3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
4ESFA 5FD6A 2VONA 1QPMA 1PP7U 2PG4A 1KU2A 3MZYA 4ESJA 4M71A 2FBIA 2PJPA 1UCRA 3O2PE 2XKPA 1U3EM 2FNAA 1UFMA 1J2XA 2HDCA 2DTRA 2CFXA 3M7GA 3HHHA 3V8LA 2LNBA 4RB0A 4EVIA 3I4PA 2A07F 2FQ3A 3HSEA 2VBZA 1FSEA 2QWWA 5LHIA 3JW4A 2P5KA 4U7BA 1HXDA 2BV6A 5FB2A 2H27A 1GHCA 4OIOF 4WXDA 3GO5A 3FHZA 1W4MA 4N9IA 3JTGA 4HX8A 4HBLA 4EJUA 3GF2A 1IXSB 4A2UA 1CF7A 2QBYA 1KU3A 5K5OA 4EJOA 1V3FA 3BPVA 1IXCA 2DQLA 2O03A 2X4HA 3D0SA 3GFMA 2ZMEA 1GXQA 2EFPA 1MJ9A 4MQ9F 2WC2A 4EJVA 1CF7B 1Y0UA 2QBYB 2CO5A 2DQRA 3FF5A 3MWMA 1EH8A 5E20A 3QPTA 5KVRA 5HS7A 2M8EA 5LEKA 1B9MA 2ZMEB 5ICEA 2D2WA 2IVMA 2JT1A 2RNJA 3TGNA 4RB3C 1EH6A 1ZG1A 3FWEA 1K7AA 2YX7A 2JSCA 3HRUA 3TQNA 1ZH5A 3J80K 5JI6A 1TW2A 1IAWA 3R6SA 3E5XA 1K78A 1ODDA 1TW3A 4MTEA 4M9ZA 4MHGA 2K27A 4LG0A 3BJAA 4M73A 2XVCA 5HLGA 3CUOA 1FBQA 4M72A 2RV8A 5ICGA 2GZWA 4KN4X 3K1PA 4P9UA 3F21A 2QLZA 2FMLA 1U5TC 2HR3A 3U2RA 5BS6A 3FXRA 1K78B 3WGGA 3HOTA 1ZGAA 1L3LA 2DK8A 4N0BA 1TQMA 4JK1X 1XN7A 5ILSA 2AXLA 3BP8A 2ELHA 2K4JA 2EK5A 4ENMA 1U5TB 1HW2A 3LQRA 3HTSB 5CVUA 1MGTA 4HX4A 4YFNF 4U88A 4K2EA 4KICA 3MQ0A 4BHBA 2P7CB 1S7AA 4WK8F 4HV5A 3DEUA 2HQNA 3ZMVA 1IN5A 4ZYEA 1RUNA 2IPQX 3RPUA 5E8IA 2JZYA 3BDDA 1FY7A 2IT0A 3T1BA 1G6NA 1L0OC 1TLHB 1G3TA 4HQMA 2RQPA 2ZBKA 4JQFA 2L54A 4LD5A 2MC3A 3T8TA 4KIFA 2UZKA 5HDKA 4PZJA 1ZLKA 1R58A 2PQ8A 4ENNA 3U9GA 2MD5A 2NAZA 2H6CA 4HDVA 1R1TA 1S6LA 3HIFA 1G3YA 4GGGA 3V8KA 2OD5A 2ETHA 4U7DA 3HUGA 3FMQA 4A0YA 1BI2A 4YIFA 4N9HA 4GXOA 4YFKF 5AONA 2DAOA 2BYVE 4O5VA 3K9TA 1XB4A 3R4KA 1BBYA 4RGSA 1K79A 3KP2A 2F5FA 3QU3A 2XROA 3REOA 1XCVA 2RGVA 4I01A 4A6EA 1YW8A 3FMRA 1D3YA 5BPIA 1MJBA 1BC8C 2CQKA 2Y75A 4LK1F 1W7PD 4KMUX 1KGSA 2W84A 4TV7A 4NB5A 3KP6A 3S2WA 3I0TA 1KQ0A 1PP8F 4P9FA 5ILVA 4L9TA 3R0JA 4EM1A 2V1UA 5FFZA 1SFEA 2HKXA 1F4KA 2LDUA 2P6SA 2R7FA 2YX4A 4G7OF 1S3JA 1ZRCA 5D6EA 3M8EA 1R22A 2HTSA 3WU1B 2DU9A 1P2FA 2HYFA 5FD5A 4ZH4F 1YIOA 2V6CA 4IHTA 2K02A 2XGXA 3LAPA 4O3MA 4DNCA 4MGRA 1YYVA 3WU0A 2E7XA 5EEGA 4Q5SF 2W57A 2QQAA 3L7WA 1ZRDA 4MTDA 4WF2A 1J9IA 1HSTA 3ABTA 3GLXA 3GZ5A 1ZLJA 1FP2A 4G8XA 2P6TA 4LB6B 1KA8A 4MEYF 1XGSA 1SFUA 2CGPA 3LA3A 2G9WA 2P5VA 4RB2C 2QVOA 1YQAA 2HWVA 5IT9Z 1IUYA 4UNOA 3KP3A 2ACJA 4AIHA 3GUDA 1TQIA 4Q4ZF 4G6DA 3F6VA 4CHUA 1FLIA 4OMZA 1W5SA 2PN6A 1V4RA 3J7AO 4GYGA 4KFCA 5CVRA 5D4SA 4I0AA 2PMHA 2P4WA 2DT5A 1SD6A 3OV8A 5FLXZ 4L0YB 4S05A 3EDPA 3ROUA 4RAZA 3EYIA 1Z6RA 1YFHA 1WQ2A 3KEQA 4GYIA 1HBXG 3R60A 4WCGA 4R8HA 3BPXA 3KCCA 1O3TA 2DPUA 5ICCA 2LF7A 1IZ1A 3E5UA 2HYGD 5JHUA 3RKWA 2OBPA 2W25A 3R0AA 4EMSA 1QNTA 5JVTA 2QYOA 1GXPA 3MFKA 2JPCA 2D45A 2XUBA 5JFRA 2ISZA 1WI9A 3P9CA 2XRNA 5HVQC 1O57A 1R23A 4XBFA 3ULQB 5CJ9A 4CYDA 5LEJA 4HF2A 3E5QA 3WG9A 4P55A 3G73A 2PLYA 4KUMA 4UV8A 5HDGA 3V7SA 3HHGA 4LLLA 1ZHFA 2PFBA 5L3CA 3SFZA 3COAC 4I09A 3F22A 3GYHX 5E17F 3BJ6A 2NNYA 4LK0F 3KP4A 4QWQA 1MZBA 2P7VB 2STTA 1C0WA 1YW9A 3E6MA 2EB7A 4I7HA 4HYEA 4CGZA 4HDUA 3ISPA 3WTZA 4UHTA 4R79A 1S29A 3FX3A 3DQVC 3C1DA 1R5GA 1B6AA 2FBKA 3GFJA 1BI3A 4KMFA 4EGZA 1T6SA 3WE3A 1SMTA 2O3FA 2F5EA 3C18A 3DP7A 3VB2A 3PQKA 2V1DA 2Z99A 2J5PA 3RYPA 2XIGA 4R1HA 3SXYA 1LQ1A 3PFIA 2QQBA 3KLOA 5HLHA 3M9AA 1DDNA 5D5WB 4F7ZA 3NQOA 1JHHA 1KU7A 4AIJA 2XHKA 4WXCA 3GEZA 2L01A 3Q5FA 2COMA 1I27A 4U0WA 5LGTA 1WSUA 2RKHA 3RI4A 1ZYRF 4YG2F 4LMYA 3F8BA 3FXUA 4EJTA 2Y0MA 4IF4A 1B1BA 3W6KB 2Z9OA 3PQJA 4FHTA 3T5XA 5J8FA 4L5IA 4E70A 1ONVA 1KU9A 4CZZA 5CVVA 2DW4A 2YSRA 4UVAA 4MQVA 5IT9K 1KYZA 3E3VA 4U0YA 3LSTA 1AWCA 5E8GA 1S7OA 3IWFA 3E6BA 1SD4A 5HDNA 4KIGA 4G7HF 1J59A 3SZTA 3ECHA 1S8NA 1F5TA 1YTYA 4NQWA 1LEBA 3ECOA 5D5XB 3ZPLA 3QU6A 5BQTA 1LNWA 1FZPB 4CXFA 3MZHA 1MKMA 3FZVA 3KFWX 3JAMZ 2FRHA 1QO0D 3GWZA 3QP6A 3KE2A 1RNLA 1KQ9A 2HFHA 4RGUA 1U5TA 1HKTA 1R1VA 5FLXK 5LRRA 3D5LA 4L18B 1RI7A 2VBXA 1F1ZA 2DFIA 1R36A 4M74A 5KK1A 5F6FA 5D5VB 1JGSA 3JTHA 2KJBA 2QM3A 5L3FA 1P4AA 2ESNA 4P96A 4I0BA 2MBFA 5AIPA 4UVBA 3GX4X 4ZYDA 1G4DA 4P5OA 1YG2A 2K4BA 1U78A 3M8FA 2E1NA 5TJJA 5BPDA 4GO1A 1XD7A 5CYVA 1JXSA 2FSWA 1TQPA 5CVJA 4KDPA 2FA5A 2L3DA 3C7JA 3FMSA 1TTYA 2L02A 2P8TA 3QPHA 3TDUC 2ESHA 1G3WA 3QOPA 1O3SA 1XGNA 3N4MA 2MH9A 3HOSA 3DFGA 2STWA 6PAXA 5IT3A 3ZMDA 1EH7A 3P9KA 4HQEA 1W7PB 5DYMA 4BH9A 1ZARA 1UHMA 4A0ZA 2FMYA 1TNTA 3QRFF 1ZN2A 2O61A 4Q48A 4CDGA 1SD7A 2F5CA 2OAZA 4CO8A 1JHFA 1OKRA 5FO5A 4D0PA 5K5QA 4MNUA 3F8FA 3TO6A 3QP5A 4ZZLA 1R1UA 3CTAA 2DBBA 2O0YA 1FC3A 4EV0A 3WTWC 2K7LA 1YS7A 1FBSA 3VOEA 4FX4A 3FM5A 4L9JA 4BHCA 5D4RA 1SFXA 2IW5A 1FPQA 2JTVA 1D8JA 3I54A 4KYWA 1K6OA 2LKPA 1NHAA 3L2CA 1PUEE 1R5HA 2ZNYA 2WWYA 3F6OA 5EEHA 1KQ8A 2VXZA 4A5NA 1ULYA 2GXGA 1OYWA 2FEZA 4ESBA 3T0YA 4HX7A 1IN6A 4I02A 4PDKA 5D8LB 3I58A 3ZP5A 1IF1A 2J5OA 3E6CC 1HW1A 3DPTA 3CJNA 3CO6C 1LVAA 3O6BB 2HGCA 2YPRA 4IPAA 3VFZA 1DP7P 1QZYA 2CYYA 1B59A 1IW7F 3L09A 2PBIA 3LA7A 2IJLA 1XGMA 3RKYA 2ZCWA 4HLXA 1XSXA 2EFNA 1Z9CA 2ISYA 3NEUA 1OMIA 1J0RA 5DUIA 5E18F 3KP5A 2UWMA 4HF1A 3LQQA 2A69F 1XCBA 4ETSA 1HSJA 2FOKA 1Z05A 4BYYA 2VC0A 1FBUA 4UVCA 2W85A 2VT2A 