3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
b'SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
2H6BA 4DQ2A 5J8CA 4CGZA 1HW1A 3E5XA 5JI6A 4M9ZA 2VT2A 3QP6A 1IN6A 2RQPA 2YU3A 3K1PA 4YIFA 1IN8A 3FMQA 3V7CA 4Y13A 3HRTA 5E8GA 2BBYA 3RKWA 4MEXF 1HKSA 2JSCA 1QGPA 5CVIA 2BYVE 1QNTA 5F1RA 1BI0A 3ABTA 1LEBA 1SD5A 2UZKA 2Q8KA 1R22A 1JHHA 2HFHA 2WTEA 4EM1A 1KGSA 2FE3A 1P4WA 2EA2A 2FMLA 3WTUC 5D8KB 2ISZA 2P5KA 5A2QK 3V7RA 5D5UB 4WCGA 4PDKA 2WC2A 4OOIA 4OMZA 1BBYA 4G6DA 4HA8A 4LG0A 1B6AA 4IJAA 4BYYA 2GXBA 1K79A 3C1DA 1YIOA 2XAGA 4IXAA 2Z33A 3B73A 1FP1D 4HZFA 1XDUA 2XIGA 2MC3A 4M9SA 1G3WA 1K6OA 2GQQA 4ENNA 1K7AA 4LK1F 2P4WA 1R7JA 5HOOA 2UXXA 4G7ZF 3RYRA 2DAOA 2G7UA 2PFBA 1S29A 2HWVA 5ICGA 2L01A 2G7HA 3LAPA 2KJBA 3K1MA 5EEHA 3SQNA 3Q5FA 5BPIA 4ZZLA 3DP7A 4ESBA 2PI0A 5BMZA 1SMYF 3MAJA 3L00A 4I98B 2EB7A 2IW5A 5LGTA 1HKQA 1ONVA 2VN2A 4EJTA 2ESHA 2AXLA 4KUMA 3RPQA 1S7OA 2A3SA 4HF0A 1CGPA 4ENJA 1XDSA 1H0MA 4HLYA 4AWXB 2QENA 3C18A 5E1WA 1FC3A 4U0WA 1JGSA 4ZYDA 2EV5A 4KNYA 1ZARA 2P6TA 5JVTA 5FLXK 3HTUA 4KIBA 3TQNA 1RIOH 1DUXC 3O3KA 2FU4A 4L0YB 5DEQA 2P8TA 1I6XA 3GFJA 3PQJA 4ZYGA 1T39A 2DQLA 3LFKA 4KDPA 3WU0A 2HKOA 4RAZA 4LB5A 3SHFA 2P5LC 3T8TA 5FLXZ 3E6BA 5HVQC 2XKOA 3IKVA 4R79A 4I09A 1BIBA 2ZXJA 2DPDA 5AONA 1LVAA 1W7PD 1MDMA 4EJVA 5HLHA 3M7GA 5H20A 3ISPA 4G7HF 3WGIA 3WE2A 5CVUA 3JAMZ 3ZMUA 4L9VA 1T6SA 3N4MA 1X3UA 2EFPA 1YO5C 4WK8F 1PP8F 4LFUA 2XROA 3O6BB 1PUEE 1Z05A 2DO7A 4IHTA 4P55A 1EV7A 4OIRF 5D5WB 1K78A 2K4BA 4EGZA 1HKTA 3FM5A 4F7ZA 2LSOA 2FSWA 1MKMA 3B02A 4PGGA 3Q9SA 1PDNC 2IA2A 3BJ6A 3DV8A 1O3QA 4OIOF 1SFXA 1UHMA 1IXRC 2NNYA 4CICA 4OMYA 3F21A 1MDMB 3K9TA 1LEAA 2PJPA 3IWZA 4IRGA 1ZN2A 2XV4S 5L3EA 3QOPA 1HXDA 1XGSA 2KIFA 2W24A 2H27A 2V1DA 5CYVA 4PCQA 4BQAA 4NHJA 2L02A 4A0YA 3WE3A 1B59A 4YFNF 1BI2A 4L9JA 6PAXA 5HLIA 2UWMA 3WG9A 2AS5F 2VXZA 1HSJA 2ZNYA 1ZLKA 3MZYA 2HQNA 2X0LA 2DK5A 5J8FA 3EQLF 2RDPA 3LQRA 1IW7F 2VBZA 1IRGA 3TO9A 2HTJA 3FHZA 4HDVA 2O8XA 1Y0UA 4RB2C 4HX8A 2C6YA 1G6NA 3ZN0A 3F23A 3FZVA 4CZZA 5EEGA 4A5NA 1ULYA 4QWQA 1FSHA 3IRQA 2F5FA 3VB2A 3WGHA 1F9NA 1RUNA 3SXYA 2BE5F 4DNCA 3TOBA 4OIQF 3BY6A 4JQFA 4ON0A 4MQ9F 3DKWA 4L5IA 2OQGA 1J75A 1REPC 3I53A 1QBJA 1LDJA 3DFGA 2FBHA 2IA1A 4ZYHA 3F22A 2VC0A 2VODA 1D8KA 1FBQA 1KU7A 2JPCA 1R36A 1STZA 3E97A 3R4KA 2H6CA 3HHHA 1TNTA 3GF2A 3H92A 1DDNA 3O2PE 4EMSA 4I02A 4IF4A 2M1BA 4UXNA 3ML6A 3COAC 3GLXA 2ACJA 1ZG1A 3QRFF 4A0XA 2WV0A 4I2OA 1TNSA 4HQMA 2ISYA 3RKYA 2CYYA 1W5SA 3VEPA 1D3YA 4YG2F 1YFHA 3F8FA 1PP7U 1VTNC 4RGXA 4HF2A 1HQCA 1IUYA 4P5OA 1RNLA 5TRDA 4KICA 2VOPA 4LD5A 3DPTA 1FLIA 4HX7A 1TQPA 2L4AA 3EUHA 3CO7C 1QPMA 2QWWA 2YX7A 4JBAA 1J0RA 2ZMEB 4KN4X 2K27A 1BM9A 1LQ1A 1U5TA 1YYVA 2IRFG 1XSVA 1MZBA 3T0YA 5LHGA 4KN7X 3I5UA 2ADUA 2GIVA 1RI7A 1LJ9A 5DYMA 5DCFA 4NQWA 3WU1B 1SD4A 3R0AA 4UUVA 4LB6B 3D5LA 4HQEA 2A6HF 2VT3A 4CYDA 3F3XA 1YS7A 4AVPA 1U3EM 3TKYA 3VOEA 3WODF 2L3DA 2W57A 2XAHA 2QUFA 1TW3A 4MGRA 3GZ5A 5ICCA 4MNUA 4BHCA 3M9AA 5FO5A 3SZTA 2A61A 3L2CA 1R1VA 1I5ZA 2QQBA 3DF8A 3BROA 4UV8A 2O03A 1U78A 2Q2EA 4RS8A 4RB0A 1FZPB 4G6QA 1U5TB 2QM3A 2ESNA 3ECHA 2FBKA 2IT0A 3FXQA 4N9IA 3JSPA 4ETSA 1LDDA 1MD0A 2ZJ2A 3HRSA 3LAJA 2KKOA 3KZZA 2Y0MA 4OINF 1TBXA 1TW2A 2Z99A 3WTVC 3LWFA 1Z9CA 1YG2A 2MLKA 4UVCA 2CQKA 2STTA 2GZWA 5E20A 4WXHA 2PEXA 3KFWX 2O6GE 3HRMA 4EQQA 1O3SA 5F6FA 1O7FA 2IA0A 1IN5A 3QP5A 2VC1A 5KK1A 3CLOA 2VE8A 1NHAA 3QAHA 2EFQA 5F64A 1FT9A 3KP5A 4B09A 3IHUA 3M8FA 1XB4A 2K86A 4L18B 3GW2A 4HDUA 5E8IA 3I59A 3HOTA 3HHGA 3VODA 1SD6A 1TQMA 4Q48A 4N9HA 4UNOA 4CO8A 3C3WA 3ZP5A 2NRAC 3DPLC 3CO6C 3CUQA 3I58A 3P7NA 2F5DA 4AD9A 3KEOA 4ESFA 2VONA 5A2QZ 4IRIA 1RUOA 3MCZA 2G9WA 3WTTC 1Z6TA 4LLLA 3HSEA 4P9UA 1LNWA 3GVAA 2OZUA 2EFWA 3N97A 3F8NA 3R60A 2XGXA 4HW0A 3GEZA 2PQ8A 1F1ZA 1TTYA 3CDHA 3V7SA 2D1VA 3RKXA 5LEJA 5JR3A 4IPAA 5LGUA 1JE8A 2W25A 4WX9A 4U88A 3I59B 4LG0B 2W84A 4S04A 1J5YA 1A04A 1HSTA 2P7VB 3EDPA 2EFNA 3HIFA 1S3JA 5D5VB 2JT1A 3CUQB 5DUIA 2KIMA 1SAXA 4YIIA 3RIRA 1R5HA 2QLZA 3EYYA 4EJOA 2D2WA 2MBFA 3DQVC 2W85A 2P6SA 1FBUA 5LRRA 1Z6RA 3M8EA 1MGTA 3LA3A 1U6GA 1BJAA 1SD7A 1R58A 3DEUA 3ZN1A 3ULQB 2QQ9A 1BC8C 3FX3A 3IC7A 3IL2A 4RGRA 2DTRA 3V8JA 1QQIA 2O0YA 4HYEA 1ZG5A 1KYZA 4AIKA 3FXRA 2LNBA 1B1BA 1GVJA 1V3FA 3F6VA 3G3ZA 3JSOA 1WRJA 5DCMA 2HDCA 1JHFA 1O57A 3ZMTA 1O3TA 3SZPA 2RV8A 5DD8A 1BOAA 4EV0A 5HS9A 3GUDA 4P96A 3BZ6A 2FNAA 4XSXF 2BGCA 2RKHA 2OAZA 1W5TA 5CJ9A 5FB2A 1XMAA 3RDIA 3W6KB 4BAYA 1OMIA 4Z2YA 5HS8A 1Z1DA 1G4DA 4YFKF 2O3FA 2ZFWA 4MTEA 1FBSA 2JZYA 3J7AO 4ZYEA 3U1DA 3ERED 2DFIA 2PMHA 2A68F 3HTSB 5DCMB 3U2RA 4I01A 2P7CB 1WQ2A 5BOXA 1ZRCA 4MTDA 3GWZA 1FYLA 3MFKA 2EJRA 3FM3A 3ELKA 4IRHA 5LEKA 2NYXA 1WI9A 3ZMZA 1K78B 4RB1A 1XCBA 4OU0A 1MJBA 2J5OA 3HSFA 4XSZF 2E1NA 3KP7A 4L0ZB 5HDGA 1T98A 2FA5A 1F4KA 4EGYA 1S8NA 1AWCA 3TDZC 4ZZDA 1HW2A 4L9NA 1EH8A 3Q9VA 1Z91A 3E5UA 4LJZF 3G73A 1R5GA 3NRVA 1DP7P 2EFOA 4GO1A 2M30A 2K7LA 4EM2A 4QLCU 1H9GA 2ETHA 3WTZA 1OPCA 1IXCA 5HDKA 3P9KA 5D4SA 2HQRA 1L3LA 2H09A 3E3VA 2HR3A 5H6QA 3S2WA 3FWEA 3R0JA 3J80K 