSB 3LH2S 3I32A 4L5JA 3W5YA 2FQ4A 1U9NA 3MM5A 1XDOA 4ETXA 4KBMB 2CQHA 3JSMB 3UN5A 2HQ3A 1Q78A 2UUAT 4OHZA 2KFYA 2PT0A 4WKRA 3K2ZA 4P9UA 1C1BB 3HHGA 3VZIA 3MZIA 5A0YA 5FKLA 2WBRA 4BJ5C 5KXJA 4EWTA 2VL0A 1R27B 3QWLA 3VRAA 3E08A 2GC8A 6AT1B 3HOSA 4UV9A 1EKSA 4Y3OA 3QPHA 4PFPA 2QLWA 3O44A 4JI4J 5JDHA 2WM9A 2VC1A 4C30A 1VC5A 5DJQC 2AP6A 2MQPA 3WU1B 4MIAA 3V6KA 4LFBF 2YU9J 4TU7A 1APSA 3PKYA 1RT5A 3H59A 2KG0A 4I69A 1J5OB 5LCYA 3EVOA 3IV5A 3D6TB 3HJVA 4ZJQA 3F57A 3S3NA 2O7OA 1HBOA 2VBZA 3JQKA 3I59B 2QENA 2W4CA 3NBPB 4ENKA 1IUFA 3HHKA 1TKZB 2WADA 2DA6A 4X4UA 4WFBQ 1I94T 2LDYA 5J4YA 2G0IA 4OMFG 4ZOLE 5KFWA 4LG3A 4JI8T 3L2CA 2ACJA 3CCZA 1S7HA 3DPLC 1RYSA 5L8RC 3JYTA 4P96A 1SAXA 1JNZB 4Z6YA 3IHUA 1WOPA 4Y00A 4YB7A 4LBPA 4UF4A 2FQQB 3PW5A 3HHHA 2STTA 3DRXA 3UU4A 3RKGA 1HDPA 3UDVA 1FDBA 3M8EA 2BJEA 1UVJA 4U0VA 3Q23A 1WJEA 5CABA 5BMVE 3T1HF 1NK5A 1WF1A 2M9HA 5ICFA 1VQ5I 4Y34A 1WR6A 4C2MJ 3Q9SA 3OYDA 4ZLJA 1R0AB 4MNUA 3AAFA 3CCWA 4HEA9 3NRXA 4EOZB 2FOWA 2QE5A 2CQ7A 5E0OA 4IRDA 3IRWP 3KP5A 2HFOA 2ZM0A 1X4FA 4CT8A 3FXDB 1FOYA 2LVSA 4LF7T 3VKGA 3TJ8A 4WPAA 3I0SA 1Z3XA 3HK2A 3H5XA 2DITA 2XROA 4CYUA 2VG7A 3OTOT 3IAM9 3OBIA 3LP0A 1E2XA 1IKWB 1RT4A 2M8HA 2MGZB 3FMBA 1JJHA 3DRSA 3JQMA 5IWAT 2V50A 4YT0A 3CJRA 2ELHA 4UW2A 5JLWA 4K4SA 2XQ6A 2XY7A 1H74A 1WF0A 1FJ7A 3F41A 5KFOA 3TAPA 3CWZB 4KGXB 3LK2B 1N0UA 3CDUA 3O1IA 3TZWA 3SEQA 5IUXA 1O0PA 2E5GA 3RBEA 1PBAA 5FJ8J 3S1TA 2LMIA 3HRUA 1LKXA 3H0PA 1IBLT 4DX6A 2DB1A 3WAKA 3RQIA 1SE7A 5HVGA 3WTYC 2AE9A 4HGAA 1UMQA 5AQMB 2LFBA 4IFYB 1U6BA 4JI1T 3Q0AA 4K5SA 3OYKA 3Q86A 2X6WA 2DCLA 2DT6A 3HDDA 2DNXA 4UQGA 4M5IA 1MJBA 3GSIA 4A5XA 3C19A 3W2VB 3OT9A 1WF2A 3B13A 1JLQA 3CMAI 1QUPA 4FBTA 1R1VA 2C3MA 1YO5C 2Z2MA 2CUYA 4OHWA 4DBQA 3DM2A 