2ZXJA 2CSOA 3WTVC 1ZG5A 3LFKA 2BEOA 1PDNC 3BWGA 3G3ZA 2A6EF 1XSDA 2V1XA 4HAMA 2HS5A 2GAUA 3JAMK 4HLYA 3CLOA 2FE3A 1G3SA 5D6FA 3SQNA 3WTTC 1MD0A 1RIOH 1XDUA 5D5UB 1RZ4A 1P92A 4ASNA 3GVAA 3Q9SA 2RC4A 1U2WA 4KNYA 4KT5C 5CVIA 2NNNA 2LF8A 2GA1A 3I71A 2HQRA 4RGXA 5DD4A 4S04A 4Y13A 1E2XA 3KZZA 3ZMZA 2XAQA 4RS8A 1AOYA 4RAYA 2QENA 4ZYGA 1ZREA 1O7LA 3ML6A 4OOIA 3IRRA 3RJPA 2XKOA 5BOXA 3HYIA 2MLGA 3O3KA 3EETA 2GIVA 4H0EA 4XRFA 4EQQA 2B0LA 2M87A 2EWNA 1BM9A 2D1VA 2G7UA 2GA2A 2OQRA 3I59B 4Y17A 1FT9A 3WE2A 4OIRF 2BGCA 3CDHA 3P9IA 3V8JA 2EA2A 3F3XA 1BOAA 2DO7A 2VBWA 4LJZF 5E1WA 3DXJF 4ZZDA 3KETA 5FGMA 2YU3A 1HW5A 3ELKA 2OU2A 1XGOA 3DV8A 1FP1D 1B4AA 2GQQA 2A3SA 2H6BA 3J81K 2VC1A 2VOOA 2AS5F 3CUQC 3GXOA 1MDMA 2EV6A 2Y48A 5L3BA 5HS9A 4PGGA 3ZN1A 2A6HF 3TOBA 2WTEA 3TO9A 1I1GA 4WX9A 3ZMSA 2XASA 4HV6A 2F2EA 2KIUA 3LWFA 4DQ2A 4A6DA 4KN7X 1CGPA 1Z91A 2EA4A 1KYWA 4M6YA 4IXAA 3RTRA 3I64A 1MDMB 1DPUA 5LHGA 1LJ9A 2WV0A 5DDGA 2OQGA 1IN7A 2JPBA 2PMUA 3K2ZA 3RIRA 3JSOA 5CLSA 1R7JA 3GW2A 3KEOA 2L4AA 1MJAA 3H92A 3L00A 3F23A 2M30A 3TO7A 4KA4A 3IKTA 3HRTA 4O6JA 5H6RA 3LAJA 1OPCA 3MAJA 3WGHA 3DPLC 4XLNF 2RN7A 3VEPA 1SD5A 1QBJA 4NHJA 5A2QK 2ZO4A 5K5RA 2EV0A 3WTYC 1HQCA 2XAGA 1WKMA 2HZTA 1QZZA 4YIIA 3HRSA 2XAFA 1FNNA 4PCQA 4HF0A 2D1HA 4AIKA 3GZ6A 1ZRFA 4L5JA 2CW0F 4LGWA 5LRSA 4LLNA 1STZA 1O3QA 3IRQA 5L3EA 3DKWA 1ON1A 1FOKA 1OYYA 1WWXA 1VTNC 4ZYHA 5DUKA 3P7NA 3ZN0A 3I5UA 4QLCU 2VT3A 2EV5A 1YS6A 5DCMA 2VODA 5L3DA 4Q47A 1UHWA 1WRJA 1DUXC 4U0VA 3TOAA 5JR3A 1YLFA 4EJWA 4LFUA 1BIBA 4AVPA 2LSOA 1FYMA 5LGNA 1I6XA 2E7WA 1O7FA 2QUFA 3R61A 4M9XA 2RDPA 4BHPA 5DCMB 5J6XA 4UXNA 3E97A 1J75A 2KIFA 2XAHA 3E6DA 2Z33A 2P5LC 4M6XA 4WXHA 1BN5A 4OIPF 4HOBA 2TDXA 2NS0A 2XV4S 4GCVA 3M1EA 3GFIA 1UB9A 3K69A 3W6JB 4RB1A 1U8RA 4OINF 5LBQA 3QAHA 2BBYA 4XSZF 3Q9VA 1XSVA 2ZJ2A 3ERED 4Y15A 2RVCA 4KIBA 3H3UA 2NYXA 2KKOA 2V9VA 1T0FA 2V79A 5DD8A 3B73A 2MH2A 1HKQA 1YW7A 3H3ZA 1FX7A 3EQLF 2UXXA 1SMYF 4BXUA 5H20A 3EUHA 1SAXA 4CICA 4PGHA 2BE5F 3CO7C 1IRFA 2L4MA 5F1RA 4IRHA 3BY6A 3F8NA 1Z6TA 2ZKZA 3ABUA 2M5WA 2VE8A 1OYIA 2Z3YA 5E1ZB 2KRFA 2IA0A 4AD9A 2JRTA 4B8XA 4LG0B 4HW0A 1USSA 1USTA 3IHUA 1W7PA 5L3GA 2PEXA 2IRFG 5HOOA 4ENJA 1DPRA 4A5MA 2QQ9A 2C6YA 2PI0A 5LHHA 2EFQA 4EM2A 4FX0A 4IRIA 2M45A 5D8KB 1XMKA 1IRGA 2YR2A 3HTUA 1BI1A 1LB2A 2OZ6A 2DPDA 1A04A 3ZMUA 1FYKA 1Q1HA 3V7RA 1FYLA 3IL2A 2Q2EA 3BJOA 3V7CA 2MLKA 2A61A 1H0MA 4G9YA 2IP2A 2R7DA 3J81Z 4IHSA 3GFLA 5FFXA 1B9NA 2ZNZA 2H09A 3K1MA 1D8KA 2VE9A 4L9VA 1OR7A 5LGUA 5J8CA 4BQAA 4UUVA 3WTXC 1JE8A 2Q0OA 2W24A 3MEXA 3F8CA 4BAYA 3WGIA 2FU4A 5DCFA 4OMYA 2A68F 1I5ZA 3HRMA 4AWXB 1H9GA 3WODF 1Z1DA 1D5VA 2HOEA 4MEXF 2XAJA 3B02A 4OIQF 2ZFWA 4M9SA 4OU0A 1E17A 3SHFA 2CWEA 2VBYA 5H6QA 4I2OA 2IA2A 5F64A 2A5YB 2FBHA 2GWRA 3RDIA 1IXRC 3F72A 5TRDA 3N97A 1I1SA 2UXNA 1RUOA 1U6GA 2R3SA 3WTUC 3K1NA 4XSXF 5ERIA 1LEAA 1LDKB 4LLGF 1ZG3A 5A2QZ 3SZPA 3BOQA 2O6GE 3DF8A 1T2KA 4I98B 2DLLA 2HKOA 4G94A 4JBAA 4UV9A 2Z5UA 1J7KA 2FXAA 1LDDA 1YO5C 1GVJA 3IC7A 2ADUA 2O8XA 1T98A 1J5YA 3NRVA 2G7HA 3RYRA 3F8MA 5ED4A 2EFOA 2KJCA 2QZ8A 4G6QA 2HEOA 2NRAC 4FT8A 4EM0B 1W5TA 1QGPA 4LB5A 3HSFA 4XLPF 4BNCA 1P4WA 3KZYA 5E1XA 5HS8A 5DV5A 3T8RA 1TNSA 3BZ6A 1HKSA 4EGYA 1X3UA 4ENKA 3BROA 3TDZC 3C3WA 2FF4A 4HA8A 4IVNA 4RGRA 1FSHA 1TBXA 1ON2A 1R00A 1FWZA 1O3RA 5BMZA 3I59A 1IN8A 1BIAA 2DK5A 1ZAOA 3OOPA 3V4GA 1IN4A 2M1BA 1H9TA 2OZUA 3LA2A 4L0ZB 3I53A 2Q8KA 2KIMA 1LDJA 3VODA 3EYYA 1BJAA 3J80Z 4IRGA 2DI3A 3RKXA 4B09A 4HZFA 2K86A 2F5DA 2OA4A 3WTSC 5ILUA 5DEQA 1EV7A 4Z2YA 4A0XA 1XMAA 3JSPA 2FNPA 4A12A 2CG4A 3KP7A 3TKYA 1ZGJA 3HSRA 1Z7UA 2MA3A 2GXBA 2EFWA 3IKVA 1BI0A 2IA1A 3FXQA 4YFXF 3CUQA 3L9FA 3ZQ7A 3KLNA 4ON0A 2VOPA 3U1DA 4IJAA 2HTJA 5AIQA 3IWZA 1T38A 2X0LA 3FM3A 2EJRA 2VN2A 5HLIA 3RPQA 1T39A 1P6RA 3K0LA 1BC7C 3ZMTA 5K1YA 3CUQB 3MCZA 1P4XA 4L9NA 1XDSA 1REPC 3AAFA 4WWCA 2H94A 1F9NA 4G7ZF 5ICFA 2E1CA 5LLQA 1QQIA
chains in the Genus database with same CATH superfamily
4ESFA 1KLNA 1RWKB 1QPMA 4USWA 3MZYA 2OSRA 2RQCA 1NDKA 4MKYA 1CC8A 4BY1J 1NSKL 1UCRA 1WSVA 5JDQA 3E08A 1WHXA 4EZHA 4UR9A 2GM4A 4LR7A 2CV1A 4CA0A 2ZM6F 4ATNA 2HVZA 4HEA2 3M9OB 2M88A 5HQMA 4EWTA 3CMES 3S14J 4NX9A 4HNUA 2CPTA 2FQ3A 2K9AA 3F73A 4P0AA 1CS4A 5K8OA 2VBZA 1FSEA 3KNGA 3C66A 4ID5A 4HI2A 5HI7A 1J27A 1X9BA 2YX1A 1HXDA 2N82B 3PY8A 2I9SA 1T9YA 4MBQA 2DNNA 3FRYA 5KFDA 3PX6A 2AZ3A 3CO0P 5ABFA 1W4MA 5FLMJ 3TX8A 1EX8A 4DV4F 3P5JA 4HX8A 4HBLA 2W66A 1Q16B 3VPRA 4H9QC 4ZYAA 1D8ZA 3LA0A 5DM6Q 4ZOSA 2PIIA 3MR2A 4MHCA 5KFWA 3BGRA 3HM5A 4EJOA 3SXLA 3PR4A 4RWXA 1V3FA 3BPVA 5GMKa 2L9VA 3A8IA 4PG5A 1ICEB 5CKTA 4PYAA 2IY5B 4JB8B 3RB0A 4BA9A 4ZPVR 2HGMA 3D0SA 1AW0A 1S6QA 4ZKAA 4HWFA 2ZMEA 1UG2A 3NNAA 4IRDA 3QJPA 2EFPA 1PIEA 2KRBA 4G1QA 4EJVA 1IV8A 2DNXA 3ZKRA 3ITHA 2QBYB 4DR3F 2IA6A 2HVQA 5F3JA 1J1JA 1PJ5A 5IQQA 4DPTA 3QLHA 1EH8A 4LOCA 4RDUA 2EHOA 4GYRA 3S1TA 3ABMH 2WW8A 2WB4A 1OEDA 3T1YT 2M8EA 2CQDA 1B9MA 4R5PB 1Y1WJ 2IVMA 2IS1A 3QMQA 3P8CD 4I50E 1HWIA 4ENOA 3U1LA 3PUZF 2JK3A 2D3UA 2FX0A 3O5TB 4BDPA 