3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
molecule keywords Putative transcriptional regulator
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
4AVPA 4O5VA 1FYLA 1T0FA 4G7HF 2P7CB 3IKVA 3W6KB 3I53A 1WWXA 4CYDA 1Z91A 5ILUA 5IT9Z 1L3LA 3RYRA 5D6EA 5D8LB 2OQRA 4HX8A 3WTVC 2XAFA 5D6FA 4Y13A 4FHTA 1OYYA 1OPCA 2HQRA 4KA4A 2Y0MA 1QBJA 4UVBA 3V7SA 1YTYA 3QPTA 5HS7A 3QOPA 2NRAC 4JBAA 2FE3A 5CJ9A 1JGSA 5DUKA 4DQ2A 2KJBA 3GO5A 4MQ9F 2A6HF 2FA5A 4OIRF 3GW2A 1ZG5A 4P55A 5BMZA 2XVCA 1TQIA 3HRMA 2FSWA 1ULYA 2W24A 1Z9CA 1T6SA 4R79A 3K1MA 2KKOA 5CVIA 3TGNA 4ENNA 2VT2A 5AONA 2STWA 1ZHFA 1ZAOA 4QWQA 2L4MA 4HYEA 1ZG3A 3CO7C 3FHZA 1FBUA 4HV6A 1SAXA 3HOSA 3E5XA 2HFHA 4NHJA 1YW7A 2X0LA 3KP5A 3D0SA 1LB2A 4MTEA 3LAJA 2ZNYA 2IT0A 5LGUA 4HF2A 1Z6RA 2FBIA 4HBLA 5BQTA 2HWVA 5DEQA 1OR7A 3ZPLA 3HYIA 5D4RA 2BYVE 5HVQC 2X4HA 3L00A 3K0LA 2GWRA 2VBZA 2CFXA 2H27A 3MZYA 3KP6A 3RKXA 1ZGJA 3VEPA 1LNWA 5E1ZB 4WCGA 3ZMUA 1XGOA 4Q47A 3FMQA 5F6FA 1TNSA 4QLCU 3ECOA 4PDKA 2FMYA 4HF0A 1R58A 4CDGA 4U88A 1QZYA 5ILSA 1KYWA 1HSJA 3FXUA 3F8FA 2F2EA 4A5NA 4M9ZA 4EJWA 2FF4A 1YS6A 3BP8A 3H3ZA 2M1BA 1KGSA 4IRGA 2W85A 1WKMA 4WWCA 1MD0A 1R00A 1ZH5A 2F5DA 1J7KA 4EM2A 4HQEA 1O3RA 3JSPA 2H6CA 2A61A 2NYXA 1OMIA 2V9VA 4G94A 4UUVA 4XLPF 4JK1X 3E6DA 2QENA 3TO6A 4AIJA 1D8JA 4AIKA 3QU6A 3QP5A 5ICCA 1F1ZA 1T38A 1J59A 3J7AO 2EV5A 1G3SA 4NQWA 1IUYA 3ZN1A 1HW2A 2ESNA 1TLHB 1K79A 1O57A 1RIOH 3IL2A 3REOA 3ZMSA 3IKTA 2YX7A 4ZYHA 5ICEA 1BC7C 1WSUA 4MEXF 2Z3YA 3LAPA 5ILVA 3KP2A 4L18B 3CLOA 5D8KB 3V4GA 2MH2A 2OZUA 2IA2A 3WG9A 2DLLA 5HLHA 2MH9A 1TNTA 2QQ9A 2XGXA 2KRFA 1TTYA 4I2OA 1IN5A 2MBFA 2EFOA 2XAHA 3Q5FA 1IAWA 2DFIA 4ZH4F 4BNCA 4BQAA 1P4XA 3K2ZA 4PCQA 4YG2F 1FT9A 3HSFA 3KZYA 2HS5A 4I0AA 5EEHA 1W7PD 5LGNA 3DQVC 3U1DA 3J80K 4CO8A 5LLQA 1H9GA 3KCCA 3DF8A 5K5OA 4L0ZB 2ETHA 4M9XA 5AIQA 2EB7A 4OIPF 2DW4A 4WK8F 2XAGA 4LG0A 1P6RA 2O61A 5LGTA 2R3SA 4HW0A 3U9GA 5L3BA 2M45A 4HDUA 1IRFA 4BHPA 1UB9A 4ETSA 5D4SA 4KIGA 5DD4A 1OYWA 1YS7A 1R5GA 3IHUA 2K7LA 4UXNA 2CO5A 4LK1F 3I4PA 1STZA 2HTSA 2XIGA 2E1CA 3PQKA 2M5WA 2ZMEA 3PQJA 4AIHA 1DUXC 4PZJA 2VE9A 3IWZA 5FO5A 2VONA 3ZN0A 5J6XA 2IJLA 2GA2A 3M9AA 1F5TA 3JSOA 1QPMA 3ML6A 2RN7A 1W7PA 3ZQ7A 2RQPA 1USTA 1ONVA 1WI9A 3EQLF 3Q9VA 2H09A 3ZMZA 3WTZA 1RZ4A 1I5ZA 3TO7A 2VN2A 4BH9A 2W57A 3N97A 1CF7A 3HUGA 2DPUA 1KU7A 2ISYA 5JHUA 1WRJA 1XGNA 1KQ8A 2P5KA 2L4AA 4U7BA 1SFEA 1U5TA 1YLFA 1P2FA 2LDUA 1ZN2A 3LA7A 3SZTA 2J5PA 2DU9A 3COAC 3V7CA 2PI0A 4BXUA 1GXPA 3BJOA 2PQ8A 2Z5UA 2W25A 4L9VA 1ZG1A 2JPCA 1ZRFA 5JI6A 5K5QA 3DXJF 4LB5A 4A6EA 1HSTA 5D5WB 4HLXA 3C7JA 4KIBA 2H94A 4R8HA 4YFKF 3RKWA 3IRQA 5E18F 5CYVA 3N4MA 1YG2A 3WGIA 2VXZA 3SFZA 1REPC 2WV0A 4RB3C 3SZPA 2Q8KA 3DP7A 1S29A 3KE2A 3F8NA 4G7ZF 4TV7A 4MQVA 4WF2A 1KA8A 1HKTA 1MJAA 2MC3A 5J8FA 2XAQA 5E1WA 5A2QK 2HZTA 4OIOF 2O3FA 4IRIA 3R0JA 1J2XA 1R22A 3M8FA 5LHIA 5CVJA 5F1RA 4LK0F 5L3EA 3FF5A 5TRDA 1X3UA 2DO7A 1QQIA 3P9CA 2V6CA 2WTEA 3ULQB 3J81K 4FT8A 5E17F 4ESJA 2Y75A 3J80Z 1YYVA 4M6YA 2V1DA 2P6TA 3KZZA 4YIIA 4G9YA 1GVJA 1Z6TA 1FZPB 3K9TA 3F8CA 2NNNA 2G7UA 2GQQA 4MHGA 2GA1A 2CSOA 4I09A 2XAJA 3WTUC 3QPHA 3F8MA 2YPRA 5E20A 1ZGAA 4UVAA 1U3EM 5CVRA 3RI4A 4ENKA 3HSRA 3JAMZ 2D1HA 1IN7A 1PUEE 3GWZA 2HOEA 2QWWA 2K86A 3TQNA 3GVAA 5E1XA 3F22A 1USSA 4D0PA 2ISZA 2OAZA 4HLYA 1BIAA 1DPRA 1BC8C 2HKXA 4K2EA 2BBYA 1EV7A 1KQ9A 3EUHA 3LSTA 4KIFA 4N0BA 3BJAA 4B8XA 2HEOA 4I98B 2A6EF 3CDHA 2ZCWA 3C1DA 5LEJA 3P9IA 2PMHA 1FYMA 3WU1B 3MWMA 4RGUA 1Q1HA 2Y48A 5J8CA 1FSHA 2JSCA 1XSVA 3NQOA 4R1HA 1XGSA 2VBYA 3P7NA 3ZMVA 3F23A 2CW0F 2EA4A 5LHHA 1F9NA 2UWMA 2MLGA 2R7FA 1H9TA 3DKWA 4EJVA 1G6NA 3GF2A 2ZMEB 5EEGA 1BOAA 5ERIA 1ZRCA 2JRTA 4IVNA 5D5UB 3JW4A 1JHFA 2MA3A 5CVUA 1J0RA 2ZKZA 2QLZA 2OBPA 2EFPA 4LJZF 3V8KA 3RIRA 4RB0A 2FBHA 3I5UA 1XMKA 1XB4A 4B09A 2RGVA 1U5TC 5HDGA 2D1VA 3KP3A 1HBXG 4LLNA 5DYMA 4JQFA 1PP7U 2NS0A 1TW3A 5FB2A 2VT3A 1O7LA 1FX7A 2M8EA 4Z2YA 1JHHA 3I59A 4P9FA 1R36A 2QBYB 3WTTC 1W4MA 3WGGA 4UVCA 2E7XA 3MEXA 3L09A 4RGSA 3I54A 5DCMB 3F3XA 1LQ1A 2AS5F 4ESBA 3T0YA 5BOXA 3GFMA 2FEZA 2GXBA 4N9HA 1S7AA 2IW5A 3CUQB 2VOPA 4GXOA 4AD9A 5L3GA 2QZ8A 1FPQA 2E1NA 3ABTA 2UZKA 2JPBA 4HF1A 2XUBA 4KICA 1U8RA 1IW7F 4Q5SF 1U2WA 5HS8A 1P4WA 4I01A 4NB5A 3R60A 1MGTA 2CG4A 1HW1A 3ECHA 4WXDA 2VC0A 4M74A 1KU3A 4A5MA 3BY6A 1SMTA 3QRFF 1IXRC 1P92A 1B4AA 1S8NA 4I0BA 2UXNA 2ZNZA 3KETA 3WGHA 4EQQA 2NNYA 1YW9A 2IA0A 3V8JA 5HDKA 3KLOA 3K1PA 4EVIA 2DK5A 1B6AA 3WTYC 1S6LA 3ZP5A 3E5QA 1T2KA 2P6SA 5BS6A 1YO5C 1F4KA 1XSXA 1IXCA 5LBQA 5LRSA 4RAZA 1T98A 2K27A 5BPIA 3O6BB 1K6OA 3D5LA 2V79A 2XKOA 5E8IA 2HDCA 1SD5A 4ON0A 1HW5A 2EA2A 2BGCA 1D5VA 1YQAA 4M6XA 2IA1A 3R0AA 1KU9A 2XKPA 2KIUA 4XSZF 2BV6A 2QVOA 2O6GE 3E6MA 4KUMA 1HKQA 4YFNF 2FQ3A 2XASA 4HDVA 1SD4A 1RUOA 3W6JB 2STTA 1BM9A 3T8RA 3TDZC 3ERED 3MAJA 1IRGA 1BI0A 1H0MA 3IC7A 3QU3A 2V1XA 4L9TA 4LB6B 1K78B 4LG0B 4M72A 2FOKA 4M73A 1MZBA 5HS9A 3VODA 3FX3A 3RPUA 4MTDA 1Y0UA 3GEZA 3KEQA 4G6QA 4ESFA 1QO0D 1U6GA 3VFZA 2L02A 1I6XA 3LA2A 3E6BA 3L7WA 2CWEA 1T39A 4M71A 2O0YA 2J5OA 