3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
5LRRA 4ESFA 3T8RA 1PUEE 3KZZA 2P7VB 3D5LA 2YPRA 5HS7A 1R1TA 2GZWA 1XSDA 2VBWA 2Q8KA 4PZJA 2GWRA 4MHGA 4XLNF 3TGNA 1ZREA 2PLYA 2DK5A 2PMHA 2HS5A 3KLNA 4YIFA 3EDPA 4I09A 5FO5A 4UVAA 3HTSB 4AD9A 4A6EA 5ICFA 2A5YB 1MD0A 2RDPA 3HSFA 1ZRFA 1DP7P 4A0XA 2A61A 3FXUA 4WCGA 1TBXA 5LRSA 2DAOA 4E70A 1PP8F 4KIBA 2HQRA 4P5OA 1Z9CA 2GIVA 4ON0A 3SXYA 5H20A 4JK1X 1LJ9A 5CVIA 2RV8A 1W5TA 1XGSA 4M9ZA 3J7AO 3V7CA 4EJTA 5CVUA 5FD5A 3IHUA 3K1MA 2DPDA 3R6SA 1JGSA 1IZ1A 2P6TA 3WTYC 3WTXC 4HW0A 2VE9A 4KUMA 2RQPA 5L3EA 3E97A 4Y13A 4WXHA 3GEZA 5FFXA 4K2EA 2OA4A 2GA1A 4KIFA 1ZLKA 1B9NA 3V8JA 3F8FA 4YG2F 4LD5A 3QP5A 2A07F 1YO5C 4M72A 1F9NA 2V6CA 2V1UA 1XSVA 5K5RA 4CXFA 4BHCA 1YQAA 1HW5A 1WWXA 4ZYHA 1KQ8A 2LKPA 3IWFA 4HAMA 5L3BA 2QVOA 1GXPA 2IT0A 3EETA 3VFZA 2LF8A 3P9KA 2YU3A 4JQFA 5DD4A 4BH9A 3J81K 3V8LA 4EJWA 3H3UA 3L9FA 1DPRA 2NAZA 3Q9SA 5BQTA 4UHTA 3TQNA 4RB0A 1FYLA 5JFRA 2VODA 1HKTA 4Q4ZF 2UXXA 4EM2A 2F5FA 1QZZA 3WE3A 1EH8A 2ESHA 4HDVA 2PI0A 3FMSA 2XRNA 3WTUC 1IRFA 1B6AA 1ZRCA 1B59A 3KCCA 3VODA 1E17A 1FNNA 3FXRA 2NNYA 4ZYGA 2MLKA 3HIFA 1BN5A 1XB4A 1XGOA 3TO9A 4HV6A 2OZ6A 3PFIA 3TDUC 2XV4S 3I53A 3K69A 4BHPA 1KQ0A 2O6GE 2IA0A 3GVAA 1IN4A 2XAHA 4CYDA 4RGXA 4AIJA 3C3WA 1WSUA 2XVCA 2Z3YA 3IKTA 2PEXA 3RPUA 1MKMA 1H9GA 2D1VA 4G8XA 3KZYA 3BJ6A 4ZZDA 3IRQA 3LSTA 2G7UA 2QM3A 3I54A 3JTHA 2CQKA 5E8IA 3K0LA 3TO6A 1BJAA 4RS8A 3F8CA 4XSZF 5E17F 1BM9A 3ZP5A 2DO7A 2MH9A 2FU4A 3PQJA 3CLOA 2AXLA 1S3JA 2A3SA 2HKXA 2D2WA 2A68F 2O03A 2PG4A 3HYIA 4GGGA 2M5WA 2ACJA 2VONA 3ZMUA 1HKSA 4H0EA 1R7JA 3E5QA 1SFUA 5D5XB 1UB9A 3E6DA 3FMQA 2FNPA 1FSEA 1XD7A 1W7PD 3JAMK 3WGHA 2E7XA 2FE3A 1K78B 5LGNA 4HLXA 3IC7A 2G7HA 2GXGA 3V8KA 2YR2A 3K2ZA 3E6CC 2YX7A 4YFNF 4XRFA 3GFLA 1UCRA 2VC0A 4NQWA 2K7LA 3CUOA 3H3ZA 1BI3A 3E5XA 3MZHA 5JI6A 4BYYA 5ED4A 2RNJA 5HDKA 3KE2A 2UZKA 3BZ6A 1ZARA 1SD4A 3GW2A 3WGIA 2XGXA 4R8HA 1XMKA 3HRMA 1F1ZA 2DK8A 2XAJA 2RGVA 3PQKA 2L02A 4G6QA 4CZZA 2D45A 1YLFA 4ENMA 1QZYA 1B9MA 1J0RA 3RDIA 3GF2A 2EFPA 2HZTA 5CVJA 1L3LA 3KP7A 4PGHA 3KP4A 5ILUA 4AVPA 2H09A 1IN8A 3GFIA 1FYMA 2F5CA 4O3MA 5D5WB 2CO5A 2L3DA 2EA2A 2AS5F 3NEUA 1B1BA 3O6BB 4LB5A 2IP2A 4OIPF 2X0LA 5JHUA 1RUOA 1V3FA 2X4HA 2BV6A 4OU0A 4WK8F 3GX4X 4EQQA 2XASA 2JPBA 3FHZA 4L9NA 2ZMEB 3J80K 2PMUA 1LDDA 1J59A 3WU1B 1NHAA 1OYWA 1SMYF 2RKHA 2QQBA 2VC1A 1Z1DA 2EFWA 1QBJA 2ELHA 2QLZA 1O3QA 2FMYA 2IJLA 3F21A 4LLNA 1G3TA 1W4MA 2NS0A 1PDNC 4D0PA 4MQVA 3KP2A 4UVBA 1USSA 5FLXZ 1ULYA 4B09A 1D8JA 2Z5UA 2EB7A 4HX7A 1S7AA 1CGPA 3VEPA 3Q5FA 3LWFA 3FM3A 3IKVA 1KYWA 5E1XA 2IVMA 4ZYDA 3TDZC 4WXDA 3R0AA 5JVTA 5K5OA 4OINF 1O3SA 5FB2A 5ILVA 2FNAA 1HQCA 4I01A 4HLYA 4WWCA 2HR3A 5F1RA 3QRFF 1YW7A 4I0BA 2CGPA 1XN7A 2MBFA 4LFUA 5D4RA 2DI3A 3DKWA 3F3XA 3U1DA 4HYEA 3COAC 1RUNA 1XDSA 3ZPLA 2FXAA 2R3SA 3I64A 4HBLA 4KYWA 3M7GA 2C6YA 2RC4A 3EQLF 1I6XA 4IRHA 4OIRF 5ERIA 3WTZA 1LEBA 1PP7U 2K02A 3DXJF 1AOYA 2D1HA 1KA8A 2HWVA 2FOKA 3ROUA 4I98B 2W25A 5D6EA 5F64A 1V4RA 4RAZA 2M1BA 4CGZA 4DQ2A 1ZLJA 2FRHA 3N97A 1XMAA 2XIGA 3QPTA 4HF2A 2IA2A 2HOEA 3T1BA 5A2QZ 1YYVA 2K27A 1QNTA 3HHGA 1TTYA 3GLXA 1OYIA 1OKRA 3LQQA 1EV7A 3VB2A 3QU6A 3MWMA 4ESBA 1MGTA 1IN6A 1ZYRF 1U78A 4FHTA 3JSOA 3CJNA 1MDMB 2WV0A 3GYHX 4KICA 1USTA 1BIBA 3E3VA 1X3UA 2GQQA 4G7ZF 4L9TA 5BPIA 1FX7A 1ZN2A 2ESNA 4G94A 2HFHA 4Y17A 3I0TA 3KETA 4ZYEA 3R61A 1P6RA 4IHTA 4UNOA 2KIFA 5D8KB 1R22A 3M1EA 1FP1D 4HA8A 5BOXA 3ISPA 2BGCA 4F7ZA 2JRTA 3CUQA 1AWCA 3B73A 4P9FA 1BOAA 1FC3A 2R7DA 3MEXA 1YIOA 3KEOA 4Q5SF 3ECOA 4P55A 1QO0D 2HGCA 5HVQC 4XLPF 1U3EM 4G6DA 2K86A 5FGMA 1P2FA 4PCQA 3IRRA 2OQGA 2FBIA 3FXQA 1TLHB 3F6VA 3QU3A 4EJVA 1FZPB 3QP6A 3KLOA 1FT9A 2VN2A 4L9JA 4IJAA 3L09A 2ISYA 1IF1A 1YG2A 3P7NA 4YFXF 4MGRA 5HLGA 3GO5A 2DBBA 4S05A 2VT2A 3GZ6A 2Z9OA 2M8EA 4UV9A 2VT3A 3WG9A 4L5JA 2EFQA 2V9VA 1G3YA 3ZMVA 4HOBA 4AWXB 3M8EA 5LLQA 3HTUA 3L2CA 5E18F 4WXCA 3I71A 3DFGA 5AIPA 2BE5F 1KGSA 2F5DA 2EFNA 4EM0B 1FSHA 1O3RA 3E5UA 3TOAA 1GXQA 2M87A 3F23A 1J7KA 1FBUA 2H27A 3GXOA 5LHIA 1D5VA 4LJZF 1GHCA 4FX0A 2NNNA 1K6OA 2FF4A 1XDUA 4NB5A 3F8MA 1J2XA 1ODDA 3SHFA 4OIQF 3R0JA 1TQIA 4EJUA 2UWMA 2P6SA 4IRGA 1XGNA 2CW0F 1D3YA 4KT5C 1OR7A 3CUQB 2DPUA 2NRAC 1KQ9A 5LEJA 2Q2EA 1DDNA 1G3WA 3J80Z 1Z05A 2XUBA 4R79A 4BNCA 2LNBA 2HEOA 3CUQC 2VBZA 2L01A 1FPQA 2ZNZA 1EH7A 1HKQA 3HRTA 3U9GA 4BAYA 1UHMA 1K79A 4WF2A 3WU0A 3WE2A 3G3ZA 1BBYA 5DCMA 4CDGA 3K1NA 2OZUA 2H94A 1FBSA 2O0YA 2JT1A 1K78A 3MQ0A 2JPCA 3MZYA 3KFWX 1MDMA 1B4AA 4IF4A 3BP8A 1LEAA 1MZBA 1ONVA 4KFCA 1F5TA 2QWWA 4L5IA 3GFJA 3ZMSA 2QQAA 2WC2A 2QENA 5FLXK 2F2EA 4CO8A 5A2QK 6PAXA 2DW4A 4A5MA 2Z33A 3ERED 3ULQB 1JE8A 2CWEA 3FMRA 4HQMA 2DFIA 3O2PE 1U5TC 1BC8C 2L4AA 4HF0A 1OMIA 3NRVA 4XBFA 5FD6A 1T0FA 2V79A 3L00A 4JBAA 1O7LA 2GA2A 5IT9Z 5J6XA 2A6EF 5HS8A 1QQIA 3HUGA 3I4PA 4ENJA 1JHHA 4MTEA 1ZG3A 3C7JA 4GCVA 4P96A 3QOPA 1HSJA 1LDJA 2COMA 1BI2A 2QUFA 4B8XA 3S2WA 3W6KB 3JSPA 2PQ8A 1T2KA 2OQRA 2ZNYA 1SAXA 1QPMA 1Y0UA 2XKPA 1T98A 2H6BA 3RTRA 1R58A 1BI1A 2E1NA 3E6MA 3LA2A 2VOPA 