3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
2HYGD 3WTVC 3L09A 4RAZA 3KETA 4P9FA 1SMTA 3LSTA 2H6CA 1WI9A 1UB9A 1ULYA 3DEUA 2EFOA 1XDUA 1R36A 3WTTC 3MFKA 4L9NA 1TNSA 5AIQA 5LRRA 1MJBA 3DV8A 1BJAA 1IXSB 2V1DA 2KIUA 4RGXA 1Z91A 2FXAA 4G6QA 4JBAA 2VC0A 3O3KA 2QYOA 3EETA 2XAGA 1XDSA 1R1VA 5TJJA 2RNJA 1Y0UA 1WRJA 2ZNZA 2E7WA 2KIFA 3GO5A 3ZN1A 2DPUA 2EWNA 2KRFA 1JHFA 5E1XA 1QZZA 2VONA 2HEOA 4PGGA 4XRFA 4WXHA 3GFIA 1YYVA 4LMYA 4M9SA 2G7UA 1BI3A 3SZTA 1ZGAA 3VOEA 2HDCA 3F72A 5FB2A 2P4WA 2BGCA 5LHGA 2IRFG 1P2FA 1J0RA 1C0WA 1Z6RA 3H3ZA 4YFKF 1O3TA 2D1HA 3CUQA 1I1GA 1OPCA 2LF8A 4K2EA 4AIHA 5CVJA 4RGRA 1R22A 3DF8A 3L2CA 2YX7A 2FMYA 4LLLA 2VOPA 2V9VA 4FX4A 3KLNA 2BBYA 4EVIA 4WWCA 4N9HA 2JZYA 1TQMA 5FD5A 3HSFA 3HOTA 1WKMA 1BC7C 1B9NA 3TO6A 5D4SA 3QAHA 5HLGA 1S7AA 1ODDA 4LD5A 1R1TA 5IT3A 4KIGA 3QP5A 1FPQA 3WGIA 2QQBA 2GXGA 1T98A 3MZHA 2H27A 1ZH5A 4NQWA 2RKHA 5LGUA 3KP3A 2A3SA 2QLZA 4UVAA 1HQCA 3RTRA 2VODA 3K9TA 2GIVA 3J80Z 1ZAOA 4I7HA 3QP6A 1W5TA 3RKWA 4LK0F 2ISZA 4U7DA 3WGHA 4YFNF 4OMZA 1KQ8A 4ENNA 1YO5C 3BWGA 5HDGA 3P7NA 3BZ6A 4MEYF 2OQGA 2V1UA 1P92A 4FHTA 4HV6A 3GEZA 1XCBA 2NAZA 1LEBA 3U9GA 1B9MA 2QBYA 2EA4A 1O3RA 3FZVA 5LGTA 4XLNF 1KA8A 4ESBA 2DT5A 3CLOA 3R6SA 2UWMA 2CQKA 3K2ZA 2W84A 1SD4A 1B6AA 4HX7A 3KE2A 3F8CA 2ZNYA 2A68F 1P4XA 2M45A 4OIOF 2OD5A 2PG4A 3IWFA 2E1CA 1YW7A 4LFUA 1HSJA 2WTEA 5BOXA 2DQLA 3WTUC 3F23A 1OYYA 5K5OA 5HVQC 5JFRA 4PDKA 2VBXA 2YX4A 4LG0A 3F8MA 3LAJA 2Y75A 2WWYA 1YW9A 1QPMA 2BE5F 3KZZA 3FF5A 1ON1A 3PQKA 2XGXA 3FMRA 1QZYA 1FT9A 5FLXK 2K02A 2A69F 3P9KA 5DYMA 3ZMDA 5ERIA 1HKQA 3DPLC 5DCFA 1IF1A 2K7LA 1YW8A 5D5UB 3GX4X 4ZYGA 2ZBKA 2QUFA 3CUQC 2VT3A 4MGRA 3PFIA 2P5LC 3C18A 3CUQB 5JR3A 4ESFA 4G94A 5LBQA 1J5YA 3R0AA 3V8KA 3K1NA 3WTXC 3GYHX 3T1BA 1MZBA 3BJAA 5DEQA 2FE3A 4Z2YA 4FX0A 5E17F 1ON2A 2V1XA 3GF2A 5CVRA 3DPTA 3KFWX 1U8RA 1K78A 5HLIA 2ESNA 1U6GA 4O5VA 4RGSA 1U3EM 3KCCA 3FX3A 2V6CA 5CVVA 5AIPA 2FMLA 2FBHA 4L9JA 1YG2A 1ZLJA 2W85A 4M9XA 2MBFA 2HFHA 3KP4A 1RUOA 1BBYA 1V4RA 2JTVA 3TDUC 3I64A 1BI0A 1IRFA 4ON0A 1XSXA 2F5FA 4WXCA 3LQRA 1MJAA 4HA8A 2XROA 2VT2A 2STTA 3JTGA 3F22A 4RB3C 2JT1A 5JI6A 5E18F 2CFXA 3C7JA 1FBUA 4L5IA 2RV8A 3T8TA 2IA2A 3ISPA 3RYRA 2D1VA 4KDPA 4WX9A 3IKTA 3RPUA 1GXQA 4KMFA 5AONA 1BN5A 2DO7A 3RKYA 3L7WA 1YQAA 1SD6A 2QBYB 4LLNA 3KP7A 1MGTA 1TNTA 2VE8A 1ZRDA 2OU2A 3ZMSA 3M9AA 1FYMA 1HKTA 3DXJF 3HOSA 5D5VB 4GO1A 5BS6A 1H0MA 4BHPA 1IN4A 4BYYA 3ULQB 2UXXA 5L3FA 3FXQA 4L18B 4BHBA 1VTNC 2P7VB 2KKOA 4BHCA 4WXDA 4N9IA 4KYWA 2DBBA 5ILSA 2LF7A 4QWQA 4XSZF 3QRFF 1LJ9A 3HTUA 3ZPLA 5J6XA 4A6EA 2LNBA 4IJAA 2VBWA 3RI4A 5CVUA 2EJRA 3DKWA 4LG0B 2XIGA 4GYGA 2A5YB 3SFZA 4OOIA 5LEJA 1DPRA 4DNCA 5DUIA 3QPHA 4UVCA 3U1DA 1YS7A 3R4KA 3CTAA 1P6RA 5L3EA 1IN8A 4G8XA 3KEOA 1CF7B 2A6HF 2K4JA 3ELKA 4P9UA 1D8KA 4P55A 2XAQA 5D6FA 2XKOA 1OYWA 3F8NA 3ECOA 4U0VA 1ZARA 4OIRF 5KK1A 3SZPA 5ILUA 1HW1A 4G6DA 2XVCA 4RGUA 3BPVA 1RUNA 2Z3YA 3OOPA 2FNPA 3JTHA 4A6DA 3Q9SA 3BJ6A 3BOQA 2BEOA 3HSEA 1GHCA 2XHKA 4AWXB 4CZZA 4E70A 1SMYF 5L3BA 2YSRA 2VBYA 2KJBA 2HZTA 4OU0A 1LDJA 4EJTA 3EUHA 2M1BA 4P96A 3I4PA 4HW0A 3LA2A 5D6EA 1RIOH 4UXNA 5ILVA 5LLQA 3HHHA 4WF2A 1D8JA 1EV7A 2LKPA 5FFZA 3Q9VA 4LB5A 3G3ZA 3I58A 5FFXA 2J5OA 2LSOA 4HQMA 2HQNA 3D5LA 3HRTA 2V79A 3ROUA 1IUYA 2O3FA 4Q48A 2MD5A 4EJOA 3H3UA 5ICCA 1UCRA 3IWZA 5D4RA 4EV0A 1XMKA 2ZFWA 1SFUA 2TDXA 2DU9A 3MZYA 4YFXF 2XV4S 1LB2A 1FBQA 2HR3A 3LFKA 1REPC 1RNLA 3BJOA 3I71A 1S29A 1B4AA 4KN7X 4A0ZA 2STWA 2W24A 1EH7A 2EA2A 1OYIA 1P4WA 1U2WA 1Z1DA 3WGGA 1T2KA 2ESHA 1KU7A 3KP5A 3GZ6A 2OZ6A 4RB2C 1Z05A 4IRHA 3WU1B 1T38A 2HTJA 5D8LB 4ZZLA 1XGMA 5E8IA 1S6LA 3F8BA 4Q47A 3R60A 1B1BA 1IRGA 2GWRA 5L3CA 3JSPA 1MD0A 3R61A 4IVNA 2CSOA 2EFNA 4AD9A 2C6YA 5HOOA 5FLXZ 1O7FA 2P5KA 4MEXF 2IVMA 2X0LA 2L54A 3TKYA 4IRIA 5HS8A 3FMSA 3HIFA 5H6RA 3L9FA 1KQ9A 1LEAA 3LAPA 2QQAA 4M73A 2CO5A 3HSRA 1V3FA 1FLIA 2GA2A 5FO5A 1QBJA 1ZYRF 4YIFA 5ICGA 4KNYA 3BROA 3J7AO 2L02A 3HRMA 1G4DA 2UXNA 4HAMA 1XD7A 4UHTA 3REOA 2O03A 1E17A 3DQVC 1LDDA 3MQ0A 2XUBA 3AAFA 2L4AA 5BPIA 2RGVA 3DP7A 1R7JA 2NYXA 2MC3A 1SFEA 1A04A 3JSOA 4A12A 2PMUA 4AIJA 1PP7U 1BC8C 1FSEA 2D2WA 4OIPF 2Z5UA 4KA4A 3LWFA 4RS8A 3RIRA 4I98B 4Y17A 5KVRA 1D3YA 4HDUA 1F9NA 2MH9A 3CUOA 2PEXA 4BH9A 1YTYA 3O2PE 1SFXA 3CO7C 4R8HA 1R23A 3JW4A 3TGNA 4R79A 4LB6B 4S05A 5JVTA 2FOKA 4I0AA 4OIQF 4A5MA 2OA4A 2F5EA 3T5XA 1PDNC 1FOKA 3CJNA 1TW3A 4U7BA 3FHZA 2H09A 3K69A 2M8EA 3GUDA 3K1MA 4EM1A 4IXAA 4PGHA 2HS5A 2VE9A 3KEQA 1J75A 2QQ9A 1KU9A 3GFLA 1FSHA 3KLOA 4MQ9F 1P4AA 2XKPA 5DDGA 3G73A 5J8CA 3GZ5A 2HKOA 4QLCU 1WSUA 2CYYA 4CGZA 4FT8A 1HSTA 2B0LA 2R7FA 1K79A 3F21A 1WWXA 3W6JB 4CXFA 3FXUA 5HS7A 2WC2A 4R1HA 1ZG1A 3WTYC 4G9YA 1HXDA 3BY6A 4OMYA 4P5OA 1E2XA 5CLSA 3C1DA 2YPRA 5DD8A 1FC3A 1W7PD 4CHUA 3FXRA 1T6SA 3S2WA 3QU6A 4L9TA 4MHGA 5LRSA 5L3GA 5D5XB 3F6VA 1FP1D 4U0WA 1QO0D 3VB2A 2ACJA 1KYWA 2Z99A 1FYKA 1X3UA 4KUMA 1T39A 1T0FA 1F4KA 1J2XA 4EGZA 1IN5A 5J8FA 2P8TA 1KYZA 3R0JA 1KU2A 1FBSA 6PAXA 3TOBA 2L01A 3VODA 1ZN2A 5BMZA 1TQPA 1XSDA 1O3QA 