3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
5LEKA 4KN4X 1F1ZA 2IW5A 3F8FA 3C3WA 5D4RA 2DBBA 2FEZA 1BIBA 3R4KA 3FMRA 4BQAA 4HDVA 1FWZA 4BH9A 2D2WA 1I1SA 3ABUA 1G3WA 1YS6A 5BOXA 3V7SA 3ZQ7A 3QPTA 3GO5A 2MH2A 1B9NA 1E17A 2A6EF 2Q8KA 2M45A 3OV8A 1AOYA 4P9UA 1BJAA 2EFWA 2LNBA 5K1YA 3P9CA 3FF5A 2FMYA 5E17F 5D5XB 5CVRA 3C7JA 5L3FA 2J5OA 5CVUA 3REOA 1OMIA 1UB9A 1O7FA 5L3EA 2FF4A 1R22A 2BGCA 2DK8A 2M8EA 1Y0UA 4HF2A 4ASNA 2L01A 3KEQA 2HTSA 5DEQA 1WSUA 1FYMA 4MQVA 1QNTA 4HQEA 3FXUA 2HKOA 1K6OA 4G7OF 2F2EA 2DT5A 5LHIA 1XDSA 4NQWA 1RUOA 3JTGA 4UVAA 4A6DA 2IRFG 3WE2A 2G7UA 1P2FA 1SD6A 3I5UA 2EV5A 3Q9VA 1ONVA 5J6XA 3CO7C 4L9NA 3BJ6A 3TQNA 5DUIA 4I0AA 3ZMSA 4ENMA 2PQ8A 2ESNA 3R60A 4YFKF 3G73A 4FX4A 2ETHA 2PFBA 1MD0A 1O3RA 2JTVA 4RAZA 3JSOA 4ZZDA 3WGIA 2J5PA 2UXXA 3E97A 4JBAA 4LG0A 4N9IA 4I7HA 5D8KB 3EETA 3F22A 1BI3A 3KZZA 2NS0A 2Z5UA 2DPDA 4LLNA 3WODF 2Z99A 3QPHA 3LA3A 3BPXA 4HDUA 1BOAA 4IXAA 3MZHA 2ZNYA 4HX8A 5JVTA 1FNNA 1HKTA 1VTNC 1IN8A 3F8BA 3CUQC 1FBQA 4EVIA 3V7RA 3KFWX 2W85A 1ZREA 2UXNA 2V79A 4FX0A 3HHGA 4ENJA 2KKOA 2FXAA 3K1NA 2HGCA 1T2KA 4BXUA 1LB2A 2NNYA 5L3GA 2PBIA 2CW0F 4LGWA 3TOBA 3FXRA 1UFMA 4EQQA 2DQRA 4HW0A 1D3YA 1IF1A 2GA2A 3IHUA 1G3TA 2JSCA 1BBYA 5DCFA 2GQQA 3C18A 1V4RA 2HR3A 2E7WA 4EM0B 3E5XA 5D6EA 2O0YA 3IKVA 4MEXF 4M72A 4D0PA 1S8NA 2QBYA 4OIRF 2OQGA 1RIOH 1EH6A 2ISZA 1HW5A 1ZN2A 2OZ6A 5LRRA 3ZN0A 3C1DA 1PUEE 1O57A 4G6QA 1U2WA 1JE8A 3N97A 1XMKA 4RB1A 5FFZA 4MQ9F 1ZYRF 2K86A 1JXSA 1YW7A 5H6QA 3WTXC 1D8KA 2DAOA 1R1TA 2ZKZA 1BIAA 1E2XA 1I6XA 1FYLA 1FYKA 1OYWA 4U0YA 1Z6TA 2FNPA 1RNLA 4A12A 2ISYA 1XB4A 3O2PE 3GEZA 2GA1A 4BNCA 4O3MA 1FP1D 1B9MA 3ZMUA 3H92A 2A61A 2EV0A 1KU2A 3KLNA 1O3SA 1TNSA 1KYZA 4PDKA 2OU2A 3J80Z 3ISPA 1B6AA 3WGGA 3V8JA 1S6LA 3K1PA 3NQOA 1UCRA 4HV5A 4EM2A 3NEUA 1R36A 3ABTA 3DV8A 2P5LC 1YLFA 1TQMA 2YX4A 2HOEA 1Z6RA 2F5FA 5BPIA 4LLGF 2R7DA 3ZN1A 2P7VB 1ZRDA 5FD5A 2UZKA 1FC3A 2XAJA 2HEOA 3BZ6A 4L5IA 1Z91A 3LQQA 2H6BA 1ZGAA 1O7LA 4PGGA 3F6OA 3KCCA 3R61A 2MLGA 2TDXA 5TRDA 1YG2A 1IXSB 2CG4A 1FY7A 3T8TA 3HSFA 1WQ2A 4KIBA 3HYIA 5L3DA 2ZCWA 3I59A 2X0LA 4WXCA 2DPUA 3HUGA 2IPQX 1J0RA 1XSDA 4HBLA 3FZVA 3B73A 2M87A 1SFXA 4L9TA 2CFXA 2FNAA 2V1UA 1L0OC 1IN5A 3R0JA 4GXOA 4TV7A 4A5MA 3E6CC 3RPQA 3RI4A 4OMYA 4O5VA 4A0XA 3K0LA 4KT5C 3HOTA 4OIQF 5HOOA 1XMAA 5FFXA 2ZFWA 4CYDA 3I58A 1J2XA 3DKWA 1ZAOA 5JR3A 3I4PA 5HS8A 4AIJA 3WTUC 4CO8A 2F5EA 4KDPA 4AIHA 1B4AA 1Z05A 2K7LA 1FX7A 5F6FA 5E8IA 4RGXA 4IRHA 2KRFA 2LKPA 1CGPA 3M7GA 5K5OA 2HQRA 3SZPA 3F8MA 2EFQA 1USTA 1W7PD 4XBFA 3CUQB 4KFCA 4LK0F 1U5TC 3VOEA 2VE9A 1IN7A 1IZ1A 5E1WA 1T39A 4LB5A 3GUDA 2HFHA 2E7XA 3GFJA 2A68F 1F4KA 1W5TA 2AXLA 2QUFA 4ETSA 4G6DA 3TOAA 3IRRA 3L09A 1JHFA 1T98A 2ZXJA 2DLLA 4MHGA 2K27A 5EEHA 5BQTA 1HQCA 2XVCA 1HW1A 4WXDA 3WTWC 3BP8A 5CYVA 5L3BA 5KK1A 1LDJA 2DW4A 2WC2A 3ECOA 3W6JB 4ZYDA 1TNTA 3TO9A 4Y15A 2FE3A 2QVOA 4B09A 3DEUA 2XAGA 3QP6A 1S29A 3B02A 5FLXZ 1FZPB 3GLXA 3EYIA 4WF2A 1OR7A 4EJOA 2GIVA 4UVCA 4L9VA 4HX4A 5DUKA 4G8XA 2VXZA 3IRQA 3VEPA 2D1HA 1SD4A 1ULYA 4M73A 2PEXA 4KNYA 2P4WA 2QBYB 2P8TA 1LDDA 3RTRA 1BC8C 3FMSA 4CGZA 4P96A 4XSZF 1SD7A 2Y0MA 2VC0A 1KQ8A 3SZTA 5HS7A 4P55A 4FT8A 3BWGA 3HSRA 3V7CA 2DTRA 3DXJF 1EV7A 3PQKA 1IN4A 5FGMA 3I64A 3NRVA 1W4MA 3HRTA 1FSEA 3PFIA 1IW7F 4QLCU 3F8NA 4AD9A 2XASA 4Q5SF 1HSTA 3CTAA 2ZMEA 3COAC 3H3ZA 3F72A 2FA5A 4EGYA 4OIOF 2HTJA 3WTYC 4M6YA 5JHUA 3K69A 3ZPLA 4CDGA 3GVAA 3L9FA 5AIQA 4HAMA 2VOPA 1Z9CA 1J59A 5LRSA 3TDUC 5ICGA 1KYWA 2BV6A 4WK8F 2JT1A 2DK5A 4EMSA 3V4GA 2ZMEB 2COMA 4A2UA 2A07F 1X3UA 4I01A 1F5TA 4ESFA 1R5GA 2DFIA 2PMUA 3EDPA 1DPUA 4M9SA 4BAYA 4Y13A 4WX9A 1EH7A 2IJLA 2V9VA 1R5HA 3T8RA 1EH8A 5FB2A 4N9HA 1S7AA 5ICCA 5LHGA 4L18B 4AWXB 1FPQA 4RAYA 2DU9A 4ESJA 3GF2A 4ON0A 2P7CB 1ZH5A 3FMQA 1J9IA 1Q1HA 2GWRA 1YTYA 4JQFA 3J80K 1T0FA 3T0YA 5E20A 2RV8A 2IVMA 2KIUA 2Z33A 4ENNA 1FLIA 4RGRA 5L3CA 4AVPA 2E1NA 5BPDA 5HVQC 2P5VA 2A5YB 1D5VA 3P9KA 1BI2A 5ILUA 1P4WA 3TGNA 2H6CA 3ELKA 4F7ZA 2VBWA 1G3YA 2BYVE 3QAHA 4WCGA 1YS7A 2NYXA 4CZZA 3F6VA 1QGPA 2ZBKA 4KIGA 1HKSA 1YIOA 4WXHA 1U8RA 4Q47A 2Q0OA 5K5RA 5HLIA 5HS9A 4KICA 3JSPA 3GWZA 3MCZA 1ZGJA 4OIPF 4KA4A 2Z3YA 3HTSB 1ON2A 3R0AA 4HZFA 2EV6A 1MGTA 1TQIA 5DDGA 5JFRA 2ACJA 1H0MA 3JAMK 2EFNA 1LEAA 2QQ9A 3HOSA 4AIKA 4S05A 1IRGA 1Z1DA 1ZG3A 2IA2A 3EUHA 5ICFA 1IRFA 2YSRA 2BE5F 4DQ2A 3J81K 2O8XA 5AONA 4EJWA 2RKHA 2AS5F 2VBYA 4UUVA 4MTEA 4Z2YA 4E70A 3CUQA 1G6NA 2WWYA 1U3EM 1WKMA 2JPCA 3LA7A 3ERED 5FO5A 4LB6B 2KJBA 1LEBA 1R00A 1UHMA 3KP3A 1FBSA 1ZHFA 2Y48A 4HLXA 3DQVC 1TTYA 2FOKA 2P5KA 5EEGA 3CUOA 3U2RA 2EK5A 2OA4A 3KETA 2HS5A 1ZRCA 2VT3A 5D8LB 3GW2A 3V8LA 2A3SA 4MNUA 2HYGD 4UV8A 5LGTA 4O6JA 4I98B 4P9FA 3LQRA 1SAXA 4CICA 2O61A 5HLHA 2XAQA 4KUMA 1V3FA 3MWMA 3LAPA 5DD4A 1MJAA 4IHSA 2CGPA 3EYYA 3I53A 3WG9A 4XLNF 4EJUA 2IT0A 3ZMZA 3ML6A 2H09A 5DV5A 3FHZA 1R1UA 1S7OA 2P6SA 1AWCA 3FM3A 2PN6A 2HDCA 5DCMA 2FRHA 4KYWA 2LDUA 1OYYA 1XGOA 3F3XA 4P5OA 3MZYA 1TW3A 3GX4X 2F5CA 2CSOA 4BHPA 3JW4A 2KIFA 2FSWA 4GYIA 2OZUA 3EQLF 3VODA 4U7BA 