2IVMA 1R1VA 3F6OA 2L54A 5ED4A 5LHGA 2EFQA 5FD6A 3BROA 4LFUA 2LNBA 4U0VA 4WXHA 2MLKA 3FXQA 3NRVA 4RGRA 3GYHX 3MFKA 1LDJA 4U0YA 2F5EA 4A0YA 1U78A 3H3UA 5HLGA 3KLNA 1Z1DA 5CLSA 3ISPA 4LLLA 2ADUA 1IN6A 3HTUA 3RDIA 3GLXA 2CYYA 4G6DA 1CF7B 2D2WA 2W84A 4BHBA 4OIQF 4ZZDA 2IPQX 1SD6A 4YIFA 3F72A 1HQCA 2ESHA 3M8EA 1SMYF 3T1BA 5KK1A 2CGPA 4GO1A 1XN7A 2COMA 3BDDA 4AWXB 3SQNA 3JTGA 1V3FA 1IN8A 2RNJA 1LVAA 4L9NA 2GZWA 3JTHA 3E5UA 1BJAA 2VODA 2P4WA 1BI2A 4KFCA 1A04A 2P8TA 3SXYA 2Z33A 2RVCA 2PFBA 4HA8A 4ZYGA 3MQ0A 4A0ZA 4S04A 3F6VA 3KP4A 4RB1A 2EJRA 4GYIA 4MNUA 4S05A 3L2CA 1SFXA 3TO9A 1CGPA 4IPAA 2CQKA 3FWEA 3R61A 1LDKB 2HQNA 1BBYA 3VB2A 4KT5C 2A69F 1FSEA 3ZMDA 5L3DA 2XV4S 3FMSA 2E7WA 2QQAA 2EV6A 4L5IA 2RC4A 2RDPA 1RUNA 4KMFA 1TQPA 4N9IA 2B0LA 1QZZA 4HX4A 3BWGA 1Z05A 5KVRA 2QQBA 1I1SA 2WC2A 3DPTA 4HAMA 1FWZA 2MD5A 5DV5A 4OINF 3QAHA 4L5JA 2PG4A 2ELHA 1BIBA 1MKMA 2PMUA 5HLIA 2A3SA 3K69A 1BI3A 2P7VB 1RI7A 2IP2A 3H92A 4KYWA 4FX4A 3EDPA 2PEXA 2O8XA 3ZMTA 4ZYDA 4EJOA 1UCRA 2HR3A 1ZRDA 5FD5A 4ZZLA 4MGRA 1JXSA 4Y15A 1XDSA 1FYKA 3I64A 4CHUA 3ELKA 3S2WA 2A68F 4CZZA 4XSXF 2G7HA 3WTSC 5DD8A 4A0XA 4BAYA 1S3JA 5HDNA 2DK8A 2JZYA 3WE3A 1XD7A 4KN7X 1JE8A 3VOEA 4EM1A 4Q4ZF 1LDDA 1SD7A 1DP7P 5FLXZ 3L9FA 2F5CA 4P96A 1EH8A 2EFNA 2FU4A 1OKRA 3O2PE 2OD5A 5DCFA 1SFUA 4UHTA 3V7RA 1ON1A 3WTWC 2XRNA 2YSRA 2PN6A 2C6YA 3HHGA 1R1TA 3RJPA 1P4AA 3EYIA 5AIPA 3OOPA 3LWFA 4U0WA 4WXCA 5JVTA 1C0WA 3GFJA 1G3TA 3RYPA 1D3YA 1FBQA 2GAUA 1MDMB 2ACJA 2YR2A 2DBBA 1GHCA 5K1YA 2DTRA 1IN4A 3HIFA 4GCVA 1K78A 1D8KA 2LF7A 3GX4X 2H6BA 4IHSA 4P9UA 5CVVA 4WX9A 3G73A 4CXFA 1FLIA 3F21A 1TBXA 2VBWA 4IHTA 3CUOA 4U7DA 3J81Z 1KQ0A 1WQ2A 3FM5A 2KJCA 3B02A 2PBIA 2GXGA 2WWYA 1V4RA 1LEBA 1G3YA 2VE8A 1J9IA 4RS8A 3WODF 4EJUA 3NEUA 1E17A 3I59B 2K02A 5BPDA 4HQMA 1LEAA 3HHHA 1B9NA 3KP7A 3SHFA 1J5YA 5K5RA 4UV8A 4ENMA 3U2RA 1DPUA 1O3TA 3P9KA 3LQQA 2P5VA 3BOQA 1FP1D 2G9WA 4KN4X 3V8LA 5D5XB 4MEYF 2FMLA 2FBKA 2A5YB 3ABUA 1OYIA 2FNPA 2VBXA 3CUQC 3RPQA 3HRUA 3BZ6A 4EJTA 3MZHA 3QP6A 4CICA 3PFIA 4GYGA 2GIVA 4LLGF 1E2XA 1IXSB 4RGXA 5H6RA 2HYFA 3LFKA 3WTXC 3EYYA 4BHCA 1YFHA 2RKHA 1XCBA 4OU0A 4XRFA 1FY7A 4G8XA 3OV8A 2QUFA 2VOOA 3IWFA 1YIOA 3BPXA 1HXDA 1ZREA 4HOBA 3M1EA 1W5SA 3T5XA 3DFGA 2PLYA 2QBYA 5IT9K 1QGPA 2LKPA 5ICGA 4PGHA 1MJBA 3DV8A 5DCMA 4CGZA 4OMYA 1PDNC 3I0TA 1ZARA 1LJ9A 1TW2A 3HRTA 2DI3A 2ZBKA 3GFLA 4IJAA 3JAMK 3CUQA 2F5FA 3BPVA 6PAXA 3RKYA 2HKOA 4IXAA 2YX4A 4UV9A 1O7FA 1I1GA 1KYZA 2YU3A 2PJPA 1ON2A 4HZFA 1KU2A 2FRHA 1R1UA 3O3KA 5LRRA 3WE2A 3E3VA 2LF8A 5H20A 2BE5F 3HTSB 2OA4A 1FBSA 1R7JA 4A2UA 3TKYA 2EFWA 1O3SA 4H0EA 2P5LC 3KFWX 2ZJ2A 3IRRA 4Y17A 2L01A 4LMYA 5IT3A 4P5OA 3KEOA 1J75A 4M9SA 4I02A 1MDMA 4EM0B 5FLXK 2RV8A 4L0YB 2ZXJA 3I58A 4O6JA 1ODDA 1IZ1A 3RTRA 2FXAA 1ZLKA 2OQGA 2KIFA 3EETA 4RB2C 1GXQA 5LEKA 2BEOA 1RNLA 3MCZA 3GUDA 5L3FA 4KDPA 4IRHA 3WU0A 1UFMA 1FC3A 1FNNA 4HV5A 4PGGA 5FFZA 1U5TB 1ZYRF 2M87A 4LGWA 4FX0A 3C18A 4L9JA 3FXRA 1G4DA 1BN5A 1S7OA 1G3WA 1YW8A 4IF4A 1B9MA 2DQLA 2XHKA 4EGYA 1BI1A 3E97A 3HRSA 5F64A 4OMZA 5L3CA 4ASNA 3TOAA 4DNCA 5E8GA 5HOOA 1I27A 4KNYA 1W7PB 3F8BA 1IF1A 4A6DA 2DPDA 1K7AA 3K1NA 2JT1A 3GZ6A 2UXXA 5FGMA 3E6CC 1EH7A 3TDUC 2IRFG 4RAYA 1O3QA 1B1BA 2HTJA 2Z99A 2NAZA 1ZLJA 3R6SA 3TOBA 1XDUA 5H6QA 3G3ZA 1EH6A 2KIMA 2VC1A 4Q48A 3M7GA 4ENJA 5DDGA 1XSDA 4EV0A 3B73A 2L3DA 2A07F 1TQMA 2M30A 3Q9SA 2K4BA 2R7DA 3R4KA 5JR3A 2DQRA 2EV0A 2EWNA 1XGMA 4YFXF 4E70A 4OOIA 4O3MA 1UHWA 1AOYA 2HYGD 1XMAA 3T8TA 3LA3A 3LQRA 4EMSA 1MJ9A 3C3WA 3FM3A 2V1UA 3GXOA 3HSEA 1PP8F 3AAFA 2QM3A 4XLNF 1UHMA 1W5TA 2JTVA 2LSOA 1R23A 1R5HA 2XROA 1NHAA 1QNTA 3DPLC 4G7OF 5DUIA 1XCVA 4XBFA 2Q2EA 2Z9OA 3HOTA 2EK5A 2Q0OA 3CJNA 4GGGA 3GZ5A 2ZFWA 3FMRA 1Z7UA 2TDXA 4BYYA 2OZ6A 1DDNA 2AXLA 4KMUX 3BJ6A 4LD5A 4ZYEA 2K4JA 2O03A 1FOKA 5JFRA 4EGZA 5A2QZ 4I7HA 3GFIA 1B59A 3CO6C 4HX7A 5FFXA 2HGCA 2DT5A 1L0OC 4A12A 5TJJA 2D45A 3DEUA 1FP2A 2OU2A 5D5VB 2QYOA 4UNOA 3I71A 2DAOA 3CTAA 2ZO4A 2FNAA 3ROUA 4F7ZA 1VTNC 5ICFA 1AWCA 1HKSA 3FZVA
chains in the Genus database with same CATH superfamily
3PTWA 4BWJA 1BW5A 3UDCA 3FBCA 3CMES 2CU7A 2QT7A 2ASLA 3TAQA 2NZ4A 5GAEU 5LD2C 1WWXA 3R97A 2IA6A 4ITSA 1Z91A 3JTPA 5ILUA 5IT9Z 3CJSA 3G4SI 2JSXA 2JWNA 1RT7A 2BJDA 5J4VA 4CT8A 3GLLA 3S93A 4YDDB 4AUXA 1O5JA 2QCOA 4HX8A 1EJ7L 2XAFA 3Q8QB 4MYTA 5IYZE 2DXIA 1KTQA 4FHTA 2RDJA 1OPCA 4A3CJ 2QL5B 2QO3A 2YINA 4KA4A 3DHXA 5BNGA 1N5VA 4BU2A 1QAXA 4JEUB 3UFEA 4ED8A 4LF6F 3W9HA 4JLEA 3AEFA 1JGSA 3SS1A 4K4WA 1NJZA 4MQ9F 5F8MA 4XK4A 2XVCA 3HRMA 2HS3A 1RRJA 4HH1A 3VF0B 2W24A 4IG3A 2RSQA 5J2QA 3T1YJ 3G6EI 2FHKA 4RZRA 1Z9CA 4J9VA 1T6SA 1HS7A 3J7YI 3I1AA 4R79A 3DOLB 5EZYE 3R2DJ 3FFIB 4X62F 1DAXA 1WH7A 4DEZA 1VFJA 1B72A 2HVRA 2OSRA 1IDZA 4CLTA 4QX7B 3OJAA 2H5EA 4G2AA 4HDGA 1N5YA 2CJAA 2JOQA 3FXLA 2VQHA 1UZDA 4X4UA 4F4XA 3OOUA 1CJUA 2BRKA 4NHJA 1SVLA 2KQRA 1R8IA 1NUEA 3LSJA 3DLLF 2ZNYA 2QL9B 2MTLA 1I51B 3GPAA 1OCTC 1Z6RA 3PNVA 3FKIJ 1EF4A 4OZ2A 1UL3A 1VCTA 4C2MA 1A7GE 1BUXA 1JX4A 1NRKA 3T1AA 2R7VA 1J5OA 1VFCA 4CWBA 3MZYA 3P8CD 