1FNNA 2KIMA 3L00A 1JE8A 2FRHA 1XCVA 3BPXA 2P6TA 4O6JA 4EQQA 4IHSA 3LA3A 5LGNA 1HW5A 3KZYA 5E8GA 3ZMTA 4KICA 5HDNA 3TDZC 1I27A 2GAUA 2WV0A 1L3LA 3ZP5A 2NNNA 4BXUA 1J7KA 1W4MA 2IT0A 1GXPA 4ZYHA 5E20A 4EGYA 2K4BA 1BI2A 2FF4A 4ETSA 4XLPF 4B8XA 1K7AA 3IL2A 1USTA 2RVCA 1BIBA 2G7HA 2MH2A 1QQIA 2A07F 4ESJA 1F1ZA 4KIFA 3KP6A 3ABUA 3PQJA 3W6KB 1R5GA 2F2EA 2K27A 1AWCA 4EJVA 1Q1HA 3TOAA 3IRRA 1ZLKA 2YR2A 3V8JA 1I5ZA 4KMUX 1IXRC 1FP2A 1HBXG 5DV5A 3Q5FA 1FZPB 3WTZA 3EYIA 4IF4A 4UUVA 2BV6A 3HYIA 1YS6A 2LDUA 3ML6A 2JPBA 2EB7A 2HGCA 1O3SA 2PI0A 2OAZA 1XGSA 2IA1A 3NQOA 3M1EA 3RJPA 1STZA 4UV8A 2FSWA 2CWEA 5DUKA 1SD7A 1NHAA 3V7RA 3F8FA 1U5TA 1XGNA 5A2QK 2L3DA 3E6MA 3JAMZ 2NNYA 3O6BB 4RB1A 3M7GA 4LLGF 3I0TA 3MEXA 2HWVA 4M6XA 2KJCA 1O7LA 1LDKB 3WTWC 2ZXJA 1USSA 4XBFA 2XAFA 1OMIA 3I59A 4Q5SF 2HTSA 5D5WB 4MTEA 1DP7P 4IPAA 3FM3A 4HDVA 1W5SA 1BI1A 3IKVA 3K1PA 2GA1A 1F5TA 2DK8A 1FWZA 1QGPA 1G3YA 4A0YA 1DDNA 1XB4A 4ENKA 2FU4A 1S7OA 2M30A 4HF0A 2HQRA 3F3XA 3GWZA 2PMHA 3OV8A 2JPCA 1DPUA 1K78B 2ZO4A 4HLXA 4I02A 1IW7F 3E6DA 3TO7A 2RC4A 1BM9A 2VN2A 5K1YA 4HBLA 1J59A 1ZHFA 1ZRFA 2VOOA 2CGPA 4M71A 4S04A 4HF1A 3M8EA 5ED4A 1B59A 2ADUA 3GFMA 1IZ1A 4EJUA 4GGGA 3WE2A 2M87A 2QENA 2R3SA 2JSCA 1TW2A 2ZKZA 2DK5A 2GQQA 4M6YA 2XAHA 3QOPA 1HW2A 4I0BA 2RN7A 4GCVA 1SAXA 1K6OA 5K5RA 3C3WA 3RKXA 1QNTA 3E3VA 2ELHA 1D5VA 1XSVA 4O3MA 1JHHA 2DW4A 1JGSA 1G3TA 2M5WA 1BOAA 5IT9Z 2E7XA 3E6CC 3HRSA 4L9VA 4Q4ZF 4G7ZF 2Z33A 2QWWA 2A61A 3KP2A 2EFQA 1ZG5A 1EH8A 3I54A 4I01A 1I1SA 1XMAA 3B02A 4UNOA 4DQ2A 4AIKA 2NRAC 1R1UA 2VXZA 4D0PA 2L4MA 3M8FA 2DLLA 3WG9A 3BDDA 2FEZA 1XGOA 3RPQA 4JK1X 4HX8A 2Y0MA 1LVAA 4CO8A 3JAMK 2MLGA 1DUXC 3V8LA 3DFGA 3ECHA 4H0EA 3ZMZA 3D0SA 3LA7A 2RDPA 4ENJA 1TLHB 5LHHA 2CW0F 2DQRA 2VC1A 2H6BA 2O61A 4G7OF 1IN7A 4JQFA 4CICA 1HKSA 4LK1F 2MA3A 1JXSA 4RAYA 2VBZA 2XRNA 1U5TC 5LEKA 2FQ3A 5CYVA 4HF2A 2A6EF 1I6XA 5DCMA 4U0YA 1LNWA 3P9IA 2EV0A 3EQLF 2J5PA 1U5TB 4F7ZA 1TBXA 2RQPA 3ZQ7A 3IC7A 3MWMA 4L0ZB 2ZMEA 3GVAA 1LQ1A 1FY7A 3WTSC 3E6BA 1WQ2A 1MDMA 4WCGA 5F64A 1UFMA 3E5UA 3NEUA 4TV7A 2JRTA 4HQEA 2PQ8A 4MTDA 3E97A 2D45A 2Q2EA 2Y48A 2PBIA 4A5NA 4ZZDA 3I59B 4A2UA 2FBKA 5LHIA 1FYLA 5L3DA 1UHMA 5E1WA 3HRUA 1GVJA 3IHUA 4HYEA 3ERED 5HLHA 1G3WA 2DI3A 3E5XA 1U78A 1TQIA 4L0YB 3BP8A 3FWEA 1ONVA 1PUEE 1ZREA 1IN6A 4LJZF 3B73A 4PCQA 2HOEA 2IJLA 2EV5A 4NHJA 5IT9K 2XASA 3WODF 1YFHA 3K0LA 3RYPA 4BNCA 4YIIA 4ZYDA 1Z9CA 1ZGJA 4XSXF 1UHWA 4A0XA 4PZJA 1KQ0A 3VEPA 4Y15A 3V7CA 2P6SA 3HUGA 2F5DA 2DAOA 3I5UA 4EJWA 2QZ8A 1CF7A 4IRGA 3EDPA 4EM2A 4NB5A 2DFIA 4RB0A 4CYDA 2UZKA 2HYFA 2IPQX 2OBPA 2AXLA 3CDHA 3MAJA 3V4GA 4EM0B 2ISYA 4HLYA 2AS5F 2EFWA 2NS0A 1W7PA 1ZG3A 3H92A 1R58A 2ETHA 5E1ZB 1L0OC 4UVBA 2F5CA 2HKXA 5JHUA 3CO6C 4HOBA 2BYVE 3QU3A 4WK8F 1MKMA 3T8RA 5EEHA 4Y13A 5A2QZ 2EK5A 1G3SA 1KGSA 2W57A 4G7HF 5DD4A 2K86A 3GLXA 1RZ4A 3HTSB 4M9ZA 5H6QA 2FBIA 1RI7A 2R7DA 3TQNA 3TO9A 3WU0A 3J80K 3ZN0A 5FD6A 3J81Z 3HHGA 2E1NA 3U2RA 3ZMUA 3MCZA 2DTRA 3RDIA 5EEGA 3E5QA 1TTYA 3FMQA 4KT5C 4N0BA 3SQNA 2QVOA 4LGWA 1S8NA 1YIOA 1R00A 1BIAA 1S3JA 4EMSA 2IP2A 5DCMB 3T0YA 3WE3A 1R5HA 4OINF 2G9WA 3N4MA 4ENMA 4MNUA 2IW5A 2ZMEB 1KU3A 2PN6A 4KIBA 3IRQA 3NRVA 3QPTA 1MDMB 4B09A 2GZWA 3ZMVA 4UV9A 2EFPA 4ASNA 4HV5A 2DPDA 4YG2F 3SXYA 5HDKA 5CJ9A 2P5VA 1YLFA 4BAYA 4ZH4F 4HX4A 4KN4X 4BQAA 2H94A 3VFZA 4L5JA 1OKRA 4IHTA 2Q8KA 2O8XA 4I09A 1SD5A 2OZUA 2XAJA 3N97A 2GXBA 1CGPA 2Z9OA 1Z7UA 4KFCA 2PJPA 2FNAA 3I53A 1O57A 2P7CB 3ABTA 1OR7A 4HZFA 3P9CA 2EV6A 3F6OA 5BQTA 4M74A 3EYYA 5F1RA 4AVPA 5TRDA 5K5QA 2O6GE 3GXOA 4U88A 5ICEA 1IXCA 1Z6TA 3GFJA 2QM3A 5CVIA 3COAC 3FM5A 4GXOA 4MQVA 3GW2A 2YU3A 2ZCWA 5F6FA 2IA0A 3SHFA 5BPDA 1ZRCA 1H9TA 1EH6A 2O0YA 2FA5A 2W25A 3J81K 4GYIA 1AOYA 4M72A 1XN7A 2CG4A 1IAWA 1W7PB 1H9GA 3LQQA 1PP8F 2MLKA 5ICFA 2PFBA 2Q0OA 4CDGA 1MJ9A 5H20A 2ZJ2A 2OQRA 4I2OA 3V7SA 2PLYA 5FGMA 2X4HA 1FX7A 1J9IA 1G6NA 4ZYEA 5D8KB 2COMA 5HS9A
chains in the Genus database with same CATH superfamily
2Q9QA 2HYGD 2G0IA 2O1PA 2UVWA 4QHOA 1TL7A 3MPDA 4FPIA 2N4DA 1U45A 2EZHA 3LSTA 4C3KA 1U09A 4UOGA 1WI9A 2JLEA 1UB9A 1FJEB 4N47A 3NRXA 1ULYA 3DEUA 4JI8T 1C1BB 4CT9A 3GZNB 3CDBA 2RNGA 4K7QA 4B17A 2R8JA 2Z2SB 1MMNA 2HNDA 1R36A 2AE9A 5JDGA 1FF2A 3OYXA 2BMBA 3M6XA 3RTVA 3BTIA 4P09A 1V5FA 3ESWB 1BJAA 3NGSA 3OL3A 4DUYF 4XKCA 4YTMA 5CGMA 2FXAA 4A69C 3RYLA 4DLGA 4JBAA 1HBUB 2VG5A 4DV1J 2K3FA 1YHQI 5FL1A 4UUXA 3PUWF 3H0DA 1GK8A 3I9V2 3O3KA 4HFDA 4DR4F 5JQGE 3DLEB 4LF4F 4M63A 1AKHB 3FC9A 3MDFA 3VR1A 3SDEA 3SFEA 2KIFA 2QTWA 1CQTA 2DPUA 1FJLA 2PE8A 2BY3A 1JHFA 3KYLA 4RKUC 2K9LA 4CI2B 3CEDA 3PHEA 1WHYA 2QYGA 3T1HT 4MFDA 3GFIA 2I5JA 1PVEA 3OTOT 1EARA 4IHJE 3NY0A 3LMMA 3PYEA 3VGSA 3CCWA 5ETRA 3TLWA 2G7UA 1GTEA 5M2RA 1BI3A 1ZGAA 1XPXA 3VOEA 3M2UA 1SFOJ 2ZH9A 2PC6A 1K8AT 2BGCA 1J0RA 2QX0A 2Y30A 1C0WA 1VCTA 1Z6RA 4B9VA 2JWNA 4DMWA 1OLTA 4OX6A 1QSYA 2X68A 3GPAA 1O3TA 3CUQA 2X1AA 3UTKA 2YEVC 3PR4A 1IBLJ 3NEKA 2X1FA 4F55A 2G2OA 1YQ4A 3H7HB 1RUSA 3BBFA 3GWCA 2LQBA 3OYKA 4HTJA 5TISC 4X66T 5FLXY 1TVRB 2LY2A 4LF8F 