4KT5C 3KLOA 5D6FA 1FNNA 2B0LA 2FBIA 3F8CA 2CWEA 5ICEA 1J9IA 3FF5A 1LB2A 3KP6A 2DBBA 2VOOA 5ILUA 2HYGD 2DT5A 4GYIA 2MD5A 3JW4A 3TO7A 5E17F 4FHTA 4FX0A 1XGOA 2KJCA 3E6MA 1C0WA 4RAYA 4PGHA 5HLGA 3TGNA 1YW9A 2J5PA 2MH2A 2V6CA 2Z9OA 3FXUA 4GGGA 5CVRA 5L3FA 4ASNA 2FXAA 1I27A 2MLGA 4CHUA 4B8XA 4U7DA 1XSDA 4HAMA 5K5QA 1E2XA 3BPXA 3ABUA 3QPHA 5LGNA 1OKRA 4KIFA 4M6YA 2R3SA 5DD4A 3KEQA 1MJAA 2DU9A 2CG4A 2QYOA 2A07F 1OR7A 1GXQA 5LBQA 2YR2A 2STWA 4WF2A 4M6XA 3K1NA 5BPDA 2OD5A 1YTYA 2R7DA 5LHHA 4HLXA 1WSUA 3BPVA 3TDUC 1J7KA 1QO0D 2FNPA 3I0TA 1KQ8A 1YQAA 5IT3A 1W7PA 3F8BA 5FD6A 2FEZA 2UXNA 3E6CC 5H6RA 2Z5UA 1USTA 4UVAA 1QZYA 1G3TA 1U8RA 2XAQA 4ENKA 3IKTA 2JRTA 5HDNA 2Y75A 2WWYA 4M71A 3L9FA 1BC7C 4MEYF 1RZ4A 3FMRA 4CDGA 2D45A 5CVJA 4EM0B 4Q47A 3GX4X 3P9IA 3ZMSA 3ZMDA 4EJWA 3E5QA 2GA1A 2F5EA 4MQVA 3DXJF 1U5TC 2DK8A 1UCRA 2NNNA 1S6LA 1TLHB 2CSOA 2KRFA 4LMYA 3QPTA 1I1SA 5AIQA 4A6EA 2M87A 4O6JA 2A5YB 4G9YA 1YS6A 2PN6A 1ON1A 4TV7A 4L5JA 4I0BA 4A2UA 1LDKB 4R8HA 2PLYA 3EYIA 5IT9K 2BEOA 4XBFA 2FOKA 1W7PB 1G3YA 4RGSA 4WWCA 1BN5A 2DW4A 4KMUX 4EJUA 3C7JA 3VFZA 4UVBA 3LQQA 2L54A 4I7HA 4Y15A 3SFZA 5HS7A 4M74A 2HEOA 2D1HA 3RJPA 2YX4A 1ZG3A 1P2FA 2LF7A 1ZAOA 4S05A 2JPBA 5L3GA 3KP3A 3BOQA 5IT9Z 1T2KA 1UB9A 4E70A 3TOAA 4ESJA 5LHIA 3GO5A 3ROUA 1WWXA 5LLQA 3BJAA 3TO6A 4FX4A 2FQ3A 2IP2A 4P9FA 2QVOA 3H3UA 3I71A 1R00A 5FGMA 2COMA 1T0FA 1E17A 1GXPA 2OQRA 2HKXA 3CTAA 3JTGA 2ZCWA 3W6JB 1ZLJA 1O7LA 5DV5A 3OV8A 4GYGA 4RGUA 3REOA 3QU6A 2JTVA 2IJLA 4KMFA 4KA4A 2VE9A 2YSRA 2F5CA 3OOPA 1XD7A 3EETA 1ZHFA 1SFEA 1USSA 2OU2A 1YW7A 4IHSA 2PMUA 1J2XA 3WTSC 2A6EF 5K1YA 3KCCA 1L0OC 4OIPF 2RGVA 5ICFA 2E1CA 2HS5A 1ZGAA 2EV6A 3I64A 2GA2A 2NS0A 3KLNA 1P4AA 4G94A 2DLLA 1Q1HA 4BHBA 1KQ9A 2GWRA 3GZ6A 4GXOA 4M72A 3MZHA 3RPUA 3T5XA 2OZ6A 2QBYA 1IAWA 2VBYA 3WGGA 1BI1A 3CUQC 4Q5SF 5L3CA 3U9GA 5TJJA 4XRFA 2PG4A 3GFMA 1B4AA 4L9TA 4LLGF 5E1ZB 4BH9A 2P5VA 5JFRA 2Q0OA 3F72A 1BIAA 4M9XA 4XLPF 2FF4A 2XAFA 2LDUA 3IRRA 1DPRA 1KU2A 3GXOA 1R1TA 2RN7A 3BDDA 3BJOA 1FX7A 3LA7A 2ELHA 5FD5A 3RI4A 1BI3A 3FMSA 5K5OA 3JAMK 5D4RA 2V79A 2BV6A 3ZPLA 3QU3A 1H9TA 4A6DA 4IVNA 4ZH4F 3LSTA 1T38A 2QZ8A 1KA8A 4Y17A 3E6DA 2QBYB 3RTRA 2E7XA 4HX4A 5K5RA 4N0BA 1AOYA 4WXDA 2XUBA 1OYYA 1XSXA 5DDGA 1FP2A 3HSRA 2EA4A 1P92A 2LKPA 4D0PA 1EH7A 2HZTA 4GCVA 4M73A 3BP8A 1KQ0A 3WTYC 1D5VA 1YW8A 3HYIA 5D6EA 1CF7A 3LA2A 4HV6A 4HF1A 1KU9A 3K69A 4A5MA 1P6RA 3KE2A 4FT8A 3D0SA 5DUKA 4UV9A 2FMYA 4HOBA 4RB3C 5D5XB 3PQKA 3GFIA 5BQTA 1FPQA 4K2EA 2IPQX 1ODDA 2R7FA 5CLSA 4NB5A 1IRFA 2O61A 4KYWA 4LGWA 2QQAA 2YPRA 2ZO4A 4A0ZA 1KU3A 1SMTA 4PZJA 2H94A 1SFUA 3I54A 2ZBKA 3MEXA 2OA4A 3J81K 1G3SA 5JHUA 2F2EA 1ZREA 3GYHX 1CF7B 3L09A 3MQ0A 2L4MA 3AAFA 2GXGA 3KETA 2E7WA 1D8JA 4R1HA 1WKMA 3HOSA 2Y48A 2V1UA 5AIPA 2X4HA 2HYFA 4UHTA 2XKPA 2V1XA 1ZH5A 1DPUA 3K0LA 2EK5A 3J81Z 2RVCA 4HV5A 1FYKA 1KYWA 4HBLA 1HW5A 1UHWA 4BXUA 1F5TA 2MH9A 1J59A 2HOEA 3ZMVA 1O3RA 2VBWA 1EH6A 4AIHA 1JXSA 2DQRA 1FYMA 2HGCA 4A12A 1R1UA 2NAZA 3F8MA 1ZYRF 2V9VA 5ERIA 2RC4A 1B9MA 2VBXA 4I0AA 3J80Z 1IZ1A 4EVIA 5D8LB 2Z3YA 5ED4A 2XVCA 3V8KA 1IN7A 1GHCA 4BHPA 3V4GA 4KFCA 4H0EA 3M1EA 3L7WA 4ENMA 2IVMA 2ZMEA 2TDXA 2MA3A 4XLNF 3F6OA 4WXCA 2K4JA 2CGPA 2PBIA 5FFZA 2CFXA 1P4XA 3KZYA 2ZKZA 1IF1A 5E18F 1QZZA 1R23A 1IXSB 2ZNZA 1MJ9A 1I1GA 3RYPA 2HTSA 1ON2A 1YLFA 3KP4A 3ZQ7A 2M45A 5BS6A 1IN4A 3HRUA 2KIUA 4Q4ZF 3IWFA 2M8EA 1XGNA 2GAUA 2LF8A 2XASA 3H3ZA 3GFLA 3V8LA 4YFXF 4LLNA 1OYIA 4AIJA 2OBPA 1XN7A 4G7OF 2EWNA 4U7BA 3BWGA 4LK0F 2A69F 3R61A 4JK1X 4G8XA 3R6SA 4CXFA 3CJNA 2CW0F 5L3DA 3HUGA 1U2WA 3PFIA 1V4RA 1UFMA 1XCVA 3MWMA 1OYWA 1Z7UA 2DPUA 1FY7A 3WTXC 1ZGJA 2RNJA 2XHKA 1ZRFA 2CO5A 4O3MA 3NEUA 3WTWC 1TQIA 3JTHA 1B9NA 2M5WA 2FRHA 2XRNA 2DI3A 5E1XA 5LRSA 3ECOA 3CUOA 3I4PA 5CVVA 3T1BA 5J6XA 5FFXA 5L3BA 3KP2A 2K02A 4U0VA 4MHGA 1S7AA 1FWZA 4KIGA 5KVRA 3K2ZA 1FSEA 1W4MA 2EV0A 4O5VA 1FOKA 1ZRDA 1HBXG 3NQOA 5ILSA 4BNCA 3T8RA 2XAJA 4U0YA 3P9CA 5ILVA 1XGMA 1XMKA
chains in the Genus database with same CATH superfamily
1TZ0A 1U2FA 2UUBF 3MPVA 4Y6IA 4IOAQ 3MXHP 5TISC 1HW1A 1B8IA 3OJSA 3CCUS 1U6ZA 1R6YA 2JQQA 1R49A 3TEDA 1QSYA 4M9ZA 3QP6A 2NTYA 3MECB 4IDNA 1IN6A 3K1PA 2I5UA 1H89C 1U25A 3V7CA 4Y13A 3PJAA 4V1Ak 5E8GA 3RKWA 5FKOA 2XQ5A 4CLLA 2J47A 4DQRA 1Z4UA 4Q2MA 4MEXF 2JSCA 2VFUA 4JI4T 5J0ZA 4TWHA 4MKYA 2QL7B 2XAQB 1HNWJ 1U7LA 5KFDA 2L9RA 2TRTA 2DA6A 1LEBA 1WKJA 3OFFA 2YNHA 1V3SA 3K8WA 2DR7A 3QWUA 1VC6A 5IY5H 1YJNI 3ONJA 3O5TB 2BKNA 1DHMA 2CUEA 2IM0A 4EM1A 4EXTA 1KGSA 1QAJA 1RISA 9ATCB 2FE3A 4DSJA 1P8GA 2EA2A 3QPSA 3P5JA 2DHRA 4LFBJ 2DR5A 4YTNA 4JV2A 3EE3A 1TVRA 2DK2A 5D5UB 4WCGA 2R7SA 3AD9C 1MSFC 5E5NA 4LF6T 1VHFA 1BBYA 2WBLA 2CZVC 5E3RA 4ZC3A 3OL8A 4HA8A 1U26A 2ZJQF 3DEEA 4LG0A 3GONA 4DO0A 1I50J 4IJAA 3BLYA 2A9UA 2GXBA 3VPRA 1K79A 3H3VK 4TQRA 2G2ZA 2BG9A 5C2TA 2ZBCA 3C1DA 3LP0A 3OL4A 3D1QA 1S48A 2Z33A 1RWUA 1WHWA 3OTOT 1G3WA 2CU7A 2GK9A 2CQNA 1K6OA 2R0QC 3CULA 4ZJZA 3BREA 1K7AA 4LK1F 5HXEA 4CO4A 1R7JA 1OMSA 1DTQA 2LLYA 3RYRA 3I9WA 5GADI 4C9YA 2K3WA 4HVZA 