3CVKA 4LRBA 4TU8A 3RKXA 5DS7A 1LNWA 5E1ZB 1R6VA 3ZMUA 3K4MA 1FVQA 4Q47A 2DODA 2EI5A 4B9UA 2C2ZB 4CQ1A 4HWDA 3ECOA 2I9SA 1IQZA 1PSDA 4O2AE 1RAJA 4JI2J 3S8PA 2XCPA 2VKHA 1KYWA 3E2EA 1S7HA 1CC7A 2CWOA 4A5NA 4XBFB 3MPDA 4LF4T 3WC2A 4EJWA 3HSZA 3DRSA 1XBWA 4XIDA 4DL2A 3BP8A 3H3ZA 3KLGA 3ZQHA 1APSA 3BZKA 1WKMA 4JI6F 1AZSA 1VQPS 5HJXA 1U1RA 1J7KA 5AQNB 4O4JE 2VKDA 3WU2C 4F91B 1O3RA 3JSPA 2H7VC 1UFKA 5J1YA 3AAAB 4TXSA 4QYZJ 3LNQA 3AE5A 2NYXA 2V9VA 5GONE 4UUVA 4XLPF 4JK1X 2B9YA 3E6DA 2DRBA 2W4DA 4F4AA 4U7UD 5JR9C 4I67A 4J9QA 1D8JA 2L9WA 3DOMB 5ICCA 1F1ZA 3MJXA 1YJNS 3NWIA 1G3SA 5E2QA 3DBHB 4NQWA 3RYIE 1IUYA 2X6WA 3ZN1A 1HW2A 5CGMA 1IUJA 2ROEA 2KJWA 4RUHA 2RQCA 3QYYA 4X4VA 2O5RA 4CN4A 4L73A 4I2PA 1CQNA 4A93J 1RIOH 4WCEQ 3RR7A 1H6KX 1NH3A 2V50A 3KK3B 2NXCA 4UUSA 2QYWA 1RBOB 2W4XA 2QMWA 5M5WJ 1LK7A 1VISA 3UU8A 2XQ5A 3ZMSA 5L46A 3MEEB 2EZIA 2X1DA 4LIVA 1NB7A 4PXDA 5EK4A 3DI6A 4ZYHA 4QTRA 1BC7C 3PE0A 2M0CA 3FIWA 1WSUA 2NREA 1UKUA 1WDDA 1FJGF 3HXLA 3DCAA 3KP2A 3GSDA 3MGJA 4DR2J 1A0OB 1U48A 2XYHB 2OZUA 2IA2A 4IDKB 2DLLA 4OI1A 4ZHRA 4NWBA 4FF4A 3HOUJ 1DFDA 1YRNA 5IP7J 3KOAA 4K8RA 2QQ9A 2JMKA 3D1OA 3AA1B 2L7ZA 3UUBA 1TTYA 5DQVA 1FKPA 4ECSA 4I2OA 2VIXA 2XSJB 4DFJA 4WBFA 2DGTA 1J5OB 3OL9A 1UW4A 2W01A 1IAWA 4Q44A 2IW5B 4BNCA 5KMGP 5KFZA 1XR5A 4BQAA 3B54A 3MUVP 2DGSA 2YK0A 4RPFA 4DF8A 3K6GA 1XTZA 4YG2F 2HRUA 3KZYA 3IA3A 2AJ2A 5GMEA 2HFUA 3GJRB 1W7PD 5LGNA 4TV8E 1HQUA 5JH7E 3ZZPA 4A8XA 3U1DA 2BJ3A 2X9DA 2CS3A 4A3KJ 3ZFVA 1K6YA 4KGZB 3TUIC 2VF3A 2WP9A 4YHHT 4DL6A 4XLHA 1H9GA 2W7OA 2A6OA 1C1CA 4DN9A 3AJ2A 3KBTA 3BLYA 1WYBA 1VQ4S 2B6AB 4BJ6C 1VQ9I 1N88A 4L0ZB 3P7IA 1PKUA 1X4OA 3HPOA 3UNGC 3K2YA 4QQBA 3IAS9 4HVZA 1TL5A 3ZQGA 5FXWA 4ILBA 4OIPF 1QHGA 5KT7A 2DW4A 4AD6A 4WK8F 2XAGA 1FHTA 1YOVB 5LGTA 1LOUA 1CJVB 4HW0A 5L3BA 4ZI2C 2QV6A 3PU3A 5ETWA 5AT1B 3MFIA 4BHPA 1UB9A 3V4IA 4CLPA 1B8IA 4UTGA 1MIVA 1E3OC 2YKOA 4M5KA 3UDVA 1LK5A 4DCOB 1JUPA 1YS7A 2BJ8A 4CO0A 2K7LA 5KFQA 2MZQA 1IBLJ 3MMBB 3H4BA 4IRDA 3V6HA 4K4TA 2V0NA 2RS2A 1YQ3A 3GBGA 3N2KE 1STZA 3W65A 2PMZD 2E1CA 2E5LJ 2NTYA 3RQIA 2ZMEA 1JKHB 3RX6A 2X1AA 3VAGA 1RTDA 4Q2MA 2ELKA 2AJFE 1FKAF 1SC3B 2HGNA 3P5BP 4DR4J 2CHNA 5J2QB 3PO3J 1IKXB 1JMTA 3RR8A 2P8IA 4ID5A 1HBNA 1B72B 2NVTJ 4C91A 5J6XA 2HZVA 2IJLA 4ZLNA 1U4BA 1ZYQA 4EUVA 5TGTA 3T8OA 1UGOA 1QPMA 3ML6A 1W7PA 4KUMB 4V19J 1USTA 1WI9A 1YD8G 2APOA 2KB2A 3H2UB 5LHHB 3CCES 2VA2A 1VQMI 3ZMZA 2XGPA 1N54B 3K5PA 4CYUB 1IO2A 3TO7A 4F0HA 2P0WA 1CVJA 3DRRA 2X1CA 2B51A 4BEHA 3VRBA 1U8BA 3D28A 3N97A 1ACMB 3HHKA 1CF7A 2DPUA 2VVSA 3NZQA 3BTLA 3ETOA 2ISYA 1TV6B 3CD7A 1VHFA 4W92B 3BZQA 2F1FA 3DFEA 4HEA2 1XMXA 4LRCA 1T11A 1ZM4A 1Q53A 1P2FA 4NRTA 4Z6YA 2OGUA 4YQWA 3J7YU 4ASKA 4C90A 5ABFA 4MIWA 3CCMI 1FCAA 4RJVA 5BYQA 3COAC 2XRLA 2OFGX 2PI0A 2E1MC 4RNNA 1ZTWA 1GXPA 4RLFA 1UK5A 2KP6A 2E5NA 3HZJA 4A3FJ 5F0UA 2PQ8A 1Y5NB 4JI7J 4MKBA 2W25A 4BY1J 2M7AA 2LXFA 1T3NA 4IE4A 1YWXA 3DXJF 3O1JA 3DTEA 4IQ4A 2F63A 3HHLD 4BS2A 4HLXA 2CA5A 4EB6E 4Q0BB 4C0OC 2H94A 3SDEA 4CO3A 3IRQA 1D1UA 1LWXA 3MPYA 4F93B 2KXFA 1QPIA 2MSTA 2CPZA 1REVA 3SFZA 1REPC 2WV0A 2ZM6F 1QD1A 1JXVA 2H54B 1J09A 2WA0A 2Q8KA 3DP7A 1L3TA 3CJRA 5CPRB 3F8NA 1ZZNA 4GMKA 4TLRA 3AE8A 2OPQB 2RRBA 1O4XA 3JB9k 3TMOA 1MJAA 1U8SA 4I64A 1FD8A 2XAQA 4OIOF 2IM3A 5D0RA 2O3FA 4IRIA 3R0JA 1J2XA 4ZVUB 1M1HA 2BOPA 3R8YA 3M8QB 3RSNA 3US5A 3MM8B 2XZWA 4FF2A 3FK6A 1KNPA 2YKMA 1JLCA 3OYGA 3T19A 5TRDA 1TL8A 2JJ9A 2HK2A 4OI0A 2JA5J 4OYIA 3HMJG 2DO7A 2HS4A 3IM8A 3P9CA 1VQOS 3BSNA 4I56A 3EAMA 3ZO7A 1SQFA 3BR0A 3J81K 5KHDA 4O3NA 4FT8A 3FGVA 5E17F 1H7WA 4P2MA 4DR6F 1IBLT 1DQUA 3J80Z 2JEIA 2X3GA 4M6YA 1RWWB 2V1DA 2P6TA 2M6IA 2ZMEC 4JUZA 1SE7A 5CFBA 3HSGA 5HP1A 4CI0B 1MNDA 4B1RA 4QHOA 2Y30A 1E0EA 1N34T 5CXTA 4DR3J 3RKOA 1Z67A 2IYIA 4Y52J 3MM7B 4AIUA 2CJ9A 1PUFB 3G87A 4A3LJ 4S0HB 2C2EA 2HHVA 2XTJP 3S15J 4I09A 3S2DJ 4IE5A 5A8WB 1AA7A 1TU0B 1VRTA 2DNGA 2E66A 3A8IA 3ZQCA 1VF9A 2DFEA 5E20A 2KZMA 2H3EB 3LA0A 1FDNA 4CYCB 4UVAA 5AE1A 1F3FA 3N9NA 5ABFB 3JAMZ 3JR9A 4UR9A 4KFBA 2KINB 3LGMA 1Y00A 3M2UB 2C3OA 3L39A 2QWWA 4RLQA 4DPTA 2RU3A 5KOXA 3F22A 2QLWA 4RW9B 2XUEA 4HLYA 1BIAA 4BQNA 5C24A 4R8UA 2KDOA 2EFGA 1BD6A 1QSDA 2M67A 2CIMA 4O4HE 3NL0A 4EV6A 2LBFB 4OYXA 2ASDA 1GMWD 3LF0A 3OR1A 2UXXB 4KIFA 5F0FA 3FZKB 1AHDP 4B8XA 3NARA 1ELOA 4C9DA 1RWNB 5CYQB 3LTOA 4MK7A 4MIAA 3IH4A 4XM3A 2HXIA 1FDBA 3C1DA 3M4OJ 3H2VE 5LEJA 3LAMA 2KZGA 2QA4G 4U67Q 1FYMA 1D9AA 3WU1B 1QLNA 3EPIA 2C2OB 4OAZA 1MBKA 2IXSA 3P7NA 4QPOA 1SL0A 2CW0F 2EA4A 4DW6A 1L0VA 3PDYA 1YW0A 2MLGA 1H9TA 2FHJA 2IBKA 3DKWA 4EJVA 1G6NA 1QA6A 2CQ3A 2ZMEB 5BYRA 3IH3A 4DG1A 1SVDA 1ZRCA 2VKJA 3KPHA 4IHYA 4MTPA 3ZQLA 1UEKA 2XWYA 3VZHA 3OV7A 1HNWT 5CVUA 5HXCA 2YKNA 5F9LA 4QU6A 1JXLA 3SQOP 4U8VA 2R7SA 5E3QA 3RIRA 2QGUA 4PJMA 2FBHA 2JQ7A 3H5YA 3T5HA 1QHHD 4RNHA 1KEYA 2PG8A 1XB4A 2PJQA 4LG3A 4M5HA 1DTQA 1O6XA 5CB4E 4TVAB 5HDGA 2LKZA 2LLZA 3CJ0A 1W2IA 4UQGA 4LLNA 2GIQA 5DYMA 1PP7U 4ZZBA 2ZFHA 2AEFA 3T3FA 3D67A 1MLAA 3LP0B 2A2CA 3BPSP 1XWMA 1FI4A 2H4WB 3PIOQ 1O7LA 1FX7A 5F0HA 