3FSIA 3TQNA 4CZZB 4J00A 3J80K 3B78A 4Y0FA 4RW9B 2LEHA 2VQEJ 4Q8EA 1IM4A 1AA7A 5C24B 5C2TA 2UUBT 3NOCA 3E5XA 2AIRB 1S79A 5KTQA 4J9QA 1K78A 1ZV4X 3CLQA 3ZC1A 1EP4A 2IPOB 1KKHA 3K3QC 1LK7A 3LSIA 1PYVA 4M9ZA 2K27A 3AEDA 2XVCA 2WMNA 3CUOA 2BANB 5J1EA 4D1QA 2ZJRQ 1Y5IB 4ASKA 1ZK8A 3WX4A 4IH7A 3RQ4A 4LF7J 5J2MB 4GO5X 4KN4X 3PHTA 2CIMA 2CQPA 2F4MB 3HHLD 4WYVA 3F21A 3PJWA 1N36F 3OL7A 5E3PA 2GJIA 2FMLA 3CDUA 1KLMB 3DMJB 4UOFA 2ZOFA 3ADAC 4P6QA 2HR3A 5BS6A 1XN9A 1BUXA 2ABYA 3HOTA 1ZGAA 2AJ0A 4CP5A 4U33A 1IBKT 2EPIA 4DZJA 1S1VA 4WBOA 2QT7A 1LW2A 5ILSA 2HHPA 1AYEA 2ME0A 3B6BA 2WAUA 1JMTA 4NZ0A 3W60A 3HZGA 3TUJC 2EK5A 4YRVA 2EK6A 1H2UX 2XB0X 1WJAA 5FNVE 1M62A 1Q8LA 4ZP8A 4B3TF 3R84B 3AE1A 1RT5A 1WHYA 1T3NA 4U88A 3LSMA 4K2EA 2ELJA 1T9XA 4ZDLA 4DLEA 2LLZA 1PC4A 1MMGA 4KICA 1S0VA 4HRIA 3FXDB 3MQ0A 5BR8J 5M5YJ 3ISND 5EWGA 1TV6B 2AJ4A 4KT0C 3D2WA 4WK8F 4URSA 2V6EA 3N9QA 2CADA 4QIVA 2VIHA 3DEUA 2AMCB 5D0HA 2XUEA 1IN5A 4YTPA 1JB0C 1WKJA 3LFMA 3RPUA 5IP9J 1NZ8A 4CWBA 4RLFA 5D78A 2JA7J 3BSAA 1YI2S 3UFCX 4JP0A 3KUGA 1RABB 4GDFA 4NLXA 2JUGA 1HHQA 2OJ3A 1L0OC 4J7CA 1TLHB 3RC8A 2YDSA 3CCUS 4B9MA 2ZBKA 1TKXB 3P50A 1FX2A 3M8WA 3A3OB 4KIFA 3K8VA 4CI0B 5CPRB 1JNRB 3GYXB 4I6ZA 3S1NJ 5HDKA 5IWAJ 1VBYA 2IFXA 3VWBA 4PPZA 1WKLA 1KQGB 2CNLB 5D77A 4HL9A 2MD5A 3KBTA 2YNGB 2QKMB 1MWZA 2HXIA 4DG1B 4U7UK 1ZOYA 1S35A 3M30A 3HSGA 5D0RA 1GV2A 1R1TA 4ZVGA 3HIFA 3KDNA 2ID3A 2HZAA 4U7DA 5KX5E 2Q43A 2L8KA 4D5FA 3HUGA 5DDPC 1QSLA 2BRLA 1T11A 3FMQA 1YHQS 4A0YA 1BI2A 3I82A 4N9HA 4CLYA 4YFKF 2BV3A 1O5JA 3QPLA 3P4SA 2DAOA 4Z7CA 3DGPB 3GE9A 3WC0A 3HGGA 3R4KA 3D0TA 1U1LA 4EYIB 1HFAA 1F3VA 3OYLA 2ZD1A 4RGSA 3IAS9 1QVTA 4U9RA 4EFAC 2I5UA 3AL0B 4GOUA 1D0XA 2RGVA 3X2QH 5HLFA 3FMRA 2IC9A 5BPIA 4HHHA 1BC8C 4WXOA 2WA0A 4H54A 3WBZA 2VQFF 4P10A 4KMUX 1KGSA 1U0HA 4U67Q 2VKRA 5JTGA 2GAGC 3ENWA 4BQOA 4I4BA 1WORA 1RXOB 3OY9A 3QGPA 1L3SA 2F8MA 2RQKA 3IBWA 1PP8F 2M4KA 1JLGB 4F25A 5IOZA 2KG0A 1LWFA 1A6IA 1UK5A 4DN0A 3K3OA 3KIOA 2V1UA 3Q2SC 2K48A 3CD6S 1T8IA 3FUYA 1W2BR 1F4KA 3S01A 1WH7A 1XBWA 1NHVA 1M5HA 2R7WA 1YJNI 2YX4A 4OZJA 4G7OF 4P74A 2YKSA 1RWNB 4EMDA 2FJBA 3UUNA 5L4EA 4P2SA 1D1AA 2ECBA 3RRGA 4RA2A 2XDVA 3AA1B 4TN7B 2KT5A 2E60A 4DV1F 3WU1B 3KNAA 2DU9A 1D9FA 2HYFA 2W67A 2K02A 2XGXA 4FE7A 3PEJA 3DI6B 3PUAA 1YYVA 3WU0A 3TEGA 2MJUA 1HD0A 1P1TA 2WS3A 2AU0A 3H40A 2H88A 3DM2B 3L7WA 2EIMH 2IMLA 1PC5A 4WF2A 4C98A 3GB0A 1VQMS 2CWYA 1X79A 1R6VA 1HSTA 2PMWA 3GZ5A 1ZLJA 3FKIJ 2FLLA 2VICA 2H1LA 5K7FA 3V4IB 2ODVA 1VC6A 2HQ5A 1CJKB 1VHIA 1XMOJ 5LG3A 4WP9A 2FD5A 1NJIT 2FB0A 2ZHOA 4RB2C 1NSPA 2HHHJ 1AZSB 1OCZH 2EG2A 4WK1A 2HWVA 1VFCA 1JGGA 1UX5A 3MEDB 2A0FB 4JI8F 3JTOA 3B5MA 4RW8A 2ACJA 2FPHX 5K7HA 2GMHA 1WVRA 3GUDA 3D5RC 2VUGA 5KFNA 1I6JA 2ZBCA 2VQEF 1Y4ZB 3TAPA 3MD2A 4G6DA 4KV8B 2CUJA 4NI2B 1VNDA 3LF0A 1F5CA 4MLOA 4UUSA 2E5LJ 3PM1A 3MEEA 1B72B 5AJ3J 2K5BB 3ET6A 4Z37A 1VJQA 5CVRA 4IQMA 4XKVA 2XAQB 3H37A 1DARA 5FLXZ 4L0YB 1WOPA 2HFVA 4S05A 3C50A 4F67A 3EDPA 3MR5A 1YFHA 5DABA 1WQ2A 1VQOS 4DSKA 2MC4A 3KEQA 3Q0UA 1ZZNA 3QGIA 1MN9A 1OWAA 1Z7LA 4R0EA 5B09A 3IGVA 4L9IA 5AQPB 1HBXG 2YUSA 3BPXA 3F0CA 2WP9A 1FNOA 4ZPTR 1BJZA 3R5JB 2O67A 3RKWA 1GK8A 1TMMA 4ZHRA 3TAQA 1NK9A 3IC1A 3S2DJ 4E6KG 2D45A 5F8GA 1FJ7A 1SJFA 2ZSIB 2R8KA 5BR8F 1PBAA 2JZ5A 1T8EA 3P9CA 1G2EA 2CPDA 4QH5A 2KNDA 4TYAA 2K9QA 4XBFA 2C3MA 4X20E 4CYDA 4HF2A 2W2NP 1Y3KA 4HNVA 4P55A 2PLYA 3HKZN 4KUMA 3I56S 4UV8A 1JKHB 5HDGA 1FRLA 1M1KT 2IIUA 4BJ5C 5L3CA 1X0PA 2HHXA 1X7VA 1URNA 3SFZA 3P49B 5IV3A 3GSDA 3PJXA 1BR1A 3H0GJ 3F22A 1SL1A 5KT2A 2N4DA 2BVMA 3EXCX 3GCWP 1U1QA 2MFZA 3ASOH 2NNYA 2BJ8A 2JA8J 2J9DE 5CABA 4QWQA 4BHQA 2MZTA 1DZ5A 2BQ3A 4YJ2E 1R8BA 4YS2A 2XASB 1M5PC 2EB7A 1D9AA 2BABA 3BR9A 4EBEA 2UUZA 3WDOA 1WJBA 3FBBA 1QTNB 1KF6A 1H73A 3OSNA 2B4OA 1EF4A 2F6CA 3ANWB 3NS5A 2OTJI 3QBCA 1R5GA 5FIIA 3GFJA 2X66A 3EVWA 4FNIA 1MSFC 2K06A 4DFKA 5LHGB 5C8YE 5JVGQ 1HQEA 3ZTOA 4C3KA 3WE3A 1SMTA 5EWFA 1T9TA 3VB2A 2DTJA 2RAEA 2V1DA 2HVDA 3K5OA 3NWSA 2NTXA 1D0ZA 4KHPJ 4E7ZA 4DSJA 4PJMA 3W5ZA 2MGZA 2BUNA 4BY7J 2B4UA 5FY7A 3SXYA 1HA8A 5ETWA 3PFIA 2QQBA 5HLHA 3M9AA 1UFKA 5FP3A 2V6YA 2AW0A 4YEAA 2VB6A 4XDCA 2Q66A 1JHHA 1M90T 3MM8B 2XGEA 3MEGB 2R5ZB 2XHKA 3C2HA 4U0WA 3S17J 5LGTA 1JLEA 3MPUB 5L47A 2WONB 4X64F 2V2QA 3CIZA 1HL6A 1ZYRF 1NK4A 1FX4A 3OMYA 4O3NA 5E3OA 5B0FA 2PA8D 3W15B 3UU5A 2KG1A 5AQLB 3CEDA 2MMYA 1X4OA 2DR6A 2K9NA 2JIWA 3CKDA 4WZMA 2JSPA 1G8XA 2R93J 3CIRA 3HOXJ 3SOLA 4FHTA 5J8FA 4DN9A 4L5IA 4PKDB 4F3QA 1ONVA 3HL6A 1KU9A 4H9PC 1UA0A 1B0TA 2YSRA 1DQAA 3H8YA 3BR1A 3VAKA 5IT9K 2KTQA 3LBXB 3CCES 5L1JA 3E3VA 3FBLA 4YP3A 3VVUA 1AWCA 2YBVA 1PJ7A 3TUIC 3CCWA 1BMQB 1EETA 4KIGA 4FKYA 4G7HF 4DHVA 1L3VA 4C2UA 3ZN0B 1E7PA 3ECHA 1HBMA 3DXBA 5F0WA 4C6AA 3UWTA 1Q79A 2V4QA 2L48A 2X3DA 4NQWA 2PJRB 4V2FA 4DOZA 4DL4A 3E7LA 2M8HA 2W9BB 1LE8A 2AE9A 2OD4A 4TU8A 3JQJA 2R92J 3MMAA 3FJ2A 2R7TA 3THTA 3JRGA 4DQQA 3H25A 3KFWX 4DO0A 4EO8A 2WMOA 4G3IA 1XMOF 1KQ9A 4UXNB 5I4MA 1HKTA 2ATCB 3HPGA 3BYPA 2LQ9A 4WWSA 1F1ZA 1R36A 2VKZG 1WNEA 