3T8RA 2MZJA 2HU9A 4LSNB 3G86A 3RGIA 4ID8A 2R5ZB 1ZZNA 4ED8A 1VMBA 2V1NA 1VRUB 1YD8G 1RPWA 4DR1T 3ZQ7A 3WGIA 3UE2A 3AXJB 4U96A 4LF8F 5CVUA 1RT3A 3DLEA 3EDRB 4MTPA 1MDMB 4H4OA 2E9RX 3K3NA 3HO1A 3LSMA 3FZVA 2C5JA 2FPHX 5DEQA 2VURA 3KBUA 3T19A 3Q2MA 4ASKA 1JT0A 2CPZA 4IHXA 3ISNC 4ID5A 1YITS 4DR3J 1QPIA 2ASJA 1N5YB 2CWOA 2DO0A 1X9WA 2FJXA 3EE3A 4NYOA 1RACB 1M7KA 1ZG5A 5CH7B 1S10A 3ILJA 1YWXA 3KLNA 4EUVA 1R5GA 1RHRB 4HOBA 2W9AA 4HLYA 4L9TA 3QPTA 5LGNA 1HW8A 5IXUA 1SD6A 2WY7Q 2LEBA 4Y7NJ 4NLTA 3LFMA 1WTFA 4AQYJ 3KJNB 3P3DA 3KOAA 3X2QH 4LFBT 1TW2A 3J80K 3BZ6A 4IQMA 2EEYA 3MZKB 2YY3A 3SEZA 1UFKA 2BE2A 4M6XA 5CA5A 1UZCA 2DNZA 3GWHA 3KHRA 3ANWB 5K7HA 3HBLA 4I0WA 3OLBA 4KFCA 3QU3A 3EHZA 3I53A 3TR5A 2MKIA 2RAEA 2W4PA 3J7AO 4XRSG 5HMWA 2F5CA 2YN6A 3GFXA 1VHFA 1Q82T 4QX7B 4YFUA 2NOXA 4USUA 1WORA 3R6LB 6FDRA 3AOAA 5H6RA 4AL5A 3M2RA 5KFIA 1L3UA 3TP0A 1O8BA 3MR3A 2DR9A 2GO8A 2PFBA 3EVMA 2EZIA 2HHSA 3CCEI 3VSLA 4KITB 2XGXA 3FCVA 1B7YB 3HHLC 2ZH7A 1GNKA 1NH3A 1YRNA 4LLNA 3VAJA 2L08A 3V8JA 2XMKA 4LSLA 1JKHA 5D4SA 3NNHA 3L09A 4EV6A 2H8RA 1YJWI 2DKOB 3E22E 4J2CA 1TWCJ 1V3FA 1CJKB 1X3ZB 2LQ5A 2BXJA 2PC6A 4HDVA 4IL4A 1YX2A 4CLWA 2FE3A 2CJ9A 4LF9F 2HHTA 3ZN0B 1EIYB 1TKXB 1R31A 4B3XA 2AQ4A 2XAHB 3N4MA 5EYRA 3ILLA 3MPWA 2RD5C 2E29A 2JPFA 2EC0A 2IM3A 4A0ZA 4RNNA 3E5UA 2COLA 5IZHA 2VKVA 1U6FA 4WIQA 2LKGA 4G8XA 4M6VA 1T8BA 3HVAA 3DXJF 1AHDP 4HTIA 2UP1A 1J09A 3DLLF 4OINF 3CC4S 4DZDA 5JI6A 1YVFA 2V2ZA 5DQIA 3ULHA 3JSPA 2YKPA 2FD2A 3NS5A 3KLVA 4HNTA 3DRRB 5HL7Q 4XOPA 1MLAA 2E1OA 5DD4A 4B3SF 1RRJA 4USHA 3LP0B 4JI0J 1SFKA 4TY8B 2QGUA 5A0YB 3QPSA 2B6AA 3RIRA 2IFXA 1FOXA 3HKZD 4DCJB 2N9DA 2V4JA 1X1PA 4G2AA 3E0JB 2J4GA 2QX0A 3H1CA 1Q1VA 2DISA 1FJGJ 4R8HA 5I3QA 2MLGA 3EUAA 4E7KA 2Q66A 