1G3SA 4LG0B 1WKMA 3F72A 1ON1A 2ZXJA 2A6HF 4MEXF 1J5YA 3RYPA 2QBYA 1T6SA 3FM5A 3W6JB 1FY7A 3SFZA 2QYOA 5J8CA 4BHBA 2PBIA 5CVVA 2XKOA 3KP5A 4Y15A 1OPCA 1P4XA 3T5XA 5D4SA 1HSTA 3R60A 1MJBA 3MAJA 3RYRA 5ILSA 2Y48A 2EA4A 3BPVA 2Z99A 4OMZA 1IN5A 4M6YA 1FYKA 3DEUA 1E2XA 2QZ8A 4KMFA 1I27A 4N9IA 5D5VB 2O8XA 4EVIA 2KJBA 5EEHA 1IAWA 1IXSB 2OBPA 1SFXA 3SQNA 4O5VA 4N9HA 3DF8A 5LGUA 2EWNA 3M9AA 4YIIA 1ZGAA 1T39A 2WWYA 5AIQA 2XHKA 2ZCWA 3TKYA 2ISZA 2V1XA 5FFZA 4PDKA 2HDCA 4LK1F 1KU9A 2RN7A 2VE8A 4I0AA 1A04A 3TOBA 1S8NA 4GO1A 5D6FA 5L3DA 2QBYB 4M6XA 1J75A 2MD5A 3R4KA 1WQ2A 1YW8A 2K4BA 5DDGA 4EGZA 1IN7A 5HLIA 5KVRA 4FT8A 5E1ZB 2YSRA 1Z6TA 2KRFA 3WTWC 4IHSA 4MNUA 4MQ9F 2RVCA 5LHGA 1R36A 4M74A 1HW2A 4U0WA 5TJJA 1RZ4A 2B0LA 1YTYA 4M71A 2YX4A 3F8BA 2ZJ2A 1GVJA 3CDHA 4Z2YA 2VBXA 4U0VA 2W84A 4IXAA 1HXDA 4LLGF 1L0OC 4TV7A 1XGMA 3M8FA 3E6BA 2W85A 3L7WA 1O57A 4RGUA 1MJ9A 3RKXA 5TRDA 2FBKA 3WTSC 3DPTA 1R1UA 3EUHA 2ZKZA 1KU2A 1I1GA 1D8KA 1H0MA 4A0ZA 5LBQA 2P4WA 1IXCA 3IWZA 1FP2A 4LLLA 3T8TA 3H92A 2BBYA 2BYVE 1SD5A 3P9IA 3I59A 1LVAA 3BWGA 3DV8A 2EK5A 4HQEA 3REOA 5E1WA 2P5VA 2JZYA 2JSCA 5L3FA 3BOQA 4L18B 3LA3A 1O3TA 3HRSA 1UFMA 2H6CA 1S6LA 2Y0MA 5HDNA 1R00A 4GXOA 4RB1A 1DUXC 3B02A 4ENKA 2ZFWA 1XCBA 1I1SA 2P5KA 3QAHA 4A6DA 3ZMZA 3JW4A 1CF7B 3DQVC 1ZGJA 2J5PA 4RGSA 1P4AA 1XCVA 2Q0OA 2J5OA 1J9IA 5L3CA 5AONA 4P9UA 4S04A 4M9SA 2FEZA 2HKOA 3OV8A 4MTDA 1RI7A 4M9XA 2FBHA 2HTSA 3CO7C 2KKOA 5ICCA 2ZO4A 3I59B 4ZH4F 1YFHA 2V1DA 5D8LB 2NYXA 3ML6A 2M45A 2MC3A 2PN6A 4OMYA 5LEKA 5IT9K 4HX8A 2FQ3A 2FA5A 1W7PA 2EV6A 4OOIA 1JXSA 1JHFA 2CYYA 1SFEA 4A2UA 1FBQA 1LB2A 5LGTA 2W24A 3ZMDA 2Y75A 2KIUA 4ESJA 3ECHA 1RIOH 1LNWA 3F22A 1ZG1A 3ZQ7A 1ZG5A 1Q1HA 1ZRDA 2OAZA 4U7DA 2ZBKA 2LF7A 2MA3A 4AIKA 1O7FA 4A5NA 5DUIA 5L3GA 4ZZLA 5DCFA 1I5ZA 4KIGA 3FZVA 4GYIA 4CHUA 3V4GA 2STWA 4PGGA 1HBXG 5BS6A 4I02A 1REPC 5CLSA 1TQPA 3O3KA 5DYMA 1Z7UA 2UXNA 2G9WA 2LSOA 1BIAA 1IUYA 5BPDA 3SZTA 4IPAA 4Q47A 2P8TA 1TNTA 1R23A 1QGPA 4BQAA 1HW1A 3RKYA 4ENNA 1ZH5A 4AIHA 5CJ9A 3V7SA 3DP7A 5HOOA 1XSXA 3KP3A 1UHWA 3CO6C 1TW2A 2CG4A 3BPXA 2P7CB 2XAGA 4U0YA 4HZFA 4ASNA 2IA1A 5BMZA 1U8RA 3WODF 1WI9A 1W5SA 4HX4A 1S7OA 4G7HF 1IXRC 4KN7X 5F6FA 5K1YA 4N0BA 1G6NA 4RAYA 3EYIA 3KP6A 3JAMZ 1TW3A 5K5QA 3KEQA 3Q9VA 3LAJA 3FF5A 4LB6B 2F5EA 1ON2A 4HDUA 3N4MA 2E1CA 1S29A 5DV5A 4UV8A 1VTNC 3LAPA 2L4MA 3BJOA 4UUVA 4A0YA 3V7RA 1FWZA 1LDKB 3U2RA 4I7HA 1TQMA 2EFOA 3I5UA 2P5LC 3RKWA 3BDDA 3QPHA 1K7AA 4DNCA 2JTVA 2IPQX 2K4JA 5CVRA 3F8NA 2GAUA 2O3FA 4QLCU 1U2WA 3GFMA 2CFXA 3ZN0A 2ETHA 3MCZA 3OOPA 1BI0A 1YS6A 1CF7A 3HHHA 3DPLC 3RJPA 5DUKA 1U5TA 1DPUA 2FMLA 4L9VA 2WTEA 2DLLA 2FSWA 3ABUA 3LQRA 3ZN1A 3NQOA 4RGRA 2KIMA 3FX3A 4G9YA 1P4WA 4EMSA 5DCMB 4RB2C 5ICGA 2XROA 3BROA 1WRJA 2IW5A 1ZAOA 5H6QA 3HOSA 3BJAA 3HSEA 5CYVA 2PFBA 5D5UB 3J81Z 4RB3C 2A69F 4HV5A 1W7PB 3CTAA 4FX4A 3RPQA 3ZMTA 2BEOA 5HLHA 3WGGA 2E7WA 1RNLA 1LQ1A 1F4KA 1SD7A 3K1PA 1TNSA 1YW9A 3HSRA 2DU9A 3GZ5A 3VOEA 2L54A 4NHJA 5HDGA 2EV5A 1T38A 1BC7C 4I2OA 3LFKA 4QWQA 2CSOA 3K9TA 1STZA 1ZHFA 2VBYA 3G73A 1H9TA 4GYGA 4CICA 4EGYA 4WX9A 3WTTC 2W57A 4LGWA 2TDXA 3TO7A 4EJOA 3MFKA 3LA7A 1U5TB 5DEQA 5ICEA 1IW7F 4EV0A 1R5GA 4O6JA 2STTA 3GUDA 2XAQA 4LK0F 5J8FA 3RIRA 4L0YB 1C0WA 2HYFA 1FOKA 4KA4A 2MLGA 3F6OA 4XSXF 4R1HA 2HTJA 2O61A 2LDUA 2ZMEA 1FLIA 3P9CA 4MEYF 4KNYA 3EYYA 2HYGD 2EJRA 3HRUA 4IVNA 2DQLA 3ELKA 3HOTA 5E8GA 5IT3A 3D0SA 1U6GA 3C18A 1YS7A 1Z6RA 4BXUA 3AAFA 5EEGA 3GWZA 3RI4A 2IRFG 4HF1A 3ABTA 1SD6A 5KK1A 3FWEA 4L0ZB 4U88A 5HS9A 4A12A 2DQRA 3C1DA 1KU7A 5JR3A 3SZPA 4G7OF 2R7FA 2DT5A 2XAFA 4ETSA 2PJPA 1Z91A 4LMYA 1MJAA 1KU3A 4KN4X 4KMUX 1KYZA 2KJCA 4UVCA 5H6RA 4EM1A 1R5HA 2GXBA 4UXNA 4OIOF 2M30A 2OD5A 3WTVC 3BY6A 2VXZA 3T0YA 3I58A 2VOOA 5E20A 1IRGA 5DD8A 2MH2A 2DTRA 4KDPA 5LHHA 1EH6A 1G4DA 1P92A 2HQNA 4YFKF 2ADUA 1R1VA 4M73A 2OU2A 1OYYA 1SMTA 4Q48A 4LG0A 4U7BA 4IRIA 2EV0A 3IL2A 2QQ9A 3JTGA
chains in the Genus database with same CATH superfamily
2FGOA 1PUEE 3ERMA 1S6UA 4F8RA 3KZZA 5LD2C 2P7VB 4ZLPA 5HS7A 1K83J 4BDYA 2GZWA 1XSDA 1VQMI 2VBWA 3D2WA 2FZKB 1T0TV 2OPSB 2OHDA 5EJCA 1N34J 1HIYA 1RHQB 4XLNF 4G6TB 3X2QH 2DK5A 2HS5A 4DR6F 3BG5A 1R27B 2DRBA 2L3MA 4Q25A 2RKIB 5IM0A 2HHHF 4IR9A 5D8HB 4UVAA 5A8KB 3M2UA 1RTHB 2BW3B 1XNQJ 2H5EA 5ICFA 2PD1A 3OIQA 1RTIA 3VTIA 4ZZCA 4NCAA 3JAFA 4Z6YA 3R7SB 4A0XA 2A61A 3FJ2A 3VAKA 4JYAF 2HVHA 4LFCT 4WCGA 2EZIA 2C2MB 3IFEA 1PP8F 4E70A 2W01A 4P5OA 4M5MA 1F3VA 1Z9CA 4AKLA 4DGWB 3DOKB 2GIVA 3SXYA 4X5TA 5KG0A 4YR0A 5H20A 2ZDOA 1FRLA 2BDEA 3BF4A 5F04A 1SPBP 5D6GA 2BZBA 2RV8A 3VHQA 2DRAA 1YW0A 1W5TA 2W62A 3LAMA 1NJZA 1FIOA 4QKNA 5HQMA 5M3FJ 4DUZJ 1APLC 4PAGA 4HI2A 3CZ6A 2DCFA 5CVUA 3ILIA 5D77A 2FJAB 2YKPA 1XR7A 4FN5A 2DPDA 3JCUC 1T9UA 3RAMA 1JGSA 1IZ1A 3QYFA 4F55A 3WTXC 3BO4A 1VLYA 2C22A 1EZZB 4WKYA 2HQGA 2JLEA 2IS1A 3LOCA 5E79C 2RF2A 4IH7A 5A6PA 5L3EA 3E97A 3RB0A 4ABZA 1ZK8A 5CA1E 4JI1F 5HJXA 3VQSA 5KFBA 3WHIA 4BJTA 1Q5VA 3JB9k 4KIFA 5EGOB 1BQNA 3C3LA 2MYSA 1B9NA 2JA8J 3GFZA 2VVSA 2PFFB 3QP5A 2DNQA 1N77A 