4ZC3A 4M74A 3R7NB 4L6V3 4Y6IA 1JGSA 3MM6B 3W62A 1SA0E 7FD1A 1P4AA 2H5JB 4YFUA 4RW6B 4WPAA 3J81Y 1EA3A 4I0BA 2EXUA 2DA3A 3ZSSA 4UVBA 2V0NA 4M5MA 3CVKA 4M5GA 4MYTA 4ZVSB 1X1CA 4BU2A 4P5OA 3PJRA 1U78A 3M8FA 1ZTRA 2LT3A 3CJTA 1FTRA 2RE1A 4C3JJ 5CVJA 1S6UA 2E5LF 4JV1A 3RG6A 4IFYA 5GAHU 2W8LA 1UHSA 4PG4A 1OEDE 2BS4A 2HGLA 2W2PP 1LW0A 3FMWA 3S8PA 2FZCB 3FZ2A 4CDIA 3OOUA 4G2AA 4HT7A 1Q5YA 2B7CB 4JV0A 3QOPA 4MTPA 3GILA 2IRYA 3MUMP 3DRYA 4W92B 3RKQA 3FFIA 6PAXA 4U2ZA 5IT3A 3AQPA 2ASJA 4QR1A 3OTCA 3P9KA 2B63J 1W7PB 2QLJB 3POTB 4AE5A 5M5XJ 2XWYA 5DYMA 1Z4UA 1CQNA 2MTQA 2OP5A 2ILZA 4A0ZA 2FMYA 2N3OA 1JJ4A 2E9XB 3S8SA 2DPJA 2Z2ZA 3UDEA 1HBOB 4ED2A 2RF2A 4H9RC 1NXIA 5LHHB 4EEBA 1T02A 4LF8T 4D0PA 4DV6F 1F9EB 3TO6A 1ULRA 1BR4A 1RTIB 4TNWA 2IM2A 3QP5A 3CTAA 3TARA 2DBBA 2O0YA 5A2QY 1FC3A 3PG9A 2K7LA 1YS7A 3FBNB 1YD8G 2D0TA 3CCZA 1VQKS 4RNMA 3FM5A 4L9JA 5D4RA 1CJUB 4ZLNA 1SFXA 5KDMC 2IW5A 3I54A 3QFHA 4RUHA 3ELHA 1TKZA 5JR9C 4RBVA 2IMOA 2NPFA 5L9NA 1GT8A 2XQ5A 3EZUA 1R5HA 3MPYA 2F48A 3SIPB 3Q8SB 4E7KA 3F6OA 1O4XA 2KN4A 3IO1A 1HHTP 4GC6A 1KQ8A 2VXZA 2CMRA 4D9JA 2QMXA 1JWWA 1MWQA 5AQFB 2GXGA 3HSJA 3G86A 4UIGA 2CJYB 3H4DA 3HG9A 2H51B 2YH1A 5JDMA 1HMVA 1IN6A 1S48A 4I02A 4ZTJA 4PDKA 3I58A 1QY7A 4WE1B 2J5OA 3DTEA 3QIPA 3E6CC 1CJVA 2AF6A 1IVZA 3DCFA 4CCMA 1CBKA 2R4FA 3HFVA 2LRDA 2HFZA 3CO6C 3QYFA 3F56A 3PW4A 2GAHC 3VFZA 1DP7P 1V3SA 3DRPA 1SC7A 2CYYA 4EEFG 2XAJB 3IRXB 3PKMA 1JXVA 3V42A 3KJFB 1X9WA 4C48A 3GIRA 5GAGU 1BOBA 4NA3A 1H38A 1Z21A 2BQUA 2I59A 1XGMA 2JH3A 3HI9A 5LXYA 1ZZFA 4X2BA 1Z9CA 3AXKA 3N79A 2W1BA 5AXKA 2UVVA 4MFDA 1YZ6A 3RIFA 5AFUL 1JLBB 1J0RA 5DUIA 5E18F 5KFIA 3LQQA 4IH6A 4LF5J 2OC6A 4BUPA 4KHRA 4ECTA 2GO9A 1FOWA 1BA5A 3C16A 4M5DA 2FOKA 2WB1N 2GA7A 4XAKA 3KLEB 1RRJA 2W85A 1NHKL 4LFBJ 2ZXJA 3BEGB 4I2PA 3QRQA 3VSLA 3EAMA 3W9HA 4N5SA 1ZG5A 1MIWA 2W1OA 3LFKA 2K40A 3OTBA 4BLGA 1JUPA 3ETMA 3CJ5A 2BEOA 2XGPA 1GXTA 2KFYA 1N0VC 2UUAF 5GP9A 2CBIA 1JNZB 2KI2A 1XNRJ 3H9QA 5L9XA 3FZMB 1XMQF 1XR6A 2A6EF 1IKWB 4DV3J 2N9DA 3I4NJ 3MECA 3VQSA 4I99C 2DGTA 3JAMK 4UV9B 3IWXA 5JDHA 4HLYA 2Q79A 4ZN3A 3NZQA 1WPKA 3A5XA 3EGWB 3WTTC 2DH8A 4O4RA 2E2IJ 2DL1A 1XQIA 3T1HT 1HQUB 1YBTA 4K50A 3CUNA 5J1GA 4OZ5A 3ETVA 2EG1A 2I8EA 2UU9F 4KNYA 5CVIA 2LF8A 2VVNA 2CWKA 3PACA 3I71A 2ZZMA 4JI0F 4I0UA 4QXHB 3W63A 5TISC 3V6KA 3E2EA 4QIGA 4AD6A 3HKEE 3QPIA 1RT7A 2R7ZJ 1BQNB 2M7AA 2HAFA 1F9FA 3OTOT 1Y5LB 4I1TA 4COFA 3GYNA 2XZDB 2BOLA 4RS8A 1LVFA 4CO2A 2G0CA 4PQUB 2LSGA 5HWYA 1S1XB 4N77A 1A6QA 1YOVB 2ADCA 4HWIB 1N6QA 4GMKA 3J80U 2XKOA 5F0CA 3PTWA 3PX0A 2LBFA 4PZVA 2QO3A 3EETA 4H0EA 2RT3A 4QWDA 3UCGA 1B4SA 3VV2B 2EWNA 2YN6A 2G7UA 1GDTA 4YOEA 3OR1B 4Y17A 3H59A 4OIRF 3W2WB 2BGCA 3BBFA 3ILOA 2L41A 1JQGA 3KK1B 3BREA 1S6PB 2GIQA 1WELA 1YJWS 3WG7H 4WFXA 3N2GE 1Q53A 1C0TA 4XM3A 3V4MA 1WSRA 3DWLE 3MGJA 4WFYA 2HFOA 4ER8A 5JRCA 3CWZB 3NWIA 5LP6E 3UPFA 2CJQA 3T5KA 2KFNA 2HQCA 4RKUC 1F9HA 2JDJA 4Y28C 2DRAA 4OYAA 3QO9B 3CD0A 4ZZDA 1JT0A 1R0CB 1QJHA 3CC2I 3Q22A 4TV9E 1IV6A 2HHQA 1HW5A 5KMGP 1IZNB 4NRUA 3KX2A 2HVRA 4E4HA 3DBLB 3BN7A 1FP1D 4TKTA 4HWHA 3NRBA 3L8RA 1ETVA 3J81K 1VQ7I 1T8BA 2AS5F 3CUQC 3GXOA 4GKKF 2Y48A 2A3DA 1YE9A 5L3BA 1V5GA 5HS9A 2C2OB 5CA0E 4LSNB 2DH9A 1FK9A 3TOBA 3IH2A 1H88C 2V2VA 1MBJA 5F8MA 3T5LA 3CMAS 1KZHA 1RE1B 2PMZD 4BDYA 3JYTA 2FJWA 3CNQP 4LIRA 2WBMA 2H1KA 4KHZF 4YLHA 2E9TA 3I0SB 3BR2A 1HOMA 1IR1A 2IM0A 3IGNA 2HFSA 4OJGA 4KP3C 1SJ1A 4JOUA 4K4ZA 2GJ2A 1KYWA 4UF0A 4LG3A 4M6YA 5JVDE 4ILRA 3DLHA 1T03B 2QN6B 3I64A 3P6YC 3D6MB 1H2TZ 3MPWA 4BBRJ 4DUZT 2ZVIA 3VAFA 4LF6T 3GP9A 2PGCA 3RR7A 5E3CA 2KLOA 3KDOA 1ELOA 1FWLA 1VQPI 1TL7A 3BSOA 2HAIA 2M30A 1S1TB 1RTDB 3PJAA 3MN2A 1HX8A 1Z8UA 3CJQB 3I0RA 3EABA 4UOGA 2RNGA 3LAJA 1GXLA 1OPCA 2Y0BB 1W09A 2OPSB 5ADZA 3WGHA 1VLYA 4DVDA 1ITPA 1X4AA 2CQHA 5KXJA 1VBZA 4OL8A 4ZS2A 3M1VA 1LRZA 2XRLA 1FFGB 5A2QK 3LP0B 2XG8A 4I56A 3BGOP 4B43A 2VPYB 3MF5A 2F4VF 3S4UA 2F63A 2VL1A 1RACB 1JJ6C 4K4XA 5H6RB 2P9BA 3ONLC 2CV0A 3V6JA 3D0GE 3HRSA 1WI8A 2XAFA 4ERDA 2BW2A 1TZ0A 3HOWJ 4EUVA 1SV5A 4L5JA 2LDYA 3LANA 1S97A 4NWBA 2CW0F 5EX0A 1JLAB 3D5MA 2V8VA 1SVLA 4AQYJ 3JQKA 1CS4B 4OWRB 4DXLA 1Q81T 1RYSA 3FHNA 4L72B 4ID5B 1JK9B 4P75A 1N5TA 2DA1A 1AU7A 1Y11A 1Y6IA 2IAIA 4F2RA 4ZYHA 3P7NA 4EO6A 3LOCA 1P7JA 4EU0A 5DCMA 2VODA 3KJVB 3GV8B 2DTZA 5ABFB 1WRJA 5K9FA 4BJNA 2LKHA 1DUXC 4DDFA 1IBKJ 4IDPA 4LMJA 3P4QA 4L5EA 2B9YA 3ISNC 4LF5F 5IUXA 2HNDA 3H0DA 4LFUA 4QOTA 1WHWA 1VQSA 4CUGA 5LGNA 5IT0A 1HHSA 3E51A 5LJ3Y 1WFXA 1WI3A 3CQCB 2QUFA 4M9XA 1WG5A 4EB6E 2J7KA 5J6XA 1BWVA 1RAOA 3E6DA 4V19X 3HJEA 2RVJA 1S6QB 4PAAA 2V5DA 3GV5B 1UAAA 2QLWA 4J9RA 3UN3A 5EK2A 4G1QB 4P2XA 3BR5A 4KKOB 4YIRX 3CDIA 3H9JA 3M1EA 1UB9A 1S7IA 3OTDA 4ILBA 2V7IA 2V6XA 1GNKA 3JCUC 3UUBA 4ED7A 3QAHA 3QYBA 3ERED 4K5RA 2RVCA 3EPIA 1I3OB 4KSEB 2V9VA 4FDFA 5E2QA 3W1YC 4PPDA 1HKQA 1FX7A 1NK6A 2UXXA 4B48A 3C4ZA 1G59A 1HDPA 2HMIB 4FP9A 4K8RA 2IS2A 1IKXA 2CH0A 1SJRA 4NCAA 2ZWPA 4IT4A 3CJ0A 4U8VA 1XWLA 5F8HA 2C2KB 2LKZA 4P7VA 1TFWA 2GVDA 2V69A 3M8SA 5A8RB 3IR6B 