2K4JA 2V94A 1ZHFA 4ZH4F 2OPQB 1T9YA 2LQ9A 3WTTC 4G9YA 1BMQB 3D0GE 2XSBA 2D7SA 1KYZA 1LVFA 1KF6A 3NKZA 1U0JA 2XS2A 5LRRA 2JMKA 4OWRB 4RNMA 2AJ4A 4RUCA 3US5A 1HSTA 1SAUA 3HSJA 3BR6A 5FKKA 2CUJA 2X9WA 1KQGB 2DLRA 2HWTA 4KJIA 4HT5A 3T3FA 3CCMS 1V6HA 2CZ9A 1RR8C 2X7IA 3HKZA 4Y65A 3DM2B 4DYCA 3QUJA 2SPCA 1FXRA 2KXPB 1FRXA 1Q79A 1SCJB 3OBVE 3EZ5A 3CMQA 1WHVA 2AGOA 2YQ1A 4M5JA 4M5DB 2D3OR 1OLTA 4X20E 2ZHOA 3G96A 1SMTA 1G6NA 1APLC 1IJ5A 3QYYA 4A47A 3I58A 1P7IA 5HLHA 3ZMSB 1W7PD 1FBUA 1KLNA 1TK5A 9RUBA 2ZDPA 4MGRA 1UELB 4IIJE 4ITVA 1N33F 4WZQA 1XNQF 4IE6A 1B3TA 2WVDA 2DHGA 5ABFA 5ETVA 3TEHB 2GV1A 2VJIA 3ZCJA 2DNHA 4DV2T 4Y15A 3JTOA 4DF8A 2PJRB 4KQZA 4JEUB 1OXZA 2DEIA 2L4MA 5ILSA 1GMVA 3D66A 3NL0A 2CMPA 1KTVA 4E8UA 2IUBA 2V9WA 2ZC3A 2K1RB 2BS4A 4B09A 1M5HA 2CUZA 2H5IB 3CC2S 2GVDA 4URQU 2VL1A 3M8RA 3T0YA 3RB0A 1R89A 2QRXA 3VGVA 2XF7A 3ZN1A 2Y6XA 1UX5A 2NXEA 2KL4A 4WWCA 2YNIB 1TFWA 5EZYE 1QJHA 4ABZA 5J4VA 1IXRC 4G3IA 3BDPA 4B9MA 4FS2A 4DZJA 4HX7A 5FXXA 5L1JA 4PPDA 4Q45A 4C2TA 5C25A 2RKHA 2BY0A 1ZN2A 1ZYQA 1S0MA 1ZHCA 1JKRC 1A6LA 2XAJB 2MSYA 2PQ8A 5CA1E 4RX6A 3H0DA 2LF8A 3FKJA 2BACA 2H9ZA 1WDDA 1S4FA 3BDDA 2FX0A 4ZI7E 4JI7J 3AE1A 2I9SA 2MXYA 1P9QC 2K9AA 1C1CA 4L0RA 3DKWA 3L2RA 3J7AY 1DLOA 2QM3A 4NLQA 2V2QA 3KDSE 4LRCA 4HPQA 2ILZA 3M1CA 3RKWA 4HI2A 5KT5A 5F8PA 3GFYA 3OYAA 3CD5A 2IRYA 4NHJA 4ZCLA 1JUSA 2M7BA 2O3FA 1M0SA 1Y0UA 5EK2A 1SV5A 5J0ZA 2K06A 2BW2A 2QA4G 2Y75A 4ITSA 3NNAA 2VF3A 2QQAA 3V6HA 1OYDA 3S93A 5F8HA 1LWEB 3ASNH 2CA5A 3QLHB 4II3A 1RUOA 3BTCA 4Y6IA 4GYGA 5HI7A 1D8YA 3IH3A 4DN9A 4HAMA 2DXEA 4DX8H 4OX8A 1OIAA 4LF6T 2ZXIA 4Y2CA 3C46A 5AQUB 4A3IJ 3LBXA 3VKHA 4CLZA 2B4UA 5ERIA 4ICLA 3MECB 2L9DA 1N8RT 4FF2A 4N0BA 1E17A 4KT0C 1SVOA 3M8QB 1NB2A 5FXZA 