4L5JA 2CYYA 3CLOA 1GVJA 5JI6A 3O3KA 2YU3A 1OKRA 4IHTA 1JHHA 2LF7A 3L7WA 1XCVA 6PAXA 3ZMVA 1SMTA 5DYMA 4GCVA 1H9TA 1IAWA 4KN7X 4XLPF 4R79A 3I54A 2STTA 2IA0A 2HKXA 4YG2F 4L9JA 2IP2A 3TDZC 5LGUA 1IUYA 5D6FA 2QQAA 1O3QA 2XGXA 3RPUA 1O3TA 3RKXA 2R3SA 1XN7A 4MGRA 3KP4A 2ADUA 1SFEA 2B0LA 1STZA 3LA2A 5AIPA 3WTTC 2EA2A 4ESBA 3SQNA 5F64A 4RGSA 2OAZA 4L0ZB 1RZ4A 5J8CA 2VBXA 2MBFA 4HLYA 1C0WA 1K79A 3DFGA 4PGHA 3M8EA 2NAZA 3PQJA 5ICEA 2W84A 2YX7A 2QM3A 3GZ6A 5IT9K 1YQAA 2VOOA 1RI7A 3MFKA 1MDMA 1ODDA 4LLLA 3U9GA 2VE8A 4PCQA 2KIMA 4I0BA 3AAFA 1I5ZA 2V1XA 2G9WA 4U88A 2X4HA 3H3UA 3N4MA 3I59B 5CLSA 4UHTA 5ILSA 2K4BA 3P9IA 5D5WB 1FOKA 1FBUA 5LGNA 5H20A 3QOPA 4OU0A 2EA4A 2W24A 3BOQA 4YFXF 5HDNA 2XAHA 1BC7C 1FSHA 3KE2A 4M9XA 2L54A 1F9NA 4NHJA 4BYYA 4ZH4F 3OOPA 1HXDA 3J81Z 2PG4A 2Y75A 4M71A 4N0BA 3L2CA 2HWVA 4IF4A 2H94A 3T1BA 1K78A 2NRAC 2YPRA 1B1BA 3VB2A 3W6KB 1WRJA 3IL2A 1GHCA 1KQ9A 3GZ5A 4UNOA 1QO0D 5ED4A 4G9YA 4GYGA 2FQ3A 5DD8A 3HRMA 2FBIA 2HQNA 5ILVA 3RYRA 4HA8A 1BN5A 2WV0A 3I0TA 1ZLJA 3KLOA 1FP2A 3K9TA 1DPRA 1I27A 3HIFA 3RKWA 2MD5A 4DNCA 1QZYA 3E3VA 4MEYF 3KZYA 1YO5C 2MA3A 4WWCA 2FMLA 3HSEA 2E1CA 3GFIA 3P7NA 3KP6A 3GYHX 3QRFF 1BI0A 4Y17A 3E5UA 3KEOA 3RIRA 4BHCA 5CJ9A 3MEXA 3M8FA 2NNNA 2ELHA 4HYEA 1HKQA 2L4MA 1DP7P 1W7PA 1LQ1A 4CHUA 2LSOA 2F5DA 3M1EA 4RGUA 1REPC 3BDDA 3ROUA 4EJTA 2W57A 1U78A 4UV9A 1JGSA 1H9GA 4ENKA 1P6RA 4HQMA 2OBPA 2JRTA 2XRNA 3D0SA 1ZLKA 2M30A 2XKOA 1KU3A 1DUXC 3JTHA 3U1DA 3QU3A 4HOBA 4IPAA 3FXQA 3BPVA 3QU6A 1USSA 3ZP5A 2A69F 3DF8A 1NHAA 2MH9A 5A2QK 4EM1A 4IVNA 2P6TA 3E6BA 2JZYA 3WE3A 4FHTA 3L00A 1TBXA 1WI9A 4NB5A 4PZJA 2EB7A 1HSJA 1Z7UA 1GXPA 2EWNA 3F21A 1HBXG 4ZZLA 4MTDA 1RUNA 3WGHA 1GXQA 1S3JA 1A04A 2XV4S 4K2EA 4YIIA 4S04A 1XGNA 1XGMA 1QQIA 3M9AA 1CF7B 1XSXA 1ZG1A 2GZWA 2DI3A 4U0WA 3G3ZA 3DPLC 4RB0A 1R7JA 3SXYA 4M74A 5CVJA 3IWZA 2FBHA 2W25A 3BJAA 4LG0B 3RKYA 2C6YA 4M9ZA 3TO7A 2GXBA 3KP2A 2VODA 2PLYA 1J5YA 2FU4A 2VN2A 4IRIA 1DDNA 5FD6A 3K1MA 2BBYA 1G4DA 1KGSA 1PP8F 3DP7A 3CJNA 3HRUA 2CO5A 4HF1A 1BI1A 3I71A 1YFHA 1I1GA 1SD5A 4EV0A 1B59A 4LJZF 1OYIA 1LNWA 5HDKA 2QENA 5CVIA 1XGSA 1OPCA 1CF7A 4GO1A 2JPBA 4A6EA 2VT2A 1WWXA 3KP7A 4H0EA 1QPMA 2A6HF 1KQ0A 3K2ZA 2O03A 1K78B 1J75A 1R1VA 1MZBA 2R7FA 4U7DA 2O6GE 2H27A 2RN7A 4L0YB 1SMYF 3TO6A 2QYOA 3WTSC 1YYVA 1LJ9A 4RB3C 2EJRA 4LFUA 1IN6A 2M1BA 4OINF 2Q2EA 1KA8A 1YW9A 3RJPA 4B8XA 2WTEA 2STWA 1XCBA 3IC7A 2XUBA 2XHKA 1HW2A 2BEOA 2DQLA 3WU0A 2YR2A 5LHHA 5E8GA 1PDNC 4G7ZF 4GGGA 1MJBA 1ZARA 1FT9A 3T5XA 4RB2C 4IRGA 3VFZA 3IWFA 1IXRC 2RGVA 2FBKA 1MDMB 2GXGA 5LLQA 1SFUA 1L3LA 3BROA 3SHFA 2PI0A 1KU9A 1U6GA 3GXOA 1U5TA 4XSXF 3ULQB 1LVAA 1BM9A 4KMUX 4R8HA 5E18F 3E5QA 1D8JA 2M5WA 3V8KA 3F23A 5D5VB 2LF8A 2RDPA 3GFMA 1W7PB 3BJOA 3LSTA 2OD5A 3E6DA 1XDUA 3LFKA 5K5QA 3FWEA 2RC4A 4ZYGA 1IXCA 5D4SA 4R1HA 4YFNF 3RYPA 5F1RA 2D1VA 1LDKB 4ZYHA 4KIFA 1T38A 3HRSA 2XIGA 2ZJ2A 4ZYEA 5TJJA 4EGZA 2L3DA 4LK1F 3JAMZ 4HX7A 1ZG5A 4OMZA 1QZZA 2XROA 3E6MA 4I09A 1MJ9A 2L4AA 4I2OA 3J7AO 3Q9SA 4QWQA 5HDGA 1R23A 4HF0A 3GFLA 3HTUA 5LBQA 4G94A 2K4JA 3IKTA 5E1ZB 2V1DA 3O6BB 4OOIA 3WTZA 3D5LA 5D5UB 3ZMTA 1P4AA 5IT3A 5HLGA 2QWWA 4G7HF 3HHHA 1XD7A 4M6XA 1T6SA 2PJPA 3RDIA 5DCMB 5FLXK 4IJAA 2XAFA 2VC1A 3LWFA 5H6RA 4UXNA 2QZ8A 1ZRFA 3Q5FA 2CWEA 5J8FA 4RS8A 4XRFA 2CQKA 4A0ZA 3KP5A 1TQPA 2Z9OA 3FM5A 1QBJA 1MKMA 2ZNZA 1TLHB 2EFPA 2RVCA 5LEJA 3S2WA 4EJVA 4A5NA 2HYFA 2EFOA 5ERIA 2ZO4A 2K02A 1YW8A 2GAUA 4I02A 3QP5A 2QQBA 1KU7A 3F8CA 4BHBA 2IA1A 3CDHA 3MQ0A 2VBZA 2V6CA 2OQRA 2RNJA 4LD5A 4LMYA 2PMHA 2ESHA 2KJCA 3MAJA 5IT9Z 4Q48A 5A2QZ 2O3FA 2D45A 1UHWA 2G7HA 1R58A 1TW2A 1W5SA 3LAJA 3WTVC 2L02A 3ECHA 1J7KA 2MC3A 2MLKA 4JK1X 2QLZA 5BS6A 4Q4ZF 1G3SA 1P92A 4CXFA 4U0VA 5BMZA 2DO7A 4UVBA 5CVVA 2UWMA 1K7AA 2VONA 2HZTA 1PP7U 3ZMDA 3R6SA 3DPTA 4HV6A 1P4XA 2XKPA 3BY6A 4A0YA 5E1XA 5KVRA 3WU1B 4YIFA 3TKYA 1XSVA 3SFZA 1ON1A 3CO6C 3FX3A 1U5TB 4KMFA 2RQPA
chains in the Genus database with same CATH superfamily
2IEKA 3S14J 3I87A 3N79A 1F1ZA 1ZETA 2IW5A 4N77A 5LJ5Y 1SC1B 5GTHC 2K7KA 4WP9A 2VG6B 2HRTA 3OTDA 3N28A 3JADA 1EKRA 1VC5A 4BQAA 3QC9A 3ZFVA 2DXEA 4I68A 1I1SA 2DNHA 3PRBA 1YS6A 3D9BA 3QYYA 2UU9F 4OZLA 3QPTA 3QBCA 2A2FX 3BEGB 4LF6J 5TISC 4FNHA 1X5PA 2EHOB 4YXDA 2QYWA 3OV8A 2EFWA 3AB4B 2A3JA 1S7HA 2YU1A 3UW1A 4JI4J 4JV2A 3FSIA 1GK8A 2FY8A 1OCZH 4M5DB 5D5XB 4OX9F 4N78D 4ERDA 3C7JA 1HR0T 3CCMS 4ISSA 3FSYA 1WR0A 4ID5B 3GZNB 4O3NA 3GIIA 1OMIA 3L2RA 3QYFA 5LMUJ 3CUNA 4EI2A 1D3WA 2XDVA 2KTQA 1IBKT 2VG5A 2YKMB 2LM2A 1DLOA 4U72A 1RTDB 1Y0HA 3OYJA 3TEHB 3UCGA 1GX5A 2ZE2B 1FYMA 3KEQA 4KUMB 1WSUA 1C1CA 3BBCA 4TLQA 5CYMA 4DX6A 1DGRM 4C8MA 4MQVA 1QNTA 2HGMA 4G7OF 3AG2H 2WOMB 5LHIA 1XDSA 3MKDA 2BA9A 2DGUA 2PJRB 3HCXA 2LHNA 4ECSA 4A6DA 1QJHA 2IRFG 4CYUA 1UJ5A 2Y9ZA 5D78A 3AXJB 3Q9VA 4PG8A 2CPDA 5J6XA 4X84A 2R7OA 1CJKB 4Y33A 4CDIA 2BZTA 4AXJA 2RKIB 3C8YA 1T95A 4DV2F 4DX7A 2XQ5A 2Y1RI 2ESNA 3R60A 1YKWA 2FC8A 2G2ZA 4A3KJ 2OSRA 2Y9HA 4ILMA 3ASOH 3G73A 4B3SJ 3WI3A 4DV0T 1OCTC 1N5YA 4I7FA 5KFTA 2M4GA 3R97A 2DNXA 