3TX8A 1H88C 2HGNA 5H9FJ 2KJVA 4V19K 1U2CA 2JWNA 5AXMA 2KRBA 5B66C 5A76A 4USKA 1FX4A 2XULA 2YNHB 2G7HA 4KBIA 2EHOB 2AGPA 1XPXA 2IRYA 4AD6A 4C0OC 1W0UA 5DETA 1ZM4A 5KT3A 4ZZLA 2X0HA 5GAGU 4K5SA 4QOTA 3CPZA 4XAKA 5HP1B 4C2TA 1SMYF 3MAJA 3SCLE 2B4OA 4F2SA 4YHHF 2IW5A 1W36C 4MHCA 1H98A 2AXLA 4Y3CA 4ERDA 3HKEE 4AYBD 3R1HA 1ORKA 5D0GA 4IFVB 3SQGA 2CS3A 4HLYA 1NHUA 4TN2A 1KC8T 4RLQA 3OYIA 3OTBA 1WH5A 4EV6A 4URSA 1MSEC 3NCRA 1S77D 1DTQB 3QJJA 4J00A 4XRSA 2P6TA 1BMQB 1JLGA 5JVTA 4ZITA 1X3ZB 7FD1A 3HTUA 2R7VA 2JJ7A 3TQNA 2C3MA 2HQFA 5IV3A 3O3KA 3TWZA 4I55E 2FU4A 1WDDA 4HHHA 1LW2A 2P8TA 3C4XA 1F5AA 1I6XA 3VSKA 1MNDA 4HFDA 3ILIA 4U6PA 1YRUA 3GTLJ 4RW6A 4ZYGA 1OYEA 3R8YA 3F0NA 1WF1A 3BQLA 1D9FA 2DHXA 1AROP 2R92J 1R6RA 4LB5A 3W62A 2RQMA 3LJCA 4CSWA 3E6BA 4DIDB 5HVQC 2XMUA 4K7QA 3AA0B 1C4CA 1BIBA 2GS8A 2ZXJA 5FXVA 4EZ9A 5AONA 5ADZA 3M65A 4AIDA 1OEDA 1MDMA 5HLHA 4NLTA 3SQGB 2LA4A 3HXMA 3CDBA 4RO0A 4G7HF 3FBEA 5DQHA 3WGIA 2V63A 3ZC1A 2XQ7A 2LD5A 5KFIA 3I4NJ 5GADU 3MM6B 2KHMA 3PIOF 1KLNA 2EFPA 4WK8F 2DGTA 2IY5B 2WAQN 1C0UA 1S1VA 1JLGB 3BGLA 3RZDJ 1PUEE 4EEDA 2HXIA 3H3AA 2OMOA 4NLQA 1CJVA 1N25A 1IQTA 2XAFB 1CVJA 3KJQB 1EV7A 2Q9QD 5J4VA 3I0QA 2EIMH 2K4BA 3PTWA 4MAKA 1LW2B 3RKOA 1R8HA 4DR4T 4X4TA 3RTVA 1RHJB 4EBEA 3VU7H 4RW6B 3J81Y 4LQ9A 1VS3A 2IA2A 2H48B 4IQXA 2E5LT 2R7QA 1SFXA 1QM9A 3K4MA 4KSEB 1NSKL 2HS4A 1AU7A 2B3TB 3SOLA 1IXRC 4MYTA 4OMYA 2QA7A 1Z67A 2DMQA 1MDMB 4K4YA 5KFXA 4F0MA 4PWDA 1TR0A 1ZN2A 2CHOA 2XV4S 1QSLA 2LJLA 5LYJE 3GSDA 2H88A 2FUPA 3QOFA 3H40A 1KEKA 3O44A 2KIFA 3UPFA 4GK5E 1SV5B 2H27A 2XC9A 2DA3A 3CCJI 4O4IE 1X1BA 4BWMA 1C0UB 1S1VB 3LO3A 3R7NB 4NHJA 4X4QA 4ZPTR 2L9NA 2LQBA 1S6OA 1CJVB 3OD2A 4YFNF 1N56A 4KE5A 1D9AA 4LIWA 4CLTA 2AS5F 2VXZA 3TAMB 1S6PA 2GFFA 3C14B 1YJ9S 1NAFA 1Q4RA 2MJUA 3KV5A 1FFWB 1SKSA 2V9WA 2CBJA 2A1BA 5CYMA 2F4VF 2MTQA 4JYAT 4DFKA 1HQUA 1OISA 4P10A 2J4GA 1GK8A 4RX6A 5EX3A 2V2ZA 4P1WA 4HDVA 4WTYA 4CT8A 2OPQB 2D9DA 3QB5A 4IG0B 4YDXA 2V4QA 5LP6E 4RB2C 2C6YA 4BEHA 2W61A 3SJMA 3OL6A 4PWDB 4OHFA 5A6WA 3G71S 3AD8C 1QTNB 1X4EA 3WGHA 2LRKA 3DRYA 4LMJA 4UQTA 7AT1B 2IMWP 3C16A 5E3QA 5T41A 3PCOB 5JVGF 2BJ9A 4DJBA 2YU9J 4CP5A 4K4ZA 5HQ8A 1U02A 2KZMA 4JQFA 1P6TA 1NDKA 2CVIA 4L5IA 3T6BA 3IG1B 3KLIA 1J75A 1REPC 3ZC4A 5FKYA 1RKWA 4JI6T 1LDJA 1YKWA 3M05A 2CJYB 1W09A 2FBHA 1V3RA 3GWHA 1YJTA 2J9EA 3LSHA 3F22A 3AECA 1D8KA 1NHKL 4A3BJ 1W0TA 2JPCA 1R36A 1STZA 1ZQ3P 2ZLYA 3JTOA 3N2GE 4O0NA 2WSSV 3AA9A 2VQET 2CUZA 1RA6A 1N48A 3O2PE 3TW0A 4YB6A 4BEHB 2WM9A 2CPZA 4I02A 2W48A 3NG8A 4P2MA 2AXDS 4FJOA 4UXNA 3CCZA 4ZP6A 3AL0B 2V7IA 4EATA 3C64A 3IR7B 5HBMA 1ZG1A 3SDEB 2Q6BA 1UELB 2WV0A 4I2OA 3ZMVB 3D6TB 3PDNA 4P74A 5DTDA 3RKYA 1MMNA 3C16B 2DNYA 5F3ZA 2HMIB 3HC7A 3UD4P 3AL0C 4LF9T 2R2UA 3K17A 3DKDA 4LFAF 2NWBA 1Y1VJ 2MGQA 3I3LA 4HF2A 2CXFA 1KWMA 5DRKA 4YY3F 4F4AA 4P5OA 5TRDA 3WQPA 1FEXA 1YGYA 2CQ4A 4TLRA 1U24A 3AB4B 2BEFA 4LD5A 4AYBA 3HOXJ 3UUXB 3I87A 5CD4A 2D5VA 1N0UA 1FLIA 4LRCA 3JCUC 4K4VA 3W3CA 4DL5A 5IV4A 5HROA 3EUHA 2O9LA 3WZ0A 4K0KJ 4BWJA 2DGUA 1ETYA 2ZUAA 2ATLA 3NMAA 1W25A 4C91A 1LQ1A 4AISA 1MN7A 3M2VB 2GIQA 3O4XE 2IRFG 2LRDA 1NKBA 4AQGA 3LUYA 1V54H 4QWDA 4CCHA 5H9FK 1VNDA 1XSVA 1MZBA 1S0OA 5HBMB 2I38A 2VJ5A 3HOVJ 4KN7X 2ZJRQ 2G4BA 3ZCIA 3RB3A 2ADUA 2GIVA 3SMZA 3WDOA 5DYMA 5DCFA 2FGOA 3N5BA 5EK2A 3OYAA 2WS3A 1SD4A 1QTMA 2LSGA 4UUVA 2IC6A 3D5LA 4LB6B 4HQEA 2KNDA 1LXJA 3F3XA 3BPDA 1QVTA 3IFEA 4JEUB 1YOVB 4AVPA 2DWKA 3MZKB 3MDFA 4JI2F 2M8DB 4DMVA 2YBVA 1TP7A 3TKYA 3HBLA 1WACA 3WODF 4DV4F 1MMSA 2L3DA 3CCSI 3CGIA 1J5EF 2K5CA 1Y4ZB 3CJQA 3DDIA 4DU8A 1N5QA 4KV8A 3M9AA 4U87A 4LF5T 3NNAA 3TZWA 3O3LA 4CH1A 1R1VA 4GKKT 1WF2A 1H72C 5CAAA 3M32B 1I5ZA 2FJAB 4HWHA 3ZZPA 4RS8A 4ITVA 1RWWB 2GHVC 4B3ST 3MR5A 2ESNA 4RBOA 4PAAA 3D66A 3CQXC 8AT1B 4O4GA 5EWFA 3ECHA 1HR0F 4X62F 3FXQA 2IMOA 3JSPA 4ETSA 2ZJ2A 3DHXA 5KFYA 2DTJA 3OPCA 2Y0SN 3KZZA 2NZ4A 2P9CA 5M5XJ 3R7SB 4OINF 4LBPA 3MZ8A 4PUOA 3DLLQ 2FJWA 1EQ0A 1RAAB 1OY8A 3TEHB 2HRYA 3W7BA 2WOMA 2CQKA 5DLGA 5AQQB 5L3BB 1EAYC 5B0BA 3T1AA 5H9EJ 2FJBA 2MQPA 1WKLA 3PYFA 1POGA 2OD4A 2E71A 2OPSB 1Z0PA 3E8OA 2VC1A 2A5WA 3NZPA 2DYAA 2F5GA 2NQPA 2M9HA 5E3AA 3RGLA 4U72A 3JRFA 1JX4A 4ILLA 2Y31A 2PI5A 3KV9A 2KPMA 3FFIB 3K3OA 3QYFA 1ZK8A 1JLQB 4EYYR 2VQFT 1V5IB 3D0GE 4ZHQE 2L08A 4L18B 3W65A 4DV0J 1S1UA 3I59A 1MBFA 5CQEA 2IA6A 4BE2A 4HHUA 1TQMA 3SZ2A 4V19X 2CQPA 4UNOA 4CO8A 1UJ5A 3GU0A 4OYBA 3LAMA 4I2QA 5EN1A 5FY7A 4DZDA 1M1GA 3CUQA 2KJWA 4IDOA 4OHXA 4IDZA 4ESFA 3EAMA 2CPYA 2WDVA 4LLLA 4IQJA 2M0CA 1UPMB 2OLWA 1WG1A 2G1DA 4P9UA 2LG4A 2Z16A 3DXBA 1XERA 3IRWP 1Q5YA 2EFGA 1FXLA 3N05A 5HMXA 3QJPA 3PV8A 5KFFA 2OZUA 5C2GA 1L0VA 5J1PA 3JC6D 4HFVA 5HXCA 1TQLA 5JLXA 5FXWA 1XN9A 3PEJA 3C2HA 4HW0A 1NSQA 3D6MB 2YQ0A 5KT2A 3Q3SA 2KISA 4E7KA 4BA9A 1KHVA 2CG8A 1PILA 1ZA2B 4N47A 2D1VA 2BY2A 3HKBE 1YKEB 2AEMA 4XKWA 2ATCB 3MTJA 2H3RA 3I59B 1A04A 1URNA 2WW4A 3NS7B 2AQ4A 1S3JA 4K0UA 2M0MA 4II2A 1WDTA 2K9MA 3CUQB 3W9JA 2BG9E 3DTEA 3MKYB 4YELA 4CO5A 4WU3A 4IDKA 4PXDA 1S72I 3RYLA 4C7QA 2AT1B 1C1CA 