2KRFA 2VKOA 1EP4B 3X3UA 1FJCA 3Q5DA 1R27B 4M5LA 3MHYA 4DL5A 3VU7H 4HE8A 1X3ZB 5HOOA 2X3GA 1HF0A 1GTEA 3RKGA 1D1UA 3R6NA 4NLDA 1F0XA 2CQIA 2YPYA 3CDWA 2ASLA 4B3OB 4DPUA 1FVQA 2UV8A 5DQGA 2L9RA 1S72I 2ZHAA 2MY7A 2HBYB 3GIMA 4XN3A 4IRIA 2W4CA 4B9NA 4KPCA 2Y1JA 1S1VB 1LW2B 3M8ZA 3DXSX 1VQ4S 1S9EA 2GVZB 1YRNA 1GMWD 2OZ6A 4Y33A 1FO1A 4ZJZA 4ILMA 1VQ6S 3QWLA 1PO6A 2D69A 1A04A 5CYMB 2FJXA 2K9LA 2PC6A 3NZPA 1RT5B 1FYKA 4F3OA 3V7RA 1N77A 1X5SA 2CQCA 2FJ1A 3ZTSA 3CF2A 4B3AA 3V7CA 1KTVA 4B3XA 3GTGJ 1WKKA 3S32A 4PK6A 3KV5A 1ACMB 4IHSA 1B9NA 3PIOF 1D8KA 3MR6A 5HLTA 5JR9A 2A6OA 2JEIA 2LVWA 3SMZA 1TL1B 2ZM2A 5DG7A 3TZXA 3M32A 1UCUA 4FYXB 4PWDA 3NKZA 4ZXLA 4O3OA 3Q8VA 5KAIC 3SCLE 3F8CA 3JRAA 3W2AA 4ZVTB 2FU4A 5DCFA 4K4SA 2IDOB 4NUVA 1U9OA 4BBSJ 1Y01A 5F9NA 1Q0NA 1C0UB 4QW8A 3CJ4A 2ACXA 1A7GE 1MU2A 4S0HB 2KMFA 2ZFWA 3EDUA 4JI2T 3MUVP 4KJZA 3A01B 2UXBT 5HROA 1T33A 1E17A 2WOMA 2VBYA 3LQVA 5H6QA 1SH3A 1C4CA 5LG4A 3B4DA 3K5PA 5RUBA 2DT9A 3RW7A 3AAIA 5K8PA 3M30B 3RDIA 2W62A 2J8AA 3JREA 1NJWA 3C3LA 1I1SA 3UDVA 3T1YF 1MH4A 1RUOA 2A1BA 3TBIA 1N5YA 1CJTA 3CCMI 4I55E 5DO2A 3BZQA 1JKOC 2YOEA 3E01B 5C25B 1XR7A 3N9MA 1HTJF 1RHUB 4XKBA 2X68A 4B02A 3MCSA 1YJRA 1WJDA 3LP2A 2LK2A 4DF8A 3BO4A 2ZD1B 4I98B 3VCDA 4G94A 1FWPA 5GAEI 1DU0A 1KONA 2BKOA 1SBRA 5HLFB 4K7QA 3QAUA 2UUBF 1UMQA 2FY1A 3K4CA 2LM9A 3C98B 5M2PA 1SL2A 1DJ0A 1EZ3A 1YO5C 2NVQJ 1HDDC 1GVJA 1NPRA 4BC9A 3JTNA 4ZI3C 1TK0A 1U09A 3BQZA 1U0HB 3N9LA 4X4TA 1D1BA 1T98A 2F8EX 1LWCA 1J5YA 3NRVA 4RL1A 4B3MT 2KT3A 3J7A1 3R7BB 1K0VA 2UZAA 5HCMA 1H74A 3JXOA 1KQKA 1KTQA 5E3AA 4M3FA 2IC3B 1LWFB 3A4CA 3JRHA 2LMIA 1SVOA 2QSWA 1WJ9A 4UUXA 4FT8A 4NLPA 4W1UA 2ZH3A 2CUEA 1NPPA 4RNOA 2Y3YA 4BNCA 5KG6A 2BG9C 2JRKA 2Y8WA 5G0RB 5HP1A 1TK8A 1IXKA 5ETQA 2FGCA 4HG2A 4OI0A 4Y3CA 3NGTA 3GZ7A 3NY0A 3W6VA 4ZDNA 3CCLS 5IT9U 4HA8A 5J2PB 1FSHA 3HA4A 5DGBA 3I59A 1IN8A 2B9WA 4D3GA 5KNLA 3CSKA 3OOPA 1V5VA 3AH6A 3LA2A 4JI6F 5F0UA 1FESA 2V8DA 2MEWA 4LRAA 1GXUA 4X65T 2KIMA 2F9JA 3ZEFB 3CZ6A 3EYYA 4Z90A 3H42A 2YEVC 3H35A 4IRGA 3BR3A 2DI3A 3BH7B 3AEAA 3QFWA 1KFDA 2HLUA 5BXIA 4QYZK 4HZFA 4KH0B 3MXZA 3Q89A 1HLVA 4MJKA 5E3NA 1A6LA 1QUUA 4RW8B 3GBGA 2XQ8A 9RUBA 4JI4T 2HHVA 3GTJJ 2X85A 2AYBA 1RTJA 4RBUA 4AKGA 1ZGJA 2HVSA 2MA3A 3C15B 4NYOA 1SQGA 4A46A 3PHEA 2CQ7A 5HXEA 5HVFA 4IO9Q 3FXQA 4YFXF 3CUQA 4PJJA 3W2VA 5IYCJ 2L9NA 4EOZB 2R2UA 2ID6A 3LPEA 4HH0A 4P2MA 1XK8A 2DIVA 3SSQA 2ZJPF 2HTJA 2J0XA 3IWZA 1DLOB 2QA1A 1T38A 5FROA 2DH7A 4O4GB 2EJRA 2OELA 1W25A 4OYMA 3VR9A 1S7EA 5FJ4A 1P6RA 3A03A 2DWKA 4LBHA 3NRYA 4F0HA 5DGAA 4IHYA 3ZR8X 2CXFA 1IR2A 2EW9A 3TWZA 1ZA1B 2VQGA 1HIYA 1MNDA 1E0EA 5KT7A 2LHNA 4ZJQA 1S94A 5AE3A 1S10A 1HCIA 4RW7A 2OMOA 4CH7A 1T9WA 2B6AA 3KHRA 3H3MA 1QQIA 1FTCA 5M2RA 5FD6A 3PO2J 3ZNJ1 4F3MA 1SB6A 4A3FJ 3IA0A 1FDDA 2BR0A 2XULA 2CLYB 2BJ3A 3K70D 4ESJA 1YJUA 4M71A 4XBFB 4OMFG 2LOOA 4F6RC 4DWIA 3O2PE 3TL4X 4M5KA 1G2HA 4RMNA 4MLKA 3ZZTA 1WDDA 2FC8A 1YIJI 4UV8B 1UFMA 3P4PA 1R8HA 1FTTA 1NU4A 5L3CB 2LHRA 2HPLA 1FVSA 1OJ4A 2CFXA 4R8UA 3M7GA 2HVEA 3DPUA 2BY0A 4RB0A 3JRFA 3P5BP 4F26A 1SFOJ 3FK7A 2FUG9 3LGMA 2F1FA 4F8RA 2OLWA 2P5KA 4UB6C 3SFGA 2R2RA 2IIHA 3R97A 4C2TA 5FB2A 4ZS6A 2W61A 1FEXA 1FEEA 2AT1B 2CUZA 2DCEA 4N9IA 3JTGA 2H3RA 4JBWF 4TYBA 4RUBA 1HQEB 1L3KA 2MZ1A 3AD9C 3DDNA 1MMLA 4CCLA 2CXEA 2ZZTA 3HKZD 3PUSA 3Q5WA 2RRNA 2QBYA 1BLUA 3MCNA 1NUEA 3QT7A 1TUWA 2G13A 2JVGA 1EAYC 2V1DB 3CCSS 1HI0P 3PV8A 4RO0A 3MURP 4ERRA 2PA3A 2O03A 4YEJA 2M8GX 4WBNE 1F5BA 4ZCLA 4YR0A 4U7IA 4R5PA 2KHDA 1LKZA 2UVWA 3G96A 4FXWA 4A8YA 1BQMB 4CH1A 1UZDA 1K8AT 4MQ9F 2V6YB 1UJ5A 3IXQA 3I9YA 1LFWA 4KISA 3OYJA 2C2DA 4PUSA 5F0HA 4NBQA 5JLXA 1JLEB 2JA5J 1KQSR 3Q3SA 1D09B 1MNMC 1VQLS 3RIUC 3ILIA 2V67A 2JQ9A 5ICEA 2MG4A 2D2WA 4IOBA 3PUBA 1ETWA 3F2EA 2HOTA 3TGNA 5BNGA 2PSZA 2BANA 3JADA 4ZLPA 3TJ9A 3FWEA 1XC9A 3AG3H 4J5OA 2MQMA 1ETYA 1TW2A 1SXLA 1HBNA 2QMUB 3R9LA 4WFZA 3JAMU 2RB7A 3R6SA 4M95A 2WK4A 4CLUA 4F92B 5LD2C 4CCOA 2PFFB 3TMOA 3ZQFA 4I67A 3W9IA 3JRDA 4MHGA 1RAGB 4FCYA 3M65A 1EETB 5HLGA 1ZGWA 5A6PA 3CGIA 1DQ9A 4M72A 1HBMB 2E2AA 1IUJA 3X1DA 4LF8J 1JXEA 2K24A 1U1MA 3GYGA 1REGX 3LUYA 4P9UA 4CCHA 2C3PA 3HFKA 3Q8YA 2B4VA 1HNZT 2DWGA 2VL0A 5J4VA 1XNQJ 4UOHA 3MMAB 4DMZA 3AD7C 5B0EA 1L3LA 1H89C 3MKWB 3UI3A 2KJVA 3C2PA 3RBZA 4IUFA 4KAIA 2AXLA 1SANA 1UAWA 2K4JA 4ECQA 3G4SS 1HW2A 3LQRA 2C2ZB 4R25A 2ROPA 1MH3A 4F93B 1GUUA 4DLGA 4DQPA 2IDLA 2QE5A 2YNIA 4HX4A 1WG1A 1RWVB 4NMXA 2QA4I 3NS7B 3UFGA 1VYAA 3KMQA 3J7YU 1MIVA 2QLXA 3IH3A 3Q5EA 4A8FA 2HWIA 4DV7J 3JRIA 4HV5A 3MUTP 2Y1RI 3PFOA 3DN9A 3TA1A 3BQKA 5F3TA 3PUGA 3LSRA 2Y31A 3UE2A 4EAHA 4IKAA 2LY1A 3ZMVA 4ZYEA 2H5IB 4HN9A 1GMVA 1FE0A 2IPQX 1VQ5S 2DA5A 4XN0A 3HVTB 1OCPA 4FBUA 4IFYB 2IT0A 4DSIA 2C5IT 3DHXA 3T1BA 4ANDA 1G6NA 4A97A 3ZZPA 4TLRA 3Q24A 1F6TA 3FISA 4OX7A 3Q2MA 2HU9A 5CB4E 1WUUA 4KQZA 1HR0F 3D67A 1HNVA 2ZXWH 3PXGa 2NOJB 1LW0B 4LD5A 2HS0A 3IM9A 2E5GA 3NGKA 4CLFA 5KG2A 1CSJA 2XQYA 1HWUA 2J7UA 3ZT7A 2M70A 1YVFA 4O3QA 1VQNS 2NW7A 1QSYA 2PQ8A 2EQRA 3FFIB 5DM7Q 1RB0A 1Q1VA 