1HNZF 1MD0A 3IBPA 4RAZA 1U1KA 2CQ4A 2KJWA 4DR1J 4TNOA 4RU9A 5F8MA 1HBMA 2B4VA 5B0EA 4DSIA 1TMJA 4C8ZA 5KG1A 3ETUA 1QSDA 1I94F 2W62A 4PWWA 4JI5F 5IFMA 1C0TB 4N9IA 3N6LA 1BI3A 3UFGA 2VKVA 3H5UA 4IOCQ 3OIPA 3CF5F 2DR6A 3WODF 1VQOI 3BQ0A 4ZVQB 3J7YJ 2Y0SN 3GTPJ 2F4FA 4KGZB 1WF0A 3QJLA 1KS2A 1X1AA 2EKNA 3NWIA 4HDUA 2LY2A 1BOAA 4IXAA 2ZNYA 4P0BA 4HT5A 1SJFA 1FTCA 4U2ZA 1YSJA 3M2VA 3TLUA 4X65T 3H9QA 4H9PC 3RRKA 4OI0A 4PAGA 1YKHB 3F8BA 4JYKA 3E2EA 3CCYA 2DT7B 2V2QA 2W85A 1ZREA 5IC4B 2CXEA 4O0IA 2XPKA 4DR3T 3A8JA 1M1KT 4FX0A 3PJRA 4ENJA 1XMXA 1OY6A 5ETVA 2AJFE 5IV3A 5KG6A 2R42A 2D0TA 2GCFA 2Y9YA 3GYGA 3DLKB 4WZXA 2LA6A 2QLFB 2MABA 2K5BB 3KVAA 5DZ6A 3LF0A 2CRGA 4QR1A 2G0IA 3ZT7A 1S57A 3V4IB 3CZ6A 4X1IE 3TOBA 3DFEA 1RXOB 3HOYJ 2NXUA 1WD6A 5KFIA 4EQQA 2DQRA 2JIWA 2NTXA 2AGQA 1IF1A 5E3MA 4PYAA 4FF2A 1A5JA 2JFDA 1Z2LA 3IHUA 1S77D 3K0JA 2V6EA 3CCES 2QLWA 3ZTQA 4O4RA 1V4RA 5ADXL 2KL4A 4RU2A 3MUTP 4GMKA 1VF9A 4CQ1A 5J47A 5D6EA 3H3MA 5LGNB 1YITI 3O8GA 1GV2A 4ZA1A 5K14A 1QZEA 1HNWF 4CZZB 1LKZA 5D0GA 2FUG2 1KQSR 4EWTA 3QQAA 3THPA 3K89A 4D0PA 2QBYA 3NBPB 1MLAA 4KT6A 2DT9A 1RWVB 4RNMA 1YHQS 5HVFA 2OZ6A 5CA0E 2RNEA 4DPOA 3C1DA 2Q6BA 3T41A 1O57A 1U2WA 4IRCA 4F2RA 3HZJA 2XWXA 4RB1A 1G6BA 3ZSSA 1RYSA 5AXKA 1C4CA 3A01A 3LP0B 1ICEB 3G4SI 3EGWB 2R7QA 5H6QA 3WTXC 2V1NA 1FJEB 3NGKA 1D8KA 3VKHA 2N4CA 4DL7A 1AW0A 2XSJB 2WSEC 4UUSB 2LG4A 4XO0A 1FYKA 1VQ7I 3U02A 4UY8T 2VFVA 4PZVA 5KT7A 5F04A 3CJTB 2FNPA 1PGZA 3BLYA 3PM9A 3CXCR 4DJAA 2M5YA 1XTZA 2ISYA 4DMVA 1S1TA 4LF4J 1MIVA 5KG0A 2HQCA 3OSNA 3GCWP 1B9MA 1M5PC 1LW0B 3W9IA 5BYRA 2YNIA 3H92A 2C2RA 5B0GA 2KISA 4OJGA 3VWBA 1U1PA 4PDKA 2OU2A 3GV7B 2COLA 3A13A 1S6LA 3P5TL 1H74A 5A0YB 3NQOA 1F0XA 2D9DA 2ZMEC 2VQFF 3DRPB 2I8EA 4PWDA 1B64A 2YWHA 4FXDA 1T02A 1P6TA 3LOCA 2W2QP 2NUUG 3KJFB 3ABTA 4LR8A 4HDGA 1U2CA 5C25A 1RT5A 5AJ3J 1L3KA 3FISA 1IJ6A 1F3VA 2YX4A 1OY9A 2YN6A 1Z0PA 2AQEA 4ED7A 2NXCA 2P7VB 4BBSJ 2X0HA 2F5GA 1X4FA 2UZKA 4WU3A 2YWEA 5H2FC 1ZHCA 4LF1A 4CLYA 2L5QA 3K4NA 1Z91A 1GTHA 2WADA 4QYZJ 2XO6A 1ZGAA 3AT1B 2XGPA 2WDRA 1R0CB 2RJZA 1V5VA 3GTJJ 2UUBT 4UR9A 1QLNA 3AE4A 4UOFA 4B02A 4DUYT 1YITS 5KG2A 5KFCA 3VRBA 3C4XA 2F4VJ 2CQIA 2X9WA 2IAJA 5TRDA 4KV8B 4CT8A 1U1OA 3KLIA 5JDNA 2VL8A 5BJRA 4DN0A 5LMNF 3SYZA 1R89A 3HSFA 1WQ2A 4JI7F 2WBMA 4KIBA 1IBMJ 4NI2A 4QIFA 1T0FC 1J5OA 4JBWF 3GJSB 1YHQI 2WS3A 3JYTA 3PVXA 3N9OA 4UT4A 2J9DE 2IBOA 3L3CA 1PBUA 4OYMA 1HWIA 3WHBA 4O4IE 2IPQX 1XSDA 4C3MA 4HBLA 1VQ4I 2V50A 2PC6A 1H8AC 3FBFA 3H2UB 1SXLA 2YOEA 3UU5A 2XJ7A 2E1OA 4OYJA 3JCUC 3PNTA 4DL5A 1X1CA 1SH3A 4GXOA 2Y8YA 3DMJB 2LKSA 2IAIA 3RI4A 3CGIA 4OMYA 3J7YU 4F67A 3G6YA 1FTRA 4KT5C 4RBOA 3HT0A 3DRXA 2W8LA 3F31A 4OAZA 1FK9B 2KXHA 2WONB 4ES2A 4NWBA 4MKYA 3HHLD 3Q8QB 4WK3A 3BQLA 1N52B 5L3DB 1KBRA 1L3TA 2WZ1A 4PK5A 5EWGA 4WYLA 3H25A 4ZIWA 1SFKA 5FY7A 2J8AA 1UAWA 1WC0A 5JR3A 1SC4B 1M0SA 1UFKA 1JLQA 3WTUC 2VPYB 5BXIA 4CO8A 3OR1B 1I51B 4EOZB 4QQBA 2GO9A 3ZZTA 2YDRA 3CQCB 2K7LA 2OA5A 2YNHA 2RHQB 5E8IA 1WLXA 4O23A 5GAEI 3MFIA 3L8RA 2L7FP 2LKPA 3MKLA 2ROPA 1I3QJ 3M7GA 1ZGWA 3LSHA 4DR5J 3SZPA 2IJRA 2I5JB 2HBYB 2F3JA 3CESA 4FISA 1CULB 3CUQB 3IWXA 1NJYA 1NDKA 1MMDA 1A9NB 2YDSA 2DMPA 1LFPA 1G8XA 2IGMA 4LK0F 1HG5A 4QIWN 3VOEA 2BABA 1IN7A 3LGNA 2VQLA 1CULA 5E1WA 2KB2A 3GYXB 2W7AA 4LB5A 4WE1B 3MMBB 4KX6A 3GE9A 3HZEA 2GOMA 3IGNA 3MCSA 4DYCA 4X64J 3DXSX 4B3RF 3RBXA 4HN9A 1W36C 1UEKA 5KFGA 2RPAA 3WC0A 2O01C 2XZWA 1IKVA 3W62A 5A76A 1RAHB 4PSXA 4DV7T 3JRBA 4IFVB 4ETSA 1W36D 3PU3A 1I3OB 2F8MA 1ZV4X 2M67A 2FUG9 2PT0A 5FKMA 1LK5A 2K9MA 3IRRA 1BOBA 4CLZA 2VJ5A 4IQMA 2CMRA 2CWKA 4TUYE 1K1QA 5BQTA 4YP3A 4UOCA 1HW1A 2ZSIB 2QRXA 3BP8A 2O7OA 5CYVA 3WIUA 5KK1A 2POKA 5FXXA 1I94J 3X1LB 3ECOA 4ZYDA 1TNTA 4OYAA 2ZH4A 4EGWA 4MJKA 1ROFA 2FLPA 3PJWA 4B09A 3OTOJ 2XAGA 4C97A 1S29A 3B02A 1SUMB 4B9MA 5FLXZ 5CYQA 2QFJA 2HXIA 2IIHA 4EBEA 1OR7A 1EARA 1H7CA 3DLEB 4XN3A 3AE9A 4HX4A 2VXDA 2IVFB 3PKYA 3Q23A 4ZEYA 1RT3A 2JMHA 5DUKA 2IS6A 4G8XA 4F3OA 2W4SA 5J1UA 4AL5A 3HG9A 3IRQA 1E3OC 3MEDB 2DGXA 4A47A 2MW8A 1SD4A 3E3XA 1ULYA 2PEXA 4ZVTB 1FRJA 5HP1A 2IBKA 1OMSA 3R3TA 3NARA 3RHWA 5IZHA 3FXEB 1G7CB 3QMQA 1FKOB 5DG7A 3UU4A 4X62J 2JFKA 4NI2B 2CBIA 5AQNB 2CA9A 1WZ2A 2HVIA 3CO0P 2BHYA 1FDAA 3PDYA 3MUMP 1D0ZA 2RDIA 4CT9A 4V1Av 2E66A 3HKZA 2DTRA 3V7CA 1HPZA 2V8GA 4QH4A 1IN4A 4NZ0A 1LQ9A 1FIAA 1OSCA 3FMWA 4I99C 4CIOA 2ACZA 3BQYA 3HRTA 3PFIA 1OEDB 1IW7F 3OOUA 3VYSB 2BHZA 3QJPA 1K61A 4M3BA 3SS1A 3JTNA 3CCUS 1N32F 3MWBA 2XAJB 2E2IJ 4LG3A 2ZMEA 3UD4P 2P9EA 4KGKA 4Q2MA 1JTYA 3COAC 3CMES 4ID8A 4ANEA 4I43B 3UUXB 4OAYA 5K9FA 2WU2A 3LK42 4IGUA 2W8KA 4ED5A 1EAYC 4HEA9 3D6TB 1LFBA 4J9OA 1YK9A 3GVAA 3L9FA 3MZ8A 3IR5B 3UUMA 3O44A 3BG6A 3W64A 2IMWP 1IGNA 3D1NI 4OL8A 5KFVA 4TX5A 4EUVA 1SJ1A 3I1AA 1ZM3A 2JJ9A 2EIKH 5LRSA 1F43A 2J7UA 3OL3A 3TDUC 1YKEB 3JRGA 1XEZA 2XAUA 3CQXC 2DFIA 4RW8A 4DZ6A 2BE2B 2AJ4A 3N9UC 2WB1A 5J1EA 1HA8A 2OPSB 3BREA 4WX9A 1QSSA 1K44A 1R5HA 1LFUP 3T8RA 1EH8A 3QRQA 1FDBA 5J2NA 1S7AA 2Y1JA 5ICCA 5LHGA 3PO4A 4AWXB 2DU9A 5FLVA 