3PUXF 4CNYA 5JDMA 3NGRA 4AKIA 3RIRA 1YJNS 4EJOA 4J9PA 2D2WA 3SZGA 2MBFA 2V6EA 3DQVC 5D15A 3ZZYA 2W85A 2XI3A 2P6SA 3D68A 4IQ4A 1FRXA 4HRIA 1X9BA 2BDEA 1OWAA 5KT5A 4GYRA 4C2MA 4QJVA 4H63V 2ID3A 2M52A 1MGTA 3EVMA 2ZB9A 2N4CA 3P5BP 1PYVA 1R58A 2EILH 3ZN1A 2QLBB 5F8IA 1RBOB 1QVUA 5C42B 3FX3A 1ZTTA 4ZJQA 3PO3J 3HHNB 1X60A 3IL2A 4A46A 4HH0A 2E5IA 1C4AA 2JEJA 4ILUA 4KUMB 3RCOA 3PX4A 3VR9A 4M3BA 2O0YA 4HYEA 3LBXA 1ZG5A 1KYZA 1S12A 2R5YB 4HKQA 2YWEA 2C5IT 3H9GA 4LFCF 4OI3A 5HLFA 5IPAA 1KF6A 3RR7A 2D9OA 1N5TA 3FRZA 3GCWP 5LA6E 4NEZA 2W0GA 1WRJA 2ZH9A 2X1EA 3T1HF 5HN0A 1T9TA 1WRDA 8ATCB 3G1OA 1J27A 1TT0A 2RH3A 2JSPA 4OYJA 1MMGA 5A8RB 4X4NA 2XM1A 1TWGJ 3UU3A 4GVBA 1ZKEA 1M1KT 5DD8A 3QFWA 3E01B 2PE8A 4MFDA 1U5PA 5JR9A 5IWAJ 2EZLA 2WP9A 2MEWA 5FJ4A 3DLKA 1F5CA 4P96A 3BZ6A 5HMZA 1JLCA 1D1UA 3CMMA 1B0TA 3KZIC 3S3NA 4WBFA 2BZTA 3ZN1B 1R6VA 2RHSB 3BSAA 4ENOA 4DZ6A 3W6KB 4BAYA 5HYAA 3G8QA 2CJQA 1X4GA 3QPLA 2FHKA 3VDXA 3FZKB 2EK6A 4L75A 1Z1DA 1G4DA 4YFKF 2K1RA 2QLFB 2ZFWA 1FDAA 4IHJE 1X79A 4Z7CA 3AQOA 3B13A 5HLFB 3NAIA 2HK2A 5D3GA 1OEDE 3QLHA 3NZQA 3U1DA 2DFIA 1S59A 4ALZA 4DU7A 2LSYA 3N28A 2E60A 3HTSB 2XZEA 4HEA2 4KI0F 1WQ2A 5DQGA 2C1EB 3QBCA 4MKBA 5HWYA 3A2KA 3MFKA 1KRPA 3T1YF 5LMNF 4QBUA 3H90A 3FM3A 5HI7A 4AL5A 4U9RA 3M8PA 2WBMA 3N9NA 1MG7A 5JR9B 4LSZB 2HW3A 3S8PA 4MIMA 3KHLA 2QFIA 2XYHB 4DR6J 3QYYA 4ECRA 4LREA 3HSFA 4OWRB 1RT1B 5DQWA 3IHRA 5HQMA 4DSIA 4JI5T 3NXZA 4NZ7A 4EGYA 4CM2A 4BAYB 2MKIA 1HWKA 2AYEA 3TDZC 4XIDA 2P2CB 3CCYA 3HPOA 3VAFA 2YKOA 2NXNA 2DNKA 1YZ7A 1VRUB 1SVOA 5IP6A 3E5UA 2K1RB 2LSJA 1RHMB 2CJJA 5BYSA 3I96A 3UR3C 2UUTA 3VKHA 5D3GB 2QGUA 5KFBA 2QYCA 4XRMA 4N78D 3QLHB 3FBFA 2WVDA 2ZH1A 3Q8YA 2ASJA 3WTZA 2AJQA 2PMZA 4IZZA 1IXCA 3OFHA 2CQDA 3QZ7A 3QATA 3FWEA 1M5HA 1R0BG 1WTFA 2DA1A 3M8PB 3AG2H 1CSJA 1S6UA 3GIIA 1ZAXA 4KT5C 1IGNA 3MN2A 3LSIA 1FNNA 2PMZN 2X6WA 4RU2A 2KQRA 2UU9F 1VISA 2MOZA 3UU6A 3ZQLA 2HG4A 3EJMA 1WC1A 4CRJA 4IEJA 3D6FB 2HYGD 1KEYA 4A47A 5L46A 4XR6A 2UUAT 4DN9A 3FRYA 1KFYA 3W2AA 2NXNB 1JUMA 3MFHA 4RW8A 3JW4A 3TO7A 3M4XA 5ETOA 4LG3A 1PYOB 3CCJS 5H9EK 3ZN0B 3BBCA 2KJCA 3T6JA 1Z7LA 1APLC 2AQEA 3FMBA 4KFBA 2U1AA 1KONA 1YW9A 2MH2A 3PJWA 3FXUA 4GGGA 1UG0A 1HBMA 1VRTA 5B1BH 5DM6Q 3MI7X 2K7JA 1V9OA 2FXAA 1Y9OA 5EK4A 2YKNA 3Q0UA 4B8XA 4WZXA 4DSKA 4NCGA 1I94F 2MYFA 4NC8A 2XQ3A 4LBHA 4DW6A 4XOTA 1E3HA 1K61A 3KIOA 1YVFA 1LV5A 2DLRA 4JEHB 4U2ZA 5B1AH 4TUYE 4R5PA 1W0AA 2YXLA 5ETSA 3RRHA 4ZI3C 5KFMA 1Q81T 2HQ3A 2ZITA 3EXCX 3HX9A 3HGGA 5HO4A 1X1PA 4DR5J 1U6FA 1OXZA 2UVVA 1IJEB 3R84B 2DU9A 4E7IA 1HG2A 1G6BA 3DTOA 2UVRA 3CJRA 1FWPA 1PG5B 2KFNA 3FBNB 2M5YA 3MUVP 4XORA 2BJ3A 1TUGB 1GXQA 4RZRA 1RAJA 4DPTA 5LBQA 1VRTB 3Q8VA 4M6XA 1NK7A 1BR2A 4UOGA 3EICA 4C3LA 5BPDA 4P1NA 3TQEA 3US5A 4H4KC 4YS2A 2YKNB 3FEXB 4HLXA 4Y4RA 4X66F 2ZJRF 4AQFA 1OPIA 2E1OA 2MG4A 4NCGB 3WX4A 3BPVA 3KTQA 3BJYA 3VHQA 4X1KE 1W7PA 3BH7B 3F8BA 2UXNA 3E6CC 2FVSA 1UW4A 2Q1ZB 4R5PB 5H6RA 5HK4A 2Z5UA 3RR8A 1USTA 1QZYA 2QSFA 1TFWA 3K5MA 2JRTA 1OO0B 3ADAC 3G9CA 1X4DA 3BCAA 4F4ZA 2OA5A 2H5EA 1RZ4A 4CDGA 3NEKA 2D45A 3FDYA 2HN2A 3ZMSA 2Z4PA 2GA1A 3DRRA 2DY1A 2W9BA 4LITA 3UVJA 2DK8A 4IQMA 3EPGA 4JI0F 2CSOA 3ZXWA 4MTPA 3QPTA 4CLKA 1RLDA 4NQWB 2M87A 4O6JA 1YIJI 4EZ4A 5F8MA 2A5YB 3HSJA 2WWVA 3JSMB 4J9MA 1JJ2R 5FMNA 4TV7A 3HHLB 5HXHA 2VKJA 4A2UA 4B3TT 2ZBIA 1LDKB 2PLYA 2X9DA 5F3TA 3V6KA 4QYZJ 2XAHB 4XRSG 3U02A 3EYIA 1WGXA 3HDSA 4FI5A 1ZR2A 5C4XJ 4ZDPA 4KHPT 1NJWA 3SFIA 3W9HA 3OSGA 4HEAA 1W7PB 4J9KA 1T9UA 2D3ZA 4KMUX 3NGSA 1Y11A 2B56A 5DABA 2OO4A 5H6RB 5A0YB 4GKJJ 3EUAA 3L2WA 2YQ1A 1M5KC 2L7KA 2W2MP 4XLAA 1HYSA 4E7ZA 4I7HA 2QSFX 2IS2A 3KLVA 1U9NA 2HEOA 4FF2A 2D1HA 3J7Yq 2R5ZA 3D6HB 5IZHA 1UG2A 4ZLJA 2ZH5A 2EIKH 1R71A 4HDHA 4DPWA 1ZAOA 3JRDA 1T05A 2HVDA 3KP3A 3BOQA 5IT9Z 3PUSA 3PG9A 3DRRB 2W9BB 4E70A 1GNKA 2OFHX 2VDIA 3UVJB 1E6YB 2GVZA 4NXNT 5LLQA 3SCIE 5JJBA 2X6XA 3BJAA 1NJZA 2F1FA 1S76D 3CCSS 4X4VA 3TO6A 2I1RA 4RUCA 3A3OB 3MVPA 3V81B 4WE1B 5L39A 4G3IA 3EABA 1T0FA 3AT1B 5F9NA 2B7BB 3KHGA 3JTGA 3ULHA 1IJ6A 3RYFE 3W6JB 3ZQIA 5DV5A 1XNRF 3BF4A 4GYGA 3REOA 3KG0A 3BZQA 3QU6A 5C24A 4KMFA 1FD8A 4C6AA 4HTJA 1FRIA 4MK7A 2IIHA 3P3DA 2KO1A 4QWCA 3D1OA 2LFBA 3PNTA 2FZKB 3TNVA 3VYSB 2OU2A 1YW7A 1KR4A 2MZSA 3CIZA 3T9ZA 2R5ZB 1J2XA 3OPKA 3AAEB 4P75A 1L0OC 4Y2IA 2BM1A 4ZPVR 3AOCA 3NGUA 3QODA 3D5MA 1W1WE 5IM0A 2GVZB 2VKEA 3JCFA 4AIUA 3NOGA 2R93J 3RG6A 2NS0A 3UFEA 3KLNA 4CO0A 4G94A 2DLLA 3LSVA 2I0XA 3SYTA 1KQ9A 1NSPA 1X0PA 5DS7A 2JJ4D 2YNGA 4M72A 1DY3A 2CQ0A 4NA3A 3RPUA 3T5XA 3BBFA 4EU0A 1FRKA 2J5AA 2HS3A 4Z2XA 3V4MA 5JQGE 2ILYA 2KU7A 1TTHB 2EKNA 2NS8A 1P9QC 4XRFA 3ETVA 2LCWA 2DJNA 2PG4A 2VUMJ 2WSCC 1SVLA 2KRHA 4A3IJ 4WZQA 3RIUC 4BH9A 1Y1WJ 4EK2A 5IT9U 3TA0A 2VFTA 2V4JA 2Q0OA 4HSTA 4BY1J 4O23A 3F72A 3QYBA 3NLCA 2R42A 1TUVA 5LCYA 2LDYA 5EZGA 1R1TA 3S3OA 3PU8A 2VD3A 2GHWA 3BJOA 5LGUB 5AXKA 2ZM6J 2E2JJ 3LA7A 2KT5A 2ELHA 2B8QA 2JA6J 1DQAA 3FMSA 5IM0B 5LSRA 5K5OA 4I64A 5D4RA 4WYLA 2OSQA 1HBNA 2BJ8A 4DV7T 3QAEA 1BGXT 4LF8J 5F8JA 3BR2A 2G2OA 3D67A 3FZMB 