4LF6T 4EYUA 5C8YE 1GTEA 3ZZZA 4UZCA 3I59A 2GVZB 3GV7B 2G0UA 2CEAA 1TKZB 4DR1J 4AQGA 2QBYB 2V1NA 3AFHA 4OZ3A 1KVJA 1UX5A 1KFDA 4DR6T 3MHYA 1XNQT 1HBNB 5K20B 2PA8D 2GOXB 4RGSA 5H6QB 3I54A 4LF4J 2DYSH 5DCMB 1OWAA 4AL6A 3KG0A 3F3XA 1S4FA 2UV1A 2AS5F 2IBOA 4EIWA 2VQGA 2IRXA 2FJVA 4WTYA 2GVDA 2D9OA 2IW5A 3CUQB 2ZC2A 3NGRA 4GXOA 4AD9A 2BJ1A 4YB6A 2E1NA 2V7LA 2PTFA 4HF1A 2KRHA 2CV1A 2JQQA 1PIEA 2BBJA 1XMQJ 1IW7F 2HVHA 3LH2S 4A8QA 4CCHA 5KTQA 1P4WA 3U3IA 4NB5A 2CG4A 5JJBA 2MLZA 3C98B 3QODA 3AE9A 2NUUG 2V7FA 4FS2A 4RW4A 3W9IA 2JMWA 1NSKL 3I9WA 1QVGR 4YEJA 4QXCB 4EI2A 1NHKL 1P92A 2E2AA 4H9QC 3IA0A 2BG9B 2AZ1A 3F41A 2LJLA 2NNYA 1YW9A 2NSBA 2B7CB 2GAHC 3TW0A 2IA0A 3PW0A 2ZSIB 1VJQA 5F41A 4OZ0A 1WOPA 1S6PA 1UX4A 3WTYC 2X6XA 1DY3A 4EEBA 3OIPA 1KC8T 3P8BB 4JB8B 1YO5C 3LGNA 1F4KA 3UUXB 2FLPA 1AKHA 1F6TA 4C8YA 3UE2A 1IXCA 4H4OB 2XHCA 3GYGA 1RACB 2BA9A 1T98A 3MR6A 2K27A 5J2UE 1Y1WJ 5CQGA 2H48B 4FISA 3KEYA 3OVAA 1WC6A 5IM0B 4IOCQ 4II2A 4FYVB 5L3BB 1D5VA 3FK7A 1HFEL 3B57A 4EFAC 3CCUS 3GONA 5KCMA 4WW0A 1NXIA 1W7WA 4PWDB 2JN6A 1F0XA 2IA1A 5M5YJ 2GAGC 3R0AA 1S6OA 1KU9A 4G63A 5C2CA 3MEEA 3RAMA 1TAUA 2DHAA 1IR1A 1XNQJ 3FXKA 2V7IA 2WVEA 1M1KT 1VIXA 3A12A 4HFHA 4IYQA 1CJTB 4NYZA 1BM9A 3R5AA 1IKVB 4KH0B 3I3LA 3ASNH 2XQYA 3TUJC 2RAQA 3WBZA 3PUAA 4NQWB 2YWEA 3IC7A 3QU3A 2ZC3A 4BS9A 2WADA 4YRVA 4DV1J 5GADJ 1IBMF 3FZ2A 1K78B 2B3TB 4LG0B 2D0UA 2IS4A 3HI9A 3MKYB 3LBXA 5HS9A 3VODA 2JQHA 4QPXA 3DOLA 2OPRA 4JP8A 2Z16A 1U0SA 2CJYB 3RPUA 1Y0UA 4NLYA 4GYRA 3PEHA 2DTZA 2K3FA 5CA0E 2HFZA 3OYKA 2V2ZA 1HNIB 5EUHA 2FUPA 1C1BB 2HFNA 1J2VA 4XKCA 4LF7T 3L7WA 1T9XA 1EX8A 2XLIA 5D3GB 1JLAA 4DJBA 2O0YA 2QGFB 1N5YB 3T6JA 3TQEA 3B4MA 1RLDA 4U96A 1X1AA 3AE1A 3F6OA 2CWXA 2K3PA 4Y3OA 5ED4A 2MYFA 4YEAA 4U0VA 3PG9A 3V5UA 2HRTA 3FBZA 2Z1DA 1KDNA 3H42A 2DWGA 1KRPA 3GYHX 1GT8A 3M2RB 3TLVA 1ITYA 1VYAA 2HVZA 3RBEA 1E6YA 4HSTA 4NUUA 2MKSA 5HLGA 4CH7A 4Q43A 1Z1DA 4LLLA 4H4KA 2DA5A 3R7BB 2ADUA 3TA2A 1FE4A 2AP6A 2R7XA 1YRXA 2YEVC 5KOWA 4IL4A 5FY0A 2R93J 2LR8A 2ESHA 4IG0A 2JEJA 2ATCB 4MKYA 1R8AA 4C48A 5KK1A 2CGPA 4FBUA 4I50E 3LSKA 2EQRA 4GO1A 3BK9A 2JRSA 3ILLA 4TKTA 2XC7A 4URQU 1F1BB 3EDUA 2Q43A 2VQFT 3EGZA 3DTOA 3JQMA 4AWXB 4CXYA 3VSKA 3U02A 4MIMA 1KP6A 4WIIA 2AGQA 3JTGA 1V3FA 1IN8A 3NS6A 5IQQA 3UCUP 5LNKA 1Y8QB 1VQ5I 3JTHA 3CULA 5LB7B 2JL9A 1BJAA 2W61A 2A6MA 3ZTOA 4LIWA 3G82A 1Y5LB 4LFAJ 1KF6A 1K83J 4J9NA 3HPGA 2P8TA 3Q24A 1S72S 2GHVC 3SSRA 2OIHA 5FL0A 3NG8A 4ZYGA 5E5NA 1QSLA 4NL5A 2XPVA 2V68A 3F6VA 1XNQF 4RB1A 2CBJA 4GYIA 1S72I 3RQWA 2E1OA 5KFEA 2CQKA 2HQNA 1Y5IB 3DEWA 2KO1A 1BBYA 3VB2A 4KT5C 5T7LA 1HQ2A 4ZLJA 4JI8T 3KV5A 1FSEA 1BHNA 2K48A 5L3DA 5KFRA 3R84B 5H9FK 1HC8A 3IN5A 5C25A 5DGAA 2OV9A 4O23A 1YJWS 1RHJB 1TQPA 2VPWB 4HWFA 1BOBA 3JC6C 1HA1A 1UCUA 2HNDB 4AM3A 1W5CC 4AKHA 2QQBA 2XMJA 1I1SA 5F8LA 1LQ9A 3CD6I 1T9WA 5F8HA 2BQ3A 3CMAI 2FY8A 4R25A 2E44A 3LP1B 2ADCA 2PFVA 4ZJOA 1S5LC 4ED7A 4JI6T 1FRLA 4L5JA 1SH2A 4AL7A 3OS2A 3RIUC 1OY9A 2KHCA 3PJXA 4EEDA 4Y2AA 2NXUA 1VR6A 3FSYA 4UUWA 4BE1A 4LREA 3D4JA 2PMUA 1MMAA 3Q8UA 3S7RA 1HR0T 4DN0A 3K69A 3BDPA 2P7VB 2D5VA 3R5JB 3BQ2A 3MUMP 3W2WA 3FZHB 3OL3A 4HGAA 3B5MA 4DSIA 2AJ1A 1MN9A 2KYZA 2L9VA 2PX9A 3MM5A 3QPIA 2CQIA 5FD5A 2BY3A 4MGRA 4BHQA 1JXSA 2N4CA 5HMYA 1M5PC 4D3GA 3QO9A 3UUNA 2W2MP 5LXYA 3HF5A 4YUDA 1FYKA 2DT6A 1VQYA 5CABA 1TZ0A 2K8GA 2WTFA 4CLZA 2ZHOA 1WJFA 1U45A 4I2QA 4PK4A 2MLYA 2B6AA 2AF6A 2DEJA 4ER8A 1L3VA 4LUBA 5HANA 3ERMA 4ILCA 3BQYA 4USTA 3I0SA 4IO1A 1U2FA 2LE8A 1X1BA 4BAYA 4AFFA 5IPAA 4JI1J 4A8SA 1IBKJ 1R71A 4TN2A 3WE3A 2OPPA 4EEFG 2Y0SA 4XLFA 4KN7X 3D3BJ 1JE8A 3DXSX 5B08A 1B7FA 4Q4ZF 3W2AA 1N6QB 4CNZA 1W1WE 3L9FA 2K1RB 3Q89A 2HBRB 3GYXB 2NR0A 2YDQA 3AKZA 4YY3T 4MKAA 2GA7A 1PVEA 2VG5B 1XDPA 3O1IA 2OKQA 2VKOA 4LBIA 4FYWB 5LMNT 2JVOA 3ETMA 2XRNA 2YNGA 2CUYA 4ZHRB 1U2RA 3BGRB 3RJPA 2ZITA 1GMWA 3ZNJ1 3H25A 1SKWA 3HHLC 1LE8A 2JMHA 3ZLIA 5CCMA 5JVTA 4WXCA 1NZAA 3ZC4A 2RQMA 2HYIB 3L4BC 1G6BA 3PIPQ 1FBQA 1OEDA 4HRIA 4ZDNA 4J9MA 1EETB 1HIYA 2R0QC 2XBPA 3OQ2A 4CH1A 5EYRA 1K78A 2ILZA 1FMWA 3GX4X 4P9UA 1MMSA 1EQ0A 2NS7A 2OEMA 2N3LA 4DL0C 4F92B 3BR2A 4IHTA 4C8LA 3OS1A 2C42A 2HPLA 4HNTA 3CZ6A 3FM5A 3N28A 3UU4A 2X0HA 2G2OA 3N01A 2E1MB 2OTJS 2ZUGA 2XSJC 2PBIA 3K70C 2WZHA 1OMSA 4E0DA 2FLNA 1LEBA 2DNYA 4URSA 2JLEA 3PTRB 1XTAA 1X8DA 4KH1B 1AKHB 1GK8A 5LJ3Y 3VAFA 3RIFA 1Q8BA 3NEUA 3DLGB 4QIGA 4WK1A 3D1QA 3AOCA 2XSDC 1LEAA 5FKLA 4A8MP 4AE5A 4ELUA 2YQ0A 4FI5A 3KP7A 2DMPA 4V19K 1D0YA 4HACA 4ID8A 4PAAA 1XC5A 2R5YB 3HDSA 1J5YA 5KDMC 1B3TA 3U2RA 4X84A 4A69C 1DPUA 2FJBB 1M1GA 1S12A 4QYZK 5HODA 2V94A 5F1JA 2HRYA 2GM4A 3V6KA 2P5VA 1E2AA 2VFUA 5D5XB 4MEYF 2FBKA 3ZZ0A 2ZUAA 3IR5B 2CQNA 1JLFA 3RZAA 2R4FA 3H59A 4X20E 1FEXA 4ZS3A 2XB0X 2VBXA 3HRUA 1KBRA 1Q5YA 1S9FA 4BDZA 3JAMU 3AD9C 2FYXA 2QEXS 2ZMAA 1YITI 2KT2A 1WVRA 2LP4A 3RBXA 5IM0A 1UVMA 4GYGA 2SPCA 5FRNA 2GJ2A 4CCMA 2MKYA 2LREA 1TL7A 3L3CA 4LLGF 4OZ5A 4PK6A 3MMCA 1LEOA 3UKGA 2DA3A 2TCTA 3H5UA 4C7QA 6FD1A 5DJQC 4LR8A 2NXJA 3BB5A 2DO0A 1LWFB 4WPAA 2RKHA 4ZOSA 1PYVA 1Q79A 