1FOXA 3TLUA 4ENNA 1FKAF 4NYZA 4UUTA 3OHAA 2V5CA 2HS4A 1SC4B 2NAZA 5IS2A 2UXCJ 3QK6A 2D9PA 2OPPA 4GRSA 2M7BA 2RF2B 2VPLA 1FERA 4ETXA 1G3YA 2ZEJA 3FXKA 4XICA 5HK4A 4GGGA 3MM9A 2OD5A 2LVSA 4C8OA 4QW9A 4CN6A 1HC8A 3G87A 3TVZA 2AYEA 5IC4B 1OPZA 2FUG2 3NAIA 2VFTA 1JJ2R 3IMQJ 4QR2A 5AQGB 4O3SA 2RKIB 5BJRA 3PURA 4O5VA 3KKFA 3WQPA 1XB4A 4HHUA 3PEHA 2YWHA 2IW5B 4X4OA 1SC1B 3KV9A 1JLGA 3T1HJ 2KT9A 2V7MA 4BL0B 3L4BC 2L7KA 1XCVA 4OAYA 4A6EA 3BJYA 1YW8A 2UVUA 3FXLA 8RUCA 4ECRA 2JMHA 2CQKA 3OYAA 3RB4A 4LK1F 2EZHA 1W7PD 3M8PA 1WACA 3CDBA 2JWNA 2VPZB 4TV7A 5M3FJ 4A3DJ 3LL7A 1GTHA 2E9XD 1XMBA 4A48A 3UO0A 3BYRA 4C11A 1KWMA 1IJ6A 3H5RA 2WU2A 4V19J 5ILVA 2BE9B 1HMVB 1V3RA 3OW2R 1I94T 5FVLA 5FFZA 3SEQA 2IGKA 3CWJA 1SFEA 3M2UA 1DAXA 1CJVB 3X1LB 2IBKA 2WWUA 4TXSA 2LCWA 3FDYA 5FL0A 3M8EA 2HTSA 3IS9B 2X0HA 4NASA 4CN4A 3PSIA 2IJNA 5FD5A 4ZH4F 4DNCA 3MACA 1IC8A 3L2RA 2BG9A 3KEYA 1YWXA 1ETKA 1IJWC 4JI3J 4O44B 1CJKA 3KOAA 3C4WA 4AI6A 2ZKTA 3T5HA 2KZZA 3GCMA 2W57A 1FJLA 9ATCB 1TKTB 2QQAA 5LOQA 2WVBA 4LF9F 1BGXT 2GC8A 2WDQA 3SV4A 5J2NA 3J7AN 2FTRA 4MTDA 2I6WA 4DPYA 3GMIA 3ZCJA 1CG2A 4ZVPB 2E5JA 1S4FA 1FP2A 4ZHQE 2QL7B 2OCCH 2CPYA 4KH1B 4OJ1A 2EILH 4PG7A 4LB6B 4I2PB 4TNOA 4MEYF 1XGSA 2C2NA 1SFUA 3H5AA 2WBRA 4C8MA 4FQGA 2NP9A 2XS5A 1A0OB 1GFWB 2QVOA 2B8PA 2L3MA 3KHGA 4Z6YA 2VF3A 5C4XJ 2GQ2A 4MFBB 1B72A 3MECB 2Z4PA 5H9EK 5L1LA 2HZVA 2HHUA 4KBMB 3B54A 2UV1A 2OEJA 5AQVB 2GMLA 4HKAA 1TQIA 2CCQA 3RJMB 2CXLA 1W36C 1OWXA 5F8IA 3MJXA 2R8HA 2RJZA 3EI0A 1W5SA 3PRVA 1N0UA 2M4GA 2DCFA 1V4RA 3MOJB 3J7AO 3AFHA 4Y65A 2QEXI 4GYGA 3HP6A 4P9SA 2XQ3A 2WB1D 1RT7B 5D4SA 2HQIA 4AIDA 4DUZJ 1KFSA 4ECWA 2CJKA 4A3KJ 4LF6J 5KFAA 1U1KA 2PMHA 3IAM2 2QA2A 2DT5A 1SD6A 3VZHA 3DLBA 4DGWB 2HSEB 3FCVA 3ZSTA 5HWXA 2AJ2A 1OCTC 3OYGA 2A72A 5KT3A 1RWOB 4CH0S 3F57A 2CU7A 1ZHCA 3AG1H 2E1PA 1Y56A 2LBFB 3UU3A 2LH9A 2HNHA 1UJ4A 1KN6A 1T72A 4L5GA 1YITS 3IBFB 4WCGA 3NGUA 4P0BA 3S6EA 3U78A 5JUMA 1LWEB 2LF7A 1IZ1A 1JKHA 2NXEA 3PU8A 2I8DA 3A12A 3R5GA 3UNGC 3R0AA 2DA7A 2KISA 5LMNJ 4DV2J 1QNTA 1VS3A 3PRBA 3N05A 2C0SA 3IM8A 1X31C 5GPCA 1WI9A 4UTGA 4OFZA 1VK3A 3Q8UA 5JRCB 1MROA 1U45A 2KRHA 2DMNA 2XI3A 2BY1A 5CJ9A 3KWMA 3FIWA 4TLQA 5HXSA 4BACA 4IDKA 3G73A 4BGDA 2DRDA 3Q0WA 2PFBA 4N7TA 2LXFA 5A8WA 3COAC 2IYGA 5GTIC 4ICLB 1DTTB 3CT9A 3D9BA 3G6ES 3GFZA 5E17F 1AT1B 5L3BB 4ED4A 2LXIA 4USTA 1FK9B 1E6YB 2QA4G 3H7HB 1S77D 4LITA 1YW9A 3BR6A 4HYKA 3ABVA 3PV0F 1OQYA 4I7HA 5ETMA 2OIHA 2C42A 4HDUA 4BE1A 3VGTA 1GH8A 2YWWA 4FS1A 1S29A 4JUYA 4UF0B 3P45B 2HVHA 2FBKA 1FDNA 2MHEA 1BI3A 3R8YA 5J40A 2LEBA 1RR7A 2CRLA 3C19A 4WW0A 3OLAA 3HVRA 2PI5A 1BR0A 1OMSA 3C18A 3R2DJ 3MM8A 3LTOA 4F0KA 3RX6A 2Z99A 4M3EA 2WONA 4DJAA 1IBLT 3HB9A 4FPIA 5A1LA 1SVDA 4R1HA 1RETA 2AX0A 2P0WA 2MTLA 2AGPA 2CW7A 3MKYB 1W0BA 3I0RB 1MIYA 2KVIA 4DR7T 1JKQC 4KO0A 4J90A 3J7AY 4TQRA 5HN0A 2VJUA 2LM2A 1KU7A 3TLTA 3Q83A 4J2CA 4H9NC 4FETA 2AO9A 2L01A 2XWXA 2COMA 2GNKA 1I6HJ 2RKHA 4ILCA 3RI4A 3I55S 2TCTA 4ES1A 4A5XA 5HCJA 3LK42 2X67A 3HL2A 1X8DA 2FJAA 2B7EA 4KGZB 4NLWA 1CPZA 1HG5A 3OTOF 1K0TA 1GQEA 2NSCA 3WZ0A 2Y0MA 2XAFB 2AGOA 5B0CA 4IF4A 3PFEA 1B1BA 3RIUA 2G9OA 1DFDA 3W6KB 2Z9OA 1B7FA 3T5XA 3EUKL 3KK2A 1U48A 3BTLA 4IL9A 3NWGA 4E70A 5D0GA 4J9NA 2OV9A 5CVVA 4JYAT 2DW4A 2R9LA 4DR2F 2M67A 4ITVA 1HS7A 2VKEA 3K89A 2VQCA 1UG0A 1SC6A 5GAEJ 2WVCA 2V8PA 2K5CA 1KYZA 3CC7S 1FDBA 1S5ZA 5A0YB 4QBUA 2KYXA 5LNKA 1S7OA 5F8NA 3UW1A 4M3GA 2Q1LA 4LQ9A 2DMQA 2XY5A 1J59A 3SZTA 3MDFA 1BW5A 4MIBA 4IDZA 1JLCA 3QGHA 5J2QA 1US7B 4UEMA 3HXLA 2WADA 2BE7D 1LEBA 3QQAA 2XEXA 3ECOA 4WU3A 2V5HG 4MFEA 4UVAB 4EZ4A 4ED1A 2MABA 4FISA 2OTLI 4KHPT 4I68A 4WBFA 3MM6A 4PXEA 3MZHA 3J7ZT 1ZBTA 1R4MB 4JEUB 3AE2A 3K5NA 2FRHA 5LGNB 1J5WA 5HJYA 2E1MC 3OVSA 4Q25A 2ATLA 2HFHA 4RGUA 2C2RA 4DUYT 4P1WA 5FLXK 3A0HC 3A8YC 3CVRA 2LLKA 4OZLA 3M6UA 2C1EB 3DBHB 5ADXL 4BBYA 5KK1A 5D15A 4GK0E 1NKCA 3JTHA 2X1GA 2QM3A 5L3FA 1K4TA 1IDZA 3H1CA 3P5TL 5AQHB 5E3QA 3OXFA 5BMVE 1T0FC 1NPKA 3K59A 5AXLA 5GMEA 4YTMA 5C4JJ 3OIQA 2BY2A 5EG0B 4MFRA 3RSNA 1S1WB 3D4JA 3LP1B 3DLEB 1XD7A 4G12A 2FSWA 1TQPA 5KT4A 2K85A 2B1EA 2HGNA 1W7WA 4KDPA 1YK9A 3UD4P 5K8MA 4UY85 3C7JA 3DTKA 3FMSA 2APOA 3DRRA 4NA1A 4DUZF 4KR0B 1IKXB 2QMWA 2DD8S 3TP0A 1TTYA 4JI2J 2UXBJ 3UQ7A 2PG8A 1OQ3A 3QPHA 5JVHQ 2ESHA 1G3WA 1XG1A 4XRSG 1AFJA 4EEDA 1RTIA 4NLTA 2JA6J 4H63H 4YB7A 3DFGA 1W9RA 2MJNA 4IHJE 1TC3C 1F1BB 2XO7A 1WCRA 2EHOD 4HQEA 2BM0A 4I76A 1EB0A 3T19A 2K3FA 1U26A 1CJUA 4NLGA 3HKWA 4NLSA 2IAJA 4WIQA 2XMAA 2X6WA 1WI6A 1ZN2A 2O61A 4IIJE 4B3RT 3RU0A 4CNZA 2UP1A 2R2TA 5FO5A 3IBPA 3F8FA 4URGA 2WU5A 4ZZLA 3D1QA 4H4MB 2BVLA 2I10A 4ECUA 3WTWC 1T08B 1V5FA 1M1GA 4WZQA 1RESA 4K0KF 1S9EB 1FBSA 4D7MA 1YRNB 3HCXA 3PIOQ 4K4UA 4FX4A 4LVNP 2YKMA 4AM3A 4MIAA 3DKXA 4PRFA 2A3JA 5DLFA 4DF4A 5CH7B 2DGWA 1K6OA 2ZITA 1X4HA 4DEZA 3FCWA 4B3MJ 5ETNA 3BT9A 3MZIA 4L3KA 4AISA 3FSYA 1KSPA 4EYHB 2A10A 3JAFA 3J7ZI 2Z56B 3OS2A 4A5NA 3JB9k 4KC5A 4CNYA 4CT9A 3T6BA 2FEZA 4UZBA 2DNOA 3K2YA 3U1NA 3FXEB 4O4HE 3KLGB 3QC9A 4CCKA 3NGRA 1YGYA 3EJMA 