3IA3A 1KA8A 4ZI2D 2YNGB 2P9EA 3UQ7A 1NNDA 4ED5A 4LF7T 1C0TA 1ENHA 4HX4A 4WBNE 1OFCX 2ABYA 4N0BA 4JI8T 2ZH2A 2DDBA 4B3RF 4WXDA 2K9AA 3LAKA 1FI4A 2DODA 4M5IA 1XSXA 3R97A 4X1EA 5MLCV 1VQ5I 1SC1B 1K73T 1S9GA 3K5OA 2EA4A 3MKLA 1F3VA 4L3KA 1P92A 5HAXA 4ZS3A 2IXSA 2V4JB 1LFBA 2RB7A 1B0PA 3BGOP 2NPFA 5LG3A 2RF2A 1XQIA 1HMVA 1FIAA 1XK8A 2R8KA 4DPOA 5D6EA 4CYUA 1T8EA 1Q53A 2MTLA 4B6XA 2MSTA 1QUPA 1Y3KA 4A5MA 1RWNB 4MYUA 1S4FA 2VU5A 3T41A 3Q8QB 3BM7A 4IRKA 1RLCL 1S72S 2FMYA 2OKQA 4X4PA 3GCXP 2ZFUA 4TQSA 3ZKRA 1HBNB 3QT7A 1FNOA 3IM8A 1FPQA 1P1TA 1CC8A 2KINB 3CJ4A 4PAGA 3DCFA 1EKSA 1JNRA 5EX0A 2J0QD 1C0TB 2HVIA 2EBIA 1IRFA 4DV1J 4JX4A 4U8YA 1DGWY 2ZXWH 3JADA 4HFEA 3ENQA 4LGWA 4XLHA 4WFNQ 2IYIA 4LF4F 2QQAA 3MKDA 2CJXB 5LL6d 3J7AN 1TZLA 3PX0A 3ILOA 1S9GB 2HHXA 2FPHX 4IOBA 1KU3A 1SMTA 4QIWD 4X64J 2DJIA 4RNMA 2LREA 2K3FA 4O3OA 3MMJA 1CHUA 4Y00A 3CO0P 3I54A 2ZBKA 2OA4A 1HNXF 4FF3A 2XLIA 2OTJI 1P1LA 4CYUB 3H98A 3L3PA 2PEBA 3M4OJ 2L4MA 1VQKI 2B4VA 3AAFA 3SCKE 2GXGA 3KETA 2E7WA 5C8YE 4AQYT 1SI9A 3ZZUA 4DL4A 3AODA 2ZH7A 3PSIA 2X7IA 4OZ2A 4UHTA 3NKZA 1ETVA 5T14A 5J2NA 2MFZA 2XKPA 2PJQA 1ZZFA 1VC5A 2X51A 5AXNA 1D1AA 1JNRB 3AFHA 1X1DA 2RVCA 5F0HA 4HV5A 4FN5A 3HFZB 4Y2KA 2X3DA 1U1NA 5C7PA 2KLQA 2WTFA 4JI3F 3OYLA 2DNPA 3F31A 1W7WA 4E4HA 2BY3A 1KFSA 5DQIA 5K5MA 2HOEA 5TGTA 1N36F 2G0EA 4AIHA 2QA1A 3DGVA 1JXSA 1SEUA 4NXMJ 1XC9A 3ZQQA 2DQRA 2DL1A 2RDIA 1IBKJ 1BA5A 4XPEA 3FXMA 4ID8A 4ECXA 1RWXB 3MPYA 3QK6A 3MPUB 4IGUA 2ZE2B 5LXRA 5HXRA 4J9UE 2DY9A 2UUBJ 3KV4A 3A02A 1B9MA 5DM7Q 1RAGB 2VBXA 4BGDA 1MMDA 2PA8D 4QYZK 1FJ7A 3EHZA 2C2MB 1ZTWA 4ZN1A 2BJDA 1SQEA 5ED4A 2UXBF 1I5OB 4BHPA 1U0JA 1NKEA 4CH7A 3M1EA 2CCQA 4X5TA 1UEKA 2MB0B 1DTTA 2HNDA 2BE7D 2ZMEA 4NCBA 3EGVA 3OQ2A 4XPCA 1HTJF 4PEOA 3LOUA 1FRLA 4ZJLA 2X1AA 2R7WA 1LXNA 4WXCA 4JB8B 1N34T 4M95A 4YFUA 5FFZA 3VR1A 2IMLA 1P4XA 1VRBA 5L47A 1FK9A 1JQGA 4E7SA 1I1GA 5J47A 2KH9A 1KQFB 4WYVA 2MSYA 4P73A 1ON2A 4C9DA 3NRBA 1VQOI 2DNXA 4OHZA 3P8BB 1NZ8A 1IN4A 2DT7B 1OY9A 3GYNA 3L3CA 3W2VA 5GTIC 3HULA 4IHYA 2VL0A 3IBFB 3IWFA 4CI0B 3IBWA 2VJVA 2LTPA 4AXJA 3BDEA 5AQGB 2E1RA 2LF8A 3GTYX 2MXYA 3Q2MA 1GXLA 4Y0FA 2D7SA 4YFXF 1BQNB 2D69A 2GHPA 4AIJA 3HI9A 4C3MA 4RUHA 4U3CA 3MOZA 4U7BA 4LUBA 4CXXA 1RAEB 1SL0A 2QYWA 4IE5A 3EPZA 3MA9A 3C4ZA 4BJNA 1CQTA 2NXUA 4OJ1A 5DG7A 3ESLA 4NYZA 3UU5A 1N33T 1LWCA 4D3HA 3UUMA 1DTTB 4MKAA 3PFIA 2COLA 1V4RA 3VGUA 1MBKA 2X1GA 2XS2A 3IWLA 2XO7A 3HKZD 1OYWA 2DPUA 2LOPA 2YKQA 4DPYA 2DA2A 2XTLA 4WBOA 3A8IA 2XHKA 2CO5A 3OYCA 3ZTPA 3KEYA 1PC5A 3QWPA 1MBJA 4TKTA 2XYPB 4KHZF 2JVGA 2WB1A 3JTHA 4NC6A 1VQ7I 3LH2S 5JH7E 1JMTA 3W63A 2M5WA 5CCMA 2UXDF 3OJUA 1MBGA 2FRHA 1G3OA 4ELUA 3SI8A 3CUOA 1JJCB 3SWHA 2CMPA 3A1YA 5J6XA 4YHHJ 5EUHA 4BDPA 4V2FA 4Y2AA 4MHGA 2CNOB 3MUTP 3UTKA 1O5JA 3K2ZA 1ZS6A 2ECCA 1RWPB 2B9SA 1RAHB 4DSLA 4ZPWR 2BVMA 3ETMA 1HBXG 2IGNA 5CCLA 4JUZA 2QA4G 3MCSA 5I3UA 2BJ1A 1OSCA 2PGCA 1QVGR 4I69A 4MFEA 3VKGA 2OH2A 3A0HC 1WJ5A 2HGLA 4FCYA 1LW0A 3CCVI 1EZZB 3P9CA 4JI4F 4D7NA 3KBUA 2DGOA 5J1GA 4UUTA 3QRRA 2X6OA 4II3A 1REGX 1DBDA 3PNVA 2LHRA 5J8CA 3U1KA 4CGZA 1RT7B 2KL4A 3NGTA 2B51A 1GUUA 4KITB 4ZLLA 2QL9B 3BGRB 5CA0E 2FY1A 2VKRA 3PX6A 3H3MA 1DU0A 2B7EA 1JTYA 1VBYA 3UUBA 1LWXA 1U8SA 2CRBA 2QGFB 2ZH3A 1RHQB 1WH7A 5KX5E 4USWA 2M4GA 4IE0A 4NI2B 2HXOA 3HRTA 3BSNA 4LF6F 4PSXA 3J7ZT 4UVAB 2ZJPF 1HKSA 3AEBA 4XL9A 1QGPA 1T72A 1XR5A 2RUSA 1Y01A 1U49A 4O3NA 4NLOA 2HOSA 5HANA 2AF6A 1BI0A 2AHQA 4ZS2A 2KG1A 2OLTA 3H5SA 3ABTA 2OPRB 1QLNA 4XIUA 1XMQT 5FJ8J 5JRCA 2ZMAA 2UZKA 1RAOA 2CE7A 3N79A 1YI2I 2DGXA 2OPPB 3OTOF 2Q9QB 5I3UB 1S0VA 4DX7A 1R22A 2E5ZA 3HVTA 3GCMA 3FXJA 5C2CA 1SJFA 4K59A 1FEEA 1P4WA 2XPKA 2FUG2 2Q9QC 4XM3A 5A2QK 3CDIA 3FZBA 5JVDE 4FKXA 2KXFA 1HFAA 2M6IA 3VSLA 4UUXA 3KHRA 3DDKA 3K4NA 1KDNA 1BR4A 4UOHA 3VAIA 1X8DA 2RPAA 3FBIB 1YIOA 4XBFB 1DAXA 2XAGA 4IXAA 4LBIA 3B73A 4HZFA 3GE9A 3B6BA 4ENNA 3SEQA 4XDDA 4CLFA 2G0CA 2P4WA 1SL1A 4G7ZF 3LTOA 3JTNA 3PO4A 2YX1A 1TL4A 2PFBA 5EF6A 2B7CB 3D28A 3X1LB 1S1WA 4Z7YA 2M70A 2BRKA 4Q0BA 2O3DA 2HWVA 5F8PA 1KLMA 5ICGA 4ADZA 5L1KA 5E41A 4CCLA 5EEHA 3SQNA 1YIJS 3Q5FA 1S0MA 5KG7A 2QLJB 1SKUB 3DP7A 2JRSA 2PI0A 2BKOA 2L8KA 5BMZA 4OLPA 3L00A 4I98B 3GTPJ 2KT2A 3FHNA 2DR9A 4MIBA 1HKQA 3ZT7A 2VN2A 3IWXA 4DV2T 4USHA 4ZPAA 1S7OA 1PJ7A 5B0CA 3TZZA 3TAQA 3OSNA 3BTLA 3GJSB 1WOOA 3MM9A 4ENJA 1XDSA 2HFSA 3KUGA 2LBFB 1FIOA 5LJMA 2Z2MA 4AWXB 2QENA 3JYTA 3C18A 2AU0A 2KM8B 2A6OA 1T11A 3LGMA 3NCPA 4U0WA 5FL1A 4DJAA 5E7OB 2VIHA 1S5ZA 4HYKA 1Q7YT 4QIFA 2H4WB 3RYHE 2EV5A 5HNFA 2K48A 1ZARA 4YT0A 3OYNA 2CPJA 4HL9A 2VICA 1GX6A 1P7JA 1JKRC 3GN5B 4KIBA 2QSGX 5AE2A 2KM8C 3PUFA 5FY0A 4OI4A 2K24A 4Q0BB 4EEYA 1A36A 5DEQA 2DFFA 3RC8A 2XS5A 3GFJA 1UFLA 3PQJA 1TWCJ 3IH4A 4S0HB 2QRRA 3LFKA 3MEDA 1YITI 3WU0A 5JDNA 2HKOA 1NK0A 4FXWA 2UUWA 3JQKA 2P5LC 3ETUA 3SYZA 1T0TV 3EDRB 5C3EJ 5FLXZ 4W4MA 3EVYA 1YJVA 4IE4A 1A6IA 2NXCA 3L2QA 2DPDA 4KGXB 1I51B 2YWFA 5B09A 2J7UA 4DR4F 8RUCA 2DO4A 1HNZT 3MM9B 4Q43A 4EJVA 1UPPA 1N32T 2Y30A 4GVLA 3F73A 2HHHT 3ISPA 3J7ZI 2R8IA 