4FX4A 1J5OA 4NDLA 1NSQA 3MKDA 3IH2A 1H89C 4JOUA 4COFA 4MBQA 3C16B 2W9CA 2MD0A 3BS9A 2LKGA 4LIWA 3ZO7A 3TO6A 1R1TA 5IT3A 4NMLA 2I0XA 1VQ9I 4EZ4A 2QQBA 3A3PB 1T98A 2PG8A 2H27A 1S0MA 3HMJG 3FISA 3FEYB 2WB1A 4MYTA 1QPIA 2NW9A 3J7ZT 2QLZA 1C1CA 1NK4A 1MN9A 1JIHA 2KYZA 4NNJA 1Q1VA 4HKAA 2E7VA 1PC5A 1YX3A 3CSKA 4ILRA 4BHQA 3VU7H 4P2FA 2BBHA 5GAHI 3IH3A 3MMAB 2I10A 2ISZA 5GAGI 4C0HA 4YFNF 2VICA 4C91A 2DMPA 4ENNA 3AXJA 4QPQA 5A8WB 1ELOA 4ECQA 2O5RA 3RB4A 2BXZA 4LF7J 4YDXA 2KT2A 4KISA 3DC2A 5HDGA 2V1UA 5F3TA 1QU3A 3SSRA 3CESA 1BR0A 4PG6A 1S1UB 1NHKL 4B3RJ 1LEBA 1DZ5A 1XNQF 3MD1A 3CP8A 2BG9E 1TWGJ 3R7BB 1U0SA 4OJGA 5KFIA 4C30A 1WI3A 3CCLS 3H0PA 3U78A 4PJJA 1KA8A 3ZNJ1 1BA5A 2NS8A 1AROP 2VFVA 2BYCA 1UX4A 3K2ZA 2P8IA 2W84A 4RWWA 4HX7A 3OYEA 3MCNA 2QA4I 4ZVHA 2M45A 1HLVA 4JUYA 2LY1A 3CCJI 4OIOF 2LSKA 3BQKA 2LEAA 4JI4J 3IWFA 2LD5A 5KG2A 4C8MA 1M1GA 4IR9A 3OIOA 5DG9A 5KFMA 4ZLJA 2HBRB 1Y11A 3NKZA 2QSHX 3CMAS 5KFYA 2HHTA 3UI3A 4DYCA 4BKXA 2H4WB 3KTQA 2W62A 1OYYA 2V1DB 2LKXA 2D74B 2GGPB 3ESLA 4K5SA 1BOBA 3ONJA 4LG0A 4BWMA 3CCVS 1KRPA 3F8MA 1N32T 3RRWA 1XK8A 3MM8A 1LXNA 5F8NA 1S35A 1HTJF 2XAGB 3HX9A 1QPMA 2DT9A 1NJIT 4KGKA 2R5YB 4M95A 4TVAB 4PK6A 1CS4B 3AL0C 3ZN1B 3FF5A 3TYTA 3M6UA 3MMBA 3AL0B 1HNXJ 5GAGU 3FMRA 1DAXA 4IOCQ 3FB2A 3VYSB 4JI5T 3R3TA 3SZ2A 1YSJA 3PEJA 3JSMA 3CCMI 1U1NA 4TNWA 3B82A 2BM0A 4W97A 2W67A 2E36A 3SDBA 3RCOA 4KAIA 3EUAA 3I87A 4NBQA 3I0RB 2ZM6T 4LVOP 2N2NA 4USUA 2EBIA 5ADXL 3CJQA 1WVRA 3MAHA 3L95X 2M52A 2VT3A 4MGRA 1RTIA 4YY3T 3FXJA 3PFIA 2B56A 3TVZA 3QT7A 5FKKA 3KK1A 4ESFA 4IO9Q 3HKZA 4HEAA 4G94A 4WBOA 2J6SA 1LWEA 3PYFA 5CA0E 2LC2A 1RU1A 2ZWPA 2WOMA 3TEGA 4I2QA 4USIA 3LL7A 3BYPA 2OLTA 4V19K 3H9QA 1SPBP 3MFIA 3NRBA 1KZHA 2L7FP 3SBMA 3RRHA 3HJEA 3Q3SA 4MKVA 4FX0A 3S17J 1GXUA 4P7VA 1F36A 1IQTA 2KRBA 4LF6F 3GF2A 5CVRA 1MWZA 2MHEA 3W8PA 4ZDNA 1TR0A 2DOEA 2XQ8A 1D1BA 4AI6A 3VDXA 4ELVA 2WB5A 4U96A 3DLAA 2ESNA 4I99C 4RGSA 5HWXA 4CLPA 1R6RA 4N5SA 4Y2AA 5CVVA 5KFQA 2ACYA 5AIPA 5LCYA 1VK3A 3LSHA 3KLGA 4CO0A 1R8IA 2ZUAA 2W85A 1HA1A 3A0BC 1RSCA 1NJZA 1T9XA 1N48A 2BHYA 1ZR2A 2IS4A 1SUQB 1A0OB 1FKPA 4KPCA 4ON0A 1TKXB 3OR1C 1AB8A 2W63A 2XGEA 2B5JA 4A8QA 1MJAA 4HA8A 4PSXA 4XN0A 5CXTA 2FVCA 3M07A 1Y4ZB 3JTGA 1LNQA 3EGNA 4HFIA 2HHVA 3FQKA 3OR1B 4IQMA 2LJLA 1WD6A 3PDNA 4DF4A 3PJAA 4QWNB 2OUMA 2E9RX 5C7PA 4YQWA 1JKPC 4FBTA 1MSWD 1K1SA 4F0KA 4L5IA 3M8PB 2LVSA 4HWDA 3RPUA 3RIUC 3SCIE 4J9LA 4KMFA 4AUKA 2FJVA 3P8CD 2AWZA 3RRCA 2HAFA 3CDLA 3V4IB 1SD6A 3ASNH 1TZLA 4PAAA 2ZXWH 1TNTA 2CFOA 4PW8A 3ZMSA 1NEKA 3TANA 2GJIA 5D5VB 4GO1A 3KLFA 3PO2J 2ASDA 5CPRB 1IN4A 1X5OA 1RWVB 3ULQB 1HWLA 2ZH1A 3JC6C 2BW7A 2JUGA 3ZXWA 4HEA9 3UO0A 2P7VB 1JKQC 1H0HB 4P2MA 4WXDA 4N9IA 2LU1A 2IRYA 4KYWA 3VYUB 5BR8F 4BE2A 1URNA 2HKEA 1LJ9A 5J6XA 4A6EA 5FMNA 3TP3A 3TAPA 5IP6A 2ODUA 2PEBA 5T7LA 2Z2MA 3HHKA 5ADZA 1Q8BA 1S59A 4NX9A 5CVUA 2LXFA 2EJRA 1U4BA 3DKWA 1VLOA 3MZ8A 4GYGA 1AT1B 1RT5B 5LEJA 4DBRA 4D5CA 3IBWA 3BDEA 5DLGA 3QPHA 2CQ3A 3N2KE 4P0AA 4JX5A 2ELJA 3D67A 2B9YA 2NSCA 4I1TA 4G8XA 3QGHA 4TQRA 3TWZA 3OSFA 2M67A 1ULRA 4JI4F 2XAQA 5D6FA 1PYOB 1HD0A 1S1WB 3M8YA 2MSSA 4U0VA 1UWBA 1ZARA 3VVUA 5C42B 3OL8A 3SZPA 3PYDA 5ILUA 4C2TA 1VIXA 1T9YA 2X9HA 1Y64B 3VWSA 2XVCA 1HG5A 4RGUA 1ZKEA 2Z3YA 4UELA 3T6BA 3OY9A 3E01A 1TV6B 3A0HC 1RT4A 4LFCJ 1Y3KA 5EUHA 2XHKA 3DFEA 2ZOFA 4PWDB 2V8HA 3LSJA 2O7OA 2XRLA 3CD6I 3G96A 3DBLB 4L76A 4ZPVR 2NOXA 3HT3A 2HZTA 4OU0A 5IT0A 3MR2A 1Y3JA 4EJTA 3EUHA 4P96A 1Y8QB 3I4PA 1YZ7A 2C3YA 4HW0A 5D6EA 4OX9F 3KLVA 4UXNA 5ILVA 2EHOC 4WF2A 4Y33A 1D8JA 3Q9VA 4KB7A 3G3ZA 2EHOB 2EKYA 3NOCA 4GKKJ 4IE7A 2E5NA 2J5OA 2LSOA 3D5LA 3T1YF 1YJUA 1OCZH 1B0PA 3H3UA 5ETPA 2W7NA 5ICCA 5AE1A 1QHHD 2KISA 4P9SA 4GVLA 1GMVA 4HKQA 4M5HA 5C24B 3GBGA 4PK4A 2ZM2A 2DU9A 4BC7A 4XOTA 2LKZA 1N34J 2WZHA 1XWMA 4YFXF 5D0GA 2B6AA 4E7KA 2XV4S 3LK42 2NSBA 4QYZJ 4WZQA 3LFKA 1RNLA 2K9SA 5J2MA 3C15A 1UCNA 1ACMB 2HQGA 2LXUA 3I71A 2BJ8A 4RUAA 1QAJA 2EA2A 2F4VT 1OYIA 4X84A 4ZVFA 1Z1DA 4KV8A 2ZJPQ 4XMYA 1BC6A 3H42A 2ZJRQ 1ZHCA 2V26A 5LB7B 1Y0HA 2ESHA 5E3NA 1EB0A 2KFDA 2KLQA 1IWGA 2OCCH 3SMZA 4DV4T 3HHLC 4RB2C 2J0XA 4X4NA 3A03A 4RMNA 4ZOLE 4IRHA 1EQMA 3QMQA 1T38A 5JVGQ 5D8LB 3HHLB 1NPPA 3ZKRA 2BJ1A 3UU6A 3I9V9 3X2QH 3DRSB 3WBZA 2HHUA 5L3CA 2BANA 2WHOA 2Q3PA 4AQYT 1V6HA 3BH7B 2C2OB 3UW1A 4IVNA 5DDPC 1MNDA 3FIWA 1G6BA 5J2QB 3MJXA 3GIIA 2A3DA 2FJBA 1ETWA 4XPCA 5HOOA 3MR3A 3M3YJ 4HNUA 5EDNA 2XYHB 1O7FA 1EQ0A 4B3SJ 3LGMA 3DRXA 3FBFA 2IVMA 4DHVA 3MKWB 4C8LA 3MMJA 1KR4A 2UXXB 3A5XA 1JJ8C 1SL0A 3IEEA 2POKA 1RYSA 2AYEA 5B3SH 3LAPA 2R7ZJ 2E1PA 2Z0GA 2NREA 4JI6J 2F8MA 4BDPA 4FCYA 2DXEA 3FRZA 2AQ4A 2CBJA 3GQCA 5FO5A 2HPLA 3V81B 2OHDA 2YPYA 4USKA 4DPYA 1B72A 4PJMA 2NTYA 1YJNI 2OPRB 3DTIA 3GZ7A 1J5WA 4PQUB 2BG9C 1N5VA 4YB1P 1X4GA 1ZA1B 3J7AO 3C66A 3QAUA 2UXNA 1XD7A 3ZT7A 4UHTA 4ICLB 2HZVA 2BG9B 5IUXA 3G8QA 2M6BA 1E17A 4G1QA 5A8KA 3MQ0A 4YEJA 1U6BA 1L5UA 2UUBT 3ZC4A 3RB3A 4DW6A 2JK3A 4QSHA 2N3OA 3N5BA 2CQ4A 1HNZF 2OEKA 2NYXA 2MC3A 2VIHA 4ZJOA 2HGMA 4DV2F 5G0RA 