2A07F 2EXUA 4UF0B 2WVBA 3LP2A 2EK1A 4M72A 3H5RA 2V6CA 3RRKA 1RT2A 2E19A 3ETOA 4CXFA 3BYPA 4BHCA 5BXIA 4EXTA 1RWVB 1WWXA 1RKTA 3BG9A 2HURA 2LKPA 2GVDB 2NSCA 3IWFA 1CHUA 3BGLA 5FKYA 3EDQB 2VJ4A 2QVOA 4NYPA 3W9JA 2IT0A 3LDQB 1YQHA 2YINA 4YJ3E 4K4SA 1IAPA 3CCES 2YNGB 3P9KA 4DV5F 3DOKA 2YU3A 2XAGB 3KG4A 2L7FP 4KT0C 3GR1A 2D3O1 2GGPA 5DGAA 3AG2H 3EX7B 5BQTA 3Q8VA 5B0DA 4RB0A 2KRRA 2RQQA 2DNKA 2B9EA 1HKTA 2PEHA 1O3XA 4NLSA 1NB7A 2AW0A 2HPJA 4EM2A 4ID8A 1Y0NA 2B9SA 3VSKA 2E2AA 3WE3A 1Z1ZA 2CXDA 3DRYA 5CH7B 5HODA 2LRLA 4HDVA 4ZDOA 3AAAB 5LOVE 1M0SA 1O51A 3K5NA 2PI0A 2UUCF 2MGZA 3MI7X 1DGWY 5B0GA 3B6BA 4FYVB 3FMSA 1B6AA 3PRDA 1B59A 4XLEA 4X66T 3GSIA 1ETQA 2K24A 1RT1A 5IQ6A 4ZYGA 3RU0A 4J9LA 2DMTA 4QR2A 2CWXA 2Z56B 2DMQA 2MQOA 5JVDE 1U24A 4DEZA 2OLTA 3D66A 4R0JA 2OZ6A 4B3OA 4J90A 2Y0SD 3F0NA 3BLYA 4XDCA 3HPOA 1H2TZ 4DQQA 5IS2A 3I53A 4G1QB 4ECWA 4RW7B 2ZH4A 3TA0A 3K4NA 3F56A 1VNDA 4ILLA 3WX4A 4ED0A 4G1PA 4IRKA 2WY2A 5D4NA 1HL6A 4ILRA 1RT6B 4Y2CA 4CYDA 4RGXA 1XC9A 3NARA 4LJMA 1WSUA 1QSYA 3FIWA 3BG6A 2PEXA 3RPUA 1MKMA 2C2KB 2LEBA 4HN9A 4F91B 4G8XA 3KZYA 3BJ6A 1AB8A 1NM2A 4ZZDA 4WFBQ 2XPVA 2G7UA 3I54A 1UAAA 2BE7D 1PVEA 1M5HA 3UNYA 3K0LA 5KFNA 1BJAA 2Z2SB 2KZGA 5HNHA 2CU7A 3F8CA 2N9DA 5E17F 4HKQA 1M1GA 2FTRA 3ZP5A 2DO7A 2KJWA 2J6SA 5CABA 4NMXA 2ZOGA 2DGUA 3PL8A 2EHOA 4F7VA 2JMHA 2A3SA 3W2WA 3THVA 1URNA 2O03A 3HYIA 1Y11A 3C14B 5FLVA 4USUA 2VONA 1SIZA 2RNEA 1HKSA 3SCIE 2JRSA 4H0EA 1R7JA 2CQDA 2W8KA 3EGVA 3MPVA 3E5QA 5D5XB 1JJ6C 1TWHJ 1VFJA 4ZS3A 3E6DA 4LR7A 4DWIA 3L1PA 2LA4A 4IDQA 1QAJA 1U25A 1FA0A 2V2KA 4AXPA 4I2QA 4YR2A 2APOA 1HNWT 2QTWA 5A0YA 5DLGA 5HMWA 4ISTA 2L8KA 4EI2A 3HDSA 5FDLB 2L9DA 4FYXB 3LG7A 3ENAA 2RAEA 2BW3A 2G7HA 3US5A 3CD5A 1B72B 4IUFA 2XCAA 4CCMA 1IR0A 2AMCB 4JI2F 3DYAB 4EYHB 1V3ZA 2HHPA 4RA2A 1RHKB 3AG3H 5THWA 4YFNF 4XRFA 4BEHA 4O4GB 4C90A 3OBIA 3M30B 2WOMB 2XGQA 3G06A 2VC0A 2QGUA 1ZS6A 2BE9B 4BHQA 4Y2KA 4NQWA 3CESA 2H88A 2DY9A 5KFAA 1S94A 3I0SA 1U1NA 3V5RA 3H3ZA 3BR6A 3E5XA 4JI8F 4DCJB 3MZHA 2Y6XA 1RWNB 3HKZD 5ED4A 4XN3A 3SCJE 4Y34A 1N34F 3OYDA 2PA8D 1NK8A 1DY3A 4LFAJ 4ZXLA 2QC3A 3LSPA 3PUWF 2R2TA 3K8WA 2G9OA 3GW2A 3WGIA 3CJ0A 5GAGU 3RIUA 2XGXA 4I69A 1XMKA 2J7KA 1NCLA 3IA0A 1TL7B 4ID5A 2EKYA 1F1ZA 2CNNB 4I2QB 3JRCA 2NW8A 3KWMA 4DHVA 1GT0C 3A8JA 3P6YC 4CZZA 2D45A 1T3OA 4ENMA 3ZTPA 2VFSA 3MMCA 1B9MA 3UNGC 3GF2A 5BJRA 2V67A 1NK4A 3MM6B 1IBKF 5AQQB 2XQ3A 2F1FA 3DBLB 3IWLA 2H09A 1IN8A 3GFIA 1D1CA 3VR9A 3N2KE 5HYAA 3J81j 2WOMA 2UUAF 3KZIC 3DU5A 4LSLA 4DUZF 3IN5A 3Q2TC 2JK3A 1L3VA 4OIPF 3GCXP 1JLCB 2GJ2A 1RUOA 4UQTA 3RB4A 3X3UA 3EJMA 1ZAVA 3MM8B 4W92B 3HCXA 3QUJA 4M5GA 3UDLA 3AL0C 3JYTA 3RC8A 1HNVA 3J80K 2PMUA 1AKHA 3DWLE 3WU1B 1B8IA 4IFYA 2E2HJ 1DP3A 2NCKL 3O8GA 4KUMB 1S1WA 4B9SA 1SJFA 2RKHA 3W8GA 5CXTA 2QQBA 1YRNA 2EFWA 3LALA 2ELHA 5AT1B 1DJ0A 1XJWB 2IJLA 3IHRA 4LLNA 3BTIA 4MQVA 4DSKA 3HKWA 1X1AA 1JNRA 3MEDB 1USSA 5FLXZ 2ZE2A 2K48A 1WC5A 3H5UA 4B09A 4ZPBA 3TUJC 2H1KA 2EB7A 3ELHA 3FEYB 4NXMF 4CSWA 4HX7A 3PO3J 3ZT5A 4HEA2 2ZM6T 3DEWA 3OYXA 3LWLA 2LD5A 2WB1D 3H2VE 3UU3A 5BYRA 3R0AA 3R27A 3MUMP 4DV2F 1IC8A 1XR5A 1KLMB 4NLPA 3C64A 1N0VC 1HQCA 1HBMA 4I01A 1X9WA 1TWAJ 4WWCA 2EK6A 1QAIA 1JKOC 4MIMA 4IHJE 2HR3A 5F1RA 3QRFF 1QPIA 1N33F 2ZHAA 2LBFB 5KAKA 2COLA 5GAHU 3DKWA 3QYEA 3F3XA 5IWAJ 4HI1A 1IBLF 3P4PA 2PX9A 4HYEA 3COAC 1OCPA 1REVB 2YU9J 1XDSA 2LM9A 5CKTA 4X65J 2H7VC 4KYWA 3OL6A 3CCYA 2CJKA 2MTLA 3GTQJ 4USKA 3QYYA 2CIMA 3S1TA 2Y1IA 2RC4A 3EQLF 5L1LA 4TV8E 1UX5A 5A76A 5FJ4A 2CPTA 1U6BA 4J19A 3TW6A 3ZMZB 1O8BA 5HQ8A 5LL6d 3K4CA 4ATNA 4AM3A 4DU8A 1AOYA 2W7AA 4YUDA 1KA8A 3RB3A 2FOKA 1T56A 2KXNB 4CCOA 2XF7A 4I98B 3HD2A 2GJIA 4OI4A 4KQZA 5IT9Y 1YOVB 3RI5A 5J2NB 2ZXHA 1W36C 2FRHA 4DV7T 1MWQA 1Z7LA 4YDDB 3N97A 2ELJA 3R5DA 4ZCIA 4WXWA 1X4DA 1KD1T 1IO2A 3KLIA 2LK2A 1V9OA 2V7LA 1U26A 2XMWA 1KF6A 2CJBA 3N9MA 3EI0A 2E44A 1F0XA 3LWMA 2WS3A 1EV7A 1XNQT 4BBSJ 4FF3A 3VB2A 4BE1A 4PK5A 4BQOA 1WLXA 4P2XA 4ANCA 2J8SA 4LRBA 3CJNA 4B43A 1Z0PA 3P50A 1VOMA 2KL4A 1USTA 4KICA 2XNQA 4WFYA 3MECA 4Y28C 4HACA 1X3UA 3JTOA 3RLFF 4PYAA 2V2VA 3P5TL 1WNEA 3HB9A 2HRTA 4JYKA 4DYRA 3S1QJ 2HFHA 3K4LA 1UG2A 4B9NA 2OV7A 3KETA 1HQ2A 3MHYA 3CC4I 2CXFA 3AB4B 2E5GA 4BXXJ 1R6YA 4AKGA 3RQIA 2LY1A 3ZQGA 3M1EA 4A3DJ 5AQNB 3OYAA 1W25A 4NC7A 4HHHA 1WUUA 4V1Av 5FP3A 3CX8B 5BOXA 2BRKA 3W7BA 4DS4A 1S97A 2JRTA 3CUQA 2B9XA 3T5HA 2M3DA 2DNYA 3QODA 4P9FA 1BOAA 1FC3A 4CNZA 4U31A 2H4YB 1DLOA 4U9RA 3DLJA 3MEXA 2UXDT 1YIOA 4OYKA 1WJBA 5HMZA 5AQPB 1H38A 5HJYA 4FISA 2UUAJ 2UVUA 2X0YA 1QE1A 3ZC4A 3UUMA 3KV6A 3VAHA 2N7YA 1OCRH 4P55A 2HGCA 3VAFA 4R8UA 4G6DA 5K7ZA 1U1RA 5AE1A 2HNDB 1SA0E 2ABYA 2HG4A 3F6VA 3KIOA 3QU3A 3I0QA 1X5PA 1FZPB 1LFBA 4D7NA 2CZ4A 4F4KA 3M7VA 2WSFC 1KFYA 4I67A 2VU5A 2GVDA 3CO0P 3PUVF 5A8KA 3QP6A 3KLOA 1FT9A 2XASB 1KDNA 2QT7A 4L9JA 1D0YA 3QWPA 4DG1B 2NZCA 4RLFA 4DG1A 4AIDA 2DWKA 3ZXWA 4E7SA 3CC4S 2HQAA 1PG5B 2KINB 1Q95G 4MGRA 2HGMA 4J9QA 3AXMA 3KDSE 4A8WA 2MPKA 4HGAA 2MLYA 2B8QA 3QMQA 2E9RX 2X3GA 2HQDA 1R8BA 2LQJA 2VT2A 