4ESJA 4ON0A 5AQJB 2GV1A 5CQGA 2EBIA 4H9QC 3G6EI 4ZP6A 3C6TB 4DV4J 1Q1HA 1UVMA 5IQ6A 1TWHJ 5M4YA 3QWPA 2XMAA 4ED1A 1D9DA 4U2YA 1RTJA 2C28A 4X4PA 4JQFA 1T0FA 4WP8A 1S48A 2LR8A 4LIUA 5K7ZA 4EYUA 2PE8A 3A01B 1JLAA 2Z33A 3H40A 3BCAA 4CO2A 2BACA 3WIVA 4A69C 1UX5A 4AVPA 1FMVA 2HU9A 2RILA 3TNVA 3BDPA 2C22A 2Y2ZA 4ZPBA 4IEJA 5ILUA 1P4WA 1RBLA 1JLAB 3QAHA 4WCGA 1JXEA 5LB7B 2G0JA 4CZZA 3CVKA 5EGYA 2H9ZA 3PL8A 3EUAA 1RTJB 4KIGA 3CCMI 3RI5A 1HQEB 3BTJA 3I82A 3D6HB 2GZOA 5D3GB 2QIFA 3DLJA 1VC6A 2OPPB 1YRNB 2Q0OA 5K5RA 3TAMA 4YEAA 2FJ1A 2HNZA 3GP9A 3P8BB 1ZS6A 4JI4F 1U8WA 5J1EB 1VIXA 4WIQA 3HTSB 2W2MP 5CPRB 4CI1B 1MGTA 3HZGA 3M6UA 2BYCA 2ACJA 1H0MA 1Q78A 3DGPB 3JAMK 2EFNA 2VB6A 2UXNB 5GAHI 4MFBB 2HHVA 3NWSA 2ADBA 5C2TA 3JSRA 4TU8A 3HKWA 3I3LA 3SDEB 3G71S 4Y2CA 2IA2A 3HEFA 4XTTA 4XIDA 1LUJB 2YSRA 5ETKA 2BE5F 3KPHA 2C3YA 4KGMA 3ZQGA 4ZI7E 3VGTA 4YR3A 4I64A 3J81K 2WB4A 2CEAA 3RQUA 2WSCC 2QL9B 4E70A 1FXLA 1G6NA 3BR9A 1WKMA 2B43A 3D66A 1V3RA 3PUQA 5FO5A 1R8IA 2OD6A 3SOLA 2BJ3A 4QHOA 3GILA 1C0TA 1Q53A 3PIPF 2FOWA 1LEBA 1OJ4A 2J9CA 2WDQA 2DHRA 1FBSA 2Y48A 2UP1A 2UV8G 3DQVC 2MKCA 4F93B 1WFDA 2DEJA 3I9YA 3HVWA 3TLTA 2BY1A 4CQIA 5KFRA 1HPZB 2LBFA 1YOVB 3MUVP 3NMAA 3DOMA 4I7FB 2R6GF 1YJWI 3O2IA 4NA3A 2ID6A 4TYBA 1WACA 2EK5A 2HH7A 4P2XA 2XY6A 3NXZA 2JLGA 2YVSA 2VT3A 3GTLJ 2OTLI 1RT4B 5JDMA 4YOEA 1CC7A 3GW2A 3V8LA 2A3SA 2ICWG 4CYUB 2OFHX 2FVCA 4U6PA 5HQ8A 5LGTA 4CO4A 4FPRA 1X8DA 5KFNA 3E0ZA 4P9FA 3LQRA 2WOMA 4NLGA 2EW9A 3LOUA 3C16A 2XAQA 1W7WA 3IS9A 4GK5E 3FK6A 4KUMA 1NJZA 3PRDA 5F9NA 1WTFA 2XI2A 2W2UA 2WZIA 2LY9A 4HFHA 3LAPA 1RTDA 4MBQA 1EKEA 1DLOB 2RIJA 4LF8F 1N32T 2Q9QD 2CGPA 4EBDA 3HFZB 2VQCA 1WJFA 2L9SA 5CYQB 2NSCA 4ID5A 4UQGA 2XAGB 3FCVA 3ZMZA 4ILUA 2TRTA 2X0LB 2MFZA 5RUBA 3EGZA 3NZQA 2LKGA 1N78A 5DV5A 3IG1B 1RWOB 4RNOA 3IRXA 1R8CA 1R1UA 4A3JJ 1WI8A 4MTPA 2OTJI 4UXNB 3PTRB 4DNDA 2MKSA 4RUCA 5I42B 3FM3A 3ZQQA 2HDCA 2DIUA 2PA8D 5DCMA 2FRHA 1SKRA 3BTLA 2BOLA 5IM0A 3MHYA 2ZH9A 1XGOA 2L9DA 3GTQJ 2LQ9A 1S49A 3LP2A 3OR2B 4B08A 3P4SA 3I0RB 3Q22A 1NSAA 3BQKA 3N9QA 4MAKA 3BCBA 1YE9A 3G1LA 1BLUA 3LPYA 4TU7A 3BZCA 4JLEA 4GYIA 1TKZA 4X4VA 3OTOF 1UVNA 3W66A 2DI4A 4U7BA 3F2EA 5FXZA 1UL3A 2AJ1A 4WE1A 1T9TA 1M90T 2J6UA 4NLUA 1HIYA 4A8YA 3D6FB 1MWQA 1WKKA 1FWLA 2RU9A 1FJCA 3G82A 3BG9A 1IBMT 3A02A 5ABFB 4R5PA 2WHOA 4ZLLA 3RB4A 1TK5A 1X58A 3CD6S 5AQVB 3P4UB 1SIWB 1S76D 1UFWA 5DDOC 3BO4A 2WU5A 3ZJ2A 1SMTA 2ROGA 2ZKTA 4A3CJ 1ZA1B 2KL8A 3M3ZB 2G1HA 4DCPB 3WBZA 2WA0A 2KDZA 1KRPA 2IA0A 3LQVA 1V5FA 2ECCA 3TDZC 5LGUA 1XNRT 1OWAA 5D6FA 2QQAA 3QLHB 3PNVA 2YNHB 4U9RA 4ILRA 2XGXA 1WF1A 2CNKB 5JVGQ 3RKXA 4IG3B 1PILA 3N2KE 4DV4F 3KK2A 3KP4A 1YG0A 3V81B 1SFEA 4FASD 3Q3SA 2AWZA 2NZCA 5L46A 2EA2A 2DD8S 3VYUB 2B9SA 2VUMJ 2OAZA 5HNFA 4Q7AA 4L0ZB 2VBXA 3BDEA 4G65A 1P7JA 1C0WA 3ANWA 2K48A 2GMLA 1K79A 3JR9A 2R9LA 4Z7YA 3OYEA 2MPKA 2R4FA 3Q5WA 1NK4A 3FKIJ 4FVCA 2NAZA 3GB0A 3PFOA 1S9GA 3FCHA 2X6YA 3PKMA 1FJGT 5ICEA 2OJED 2CQ2A 1P7IA 5J2PA 2V8VA 5FKYA 2DRDA 3K1SA 4CXXA 5ETOA 1IV6A 2ASLA 3D28A 3KV9A 5HXHA 2MY7A 2G4BA 3E0JB 4DR2T 2IBDA 1JWWA 4YHJA 2VOOA 3CX6B 2CUJA 3OYMA 1MMGA 3MFKA 1ODDA 3E8OA 4DCJB 3LMMA 4F25A 2DT6A 2K3IA 2WRMA 5F8IA 2IHR1 4OZ1A 1F5BA 1JLGB 4ECXA 1R9TJ 5KFPA 1HI0P 2VQEJ 3D5SC 5J2MB 1QAIA 4USHA 3QRRA 3MCMA 1OY8A 4DIDB 1PJRA 5CLSA 2P9CA 4NLOA 2HMIB 4DR5T 3RQIA 1FOKA 4BJTA 1CC8A 2OKQA 1QSYA 2HRYA 3QPSA 2XAFB 2W24A 2HHXA 2LEAA 2V2ZA 3KLIB 4KV8A 4A97A 1BC7C 3WU2C 4DR7T 2L54A 1F9NA 4D5FA 3H35A 3BR5A 3OFHA 2D0UA 5M5YJ 4IL6C 2I0MA 1H0HB 5DRKA 2BANB 3J81Z 3PUYF 2CNLB 4M71A 2FHJD 5L3GB 4BE2A 1X9SA 4OJ1A 1Z4UA 1NSQA 1VQ7S 1SC3B 2MKHA 3MEEA 4IOCF 3TQ1A 2FJBB 1HOMA 5L9NA 3M9OB 2EVZA 3SCJE 2VF3A 3W6KB 3GTGJ 4Z37A 1WRJA 3C46A 5HI7A 4A4JA 3AEBA 4QTRA 3TUPA 2JQ7A 3S93A 2H1KA 1EQMA 2ABYA 3D1OA 3W2VB 3OW2R 3I5BA 5JDGA 4CCLA 2DOFA 2EHOD 3EGNA 5ILVA 4CLTA 2WV0A 5M3FJ 4GYRA 3PDNA 4B1RA 3HX9A 1F36A 1FP2A 3L95X 1FO1A 3HIFA 4J5OA 3GIKA 2CU7A 2ZH2A 2V5HG 2MD5A 3K17A 1QZYA 4HWDA 3GR1A 1VQNS 4ZIVA 3GIMA 1Y9OA 2DA5A 1LEOA 2AYGA 2MA3A 4WWCA 4C8YA 4G1PA 3ZMUB 1WHVA 5KT3A 1V9OA 5TAOA 2IJFA 3OIQA 3QRFF 4FYWB 2Z6EA 1BI0A 2DOAA 1VCTA 1M1GA 4NX9A 5CJ9A 1S6QA 2KMUA 4NLXA 4NPOA 4BA9A 1OLTA 3M8FA 5AQOB 3ZYMA 2V7IA 1SBRA 1VI7A 1HWJA 3HGGA 1PYVA 1TWGJ 2L4MA 1FFSB 1RU1A 1X2NA 5ETPA 2DNYA 2OAUA 3R1HA 1KN6A 4C8KA 4XLCA 5BNGA 2B1EA 2LSOA 3I31A 3PNIA 3M1EA 4TV9E 1T7SA 2OMOA 4H9OC 4IHVA 1REPC 2AYEA 4I69A 1WYCA 2IRYA 1U78A 4JI6T 1VQ6I 2M6IA 4O4HE 4IO1A 3LSMA 2L7ZA 3H8YA 4HQMA 2Z2SB 2R8GA 2XRNA 4I0WA 1ZLKA 3MXZA 4ZVEA 2V8HA 3G96A 5J2QB 3O1IA 4ZLNA 3P49B 2ZBRA 1A6IA 2XKOA 2WW8A 2CXFA 3QGGA 3VAMA 3MM5A 3FXQA 3OYIA 2HVEA 2QKLB 5KXJA 1NZ8A 3NS6A 1LRZA 1D5YA 4GFBA 5A2QK 1BR4A 4EM1A 3HL6A 3H59A 3HKBE 2N9DA 3M1CA 2DO4A 4IVNA 3OKQA 1S1XA 4L0RA 1NKBA 2QL7B 3K59A 2FPHX 2DNZA 3V2UC 4BACA 5KFEA 2J62A 3VSKA 3GQCA 3V4IA 2X1BA 2HVSA 2H5JB 4XPEA 4PZJA 3DLKA 2EB7A 2HNHA 4OZ0A 4DV6T 1Z7UA 1N5SA 4A8SA 5JH7E 2HQFA 2BDEA 5L4HA 2DCFA 4P7VA 3QNUA 1HL6A 3TR5A 4PEOA 2R8HA 1ETQA 2J7KA 