2RILA 3PIPQ 3TQEA 5K8MA 1FEEA 2F65A 4A12A 4AIJA 1WKKA 1BC8C 3MWBA 2Z5UA 3G8SA 1U0HA 1UVLA 3CF2A 4UF0A 3CJ3A 2CNNB 1UUSA 3HZJA 2GS8A 5KFXA 4Y17A 3CC4S 5KVRA 3E7LA 4ZCKA 4CZZB 1RTDA 3OPCA 1D3YA 2RSQA 4WBNE 2HMIB 1IBKJ 2VVSA 2L2OA 1KKHA 2PEXA 4JI1J 2FJEA 1HWUA 4BH9A 4WIIA 1NKCA 3KZIC 2BS2A 5DG7A 3OMYA 4D9JA 3OYHA 1HHSA 4EOZB 2DY1A 1R9TJ 1SFXA 1N75A 2UUCT 1CULA 1N78A 5KFWA 2UXBJ 2J8SA 3ZEFB 2CZ9A 1R23A 3K70D 1NK9A 1NK2P 4QW8A 2PEHA 3M4XA 4R79A 3NOGA 4PXBA 5E0OA 4X4SA 1ZELA 3IAM2 2E1MB 2WY7Q 1YRUA 2Z57B 2FOKA 3N01A 1DU2A 1M0SA 2CZVC 4LRAA 2F5EA 1XMXA 1PDNC 2MKIA 4B9MA 1X4EA 4A4JA 1RT7A 5K20B 3HOZJ 3HR0A 5EG0B 4P2SA 4I6ZA 3GUDA 3LDQB 1VJQA 5M5WJ 3BGFA 2W7AA 2HPIA 4IXAA 4PGHA 2HHHJ 4AXIA 5JVDE 3B4MA 1TT0A 1CJUB 3Q5EA 4O0IA 1BHNA 2X1EA 2A5WA 4I6WA 4JEUB 3L2VA 3K5LA 5J1EB 3H9JA 3BZQA 4HE8A 2X9DA 2KG0A 3SV3A 1P4AA 3B57A 4X4RA 3BO2A 2XKPA 5EGOB 3KHLA 2IS2A 3CCYA 2PMZA 2HBYB 1WSUA 2FY8A 4ZN1A 4OV6A 3PUAA 3R6LB 3M2VA 2R7FA 5B7WA 1K79A 3F21A 4C11B 2WMNA 3S2HJ 1SVDA 4EZ9A 3QJLA 1VNDA 3ZPOA 2DOFA 4HFCA 4J9UE 1JJ2R 1R4NB 5LT5A 3V6DA 3CIMA 4YT0A 2L08A 3PJ9A 4H4MA 5HROB 1X31C 2UVVA 2H3RA 3CCSI 2RQCA 4CCNA 1LK7A 2QFIA 1SQEA 2IM2A 4MHGA 5L3GA 5D5XB 3D0TA 3F6VA 1FERA 2LHRA 1LE8B 2ZFHA 3VB2A 2ACJA 2RKIA 1IKYB 1T05A 5D3GA 2HDWA 2H5EA 1IDZA 2LTPA 1RCXB 2Z99A 2HEKA 1F2HA 4L73A 2VL8A 4DV6J 4KUMA 4OYIA 3IWXA 1PYVA 2QF7A 1S9EA 2DD8S 2R7SA 3GYGA 6AT1B 5J8FA 2P8TA 2L9SA 2GXAA 3P5BP 3ZZ0A 3KYDB 5KCMA 2D0TA 3RJMB 1JXEA 4IG3A 1D9DA 1TQPA 3GIMA 1OQYA 2CW8A 4JI3J 2V5HG 2HNZB 1GH8A 3QYEA 1JE8A 3ZTOA 5ETSA 1FFSB 3G1OA 1ZK8A 2MEWA 2HOAA 2Y6XA 5LGUB 4CH0S 4TU8A 2VQFT 1WKLA 3EDVA 2ICWG 4I64A 3W1YC 3KZYA 5EYRA 1V9OA 2VG6B 4KICA 2AXDS 4USJC 5HDNA 4UQGA 3TDZC 1I27A 4ZS2A 1UEVA 1L3LA 1HQEA 2FVPA 4BXUA 2ABYA 2VPZB 3OQ2A 4OZ1A 2EH3A 2MJUA 1U26A 2GMHA 1U5PA 5KFVA 4DSIA 4CLFA 2BRLA 3SI8A 4EEFG 5E20A 1BI2A 3DI6A 2FF4A 2HU9A 3HOXJ 2B43A 5AXKA 2VKEA 1UZCA 5ABGA 2V9KA 2FJAB 2JSPA 1U6FA 2KINB 4XAKA 3B6CA 1QSLA 3QATA 4RO0A 2FJXA 3A8YC 3GLJA 2V2QA 2RVCA 3VR9A 1BIBA 5F9NA 2G7HA 2AJ4A 4DUZF 1WH5A 5KAFC 1VQ9S 2CUJA 4IDOA 3D4JA 4IOAQ 2V4RA 5GAEI 2HNYB 3C4XA 3R5BA 4LSNB 3PQJA 3BGLA 1GV5A 4ZMMA 1QVFR 4QWEA 1AWCA 2JFDA 4PJLA 1D09B 1ZLKA 2EK1A 2X3DA 3IG1A 4FKYA 5JHFA 4BGDA 4TZ4C 1FP2A 1XNRT 1RTHB 2Z2YB 4MFBB 4HPQA 2J76E 2COLA 2K5BB 2Y9HA 3EYIA 5B09A 2VXDA 4ZLLA 2WB4A 2UVRA 2V7JA 2CQXA 4WNKA 3JS9A 3CCQI 2M70A 5L9NA 2LDUA 2DFEA 4HFEA 3IM8A 3I3LA 3RKOA 4B48A 4NXNF 3UU4A 1UFKA 5LL6d 2QA4G 3I0SA 4JX4A 1O3SA 4JI1F 2CHNA 1ZV4X 4ZK7M 1NWMX 1OCOH 3PIOQ 4GFBA 2NOGA 2HAIA 1UMJA 1P7IA 3K6GA 4IDQA 3ICLA 2CXEA 2CLYC 3A3NB 2CWEA 2XI3A 3BR5A 4O2AE 1FIAA 2E5LT 4WYVA 2FBWA 2DA4A 3J7A1 2GMJA 4OYXA 4BDYA 5JR9B 2CLYB 3Q9DA 3C6TA 2BQRA 2JZ5A 2JA5J 1R71A 4Z90A 2GIQA 2L3DA 4O3SA 3BH6B 2NNYA 2KTQA 3RUBL 4I0UA 3CCJS 2XNRA 2ZMAA 3M7GA 4LLGF 2C2KB 4QX7B 4CLTA 2OJED 3MEXA 5FVKA 4A47A 2ZBRA 2HWVA 2R3VA 3ANWB 4L9IA 4K50A 1IKVA 2XUEA 4XRMA 3OR2C 1O7LA 2ZXJA 5KFAA 4NPPA 2I8DA 1XMBA 2AJ0A 2ZSHB 3OR2B 1RKWA 2CJQA 1VISA 4D7MA 3HC7A 1U24A 3MUVP 4MTEA 2VHGA 4AC0A 1DP7P 3R7SB 2LDYA 5GONE 1HBNA 1H2VZ 1Y10A 3TLTA 3IKVA 4OHYA 1Y39A 3NWSA 1VGYA 4A97A 2UVUA 3OYAA 1F5TA 2N4CA 3MHYA 4K4YA 1FWZA 1T0FC 4A0YA 2V7FA 2NYIA 3NWGA 2CPTA 1XB4A 2CZ4A 3FCHA 2L9NA 4ENKA 1OY6A 3CJ5A 3PCOB 2XY6A 2M30A 4HF0A 2DR6A 1JKOC 2E5IA 3KJVA 3W2VB 3GWZA 2PMHA 1LKZA 1ZOYA 4DR4T 4Y3OA 2V2KA 4LF4T 3VWBA 3CCUS 3FSIA 4LIRA 4OHVA 2KM8C 2QJ3A 1RXOB 1ZHFA 1NHUA 1ZRFA 5CZVA 2KM8B 1NG7A 3EYZA 4NYZA 1N33T 2OA5A 2J9CA 3R27A 4OZ5A 1RT2B 4HF1A 4KGXB 5D8HB 3H5UA 1VLYA 2B9EA 2ADUA 4O3PA 4EJUA 1URRA 4MIMA 4KI0F 1MU2A 3BSCA 1T33A 3FXMA 2M87A 2R3SA 2JSCA 5HNFA 2DK5A 3PJAJ 2F4IA 4WFBQ 3QOPA 4URQU 1HW2A 4KGVB 4I0BA 3OJUA 1SIWB 4YHHJ 1CS4A 4UR9A 1SAXA 3AA6B 3MAAA 2X9YA 2HGLA 2L7KA 3QYBA 3W5YA 2ELHA 4ZVTB 2CXLA 3ILIA 1XSVA 1Q1KA 3W63A 1JGSA 1QLBA 1OEDA 3ZNUA 3ZSSA 2YKQA 1U8BA 2JQHA 1SKWA 4HYKA 3B54A 2GIZA 1S1XB 4EUVA 1HFEL 1VQ4S 5KG4A 5F3JA 4X5TA 4RAGA 5LP6E 4Q4ZF 3PX4A 1RESA 1X2MA 3FK7A 3I0RA 1GMWA 3GV7B 5C8YE 4LFBT 1H8AC 2WDQA 2NQPA 4ED0A 3PY8A 4ZS3A 3AEGA 2XZDB 3QJPA 2E60A 3FZKB 2VURA 1VQ5S 1V54H 5IOZA 3NLCA 4L72B 5DDRC 4CNYA 4XIUA 2NRAC 5M4YA 4F36A 3TW7A 2JHEA 5DQGA 4HACB 1N5YB 4DYQA 2Z56B 3CD5A 2FEZA 3HD2A 3T9NA 3QGGA 1LVAA 2V0NA 3K57A 2XSJA 3PNVA 4BDZA 3FXOA 2O8KA 3RYHE 1WEZA 3MM7B 3V8LA 1SV5A 4H0EA 2BY0A 3O2IA 2XC9A 5EN1A 3ZR8X 3W5XA 1FEHA 2HOSA 5FY7A 2VC1A 3WAJA 2R7TA 5EZGA 3AD8C 2KHCA 2FGCA 4JQFA 2JMWA 1SJQA 2MY7A 4U67Q 5FNVE 3OHAA 2KXPB 2VBZA 1SJ4P 5M3MJ 5HLFA 1MBEA 2L9RA 2VL1A 2A6EF 1I6XA 1LNWA 3P9IA 4YR0A 2J5PA 1SUQA 5CYMA 4DX5A 1UKUA 1YBUA 3RF1A 3ABKH 3ZQ7A 1FVQA 2YOEA 4FXDA 2GHVC 3EWGA 4DSKA 1VIOA 1RKJA 3I5BA 1RCOB 1IBMT 2XC7A 4Y28C 2KWHA 2MDAA 3PYGA 4WCGA 4JI2T 4C6AA 2WAEA 1HCRA 5J3LA 3MN2A 3A01B 1KNPA 2P0WA 2FHJA 2FLLA 2JOQA 2FHJD 4HQEA 2QEXS 3RQWA 3RC8A 5LA6E 1WSRA 2KFYA 3Q8YA 3D0GE 5CD4H 2QSWA 4MTDA 4JV5F 1T8BA 4J7CA 5IP9J 4XBFB 2Y48A 1RJJA 2PBIA 4P74A 3G6YA 2DRDA 2K40A 4ZZDA 2DL1A 2X51A 1Z2LA 4A2UA 