3OYXA 4DR4T 3UD3P 3DPTA 4DR1T 3J7Yq 2ZM8A 3ZNUA 3SYZA 5HMXA 5KFSA 1S0MA 4LRFA 4IPAA 2HGCA 2YPRA 2KDOA 2LP4A 1IW7F 2PBIA 1MU2B 2DJWA 3OLBA 1PCAA 3VDXA 4NIQA 5HROB 3G71S 3C4XA 1N25A 2HK2A 2WOMB 3NS6A 1XSXA 2ISYA 1D3WA 4CO0A 3W3CA 4QWEA 1LNQA 3MMBB 2UWMA 2CQ3A 4X65J 4HF1A 2ZM6T 1IKWA 2XM3A 4F2SA 1U9NA 3RPUD 4C8ZA 2A69F 2WY7Q 5AQIB 1ZR2A 2XTLA 2EI5A 2MSTA 3BSCA 3R7SB 1ZPVA 3PRDA 4BYYA 4UVCA 1N5YB 1CJTB 3KTQA 2VT2A 2X1CA 4LRCA 3J80Y 1HQUA 5CQEA 3OPKA 5KG5A 3G9CA 1RAEB 1V5EA 1BC6A 4JI4J 1PDNC 3IHRA 3PYGA 2GS8A 3BWGA 4OX6A 4WTYA 4L76A 3LJCA 3WAKA 1IJEB 2Y2ZA 4HAMA 4ZVEA 3SFEA 3PTRB 3CPWR 4PUOB 2EZIA 7FDRA 3CLOA 4DV4T 1XZYA 5D6FA 3SQNA 2NPIA 1RIOH 4IOCQ 1XDUA 3FEYB 3CCVI 1RLCL 3GWCA 3PO3J 1S1XA 2VA3A 2HPMA 3ZQIA 4CIOA 2GA1A 2HQRA 2CV2A 2DXEA 4M6VA 1HWKA 3TOQA 4D5CA 1T05B 4V19K 3NBPA 1PUFB 3C6TA 2OCEA 3KZZA 3B13A 1RT4B 3ZMZA 3TRGA 4ED0A 4J9OA 3M1CA 2GOMA 3N6MA 2NVUB 2M3AA 3I6PA 4RAYA 2QENA 3ZLIA 2V1NA 4ZYGA 2BOPA 1O7LA 3ML6A 5HP1B 3IH4A 3WC2A 1SUMB 3FK6A 1SQFA 4NEZA 4TN2A 2OAUA 2V26A 4G1IA 3KK1A 1S6PA 2WAQN 3SYTA 3RJPA 2W7AA 4RU9A 5BOXA 2MOZA 4JUZA 1NAQA 3CCRI 4Y2CA 2E1AA 4DV5T 4XRFA 4DQRA 2B0LA 2HNYB 3EGZA 2R8IA 4TY9A 1TMJA 2GA2A 3L7OA 2IS4A 5DZ7A 3KYDB 4QX8B 3FKJA 3I59B 5AE2A 1KDNA 3P9IA 5KHDA 4KGMA 2EA2A 3AE9A 2NWBA 3F3XA 2GLOA 2DO7A 1WH5A 1XNRT 4HFCA 4PWUA 4C8KA 4DV3T 4MIWA 5E1WA 4DR6F 3HBLA 2X1DA 1AB8A 5J2UE 3ELKA 2OU2A 3AA7B 1VRTB 2KDZA 2A3SA 2BZTA 2YNHA 2H6BA 3ZQGA 1DTQA 2X1BA 3I0QA 1WF2A 3HM9A 4BWMA 3JAEA 5HXCA 5ABGA 3CC4I 3MMCA 3O4XE 1T03A 5IV4A 2WVFA 4ZPDA 4JI2F 4NC8A 3MMJA 3M8QB 4PGGA 3ZN1A 3P96A 1Q8IA 1K73T 1RCOB 2A6HF 5KT6A 1GT0C 2MZQA 3C2BA 4XLCA 3LAMA 2R7QA 3ZMSA 5IZHA 5J47A 2VI6A 4F91B 3W2VB 1OPIA 2F2EA 2KIUA 1JKRC 2G0IA 1HKAA 1NAFA 4A6DA 4KN7X 2RDDA 3GLLA 2WZHA 2LEPA 1S1TA 3QSIA 3W5YA 3MEKA 4E7IA 4IXAA 3IEEA 4X4QA 3CJQA 3RB3A 4HDHA 2BXJA 3IG1B 2IRUA 5DS9A 2PMUA 3K2ZA 5LBMA 4Y2IA 2QRRA 2YS9A 3KEOA 2DHHA 4NMLA 5EGYA 1LK5A 3LP0A 4E2FB 3H92A 2RRBA 4XLHA 3LSPA 4X66J 4O4IE 4XR6A 3ASNH 2CPJA 4ECSA 4KA4A 2W8KA 3LK2B 4EBDA 4RAGA 4U95A 2KXHA 2NXCA 4MK8A 3G1LA 5H6RA 4RW7B 1I5OB 1ROFA 4HNTA 2VQLA 2RHSB 4B6XA 2B6AB 2MPUA 2LQ8A 3MAQA 1SD5A 2J1DG 2E9ZA 4X4PA 3PR5B 3SWHA 2E29A 3RTVA 4U72A 2ZO4A 1JLAA 5FMNA 3T8OA 4NE9C 1HWJA 3ZTPA 5B5EC 2I2YA 2PJQA 4PYDA 1HQCA 4M8LA 5KFTA 5KAKA 2E71A 3ZO7A 1XS9A 4PSXA 1QZZA 2PT0A 5DM6F 1FJGT 1FNNA 5KG1A 3L7UA 3DOLB 2CPHA 2D1HA 4EK2A 4R8UB 1U6FA 3GZ6A 1BY9A 4FYYB 3KJVA 1FEHA 1ZRFA 4NXMF 1WC6A 4FVCA 3ABKH 4LGWA 4HTIA 4D3HA 4OHWA 4C7QA 5LRSA 2DMUA 3OIOA 1HNIB 1YQ3A 3IRQA 4ILUA 2XC9A 3S1MJ 4HFBA 2FDNA 1FOKA 2I6HA 2SPCA 3EGVA 4KGVB 3OFFA 3EICA 1OCOH 1F3FA 5DUKA 1HNZJ 1LXJA 2XQCA 1YS6A 4QKNA 5L3DA 2OLTA 2W2QP 2BW3A 3K10A 3FZHB 5EK3A 1XIQA 1R8IA 4OV1A 3OL9A 2X51A 3TOAA 4H63V 1S12A 4IOAF 5HEJA 5KFZA 2C5JA 2R8JA 4M94A 3K4BA 1OCCH 2XY6A 4KKOA 3NWRA 1BIBA 3EUAA 4AVPA 1FYMA 4WF9Q 3GFHA 4IE5A 3FBIB 4C3HJ 3S3OA 2CPFA 3R61A 4BHPA 1TP4A 3E97A 1IDYA 1LV5A 2XAHA 3OYZA 2P5LC 2WSFC 2RREA 5F8PA 1UELB 4HOBA 3CIMA 2NOXA 2TDXA 5I3UA 2NS0A 2QTWA 4GCVA 2QGUA 3OTEA 4ES3A 1NJYA 4ZVFA 2H3EB 3GFIA 2CPIA 4RB1A 2HMIA 4AQFC 3TLVA 4IR1A 4MO7A 2XJ7A 3LGHA 2ZLYA 1N32J 4B9TA 2ZJRF 2V8SV 2DA6A 2BBYA 3OYDA 3W61A 2ZJ2A 4QWBA 1NB7A 3G2XA 4IL4A 5A8RA 3DOMB 4RNNA 1POGA 1T0FA 3D3BJ 4J9MA 3NLCA 2R6GF 4AQYT 3H3ZA 2BHYA 2GQCA 2XMKA 4BJ6C 1SMYF 5J1YA 2LSKA 3DDIA 4ED8A 4DMVA 4HHJA 2F4IA 1FA0A 5IM0B 2B56A 5HJXA 1TFYA 4PGHA 3TZZA 4BXFA 4ED5A 2L4MA 5LBQB 3I9V9 3CD5A 1RT3A 2P9EA 3V5UA 4F8HA 1HBNB 2HHSA 2W0GA 5L39A 4B3OA 3F8NA 1Y1VJ 2M5WA 2VE8A 3SQOP 3W65A 2MHNA 4B8XA 4EIWA 2QSFA 4RJVA 2Y1LB 1SKSA 2VZ9A 1USTA 2GVZA 2A6TA 5HATA 5JDFA 2PEXA 4ENJA 1OJLA 2D1CA 2BBEA 2QQ9A 2C6YA 1TL4A 5CYMA 2Q6BA 4LIUA 3AFGA 4HVZA 1D8YA 2PI0A 4FYDA 5LXTE 4GVLA 4EXTA 2XMJA 2YWFA 3D1HA 2P81A 2EFQA 4CO1A 4AL5A 5F5WA 1TWAJ 5D8KB 2MLZA 5BYRA 3AAAB 1KEYA 2DR8A 5L3GB 1IR0A 2ZC4A 5CZVA 2X9DA 1KK7A 1TL1A 4WP8A 1FWKA 2DPDA 3V5RA 2YNIB 1YX5A 4M5HA 1U49A 1QZEA 1FYLA 4LFAJ 4KFBA 3WHBA 3IL2A 3BJOA 3AE4A 4RBOA 3KG4A 2RHQB 2X0YA 2PE8A 2CVEA 2A61A 3AE3A 3VR8A 3EVOA 3LO3A 3I3LA 2IP2A 3J81Z 3JRCA 4P73A 1L5UA 2ZNZA 3SBMA 1L3UA 1C0UA 1I94J 2VE9A 3ZZOA 4L9VA 5J8CA 4BQAA 1N78A 4YSYA 5HEOA 4X4NA 3ZMVB 3WTXC 4C2MJ 1O6XA 3TLWA 2IBDA 4EGLA 3A01A 1VRQC 3BH6B 1R0AB 2Q2EB 3ZJ1A 3MEXA 1JLQB 2M5YA 4JV2A 3WGIA 3D68A 3CCQS 1ZTWA 4OJHA 1QAJA 3UUMA 3SFDA 1HNVB 4OMYA 4PSWA 2HFNA 3R2CJ 1YW0A 2ZOGA 3HRMA 2XS2A 1FRHA 2WDVA 5EZHA 4BQQA 4IL6C 3RGLA 3BG5A 4M9SA 1NSQA 2XLIA 2CWEA 3H0PA 5L8RC 3W64A 3E01A 1FFWB 5C25A 4IZZA 3E0JB 4KMCA 1K44A 2ZC2A 2VFSA 2RSQA 4I64A 4P09A 1TUVA 3GCXP 2QFIA 2IRXA 2CDRB 2VKDA 2OPPB 4NUUA 2L3LA 4V1Av 3N97A 2X1AA 1LOUA 3MM9B 2MZSA 1U6GA 3L95X 5EUHA 1IM6A 3WTUC 3CMEI 3PUWF 4ECVA 4KI0F 5ERIA 5H9FK 1XMXA 2KSRA 1TL3B 2LRKA 1WC1A 5A2QZ 4XORA 3QOFA 1B0VA 2TRTA 4IHXA 4OX8A 5IT9Y 2HHWA 2M3DA 4Q7AA 1E6VA 4HT5A 1T2KA 4QR0A 2DLLA 4DR5J 4DQIA 2DCUB 2IC3A 4MMOA 3F0NA 2Q1ZB 2E8IA 2ZFUA 4JBAA 1FD2A 2L9DA 5I3PA 3VAJA 3BTJA 2FXAA 2UXNB 2B5JA 2CNKB 