3BP8A 1T98A 2K3PA 3CD0A 2XAGA 1MWQA 4AYBN 4ZJLA 4JBCA 4XO0A 3BN4A 1XMQF 3FISA 3FKIJ 1UFWA 3CVRA 2CZVC 3DGPB 2G0EA 4QPTA 5KFCA 4LF4T 5LSOA 3TBIA 4OK0A 4LF8J 4TXSA 3ISZA 1VHIA 1XDPA 2VFUA 4ILCA 3CC7I 2AV5A 2ZB9A 5FVKA 4ZA1A 2JSPA 4P7TA 4HACA 3G6YA 2GAGC 2JEIA 2DMTA 1BR4A 3CJ0A 2XMUA 4HEA2 5BYSA 1LKZA 1SQEA 2Z6EA 1S7OA 1HWUA 2XIGA 3BK9A 1AW0A 1U5PA 4ON0A 4CH0S 3JSYA 4OIRF 1SD4A 4UTGA 1IBKF 2V1DA 1XCVA 1ZR2A 1BE4A 1OO0B 4JV0A 1RZMA 2R42A 2NS8A 1UX4A 4OZLA 3G2BA 1TUWA 1X5OA 4L3KA 2Z3YA 2ZOGA 1QHHD 4X4OA 3WODF 1VDHA 4KHMA 1VQ9S 2DK5A 1XK8A 1FRLA 2E1CA 5IOZA 2CXLA 4KIGA 3TWZA 1VRBA 1P1TA 3I96A 3TA1A 4DPTA 4V19X 2M0CA 2P5KA 1T8IA 3WI3A 2JHEA 4RGRA 4X62F 3AEAA 1G8XA 2IDOB 2BXZA 3LA7A 1EZZB 4NX9A 5AXLA 3ZMSA 3EVWA 4TQSA 2V2KA 3PW0A 1X4DA 2PA8D 4LVOP 3K4MA 1D9AA 2YU3A 4CZZA 2ZZTA 4FKXA 2YWWA 4BYYA 3RR7A 2UUAF 2E2HJ 2VXZA 1GVJA 2WBMA 4ISSA 2DFEA 4PK5A 3VVUA 1JB0C 3Q5FA 2FNPA 4P09A 3RYCE 4RBVA 3P4WA 5IPAA 4TWDA 4QYZK 2LY2A 1S1WB 3H5AA 1V5GA 1Z3YA 1JI8A 4P75A 1MJAA 3D54A 3OV8A 2APOA 3BYPA 3Q8UA 1HNZT 3ZZZA 3QYBA 1YI2I 2XHEB 1Y11A 2LE8A 2G1DA 4MFDA 5B0DA 4LBIA 3UQ7A 5DDQC 2P6SA 4CICA 5A2QZ 2AD9A 3JSRA 3T5HA 3G2XA 4A4JA 1WTBA 1JHHA 5H9FK 3Q5XA 2P8TA 4B3ST 3HLUA 5B08A 2PMZA 4H63V 4Q8FA 3CDIA 4D3HA 2MGQA 1QVTA 3FXEB 2JEFA 2RQKA 5D5WB 3SSQA 1SUMB 1K78B 2Z4PA 2KPMA 1KHWA 2WTEA 1NJZA 3DHXA 1CPZA 3KHHA 2J5OA 3V4MA 4WW0A 4O8SA 1UPMB 5J8FA 4OX9J 1JNRA 2YNFA 2ZJ2A 3K4NA 1YHQI 1SC7A 3NZQA 3UN3A 5H6QA 3IBWA 2R92J 5HANA 1W36D 1VQ6S 2VG5B 2Y48A 4L18B 1MMAA 1XMOT 2PFVA 3MPVA 3C3LA 4EBCA 1GV2A 3A8KA 1HNWF 3A1YG 1XS9A 2DT5A 3JREA 2B4VA 4M5GA 3D1QA 1VQNS 3GE9A 3VV2B 1RAEB 4MYTA 2F4OB 5A2QK 3M2UB 1XNRJ 3OYIA 5F9NA 3ZZPA 4Z91A 1STZA 2OLWA 3TAMB 3F6OA 3KYCB 5CQEA 2RDPA 5E8IA 1R22A