2FBKA 2V69A 4YUDA 1JNZA 2JVRA 1FYLA 4WE1B 4RNNA 1ETXA 4DCOB 3HRUA 4U8VA 2I6HA 2LCWA 2ZEJA 2KSRA 3IHUA 2IYGA 1LWFB 3UULA 2KPMA 3DTEA 4J37A 2ZH5A 1G3WA 2NUHA 4P52A 2WY2A 3BQLA 1QSDA 2DNPA 3E5XA 1U78A 3K59A 5HN0A 3BP8A 3FWEA 1ONVA 2CS3A 4CCOA 2Q6BA 2YU1A 3DOKA 3HFZB 3B73A 3AE8A 1RDRA 3HVAA 3K4NA 3N9MA 3VYRB 3JC6D 2RRNA 3VCDA 4NHJA 3N05A 1U1MA 5L9XA 1U1LA 2K5CA 2PJRB 1XMQF 3EZUA 2XASA 3DXSX 1YFHA 1VI7A 2BZTA 2Y31A 1VF9A 3OSNA 3D0IE 1LWCA 2XGCA 1B4SA 3IRXB 3CD6S 4QXCB 3LNQA 1K47A 1T7SA 2CEAA 2OPPB 4AYBN 2ACXA 3OYLA 4DI6A 4ZTJA 4UTGA 2L9WA 3MVPA 4ZHRB 3VF0B 1JI8A 3DM2B 2C2MB 5EK4A 2QZ8A 3G6ES 3OL6A 2ZXHA 4RB0A 2VQCA 2UZKA 3IAM9 2HYFA 3HXLA 4IT4A 5I42B 1N54B 2QMXA 3CDHA 2RDIA 3MAJA 1W25A 2BVMA 2FLNA 4F02A 3GILA 2W4SA 2W4XA 3CMMA 4FF3A 4DMZA 3K5PA 5E1ZB 1GEHA 1W0AA 4OAYA 2VQGA 3RX6A 2IMWP 2HKXA 2GOMA 1NAQA 2A72A 4X65J 1AJ3A 2AW0A 3QU3A 2MW8A 3BSOA 4BUPA 4DV0J 3W9IA 4WK8F 3I56S 3L3PA 4AQFC 3DLJA 3BG9A 4Y13A 3S16J 2YH1A 4LF6T 3M2RA 1G3SA 2HSEB 2XZWA 5KDMC 5IS2A 1QVGR 2AP6A 1RZ4A 3HTSB 2NPIA 5GMEA 4ITSA 5H6QA 3LK2B 1VQPI 2R7DA 3BT9A 3KYCB 4ED3A 4KFBB 4JI8J 3DMJA 3WU0A 2AQEA 3CT9A 3EPGA 4GK0E 5H6RB 3D0HE 2FVQA 4DR5T 4LFAT 1FT8A 4DV3F 3OLBA 4USWA 3J81Z 1VQMS 3OJAA 4ZC3A 2F8EX 2EHOD 2E1NA 5J0ZA 1HBMA 2R92J 4IRCA 2QC3A 1SC4B 4Q44A 5JLXA 3FXKA 4MMOA 5FLMJ 1RBOB 4G63A 1TL4A 5KFOA 4MIWA 2O66A 4K0UA 3QT5A 4JI0J 3E5QA 1TTYA 1NJYA 1ZTWA 3A4CA 3D6MB 1KBRA 4N0BA 3GN5A 1S6UA 2MKHA 3N9LA 4E6KG 3AVSA 2GVDA 4LGWA 3ILJA 1YIOA 3W60A 4BQOA 1UA0A 1R00A 3IXQA 2FJ1A 1LFUP 1TUVA 4S0MA 2VG7B 2W01A 2AD9A 3TEDA 3IA3A 4QX8B 5DJBA 4LITA 4F93B 3IR7B 4LSLB 2FLPA 2BV3A 3N4MA 2OAUA 3A1YG 1M7KA 2DFHA 5KFTA 2ZMEB 2GZOA 4Q2LA 2VJUA 5IXUA 1MDMB 3KXDA 3QQAA 3P49B 3QK6A 2D7SA 2GJ2A 3ZMVA 1ZETA 4CUGA 1I94F 2EFPA 3MEEB 4OAZA 2DFFA 4HV5A 1MNMC 4MAKA 2WBLA 4DR3T 2DPDA 3TAMA 3THTA 4YDDB 4X4OA 3E0JB 2H1YA 4YG2F 3SXYA 2CVEA 3V42A 2LMIA 5HDKA 3GV8B 3HHLD 3V5UA 1YJNS 4X2BA 4J19A 5AQRB 2ATLA 3EGVA 3P4RA 1P1LA 5D0HA 1SVLA 3IP0A 2NXJA 1FK9A 3IR6B 3OVSA 2D5UA 4DU8A 2H94A 3VFZA 1IM6A 1ITPA 3G4SI 4IDKA 4C3JJ 2CQIA 2QSGX 5KAKA 2QT7A 1IR1A 3PL8A 2FTRA 1IGNA 1U9NA 2C22A 1UURA 2ALYB 1NH8A 2XNQA 5CFBA 2XAJA 2DHSA 3NCQA 3AE7A 3K4CA 1I50J 3FZFB 4O0NA 3N28A 3M4OJ 4CWBA 2PJPA 2JQQA 4KTQA 1SQGA 2FNAA 1AU7A 1L0VA 5HYAA 3OXFA 2CPFA 1A36A 4L3NA 3RB0A 4MLKA 1O57A 1VI0A 1E3OC 2P7CB 5KFEA 1HNVA 3GSIA 3SWHA 2Y0SN 2EV6A 2LT3A 2PGCA 3F6OA 3BGRA 3DLKB 4IH6A 3QWLA 1IXKA 3EYYA 3S8PA 2KRCA 5F1RA 3UD5A 4IDZA 2P9CA 2YDRA 2PSZA 3RQ4A 4BC9A 3MUMP 1DURA 3EVMA 2O6GE 2DOAA 2HIYA 2X67A 2QL9B 2IMOA 3CJ4A 4HDHA 1UL3A 1YGYA 4B9NA 3GFJA 3HOWJ 4KYZA 2VFRA 4C0BA 1H7WA 5K8OA 1R3NA 3CCEI 1E6YB 1ZZNA 3SFDA 4MQVA 4Y7NJ 4NI2A 2YU3A 2Z58B 2FYXA 3BQ0A 2RA1A 4C98A 2DNYA 4CLLA 2B63J 3UNGC 2YNFB 4Z6YA 2BXYA 2F7VA 1XWLA 4I6AA 4ANEA 3QZ8A 2E5JA 1W2BR 1ZRCA 1PILA 2O0YA 2FA5A 2BDEA 1JLCA 4OYPA 3NAIA 4O3QA 1XN7A 2XI2A 2CG4A 2CIMA 4OX9T 5C4JJ 4BJMA 1TMJA 4O4JE 4UVBB 2PFBA 2R2RA 1NK3P 4A48A 4Y2KA 5H20A 4K4VA 4DR2T 2ZJ2A 2VKOA 2OQRA 4BL0B 4I2OA 3DRPB 3S8SA 4I0WA 2ADCA 5FGMA 4GRSA 1FX7A 3OVUA 3GWHA 3EGZA 1QDUB 2IRXA 4IH7A 4HFHA 2IAJB 1TKZB 4XONA 4RAZA 2EG2A 3GTLJ 2OTJI 3NXZA 3KETA 4P9FA 3PW0A 5I3UA 2XB2D 1S9GB 5FRNA 3AJDA 3CMLA 2AF6A 1SH2A 3D66A 4DR6F 3GMEA 3BCBA 5C25B 2MTLA 3HVRA 1KEKA 4ADZA 5K14A 5EDWA 2EZLA 4ECXA 3KX2A 2CUFA 2X66A 5KOXA 3A1YA 3MFKA 4L9NA 1IBCB 3JAEA 1UPMB 5F41A 4OHWA 5AIQA 4NLWA 3Q8QB 4TN2A 3GIKA 4NLRA 1IQZA 4ID5B 4FE7A 5F0CA 4IDPA 2HN1A 3M8ZA 3N6MA 4LR9A 2XMAA 2C5IT 1L3KA 1SAUA 5BNGA 2CPZA 3IGNA 3GTGJ 5D78A 2CMPA 1CJUA 3DLGA 3KHGA 4DX7A 2XZTB 1N52B 5J1EA 1Y0UA 3GMGA 5DDQC 1YRXA 1WRJA 2XGQA 4JI8F 2HWHA 2VA2A 3AY0A 4ZCMA 3NVOA 3DCFA 2EWNA 4M5JA 2DHRA 1G3OA 4WU2A 1NEEA 3Q8PB 4DBQA 2DA3A 4O44A 4IG0B 5I3PA 3PUXF 2EIJH 2PX9A 3KLIA 1WPKA 1E1HB 2VFUA 2IW5B 2H8RA 4LMLA 1KNZA 2HK3A 2U2FA 2LVWA 2DNQA 3ZYLA 3E51A 5L8RC 3WHBA 4H63H 4C3HJ 2M4MA 2IJRA 4XDCA 3NWRA 3VRBA 3OHBA 1JLBB 1NB7A 2ZD1A 4C2MJ 2CQQA 3SZTA 4UV9B 5HL7Q 1EZZB 3VTIA 4ZVRB 4BEHB 4N8NA 5LHGA 3LSGA 1KHVA 4U74A 5KX5E 5D4PA 4L5GA 3JQKA 1YE9A 2LMDA 2DNHA 1LE8A 2HBZB 4ERRA 1OPCA 4K2EA 2XO7A 4II3A 5CVJA 1IRZA 3F9KA 1R22A 3T1HF 3DKXA 2OPSA 4KT6A 3UR0A 1NK0A 4NE9C 3I4MJ 1U9OA 4PSWA 4L0RA 3M1VA 3OTOF 2FMYA 2AMCB 2ID3A 5HMYA 1WWHA 2VOPA 2V9VA 2DO0A 3CO9A 2W1OA 2QL7B 1OO0B 2AYMA 4WWCA 2N82B 1GDTA 2JZYA 4L74A 1TQMA 1EETB 3HSFA 1WKMA 1BC7C 4NEYA 5D4SA 2B7EA 3JRAA 1TL8A 4KIGA 1B70B 1NCLA 3WGIA 3BLYA 5IHYA 3MZHA 5BMVE 4H63V 1XR5A 3SFUA 5LOVE 4CCLA 2RKHA 5FKOA 5LGUA 1REGX 3MR6A 4I7FA 4ISSA 3SYZA 4UVAA 4DV2T 4A8MP 3QOFA 3Q5WA 2DTZA 2VODA 2V8GA 4X66F 2L3MA 3TI0A 1JJHA 2XHCA 2WTFA 2ZM8A 3UNYA 3QP6A 5JLWA 3TZXA 2P81A 2V4JC 4ZVPB 2HDDA 2HRTA 1HNWF 4U7DA 2M8GX 4FS1A 5KG5A 3Q24A 4QPTA 2JEGA 5H2FC 4OMZA 4F52A 1KQ8A 3LPYA 2IBOA 2MQMA 2ZOGA 3KDSE 4XM3A 1JLGA 3CPWR 1DQ8A 4NC6A 1UJ5A 4M3BA 1P92A 4FHTA 4HV6A 3GEZA 1XCBA 1TWFJ 2NAZA 2MYFA 3AOBA 1B9MA 4EZHA 1AHDP 4JYAJ 3PTRB 4RA2A 3M8RA 2W2NP 3BQZA 4YB5A 2GVZA 1I5OB 2OIHA 1A5JA 1HQUA 3M1CA 