4ZLLA 2W66A 4UV9B 2M8EA 2WADA 3MPDA 2FVPA 1NZAA 4NXNJ 2BJ7A 1HPZB 4QOTA 2F4OB 1RESA 1QE1B 3QNWB 5D78A 2ZWOA 2ATCB 3ZMVA 1LQ9A 2HHTA 4DIQA 5E0OA 2E34A 1ZM4A 5GPCA 2D9PA 4AQFA 2HH7A 5FXVA 3NAHA 2HN2A 3DFGA 2OAUA 3MOZA 4RW4A 5HWXA 3RYCE 4CCLA 5J0ZA 3E5UA 3TOAA 1GXQA 4Z2XA 2I8DA 2DISA 3FBFA 3OFFA 1ZZFA 2WBLA 4DV1F 2UZAA 2ZJRQ 3AG1H 4QPXA 2HGNA 2H27A 5HEGA 1WEXA 1K73T 3GXOA 2JA7J 4B3RT 1ZHCA 4H4OB 5LMUF 2DL1A 4HRIA 2G2ZA 2VFRA 3C6TB 3HSGA 1K6OA 4UXNB 4RMNA 1H0HB 2E36A 3J80Y 5EF6A 3OFHA 2QRXA 1XDUA 3PO5A 4MYTA 1Z8UA 1S5ZA 3IP4B 5LJMA 2MFZA 4OZ5A 1EKRA 1AZSB 2XMUA 3MPYA 5J2TE 2BA9A 3OTEA 4IRGA 3I9V2 5B1BH 2IVFB 4B48A 3C2BA 4IFVA 3IM9A 4MIBA 5B08A 3KK3A 2FLPA 2DPUA 3F9KA 4KGKA 1WCRA 5KFHA 3G8SA 4YELA 2Q2EA 2DK2A 1DDNA 2RVJA 1G3WA 4WBOA 4ZVQB 4F2RA 5F5WA 1BJZA 2NTXA 3J80Z 1BA5A 2XUBA 4YB5A 1HD1A 3W6VA 3KVAA 3CJTB 5CYMB 1GMVA 5LSRA 1Y00A 3CUQC 2DD8S 3JAMY 2L01A 2ZNZA 2DEJA 3J7YJ 1HKQA 3KLIB 3U9GA 4DMVA 4F50A 5JR9C 1K79A 2E9XC 1R0BG 2RQCA 4W97A 3G3ZA 1BBYA 4KHPJ 1VK8A 3KKFA 2OZUA 4AC0A 2H94A 2KT2A 5FXZA 4JEHB 2WAFA 4ZJZA 2H9ZA 2QLXA 4OHYA 2A3JA 3DTKA 5ETLA 3HVTA 4DJAA 3MQ0A 3EMTA 3HK2A 2JPCA 3MZYA 3VU7H 2DYAA 3BV8A 4HSRA 2X1EA 3KFWX 3G71I 4J9VA 1MZBA 1E1HB 3IR6B 4KFCA 3T8OA 4HPQA 2CQHA 3H25A 1J5EF 4YS2A 4J9OA 1WHXA 4OZ3A 4CI1B 3GE9A 4IOCQ 1F43A 3W2AA 1SAUA 1UG0A 2F2EA 2QF7A 4CO8A 3E0JB 2PI4A 3GTYX 1K8AT 1FJGT 4CT8A 1S9EA 2GMLA 4A5MA 1X4CA 2Z33A 3OR2B 2F5GA 3ULQB 2OPPA 4HQMA 4ZVEA 2A2FX 1BC8C 2X6OA 2YS9A 1EARA 1CQTA 1IKVA 4MTPA 1DTTA 4DV3F 4JI8T 2YQ0A 1O7LA 2FVQA 2A6EF 5ADZA 3Q2MA 5TAOA 2GAHC 4ZCLA 3BGOP 4ED6A 5DJBA 1N36F 5H6QB 2VKDA 2V2ZA 1ZG3A 2XF5A 1MBFA 2D9OA 1HSJA 4LBHA 2WU2A 3NBXX 3RYHE 4B8XA 3AA6B 1GT8A 2CNOB 1YK9A 3IH2A 1TKXB 2PQ8A 2OQRA 3VGTA 1AJ3A 2DNXA 1N25A 1Y0UA 5C2GA 3H9JA 1AKHB 4PG4A 2QLBB 3DMJA 4WW0A 1DQ8A 2MPUA 4KHRA 3LA2A 2I59A 2VOPA 4E7KA 4LG0B 3DRSA 1BR1A 1OJ4A 4CLPA 4AYBA 3QQAA 3S17J 1VBZA 3F72A 3W2WB 3HSDA 4PFOA 1TZLA 4DUYJ 2A6HF 4O0IA 3OR2A 1RU1A 2CQ0A 4MHCA 5L3DB 1T6SA 4OZ0A 4HFBA 2X9DA 3LL7A 1TKZA 2QA2A 5AJ3F 1G1XA 4ZK7M 1S72S 2UXCF 2LSYA 5A6WA 1IM6A 1H98A 2B8PA 4ID5B 1N0UA 4W4MA 2JEJA 4ZVUB 1Y01A 2NPFA 2PEBA 3UULA 2IA6A 2KN4A 5HNFA 1PILA 2XULA 2M4GA 1VK3A 4MFBB 1X9SA 1FYKA 4EZ4A 4NZ7A 3LSJA 4Z7YA 4CLYA 3PUGA 3N6LA 1IAWA 5F0FA 1H2VZ 2OBPA 3N5BA 2BG9E 4IYQA 1FOWA 2K9NA 5JR9B 2E9XB 4O5VA 5CQEA 3DF8A 1PAUB 2NS8A 3ILJA 3M9AA 1RE1B 2UU9T 2R5YA 3S8SA 1S9GA 5AIQA 3A13A 3UFCX 1CPZA 1FHTA 2IFXA 3CK6A 2NQPA 3IA3A 3MR2A 4KR0B 4U8YA 4LF8J 5FFZA 3BJYA 4L75A 4X66F 3AQOA 1WC3A 3S01A 2Q2EB 3CJ4A 4ZJLA 2KYZA 2HDCA 4I76A 4CM2A 1Q53A 3ZNUA 2DMPA 1R0AA 4R5PB 4I0AA 2H8WA 2MQQA 3QFHA 4F93B 4QXHB 4U2ZA 2AXTC 1B4SA 4ILAA 2AYEA 1S8NA 3IR5B 4ICLB 1K1SA 2QBYB 3SFEA 5HVHA 3SI8A 5KG6A 5GMDA 3R4KA 3DHXA 1TKTA 4PSXA 5TISC 2X1FA 2KLOA 5J1RA 2FVCA 3TEDA 3FBEA 3VWSA 3FEXB 1T03A 1S9HA 5BYSA 3WTWC 1K47A 4CN6A 5J40A 5DQWA 3TWZA 2MQ8A 3NWGA 2O5RA 4P73A 2W9BB 1HW2A 2R6GF 2VFTA 2ZBQA 4RW4B 1RZ4A 4KKOB 3MGJA 3G2BA 5KFIA 4C3JJ 1V6HA 1MSWD 5LGUB 4LRCA 5AFUL 4OHXA 3MAAA 3Q9DA 1Z67A 2A1BA 1SJ1A 1UCUA 1TT0A 3CC7I 1LKZA 3HSZA 4M71A 5KFDA 2JEIA 2WDVA 5DJQC 3NWIA 4X62J 3LP1B 4I99C 1VQSA 5CGMA 2UUBF 3KDNA 1N5YB 2KT0A 3CJKB 2VBXA 3GV7B 2PO4A 4NLRA 3UN5A 2M8HA 1E3OC 3I32A 1JLFB 4IXAA 1P9YA 2MQPA 4BDZA 1K6YA 2XI2A 3PSIA 5DABA 4TV7A 4CRJA 4LVNP 3OYKA 1KWMA 3R9LA 3M8FA 4EEDA 5JRCB 2FLOA 2CDQA 3D67A 1N34T 2YUSA 3OXLA 5TRDA 2CQGA 2FBKA 2RPAA 1KNPA 4OHZA 5DQHA 2MKKA 3T1YJ 4DR5F 3TLSA 4AQGA 3BCAA 3UI3A 1JX4A 1MNMC 3WTSC 4N56A 2ZJQQ 1R1UA 4XK4A 3O4XE 3I82A 2XC9A 1IDYA 1Y7PA 1YIJS 4IKFA 1FIPA 2DHSA 1U4BA 4U67Q 4O23A 4ZPCA 3AA9A 4Y3OA 1WJDA 5FXXA 2I8EA 1RHJB 2J0WA 2FJBA 1TWCJ 1MU2B 2YQ1A 4I6WA 3K59A 4CN4A 5J1UA 2GZOA 3TI0A 3VGVA 2IDOB 1R8IA 2KNDA 1RWWB 2BYVE 4ZMMA 1ZPVA 1D0XA 2DHAA 2CQNA 2MC4A 3JRBA 4YHHF 1M5KC 2RMLA 2D3UA 3H35A 2EK5A 1MROB 5C8YE 2E1MB 3MM5A 5GAEU 1U0HA 2JSCA 3QAUA 2M8DB 4UUWA 5LG3A 1PIEA 5J2MB 3AVRA 4B3RJ 1LXNA 2ZEJA 3LA3A 2V7MA 3K2YA 1GMUA 4IE6A 1UFMA 3JRIA 2UUBT 1MG7A 2V50A 3CMQA 4K0KF 3DRRA 2BM0A 1QVTA 3AE9A 1P1LA 3HHEA 4IKAA 4IR1A 2Z57B 4RB1A 3RTVA 5AQRB 1C0UA 4ENKA 1OEDC 2ZFWA 3G6ES 4X66J 4RU2A 2HLTA 1XCBA 3G1LA 1XN9A 2OMOA 5CD4A 3MKWB 3H5AA 2F7VA 3LGHA 1E2AA 4K2XA 1JXLA 2WP9A 3CCZA 1CF7B 3DQVC 2GHVC 2ZC4A 1I3QJ 1DLOB 1X79A 3H2LA 3V6KA 3BTCA 2XQCA 2J5PA 4RGSA 2X9HA 1TK5A 3P3DA 1P4AA 1F9FA 3RYLA 1QUUA 2Q0OA 1Y5NB 2W2UA 5GMKa 3AD8C 4PAAA 4LF7J 4M9SA 5ETSA 4KI0F 3VQTA 4JI5J 4YRVA 3OV8A 1NLKL 4UT4A 4YY3J 2ZXIA 3N79A 2FBHA 2MBGA 2I6WA 2HZCA 5KDMC 1WJCA 3UU5A 3DRXA 4NLXA 5EK2A 5J1GA 2VJIA 3CO7C 3C66A 1YJUA 1JKHB 1S0MA 5CHCB 5ICCA 2ZO4A 3I59B 4ZH4F 1YFHA 2HMIA 1POGA 1LWCA 2GVZA 4UVAB 1H73A 5C24A 4DR2J 3DRRB 3W1YC 3G87A 2E1RA 2QKLB 4PJLA 1S10A 4CLKA 4TXSA 5B09A 4HWHA 2FQ3A 1N5TA 3PXGa 5L1IA 5HEUA 1VBKA 5AQIB 5EEAA 1X0FA 5J2MA 2BOLA 1RAFB 4LQ9A 1TAUA 1FBQA 1SVMA 3HKEE 3FZKB 1LB2A 2H48B 2MZ1A 2EH3A 5KT5A 2GM4A 2E5VA 2DMNA 3ECHA 2QMXA 3MCMA 5FVLA 4XLCA 4LFBJ 1ZG5A 1WI3A 1Q1HA 2OAZA 5JREA 2W2QP 4DV4J 