3BGLA 4JX4A 5KG6A 4WNKA 5A8KA 3DM2A 2DNLA 2UUZA 5EK2A 4CLSA 1YIOA 3FZBA 3BPXA 2X68A 3UU5A 3TEHB 3AE2A 3K8PC 2GCFA 2VG7A 2DGQA 1OPZA 2XQ8A 1U1NA 3NOCA 2CPJA 3CMQA 4KQZA 3CMMA 2PLYA 2QBYA 5IT9K 2XPKA 5ICGA 1W25A 2XMKA 4PSXA 2WAQN 1P8GA 1MJBA 3DV8A 3CC7S 2ZE2B 5DCMA 3GIMA 5JHFA 3BCBA 1XNRF 4HFIA 2XYGB 4LF4F 3KZIC 3LWLA 3IAM2 3K4NA 3GU0A 4ZIVA 1LJ9A 1IJWC 1TW2A 3HRTA 4P1WA 2CQXA 1YX2A 1OEDC 3OR1B 3M8PB 4ZVQB 3C14A 2ZBKA 2E5GA 2B1EA 3WAKA 3ZXWA 2BEFA 1G2HA 2R7ZJ 3CUQA 4KT6A 2UUBT 1RWPB 1RP5A 3WC0A 4C97A 3RKYA 4LMZA 4DYQA 3A3OB 3J7A1 2DGOA 4Z7YA 4RW8B 4BKXA 3ABMH 4WBOA 1Z21A 4NOHA 3GIKA 2BQUA 3Q0WA 2CZ9A 2IY5B 4M6VA 3HJEA 1I1GA 1KYZA 4A8FA 1VQSA 3ETUA 4XN3A 2MPUA 4NASA 5FMNA 5CJ5A 4OX6A 4IO9Q 2VH7A 4KHZF 2FRHA 1R1UA 2EHOD 2CXLA 3CE8A 4DV4J 5L1IA 1YRUA 2JA2A 2BE5F 5DLFA 4PPDA 3RG6A 3OTOF 1Y7PA 3V81B 3Q5WA 1R7JA 4YB5A 4A2UA 2CQCA 1MMDA 1D0XA 3H90A 1IRXA 4O0IA 4F2RA 2QN6B 2P5LC 3SFGA 3A4TA 5HXHA 2LQJA 3BG3A 2ZJ2A 4WYVA 3IRRA 3Q8YA 3Q2SC 2L08A 2CNLB 3RBDA 3JSBA 1E6VB 3QLHA 1LFUP 5C2GA 5IWAJ 3I0RB 3QT7A 3K5LA 4XKVA 4A47A 4MK9A 1T08B 5K7ZA 1U47A 2MLXA 1HX8A 3SIPB 4BE0A 4HEAA 1IZ1A 4B3ST 2IMWP 2PEHA 2QIFA 2ZBPA 4FF1A 2M9KA 3M8JA 2DN0A 1GXQA 2LQ5A 5LEKA 3GV5B 3JRIA 4XPCA 1RNLA 3LG7A 1BY9A 2IFXA 4CN6A 1D3WA 1H38A 4B48A 3ITHA 5U47A 2DITA 2J6UA 5DABA 1OWXA 5J2TE 1VGYA 5FFZA 5IZHA 2ZDOA 4IKAA 2FBWA 3E22E 5KT4A 1I94J 4IOBA 1MBHA 3R5BA 2J0QD 2GHWA 2KXNB 2E2IJ 3CIRA 1OLTA 4AT1B 2XY6A 4OHYA 3NZPA 4ZCLA 1S7OA 4UVAB 3A01A 5AQOB 3RC8A 2QKLB 2WY8Q 3UT5E 1YW8A 2I6HA 2MW8A 2ZFUA 3N79A 1M62A 1VRTB 2DQLA 2UUCT 1IVZA 4DR4F 4H9SE 3IHRA 1PCAA 2MC4A 2UU9J 4A3GJ 2FJAB 2LMIA 3JRGA 3RB3A 1N36J 4IE7A 4GKKJ 1WKLA 1ORKA 3UU6A 5HOOA 1DQ8A 1SANA 4XO0A 3H37A 4OHXA 4DUYF 3JYTA 4IZZA 1MG7A 5DDOC 5LMUT 2YKMB 3R5DA 4NC8A 1YGYA 5T7LB 3K1NA 4OX8A 2UXXA 2ZBCA 4ECQA 1ZM2A 2Y6XA 1FFWB 3NRYA 2KDZA 2C2NA 4K5SA 5AQLB 1NPRA 2CQ0A 3D6FB 3IWXA 1B1BA 4OV1A 2ACZA 2WB1A 3EPGA 2X67A 3HHLA 2AXDS 2N9DA 3GYNA 2L8KA 4QH4A 3W6VA 2CWYA 2LYVA 4I6WA 4DL7A 5LSLA 5DQWA 3W5XA 4DQQA 2AU0A 2JSPA 3T1HJ 2LOPA 2XS5A 3M6WA 2YX1A 5J0ZA 4Q45A 5LA6E 3MCMA 2OO4A 3M7GA 2WW8A 3F57A 3OXLA 5DJBA 3GJTB 2XEXA 4LOCA 3LSHA 3AOBA 3CCVI 2B5JA 1NPKA 4O4GA 4JI3T 2MSSA 5LHIB 2BR0A 1L3UA 1HYSA 1V9OA 4MKVA 4JI5J 1IJEB 1FRIA 4R5PB 1DP3A 4DS5A 4KHPT 2R7DA 2EHOC 5HLFA 5F0WA 5KFVA 1ZA1B 4BJMA 1MNEA 4XL9A 5IT4A 5EGYA 3FQKA 3LSGA 2F4VJ 5DQIA 1RA6A 1XMAA 4UOHA 3TJ9A 3LQRA 1B70B 4Q8FA 3PFYA 3OYNA 5HBMA 3C3WA 2V1UA 3KK2A 2YU2A 1Y01A 1AYEA 3U7JA 3SI8A 1EQMA 4UW2A 4U7UK 2ZM6J 1CJKB 1VQMS 1VBYA 4OHFA 3AAFA 2H1YA 4QYRA 4CM0A 3C6TB 2LSOA 5JDGA 4DL3A 1TK0A 1QNTA 3ZJ2A 1JLCB 3N5BA 1RQ0A 3BC8A 3HGGA 4Z90A 2Z9OA 1SIWB 1I6JA 2EK5A 1LWCA 3LK3B 1J5WA 2WVCA 3CJNA 2ZFWA 3FMRA 5E3LA 3CCWA 4XR6A 3K7RA 4BYYA 2QFJA 3BREA 3BJ6A 2G2ZA 2FQ4A 1KLNA 4FXDA 1O0PA 2K4JA 2ZH4A 4NXNT 2XGEA 1VHIA 1ZPWX 2BXJA 5JFRA 3HLUA 1WCMJ 4I7HA 1S6QA 3GFIA 3A1YA 3MCSA 3LUYA 4G1IA 2XQ9A 3CO6C 3NGSA 8RUCA 3QSIA 1MBFA 3QOEA 1BL0A 2UVVA 2IRUA 4IR1A 2K5CA 5EG0A 3DRYA 4Y2IA 3ZTPA 1P6TA 1N32J 5ETPA 2OV7A 5JDNA 2QYOA 1PJ5A 4UNOA 3HXMA 4Y6IA 3AL0B 3ADAC 1WGXA 2ZO4A 3ROUA 2V8HA 3KUGA 3PYGA 2B9EA 3EGVA 5HSPA 3C4XA 5E7OB 2V9WA 2LKHA 2LKSA 1XR6A 3SCKE 2UXCT 3NKZA 1SKRA 2ACXA 3PUZF 4ES3A 4EATA 1FYLA 3QK6A 4WFAQ 3UD5A 3ZN0B 3W6KB 3QZ8A 3MECB 1DZ5A 1B64A 2BY2A 3JTOA 3CDWA 3D0TA 4N76A 2R4GA 1QVUA 4JV5J 4JX6A 3RYRA 3CKDA 1Q4RA 4AXJA 2OQRA 1RKIA 1A6LA 2AD9A 5B0BA 2P81A 4GO5X 5JLXA 4HNVA 1MWZA 3G1MA 1F43A 4XN0A 3KUHA 1W2BR 4UVBA 3V7SA 3QPTA 5HS7A 4OHVA 2FE3A 5DUKA 1KOOA 4RUBA 3GO5A 1ZM9A 4X4RA 1RT1B 3T5JA 4YSZA 4ZTFA 1VQKI 2J7KA 2YNIA 4OIRF 4P55A 2VFVA 1TQIA 1DQ9A 2FSWA 4N78D 3AAIA 2R9LA 3VR9A 3RRGA 1F9FA 1H74A 2W00A 1RTDB 2YWFA 4X1YE 4HTEA 5HN0A 4WKRA 2ME0A 2VIHA 1N48A 4LITA 3F56A 4CCLA 1RT4B 4CLLA 3DC2A 4ENNA 1FJEB 2DNKA 5DM6Q 1X9SA 2XGQA 1RKJA 2DR5A 5AONA 1FNOA 2STWA 1ZHFA 3KK1B 1RWXB 2VASA 3U1MA 3ISND 3VTIA 4HYEA 3D68A 3K59A 3L3PA 2KFNA 4YP3A 1ZG3A 4ZP9A 5KFTA 5THWA 5GMKa 4Y4RA 4DFMA 1YW7A 2HOTA 3N6NA 1DQAA 1RTIB 2Y1IA 3PJAA 3LAJA 1TL4A 4M63A 3FHNA 3MMCB 1FWPA 4RBTA 1U9OA 2FBIA 3EGNA 4HBLA 1TL7B 5BQTA 4J9UE 5AQPB 3PUGA 3N4WA 5DEQA 1OR7A 4U87A 3CDAA 5D4RA 1MBJA 2X4HA 3FJ2A 3U1NA 1A36A 2Y69H 3IFEA 2GWRA 3PHEA 2H27A 3KP6A 1NLKL 2OCEA 3PV0F 3J80Y 4ZDOA 2R8HA 3VEPA 3JCFA 2J9DA 2AZ3A 4A3MJ 4LFBJ 3BGFA 1XGOA 1A6IA 4KJZA 5A0YB 1TNSA 2ZVIA 4QLCU 2FMYA 5KFYA 5CH7B 2R2UA 4RAGA 2C22A 4WE1A 1REGX 1QZYA 1D0EA 5ILSA 4TNVA 3NS5A 3CQXC 3F8FA 1UVKA 2F2EA 3OYMA 4LVOP 3LSVA 4AQYT 2VQFJ 2M1BA 2BVMA 1KGSA 2VFRA 1RE1B 5FROA 1TR0A 2YWWA 1NM2A 3ASOH 2IJNA 4B3MF 1FJLA 1R00A 3K0JA 4DPOA 4EM2A 5IOLA 2A61A 2ODVA 2PD1A 4DJAA 2FTRA 1IKWA 4CSWA 4DBQA 1HBOA 4FYYB 2AQFA 3LDQB 4NEYA 4OLPA 3G6XA 3THPA 4GVBB 2FD5A 3FISA 3HBLA 3ZZTA 3BH7B 2VJ5A 4AIKA 3QP5A 3LJCA 3J7AO 1XX5A 5A6PA 2HYJA 2EV5A 4LMKA 1RR7A 3PJ9A 5IHYA 2JHEA 4DUTA 2M4GA 2VQEF 4OWRB 2CFOA 1Y10A 2AYMA 2QTWA 3AAWB 3OSPA 5M3MJ 2XYPB 5HQMA 3FBEA 4B08A 1R4NB 5LG3A 1JKRC 2ROGA 5KFOA 3P6YC 1WR0A 3O8WA 4N56A 5D4OA 3N0VA 