3R6SA 2OPQA 2D9OA 2LA6A 1TZ0A 3BR8A 2Z2LA 1FKOB 2H89A 1B6AA 1NUEA 2Q9QB 3CGIA 4LF9F 5HCJA 4XICA 1TL7B 3TA0A 2ZNYA 3LANA 2P9GA 3DRYA 3QNWB 1IV6A 4QW9A 2YS9A 1KQFB 3AEDA 2PG4A 2AX1A 4NLPA 4MT1A 3HKEE 3FK4A 3M8QA 3GTKJ 2HNDB 1IN0A 3TX0A 3TAQA 5BOXA 2CV2A 3PJWA 4XRSG 5GAHJ 2G2ZA 5IQQA 4IUFA 2KB2A 3OIQA 3PW5A 1OFCX 2DT6A 5K5OA 4A3LJ 1VK8A 5B0FA 3VHQA 2IVFB 4A3CJ 2J4GA 2VBXA 4TLQA 3Q8SB 2HXIA 2VG5B 3TX8A 3PXGa 3BTCA 4A3FJ 1ZKGA 2KT9A 1YW9A 3GB0A 1RB0A 2KJVA 2E19A 4C8YA 5HXHA 3KKFA 1FNXH 5FXZA 1Q81T 3BN4A 2Z16A 3KPHA 2BE5F 3SDEB 4JV0A 4DMVA 4LMJA 2B9WA 5IY5H 2KZ7B 4MIAA 1G1XA 5HODA 1F1BB 1AFIA 1UA1A 3ENVA 3M9NB 3FBIB 5FP3A 5F08A 1KTVA 2FDNA 1ON1A 2WVCA 4EO6A 4NCBA 1Y9OA 2LQ9A 4N56A 1FT9A 4NXMJ 1NHVA 4AL6A 1DGRM 5F8MA 1A35A 1ACIA 3MM6A 4LF5J 2AT1B 3UKGA 4EU0A 1N32F 3ZMDA 1HKQA 2I5JB 3DPLC 2V7IA 4DFMA 2W9AA 5D4LA 4HT7A 3M2UB 3P4PA 3HKCE 3AAIA 2L0KA 2DNGA 3OYBA 1OPZA 5D5UB 4ZYGA 3CUQC 1OJLA 4F4KA 4JI5F 3EJMA 3C18A 2RT3A 3CUQB 1Y1WJ 3NZPA 2LSIA 3BG5A 3GTQJ 2VV5A 4J91A 3AXMA 4NOHA 2KXNB 3R0AA 1Z0XA 1XX5A 1SC1B 2M2BA 2YDSA 1VQ7S 4DV7J 3K1NA 3T1BA 1MZBA 4I2PA 2CRBA 2RF2B 1HS7A 3W6VA 1FXRA 4Z2YA 4IX7A 1J5OB 5A6WA 4C8ZA 2CA5A 1ON2A 4W98A 5AQIB 2XSDC 4G1IA 2ZM6F 4ILAA 4B6XA 3PR5B 2KKHA 3MD3A 2W9CB 4DDFA 3SIPB 3X3UA 4WYWA 5HLIA 1NDKA 2MSYA 4YY3F 1JGGA 3H40A 2RAEA 2UU9J 3KCCA 2RQMA 4MFEA 3FX3A 5C5JA 4KJIA 4WFYA 2GCFA 2FBHA 4L9JA 2RVJA 1X4AA 3T19A 4DX6A 5C3JA 2GHPA 3DEEA 3KMSA 3GTYX 5GMKa 1JKHA 4M9XA 4OMFG 2FVSA 3S1TA 4IOCF 1QUUA 4OLPA 3VAMA 1V4RA 4WKYA 1X1PA 2CJXB 5CD4A 3HDDA 1QVUA 2ZBPA 2ILZA 4UF4A 3UVJA 3EM1A 2F5FA 4U7CA 4WXCA 1U2CA 3BGOP 1YIJS 2XM1A 1B0TA 1IO2A 2STTA 3I96A 1VCSA 3F22A 2RUGA 4RB3C 4X62J 2Z8QA 4DV4J 2CXFA 4QYZK 4K2XA 2UXDJ 2PA3A 1XERA 4HTIA 3C7JA 5LG4A 1WCMJ 4ANDA 3NP5A 2RV8A 4A93J 3K3NA 1MIVA 4R8UA 4U9RA 3T8TA 2IA2A 3ISPA 4KDPA 2D1VA 1Q4RA 1Y01A 2CQCA 2YH0A 3OFEA 4AQYJ 3QRQA 1B7TA 4KHPF 4XRSA 3W62A 1IJWC 3BO3A 1VJWA 1P9QC 3H35A 1BN5A 2QL5B 4IO9F 1YQAA 2PMWA 2YINA 4EAHA 4IO1A 2DPIA 5C3EJ 3CLQA 1IJEB 1MGTA 1WEYA 4DCJB 3HM5A 2OU2A 4BS9A 2DNXA 3DXJF 1BQNB 5E3LA 1H0MA 1FKAF 4BHPA 1H7XA 4NXNT 2WSCC 2VKZG 2MFZA 3FXQA 1N5YA 1SKRA 3DWLE 1WJAA 1HDPA 5AQFB 1VTNC 2XWXA 2VB6A 4BHCA 1Y00A 3AB2B 4FKXA 1MIJA 1ZBTA 1G7CB 2LF7A 1Q16B 3M6WA 3ZFVA 3PJXA 4XSZF 3TW6A 3QRFF 3H59A 3HTUA 2XMMA 1SL2A 3HSJA 4WTOB 4LT6A 4BU2A 1Z4UA 3OYMA 3ZJ1A 2C2DA 4HRIA 3NZQA 1FFGB 3PFYA 1VFJA 4N76A 1G2EA 1S1VA 5HAXA 1LKXA 2LNBA 1RADB 2XM2A 4WK1A 4CDIA 2ZUGA 1N4LA 4KKOA 2RAQA 1R8HA 4KBMB 2EEYA 4U6PA 4B3XA 4LG0B 1VBKA 2XIGA 2K9QA 4OOIA 1UK5A 4DNCA 3MM8B 1WJCA 2DH7A 2UUBJ 3HOVJ 3CCLI 3R4KA 3CTAA 3DDKA 2A2DA 1IN8A 4GO7X 4TLRA 1J5ET 4DOZA 1KK7A 2A6HF 2K4JA 3AEFA 3ELKA 3H5AA 4P9UA 1D8KA 3I0OA 1FJGF 4GO5X 4P55A 4GVBA 3CXCR 1FMVA 1WUUA 4ECSA 2XF5A 3OLAA 3AHPA 2WVDA 3MOJB 2DJNA 4OIRF 3MMBB 3Q2SC 1QY7A 4F67A 4YN3B 3JSMB 4G6DA 1BQMA 1RAEB 2MZTA 3LP0B 3JAMY 2E5HA 2LXIA 5DQWA 4IQ4A 2LRDA 4XK8C 1WLXA 5H9FJ 2FNPA 3JTHA 3A01A 3R8YA 3IRWP 3BJ6A 3CMAI 1VQSA 3DYAA 1GHCA 4AWXB 2A3JA 4KO0A 3SYTA 2DH8A 5L3BA 3MKYB 2B4PA 5L1LA 3CJQB 3RIFA 2QLBB 4WFZA 5LMUJ 2L48A 3H5NA 2YKOA 1RTIB 4MK7A 1DRZA 2M1BA 3ABMH 4X64J 4PXCA 1L3TA 4B3TJ 4I67A 1EHWA 5J1RA 3B6BA 3KK1B 2KXFA 2Z30B 1ZGWA 1LWEB 3LBXA 1LWFA 2LECA 5KFZA 3HHHA 2WOMB 1Q7LB 2I1RA 4K0KF 2CE7A 4C4WA 2AJQA 3TA1A 3K5MA 3AA1B 5MAOA 4QU6A 2VKRA 5L47A 3SSSA 5FFXA 2WCXA 2EIKH 4HQMA 2HQNA 1I6ZA 2JLFA 2E1AA 4FXVA 1IUYA 4EJOA 4N4NB 3DGVA 5JXSA 2G1DA 4P75A 4ZVGA 4KGZB 3IWZA 5GVQA 3CJ8A 5C2TA 4EV0A 2M4GA 1S0VA 2ZKUA 4KIAA 3KLGB 5JTGA 2B7CB 4DR7T 2NXEA 3MZYA 3MI7X 1WJ5A 2OPPA 2DHHA 3OIPA 1VR6A 3CDAA 2BVLA 3ZYKA 3IP4B 1Z7LA 1W9RA 1REPC 1N56A 2CJ9A 4FXWA 1FKPB 3G8TA 5LM7E 4CM2A 2VKDA 3LQVA 2C3PA 2B5JB 3J7Yq 1U2WA 4ABZA 4OJHA 2DR7A 3Q83A 5DQVA 3BQIA 3ZCOA 1JLAA 1HI0P 2RB7A 1NPKA 1T2KA 2MC4A 2HHXA 3LWLA 2DISA 3PKMA 1KU7A 2CPEA 1YITS 1ZYQA 1ZAVA 2VQEF 3EDQB 2HTJA 2XB0X 1TAQA 4ZZLA 3C6UA 1FESA 2IC9A 1JT0A 2CQ2A 5JUMA 3I55S 3F8BA 2EG1A 2M0MA 3R61A 5JRCA 2M7AA 2CSOA 2EFNA 3GCXP 2LEHA 2F4VF 2LG4A 3ZMSB 2C6YA 1OWXA 5DM7F 4NUUA 1HW9A 4ZDLA 1B7YB 2P5KA 2Z1DA 3KLFB 3G82B 2L7MP 4ZDPA 2OP5A 3H8YA 4DUTA 2X0LA 2L54A 1VQYA 3W7BA 5HS8A 3BR2A 3HIFA 5H6RA 4RDUA 1KQ9A 1LEAA 5HBMA 4ILUA 1Q95G 1KVJA 1CG2A 1JB0C 2VQFJ 3PRDA 2YU9J 1V3FA 2Z2ZA 2CWYA 2ZSIB 4OYZA 1WTFA 2J6UA 1UHSA 4X4TA 3PX0A 4QH4A 1ZM3A 1D3WA 2VI6A 2I8EA 4XLAA 3F57A 3HFKA 5T7LB 2XTLA 4K5RA 5F8LA 1RKTA 1IDYA 1RLDA 1F5CA 2Q79A 3K17A 1HQ2A 3D68A 3OWTA 1Z77A 4AKLA 3HRMA 2QLXA 1L3SA 2HVSA 4BQNA 2ZJPF 4R25A 2MB0B 2F4FA 3REOA 1BR1A 2ZJRF 2P9BA 1PYSB 1S76D 2OUGA 3AAFA 2L4AA 2KZGA 3I9YA 1BY9A 5H1SV 3DP7A 2E9XA 2XAQB 4F3OA 1FWPA 1D8ZA 1S4EA 1UWBB 1A6LA 4RBTA 3JYTB 1SFEA 2EFGA 1A04A 5JVGF 3CK6A 4WXWA 5A8RA 1PP7U 3OTBA 5KFCA 4ZI3C 1JK9B 1UETA 4RS8A 2HWIA 3E01B 5C2GA 3RIRA 4I98B 1VQKS 1TELA 3I32A 4EGWA 1RT4B 4EB6E 4FYYB 3V4MA 1YG0A 4AIDA 3MEDA 2RU3A 4QH1A 2DGOA 1UZDA 2ASLA 4F8HA 4Y3CA 2J0WA 1KFYA 1UJ4A 3EUHC 1FDAA 2ZHBA 5JVHQ 2KLOA 3OS1A 2V68A 1FE0A 1IWAA 3MKLA 2F9JA 