4HFCA 1T3NA 3OL4A 4CTAB 2MA3A 1RWUA 2XS2A 1O7FA 1NSAA 4USTA 1CLFA 2W9CA 4ICLA 5L3GA 3HXMA 1MU2A 4P52A 4CI3B 3F0CA 3T9ZA 3HOUJ 1I5ZA 3VZIA 3IP0A 3DLBA 5HP1B 1FEHA 4DR3F 3EPGA 1RSCA 4DV3T 3B4DA 5CLSA 3CCJS 1C0TA 2UXNA 4TWHA 2LSOA 3MFIA 4Q0BA 2KYXA 1HBMB 2ADBA 5BPDA 3SZTA 2B7EA 4IQXA 2P8TA 2LXFA 3PNIA 4Y3CA 2V6AA 1D0EA 4TNOA 1LV5A 2EIKH 4DV6J 3HGGA 1X4OA 4OYOA 3N0VA 3RKYA 1VFCA 2KJVA 5DG8A 2CG8A 3SZ2A 3OTOT 2Y9YA 4WBNE 4CO1A 3V7SA 2EZHA 1J5ET 4ED8A 5HOOA 2A10A 4QR0A 3ITHB 4U96A 3HKZN 5HMXA 1UHWA 1AU7A 4KHZF 2R3VA 3HVAA 1IKYB 2P7CB 4QPTA 4HZFA 1GLNA 3TVYA 4KRWA 2VJUA 3GP9A 4B17A 2M67A 1YLXA 2EC2A 1S1WB 2Y1JA 4GVBB 1RHRB 2K9AA 1ORKA 1Y6IA 1QA6A 1IXRC 3VKGA 4O0NA 2GQCA 4RAYA 1S1UB 1JKPC 3TUZC 2IGNA 3JAMZ 4ETZA 2XAFB 2GW8A 4IDKA 3LBXA 4D1QA 1RETA 3LAJA 2Q1ZB 4A3IJ 1F5AA 3MEGA 4H4MB 1FKPB 3RZOJ 4H4MA 4IOBA 1RK8A 3QJPA 1HWLA 3ZJ2A 4KTQA 1ON2A 4HDUA 4DFKA 1AROP 1M1KT 1UA1A 2Y8DA 5J47A 2KWHA 1U2CA 3DLGA 3TO8A 3J81U 5DV5A 1HFAA 1VTNC 3B8HA 2JDJA 4TV9E 1NENA 2AF6A 1EETA 2M4MA 2ACZA 5LG4A 1OIAA 1LE8B 5AQHB 4PQUB 3LP0A 2H1YA 4U7UD 3WU2C 4UUVA 1PC4A 1FWZA 3EGWB 3CDBA 3QOEA 3CCUS 4A3CJ 2HDWA 4LMZA 2HYJA 4U3CA 3K6GA 3KX2A 2IW5B 1DQAA 5SUHA 3RKWA 4KISA 4Q43A 2NR4A 3U02A 2DA5A 1UELB 4DNCA 3MM7B 3AAWB 2JTVA 2G13A 4ADZA 2FZGB 2LQBA 2K4JA 3W61A 1WC0A 3HJEA 5IOLA 3OS2A 4UTGA 3HFVA 5T41A 2M34A 2V6EA 1FK9A 2O3FA 2RDDA 2BS2A 1RU2A 3GTLJ 4DLEA 3ZN0A 4O4RA 3BR9A 4XTTA 4NA2A 2IAJA 4JOMA 3DI6A 1Y0HA 4LFAF 2P9BA 2ZM2A 2BJ1A 1B7FA 2K9QA 3FKBA 2CPFA 2DOFA 4MKYA 1P9QC 2QVAA 2ME0A 2RB7A 2FSWA 2W1OA 3K7RA 5FDLA 1WG4A 4OQJA 2RHQB 3K7AJ 4JUYA 1HA8A 4G9YA 3P5JA 2W4PA 3FZFB 2BRLA 2L9RA 2EHOC 1SVLA 2AXDS 2VKOA 3MEKA 3FDSA 2CQ3A 3M3YJ 5E5NA 3R7BB 4ED7A 2IW5A 1Y5IB 1ZAOA 4PPZA 3DM2B 1RT3A 3MPUB 4DSEA 2M7BA 3BJAA 3HSEA 1WACA 5CYVA 3N9LA 2PFBA 5D5UB 3FHNA 3J81Z 2IAKA 3RIUC 4MK8A 2A69F 2CPEA 1IJEB 3R5GA 2A72A 4O44B 1HHQA 4BEHB 2H5JB 2BR0A 3AECA 3E8OA 2P9CA 4DUTA 3KYDB 4LF6T 2OC6A 3K1PA 2C3OA 3JRFA 4TNVA 5BR8F 2QKMB 5ETNA 5JVGQ 2DH9A 1O5JA 5FKLA 3DXBA 4GIWA 2ZM8A 5L47A 2WQYA 1BC7C 1PYOB 2PT0A 1SC7A 1NH7A 4C8NA 3C6UA 4QWQA 1U6FA 4TWDA 4Z8XA 3H37A 4D5CA 2HIQA 5E3RA 3G73A 2D69A 1X1BA 2V7KA 5IXUA 4CICA 3CO9A 3J7AY 4FVMA 4WIQA 2FPHX 2ZSHB 2EVZA 1V5IB 2W57A 2LHNA 4A47A 2CUJA 4CIOA 3TYTA 4LGWA 3A02A 4LBPA 1EP4B 3MFKA 1U5TB 4EV0A 3AL0B 3ZZOA 2ME6A 2XS5A 2GIQA 3Q0AA 4DPOA 4DR7F 5KCMA 2NS7A 3V81B 2XZTB 1NXIA 4CM0A 4CLSA 4PXCA 4DV0J 2STTA 4LMKA 3GUDA 3CCSS 1TKDA 5L3BB 4LK0F 4L3KA 2HVRA 2HYFA 5KFMA 2YQ3A 2PE8A 4XKVA 3H3AA 1CVJA 2L48A 2VXDA 4NXNF 1GK8A 2KHCA 1XIQA 2D3ZA 4X64F 3O8WA 1NEKA 2XSJB 2EJRA 2A5WA 1Z4UA 3PJXA 4ZOSA 4ZZBA 3R1LA 3AE4A 3HOTA 3BREA 4CP5A 2K9SA 2JA2A 5F8HA 4I64A 1REGX 5KAFC 3D0SA 2CA5A 1FWLA 1VQ7I 1G73A 2RJZA 1FX4A 2D5VA 1NEEA 2PMZA 4DUYF 4OYWA 2OLWA 3QJLA 3GWZA 3CLQA 2DA3A 4QPOA 2HFUA 2LJLA 5KK1A 3FWEA 3EZ5A 5FY0A 1BQMA 1S1XB 1I5OB 4QHOA 1WKKA 3RYFE 1X19A 5HS9A 1YRXA 3H98A 5KFKA 2DQRA 3LJCA 4TLQA 1KU7A 3TP0A 1P8GA 1MBEA 4OI6A 2IC3A 3L3CA 5JR3A 2PI5A 4G7OF 4F25A 2ACXA 2M3AA 2FYXA 1C1BA 3TP3A 3UN3A 4G1IA 4LFBF 4ETSA 1OWXA 2GNKA 2H3EB 2PJPA 4XPEA 4C2MA 2LOSA 1KU3A 2XQAA 2DOEA 3PJ9A 1NJIT 3OLBA 5E3OA 4KMUX 2LC2A 2DXFA 2BY2A 4DPYA 1R5HA 4B3RF 1A5JA 1W09A 4II3A 4DVDA 4UXNA 3FDYA 3Q86A 3R5BA 4C11A 2X1DA 4OIOF 1WOOA 2K3PA 3ZNJ1 3VAGA 3R2DJ 3LSGA 2OD5A 2YBVA 1TTHB 3BY6A 3GFHA 3T0YA 3I58A 3DLLF 1DURA 4I2PB 5ETOA 4RJVA 2XB5A 4RAFA 3PFEA 2WY7Q 4ZTFA 2MH2A 2V6YB 2O01C 4KDPA 2WBMA 2O1PA 1G4DA 1P92A 4C8ZA 3VV2B 1S35A 1JIHA 4LRAA 1OYYA 5M5WJ 3GIIA 4B08A 2P0WA 2DO0A 4LF6F 4U7BA 4IRIA 4B6XA 1X5TA 3LPEA 1LNQA 2OP5A 4ZI2D 5KFXA 2OPRA 4UELA 1T8EA 2AE9A 4O4IE 3EM1A 5LRRA 1DU0A 5L4EA 3K8PC 3D5LA 2MD0A 3EWGA 2YPRA 2DMUA 5ABGA 5L46A 4DR7T 2DDAA 3LSMA 2OI2A 1VCSA 5B0EA 2ID3A 2J0XA 4DPTA 5HLFA 2VA3A 3CD6S 2GWRA 3T6BA 2K7KA 3TGNA 4DN0A 1X9MA 4IOCF 1N56A 3KLNA 1A35A 4MBQA 5LMUT 2RF2B 3LGNA 5FO5A 1VQ7S 5DDPC 1RAIB 3HKDE 2IUBA 3HTSB 3OIOA 3DFEA 4H9SE 3BKFA 3RQWA 2UUZA 2A5YB 1MD0A 2RDPA 1ZRFA 4NEZA 3S4UA 1TBXA 5CPRB 5LRSA 2DIVA 2BBEA 2AGPA 3H7HB 4KIBA 3M8SA 4GO5X 3P96A 2PFVA 4AXIA 3K4JA 4DX7A 3A0BC 4ON0A 2V1DB 2C0SA 3NP5A 4OYXA 3S1RJ 3HI9A 3FXMA 5CVIA 2CAJA 4S0MA 5CB4E 2NVQJ 5C3JA 1FDBA 4EJTA 1PJ7A 4NLUA 1U0HB 4TWFA 2UXCJ 3IHUA 1NUEA 2OKQA 3SYTA 3C4ZA 1U7LA 2FGCA 3TJ9A 3C16A 2P2CB 3OYIA 3I9YA 4URQU 2WCAA 1U2RA 2J9EA 1SV5B 2GHPA 2ZKUA 2ZM6F 4X4NA 2Q6CA 2D0TA 2RQPA 1H8AC 3DRPA 4WXHA 1VQNI 4I6YA 2CWKA 2XSBA 3GEZA 4X4PA 5FFXA 3K58A 3IWNC 1JUPA 1YBTA 2HNYA 4A8OA 4UY8I 1IBKT 3F8FA 4BUPA 3VYRB 2KZ7B 4JI6J 4IIJE 5F8IA 3DNCA 3KLFA 1YXRA 1KVIA 1YO5C 4G3IA 1BE4A 4H9NC 1CS4B 5K5RA 1FD8A 4M5DA 1X1PA 2VPYB 2CE7A 2VPXB 2AX1A 1YQAA 1HW5A 4D9JA 4HR2A 4NA1A 1KQ8A 3OQ2A 2JSPA 3V81A 5HXCA 1RHUB 3BQIA 1U0SA 2HS0A 3BR1A 3QWLA 4DUYT 1JLBB 3RQUA 1JLGB 3O2IA 1RTDA 2VKZG 4I50E 5L3BA 1GXPA 1WOSA 1FI4A 1W0BA 3WHCA 3EETA 4IH6A 3FXOA 4ZCMA 3QIPA 3SMZA 2ZJQF 3UN2A 1GNKA 3BSAA 5CJ5A 4JQFA 1RJJA 4BH9A 1D9AA 3ZZRA 1HYSA 5K9FA 3EVMA 3W66A 4C0OC 3PIPQ 1Q79A 3PY8A 4KH0B 