4LMZA 3QRPA 4H4MA 3WE2A 5CVUA 3VRAA 2K3PA 4L9VA 4C3JJ 4A3CJ 3AEGA 1FKPA 3N4MA 1PYSB 4QCLA 3CMYA 1ETKA 3Q8UA 1YO5C 1PP8F 3U27A 4O3SA 3O6BB 1Z05A 1HC8A 2DO7A 4YOEA 5THWA 1HHTP 5GVQA 2R8HA 3OT9A 5D5WB 3RX6A 1PJ6A 4WFXA 4WTOB 1RJJA 2VIXA 3TJ9A 3ZZTA 4GK0E 4PG5A 2W82A 5J3LA 3FM5A 1T56A 3DCAA 1Z3YA 4PK4A 1G2HA 5LOVE 2LKSA 3B02A 2AJ4A 1NAQA 4JI1T 1U0HA 3BJ6A 3HPHA 2GNKA 3AQPA 4FASD 4RNHA 1JLFB 4DI6A 2X66A 4OHVA 2ZC3A 4ZOLE 2PX9A 2IAKA 3L7OA 1RT6B 3VV2B 4LFAJ 4JP0A 2KHCA 4X1IE 1ZM3A 4DQIA 4YY3J 2MABA 3F21A 3BZKA 3ETOA 3PZPA 4O3PA 2ZVIA 2E5JA 2G0JA 2V6AA 5HEJA 4IRGA 2FD5A 5L3EA 2Y1LB 4H4MB 1TKZA 3NVOA 1XMOT 3KLEB 2Y8YA 1HXDA 4JYAF 1RHRB 3PU3A 2W24A 5FVKA 3FCVA 3CZ6A 4WIIA 4MLOA 4BQAA 4P09A 4CN1A 4A0YA 3AE3A 1N8RT 3DTKA 4XKBA 3RZOJ 2WDRA 1UZDA 3R6GB 3M6UA 3GJTB 4QX8B 4C48A 2RA1A 1HSJA 3QWLA 4M5HA 5FLXU 3C6UA 3VALA 1MWZA 1NO8A 2V8GA 4A3MJ 3CQZJ 2X0LA 4PK6A 2CDRB 3IN5A 2NXEA 2YVSA 2DXFA 2HZAA 3CMEI 4ZPBA 1V5VA 1NDCA 5J8FA 1U0HB 1B3TA 3GJRB 3G87A 1UFWA 2Q43A 3JB9k 2KL8A 1IRGA 2ZD1B 3J7YI 3BQ0A 5J1NA 4LIUA 4TWFA 4KH0B 4PKDB 2R8JA 2HHVA 3FBZA 2B43A 2Y3YA 2LHNA 2NW7A 4JI2J 4EUVA 4JI6F 3HP6A 4NLXA 3CJTB 4IO9Q 1Y0UA 1VQ5S 4HX8A 1YLXA 2RREA 4DV4J 2DHGA 4K4TA 3VGTA 1QAXA 5EEGA 5JLWA 1J5EJ 1IRZA 1ULYA 3FZHB 5L3EB 3OR2A 1FSHA 4QXCB 1TKZB 1CS4A 2WSEC 2F5FA 3SXYA 2BE5F 4ED1A 2A72A 2IRUA 2BXZA 2V8SV 2BANA 5BYRA 2VQEF 4OIQF 1VLYA 2RHQB 4L76A 2W7PA 3HZJA 3RJMB 1EJ9A 1WLXA 5DG8A 4MQ9F 2ZBPA 2IBDA 4PJJA 1TL8A 1XJWB 3QGIA 4USVA 1L3UA 2M7AA 2ACZA 1GMUA 3C6UB 4P2SA 4C11A 3HI2A 3CF5F 4J9VA 3DFGA 1Q8BA 5FIIA 3DRPB 3ISND 2D74B 2IA1A 4ZYHA 1BD6A 1FJEB 1IWAA 4H9NC 1EKRA 4QXHB 2DWGA 2PMWA 5KAFC 4DR3T 3GR1A 1ZHCA 3BQIA 1N77A 4LF9F 1FBQA 2OCEA 1DGRM 4DYQA 3E97A 5KDMC 4BJTA 1HF8A 5E3MA 4ZZCA 2H6CA 1TNTA 2N9DA 3H92A 1DDNA 4EMSA 1LWFA 4IF4A 4AKGA 1RTIA 3COAC 5KFEA 2MQQA 4PUSA 2ACJA 2LP4A 2F4IA 5J1EA 1L3TA 3OR2B 1CS4B 4CXWA 3OYBA 1VQ6I 1TNSA 1VOMA 4ED6A 4QIVA 2HAFA 2OTJS 4I67A 6AT1B 5ABEA 1PBAA 3NGDA 3VEPA 1VQKS 2HI3A 2XMTA 5DO2A 2FJDB 3RC3A 4YG2F 1YFHA 5AFUL 3F8FA 3OSPA 1RE1B 1N5SA 4QU6A 2A6MA 1NZAA 4D5CA 3AEDA 5AE3A 5L1LA 1OCZH 1IUYA 4F4KA 3WX8A 4D9JA 2LXUA 4KICA 4I76A 1VR6A 4HFBA 2KSRA 1JGGA 5ABGA 3DPTA 1SBRA 4ZOSA 4ILAA 1AHDP 2EI5A 3HKCE 1Y8QB 3RSNA 4NPOA 2HFNA 3NAUA 3CO7C 2DCLA 2QWWA 2MKHA 4OJGA 2C3UA 1X31C 4IKAA 2WONA 2FVPA 4ICLB 2AO9A 3I9V9 1J0RA 2K27A 3QRQA 3R1LA 1U5TA 4ECUA 2KIQA 4F55A 2N4DA 1LWFB 3PW0A 3FEZA 4QW8A 3JC6C 3EDVA 2RQCA 4ZLNA 2Y9HA 1RTIB 3J7YJ 4M5GA 3K4BA 1OQ6A 5J1EB 4DMWA 4A97A 2CNNB 1UMJA 1TU0B 4F3QA 3W5YA 2AJFE 3GIMA 2GIZA 4GKKF 1RI7A 4XN3A 4BS2A 1RADB 3WHIA 2JIWA 5ETPA 2OC6A 3CE8A 4C97A 1T7SA 1HDPA 2ZH8A 3K58A 3DRXA 2EKYA 3R0AA 2V7JA 3QT8A 4B3SF 4C8OA 2A6HF 4CYDA 1QVFR 1U3EM 2VJIA 1BE4A 2NUUG 1PO6A 1GMWD 3TW6A 3MMAA 3UFGA 2QUFA 2O66A 2JA7J 2WSFC 1RCOB 4HDGA 3H5UA 3IC1A 2CQ7A 3JR9A 2NVTJ 3AB3B 2IDEA 2CQBA 1NK9A 4U7UD 3F0CA 1ETXA 3WG7H 3PFEA 3VZIA 5AQSB 4ELTA 3S16J 2OIHA 3SZTA 2A61A 3L2CA 1U1OA 4UQGA 1FD2A 4A8YA 3MCMA 2C2NA 2WONB 2GO8A 1FZPB 1U5TB 2VPRA 3HM5A 4WFAQ 1VQOS 4HLBA 1VJQA 2OGUA 1DQ8A 2FX0A 3PL8A 2HOTA 3KDNA 3K3QC 3POTB 1LDDA 2VFSA 4Q8EA 2VVSA 4QR1A 5A2QY 2XF6A 3LAJA 1T8BA 4NIQA 1FMWA 2JX2A 2K9SA 1RABB 4URQU 1TBXA 1WORA 1HQEA 3CX7B 5K14B 4ZPCA 3LWFA 3PM1A 3AXMA 1L3VA 1Z9CA 2VQFF 2E44A 3JQMA 3GIJA 2E5VA 1VQ9I 2GZWA 1X7VA 2LKZA 1FDBA 5FLVA 4BY7J 2QO3A 3MMAB 3CCMI 1HF0A 2HZVA 4IR9A 2ZBRA 4EQQA 1O3SA 1O7FA 3EZUA 3IH3A 2K5BB 2KZZA 3QP5A 2R7RA 4LFCJ 2VE8A 4USUA 3BB5A 3MMCB 1RU2A 3QAHA 4I7FA 4OZNA 1YJUA 1U1MA 4DFPA 4B43A 3T1HJ 1H2VZ 1BUXA 4ECYA 2K86A 3D0IE 4CLZA 1VQ7S 3I55I 1YSJA 2JA8J 4C98A 4HDUA 3R5JB 4LRDA 3G82A 3W5XA 3HL6A 3G96A 2HBYB 2V34A 2ZJQQ 3K2AA 4CZCA 1Q8IA 3ZTRA 2FVCA 2FD2A 1MU2A 3DPLC 1CUNA 3CO6C 1IM4A 2PO4A 3ZFVA 2ZHAA 1UVMA 1HQEB 3I58A 2XGCA 2JN6A 2VONA 2H1KA 2C28A 3OFEA 3WIUA 5A2QZ 2DMNA 1XNQJ 3H4DA 1Z6TA 2ZZTA 2DOEA 3HSEA 4G12A 3I4MJ 3PO2J 1RTDA 1YRNB 5GONE 4U67Q 2LOOA 3HT0A 3CCVS 5EEAA 1VC0A 4CO1A 3HA4A 4J37A 2BJEA 3R60A 1IR1A 3HZEA 2XQ4A 4FYYB 4MALA 4BKXA 1WSVA 1VLOA 2WVCA 3JRGA 4W98A 5F04A 2HN1A 3M8SA 2YU1A 2HIQA 1ZBTA 3HK2A 5LEJA 4IPAA 4GRIA 3T1YJ 5LMNJ 3K5PA 2OAUA 1YHQI 2VG7A 2FGCA 3BR0A 3DM2A 1J5YA 4EEFG 1GFWB 1HSTA 5IQQA 2EFNA 1X4PA 2HNZA 4FISA 1DQ9A 1S1TB 2OTLI 2IBOA 4RWWA 4TNWA 2E9XB 5KHDA 3P50A 1HWJA 5DUIA 3ZZ0A 3V6DA 3Q5WA 2AXTC 1GX5A 1YI2S 2OSRA 5GAHU 2QLZA 3BQ2A 1X4AA 3AA8A 3RQWA 1LNQA 1RTDB 4F6RC 5GAEI 2W7OA 2MLXA 3OXGA 5GMEA 4J9LA 2BVLA 1N88A 4R8UA 4RW9B 5HVFA 4EEBA 5CYJA 4WPAA 3KOAA 1JLBA 2NYHA 2C2DA 2OCCH 5LRRA 3M8EA 3LA3A 1U6GA 2R2SA 3LA0A 2MKCA 1BC8C 1RHUB 3IC7A 5LGTB 1Q78A 3OUYB 5JVHQ 2X48A 4NPPA 3LSPA 2R7OA 1RU1A 1TL7B 2XLJA 3V8JA 5CA5A 4QH4A 5ETVA 4DR7T 1T08B 1KK7A 2EVZA 3W64A 3P49B 4PJ0C 1B1BA 2DN0A 1HWUA 1SJ4P 3P4WA 3VAMA 1FEWA 1V3FA 4O4RA 4DL2A 3G3ZA 2UU9J 1IUJA 1PIEA 1I39A 3K7RA 3SBMA 2HDCA 3E51A 3D2WA 2NTXA 3V6DB 1JHFA 3CJ5A 4FNHA 4DUYT 3PIOQ 1XMBA 5F0FA 2AKWB 4CO3A 5I4MA 1B72A 4DLEA 3S4UA 3TA2A 4YJ3E 4NX9A 4R8UB 3N9QA 2NZCA 5HS9A 4GO5X 4YTMA 