4IHWA 3B78A 5JDQA 4DZPA 3KWMA 4OLOA 2LFBA 2ZITA 3EICA 1NDLA 1M5HA 2KU7A 3JW4A 4LRBA 2MQLA 2OGUA 1R43A 4UXNB 1RHMB 1QZEA 1TP7A 4ZJLA 2I38A 3PE0A 3A8EA 4LB6B 5A76A 1XTZA 3ELHA 3MMCA 4YTNA 4IEJA 2VD3A 1WJBA 3IWLA 2E2JJ 4OIQF 1SVMA 4CH7A 2OA4A 3TLVA 4N7TA 5F8HA 1IV8A 3CJNA 1OYDA 2M8DB 3MR7A 4G2AA 4CI3B 2AIRB 1VC5A 3EABA 2H09A 5KT4A 3ZTPA 5BYRA 3K1MA 1EIYB 4EM1A 2UUCF 4WF9Q 1LW0B 2H88A 2HS5A 2VE9A 4LIVA 2IM0A 2L9VA 2E5LJ 1J75A 4QIVA 1KU9A 3GFLA 1YRNB 4J00A 4MQ9F 1LVFA 5CCLA 4AUXA 1K61A 1IVZA 2VUMJ 3UCGA 1WG5A 5J8CA 2B6AB 4M94A 5J47A 4QLCU 1YBTA 2NVUB 1JLQA 1OMSA 1QHGA 4LRCA 1HSTA 5J2MB 1X5TA 5J2TE 2B0LA 3C15B 2PIIA 5E3MA 2B76A 2ODVA 1YLXA 5LMNJ 1I3OB 2D9DA 2HFZA 4KV8B 4CTAB 1F9EB 2V50A 4IKAA 4GOUA 3LSVA 3ERMA 5KHDA 4ZI2D 3BZKA 1HXDA 3BY6A 3DEWA 2QGFB 2XSBA 3JSRA 4E7IA 5F8IA 3C1DA 3CDWA 2YPRA 3TJ9A 3FZ2A 1UG0A 3DLLQ 4YSXA 1T6SA 4LMZA 3QU6A 5ETWA 4L9TA 2ROGA 3HL6A 4DV3T 2MQNA 1UCUA 1A9NB 1HNIB 2MQQA 3DRPA 4B9UA 1FP1D 2CQHA 5L3CB 1QO0D 3DJBA 2WVEA 2W8LA 4LOCA 2LK2A 4OX8A 4BXXJ 4W92B 3PZPA 4EATA 4NA3A 2FJBB 2C2RA 5A2QY 2VPYB 3IUOA 1V9DA 4DR4J 3NGUA 1IBLT 1T39A 4ECWA 1TKZA 4LF4J 3G2BA 2D0UA 3KG4A 1RC9A 3KBTA 3LUYA 1AUSL 1J2XA 4EGZA 1IN5A 1OEDE 3AG4H 3K89A 2Y9ZA 4J9MA 3R0JA 3BQ1A 4UB8C 4OYKA 6PAXA 3TOBA 3VODA 3VSKA 2JPFA 2QIFA 3Q0WA 2YKMA 1O3QA 4M1PA 1FNNA 4IRKA 2KIMA 3NGTA 1YJWS 5HSPA 4BXFA 4EBCA 4QWAA 4Q8FA 2DNNA 2FRHA 2W4PA 4EZ6A 2C2EA 3BPXA 4EQQA 2P6TA 4O6JA 5EK3A 1R0AB 3JCUC 1T03A 2MKKA 1B72B 3L7OA 1HW5A 1UAWA 3JAMU 3KJFB 4Q5VA 4EYIB 1O4XA 2JA8J 1WHVA 2PJQA 1SJFA 4CA0A 2KNDA 3O1LA 2WV0A 2UXNB 5HVHA 3P8BB 2W4CA 3WHCA 3ZTSA 3ZP5A 4PUOA 2NNNA 1ORKA 4UY85 2K24A 5KFFA 4G1QB 5A8KB 1FO1A 2F9DA 5HXEA 2IT0A 1GXPA 1ZAXA 4ZYHA 2MYSA 4IG0A 4YSZA 3I9ZA 2R7RA 3J7ZI 3G1MA 1S72S 1EJ9A 1B7FA 3WI3A 4L3KA 5G0RB 1WRDA 4LF7T 3SCKE 3NS6A 4OI6A 3S1MJ 2BOAA 2LFVA 4F7VA 1U0HB 2CNKB 4LFBJ 4UF0B 2QKMB 5L4HA 5HXCA 1QQIA 2XSFA 3W15B 3O5TB 1SE7A 5T41A 4ZPTR 2ZHOA 4KIFA 4CN4A 1RTDB 4B3RT 3ABUA 1R5GA 4AKIA 4X4PA 3QFHA 2XAUA 4R5PA 4KRWA 2CW7A 4EJVA 2D2SA 4WXOA 4B9LA 1Q1HA 1UP1A 3IRRA 2GQCA 2NR0A 1WC5A 3RAQA 2YR2A 1CULB 1IXRC 4K8RA 5G4DA 2X0HA 3TUZC 5T14A 1HBXG 2JH3A 3RYIE 1CJTA 1JTYA 1FZPB 3U1NA 3MXHP 3OS2A 3TRGA 1YQ3A 2BQ3A 2D9PA 2DNRA 5B1AH 3S7RA 3GYNA 4WKRA 3GFHA 1UX5A 3JAFA 4A3BJ 3HYIA 3W2WA 3HI9A 3IS9A 3W9JA 2DMTA 4AM3A 2ZDOA 3ML6A 4TY8A 1YJTA 4BWJA 1X9WA 1F6TA 4M8LA 2BUNA 1RT7B 2AJ2A 2HK2A 2K2PA 4CQIA 4WWSA 1HDDC 2VPLA 3FZBA 3GIRA 2PI0A 3CC4I 5HXRA 3FBCA 3K8VA 3JTPA 1WC4A 3NQOA 3AODA 1XNRF 3TVKA 1STZA 5KFNA 3A7MA 3RLFF 2FJDA 5DUKA 1XNQJ 3V7RA 4F4XA 3ETOA 2VFTA 1U47A 4NLUA 3VYTB 2E1OA 1JTXA 4PRFA 5E33A 1WR6A 1U1RA 3LP2A 4GIWA 2RRBA 5GAEJ 3E6MA 4U72A 2MJNA 3M2VB 1ZR4A 4K4XA 4GMKA 3N6NA 2BQUA 1HNXT 3U27A 4ERDA 3T8OA 3I0TA 3UDVA 2IBKA 4Q0BA 1D5YA 1IUJA 4IOAF 5BYQA 5E3PA 3RH3A 3OYGA 4M6XA 2HZAA 3PV8A 3V6DB 1LEOA 4A8SA 2OMLA 4KC5A 1HWKA 1LDKB 1CJVA 2W1BA 4H4MB 4XNFA 1UFWA 5IV4A 2A10A 1OMIA 2CG8A 1VQ8I 3I59A 4Q5SF 1O5JA 5TGTA 3ZSTA 5D5WB 1BL0A 5L3GB 1KWMA 5B66C 2WAQD 4UUSB 4F0MA 1W5SA 2HIQA 3UD3P 2DCEA 3X1LB 1T05B 4U33A 4AKGA 5D3GB 2DK8A 4IRDA 1HX1B 4B47A 1R7IA 1SC6A 2JVGA 1Q79A 1FKOA 4LG3A 4KUMB 2Q9QD 1S9EB 2NVYJ 3IR5B 3CCRI 3Q8VA 1DPUA 4YFSA 2LSYA 4IG3B 2MKSA 2VN2A 3RI5A 7AT1B 1ETKA 3ETVA 5IYDJ 3OUYA 5ETQA 4YOEA 3PIOF 1NK5A 3F0CA 4KY3A 3Q23A 2WU2A 2VOOA 1U1QA 4TKTA 3FRYA 3AE3A 3J80U 3MZKB 4ZP6A 3FBNB 3CC7I 1B59A 1SBRA 4B9TA 1IZ1A 1B0VA 2DNZA 3AJ1A 4NLVA 2VUGA 2K3KA 4ZPWR 1IKXA 4DWIA 2ZXIA 2QENA 4EXTA 2CUZA 5EK2A 3P5TL 4ES3A 4AYBA 2XAHA 4DCPB 4AYBD 1G59A 5D6GA 1HQEB 2RN7A 1K6OA 1RT3A 2CPJA 2XMJA 3E3VA 1N33F 3AOCA 1D5VA 3DI6B 4FNIA 4CYCA 1JHHA 2DW4A 2IGOA 3RGIA 1G3TA 2VKVA 1NXIA 2JL9A 4ASKA 3C64A 3EMTA 5IT9Z 2CQGA 3AE9A 2E8IA 3VALA 1XTAA 5IT9Y 2CV0A 2E7XA 3PFOA 4NCAA 4XQFA 1VRUB 4L9VA 4LF6J 1T02A 4BY7J 3KP2A 2EFQA 1ZG5A 2M0GB 3B6AA 3L7UA 4I01A 1K83J 4QR2A 1I1SA 4XAXB 1XMAA 2QLFB 2Q6CA 1Q5YA 1RQ0A 1YRTA 4AISA 3CIZA 3UFGA 4LFAJ 2PI5A 4G6TB 2L4MA 2C2NA 2JLGA 1TTHB 3IG1B 1ETOA 2OH2A 3SV4A 2I5UA 3RPQA 4HX8A 1WSVA 1VYAA 2YWKA 3JAMK 5DS7A 4M5NA 2RF2A 3SEZA 2MLGA 2HPMA 4MJKA 3OVAA 3CQCB 2FQ4A 3TW0A 2EPIA 2ECCA 4LFBF 3B8HA 3GFZA 3ITHA 4I4BA 3KHHA 2X9XA 3ZMZA 3LA7A 3AE6A 4WP3A 1MIYA 4A98A 4ENJA 1SQFA 5K7HA 1HNWT 2LKHA 3QOEA 2QYCA 1R8CA 2O5DA 2BW3B 1ERDA 1BW6A 2X6OA 3EAMA 3I0SB 1HKSA 3O8WA 5K7FA 1DY3A 6FD1A 2FUPA 4LK1F 2WB1D 1RT6A 4IHYA 3FKJA 2XRNA 4X1IE 5J40A 1H6KX 3JQJA 5CYVA 2LBFA 4HF2A 5DCMA 1NDPA 4XLCA 4E7ZA 3QYYA 3EQLF 3NS5A 2Y1JA 2YWWA 2RQPA 3QB5K 3BBBA 2CAJA 3MWMA 3C6TB 4HI2A 4L0ZB 1LPQA 3ILLA 4RBUA 3GVAA 1FY7A 4ZZCA 3S01A 4RUBA 2CJAA 2FZKB 2R42A 2KRHA 2LM9A 4CN6A 4DFPA 2Q1ZB 2RDDA 2EFVA 2FY1A 4QR1A 4JEHB 4TV7A 4CO1A 4E7SA 3GCWP 1W7WA 4JP0A 4IREA 1MH3A 1K6YA 1PG5B 4LF9T 3SXLA 3CJ0A 1IKVB 4DL2A 1S1TA 2KFZA 4OZNA 1KLMA 5BR8J 3W66A 3CJRA 2Q2EA 2F3JA 4P10A 3R1HA 2HVHA 2BY1A 5DTDA 2HN2A 2E66A 2LA4A 3FEZA 4FE4A 4X4QA 5L3DA 2X9WA 1HBNB 1RWNB 3KLHA 1IBMF 5E1WA 3N9OA 4WZXA 4J9OA 4JI2F 5DABA 2A05A 4OI4A 3P4QA 4PG5A 