2R7SA 3LA0A 4UHTA 1FYLA 5JMNA 4XM3A 2D0UA 2JVRA 1YRNB 2XJ7A 4O44A 3VALA 2UXXA 3HM5A 5D4LA 3HOZJ 3KV9A 3IGVA 4CYCB 2QJ3A 3RBZA 4WBFA 1MIJA 2KKHA 3TLWA 2B56A 5KOXA 3UUXB 3LBXB 1VRTA 2ZVSA 4R0EA 2XRNA 1IRFA 4BU2A 1ZRCA 3K10A 1T03B 5J1EA 2DJWA 1P7JA 3J7YU 1E17A 4YDXA 1FNNA 2X6YA 4NI2B 2NNYA 2DRDA 1JLCA 3HIFA 2EILH 4J91A 3JSMB 3GIJA 1VQ5S 3Q3SA 1SKRA 1R89A 1TP4A 3N9UC 2XAQB 3OTOJ 2X9XA 4H54A 5LBQB 4I68A 3G6VA 3D5RC 3PFIA 1D1BA 3TDUC 5K7FA 1KQGB 4O2AE 2K3FA 2XV4S 1TL4A 4J9MA 1BY9A 5LHHB 4DR3T 5F3TA 4HT5A 1R49A 1WHWA 3OVBA 1IBLT 3QIDA 4BHPA 4HWCA 2WMOA 3PIPF 1KQ0A 2O6GE 5LM7E 1YX2A 2IA0A 3PJAJ 3VYTB 2Q9QA 5CA0E 3PRBA 1IN4A 1VQ6I 1FRJA 3CMLA 4HFVA 3D7SB 2XMKA 3IKTA 3K57A 4CYUA 4CO5A 1JXVA 1H9GA 1TR0A 1Y1WJ 2QMWA 4FS1A 1I50J 5A2QY 3LSTA 4ERDA 1A6IA 4U2YA 3QT8A 1RCXB 5HXSA 4RR5A 2IC9A 4LF9T 1RCOB 1VC0A 5C5JA 1BM9A 1H7XA 2MH9A 2FU4A 5DTDA 3PQJA 4OYZA 2CJYB 3CLOA 2CS3A 4X0GA 5DZ6A 1S3JA 2HKXA 1NK2P 2PG4A 2A68F 2W0GA 4MFBA 2NXNA 5CCMA 2ACJA 1RT7B 3UUBA 2ZZNA 3AA8A 3V4IB 1UB9A 1FSEA 2DR9A 1XD7A 2MQNA 4BY1J 4QIFA 1W7PD 3JAMK 3I1AA 3G2XA 4KX6A 3UO0A 2WSCC 4RNFA 3GZNB 1K78B 1EJ9A 2VG5B 4ETXA 4IL9A 4GC6A 1MWYA 2QLJB 4IZZA 2ZUAA 4ALZA 4CO3A 1ZZNA 1FWKA 2YR2A 2MQMA 3NGSA 3ZMTB 3IRXB 4KV8A 4M95A 3HM9A 4IQ4A 2ZLYA 2L08A 4XIUA 3GTOJ 3PYFA 1UCRA 2VKHA 3M8YA 3IG1B 1VI7A 2IEKA 1WF2A 3OR2C 3V6JA 4JI7J 3CUOA 4ES2A 3OTBA 3CF2A 5FKKA 2DXIA 4LIVA 3BH6B 3CB4A 1BI3A 3S3NA 1R8AA 1WI8A 1MMAA 4CN1A 2H89A 1RP5A 5JI6A 3M07A 2RNJA 4J00A 3BTJA 2A3DA 2W2NP 4C3HJ 3X1DA 1EZ3A 4E4HA 3W9IA 3HKCE 2X48A 1Q7YT 4PG7A 2DHGA 4ZN3A 3BZ6A 4YXDA 1JLAA 1TL1B 1SD4A 2CMRA 2BVMA 3C98B 2LRDA 3M32B 5DS9A 3P7IA 4C6AA 3NMRA 4FZVA 2W9AA 1KK7A 3HRMA 5J2PB 3MACA 2XAJA 4ELVA 3PQKA 3ILLA 2UUCT 2OTLS 1V55H 2Y48B 3KK1B 1J0RA 3RDIA 2E5HA 3VPRA 3U1NA 4PGHA 4OL8A 4MIWA 2M0MA 2YWFA 3OYJA 2PIIA 5ILUA 4YHHT 4AVPA 1CULA 2DODA 1ROFA 3ANWA 5D5WB 3FZ2A 2UV1A 1FJGJ 2HVQA 5HP1A 2A2DA 2EA2A 3W62A 3CJRA 2Y8WA 2X0HA 2VICA 3NEUA 4MKAA 3O6BB 4LB5A 4EOZB 2IP2A 1UEKA 2EIJH 2AT1B 3JADA 3CE8A 2BKNA 3CIRA 3OVUA 1PJ6A 1TZ0A 1M5VC 3G4SI 2N3OA 1YKWA 1HLWA 4C91A 4TKTA 2XASA 4EQQA 1TT5B 4L9NA 4XONA 2ZMEB 3Q8RB 1IUFA 3CIZA 4QWNB 1LDDA 1F6TA 4EZ9A 2YDRA 1UW9A 2OEMA 1SMYF 1FFGB 1SV5A 5ETRA 2G2OA 4I7FB 2VC1A 3MK7C 3GLLA 1Z1DA 1U49A 2QLZA 2CDRB 4F52A 1ZTTA 4DV1J 1VQPS 1O3QA 4L3NA 4RWXA 3F21A 3AJ1A 1W4MA 3HMJG 4N4OB 1JJ2R 1S77D 4UVBA 1XS9A 1ULYA 3RKQA 5DDOC 2FJBB 1OY6A 1Q8KA 4U8VA 2Z5UA 2E29A 4Q7AA 1W2BR 2HHHT 3TAQA 1CGPA 3K5PA 3AEBA 1RT2B 4BWJA 5E1XA 2DO4A 3HOWJ 1SC1B 4WXDA 1VR6A 3ONLC 5JVTA 5K5OA 4KE5A 3KHLA 2OJ3A 1VRUA 4X2BA 4UF4A 5L3CB 2VI6A 3PEJA 2JRMA 1LWXA 1T05A 2DHHA 3BM7A 1VMBA 2MMYA 3FEZA 4NCBA 2FY1A 1KFSA 3CD6I 3LP2B 2NYIA 3HOVJ 1UHSA 2LYCA 5U47A 2EBGA 1Q1KA 4U87A 1L3KA 1P27B 4HFHA 1EQ0A 5F3JA 1V9DA 2OUGA 3TAMA 2MBFA 5D4RA 2MKHA 2YKOA 4MT1A 3AA7B 5FROA 3CCLS 1RR8C 2W4CA 3BGRB 2OIHA 3HT3A 2FXAA 3H9GA 2XEXA 1S7EA 4EEFG 4KY3A 2ZOFA 3SCKE 1XZYA 4UW2A 4HNTA 2R8HA 2A6MA 2JVOA 2X67A 1I6XA 2K8GA 3AODA 4IRHA 5ERIA 1LEBA 1VQOS 2BUNA 3CIMA 2CVIA 1EF4A 4EV6A 9ATCB 4ELUA 3EAMA 3EPZA 3TRGA 2W25A 4PXBA 5F64A 4PWWA 4DV4F 2YDSA 3ZZYA 2LVSA 4A3EJ 1V4RA 2M1BA 2V9WA 4DQ2A 3ZGKA 2HK2A 3VYUB 5L38A 4URSA 4XLHA 5AQKB 1FWPA 1RT1B 1YIJI 3ZTQA 3U27A 5E3LA 4P1NA 4B9UA 1T05B 3WAJA 1RTIB 3K3NA 3NWSA 3JSYA 4ZI3D 3T1BA 5A2QZ 1YYVA 3QFWA 3PUYF 2IAIA 3FXJA 2PJRA 3GLXA 2XWYA 3FMBA 1T7PA 1MWZA 2I5JA 4GOUA 1WDTA 2AYBA 3B5MA 3MWMA 3AVSA 1GXUA 1FESA 4N41A 3OV7A 1BL0A 2LVWA 2V1NA 1U78A 3PJWA 1W1WE 5MAOA 3L2QA 4DV5T 2AJ2A 1MDMB 2LKGA 4KITB 3MM5B 4OHWA 3BR5A 3N9OA 4YSXA 5CD4H 3DCFA 2VUGA 4HWDA 1LOUA 3E01B 2R7XA 4L9TA 3OJAA 1WFDA 4QWBA 1RAJA 4O3RA 4WFNQ 1OJLA 4CZCA 4KGVB 1Q8LA 4YB6A 5CFBA 2UXCT 1HNZT 4IO1A 4ANDA 3DLEB 1QDUB 3I0TA 1TQLA 1XEZA 2FBWA 5IFMA 2UVVA 1U1LA 2HHSA 4P0AA 3G82B 4IHTA 2QL9B 3PFOA 5K14B 3MCSA 4I55E 5D8KB 1R7IA 4RL1A 4V19X 2R8KA 3LK2B 4HA8A 5HQLA 4EO8A 1IJ5A 3MURP 4K7QA 2IS6A 2R2UA 4DBRA 3B73A 1NK6A 4BBYA 3LSVA 3BBBA 2LEHA 2CJQA 1KHVA 1DARA 2X3DA 2FLNA 1I3OB 2JWTA 4DV0F 1HWJA 4CDIA 2LH9A 5L2LA 2YKNA 3MOJB 3H4DA 2LMIA 3FB2A 3I4HX 1FXDA 3GIMA 3KHHA 2LDIA 3RRCA 3G4SS 3ECOA 4I2PA 1QO0D 5HVQC 3I5BA 1Y3JA 5HVGA 4DV4T 2K86A 5FGMA 3TAPA 5LXTE 1P2FA 3BPSP 5G0RA 4K4ZA 4PCQA 2RHSB 1OQYA 1OEDB 2CUYA 2KM8B 4CCNA 3X1LB 3ZZ0A 3TJ8A 1Q81T 4U7YA 5C3EJ 2YKQA 2KXHA 2EEYA 5KFPA 5HEJA 3D1QA 1KRPA 3N28A 1RR7A 1SANA 2LXUA 3DRSB 1JUSA 4AKHA 2KRCA 2VN2A 3TP2A 3L09A 2ISYA 1S6PB 2FHMA 1IF1A 4NRUA 1UKUA 1WEZA 1YG2A 3P7NA 5KFFA 2YWWA 2BACA 3FUYA 3FQLA 3IRWP 2CPYA 3Q5XA 3TAMB 4YB1P 4NPOA 5IC6B 3NRXA 3U7JA 3GO5A 4BC7A 1IV8A 1KEKA 3S1NJ 2O7OA 4O4JE 1U47A 1R0AB 3L39A 3LMMA 3ONQA 2L7KA 4BQNA 2GQ2A 2Z9OA 1E6VB 4YTNA 3WG9A 3IF8B 2RQ4A 1WG5A 4YEJA 2B4PA 1J1JA 3M1CA 1WGXA 1UVJA 4QSHA 1CJKB 2DR8A 5E3PA 4XL9A 1A0OB 4X20E 1SC3B 2PMWA 1VQYA 4RBVA 2V9VA 5CZVA 1G3YA 3PSFA 1Q86T 3M8EA 4JI2J 1N6QB 1Q78A 3HJFA 2DT7B 1EKEA 5A8WA 3ENQA 5AIPA 2NVUB 2CPHA 1J5EJ 2H51B 3VGSA 5KX5E 1Q8BA 3R84B 2ASJA 3D3BJ 4BC9A 3O1HA 3OR1C 1SQEA 