4HACA 2B76A 3UQSA 2CG8A 4YIIA 1Y0NA 2VKOA 5LMUF 5JXSA 2X48A 5CQEA 2HIQA 3NGUA 4EO6A 4LIRA 5FLXY 2E9ZA 2OSQA 1GLNA 4U0WA 3DPLC 2ELKA 1HS7A 4DXLA 1F3FA 1KTVA 5HWXA 1Z8UA 2GQCA 2ZC4A 2RU3A 3SXYA 2K8GA 1H7XA 2IDLA 2R8JA 4PJJA 2F65A 5HVGA 2GMJA 3SXLA 2MGZA 3K4CA 3PJ9A 2R93J 4Z90A 4Y2IA 3TWZA 3HVAA 3BJAA 4C11A 3H36A 4IR1A 3KP2A 3R5AA 1REVB 2K9AA 2IM2A 2PLYA 2QA2A 4X4UA 2VN2A 3MEKA 4J9KA 4NUVA 2HZVA 3Q0WA 2R7TA 5D4PA 2BBYA 1NDLA 1REVA 2E9XD 2FD5A 2DA4A 2CJYB 4QH1A 2F6CA 3DP7A 4CLFA 4I2QB 2LOSA 1HNWJ 2CO5A 1BI1A 2A6TA 1YFHA 3MKZA 1I1GA 2MDAA 5KOWA 3MZIA 1B59A 3ZMSB 1Y5NB 2QCOA 2WV1A 3LANA 5L2LA 1IKYB 3GJQB 3CDBA 2LT3A 3N9PA 1NH8A 2WAEA 3UQ7A 4JI5J 1YJRA 1OPCA 2UUAT 1DU2A 1VQYA 1BGXT 1N36T 4USJC 1RETA 2MXYA 3J81U 1TMMA 1VQLS 3NEKA 4WFXA 5EK4A 1RLCL 2R5ZA 2VT2A 3OYHA 1WWXA 2HURA 3K5OA 3LUYA 2A6HF 4HACB 1E6YB 1KQ0A 1PC4A 4FYVB 1K0VA 4F4XA 4DLEA 5CYMB 3K2ZA 2ZE2A 2HI3A 5D15A 5IT0A 1IKWA 2FJBA 2Y0SA 4RBUA 5DLFA 2W4DA 4MFDA 4LMJA 5LYJE 1E7PA 3K5LA 2H27A 4FE4A 3QATA 5FYMA 2HVDA 3BBFA 2EFVA 1DU0A 3WTSC 3ZT5A 2YWGA 5GMKa 1LJ9A 1D1BA 2EJRA 1IAPA 1S1XB 2ATLA 3IM9A 3RJPA 3TZZA 1TP7A 3MD3A 5HLFB 2STWA 1FX2A 4CNYA 4HR2A 3IC7A 1PYOB 2QVAA 4NEYA 2XUBA 2ZOGA 1WHWA 2YKPA 2DQLA 2X0YA 3H2LA 3C14B 3RAQA 1IQZA 1PDNC 5AQIB 5FRMA 3MR7A 3BB5A 2V2KA 1FT9A 2BBHA 3NKYA 2ZUGA 4V19K 3ZMTB 4XKWA 1JLGA 4UELA 5IQQA 1IXRC 1Z2ZA 2LSYA 1Q4RA 4NLTA 2VFTA 4L6V3 3KUHA 2IDEA 3ZZ0A 4AXIA 3QO9B 3UU8A 2DJIA 2RNGA 2XMKA 2CPJA 2IW5B 2IRUA 1SFUA 2W9BB 3GCXP 2DWGA 3MCOA 3OSPA 1V55H 2DXIA 1RACB 1KU9A 2LOPA 2CPEA 4XSXF 3PJAJ 2H5IB 3MAHA 1FRIA 1BM9A 4R8HA 3PUVF 3E5QA 3BKFA 2IA6A 3S2HJ 1N56A 2P2CB 3A8YC 4P09A 3F23A 5D0HA 1LW2B 4XOTA 1I6ZA 2BBJA 2LJLA 1IJEB 4OHVA 1Z0XA 1UZHA 4A3MJ 3A7MA 3SSSA 3MAAA 5JDHA 4PUOB 2OD5A 5IT9Y 1XMOT 3E6DA 1F9FA 1MIYA 3LFKA 3AJDA 4R8UA 2DMTA 2OLTA 4ZYGA 2KJVA 2HFVA 4B9LA 1S6QB 2EPFA 4URGA 3HOXJ 3OL4A 2G13A 5JDQA 3BTIA 5FKKA 3JXOA 3ETVA 4B44A 2CADA 1K6YA 4ATNA 4ZN3A 4QU6A 4ZYHA 2FLLA 5ADZA 4DX8H 1H3DA 4J9LA 2RS8A 3OVSA 1VRTA 2ZVIA 1B99A 4ZYEA 4OHFA 2E5LT 2LU1A 2K24A 1LXJA 2RDJA 1B0PA 3MAAB 4PUOA 4ZI3C 1T05A 4DS5A 1ZG5A 4QYZK 4OMZA 1IDYA 1K4TA 2L4AA 1MSEC 1P27B 1Y11A 2WVBA 2CQPA 1FFWB 2H88A 3QYBA 4LBHA 5F3JA 1VQMS 1O0PA 1U1MA 3Q9SA 1MSWD 4NLDA 4HF0A 1TP4A 3HTUA 6AT1B 4G94A 5FJ4A 5C42B 4OOIA 3UFCX 1RAOA 1VLYA 3T8OA 4B3SF 3OSFA 3MEEB 4QZVB 4BY7J 2C2KB 3ZMTA 3TEDA 2EQRA 3BV8A 5KOXA 2BS2A 5IT3A 3JRDA 3VU7H 5HLGA 3GFYA 1UGOA 3I0RA 4WTOB 1KFSA 4E2FB 1N33T 3HHHA 4PQUB 1XD7A 2M7AA 3QB5K 4M1KA 5IM0B 2YPYA 3CJRA 2ZH5A 2CJ9A 3ZGKA 2NS1B 2V4JC 2DFEA 5LMNT 2XAFA 5H6RA 4M3EA 4UXNA 2JQHA 4F4WA 1C0UA 2W2OP 5J8FA 4DFJA 4PQUA 3QGPA 4O4LE 1FKAF 2RA1A 3MMCA 3OXGA 3O8WA 2KFZA 2Z9OA 3PY8A 1XC5A 1QAXA 2RAQA 3EPZA 4K5RA 1MSFC 4NCGA 2UXCT 1RR7A 2EFPA 2RVCA 4UZCA 4Y65A 5D77A 1X4EA 2C2MB 2LQ8A 2WAFA 3CKDA 4EJVA 3KJQB 1KHVA 2HYFA 4BC9A 3PR5B 2BV3A 4AQGA 1ZPWX 3AOAA 5ERIA 2DXDA 1S9HA 3RRWA 2E44A 2R5ZB 1FOWA 4U74A 2ZO4A 4JUYA 1YW8A 4V1Ak 1NK9A 3QP5A 2PMZN 1S9GB 3CDHA 1IWGA 4Q43A 2DNPA 1XBWA 1IKYA 2RNJA 1TL7B 4LMYA 1BL0A 1UVJA 2PMHA 1SIZA 2K3FA 4ILCA 2MJUA 4Q0BB 5IT9Z 5IOZA 4Q48A 3EABA 1R58A 4F4KA 1W5SA 3AEFA 3EUKL 2KP6A 3LAJA 4M5NA 4I2QA 3ECHA 4ETXA 3C19A 3UR0A 5BS6A 4PUSA 4BE1A 4IDZA 1N48A 1P92A 4CXFA 4EO8A 1LWCB 4ELTA 5BMZA 4IHXA 2FUPA 1IR2A 4P0AA 2ZMAA 2Y48B 2VONA 3IH2A 1V5IB 3ZMDA 3R6SA 1LWEA 2FJDA 3CDWA 3JTPA 4C11B 1FTTA 3BGUA 2FGOA 2DRAA 4HV6A 1WOPA 3Q8UA 2A2DA 6FD1A 3P5BP 4A0YA 3B5MA 4ZS6A 1P8GA 1G59A 2CDQA 3G1OA 4CM0A 1Y3KA 1U5TB 5HEOA 2VPLA 2HSEB 1T56A 4KN4X 5B1BH 3KLEA 3G06A 2W9BA 2VLAA 4HHHA 4FF1A 3JAFA 3C3WA 2ME0A 5D4RA 2JUCA 1OFCX 2F4OB 1QAJA 2FEZA 3HL2A 4MFBA 3K10A 2XYPB 3KK1B 3ASNH 3HO1A 1FWZA 2VJ4A 2D2WA 2VJJA 2BJDA 2GX8A 4QH5A 3DBRB 3RPUD 1FKPA 4USUA 4KHPF 3LP2B 4HNTA 2YDQA 2MH2A 1PJ7A 2HHHJ 3UI3A 2AO9A 3J81j 2VKEA 1RAGB 3A0HC 4M6VA 1AOYA 1SCJB 2D74B 2GGPB 1XQIA 1IBKJ 3I9WA 1MN9A 2DKOB 2HNZB 3P9CA 3BN4A 2FMYA 1JXLA 2L9NA 1YRNA 2CQGA 3LA0A 3NGTA 3CCEI 2CV2A 5L3FA 2OPPA 2J5OA 2BW2A 4ZDNA 3ZMZB 4TVAB 3REOA 3R1LA 1YDLA 2VQEF 2E1MC 4DR4J 1MNDA 2PFFB 2V94A 3WHIA 3KOAA 3C15B 1UJ6A 2DK8A 3HI2A 3TMOA 3AD7C 2MC4A 1XN9A 1Y0UA 1IKWB 4HF2A 2CRLA 2RDDA 2NS8A 4HWFA 4ASNA 3S01A 2L01A 5DEQA 4Y52J 3C16B 2QA4S 3VCDA 3FBCA 1E6YA 2AKWB 3OVBA 1K6OA 1VRUB 2F2EA 2HLTA 3DLLQ 4LF9T 2XGQA 2RQCA 4NQWA 2UUAJ 3JTGA 5LGTB 4UVAA 1RAFB 1AHDP 5BYQA 3J7Yq 4OI6A 1P2FA 3ILJA 3G2XA 1NPPA 2WY2A 4YY3T 1S5ZA 3CO7C 2HGNA 4EATA 3BJ6A 5A2QU 3CF5Q 4D9JA 5DUIA 3ZMSA 5E3RA 2ZJRF 4ENMA 2PQ8A 1SQFA 4YFKF 2HFOA 2VI6A 3M6WA 1N77A 1YI2S 4ZITA 2ZLYA 2ETHA 1UZDA 1F60B 4JI7J 1M1HA 2X1FA 2PFBA 2V9KA 1O3RA 2Y8WA 2K9QA 2AJQA 3AL0B 1U1NA 3OIOA 3WGIA 4KPCA 4K0KJ 4A3IJ 2GHVC 2R0QC 1Q1VA 4RW8B 2FHOB 2BKOA 3AA0B 1SVOA 5C24B 4JBAA 3Q8RB 1RWWB 1OQYA 2NS0A 1DTQA 2X51A 2IGNA 5CYJA 4XLHA 2DA2A 2ZC3A 4LLNA 3RRHA 2R7ZJ 2GC8A 2H1YA 4AL7A 2KI2A 1KEKA 2UXDF 4PK4A 1PAUB 3C6UA 1HKAA 2Z99A 3LA3A 3QJJA 3BPXA 3IC1A 2GIZA 3Q5XA 3MZHA 4OLPA 3CCQS 2NOGA 4CCKA 3KWMA 1M5KC 1IN8A 1FBQA 4EVIA 