1R5ID 2QG9B 2A1BA 2LLYA 1VRQC 4XLEA 2QA1A 3R5GA 3QC9A 2EG2A 2O7OA 4LF7J 2HHHF 2XPUA 4O3RA 2I0MA 3KWMA 1S35A 3UUMA 1IV8A 1JLQB 1K0TA 2Z3YA 5I42A 3ONLC 3LAPA 3DLEB 5ILVA 3I5CA 5LBMA 3IGNA 3G6VA 5D8KB 1TFWA 2WCXA 2B0GA 2ZOFA 2H8WA 4JBWF 4DPXA 2XB5A 3AFGA 4JI1F 5HLFB 4DUZT 4F6RC 4J01A 2MH9A 2AYBA 3OW2R 5DM6F 3FXMA 2KRFA 2BJEA 1S6QB 2LFVA 3F2EA 5ETRA 3G6ES 1SC1B 4K50A 1IN5A 5M3FJ 2MBFA 4O0NA 3CJQB 3RAXA 2XAHA 2VPXB 2BANA 2AGPA 1VI0A 3ANWB 2DFIA 2F5VA 4ZH4F 3CQCB 4O3OA 2V4JA 3UN5A 5KG0A 1DGWY 1U1OA 1ETWA 1P4XA 4C8OA 3U1LA 4PCQA 1HA8A 4LFCJ 4RU2A 5HEGA 3KJNB 5FXXA 3CJ5A 3MM6A 1N33J 5LJMA 4WKYA 5EEHA 2IYGA 3NNCA 3EZOA 1S9GB 3J80K 5ETNA 3C2GA 1WNEA 1OQ3A 5LLQA 3NMAA 3FBFA 2GMJA 3KCCA 2VU5A 1OCRH 4UB8C 3F44A 3HA4A 1NH8A 2XAUA 1SH3A 1XERA 4M9XA 3W1YC 3WIVA 4JI4J 1RYSA 4IR9A 4ZI3C 1JTYA 1PUFA 4HN9A 3AA6B 4BUPA 2I59A 3I56S 5L3FB 1P6RA 2O61A 2M45A 3LOCA 3VVUA 4Y7NJ 1FRJA 5T14A 2ZH6A 3AEEA 1R43A 2WWUA 4CI2B 4OJ3A 2RQKA 5CYQA 4Q8EA 3IHUA 1UFWA 2LCWA 4UXNA 3C6UB 2CO5A 3PYFA 1E6YB 3KYLA 4FVMA 3BM7A 1XNRJ 3OXFA 3QWLA 5KFJA 2F65A 3N5LA 2XIGA 2VJUA 4ZMMA 2YNHB 4MIBA 1RWUA 5FNVE 3IGVA 3G8SA 2M5WA 2VUMJ 5GMDA 2CQ4A 1W36D 4AIHA 3CCZA 1Y6IA 3HI2A 1MROA 3PUBA 1DUXC 2IS2A 4PZJA 3B4DA 3X2QH 1MIYA 3VV2B 1RGVA 1OY8A 4IREA 1BQNB 2VE9A 3IWZA 4DPUA 2MOZA 5FYMA 4DZ6A 3PUSA 3QNUA 2IMOA 4BGDA 2QSFX 1HQEA 3B78A 3PJWA 3MCNA 3HSJA 2GA2A 3G1LA 2KM8C 3M9AA 1R0BG 1F5TA 1CC8A 2A18A 5B0DA 2WMOA 2RN7A 5L8RC 2KIQA 2UUAT 1WJ9A 3BO3A 1XMQT 2RQPA 3LFMA 5AQJB 1UELB 2X6YA 1EJ9A 4JI7F 2BE7D 2C2KB 2VL1A 3ET6A 2Y9HA 3Q9VA 3UVJB 3VQTA 4OHWA 1REVB 1NK9A 2V4JC 1P1LA 4A3BJ 4FXVA 3WTZA 2X66A 5F3ZA 3CCJI 1HNXF 4BH9A 5LSRA 1JUSA 1HR0F 3KYCB 2LVSA 3S3NA 2NPFA 2N7YA 1KU7A 1N56A 5JHUA 2UUBJ 3N5FA 2WBRA 1CJTA 1SFEA 3ABLH 4JV1A 3LSIA 2DJWA 1AFJA 2K3IA 1ZN2A 3JC6D 1Q5VA 3PJAJ 1JIHA 2BXZA 3OYCA 1UEUA 1T05B 4OIXA 2LVWA 3V7CA 4RA2A 2JJ7A 4DMZA 2CXEA 2CPYA 3EJMA 4I43B 2QA2A 5AE2A 2DWKA 4C11A 3G71I 5AQQB 2Z5UA 1TWGJ 5EX0A 2E2JJ 1WKKA 5DQHA 4Q7AA 2JPCA 1Y8RB 3MMAB 2XQCA 5K5QA 2RUSA 4LFAF 2Z57B 1TT0A 4A6EA 4X1EA 1HSTA 4HKAA 1WC4A 2WCAA 4KIBA 5JLWA 1CG2A 3M8PA 2XQ3A 3C4ZA 3UO0A 1HNWJ 1YG2A 3V5SA 4K2XA 5J1UA 3WGIA 2UV8A 2VXZA 5KFFA 2QX0A 4OYWA 3THTA 4NMLA 1ZTRA 1YJ9S 1NG6A 3MM9B 3KE2A 4G7ZF 5D15A 5GAGJ 1V5VA 4OX9J 4MQVA 4WF2A 1FEWA 1X3ZB 3PDNA 4RW6A 4KO0B 3AL0C 2KN4A 4NLWA 3IUOA 3AHPA 1WEZA 2BBEA 4BWMA 1GXLA 1YRTA 3Q0VA 3H5XA 3PX6A 5CVJA 3AXMA 3PVXA 2RKIA 2RHQB 4LK0F 3AXJA 4W97A 3CJ8A 5FLMJ 1UZCA 3UTKA 2R7QA 2F4FA 3MMJA 4CXWA 2QVAA 3E0JB 3AEDA 2Y48B 2G0JA 2YTCA 1EAYC 1KS2A 1DRZA 1N52B 3B6AA 2MKHA 1UA1A 5ADXL 2DNQA 5LJ5Y 4BJTA 4F55A 2V6YB 4NCBA 2DCEA 3EHZA 2F48A 2M4MA 1JNRB 1NB2A 2FJEB 1I3QJ 3HVAA 4CTAB 1GMUA 4F50A 2PI5A 5K9FA 1FZPB 3DPUA 5F9NA 1TKDA 4Y34A 2XF6A 3UPFA 4DIQA 3VYRB 2LHNA 4MHGA 2CNNB 2IIHA 3PKMA 5GADU 4H4OA 4RW8A 1U1PA 3MKWB 3ZQQA 3D5RC 3WTUC 1QAYA 3F8MA 1DBDA 3Q3SA 4E4HA 4DMVA 5L3CB 3CWJA 3BKFA 4NLRA 1RKTA 5CVRA 2G2YA 4M5LA 2AQ4A 3O2IA 2J9DE 4KJIA 3N9QA 3MDFA 2XNQA 2D1HA 1IN7A 4H9RC 1BQMA 1PUEE 1LNQA 2WAUA 1Y64B 4I6YA 4CLFA 3T6BA 2X1FA 2K7KA 5E1XA 4F8RA 3CDIA 1USSA 2OAZA 2BG9E 3KLHB 2KZ7B 1DPRA 4AKRB 4LSZB 3FEZA 1FEHA 1RB0A 1EV7A 2XAHB 3ZGKA 4BC7A 4F36A 2O01C 1FRHA 4N0BA 4C3KA 3OYDA 1NMEB 3JADA 1FJCA 1RJJA 2FZGB 1L3SA 2WBMA 4RM2A 3M6XA 3P9IA 2PMHA 3MEDB 4J9SA 1IJFB 1DARA 3MWMA 1XZYA 1FRKA 5J8CA 3W3SA 1XSVA 3CJTA 3OT9A 3SCIE 3KJVB 2C3PA 4QZVB 2NZCA 3HG9A 1U6BA 2VG7B 3NRXA 5LHHA 2CDQA 1SXLA 3MZIA 2EPIA 1WACA 3GF2A 3IXQA 5EEGA 1HMVB 2U1AA 5M2RA 5D5UB 1JHFA 4ZJZA 2DYAA 2CQPA 5A8RA 2DNPA 4AXPA 2HQDA 1N32F 3CO9A 5EHHA 2QLZA 2DNOA 2E5HA 4PYDA 3S1TA 3POTB 3CCSI 2WDQA 4JI1T 3N05A 3IR6B 1QDUB 2MD0A 1XMKA 4RW4B 2G0IA 2RGVA 5AQFB 4HFBA 4X65T 2UXBF 1HF0A 1U49A 2Z6EA 3PFOA 5F8IA 3KX2A 4LIUA 2D9DA 5B66C 4DV6J 2Z2LA 3HX9A 4B3TT 5JR9A 2C2MB 1UUSA 4Z2YA 2CLYC 4D3HA 1LFWA 3QNWB 1XPXA 4FYXB 4ZS6A 1N5SA 1HPZB 2NVUB 5E3MA 3WTTC 4A98A 2CPHA 4UVCA 3MEXA 3E01A 3L09A 2Y8DA 2XAGB 2CJJA 1RSCA 3MAQA 1LQ1A 4LRAA 1OYDA 2J9CA 4ESBA 1OSDA 2CH0A 1CS4A 1BQMB 3D1HA 2AYEA 1VQ7I 2X9XA 3ILIA 2HLUA 4I2QB 1GTHA 1WZ2A 2MHNA 2J1DG 2VOPA 1FPQA 2LSJA 5LT5A 3QYFA 3OMYA 2UXCJ 4ZVHA 1HNZJ 2XUBA 1VNDA 2F7VA 4KICA 2H1KA 4C30A 1U8RA 3MMAA 4Q5SF 4RKUC 1U2WA 3CVRA 4DBRA 3DLKB 3M3ZB 1ZP0A 3R60A 4USIA 1MGTA 1HW1A 3ECHA 4WXDA 1KU3A 4A5MA 2E60A 1SMTA 1WHYA 1IXRC 3CJKA 1S8NA 3BBCA 3KLEB 4NYOA 3WGHA 1UJ4A 3EGWB 4H54A 2XHWA 5L2LA 2CA9A 5KG1A 2YU1A 1NNDA 2DH8A 3O9XA 4A8WA 1PC5A 1OCZH 1X3WB 5HDKA 4HSRA 4BQOA 1R4MB 2GC8A 1FKOB 3BTJA 3K1PA 4EVIA 3PU8A 4FE7A 3ILJA 5FL1A 1SV5A 2LYCA 3CX8B 4BXFA 4KY3A 3GIIA 1EHWA 4XIUA 3AE6A 2VD3A 2XY8B 3N9LA 2ATLA 2R8GA 1MSFC 5KFUA 2Q6BA 2J47A 3O6BB 1ZEEA 2V79A 1TWCJ 3UR0A 3PSFA 3TP2A 2DHRA 4F2SA 2DMNA 3IWNC 5E8IA 4LMJA 1RT2A 4WFYA 3J81U 3AA0B 2M2BA 1S79A 1V5GA 1QSSA 1HW5A 2V67A 1X60A 1ZV4X 2V1DB 1SH0A 2EA2A 1JNRA 4PXBA 4G6VB 1WWHA 2E9TA 3GWCA 1YQAA 3M30A 3HPHA 2C3YA 2C2DA 4IRKA 3NWGA 5J2NA 5AQIB 4NLDA 5DZ7A 3VU7H 4NI2A 3RHWA 3M8RA 3HO1A 3ZJ1A 2DNXA 1JLGA 2GZOA 2HEKA 