5FD1A 2LU1A 2R7VA 1S0VA 3UVJB 1FBUA 1ICEB 3SRZA 4JBCA 3LSHA 1EHWA 4ILBA 2CPJA 3GU0A 1D5VA 3HVWA 3TOQA 4D7MA 2R4FA 1GHCA 2R93J 3CQZJ 5IC4B 2IJNA 2KDOA 3MPWA 2AHOB 2ZHBA 2CJJA 3VSLA 3GIKA 2FF4A 2KVIA 3BGFA 2XLKA 4KHPF 3I0RA 3JRGA 4NB5A 3M8QA 3F8MA 4YHJA 1J2XA 4CYUB 2ILYA 1UL3A 4EJUA 1FJCA 2GCFA 2BANB 4DV2J 1PAEX 3SDGA 2RUGA 3KBTA 1XGNA 2CW0F 1SH0A 4KT5C 1OLTA 3MEEA 2NRAC 3D5SC 1KQ9A 4IO9Q 1S12A 4H9PC 1AUDA 2HVIA 1GMWA 2CQPA 1BQXA 4PWDA 3CMES 4A56A 1XDPA 3UUNA 4R79A 2ZM6J 1IJ6A 3OW2R 5ABFA 2LNBA 2XAUA 3D0TA 4OFZA 3SDBA 3I4MJ 3CX6B 3HRTA 2ODVA 2MEWA 1WWHA 3CMMA 4BAYA 2JH3A 4ZEYA 2GHWA 4KV8B 2MKIA 4YHHJ 3CKDA 2BX6A 2HRYA 3D6FB 5FL0A 4IREA 5KTQA 2ODUA 3ZLIA 3ESWB 3GMEA 2DEIA 1Q16B 5I42A 1MIYA 2JT1A 3BH7B 1K78A 2IVYA 4K5RA 3T1HF 3SCLE 5C24B 1NKBA 2DPJA 2R8JA 2B5JA 4KGZB 4N76A 1RZMA 1M5SA 2WB1A 1NDKA 3G71S 3JC6C 3ITHA 2IGOA 1JLGA 2C2OB 1N36J 2KM8C 1ETYA 1B4AA 4IF4A 3QIPB 1LEAA 4UOHA 2BHZA 1KVJA 4OJHA 2QSFA 2MABA 1S6PA 4DL5A 1K0VA 3GFJA 3VRAA 3UU4A 3EGZA 1X1CA 1CSJA 1HBNA 2WC2A 4QW8A 4LVOP 2K7JA 4ITSA 2FJWA 2LQ5A 1WDDA 4PK4A 4A3MJ 1IUJA 4A3LJ 2XM2A 4DV1T 1RT6A 2CUZA 2BYCA 3IM8A 1W9RA 2VQHA 1WH7A 3BGUA 4MLKA 4EZHA 3LUYA 4NLOA 3FISA 1ETXA 1RT4B 2CWEA 3FMRA 5ABFB 2IM0A 2CFOA 2DFIA 3O2PE 1QD1A 2L4AA 3Q5WA 2L3LA 1X9BA 3NRVA 4XBFA 3H42A 1T0FA 2IBDA 1NKCA 3IBCB 1G7CB 1NK0A 2DN0A 4B3MF 2QL7B 4J2CA 5J2UE 1QQIA 4BJMA 1FE4A 3TNVA 1JHHA 4XOPA 5E3QA 4GCVA 3C7JA 5AXMA 3W5ZA 3QOPA 4RDUA 3J9X1 2E5LJ 2COMA 2WTFA 5JQGE 3IR7B 3B54A 2WM9A 3QPIA 4M1PA 2WU5A 3C19A 3JSPA 2KZVA 1MIVA 1CJKA 1SAXA 1QPMA 4LMJA 3IWXA 4FQGA 3PVXA 3M8PB 2QX0A 2I5JB 3OXGA 1AFIA 4D3HA 2GV1A 2ZFUA 3JRAA 4E7IA 2L9WA 1WHVA 1WKMA 2D5UA 1Q1VA 2X66A 2JA5J 3DEEA 3DYAA 4X4VA 2VURA 1J5YA 3CDIA 1X4BA 3RYPA 5AQUB 3FM5A 4Z90A 3W6JB 4ZHRA 1HS7A 4HE8A 3M4XA 1BXNA 2I2YA 2OSQA 2PBIA 3KP5A 2DGQA 2UXBF 5M2PA 2YKMB 3DHWC 1GFWB 4EBDA 2EHOB 4JX4A 4EEYA 3R60A 1MJBA 4BACA 3H8YA 1WG1A 3MZIA 2BV3A 1L3UA 3RYRA 5HROB 1FXRA 4ED5A 3TL4X 3KK2A 4JEUB 4EYYR 5ABEA 2HVSA 4M6YA 1PSDA 3DEUA 2ZZMA 2ZBCA 1QUPA 1ZTRA 2MTQA 2QZ8A 4JP0A 1P1TA 1ITYA 2V8GA 4L0RA 4N78D 3BZKA 2VKVA 1XNQF 1SFXA 2LY9A 5J4YA 1G2EA 3PUQA 3BBFA 1FT8A 3PDYA 4N9HA 2RDJA 3HXLA 1JLFA 2UXDJ 1AYEA 3B6AA 2GVZB 3PYEA 1VQ4S 4PXEA 2XTJP 1RB0A 3EE3A 2UV8G 3GTGJ 2EC0A 2WWYA 3D6TB 4G63A 3WIUA 4DW6A 4DV7F 3CSKA 3FK6A 4FDFA 2EZKA 2BJ3A 1XMOT 4HACB 3G6EI 3V5UA 1F2GA 4U6PA 1ZAXA 1XQIA 2V1XA 4PDKA 2VA2A 2YNHA 2KO1A 3HD1A 1ETWA 4LK1F 1KU9A 2VL1A 2VG7A 1QTNB 4UY8T 1FKAF 5J3LA 4PKDB 1HBUA 4K0KJ 3I4NJ 3MWBA 2BE2B 4DX6A 4ZHRB 3PIOQ 4MAKA 4USHA 4ES1A 4M6XA 2QEXI 1EB0A 1WEYA 2MD5A 4PJJA 2AQEA 4WU3A 5FLMJ 1KN6A 2HHHJ 5HLIA 5KVRA 4M5DB 1Z6TA 2KRFA 4PEOA 2QFIA 3RF1A 1BQMB 1S1XA 1J09A 1FD2A 1VQ8S 1R36A 3L2VA 1J5WA 2FJDA 1OSCA 4U0WA 2BQRA 2DGXA 1ZR4A 4XDDA 3CCTA 3GYGA 2M8GX 2DTJA 1HNZJ 2IC3B 2XMTA 3Q8QB 2L41A 4QCLA 3NGTA 3F8BA 1DQUA 2HXIA 2XQ7A 3I96A 4L74A 2ZJ2A 3CDHA 4Z2YA 2BKPA 3A4CA 1JMTA 2MZTA 4ECXA 1FTCA 4ECYA 1UP1A 2DCEA 4U0VA 1WR6A 3PR5B 3PRVA 1R6VA 2YVSA 1HXDA 1AXQA 2QYWA 1OR7C 4LLGF 1RABB 4GFBA 2HBZB 3ETMA 2EBIA 1QSDA 2FJXA 4XMYA 1H7CA 4XN0A 4CXWA 4MLOA 1IJFB 2CXEA 1N33T 4I6AA 1ZA2B 4QIWN 2ZKZA 2WV1A 4M3FA 4IHVA 3QGPA 5KG5A 2IDEA 1G3OA 4WWSA 5JDMA 3W65A 2VUMJ 4GYRA 1PCAA 4AL6A 4LF4T 3KPHA 2YNIA 4A3BJ 3M32A 2KMUA 3QZ7A 1IXCA 2YWKA 2CV1A 3KV5A 3T8TA 3JSRA 1ZR2A 3H92A 3BQKA 2UUAT 4HT7A 5CYQB 1MH4A 3P9IA 2B4UA 4PG6A 4RLEA 2ZMAA 5FY1A 4DDFA 2R8GA 3CCMI 2WDQA 4ZVRB 1CEZA 1RKWA 2P5VA 2BMBA 5AJ3J 3SFIA 2JZYA 3CCSI 5CCLA 5L3FA 4NCGB 2K3WA 4M5IA 2NXEA 5DS7A 4L18B 1NBEB 2JQ7A 2PA3A 3HRSA 2MAWA 4UVCB 2XYGB 3MKLA 2E1MC 3F2EA 2F6CA 3M9OB 1GQEA 2H6CA 1S6LA 4IL4A 5IYDJ 2HPLA 1UMQA 2QCOA 4GXOA 4DX5A 3B02A 4F67A 4P6QA 4J9KA 2X1CA 2IYIA 2XUEA 2GIRA 2FJEB 1B7TA 2EI5A 1I1SA 3L9ZA 1IKVB 3ZMZA 4C2TA 2N8GA 4ZVOB 5C42B 2V8SV 4DYCA 1T9TA 4CWBA 3CCRS 4PFPA 5KFWA 3HULA 1ZGJA 4X1EA 2BG9A 4FS2A 4U33A 1MBJA 2HNHA 1IKWB 2HKEA 1J9IA 2ZJPQ 1HKAA 4JI2T 2ASDA 1Q4RA 2FEZA 4LBIA 2M7SA 1HF0A 4AD6A 3CF5Q 3FKJA 4Q45A 4DMZA 3PNTA 2HFZA 2UVWA 1ETKA 4M9XA 2XSDC 1WSVA 2WMNA 2YY3A 1UA0A 2V26A 4ZJOA 2E1PA 3BBCA 2N1GA 3BQYA 2FJVA 4BWMA 3EDVA 3W64A 4G65A 1UGOA 5LSOA 2C42A 1ZKEA 5A8WB 1H3DA 3G8QA 2I1RA 3ZZZA 3V6HA 2MC3A 2ZVIA 4M3BA 4DPXA 1X7VA 3AQPA 4FPIA 4HX8A 2N2NA 3T5KA 3OYCA 3MUVP 2EV6A 1JXSA 1RWXB 2CYYA 1SFEA 4A8SA 4H63V 2NS1B 2WVFA 2KT5A 1T95A 4LSZB 1PGZA 3SDEB 5KFLA 3OL3A 3DMJB 1D9FA 3HX9A 3SYZA 4ZCKA 2KZMA 3ZMDA 2KIUA 4ESJA 1FERA 1RQ0A 4IDNA 2CQ2A 3NOCA 1LNWA 3F22A 2Q9QB 4NASA 4DR3J 1T9WA 2G4BA 2L2OA 1EIYB 4AIKA 5MLCV 3KK1A 3VF0B 4A5NA 5F8LA 5DUIA 2JPFA 1OEDE 5M5YJ 4ZZLA 4IDOA 1HNWF 4KO0A 2WB4A 1VBXA 1DRZA 1Z3YA 2XAJB 1SKWA 1FOYA 1UJ8A 5IYBJ 4PGGA 1WRDA 1VS3A 1DGRM 2N4DA 3JSMA 1WC4A 5BS6A 3ZQLA 1TQPA 5FXWA 1UX4A 3B82A 2AGOA 3WAKA 4JI7T 3F57A 3I0OA 2NOXA 2E1AA 3WX8A 4IO9F 4JV1A 2CEAA 3ZYLA 3SDEA 1OPZA 3ZTOA 3QAEA 4TYBA 1ZH5A 3GSDA 2E9XA 2X6WA 3DP7A 3C2PA 1XSXA 4DV6T 2DNOA 4HKAA 3MTKA 5CA5A 5HATA 3CO6C 2ZITA 1YITS 2YH1A 3BPXA 1N8RT 4PG8A 3T3FA 2D3OR 