2XM2A 3NRXA 3AY0A 3A7MA 4JBCA 2ECBA 4F26A 1FKAF 4C8MA 3MXZA 2FNAA 2APOA 3CX8B 3QOEA 3KK2B 2Y9YA 1CJKA 4ECVA 1RTHA 2OAZA 2LRLA 3DTIA 4XK4A 1VQNI 3BTIA 2DGSA 1FKOB 3IO1A 2XRLA 2CLYB 4PXCA 1XMAA 3RDIA 1WYCA 3DKYA 4EO6A 2X1CA 3BK9A 3G86A 2WQYA 4I2PA 1GMWA 2ZOFA 5EJCA 2K2PA 2CLYC 2XS7A 1TKXA 1Z21A 2HBQB 1GV5A 3QIPB 3AE1A 3ZMUB 2A68F 4JI5F 2KLOA 1MIYA 2RU3A 4F91B 3VCDA 5GAEU 3PY8A 2CA5A 2NCKL 5AXLA 1NK8A 3ZJ2A 2EHOD 2MHEA 3N01A 3NMRA 5LEKA 1WI9A 1OCPA 3ZMZA 1K78B 2B9WA 1DURA 3IAM9 3TX0A 1YITS 4X6AJ 1AFIA 3ZRGA 5DJQC 4DR1T 1TAUA 4CLPA 2WVFA 1WHUA 2ILZA 3KDOA 4JLEA 4XSZF 1CJKB 4DSFA 2F4FA 2E1NA 3KP7A 3SXLA 1A0OB 4OHWA 4HPQA 3FSXA 4NUBA 1KQSR 1F4KA 4ZPDA 2MQNA 1IQZA 3CJ2A 4WIQA 4WXOA 1XBWA 4KC5A 3TUZC 1ZOTA 4DX8H 4L9NA 2K85A 4DV3T 2BS4A 1EH8A 2LVWA 1F3FA 1FTRA 2VG6A 1R5GA 1TKXB 3NRVA 3MUMP 1XR6A 1DP7P 1XX5A 1X58A 4N8NA 2E35A 4FNIA 2M30A 1RYSA 2A10A 3BG5A 5DQVA 4QLCU 2RNGA 2HHQA 1SJRA 2Z2YB 4CLUA 4IO9F 1RSCA 5M3FJ 5HNHA 2DHAA 2LXFA 1OPCA 1S1XA 4OYKA 3ENAA 4EAHA 3ENWA 2ZC4A 1S57A 5D4SA 2UUAF 5KOXA 1HFEL 2AX0A 3E3VA 2F4VT 5JVGQ 4HI1A 3PV0F 2FB0A 2HWTA 1S0NA 3S2WA 2J8AA 5M2RA 4QSHA 2KTQA 3ZR8X 1AJ3A 3MACA 3ZMZB 3EI0A 1D8ZA 4ERRA 1ICEB 2QSWA 1AA7A 4EBCA 3A1YG 3E0ZA 5KFAA 5EZYE 2WA0A 3C66A 1R0CB 3BKUA 4GC7A 2RS2A 3KWMA 2R7XA 3JRAA 4YR0A 3G8SA 1RYRA 3CC2I 2OEJA 2YH0A 3DOLA 2VLAA 5EGOA 4FBUA 3F8CA 4JI0J 5ICEA 1OYDA 1F9HA 3FF5A 4XKCA 2KXNB 2YUSA 4FP9A 4EYHB 4DUZT 2MZ1A 4QPOA 3V4IB 2ZWPA 2DT5A 4GYIA 3R6NA 3OIPA 2HS0A 2YDSA 2MQ8A 1TKTA 4ED2A 2ZXHA 5IUXA 2AJ1A 3I0RB 4ZDNA 1WF0A 1U0SA 5E17F 5ETQA 2VG6B 2AQFA 1UJ4A 3VTIA 3BSOA 4ZVGA 2WAEA 1RXOB 4N76A 4M5MA 4JV5T 2IJNA 1KTVA 1C0WA 3ZTQA 3TA1A 3OYFA 2CW7A 2R4FA 3I56I 4ZP8A 4K8RA 1ZGWA 2ADBA 4PGHA 5BMVE 1WI6A 1US7B 1CULB 3PRVA 4NLDA 3PIPQ 4FYDA 3LWMA 2QIFA 3EMTA 5D4PA 5G0RA 4WF9Q 2LQ5A 3ANWA 3Q0VA 3K3NA 1NG6A 1I27A 2MLGA 4DL6A 4CHUA 4B3MT 4ANDA 3PUAA 3ASOH 4I1TA 4ZXLA 4U7DA 2E36A 3CMES 2E2AA 3PUZF 4GOUA 4HAMA 4ED3A 3L2VA 3H59A 1LK7A 5KG3A 1IKYB 5B0GA 3WHCA 1MROB 5FXZA 4WW0A 2RNEA 4OYAA 3DOLB 3ZQFA 3BTJA 3BPXA 2GCFA 1DQUA 2WK4A 5B0DA 3QB5K 1J5OB 1JXLA 3ABUA 3MAAA 2XI2A 2WAQD 3RHWA 4ZCMA 4KIFA 1DU2A 1FOWA 2DH9A 1QU3A 1H2UX 5F27A 3PFOA 5E33A 1UA1A 4PQUB 1KFDA 3KEQA 1IV8A 3CVRA 1RT4A 4A56A 1S6QA 2CG4A 1BOBA 2L7FP 4OAYA 2RIJA 3ILLA 1R4NB 2FTRA 4ECZA 4X64F 5KG2A 6FDRA 2WDQA 3LPYA 2GOXB 1HOMA 1R5ID 1U6BA 3UDLA 1N6QA 2IGMA 2YR2A 1CJUA 4NLGA 1T7PA 4WF2A 2O5RA 1PUFA 1IKWA 3K1NA 2IS6A 3BT9A 4I4BA 1U8BA 3ANWB 1YTYA 4J2CA 1NPPA 3BG3A 5HATA 2UXCT 3CCEI 5ETTA 4A3FJ 4DR2T 1D09B 3O2IA 4LVNP 4X4OA 1MN9A 3TDUC 4OZJA 2FNPA 3K8VA 2E5HA 5CJ5A 1VBXA 1D0XA 4OX9T 1H38A 1KQ8A 1YQAA 2JMKA 2HVHA 4BBRJ 2K9LA 2BY1A 1WC4A 2I5JA 2H51B 1VQSA 3MAAB 3FK7A 1F9FA 1EETA 3VHLA 1GV2A 2W7AA 5LB7B 1SB6A 1BWVA 1U8RA 5CA1E 1W26A 1NJXA 2IGKA 4D7MA 2XAQA 2YNFA 4B3TF 3DBLB 2XMKA 2FYXA 3IKTA 2ERRA 5ABFB 1VQ6S 5HDNA 5HEUA 3SFGA 3H8YA 3L9FA 3OKQA 1UURA 4KHPF 4HHJA 4ZIWA 2GAHC 3C46A 4EM0B 4Q47A 4HN9A 4RW4A 3GX4X 1IKVA 4ECTA 3E5QA 5LJ5Y 3AJ2A 2XZWA 2K7KA 1JKOC 2NPIA 5J4YA 1TLHB 3HOYJ 1N6QB 2WBRA 2KRFA 3MD2A 5GAGI 4F2RA 1F1BB 5AIQA 1EP4B 1PUFB 4A6EA 1FJGT 1IKWB 3D3CJ 1UVLA 1P27B 1GTHA 2ZSHB 1RT5A 4G9YA 3M9MB 2EPIA 2GMLA 5KFWA 1NB7A 2CPXA 4L5JA 4J19A 4I0BA 3TAPA 1QSDA 3Q5DA 3BN4A 3WI3A 2COBA 2EZHA 1WC0A 3KHHA 4ECSA 1HR0T 5JHFA 3TMOA 2FOKA 3LMMA 4NXNF 2IUBA 3ONXA 3UQ4A 4PR6A 2V9PA 2I5JB 4RGSA 1BN5A 4PYDA 1Y8RB 1WCRA 3OW2R 3C7JA 4ZI2C 1K1SA 4RAGA 1EETB 1UEUA 4M63A 3K8PC 4A8KA 5D8HB 1YBAA 3OVAA 4UV8B 3IRXB 3SFZA 2YNFB 3X3UA 2Q2EB 4I6YA 4M74A 4CTAA 2G0IA 2FJXA 1ZG3A 3MM7A 4NLRA 5KFOA 4U7CA 2OJED 4S05A 2EHOA 4RW4B 4B17A 3EVOA 1FTTA 4B3RJ 1IKVB 1LUJB 1NWMX 1UB9A 1IBMT 4CCOA 3TOAA 2B6AA 3PVXA 4OI6A 3GO5A 3M8QB 7FDRA 4RKUC 4ID5B 5HP1A 2LMDA 3ZT5A 4XLFA 1WWXA 2L9VA 3S14J 4Y2CA 2OD6A 3R5BA 1HD1A 2W1OA 4FX4A 3BDPA 5DZ7A 2VKOA 2FQ3A 1RT5B 2IP2A 5FROA 3H3UA 3TVKA 3TL4X 2H54B 1R00A 1HW9A 5FGMA 1VQ8I 3T5HA 1K83J 2COMA 2MKYA 3H2VE 1GXPA 2MJNA 2XPWA 2OQRA 3CTAA 2ZCWA 3B8HA 3IH2A 4IFVA 3CCWA 2CHNA 2DRDA 4B3OB 2K06A 2IJLA 4LR7A 1M5SA 2JPFA 3GQCA 2XY5A 1FFSB 2YSRA 3TANA 4P71A 3WC0A 3FKBA 2F5CA 4NUUA 2X67A 3DRSA 1QPIA 3EETA 2QCOA 5AQVB 3BEGB 1SJ1A 3FCHA 4CTAB 1NDPA 4AM3A 2DB1A 1A5JA 1UJ8A 5K1YA 3MM7B 3SSRA 1X1AA 2PG8A 4BC9A 1UHSA 4EBDA 1DLOA 4M5DB 4LF4J 2B6AB 2HHWA 2E1CA 2HS5A 4DPXA 2DYSH 1WELA 4PYAA 3LSMA 1VQ9S 4WKRA 2MZRA 1P4AA 3CCMS 1Q1HA 4CXYA 4BHBA 1E6VB 5AQFB 4GXOA 2MPKA 1HNXJ 5KT4A 3MZHA 3LK2B 5IHYA 1PCAA 2J76E 2MKSA 5GAGJ 2HPIA 3ILJA 1UZHA 4Q5SF 1RZMA 5TJJA 1FCAA 3LP1A 2FHMA 3P4UB 3SSSA 1B4AA 2CXDA 2FLOA 4DV7F 1M1EB 3PRBA 3S1QJ 3MM6A 1I3OB 5I3PA 1RUSA 1UVJA 2LE8A 2BZBA 5JDLA 3I55S 3DRSB 4TZ4C 1BIAA 4LF7F 4XLPF 2FF4A 2XAFA 5IOYA 3F44A 2LDUA 4HT5A 1DPRA 1KU2A 2EG2A 3GXOA 4JI8F 1EARA 2BW2A 2KI2A 2RN7A 2CJKA 1HHQA 4JI3J 1FX7A 3DLJA 5FD5A 1LKXA 1DLOB 4TY9A 2MC4A 1N36J 3KKFA 3QO9A 3JAMK 3OYMA 5CQGA 4FS1A 2EBGA 2V79A 1H9TA 4ZH4F 1Q95G 2ZC2A 3EGNA 2VJUA 1T38A 5FKLA 3RI5A 1R43A 2LU1A 3UWTA 2WAQA 3RTRA 2E7XA 4LMLA 2XNQA 3SS1A 