2VLAA 1EA3A 4U31A 2KIUA 4WZQA 4DV3F 2N8GA 2XZEA 3KJFB 2XASA 1SFKA 4GIWA 1X4EA 4HDVA 2H65B 3RYCE 2V9PA 3M2VA 1VBXA 4JBCA 1QUUA 4Q5VA 4V19X 2CPEA 1Z0XA 2ZHBA 2ADBA 1T72A 2OJ3A 3TEGA 4XRMA 1IRGA 1GAOA 3LP1A 4DV3T 4B3TF 1X1PA 1H0MA 4IT4A 2QLJB 2M8HA 3M2VB 1S59A 3IBWA 2ZOMA 1OYEA 3W2VB 2V1XA 2Y0BB 3FEXB 1YX5A 4ZCIA 3DMJA 1MZBA 1V5FA 3ZTQA 3K7AJ 2ID6A 4KMCA 5FP3A 3G82B 4DR2T 3GEZA 3KEQA 4G6QA 3R1HA 5LGUB 1HHTP 4X4TA 3VFZA 3BG9A 3JQKA 4PWWA 1YIJI 1I6XA 1HDPA 1T8EA 1KD1T 1MN7A 4DGWB 2E9XC 1JKPC 2EHOB 3J7AN 2KRCA 2RQQA 2ZWOA 2XGCA 5F04A 1WOSA 3P4WA 3I82A 4M8LA 1OQ6A 2KHMA 3FXDB 1RU1A 4EO6A 3CMAS 3F31A 5FD6A 2CPDA 3BROA 3JTNA 3HC7A 2E8IA 2HW3A 2JLFA 2ID3A 3WG7H 3CD0A 3TJAA 3FXQA 1YIJS 4XLCA 1YJUA 3HP6A 3J7YJ 1NKBA 4TQRA 2R5ZA 4LBHA 2MZTA 2C5KT 4PUOB 4U0YA 1IN0A 3V42A 4A0YA 3MMBA 1CSJA 1MU2B 5LMUF 1HI1A 1S0NA 2COBA 1S1WB 3KLNA 1UJ6A 1KQSR 2KTQA 2EBGA 4GRIA 3H5AA 1IN6A 4AXIA 3OUYA 4HPQA 3NP5A 3ZQFA 1S1XA 2IDOB 4G6DA 4DF4A 3OL7A 4CLUA 2J6TA 4ED2A 1MH4A 3ONJA 4PUOA 2WB4A 1UVLA 3C3LA 1BR0A 4XTTA 4F0KA 2W84A 4OIQF 4ZZDA 1HBUB 3SSSA 4USVA 1SD6A 4H4KC 4TZ4C 4N47A 3W63A 2XLJA 3M8EA 1ZA2B 4XMYA 3AA7B 3PW4A 2COMA 3AXKA 2V5DA 1HG5A 3OIOA 4NA2A 1O8BA 1I6ZA 2P9GA 2LEPA 4PQUB 2L3MA 2D3UA 5IV3A 4LF8J 2CUJA 3W2WB 4N8NA 2G1HA 1HQEB 2RVJA 2YH0A 1HNIA 3EDVA 3BR9A 2GZWA 1TQLA 2HWTA 2W9BA 2V4RA 2TRTA 2AV5A 1OXZA 3TLSA 3WQPA 3R6GB 2FZCB 2MZRA 4DOZA 4DV5T 4URGA 5G4DA 2DRDA 3PRBA 1S7EA 2Y0SN 1YJRA 4KFCA 3IRXA 3P50A 1S1VA 2CWKA 3H0GJ 3OYIA 1IGNA 2WMNA 1ZR4A 5LCYA 4FZVA 2RVCA 4IFYA 4HA8A 4HFDA 3GFYA 4XOPA 1SUMB 4X66T 1R6RA 3OTOJ 2NS1B 2CMRA 4XLAA 3OLAA 1U1QA 1N77A 1U25A 3B6CA 1RLCL 2CRGA 3L2CA 1K73T 4A8OA 2HU9A 2Y8YA 5MAOA 3UR3C 3R61A 1LDKB 1NJXA 1ERDA 2B8QA 2MZJA 5KNLA 1WJAA 2A69F 4EZ4A 5HROB 1B0TA 1ZAXA 2YWGA 3SYZA 1SL1A 1MBGA 5AJ3F 5ETSA 1A6QA 2XZDB 1JLQA 2IVFB 2E7WA 2QQAA 2V4QA 5HJYA 5CA5A 4C8NA 2BG9C 1RUNA 3PO5A 1WDTA 4KMFA 3K89A 3VAJA 4CCKA 2A9UA 2X48A 2CVEA 2B0LA 1QZZA 4HX4A 3K5MA 1WC0A 3BWGA 3W8GA 5KVRA 4X66J 4B9TA 5D0EA 1UETA 4RUAA 4LIRA 1FWKA 2MGZB 3GJQB 4OINF 3C2BA 4M94A 3QAHA 2DISA 2F4VF 1RAAB 2W1BA 1ZOYA 2Z8QA 1BIBA 1JKHA 2IS1A 1R9TJ 2EW9A 5HLIA 2LXIA 3IBFB 1S5ZA 3HJVA 3KDNA 1S1UB 2KWHA 4FX4A 2EINH 1XNRT 1M5KC 4LF8T 2WAQA 3OFHA 1YRNB 2JQKA 4DL4A 4ZYDA 2HK3A 1U9NA 5B0AA 1UCRA 2R8KA 3PX0A 3Q2MA 2HR3A 5K5MA 5ETMA 2UUCF 2MQOA 3WZ0A 4ZZLA 3S3OA 2DHGA 4DR7J 2Y2ZA 1XDSA 2WAFA 2HN1A 3BGUA 2BDEA 3ENVA 1HNVA 3FQLA 4AIDA 1IC8A 3V6DB 3MK7C 3I64A 3TYTA 4GC7A 4CHUA 3BR5A 3ELKA 3C15A 4PNIA 1M1EB 4DQSA 1S99A 4QKNA 3BV8A 3UN2A 2DCFA 4IDOA 4HWIB 1NSQA 4B9NA 3PM1A 3DWLE 2G7HA 2WQYA 4ZEYA 3W15B 4A0XA 2KI2A 1S3JA 1UP1A 1R8CA 5J4YA 1HD0A 3M9OB 1RADB 3WAJA 2LT3A 1RT2B 1WLXA 3Q8VA 1N33T 1XD7A 5KFDA 4EM1A 3CC2S 1JNZB 3OL6A 4F4WA 1DP7P 4RU9A 5FLXZ 1WEXA 4OHZA 4CCNA 3LW5C 2HIYA 4E8UA 2FU4A 4TWDA 3SMZA 2OD6A 1P9QC 3O2PE 3M05A 2BG9A 3P4PA 4IE0A 5DCFA 4UHTA 1SFUA 3KJVA 4PR6A 2YN6A 3MD3A 4AISA 2DLRA 3AT1B 1IKYA 3EXCX 4KHRA 3OL8A 3WTWC 4LF2A 2UUAF 4N4OB 2WZ1A 3AD7C 3MEGA 5J1EB 3N2OA 4UVBB 5E3OA 4I55E 2C6YA 3HHGA 4NLOA 1R1TA 2YNFB 1X79A 2D3ZA 2MGQA 1P4AA 4UOGA 1X4FA 2NXNB 5JMNA 3D6HB 5LFAA 4ZIWA 3E1SA 1YQ4A 4U0WA 4OYZA 1WG1A 3RQ4A 3I5AA 4FS1A 4B3RJ 1G3TA 3TZXA 5ETVA 1XC9A 1MDMB 1ZQ3P 5KFBA 2JA7J 2LSYA 3CPZA 2YR2A 4M3DA 1X5SA 1ULRA 5K1YA 4QX8B 2DTRA 3HIFA 4BJNA 2KJVA 2LEAA 4RO0A 3ZTRA 2LOSA 4DZDA 5IYBJ 3M1VB 5CVVA 2BZBA 4WX9A 4X64J 4N7TA 4CXFA 1FLIA 3TWZA 2XNRA 2UXNB 2LY2A 4DLGA 3M1CA 1CQTA 4CIOA 2VQCA 1LFBA 2FVCA 2WVFA 1IBKF 3OYBA 3IP0A 2HHSA 2XAFB 2MEWA 3B02A 2RNEA 2WWYA 1V4RA 2M34A 2M9HA 3TP0A 3Q23A 3PURA 2H1LA 1G3YA 4OQJA 4YR0A 2VE8A 1HBUA 2VG6B 3SFIA 3BKTA 2MKCA 3IH2A 2XMVA 3TANA 3I59B 2K02A 3K3OA 2I8EA 1WI6A 3CCTA 4KP3C 2D3OR 1HX1B 3AECA 1Z3YA 2DEIA 4OLOA 7AT1B 5A2QU 2FD2A 2ECBA 1YVFA 2R8JA 4FPIA 5DS9A 4JEHB 3OJUA 1BWVA 3NBPB 4CCJA 3KLFA 1QTNB 1LW2A 4U9RA 3HHNB 3MAHA 1O3TA 3LQQA 4IFVA 1JGGA 2LRLA 1FP1D 4KN4X 2M8GX 2XF5A 1A35A 3K1SA 5I3PA 4ZVPB 4UIGA 1RAFB 2FC9A 2HQGA 3M2UA 3NKYA 2FNPA 3EZ5A 2F40A 4M3BA 2XMWA 4DSFA 2MYSA 3BZ6A 3K58A 4EJTA 3RB6A 2IBDA 4DR2F 4X1IE 2DKOB 3SJMA 4PK5A 4GK0E 4HEA9 1X1CA 4CTAA 3PFIA 2WB1N 2GIVA 2V2QA 3RC3A 1H2TZ 4ECVA 2XM3A 4GC6A 1CBKA 3OTEA 3I9ZA 4P0AA 1TKXB 2ASJA 2LA6A 4RGXA 2B9SA 1S9EB 2MKIA 3PV8A 2LDIA 3ZZUA 2HYFA 2GGPA 4LT6A 5HMWA 3MOJB 3OR2C 3HR0A 2CUFA 4OU0A 2M88A 1Z4UA 2NYIA 1Y9OA 2V8PA 3EPZA 5JXSA 2JUCA 4LR9A 2IIUA 1HXDA 1EARA 4O4GB 4IRCA 3QGIA 1FDAA 1W5SA 3D54A 3DTIA 3ABVA 2EILH 3DFGA 3JAFA 1QGPA 4OYOA 1K4SA 3SWHA 3BF4A 2DY9A 4AYBA 2LH9A 1Q81T 5C3EJ 2Y3YA 4OMYA 3I0TA 3CD5A 3OBVE 4KPYA 3UCGA 2QQ8A 3BN7A 2RRAA 2NUHA 3SDEB 2MB0B 3PNIA 4DV7J 3A4CA 4DQIA 3OSNA 3SFUA 3M4XA 2PI4A 4IJAA 2F5FA 2AJ0A 5J47A 3BPVA 4K7QA 2Y9ZA 2O1PA 6PAXA 3FBLA 2DA2A 2PEBA 5C4JJ 2RRNA 4IXAA 2YX4A 1VQNI 2CNKB 3GP9A 1LWEB 2NVYJ 1HNZF 1O7FA 3SQGA 2YU3A 2DR9A 2HMIB 1ON2A 3BBFA 4MT1A 2F8EX 2MZ1A 3O3KA 5LRRA 3WE2A 1T7SA 2LF8A 5H20A 1Y39A 3CCJS 1T05A 2OA4A 2ES0A 2UXDT 1QY7A 4XICA 4NZ0A 1D1BA 4DHVA 5BR8T 2X51A 4X4SA 1N5TA 2HVDA 1W0BA 