2UXNA 2XQ7A 4Q25A 1NEKA 2KSRA 4QIEA 5F1JA 4MYTA 4M1PA 1WUUA 2KKOA 2FXAA 3SDBA 3K1NA 2HGCA 3ZPOA 2K1RA 1YIJS 1LB2A 1WHXA 5L3GA 2PBIA 3W2WB 3HSDA 4LGWA 3N4WA 1X19A 3QPIA 4JI2F 4PYDA 1FEHA 2DNKA 3LWLA 3ZZOA 2RF2B 1V5EA 1T3NA 2L9WA 3M8WA 4H63H 3K57A 2GA2A 4N4NB 3OYFA 1BBYA 2UXCJ 1JNRA 3RAMA 1CUNA 5D3GA 4EM0B 3CC7I 1KFDA 3A1YA 4N4OB 3E5XA 2MQ8A 1DQ9A 2V63A 3AY0A 2V9PA 3L2VA 5LA6E 1VIOA 4P7TA 1WJCA 1KQKA 1K0TA 2YS9A 4CLKA 3KX2A 2KWHA 4OHZA 2IVYA 1YX3A 2QEXI 5ETQA 3R9LA 3ZYKA 3MR5A 5K7FA 4FP9A 1S9EA 3OJSA 1ZN2A 2VHGA 5LRRA 3ZN0A 1CQNA 5IUXA 1Y10A 2FLNA 1Y1VJ 3S1MJ 2R2SA 2M7SA 1RT3B 4ELVA 4MQ9F 4M5JA 3OY9A 3B6CA 1TK0A 3ET6A 3DLEA 5IYBJ 3AG1H 3BQIA 1DTTB 1J27A 4LF7J 1HF0A 4EYYR 4CCNA 3FBEA 1BIAA 5CA1E 1R71A 4LMZA 1M5OC 4LFCT 3A8EA 3QOEA 1E2XA 2PX9A 1B4SA 2JMWA 5LD2C 1CEZA 1SC6A 2XB5A 1RT1B 2Z2MA 4RLFA 4U0YA 4R0JA 4RBTA 2D1CA 3TARA 3RRGA 3L1PA 4LUBA 5M3MJ 1RNLA 4XKVA 3HKDE 3I6PA 4A12A 3O2PE 3TLWA 2GA1A 1WTBA 4BNCA 4DR3J 3SWHA 3OR2C 3TVYA 3AE8A 4B43A 4RKUC 3ZMUA 3ZC4A 1LPQA 2A61A 3QLHA 1EETA 3KLNA 1TNSA 1KYZA 1SQGA 4A8FA 3J80Z 4KE5A 1WKLA 1JUSA 3ISPA 4RJVA 2BZBA 3V8JA 4EEFG 1U6FA 2LTPA 5IXUA 3VF0B 2QE5A 4DWIA 1UCRA 4YJ2E 3VALA 2WSFC 3MMBA 4F3MA 3NEUA 2VK9A 5KT2A 3NCRA 1RTZA 3DV8A 1U6BA 3C2BA 4X4NA 2XEXA 4R5PB 3CD7A 4Q2LA 1O3XA 3LSPA 2HQ5A 1TELA 3CJ2A 2L41A 2EIMH 1XMOJ 4BGDA 3JAMY 2HOEA 2F5FA 2XSBA 2HHHT 5BPIA 4LLGF 2R7DA 2GXAA 4NE9C 1ZRDA 1S6PA 3OTBA 3HKZN 2MSTA 2J0QD 5SZTA 2ZFUA 1FC3A 2J9EA 2XAJA 4PJNA 4X4TA 2E9XB 5GAHU 3N6NA 1HBUA 3LTOA 2H6BA 3MK7C 2ACXA 2B8PA 1AKHB 1O7LA 2CJAA 5EWEA 3F6OA 4DUYF 4E98A 4CI3B 3KCCA 1VRQC 3R61A 2DA1A 4U7YA 2MLGA 4QW8A 4UY8I 4BXFA 2C3UA 2RQMA 1EZZB 2ZJPQ 1IXSB 1ZR4A 2CG4A 4U96A 1IC8A 2VL0A 2E1RA 1FY7A 3T8TA 5E3NA 2C5KT 2R7WA 1VQSA 2DH9A 3U78A 4UOHA 3IRXB 2KWIB 2XM1A 2ZCWA 3V6DB 4NMXA 5L1IA 2X0LA 4ZS2A 4L9IA 3CDUA 2PGCA 2KRRA 2M52A 4KR0B 4DI6A 5ETSA 4TNVA 1OISA 2XMJA 4F0KA 4OX9J 3B73A 2M87A 1SFXA 5J2TE 4D1QA 3ILOA 2CFXA 3K4LA 1RHRB 4OX8A 3S32A 3MXHP 1WDDA 4ILAA 4XOPA 1NAQA 1HNXJ 4TV7A 3WAKA 3RPQA 2D7SA 3PW4A 3D54A 1AB8A 2VASA 5LSRA 1T11A 1TZ0A 2AZ3A 2UUCJ 4FF3A 2FVRA 2FX0A 1OPIA 1WC5A 3UQ4A 4N76A 2XGEA 1SUQA 4PPDA 1XMAA 3M07A 3KK3B 5FFXA 1X3ZB 2B9WA 1WH7A 4N8OA 1RSCA 3VAFA 1HI1A 2BS4A 3ANWB 3MURP 3EUNA 4BU2A 3PIOF 1JT6A 1ZAOA 2CPYA 1JUPA 3I4PA 5HS8A 2C3PA 3V42A 1UP1A 5A8WB 1OJLA 3IV5A 3MGJA 3DOMB 4KDPA 1R4NB 1NK3P 2IAJB 4KIAA 1IUFA 2LBFB 1U1LA 1OQ6A 1U09A 1B4AA 4PR6A 3OYLA 5LGUB 4IRHA 1TT0A 2KRFA 4DL0C 2G0UA 2GMHA 3Q2MA 3Q83A 1YBAA 4DPTA 2K85A 2MSSA 2LXIA 2HQRA 4Q8FA 3D1QA 5DJQC 1KOOA 4JYAJ 2EFQA 3PYFA 4HKQA 4J9NA 3W5XA 5KFQA 2DPIA 5LNKA 1XS9A 4OYWA 4I0UA 2VE9A 5D0RA 5HJYA 2XZTB 2XY7A 5F0HA 4XBFB 1N5TA 4AU7A 2CV1A 3GUDA 4JV0A 4DSJA 2HQIA 1FF2A 4OYIA 1YJNI 1QVGR 2W1BA 3LGHA 1OIAA 1TKDA 2A68F 4RR5A 4YR2A 2AXLA 5E3PA 4DLGA 4K8RA 5AQPB 1FWKA 2HPIA 5E5NA 5DDRC 4J9SA 3TOAA 1VQKI 3H98A 3OMYA 4HHUA 2MQLA 4MHGA 4K4ZA 2KT2A 1HHSA 1VQ5I 2XI3A 2M3DA 1HQCA 1DHMA 3R5GA 5I42A 4C91A 3WTWC 4FBUA 1HW8A 2AYBA 2GHPA 3X2QH 4C0BA 5B09A 3ISND 2QVOA 2BJEA 1W1WE 4ZTFA 1EIYB 1JB0C 3UDLA 1VNDA 1MG7A 4EYIB 3H9GA 2V69A 3MEGA 2CZ9A 2CJJA 4EJOA 4UVCA 2HZCA 3C66A 3LP0A 4L9VA 4EZ6A 1VGYA 5K8PA 2KZZA 3KYLA 3DMJA 3HPHA 2JRKA 4F50A 4JV5J 3PR4A 2XAQB 1FXRA 3NMRA 3ZN0B 2DEIA 4XZCA 2ZXIA 2WB5A 1MBEA 2MHEA 5HMXA 1LDDA 2HOSA 3ZCJA 1BC8C 5KMGP 3FMSA 2EPIA 2HFNA 1GT8A 5IYZE 2A0FB 4CGZA 1SC7A 4ZJZA 4P96A 1R8PA 3FC9A 3SEOA 2R5YB 5EK3A 2MD0A 3IWNC 5FRNA 5E3AA 3KDOA 3MM6A 2V5DA 5T41A 3NCQA 5HS7A 4UZBA 4N5SA 2ZH6A 1G2EA 4B3MF 4PQAA 2ODVA 2PSZA 3VRAA 1JNRB 4FT8A 3H0GJ 3BWGA 1RAIB 3B8HA 1WELA 3HSRA 3PW5A 1PSDA 2UXCF 3OHAA 1I5OB 3ABVA 2G9OA 4DZJA 1SJRA 2KKHA 2BVZA 1IJWC 3CO9A 3IR7B 4BAYB 4DZPA 3Q2TC 2F4VF 4AD9A 4RZRA 1I3AA 2BE2A 2CPFA 2DJNA 4Q5SF 4IIJE 1KQFB 5KFKA 3SQGB 3DRYA 4OZ3A 2ZZTA 2K1RB 4PJ0C 4LFAT 1BE4A 3LNQA 3R7NB 4DL2A 2JH3A 4ZP8A 3TP2A 2CQCA 3BGLA 3VWSA 2J6SA 3D6MB 3F72A 4AVZA 3OFEA 4DQIA 7FD1A 5HODA 2I6WA 3HJFA 3ZPLA 3KBTA 4CDGA 5AFUL 2LFVA 1UELB 4IHJE 2L9RA 3HC7A 2E1PA 2MQOA 2VOPA 5DM6Q 3AA1B 1J59A 2B63J 3KVBA 4PWDB 4YTNA 1RWUA 1FJ7A 3BYPA 5A0YA 5ICGA 1W26A 4FBTA 4LF8J 3TUZC 1HA1A 1EJ9A 2BV6A 4RNHA 5FIIA 1KVJA 3DDNA 3FXOA 3V4GA 2ZMEB 2COMA 4A2UA 4F04B 2QFIA 4BBYA 2YNIB 1R5GA 4RMNA 3T3FA 3DWLE 1WSVA 2BY2A 1WKJA 1NM2A 2MTQA 4M9SA 2YQ0A 3G6ES 4BAYA 4Y13A 2W7NA 1EH7A 1WEYA 2V9VA 1FT8A 5IY5H 3ZNUA 4NL5A 2ATCB 1UG2A 3TAMB 4L18B 3IA0A 2WVDA 1FPQA 3KLVA 3JB9k 2YWWA 4RAYA 5E79C 1W0TA 2GHWA 1N5YB 3GF2A 4CYCA 2P7CB 1ZH5A 3O1LA 4UUSA 1FNMA 1N34T 1LVFA 1GXTA 2GWRA 2A5WA 3GZ7A 3MM6B 3UN2A 2XSJC 2R5YA 4HI2A 4DL3A 2ZM0A 5E20A 1CJKA 3EE3A 3FXMA 4DV3J 3SJMA 4IG0B 1RHUB 4KHZF 4P72A 4KITB 2HEKA 4ENNA 2MQMA 2O8KA 4RGRA 2MY8A 5LMUT 3WX8A 3G8SA 5HP1B 4GKKT 3BH7B 4WXOA 4XRSA 3T1YJ 5BPDA 4USKA 3P9KA 2F40A 3V5SA 1C1CB 2V7JA 4F2SA 2J4GA 1KTQA 2H6CA 3ELKA 3S8SA 2R3VA 4B3RJ 2Q43A 2EG1A 3K2YA 2RD5C 3MEGB 4YIRX 2IM1A 1QGPA 4B3AA 5CGMA 3ZCIA 2C42A 1P1LA 4E7SA 2XMUA 4EEDA 2LEBA 2RREA 2XGCA 1U8RA 4Q47A 2IC6A 3BK9A 