3IC7A 3M8PB 2ADUA 2JJ4D 4ZS3A 5EF6A 2XY7A 1RAHB 1HQ2A 1RK8A 4OZNA 5F3ZA 5G0RA 2PO4A 3HLUA 2KU7A 2G7HA 3RYRA 4J9UE 5ED4A 4ZOLE 4NZ7A 2FQQB 3D6TB 4C11B 1T0TV 2NZ4A 4LREA 2RD5C 4K5SA 4NCBA 2JNJA 4JV5J 4RM2A 2VG5A 3SI8A 2NRAC 1RCXB 1HNZF 3JTPA 2LP0A 3O6QA 5J2PA 3M2UB 2CBJA 3P7IA 3R5CA 1SL0A 3EDRB 1U47A 2KL8A 3HSFA 2FJDA 3ZZYA 3TAMA 3KZYA 3O3LA 2HLTA 4I2QA 4KGKA 1RZMA 3SCIE 2HYIB 2W7OA 1DRZA 5DV5A 3T8RA 5FXWA 1HNXT 3EZOA 1TNSA 2NVYJ 3AE7A 1YRUA 3VR1A 3BZ6A 4ZP6A 5L1IA 2E9RX 3VRBA 3LSVA 4ENKA 1SKWA 1RUSA 2BG9B 3BROA 3C3WA 3OVBA 4DYCA 4ZPCA 4RGRA 4LVOP 4OHFA 1N33J 3TVKA 1R00A 3NWTA 2L7MP 3QPSA 4BQNA 1FWZA 1KFYA 3E0ZA 4WNKA 3CMYA 3EXYA 5J2NB 2KWIB 2Z30B 4UUWA 1N88A 4DL0C 4F50A 2OZUA 2CUYA 2H1YA 5KFGA 4RLEA 1FRKA 2J4GA 4A3GJ 3I9V2 2IGNA 5J4YA 2QGFB 4G6TB 3O2IA 3HT0A 4B9LA 4I6WA 3GWHA 2FZKB 4F4XA 3C15A 1OY6A 3FXMA 4B09A 1AROP 4TWHA 1IJ5A 2K86A 3GMGA 3OL4A 3P8BB 4Z2YA 4LF2A 5FLXU 4A0XA 1X5OA 1JT6A 3RF1A 3JSPA 3VGSA 3H36A 4A12A 4LF7F 2CG4A 1KOHA 1ZS6A 2BBHA 3CDEA 1DLOA 4E7SA 2QSFX 4EATA 4O4GA 3NP5A 3HSRA 1Z7UA 2GXBA 3MM5B 1TT5B 2WZ1A 2E2JJ 4IFVA 1Q78A 3L2VA 3HC7A 2IA1A 5DRKA 4W97A 2KRCA 1W0AA 1QD1A 1P8GA 3ZQ7A 1NB2A 2XBPA 2DR5A 3PUVF 2M9HA 3KLHA 2VOPA 3U1DA 4O2AE 2V94A 4IJAA 1UVKA 4NLVA 1IN0A 2BX6A 2O5RA 4YSXA 1HYSA 3K4NA 2ZC3A 3FM3A 3J7Z5 2VN2A 4CYCA 1IBLJ 2G0UA 2YU9J 2JRMA 1S57A 1QVUA 3K0LA 2YQ1A 1BC7C 4MYUA 4PG8A 3RCOA 3QT8A 1JUSA 1Y10A 3D54A 2DYSH 2HDWA 3L2QA 4DR7J 2H7VC 2PTFA 4UQGA 4DX7A 1VI0A 2HNZA 3MCZA 3G06A 1NDCA 2X1EA 1RTHA 1DURA 4PR6A 3KV6A 5HMZA 5GPAA 4N78D 4B3SJ 2LMDA 2DXDA 4O23A 2X0LB 3BGFA 4G7ZF 1U1RA 5LLQA 5M4YA 1YI2I 3FMBA 4QJVA 1UWAA 2PG4A 1KU2A 2DHXA 3OWTA 2I0MA 2CPXA 2M4MA 1MROB 8AT1B 3CCUI 2FBIA 3RZAA 3JC6D 1I94F 2XNRA 2PJPA 3EPGA 3L3CA 4DJBA 1U3EM 2CRBA 4IDKB 3L2UA 3VALA 2FNAA 1D0YA 3RLFF 3PUFA 3OPCA 1J2XA 4JYAJ 3SRZA 3M07A 2JJ7A 1AUDA 1TP7A 5IWAF 4DBRA 5HVHA 5IP7J 1XTAA 2HDCA 1Q82T 5A8WB 4IE4A 4OIXA 3V8LA 2LNBA 4EVIA 2AZ1A 1OCRH 3I1AA 2FLNA 1IO2A 4QU7A 2AGQA 2F5GA 3UNYA 2B3TB 2R4GA 2Q9QC 2HPJA 4YB1P 3QRPA 3HO1A 3CCJS 1IBMJ 4OZ0A 1NK2P 1TWGJ 2DXFA 2BV6A 2H27A 4C0HA 3KK3B 5EEAA 3FEXB 2LOPA 2OPQB 3L9ZA 2XF6A 1YHQI 4WXDA 4ZCMA 3HT3A 1KEKA 3GO5A 4C30A 1H8AC 1T3OA 3PJ9A 4ID8A 4FNHA 3QWPA 3CMMA 4F4AA 2MKIA 2M6BA 1BQMA 3GF2A 1IXSB 1U1PA 1BD6A 4A2UA 1WTFA 2R5YA 2IYIA 4DUYJ 3JAMY 2CKWA 4E0DA 1H6KX 4BJTA 3MZ8A 5EJCA 1KU3A 5K5OA 1DGRM 3M7VA 3VHQA 2XQ6A 1IXCA 2LQJA 3WAJA 4AIUA 3UUXB 2M9KA 2X4HA 2Y1IA 2D74B 2LA4A 1VQ8S 1UW4A 2KXPB 4KO0B 1MJ9A 2WC2A 1SHZC 1CF7B 1UEVA 2CQNA 1NWMX 3WHIA 1Y0UA 1TWFJ 3CD6I 5D3GB 5DQVA 2WCXA 2ZHBA 1F60B 2NTYA 4CLLA 2CO5A 3WX8A 2D5UA 2DQRA 3K4JA 5HEHA 3FF5A 5LMUT 3MWMA 4TV8E 4AKIA 1AHDP 1EHWA 1FIOA 3QPTA 3ZXSA 2ZFHA 3PNYA 5C2CA 2FJAB 2JVHA 2AQ4A 2EHOC 4AQFA 2JT1A 2OA5A 4OZ2A 2RNJA 2VPRA 5SZTA 5LCYA 2XYHB 3HD2A 4BCAA 4RB3C 1EH6A 4GKJT 1FI4A 2H4YB 1R6RA 4YXDA 2ASDA 3O9XA 1ZOTA 3KK2B 1K7AA 2YX7A 2JSCA 4DPXA 5JI6A 3OR2C 1PVEA 3HD1A 4HDGA 2HBRB 1HPZA 1VQMI 3LSJA 1GV5A 2BE2A 1D9DA 1ODDA 1T56A 2HURA 4QIWN 5M5WJ 1VQ9S 2LY2A 4GK5E 4MTEA 1FNMA 1U2RA 3IP0A 4FN5A 4LG0A 4M73A 5DJQC 2HQ3A 3F9KA 1J2VA 4B3RJ 1HF8A 1FBQA 3HJFA 1EJ9A 1HBUA 3G8SA 1I39A 3US5A 3VGUA 1JLCB 5J2QB 1WZ2A 2UUAT 5ICGA 2HHHF 2Q6CA 2CM0A 5K14B 3HHNB 1UVMA 1A35A 2LREA 4G6VB 2LG4A 1T7SA 4BEHB 3D66A 4ZVOB 1U5TC 4DV0J 3U2RA 2WB5A 1WJEA 4YR2A 3NEKA 4N0BA 4QSHA 3ZT5A 4JK1X 1KVKA 1UX4A 1WYCA 1WLXA 1J5OB 3HTSB 5CVUA 4YFNF 1W0UA 1QAXA 3HVTA 3QYEA 5AE1A 2GW8A 3VAMA 1UURA 5AJ3F 2DLRA 5L3FB 4BHBA 3JSBA 5CJ5A 2R7RA 4USJC 1S7AA 4OI2A 4YN3B 1YJ9S 5HEGA 1KVIA 5F0FA 1R89A 4URQU 2HQNA 1VQOI 3ZZUA 4XMYA 4DR4J 1ZETA 3PUYF 3SDBA 1RUNA 4DR1J 1M5OC 3K58A 5E8IA 4RU2A 1E1HB 3BDDA 1FY7A 1Z2LA 4QPOA 3GTKJ 1YBAA 3HZEA 2JUCA 1WRDA 5EHHA 1WJ5A 3DRRB 4A8XA 4F02A 5BYSA 1G3TA 4JQFA 2MC3A 2XCPA 2V34A 1X58A 4DFJA 2L7ZA 3T8TA 1E3OC 3DLKA 3TW7A 1U2FA 1H3DA 2XQAA 1RHQB 1V54H 1ZLKA 2K3KA 2IVYA 1R58A 2FVPA 3SSSA 1WF1A 4DR7F 2ZM6J 4F55A 2RAQA 1Z67A 3U9GA 1XNQT 4QCLA 1SKRA 2DYAA 2AEFA 4OYOA 2RKIA 1RHJB 2H6CA 4AYBA 1RA6A 4HGAA 3I56I 4RM3A 4MAKA 4KBIA 2H89A 2IAJB 1LUJB 3HULA 4CRJA 3C2GA 3NAUA 3V8KA 2OUGA 1QE1B 2JVRA 3C14A 2ETHA 2VFUA 3JS9A 4OI1A 5GADJ 3MFIA 2GIZA 1X1AA 1QSSA 5KFLA 5HAOA 3PDNA 1R3NA 2A2FX 4GXOA 4HI1A 2QKLB 1OS5A 4B47A 3RW6A 5F27A 5AONA 4DV4J 1B8IA 3CDLA 3K9TA 1O3XA 2YKMB 5C44J 1BBYA 3AEFA 1VJWA 4JYAF 5FJ8J 2F5FA 4BS2A 1Y8RB 3REOA 2QG9B 1UEKA 4DV7T 3FXOA 2VJ5A 4I01A 1FCAA 1X4PA 1LFBA 1D3YA 4MIMA 1P9YA 3EGNA 4Y00A 4DX6A 1QSDA 3FQLA 2CA5A 3OYKA 2E5VA 2YKOA 3R5AA 5E7OB 4X0GA 4ECXA 3KP6A 3S2WA 3GG1A 3IS9A 3LPYA 4O2BE 3UN2A 1U8SA 4LR9A 1RWMB 3K8WA 4FJOA 1KQ0A 4DCPB 4U74A 2X6XA 3F41A 4XKCA 4L9TA 1KQFB 3R0JA 4IYQA 2C2EA 2WVEA 2LJLA 1X2MA 4JI1T 1IUFA 4EM1A 4Y4RA 4K4TA 3TEHB 4N56A 5THWA 4O44A 4KHPF 2LDUA 2ZH9A 2DMTA 1W2IA 1S1UB 2GHPA 2QA7A 2R7FA 4JX4A 2FVCA 2FQ4A 1TKTA 4ZP9A 1GLNA 1S3JA 3MMYB 2E35A 1R22A 1U5PA 1GX6A 3AECA 3ZQLA 3GR0A 2BY3A 3EVYA 4DV5J 3P4UB 3WI3A 2GZOA 4HFEA 3K4KA 4DUYF 2DEJA 5KG4A 4LR8A 1YIOA 2V6CA 4KJIA