3RU0A 5K5RA 3AHPA 4OYWA 2XUBA 1RQ0A 2NW9A 1AT1B 2YKPA 4KAIA 3LP1B 1FP2A 3E1SA 4ZS6A 2JJ9A 5B08A 3PUBA 1SV5A 2LKPA 3CF2A 2ZDOA 5F08A 2BBHA 2Y0SD 3GV7B 2UXBJ 3KMQA 2IVFB 2HZTA 2E66A 1WC5A 4DBQA 5BR8T 4RA2A 3HYIA 4MIAA 2XDVA 1YHQS 1REVB 3M07A 1VK8A 2KYZA 2B0GA 2FDNA 3TAMA 1CF7A 3HKZN 2DNRA 3HKDE 5GADJ 1HIYA 4KPYA 4HF1A 1KU9A 2OTLS 3K69A 1RT2B 3C14A 4K4SA 2LA6A 2DITA 3GG0A 1EIYB 3S2DJ 3QO9B 4UV9A 4H9RC 4W1UA 5CB4E 2RAQA 2PEHA 4BU2A 4ILMA 4HOBA 2HDDA 2Z6EA 2PD1A 3DOKB 4Z8XA 3MR3A 3W8PA 2X85A 3GFXA 3ZYLA 2NR0A 3IR6B 1E1HB 2OPQA 4IG0A 4ZCIA 3S8SA 5CLSA 2UUCT 2YWGA 2XB5A 4AQYF 3ZMTB 4L9IA 4KQZA 2O61A 3RRCA 3LQVA 1BC6A 4PG8A 4KYWA 4EZHA 3CUNA 3MD3A 1T9XA 1HD0A 5HEHA 4JV1A 2YPRA 1TUWA 2ZO4A 2XQ9A 4A0ZA 4E7HA 1CQNA 3I82A 4H4OB 3AE2A 2B9EA 3M8YA 3OL3A 3ERMA 2GC8A 1RCXB 2CXLA 3V5SA 3DGPB 2KDZA 2DIUA 1CG2A 3PR5B 1G3SA 4CLYA 1M0SA 3IG1A 1CF7B 4EWTA 9ANTA 1LFPA 5AQTB 2MLZA 3N6LA 4QWEA 4A3EJ 2XJ7A 1V9DA 4B47A 1RWKB 3D3BJ 3FGVA 2KT3A 2Y48A 2V1UA 1HA8A 3NWRA 2Y1IA 3AE8A 2V8PA 2Y0BB 3OBIA 3UR0A 2H5JB 2HYFA 2LK2A 3VAKA 4WFBQ 1G73A 4UV9B 4AVZA 1D8YA 2FLNA 4LJMA 4PJLA 4B1RA 3MR6A 3FJ2A 5CD4H 2QLXA 1H0HB 1WWHA 4UZBA 2UXDJ 2V1XA 2XSAA 1DPUA 1NH3A 4IE7A 2EK5A 3J81Z 2WZ1A 3IBPA 4YHJA 1T95A 1KS2A 3DEWA 3AEFA 2D3UA 3LPEA 1MH4A 2XNRA 4A3LJ 1HW5A 5KCMA 2DEJA 4DF4A 4C8YA 1UHWA 3CD5A 3M1VA 2MMYA 1F5TA 1XTAA 4N8OA 1WKKA 3SDEA 2MH9A 2VJJA 1VQNS 3ZMVA 4B08A 1R9TJ 4WP8A 3A8KA 1EH6A 2HKEA 4N77A 4ZVFA 5TAOA 2HMIA 3TJAA 2HGCA 2VPLA 5L9NA 4ZZBA 3HB9A 5FRMA 4JI4J 2NAZA 3FK4A 2JWTA 2CQIA 2HBRB 3QQCD 5ERIA 2V5DA 1N34F 3MK7C 1WHYA 2RILA 2RC4A 4M3DA 3QSIA 4URGA 2QYGA 3LF0A 4DDFA 1H7WA 2Y48B 3ZZZA 4I0AA 3GPAA 1UWAA 3P4RA 3TUJC 1UL3A 2NR4A 3AE4A 2VPZB 2XVCA 3HL2A 3V8KA 1IN7A 2KFYA 1BJZA 1QE1A 2UP1A 3MD1A 2D9PA 4LOCA 3V4GA 3PACA 4KFCA 1V55H 4H0EA 4QPXA 3L7WA 4LF6J 2MA3A 3M2VA 5FLMJ 2RP4A 1UWBB 2K4JA 2MW8A 2VQLA 1VGYA 3M1VB 2A18A 2PBIA 3HHDA 3L39A 1JNZA 2C3PA 2W2NP 4RR5A 3G1LA 2CFXA 4LF2A 3KZYA 2ZKZA 5E18F 4X4UA 3PYEA 5L8RC 3PIPF 3IR5B 3BGFA 4CI3B 3OTOJ 3RYPA 2HTSA 1FO1A 1UA0A 4IT4A 1N33F 4DHVA 3DOMB 2XHWA 5IP9J 1WZ2A 2HVZA 3QFHA 2RJZA 4BQQA 3DKXA 4PWWA 4PXBA 1UFKA 2KIUA 3RRWA 3CCUI 4Q45A 4Q4ZF 4O2AE 2M2EA 2M8EA 1NDLA 1K0TA 2V26A 2E19A 2ZH4A 2W63A 3G6YA 1OYIA 3MR2A 3J81U 5J1YA 2A2CA 2EWNA 1RAIB 4HSRA 4LK0F 1I94T 1KQGB 1U4QA 5AQNB 4MT1A 1WHVA 1QE1B 2AZ1A 3CCTA 4JK1X 3BBBA 4G8XA 3OBVE 1DARA 3CJNA 1JJ6C 3M32A 1XC5A 2FJAA 4MK8A 3CNQP 3TP0A 4DL3A 2E5GA 3FEYB 1NXIA 5KFRA 5CZXA 4H9PC 3L95X 2EG1A 1KBRA 3CC2S 3WTXC 1JNZB 3GYXB 1FDNA 3NEUA 3LW5C 3P8CD 2LY9A 2AMCB 4U8VA 1W2IA 4F4YA 1TQIA 1HA1A 1B9NA 2MGZB 2C3YA 1T03B 2XRNA 3ECOA 1OY6A 3MOJB 5J2TE 5CVVA 3T1BA 2IAJB 3C51A 3D4JA 2C5JA 2CXEA 1IM6A 3GB0A 5L3BA 2CMRA 2HHUA 2BHYA 2K02A 3MURP 5LSOA 2W4SA 3I56S 2BDPA 2EV0A 3OVSA 4HFIA 3OOUA 5J2MA 3HM9A 2OPSA 1FOKA 4X66T 3CMLA 2DGVA 2L0KA 5EK3A 1UKUA 3HT3A 4BNCA 1F60B 4JBWF 5AQUB 2RMLA 1UVNA 1KHWA 3FFIA 3UN2A 1WSRA 2Y0SA 5ILVA 3H35A 2QN6B 2XSJC 3D0TA 1JLQA 2EH3A 3W66A 1SKWA 2WVBA 2ZXIA 1NEEA 3IMQJ 1WJBA 4DQ2A 2GVDB 1XMQF 2J0XA 3FNNA 2GO9A 1X0FA 2A3JA 3NBPB 4NLVA 1X19A 3M7VA 5LG4A 1GAOA 2QEXI 5A1LA 4OZLA 1W9RA 4F3OA 3TUIC 1HG5A 1YX2A 2EC0A 4IL9A 4PWUA 5CH7B 2E9RX 2RQPA 4YIFA 1O0PA 3BR1A 2XZTB 2J7KA 2H7OA 5DDQC 2CIMA 3ZNJ1 2C2OB 2AYMA 2GZOA 4OI1A 3KK1A 2Z2ZA 5CVIA 3PSFA 4OMFG 3DN9A 5BNGA 5F1RA 3QJLA 1X2NA 1K4TA 5J2MB 4DR4J 2AHOB 2Q8KA 4P6QA 4N4OB 2HYJA 3AA7B 2PMZD 2GJIA 3E08A 3MM8B 2BW3A 1IWGA 4Z37A 3SIPB 2HU9A 4BE0A 2X68A 3VYUB 3CCES 4YLHA 2E5LJ 4N5SA 3D1HA 4C2UA 4I6AA 2FZGB 2P5KA 2FIUA 3PNIA 1UAAA 3B57A 1RDRA 2HGMA 4L74A 2R8GA 2WC2A 3FSYA 3WHBA 2KWHA 2ELKA 4NNJA 2WWUA 3R5GA 2LSIA 4DFMA 2YPZA 4BYYA 1GXUA 2P8IA 1AZSA 1FDDA 3SCJE 4QR2A 3ONQA 2JRMA 3O1JA 1FOXA 4KGZB 1XDUA 2XIGA 3S93A 2F6CA 4HT7A 1N5YA 2KT0A 4JOMA 5HOOA 3G2XA 3RRKA 3ZO7A 3OHBA 2XF5A 4BL0B 2M7SA 3KK1B 2AIRB 4Q5VA 2DAOA 4OK0A 2G7UA 1IV6A 2PC6A 1OWXA 4WFYA 2UV8A 4KIAA 4M1PA 1EX8A 4TX5A 2CW8A 3EGWB 1IBLT 1S29A 1H7CA 1IXKA 2XMAA 2WCXA 4NC7A 1Y39A 2F8MA 4WXWA 2KJBA 5L3GB 3K1MA 3UKGA 5IYZE 4DZJA 3G6EI 3LFMA 2BW3B 2W2PP 5LNKA 1XNRT 4B9SA 1D0YA 4JYAJ 5L1IA 1SQGA 4L0RA 2EB7A 3JSBA 1ZEEA 5C42A 5KAKA 4J9SA 1KNPA 4Y33A 2DHSA 1UAWA 4ETZA 1ONVA 3K0JA 4EJTA 2ESHA 4PFPA 3JAMY 4KUMA 3RPQA 5FY1A 2F63A 2A3SA 3RW6A 3KX2A 3D1NI 2R5YA 1WD6A 5CFBA 3OR1C 2V8HA 4DV6T 3CQGB 1AZSB 3CX6B 1PAUB 1U8WA 1H0MA 2DKOB 4IE6A 2KHDA 4COFA 2Q79A 2H4YB 2H5IB 1FC3A 2XG8A 5B0AA 1T8IA 1N5YB 4ZYDA 4KNYA 3C4WA 2ADCA 3PDYA 1VQMI 4GMKA 3Q22A 2NXJA 2FVRA 3HHEA 5A8RA 3BS9A 1RIOH 3DI6B 4MFBA 4YQWA 1HNZF 2J9CA 1YK9A 4BE1A 3E01A 4JI6J 1N32F 4DV5T 2HPUA 4IH7A 1WOPA 2V6YB 1M5VC 1H6KX 4L0YB 2KRRA 3FUYA 1LWEB 1S79A 5K9FA 1HWLA 2LSKA 4WU2A 3ZOBA 1T39A 3A12A 1PBUA 3CKDA 3KVAA 2DNOA 4JI7T 1WFXA 1VQ8S 2K9QA 4RAZA 1W0BA 2K40A 3L2RA 3HHLD 3SHFA 1BQMA 3UDVA 4ZVRB 1ERDA 3TLVA 3KINB 3S6EA 2VQEJ 3AB2B 1VIOA 5ITHA 2XKOA 4PG4A 4IFYA 3P6YC 4R79A 2CQ2A 3H9QA 3G06A 3ISNC 2CQCA 4I4TE 2HLUA 1UVIA 1VIXA 1LVAA 1W7PD 4TV9E 1XTZA 4ZDLA 2GGPB 3Q9DA 3N6NA