2XQ8A 3IBWA 3W6VA 1W09A 1G3OA 3IUOA 3EVOA 4UEMA 5HS9A 2OPSA 3MCZA 1VBXA 4OIPF 4C6AA 5AQGB 1ORKA 2H8RA 2WSSV 3G71I 4KMCA 4PXBA 2OEJA 1EQ0A 2HFUA 4A3BJ 1JLEA 3D68A 2B8QA 1CG2A 2ZXWH 2DIVA 2HKEA 2KHMA 1LEAA 3HOSA 2I38A 4DX5A 2FZCB 3ESWB 2DH7A 4JUZA 2VDIA 5F3ZA 5KFOA 2F7VA 4S05A 1IRGA 3EGVA 4UQTA 2J0SD 3S1NJ 1N5QA 4FNIA 2K2PA 1ZG3A 1R27B 3HPOA 2B9XA 3LFUA 3D67A 4P6QA 4DQ2A 2IIUA 5FY1A 1NDCA 1JNZA 2GA7A 3QT8A 4EJWA 3TP3A 5HXCA 3FHNA 3ZJ1A 2V0NA 2W4PA 4UUVA 3N9MA 5HCJA 1HNZT 2XMVA 3CUQA 2AGOA 3SCIE 4HVZA 1KDNA 3NKZA 3WC2A 4WNKA 2Z0GA 3R27A 1Q81T 2D9OA 4LB6B 4HI1A 1ZKGA 3D1HA 2H54B 2PFDA 2NTYA 5IOYA 1YJWS 5B0BA 3RBDA 4B3TJ 2OLWA 4HLXA 3LDQB 1MMLA 4RUBA 2JSXA 2WAQA 1LWCA 3NOGA 4NOHA 4R25A 1DRZA 5L8RC 5M2UA 4MHCA 5A8WA 3U2RA 4DV5T 2VKDA 2VURA 3JREA 3PNYA 4CP5A 4Q0BA 2HS5A 4F6RC 4PABA 2Y1IA 2W7OA 2RKIA 1FKOA 1WDTA 2ZBIA 2HYIB 4JB8B 3OL8A 1OR7C 1M5HA 4CXWA 2MYSA 2HIYA 4MNUA 4F3QA 2JVRA 1N36F 1VQMI 4O6JA 2PJRA 4I98B 1ACIA 4AKLA 3OD2A 5HEUA 4Y6IA 2NXJA 5LHIB 1SAXA 2QLJB 4NLSA 2O61A 2K9LA 3MEDA 3BKTA 4OZJA 4W97A 5HLHA 3JAMU 5KT4A 2KFYA 1V3FA 1KZHA 3MWMA 3L7UA 5DD4A 3TLSA 2ZJRQ 2YXLA 3EYYA 5GTIC 3I53A 4IE6A 1BJZA 2IT0A 2BG9A 4EXTA 3MMCB 4NLRA 3M3YJ 1RP5A 4USIA 3V6DA 1FRHA 1IBCB 3MKYB 4XRSG 4NPPA 3W15B 4ZLJA 4HHJA 5L3BB 1XERA 3TKLB 1HFEL 1FRXA 4LSLB 2KHDA 3ZTRA 1YWXA 1H88C 2EZLA 3DKXA 1VK3A 2IGOA 2QF7A 3MR6A 3F3XA 3JRAA 3V5UA 1WG1A 2JEJA 5A6WA 1E2AA 4A98A 4Z91A 3MZYA 3UO0A 1X4OA 3EI0A 2NVYJ 3AVRA 3R6LB 4IFVA 2YPZA 4LVNP 3GX4X 1EZ3A 2CSOA 4FN5A 4OZ2A 5EGOA 2ZOFA 2UV8A 1A6LA 2ZITA 2V5CA 3KG4A 2IUBA 2E9XA 2VG6A 5KHDA 1TC3C 4QWCA 4L5JA 2BR0A 5HMYA 4RWXA 3RQ4A 4COFA 4AE5A 2YU3A 5TGTA 4F26A 4FQGA 4XK4A 3CT9A 5G0RB 4LFCF 4FKYA 4NLPA 1T9UA 4IHTA 4ES3A 1JHHA 5IP9J 1JKRC 3D0IE 4QR0A 4CWBA 4IL9A 3A03A 3LSGA 2PG8A 5DYMA 4RLEA 2I5JA 4EV6A 4ICLB 2UVVA 5AQRB 3C2PA 2F5VA 3J7AN 5AQLB 2HPJA 1BWEA 1N34F 1XMBA 3N05A 4R79A 1U7LA 2EK6A 4RA2A 3CCJI 2STTA 2DO0A 3NNAA 4IE7A 4I6YA 2KIQA 3H5NA 4YG2F 4L9JA 2IP2A 5GMEA 4WBNE 1HNVB 5D4LA 5GONE 1CQTA 1QAYA 2CPHA 4DSKA 3P45B 1NDPA 3J81Y 1Q16B 2ZH7A 2GOXB 1O3TA 3AE7A 1TL3A 2R3SA 3EWGA 5DGAA 3RU0A 4G1QB 3GR0A 2JQ9A 4M5HA 4CO3A 4DL6A 2ADUA 5C2GA 3OR1A 3I55I 1UMQA 5DZ7A 1WRDA 4KSEB 3WTTC 3K4KA 4JOUA 5HN0A 3Q0VA 2VKZG 3FXDB 2GJIA 3UCZP 1YIJI 4R8UB 4HLYA 1RT1A 2BW3A 3NP5A 3DFGA 2RH3A 2XSJA 3K8VA 3NS7B 2R8IA 4M5IA 1H38A 1TT5B 4NYPA 3ONJA 3OHBA 1WCMJ 4OHWA 1Z1ZA 2KNDA 2UUWA 1XR7A 3GZ6A 1RISA 2IS1A 5CCMA 1S7EA 3QWUA 3Q2SC 4ED4A 5HLTA 1QU3A 4LF8T 3NAHA 3AG4H 3BZKA 5LG3A 1MDMA 3X1DA 2DNLA 4K4TA 2YKSA 5HCMA 4PCQA 1ZAWA 5F0WA 2LXFA 2V1XA 2HN1A 3HUGB 4CLLA 2FZGB 1UZCA 5EUHA 3I59B 4P9SA 4UHTA 5A8RA 2K4BA 3P9IA 1T33A 3JYTB 4WYVA 2LLKA 1YJVA 2DR7A 3HHLC 1J5OB 4DF8A 2E5LJ 3QOPA 2ME6A 4OU0A 3A8KA 2EA4A 4IE5A 3CNQP 3NG8A 5B0CA 5HLFA 1PIEA 4YSXA 1YI2I 5IWAT 3NAIA 3RG6A 2HHSA 2DHXA 1XNQF 5HDNA 2XAHA 1FSHA 3CW2C 2RF2A 3FQLA 2QO3A 1N33F 3CTRA 5KFXA 4QR2A 3T1YT 4N0BA 3UD5A 3GYNA 4GOUA 5A1LA 1A31A 4F4ZA 4EFAC 1HW9A 2H94A 4AQYJ 2BRLA 4E6KG 3CSKA 2YPRA 3VB2A 1FIPA 1S0MA 1Q8LA 1GDTA 2AXDS 2X9HA 1NUEA 2MZ1A 4X64T 5HAOA 1QO0D 4PRFA 5HQMA 1RT5B 5DD8A 3CMAS 5C25B 3B4DA 5KFFA 5AE1A 2HQNA 1YGYA 1IM4A 2FYXA 4B9NA 4HA8A 3W7BA 4XL9A 1BA5A 3MD1A 3KLOA 1DPRA 1S1UA 3TAPA 3DRPA 2BVLA 1HLVA 1U9NA 3RW7A 1APLC 4FF4A 1F5CA 1N32J 3I9V9 3E3VA 4CXYA 2E5NA 1QLBA 3BGOP 3PUBA 2FMLA 4P71A 3HSEA 3FJ2A 5C24A 1VQ9I 1H2VZ 1LWXA 2Q9QA 4X62F 3FFIA 4P1NA 3CX8B 1P9QC 3EJMA 3DBHB 4Y17A 3E5UA 3CMEI 2LREA 2E8IA 1S1TB 2JX2A 1ETXA 4IQJA 1OXZA 3BGRB 4OLOA 2NNNA 4NASA 1MIJA 1N75A 1X4GA 4JX5A 2M9KA 3HULA 4DUZJ 4DV2T 5CB4E 1WC4A 2MGZB 2YK0A 2JVGA 4CHUA 3N0VA 1NH7A 1HG2A 1I94T 4K4VA 2F5DA 2DVIA 3ZZYA 2W00A 4X20E 4EEBA 1FNXH 3AE6A 2EHOC 2YEVC 4IDOA 1IBKF 3JQKA 3TZYA 2M0GB 3AJ2A 3UNYA 4LFAJ 3ROUA 4EJTA 3RB0A 1H9GA 4B47A 2XYHB 7FDRA 2DFFA 1P6RA 2OBPA 2PDAA 2MKKA 1E3HA 3KYDB 3ESLA 5AE3A 2M6BA 2X6XA 2I10A 2JL9A 2BJ7A 5THWA 2OHDA 4J2CA 3D5RC 3JTHA 4U7IA 2JRSA 3QU3A 4HOBA 3IO1A 2FGCA 1Z3XA 3VYTB 2KH9A 3TA0A 2HBZB 4IOBA 5K14B 1UVLA 3I5CA 4ITVA 3SEQA 3OXFA 4TYAA 2HNDA 2D5VA 3HSJA 4ZCIA 2FJEB 2A69F 3DF8A 4AXPA 1NHAA 2OC6A 1R3NA 2MH9A 2B4OA 5JVHQ 3CMYA 4B3XA 5L3FB 4F7VA 1PAEX 2B6AA 1HNIB 1S35A 4BXXJ 5HBMA 3E22E 2HHHF 3TBIA 3I32A 4DR2F 1U1RA 2D3O1 4HWIB 1UJ4A 1Q79A 5L4EA 4E4HA 4UUWA 3HHDA 2EHOA 4WZMA 2V68A 1X5TA 4ZPVR 4FXWA 5B0DA 4HGAA 2KMFA 2CUZA 4QKNA 1HSJA 3JRFA 5AXLA 3TJAA 4ZVFA 3F21A 3MTJA 4ZZLA 5CD4H 5IT4A 2MQQA 1RUNA 2WWVA 3WGHA 3RW6A 2RQKA 4ALZA 2AX0A 2OUMA 5LG4A 2NXNA 1CF7B 3PX4A 4PSWA 1ZG1A 2RHSB 3Q5EA 2E60A 3CCSS 2W4CA 1R0AB 2KVIA 3UKGA 3G3ZA 4RB0A 2VFUA 3CCRI 2KXPB 3D0TA 1BMQB 1K83J 5JLWA 4M74A 3OYDA 1AFJA 1FE0A 4USWA 3IWZA 2H89A 3DLHA 2FBHA 4LG0B 1OSDA 1X7VA 4EZ4A 5KG5A 5BMVE 2FZKB 2E2AA 4GVBB 1YQ4A 2FU4A 3J7ZI 4IRIA 4UB6C 3I0SB 1HHQA 1NZAA 1ZPVA 3K1MA 2PMWA 3PE0A 1S72S 2VKRA 4X62T 1SE7A 4QU7A 1Y5IB 2BX6A 3FRYA 2BBEA 2IDOB 2J47A 3OPCA 1IG7A 2LQ5A 3KNAA 3LBXA 1C2PA 4PK6A 2OI2A 3QT6A 5HDKA 3DLGA 1XGSA 3AXJA 2HLUA 3Q8VA 4MK7A 2E29A 