5EDWA 1GNKA 1ZELA 3DRPA 2XM1A 2J7WA 5D78A 3KLEA 3EX7B 2A0FB 4Y17A 4LMYA 1WG5A 4JI0T 5B5EC 4II3A 4M9SA 3FMBA 4K0KJ 1CPZA 2JA8J 4FNHA 2RV8A 2ZXJA 2BOLA 2Y0SD 4IO9F 1NBEB 3P4QA 1T0FC 3CWZB 5EF6A 2R92J 2EH3A 3P4RA 2UU9F 2FXAA 1ZLKA 3U78A 3LOUA 1NCLA 2JFKA 3R27A 3AG2H 4N5SA 1OISA 3BQ1A 2DK2A 4RB2C 2VL0A 2E1AA 1R89A 1ZKEA 3DDIA 4DCPB 1YBAA 2XMTA 4LQ9A 3QRPA 2D1CA 4ISSA 2BEOA 2WSFC 1OO0B 3I96A 2LOOA 3ONXA 1E6VA 3GIJA 1HDDC 4F4KA 4RW9A 2LSKA 1WHWA 4CYUA 4IRHA 2UXBJ 1UFMA 1UCNA 4O3PA 3A8EA 2YY3A 2B7EA 5IOZA 3TBIA 3C16B 1K0VA 2DT9A 2DDBA 3Q22A 1F2GA 4L5EA 3Q0UA 4FX0A 4L9JA 5DDPC 3FXRA 4JI2F 1BN5A 2ZH1A 4R0EA 4WBNE 4RAFA 1G3WA 2DJNA 2LKXA 3RGLA 4C6AA 2BZTA 3R6LB 4EAHA 2J0SD 1EB0A 1B9MA 5HCMA 4NCGB 4NBQA 1AUSL 4EZ6A 2QLXA 3CEDA 2CAJA 1X5PA 4YHHJ 5ETQA 3E97A 4WZXA 1F2HA 2HDWA 4OMZA 3MZ8A 1IR0A 2YUSA 2HBQB 3QWUA 2QFIA 2ZD1B 5AXMA 2KSRA 1FOYA 4DNCA 4F3OA 3Q5DA 2IVYA 5LGTB 4KNYA 2BJ7A 2WOMB 3F8BA 1Y56A 2BHZA 4JOMA 3B8HA 4YR2A 1UVJA 4PWUA 1LW0A 3QIPA 3OD2A 1RT6B 2VDHA 3CP2A 2FHMA 1JTXA 1DU2A 3N9OA 2ICWG 2HHPA 5JDHA 5FGMA 1R0AB 1KQFB 3VCDA 1EH7A 4ZJQA 2I5UA 4MALA 3RRKA 2F9JA 3OPCA 2VPRA 3P45B 3BQKA 3Q83A 4F67A 4G12A 4BDYA 4KR0B 4GYSA 4O3SA 2HTJA 4XRSG 4ID5B 4W1UA 2NWBA 1RAEB 2V8DA 2EG1A 3OKQA 1GVDA 5LOQA 1EH6A 2KIMA 3HD1A 2VC1A 4Q48A 4L3NA 4KAIA 4PAGA 4DO0A 1NH7A 5L1KA 2J8SA 4P2FA 1FK9B 4IEJA 4BE2A 1OCOH 1JLEB 2HVQA 3TVYA 2KRRA 5CD4H 3RRWA 2M4KA 4WXOA 1WI3A 2W66A 5A1LA 1X4GA 3P4SA 4W98A 1TFYA 5LMUJ 1ITPA 3BO2A 4M95A 3OYZA 2K40A 3PNTA 5JR3A 3CESA 1S1TB 4YFXF 2MSYA 4MHCA 2IC6A 3EM1A 3S4UA 3VKHA 1JNZA 3A7MA 3BKUA 2EXUA 2HYGD 4A3IJ 3MOZA 2CUZA 2MG4A 2YU9J 2XWXA 1PAUB 5JVGQ 4FCYA 1W0TA 2XS7A 3Q8SB 2YBVA 2BS3A 2CXDA 2HZAA 5A2QY 1HMVA 2ZLYA 1ZTTA 5CA1E 2FVSA 2IEKA 5JDFA 1TC3C 3MWBA 1JJ4A 3GG0A 1I6HJ 1R27B 5LGNB 1NHAA 2G0EA 4ZLPA 2BX6A 4G7OF 1F9EB 5DUIA 2Q2EA 2GLOA 3HOTA 2K9QA 1RHKB 2PA3A 4TLQA 1Z7UA 1RT3A 1TL1B 4NLGA 1B99A 4LD5A 4ZYEA 3PL8A 5IT0A 3PO2J 4MYUA 1FOKA 2R5YA 1Y3KA 3W66A 2XI3A 1GV2A 1JQGA 4DIDB 3AB2B 5A2QZ 1CJVA 4ZPBA 3R7NB 8ATCB 2CM0A 2OP5A 3TX0A 2CHOA 4RR5A 4OZ1A 4JV5F 4BQQA 1D9DA 4M1KA 2XSAA 4HYKA 1K1SA 3ZEFB 2I6WA 4TU9A 1EP4B 2DT5A 3CX7B 1S9HA 4A12A 2H51B 2MY8A 4L9IA 2CQQA 3OYEA 2NPIA 3U1KA 2XMUA 3MR3A 3PACA 2WRMA 5CD4A 2D45A 3NGTA 4F02A 1FP2A 2OU2A 1FXDA 3R5CA 1RHUB 5ETLA 4COFA 3I71A 4G3IA 2DAOA 5LSOA 3CTAA 5LYJE 1IM4A 2FNAA 1HFAA 2FHOB 5ICFA 4X4OA 5L1LA 4ZXLA 2E36A 2JH3A 5GPCA 5D4PA 2ZH2A 1U24A 2A3DA 3HUGB 2L7MP 4RDUA 1T03A 4O5VA 3RH3A 1NSAA 2P7CB 1F5AA 3IKVA 4A3DJ 2XAJB 4DV4T 4CYDA 3EE3A 3NY0A 4ECWA 1WJBA 1VDHA 3CDUA 3RYHE 3IAS2 5IQ6A 4JV0A 1WJCA 3D5MA 3WTVC 5JQGE 3SCJE 1IBMJ 2LEBA 1FVSA 2VKZG 3RI5A 5LMNF 1ETQA 1OYYA 1UJ5A 3DGVA 4P52A 1QBJA 3HKZN 5TAOA 2X9YA 4PUSA 3QOPA 3T1YT 1HI8A 4JBAA 4B3MJ 1G73A 3G9CA 3RYFE 2KJBA 3CC2I 1PO6A 3K4CA 4GDFA 3CNQP 2A6HF 2IC3A 1MIJA 2E5JA 2FJDB 1TWHJ 1FTRA 2ABYA 1X0FA 1EETA 4J37A 4IDKA 4ECZA 1OQYA 2HQCA 2EIMH 4EYYR 2AGOA 2KKOA 2KMUA 3V6DA 3TGNA 4AYBN 1VQ6S 2VT2A 1AT1B 2XO7A 4YJ3E 1XMOF 2JQ9A 3ZT7A 3AE4A 3OYXA 1ZAOA 3FXJA 2L4MA 5H9EJ 1MSWD 1S97A 1FBUA 3THVA 1RYRA 4B3RT 5GADI 2C28A 2WZIA 5B0GA 1TUGB 2E5IA 3PKYA 2GX8A 2A6TA 4I4TE 4JOUA 1BW6A 3LSPA 3F73A 3KP5A 5CAAA 2ME6A 3L7UA 1LB2A 1QSYA 4MTEA 1RTZA 2IT0A 1XMQF 1NK7A 2XTLA 4HF2A 3DU5A 1OY6A 2OI2A 5EZHA 2HWVA 2BZ2A 3WHBA 5EX3A 3K2AA 4JV2A 5K8NA 3M32B 5HVQC 4PSWA 1SJQA 3FDSA 4ES2A 2HHUA 1KR4A 3L00A 3H36A 3KVAA 3K0LA 3A0HC 2VBZA 2OPTA 3KDSE 1BMQB 3DXBA 2BS2A 3M8SA 3MCOA 3KLGB 2VICA 4WCGA 2HPIA 2XQ7A 1GX6A 5EGOA 3AG3H 1DLOB 3AVRA 2HNZB 4R0JA 1RR8C 3OTCA 5HEOA 3G86A 1R58A 4B3AA 2LMDA 4CDGA 4U88A 1WOOA 2WU2A 1Z2ZA 2J7UA 4NNJA 3TW7A 2JDJA 3FXUA 3J7Yq 3A2KA 4UUXA 4M9ZA 5H2FC 2FF4A 1YS6A 3TP3A 1T0TV 2NLWA 2DL1A 3B6BA 2GK9A 4QWNB 4WWCA 3NLCA 2JC0A 4I99C 2B56A 1ZH5A 3QAEA 5J2PA 4FE4A 1S4EA 2X7IA 3KK1A 4A97A 4C2MJ 1E3HA 1X0PA 1RWMB 1M5OC 4B3MT 2RQ4A 4G94A 4OV6A 5KT5A 4PW8A 5IWAF 5KT2A 5L9XA 4H9NC 1C0UA 1F5CA 2YQ1A 2QENA 3PEJA 2WVBA 2BE2B 4RX6A 3JSMA 3HD2A 4QXBB 1U6FA 2UP1A 2BKNA 1IBMT 2XGDA 1J59A 4HL9A 2VL8A 3CD6S 3PR5B 4TU7A 5I3UA 1LUJB 1Q86T 4UZBA 1TLHB 4ZLLA 3T1YF 1O57A 3DRXA 2JRMA 1W36C 4HWCA 4IIJE 3K57A 1YX3A 4KGVB 3FSIA 3O1LA 1CJKA 1D0ZA 1OJ4A 5KFWA 1IJ5A 4AYBD 5M5XJ 4WK3A 2E9XB 1T3OA 4Q25A 3D7SB 4DV2T 1FFGB 2D69A 2YX7A 3I9V2 4EGLA 5JRCA 3J7ZI 3K4JA 3FZMB 2XG8A 4UOCA 4B3SF 3V4GA 4DUZF 1VIOA 4EYIB 2MH2A 2G0CA 1N0VC 4NZ6A 1P27B 3EUAA 3S3MA 3MM5B 2LSIA 4ANDA 2RH3A 3DEEA 1ZGWA 4ZKAA 4P2XA 2HH7A 1TNTA 4HT7A 1U09A 5AE3A 2FIUA 2GHPA 2RNGA 2W1OA 2CV0A 2LG4A 4Y3CA 4IDNA 4YT0A 3IR7B 2EFOA 1WSVA 3M2RA 4JI5F 1ZAVA 2GQCA 2G9OA 3Q5FA 3M32A 1CULB 1AU7A 4XAXB 1CJUB 1X2MA 5ABGA 4TQSA 3RZOJ 3PCOB 4HE8A 2GQ2A 1D8ZA 3K2ZA 5K8PA 1KZHA 2VB6A 3CC4I 1Q78A 2CJXB 1FT9A 3K8VA 3HSFA 5CYJA 3M7VA 1X5TA 5D4LA 2HS5A 2CJBA 1HYSB 5LJNA 3DQVC 2XZTB 3W9JA 3IS9A 1HCRA 3VGVA 5AQGB 3L9ZA 1RHMB 2IMLA 1NHUA 4L74A 2GOMA 4OMFG 5HQLA 4ECTA 4I6AA 1BR4A 5KT6A 2ETHA 2HNZA 3LANA 2V2VA 3AA8A 2HNYA 3GMIA 2DT7B 2HHHJ 3CO0P 4QPQA 4B3TJ 3FBNB 2P9EA 2R3SA 3MFHA