3T1AA 2R2SA 1BQNA 3ZZTA 5HLHA 5GPCA 4A3MJ 3LO3A 3VSLA 2IC3A 1YK9A 3CF5Q 3KJVB 1TKTA 4ZXLA 2JA7J 5AJ3F 4IQXA 1TQIA 1RWPB 4ECTA 1YKWA 4L0YB 1PUEE 1IN6A 2FB0A 4PCQA 2CQPA 1U1KA 4GKKT 5E3AA 2IJLA 2EV5A 5KG7A 4M3FA 3R84B 2PTFA 5HEGA 4DSJA 4Y4RA 5AFUL 1WOOA 1SVOA 3K0LA 5TAOA 3RYPA 2WSFC 3NL0A 4BNCA 1J2VA 3N79A 2JMHA 2H3EB 2IDLA 5KFHA 5HEJA 2AZ3A 2Y0SA 4XSXF 4DS4A 1UHWA 5FKMA 5GP9A 2CHOA 3QO9A 1Q7YT 2IUBA 3RBZA 4RX6A 5CKTA 4HWHA 1MU2B 3VEPA 4B4CA 1HBOA 1NZAA 1H72C 5HJYA 3HUGA 3UU3A 2DAOA 4YJ2E 1MBHA 3JRGA 3H2VE 2VDIA 2XQ5A 4IRGA 3EDPA 1MWYA 3MAAB 4CYDA 1Z8UA 1WJEA 2IPQX 2EQRA 2OEJA 2AXLA 1OEDC 2HWTA 4OX9J 2K1RA 4I6YA 1RHJB 5GAHU 1X4PA 3TP2A 1PGZA 1UVJA 2AS5F 2EFWA 2NS0A 1W7PA 1OEDB 3VZHA 1TT5B 3H92A 3CCUI 3LP0A 3FGVA 3K7RA 2HI3A 3U02A 2R4GA 4ZEYA 2F5CA 4NZ7A 5JDHA 5JHUA 2Z6EA 1BE4A 3T1YJ 2BYVE 1GNKA 2RU9A 1KS2A 3E8OA 2NXCA 1MKMA 5EEHA 1B3TA 4ED6A 2CRLA 2DITA 4RNMA 3ZZOA 2EK5A 3VR8A 1EJ7L 2W57A 2JA2A 1W1WE 2K86A 4NASA 1H98A 4W90B 5FXXA 1QD1A 4R0JA 5F0UA 1BD6A 3HBLA 4M3EA 1DBDA 1YJVA 2DY9A 3TQNA 3TO9A 1TL1A 5LSLA 4FETA 1YXRA 3J80K 4B3ST 3HKZD 4U2ZA 4WP9A 3ZN0A 2XSJC 1RR8C 1V3SA 1MLAA 5FD6A 5ABFA 4XKWA 1U2RA 4DU7A 1UVMA 1D9AA 2DEJA 2CPXA 2MG4A 1V5IB 2XSJB 1YBAA 3LSMA 3EDRB 4CCKA 4K4UA 4JI6T 1SV5B 1D0ZA 4OYOA 3J7Z5 3MCZA 2GFFA 5EEGA 1VQ4I 1VRBA 5F3ZA 3NBXX 1ZPWX 4KT5C 3LFUA 2EZKA 4HNTA 4Y00A 2LOOA 3K3QC 3SQNA 2H7OA 3BREA 1OYEA 4D1QA 4DQRA 2CQNA 4DR5F 4LFAF 2RE1A 1BIAA 4ZTFA 5FIIA 5HLFB 2CPDA 1Q53A 4OWRB 2JRMA 1VQ5I 3IMQJ 2BOLA 4QR0A 4KHPT 1R5HA 3OKQA 2CJBA 4TX5A 1V5GA 2WMOA 5CYMB 2VWAA 2OJ3A 4EV6A 2G9WA 2JEFA 4X4UA 2XPWA 2DRAA 3QWPA 8ATCB 3H3MA 5D77A 1X1DA 1OY9A 3TQ1A 4YEAA 4C97A 4HNVA 4RWXA 3HGYA 4ASNA 1SEUA 2BXJA 2YTCA 1X4DA 5CYQA 4V2GA 4MYUA 2I0MA 3J7AN 1ZPVA 1KSPA 4RW7A 2CV1A 2Y48B 3RPUD 3I9WA 5CJ9A 2P5VA 1YLFA 2RHQB 5KFPA 1FJCA 2KDOA 4BAYA 5JDFA 1IBKT 1JNZB 4YFUA 3UU5A 4C9YA 3CJTA 1C4CA 3MKZA 4EI2A 1OKRA 1LQ9A 3CJKA 4NL5A 4ZITA 4EBDA 2OMOA 3PO4A 1K0VA 2YKPA 2UXBT 3RIAA 3G82A 1PJ7A 2QA2A 1SD5A 5B0AA 2ERRA 1LW2A 1TWHJ 5ETNA 3HLUA 2LSJA 2X1DA 3N97A 4DR3F 1TK5A 1GUUA 4OI0A 5LYJE 1J27A 1KP6A 3R97A 3DOKB 4CLUA 3HKDE 4ELUA 2H54B 4FS2A 1X4CA 1HNZJ 3K4JA 3ABTA 2DGSA 2MZQA 4YSYA 5HQ8A 1KD1T 3EDUA 1FJGT 4LUBA 4DEZA 4DV2J 2XASB 2QEXI 4A3JJ 3HPGA 4ZIWA 3NS7B 1RWMB 5L1JA 5E2QA 3VHLA 1LWCB 1T11A 3ZZPA 2J62A 1JX4A 2QSFA 3OBIA 4NCGA 3VAFA 3L39A 3W61A 2LM2A 1Z6TA 2F48A 3G9CA 2DGQA 4CXXA 1NBEB 2XQYA 2QM3A 5CVIA 4NLGA 4F91B 3COAC 2ZOMA 4A8XA 1OXZA 3DGPA 2ASYA 1RK8A 3GW2A 1N25A 3CCZA 3RZOJ 2EBEA 3P4WA 2D1CA 4NRUA 3FDSA 5BPDA 2CQ7A 3RG6A 1EH6A 1CC7A 4LMKA 3JYTA 3S1NJ 3SZGA 3GV5B 1DP3A 1AOYA 5FVLA 1RWXB 4MALA 4UOCA 2DR9A 1OCRH 1FDBA 1D8YA 2L3LA 2MLKA 5ICFA 4IL9A 2HS3A 4ANJA 5LG3A 4K0KT 2BX6A 4OYWA 1MJ9A 2WBRA 1EP4A 3JREA 4JI7F 4FZVA 4ZI3D 3GG1A 5FLXU 3KG1A 4DZDA 3DRRA 3IF8B 2Y69H 1UFLA 1RWWB 3FCWA 2R2UA 3M2RB 4ZYEA 2NXNA 4ZHQE 3JSBA 3FJ2A 4HHJA 3L09A 1UG2A 1SHZC 4XL9A 5H6QB 2H6CA 4DV6T 5KXJA 2HFOA 3DMJB 3HVTA 3VQTA 3G6EI 2YN6A 2EFOA 1HKAA 2AKWB 1U6ZA 5HI7A 4DR2F 4WFXA 5E3RA 3QAEA 3FBEA 4DF8A 1T9VA 1YJ9S 1UVNA 2MZRA 5F0HA 3IAS2 5LRRA 2ZB9A 4BA9A 1HBMB 2QMWA 2ZE2A 3AG2H 1IXSB 3MK7C 3LG7A 1MIWA 1R49A 4RGXA 2WU5A 5DQHA 2ROEA 3J7AY 3UUBA 1LW0A 2QYOA 4JBCA 1FNOA 3GN5B 4QXBB 2DB1A 2H48B 3TUPA 1XDSA 2BKNA 3I56I 4OJ1A 2GVDB 1YRNA 2HQIA 1RHKB 2OI2A 1XDOA 5EZHA 2HLUA 2QGSA 2JDJA 3GU0A 2QFJA 2V2ZA 3GO5A 3ZQHA 1JWWA 3SCLE 3IV5A 2M34A 4M5DA 2VQET 1E3PA 1WHWA 2CCQA 5J2NB 1ZTTA 5E1XA 3L3CA 5HNHA 3BC8A 1BWEA 2R9LA 5KFGA 2VONA 4PGGA 4K4WA 4ZP9A 3NKYA 4WXHA 4E7HA 3HSZA 3HG9A 4CTAA 4O3RA 3I5AA 1VQMI 1YYVA 2HYJA 3ZMVB 3PM9A 5HEUA 4A56A 2HDCA 3F72A 3R2DJ 4Z8XA 3TAMB 2P4WA 2XO6A 4AQFA 5AQPB 4ZVEA 3H3ZA 2NUUG 4DL0C 3QZ7A 1HNIA 4YFKF 1FRHA 4K4SA 3WDOA 4Y34A 2DN0A 1I1GA 2K9MA 3JR9A 4RW4A 1FK9B 2ZBIA 2HVZA 3VVTA 3DLBA 4BJ5C 4RGRA 3W8GA 2O01C 3DF8A 5DM6F 4IDKB 3L2CA 2R93J 1RWUA 2YX7A 1APSA 1NH3A 2UUWA 3K2AA 2KFNA 2Y8YA 3AKZA 1RZMA 4ETXA 3OS0A 2B0GA 2A6MA 2XAJB 1TFWA 1AZSA 2M8HA 3IFEA 4DPUA 1R27B 4RNFA 1FTZA 1B9NA 3K4LA 3QAHA 3C14B 3P7IA 1ODDA 2YWFA 1Q86T 3F31A 1HNVB 5KT2A 3RBXA 3ABLH 4A3KJ 2UV8G 1UMQA 1JUMA 2GXGA 4DX8H 4IFYA 2VJVA 1NRKA 4ENOA 1U49A 1KONA 4OJ3A 3BGRB 1ZH5A 1V55H 2RNEA 1R0AA 4NQWA 3FNNA 2HFSA 2H1KA 1KQKA 3DLHA 2X1BA 4DUZJ 4ES2A 2IGKA 5JH7E 1HQCA 2QMUB 3RTRA 3H25A 5AQVB 1ZOTA 3K9TA 1CHUA 4PEOA 3J80Z 4FF4A 5THWA 1ZAOA 4I7HA 4DG1A 3HB9A 1X0FA 3FDYA 1VBXA 3D3BJ 3DKYA 4NI2B 1R89A 4UY8T 4ECRA 2WK4A 2F5VA 2H7VC 2WAUA 4N8OA 2KIQA 3QB5A 3G71S 3QYFA 1BGXT 1OSDA 2RQKA 4PQAA 3MD2A 2BBEA 5MLCV 3BWGA 1JLCB 5AQUB 3RZAA 4N41A 3MZIA 3RKQA 2EXUA 3F56A 3BBCA 2XAFB 4C90A 4TU9A 3N2OA 1X19A 4FJOA 2G1HA 3U9GA 3IBFB 2QBYA 3CO0P 3W5ZA 1O3RA 2EC0A 1ENHA 3RB6A 1KEYA 5LGTA 3POTA 1I6JA 3H37A 4RL1A 4NXNJ 4ESBA 4ZPAA 2UWMA 2EIMH 3PNIA 4B43A 4ED1A 1TK8A 4QIEA 3KE2A 1Y56A 4XLEA 1UTAA 3F8CA 2APOA 2A68F 5I3UB 1P4XA 4P73A 5K7ZA 2BJ9A 3S15J 2E1MC 2WTEA 5K14B 1WNEA 5J2UE 5HVGA 4I55E 3M32A 3LAMA 5FXWA 2DQLA 3CE8A 2XMTA 1LUJB 3F23A 1X60A 1SKUB