3WHCA 1TFYA 3ONLC 4RW4A 3U1NA 2RUSA 5JQGE 2XMWA 4C7QA 2L8KA 2EC0A 3T9NA 3KP7A 1IO2A 1U8SA 3RAXA 4RLQA 2N1GA 4PJMA 1Q8IA 4FPIA 1R1VA 2NVXJ 4TV8E 4DPXA 2HAIA 4Y2MA 2R7FA 1NHKL 5GP9A 2YY3A 3OR1C 1NK8A 2RN7A 2V8PA 4FS2A 4Y7NJ 3M8QA 1SMYF 1M5VC 2KDOA 4X66J 2PFVA 2LLYA 2DDBA 1YYVA 3RYLA 2L48A 4DYRA 3PZPA 1N0VC 4M5DA 1HTJF 2C1EB 4B8XA 4BQOA 3PO3J 4F91B 4H63V 1RTIA 2CXLA 1T7PA 1XCBA 1UA0A 1RTHA 2ZM6T 3CJRB 1KVKA 1KSPA 3K3QC 4QWBA 4RDUA 1OEDE 2DHSA 3RKOA 2CW7A 5E8GA 2KQRA 1U4BA 3NRXA 4G7ZF 1MJBA 1ZARA 4H9NC 2KO1A 2MZTA 2UUBF 3EDQB 2HHUA 1IR0A 1PYSB 2FQQB 5C42A 1X4CA 1U2RA 5IYCJ 3JSMB 2W01A 2GXGA 2JQKA 2V8SV 1S6UA 3MMYB 4MH8A 4YELA 3AA9A 4ABZA 1D0EA 3C64A 4DPUA 3BROA 5LOQA 4LMKA 5EWFA 4HSTA 4NXMJ 4XDCA 3DHXA 1TVRB 1QPIA 1D8JA 2X68A 1VK8A 1Y3JA 2GVZA 3X3UA 3AEGA 3ZZZA 3NWGA 2LF8A 2RDPA 2TCTA 3RTVA 2I2YA 2BQUA 1W7PB 1T05B 3TW6A 3P6YC 3PUAA 3LSTA 5LSLA 2W9CB 2ZBQA 3IH3A 2B9YA 4MIWA 2QA1A 4G6VB 3A0BC 3FWEA 5LP6E 3FVYA 2KPMA 4ZHQE 2B7EA 4KGVB 1B72B 2VG7B 4UVBB 3RF1A 5BR8J 2JLFA 4G6TB 4R1HA 1BUXA 5CABA 3GJRB 4CCHA 3V81A 3AL0C 4ERRA 4A3GJ 4C2TA 4J9PA 3RYPA 1VZ0A 3B78A 1LDKB 3J7ZT 4CRJA 2IMOA 1JJ4A 3CJKA 2H48B 3KJVB 4TWFA 2WZHA 3HJEA 3VR8A 4B3OA 5AQHB 4HFCA 2GNKA 4B3MT 4FVMA 2ZJ2A 2HBQB 1H89C 2DOEA 3QPLA 1X4DA 4IDNA 5TJJA 1KOHA 2L3DA 3EDUA 2ES0A 1FIOA 4UF4A 4LRBA 2W2PP 1VQOS 1H7WA 2CW8A 1JLFB 2G2YA 1Y01A 4O44A 4DOZA 3W3CA 4FE7A 5G4DA 1G4CA 3E6MA 3KMSA 4I09A 1MJ9A 1FD2A 5FDLB 4IUFA 3HKZD 2F4MB 3KZIC 3J7AO 4V19J 1ITPA 2FVPA 4LRAA 4YHHT 4QWQA 5HDGA 4KQZA 2OPRA 3M4OJ 5KFZA 2V6YA 2CA5A 4NXNT 3M8JA 5CAAA 3QO9A 1MBKA 2QMWA 1ENHA 3WTZA 1TKZB 2H4WB 3GMEA 2W63A 1ZM4A 4M8LA 5C44J 3IAS9 4CO0A 5DTDA 3C14A 1YRUA 2XQYA 4IREA 2L08A 1D8ZA 2M8HA 1UHSA 1W0BA 4M6XA 2MEWA 1FA0A 5AQQB 3AE3A 2BG9C 2VPXB 3CULA 3M65A 5DCMB 3FXKA 5GPAA 5FLXK 3CX7B 2XPWA 1GUUA 2Z2LA 4Z6YA 2QZ8A 1ZRFA 1UCUA 3NL0A 4Y3OA 2LHRA 2PD1A 4XRFA 2CQKA 2E19A 4O8SA 3KP5A 2DNMA 3IH4A 3KEYA 4X66T 3FM5A 3BR0A 3NZPA 1F9EB 2YH0A 4HKAA 1T03A 1XNRJ 2ZNZA 3VR9A 3EXCX 1FMWA 3UDVA 1FDDA 3UNGC 5KFUA 4OI3A 1IRZA 3O9XA 2XUEA 2L2OA 5LBQB 3S2WA 3PIPQ 3LH2S 1NWMX 1Q82T 4A5NA 2CQ7A 1ETWA 2QA4I 2XNRA 1IUJA 3EZUA 4URQU 3OFFA 5LXRA 1VYAA 2DYSH 2IM3A 5FL0A 2K02A 1GXUA 2QQBA 4LF5J 5IYDJ 4C98A 2M3AA 3F8CA 4BHBA 1J5EF 3MQ0A 2VBZA 4LREA 2V6CA 3GWCA 1RT4A 1SVLA 5C3EJ 3HT3A 2HZDA 3K5MA 2HVHA 4LQ3A 2WTFA 3O1JA 2N7CA 3CCSI 2M4MA 2IS4A 4AQFA 4DR7J 1T8IA 3RGIA 4AKIA 3HMJG 2FBWA 3DI6B 1QUUA 3WTVC 2L02A 1J7KA 2MLKA 2QLZA 3Q86A 5ITHA 1D1CA 2BQ3A 1X60A 1SH2A 2R8KA 1UEVA 4KO0B 1TAUA 4OI4A 4ZPWR 3FZFB 2LD5A 1K7AA 2ASDA 2O9LA 4DQRA 5L1LA 2HZTA 4F55A 1XC9A 3U7JA 1NRKA 1I50J 3FIWA 4BEHA 4DR2J 4QIVA 4PNIA 2ILZA 4GO5X 5E1XA 2NP9A 3WU1B 4YTMA 4C2MA 3CDLA 4YIFA 3I9V2 1V54H 3TKYA 3AEAA 2UVWA 5E7OB 1DJ0A 1ON1A 3CO6C 3I56I 5JRCB 2NUHA 3FX3A 1QRYA 3K3NA 1TL4A 4DR6F 3PSIA 2YH1A 1GH8A 2CHNA 4B3ST 3V6KA 3O5TB 5KFMA 1H72C 3F8FA 3AECA 1QE1A 3SDEA 3JQJA 1UETA 1BIBA 2D41A 2DTZA 3UVJB 4HDVA 1M62A 5LCYA 3ZQLA 3TYTA 3H5XA 4PPZA 4C3HJ 1VRBA 3CD6I 2UVRA 2NWBA 1G3WA 4JYAT 3V7SA 2WVFA 3GO5A 4C9YA 4PW8A 2DNNA 3F41A 2FJXA 1O4XA 4NCBA 1B9NA 2LP0A 1A35A 3CIZA 3NY0A 2A6EF 4ZPDA 2Q8KA 3DEWA 4P9UA 1BJAA 1WOOA 1RC9A 1M5SA 4NC6A 2U1AA 1N25A 4ZVHA 4TY8B 5E17F 2EH3A 1VHIA 2XQ6A 3ZQCA 1EP4B 2FTRA 5C7PA 5A8KB 5CVUA 2NLWA 4TXSA 4LF9J 4AC0A 5B0AA 1UB9A 3MM5B 3SCLE 2Q79A 5L3EA 2N4DA 2M8EA 3NVOA 4ZCMA 1AJ3A 4ZOLE 1G1XA 3UR3C 5HROA 1IBLF 5J2QA 4X65J 3UPFA 3OV7A 2HTSA 1IZNB 2LKXA 3MI7X 4HQEA 2HAFA 2VVSA 2W67A 1RB0A 1WWHA 1EB0A 1RUOA 4UV9B 1HMVA 5L3CB 1RT7B 3LP1A 4IE4A 4UV8B 2RP4A 2G7UA 5FKOA 1SD6A 3I5UA 3MR3A 1ONVA 2V6XA 4YT0A 1N6QA 2CQXA 3M6XA 4DUZT 1ZTTA 4CCJA 3TQNA 4PJLA 1EX8A 1VQ9S 1WHUA 4U95A 2ZBCA 1HBNA 3RYHE 3FZ2A 3ZXWA 3A3PB 5E33A 2XWYA 3LW5C 3J80Y 4DV5F 2AQ4A 2UUCF 4DMWA 3ULHA 3LSKA 3N2GE 2YQ1A 5J2NB 1CQMA 2JTVA 2HWIA 2H51B 1FWPA 4ZPCA 2LK2A 2Q9QC 4ZZDA 5LL6d 3CC2S 2J1DG 2GQ2A 2NREA 3E97A 2KINB 2BS3A 1RZMA 5IWAF 3F22A 5L1KA 5AXNA 4IO9Q 1NK0A 2XY5A 2Z5UA 1GT0C 2DPDA 1X79A 2XM3A 4L3NA 1WCRA 2AEFA 3DDIA 1LFWA 4JI8F 3QPHA 4X1YE 3PIOQ 3CWZB 2UU9J 2ZEJA 1KWMA 1TKTB 1Y6IA 4ZXLA 2SXLA 5JTGA 3W61A 5JVTA 1FNNA 3NNCA 1V6HA 2DY9A 3AEDA 5JR9A 2D69A 2NQPA 2XHCA 2DR5A 3A8IA 3VGVA 2R7VA 3V7RA 1TFWA 3KFWX 3DRRA 2DLRA 3I9ZA 1MROA 4BE0A 4A8QA 3VKGA 1SKWA 1SANA 3UU6A 3FBNB 4X4OA 3BO3A 2FVQA 2IFXA 3HHGA 3EM1A 3HXMA 2UXDJ 1T2KA 4BXUA 3MFHA 3G6VA 3O1HA 3N5LA 4A5XA 2E71A 5B66C 2XASB 1NNDA 4ZMMA 3PJXA 2JQQA 2CW0F 3TA2A 3DHWC 3FXRA 1OEDA 3TLVA 1R6YA 3HHEA 1H98A 4NDLA 1UFMA 1ULRA 3IXQA 4HW0A 1TQLA 4P10A 4MKVA 2J0XA 2ASJA 3AB2B 1CPZA 4CI2B 4J7CA 1X4HA 3K70D 1G3TA 4B9TA 5DCFA 3RKGA 2GQQA 1QTNB 4DV7J 2HR3A 2JEGA 1SFOJ 4WTYA 2CJKA 1YJ9I 5CZXA 3SIPB 4IOAQ 1UURA 2HMIA 1YQ3A 3PFEA 2KHCA 3S4UA 3H5SA 4MEXF 4DSEA 1B7FA 2BUNA 3QAUA 1U2FA 4J9MA 2VQHA 3UT5E 2YKOA 5J2MA 1ZA2B 1S8NA 1BW6A 4WKYA 4OIRF 2OQGA 1EH6A 3JC6D 3VAIA 1HW5A 2PMZD 1L3UA 3O8HA 1R31A 5E0OA 3N97A 2LLZA 4LFAF 4OX6A 1XMKA 4DV3F 2BKPA 5FFZA 1MH3A 3TJ8A 2K86A 2RQQA 1YW7A 1N5VA 3UWTA