3FRZA 1FKOA 2CUEA 2VG6B 4Q8EA 1TV6A 2R5ZB 3M8WA 4RO0A 1TP7A 2IA1A 1VC5A 4ZVTB 3NGKA 3MM7A 3S6EA 5L9NA 3FZMB 4CTAA 5K1YA 3ZTSA 4B9VA 4UOFA 3EYIA 3K4MA 3G6XA 1SKSA 1TW3A 1F3FA 3RIAA 5K5QA 1X31C 2IBOA 2OUMA 2HQCA 2MGZB 3KEQA 3Q9VA 3IC1A 1RLDA 3D0GE 3ISZA 4BJNA 3GILA 4UZCA 2COBA 4WPAA 2YU1A 4DQSA 1XG1A 3KTQA 4MFDA 3T41A 4A3GJ 1M5PC 3OL8A 2BG9B 4FBUA 1WC1A 2BABA 1MMNA 1C0TB 3AEFA 2VDIA 4UV8A 2OELA 3LAPA 5E3CA 4C8KA 5A1LA 2L4MA 2ZHOA 4IHXA 3BJOA 2XY8B 2MHNA 5GAEI 2CNLB 2NOJB 1A31A 2HBQB 3PUBA 2JWNA 3KMSA 4R8UB 4X62T 3H36A 5LBMA 3C16B 2OD6A 2LKZA 2CADA 1TQMA 1F9EB 1NHKL 4DUZT 1MN9A 1CBKA 4IE0A 2P5LC 2DGWA 3BDDA 4CO4A 4OI0A 1ULRA 1HDPA 3PJRA 3C50A 3PU8A 3NY0A 2DA4A 1HMVB 1JKRC 4UQGA 3E2EA 3D0IE 4ZLJA 5HAOA 4HLBA 5EWEA 2V8PA 2HHXA 3DLAA 3GFMA 3LSIA 4XRMA 4PNIA 3EVYA 5HLFB 2Q9QC 5AQOB 4RW6B 1BLUA 4LF6J 4QXCB 2ETHA 3CXCR 2W1BA 1CF7A 4DR5T 2F63A 2XMJA 1RAEB 1R4NB 2NREA 2D1CA 1S49A 3DPLC 4GKKT 1NK9A 4LMLA 3K70D 1C1CB 2CQCA 4XLFA 5DUKA 5GAGJ 1HF8A 2XSAA 5DZ7A 2UUCJ 4ZDLA 5CYQA 2FMLA 2HQ3A 3P4UB 4LFCF 4JYAT 4O4HE 2V34A 4P7TA 1QVGR 3ABUA 3GJSB 4DR5J 3UCGA 3HP6A 5C44J 4ZITA 1EX8A 2KIMA 3FX3A 2WVEA 3H40A 1P4WA 2XRLA 5DCMB 4PYDA 4ZJQA 5F9LA 4JI4J 3TKLB 1S4FA 1FVQA 2WVDA 2XROA 3MECB 4RNNA 1R6RA 3EGNA 2V63A 2HZAA 5JJBA 2FHJA 3GONA 1VQ9I 2OPTA 2ZH5A 1QTMA 4DSIA 1OEDA 4RW7A 2R4GA 1PYTA 2ZBIA 3LPYA 1VQLI 2J0QD 2J5AA 3O1LA 4HV5A 2PSZA 3CTAA 2B9YA 3G82A 5IHYA 1C0UB 4FX4A 3RPQA 4QIWD 4OYBA 2E7WA 2BBJA 3S16J 1W0UA 1LQ1A 1F4KA 2QL5B 3GN5B 3QK6A 2MZRA 1G8XA 3L2WA 4X4SA 1VQ8I 3FGVA 1AW0A 3RX6A 1HNIB 3GZ5A 3L7PA 4XAXB 3VOEA 3B57A 3SXLA 4I7FA 4NHJA 3B6CA 1T38A 5F0HA 4I2OA 3CC2I 3GJTB 4KBIA 2CSOA 2P9EA 1C4CA 1LWEA 4DF4A 4IFVB 1H9TA 4DN9A 4IG3B 2OEJA 5F0UA 3R97A 5DDRC 4EGYA 5I3QA 4O3NA 2OPSA 3DOLA 3AD9C 5TGTA 1V3RA 4EUVA 2XQ6A 1OMSA 2LDYA 1B70B 2WAQN 3U21A 2DNPA 1UZCA 2WWUA 1HG5A 1RBOB 1NK7A 2QLWA 4QTRA 2MSYA 3PX4A 4ECVA 4LR9A 5EGOA 2FHOB 3HVRA 3BSCA 1NTCA 3RIRA 3FRYA 4C98A 3LFMA 1N32F 1R71A 4RUBA 5HBMA 1FOKA 4KA4A 5KFSA 4DR7J 3F6OA 2HTJA 2LREA 2LDUA 2O61A 4DR2F 3CJKA 3AE7A 1FLIA 3KJVB 3ZYKA 2VKRA 2FQQB 2XGDA 2CVEA 2MY7A 3EYYA 3BGRA 1IRXA 4ISSA 8RUCA 3QZ8A 2DQLA 1HQEA 4P2SA 3NRBA 4QYZK 1OQ3A 3T1YT 3BQ2A 3DTEA 4QJVA 1N33J 1U6GA 3FK7A 5ETMA 4FYWB 4CO0A 1E6YA 1JI8A 1IXKA 3J7Z5 2ZE2B 3RI4A 3FK4A 1VQ9S 4O3PA 2XLJA 1Z0XA 2XPWA 2HXOA 3OYBA 3IBPA 4RNMA 3UU6A 2V8HA 3PO4A 5GADJ 5D4PA 2WCXA 4U74A 5M5XJ 1VQMS 3TZYA 1CUNA 2LG4A 3QT6A 3BR8A 3KEYA 5ETQA 2UXBJ 3C1DA 2ROEA 3CVKA 1U02A 2V7FA 4IX7A 1RTHA 4Y2MA 2HBYB 3OFGA 4H9QC 4RKUC 3IRXA 2Y8YA 1SH3A 3LP1A 2WWVA 4U7UK 1QHHD 1OCZH 3OL9A 4F3MA 5IZHA 5H1SV 3KLGB 2ATLA 4M5NA 4PQAA 2P9GA 3BKUA 4QW9A 3KUEA 2KJCA 4RUAA 3OTDA 2W7PA 4EM1A 4N77A 2W9BA 3PW2A 2R5YB 2RS8A 4JBWF 2M30A 5DM6F 2XAHB 2L9NA 1SUMB 5JDGA 3EICA 3JSBA 4ZI3C 3S1MJ 3S14J 2VOOA 2ZH8A 1IRGA 2DH8A 4DL0C 3PCOB 3HHLB 2MKJA 2V9PA 3H3MA 5I3UB 3ZMSB 1EH6A 3DI6B 4LF4J 2VK9A 3A1YA 4OV6A 2OU2A 4DL7A 2EV0A 1X2MA 3IL2A 1TFYA 2XC7A 3BZCA 2A05A 3FC9A 5KFVA 4LF5T 3A3PB 5LMNF 3HL2A 1FTZA 2GX8A 4E2FB 4DR1J 4ESFA 3T8RA 4BXFA 1FJGF 4HNVA 1UUSA 1MMDA 1R1TA 2BY0A 3NKZA 4PZJA 1GX5A 4GC7A 2X9WA 4BCAA 4KT6A 1DTQA 4MHGA 4KSEB 2XG8A 3P5BP 2J9DE 3DJBA 2PMHA 3OS1A 4YIFA 2AEFA 1SB6A 3EDPA 1HR0J 2LFVA 4IHWA 2YXLA 3BR2A 2DFFA 1E3PA 5HEHA 1KLMA 5F08A 1PYSB 1J5OB 1V5GA 2XB0X 4RBOA 1IM4A 4BJ5C 2LSIA 3FXUA 2GXAA 1UW4A 3PHTA 2VD3A 2ZH1A 2LRKA 4ZDPA 1YQ3A 1IJWC 3PJAA 2DAOA 2HQRA 3BC8A 5EDNA 2LYVA 3NAUA 4JK1X 1S0NA 4DZDA 3QSIA 1XGSA 3TA1A 4F26A 3J7AO 3JXOA 3ZPOA 3R5JB 5FD5A 4RU9A 3R6SA 2AV5A 1KR4A 3KG0A 2P6TA 3WTYC 4Y0FA 3MEDA 2XY6A 5J4VA 1HBNB 4HW0A 2VE9A 4HFIA 2VQEJ 1S9FA 3I9WA 1GEHA 4KUMA 3QSYB 3FCHA 2Q43A 4QBUA 1S72I 4Y13A 2RQMA 2DIUA 3K89A 3J7ZT 4DZJA 2O3DA 2Y1LB 4NI2A 2JQ9A 2FD5A 1GTEA 2DR5A 4X6AJ 2OA4A 1FFWB 3SZGA 3MAAB 5IT0A 3V8JA 4XIDA 4EB6E 3SSSA 3W2VA 1R8HA 4LD5A 2FDNA 1RTZA 3T5LA 1U2FA 1WFXA 1Z3XA 3KNGA 3HHLD 1FKPA 4JI0J 4ZS6A 4PR6A 1WYBA 2NSBA 1R8PA 2W2OP 3U1LA 3FBBA 1U8SA 1F9NA 4JLEA 3NGRA 2V1UA 1XSVA 2U2FA 5EK4A 4ZYHA 4LF8F 4NIQA 4OI3A 2EFVA 5KT4A 3LF0A 5HAXA 4C97A 1T94A 4HAMA 2KG0A 4X4QA 1Z77A 2VPZB 4ILMA 4ENOA 3C15B 4USWA 5LP6E 1JJ8C 3VFZA 1J5OA 2BANA 3M3ZB 3MUTP 3CP2A 2LF8A 1NKEA 1V5FA 4CQIA 4OJGA 4EJWA 3JQMA 3C2GA 5HN0A 1S48A 2NAZA 4ERRA 2K9MA 3TQNA 2MZQA 3HVTB 3BTLA 2Y31A 3DRPB 1IG7A 3DLEA 2VODA 5HXEA 1F5BA 2MSSA 3J80U 1D9DA 5FRMA 3KLHB 2H7OA 1YHQS 5E33A 1QU3A 2F5FA 5KHDA 2NXNB 2UU9F 3PIOF 3ESLA 3A01A 4KIAA 3QC9A 1TKZB 2GA7A 1HCIA 1EH8A 1NB2A 4B3XA 2ESHA 4M3EA 4LF9F 3DCAA 1EJ7L 3HEFA 2M5YA 1TV6B 4OX6A 3WTUC 5HWYA 2V8VA 4TZ4C 4B47A 3OR1B 1S6OA 3VODA 3FXRA 1S7HA 2FZCB 1NWMX 4F8HA 1UURA 3AE2A 2O9LA 1XGOA 3MTJA 1E6VA 1IBCB 3K1SA 4X4TA 3K3QC 4HV6A 3MEGB 1Y8RB 3IS9B 1SHZC 3OJUA 1X3WB 7AT1B 3JCFA 5FYMA 1SVDA 2HN1A 4DQPA 2ZC2A 4X4OA 3QYBA 3UDVA 4C8LA 4ED4A 2HMIB 1XWLA 1VIOA 2QSHX 1SQFA 3H0PA 3GVAA 4C3IJ 2XAHA 3C3WA 1U1OA 2XVCA 4LF1A 2Z3YA 4WJBA 1LUJB 3U3IA 2I9SA 3P4QA 5HXHA 3A8EA 1IKYA 3IRQA 2WSSV 4F4XA 1M7KA 2CQKA 4IQMA 3IMQJ 3TO6A