3L09A

Crystal structure of putative transcriptional regulator (jann_22dec04_contig27_revised_gene3569) from jannaschia sp. ccs1 at 2.81 a resolution
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
250
structure length
250
Chain Sequence
SDPIRPLVEALNAEAPLKLWSVLVTCLGDVSRDGVIEVSGVALSSFVERMGLQPQAMRVALHRLKRDGWVESRRLGRVGFHRLSDSALTQTRAVAGRIYGPGAGPAPWHLAGMPPDAPDGLSLLPDTLSATPISRRFALICGPLEDVPEDWLLTAPSGRGLPVWVQDVVVEAGCEAEFKALERTLAQIDKVPDTRLERFTLRVLVLHAWRRLILRSSPAAEAALGGARAEISCRARVHQLLDQLGSVEPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative transcriptional regulator
publication title Crystal structure of Putative transcriptional regulator (JANN_22DEC04_CONTIG27_REVISED_GENE3569) from Jannaschia sp. CCS1 at 2.81 A resolution
rcsb
source organism Jannaschia sp.
molecule tags Transcription regulator
total genus 80
structure length 250
sequence length 250
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07848 PaaX PaaX-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3l09A02
1.20.58.1460 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3l09A01
3.30.70.2670 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3l09A03
5CVJA 5FLXZ 1P4AA 4BH9A 1ZRDA 1GVJA 2C6YA 3RIRA 5FLXK 2P5KA 1FYKA 3EUHA 1FBUA 2XVCA 3IRQA 1AOYA 1XN7A 2F2EA 3LA3A 4G6QA 4LLNA 2QLZA 4YIFA 4MNUA 2K7LA 1YW8A 4IRGA 3CO7C 3KEOA 4I2OA 4GYIA 2W57A 4WXDA 2YPRA 5H20A 3QRFF 3F8MA 5BS6A 4IRIA 4LG0A 5HLIA 1G4DA 1I1GA 5DV5A 4ZZDA 3GEZA 5DUIA 1HW5A 2RGVA 1FPQA 4HAMA 3IRRA 2DO7A 1ZREA 3HYIA 1QBJA 5BOXA 4MQ9F 2G7UA 3VB2A 4KIGA 2CGPA 2QYOA 1IRGA 4IVNA 3HTUA 4WF2A 1F1ZA 2DLLA 2MH2A 4I09A 4MTDA 1T2KA 5DDGA 2KJBA 3N4MA 5A2QZ 2Q8KA 3ABUA 1BOAA 2FQ3A 2GQQA 2H09A 4OIOF 1XDUA 5A2QK 1HBXG 2VT3A 3QU6A 4GO1A 2VOPA 3REOA 2IW5A 3ISPA 2RN7A 3KP5A 4YIIA 3HRMA 2Q2EA 4EMSA 1IRFA 2FU4A 3MAJA 3LWFA 4G9YA 1T39A 1J2XA 2ZXJA 3F23A 2GXBA 1U6GA 4RAYA 5L3BA 5LLQA 1E17A 5JR3A 1TTYA 3DV8A 2XAQA 5E1ZB 2VC1A 1KQ8A 3B02A 2TDXA 2VE8A 3GW2A 2RVCA 2MC3A 2KJCA 2ETHA 3T1BA 2E1CA 1K79A 1KYZA 2OQRA 2OU2A 1P6RA 4BAYA 1SMTA 4Q4ZF 2OZUA 3V8KA 2E7XA 3OOPA 4U0YA 1S29A 5E18F 3WTUC 2AXLA 1S8NA 1BI2A 1O57A 2QM3A 4OMZA 2M30A 1W5SA 3WTZA 3GFIA 5CVUA 4EGZA 1CF7B 1IUYA 5HS7A 1IXCA 4ESFA 5D4RA 4AIKA 2BGCA 1HXDA 3MQ0A 1YYVA 2HEOA 5H6RA 3IKVA 3WGHA 3JTHA 1U5TC 4HOBA 1MKMA 2HR3A 2W84A 2R7FA 2QQ9A 1FWZA 1QZZA 3G73A 3TDUC 1ZYRF 2XUBA 2RDPA 4HA8A 3KP3A 1HW2A 2DK8A 4Q47A 5ICGA 2EV0A 4L0YB 1XGNA 2J5OA 2IA1A 3FMSA 5ED4A 2JPBA 4ENNA 3K9TA 2ZCWA 5FFZA 4HX8A 4I01A 3I54A 2XROA 2YX4A 5FGMA 4U88A 3ZMZA 4K2EA 1PP8F 4L9NA 4HZFA 4BNCA 1SFXA 3EETA 5LRSA 4MGRA 3K69A 3R0JA 3HSEA 4EJTA 5D5VB 2ZNZA 1R58A 3RTRA 4IHTA 2FF4A 4HV6A 4AVPA 3PQJA 4M6YA 2IP2A 5TRDA 1LJ9A 5D5UB 5K1YA 2Z99A 5TJJA 2IA0A 5ILSA 5EEGA 3LAJA 3QOPA 3TGNA 3GFMA 1FC3A 4KA4A 4OINF 1UHMA 1JGSA 1REPC 4MEXF 1YIOA 3RPUA 1XGSA 3WTXC 4BHPA 5AIPA 1J75A 4M9SA 3FMRA 4U0VA 4ZYHA 4QWQA 2O6GE 1Q1HA 1I5ZA 2VBZA 3DXJF 2XKOA 2P6TA 4L9JA 4GXOA 3MEXA 3ZMVA 5LGUA 2XRNA 2LF8A 3U9GA 1R1UA 1XCVA 2RC4A 4LLLA 2EK5A 5ILUA 3ZN1A 3C7JA 2FMLA 1BIAA 2A69F 1Y0UA 1XSDA 2XV4S 5E17F 1ZRFA 2J5PA 1R5HA 1H0MA 1MGTA 3F8FA 3W6KB 3BP8A 3JSPA 4L9TA 1ON1A 3M8EA 3V4GA 5FD6A 1AWCA 2VOOA 1DPUA 2X4HA 2LDUA 5BPDA 5HS8A 1IN6A 3MCZA 4TV7A 5HDNA 1WQ2A 4FX4A 4Y15A 1ZHFA 4HX4A 5ICEA 1MJAA 4KMUX 4RGXA 2QBYB 3CJNA 5CJ9A 1GXQA 2ISZA 2W25A 2HGCA 2OBPA 3P9KA 3QP5A 4UVAA 4OMYA 1ZN2A 4B09A 3BOQA 4Q5SF 5CLSA 1KU9A 1ZAOA 2CWEA 2Y48A 3HIFA 2O03A 4HLYA 4OIPF 1ZLJA 4MTEA 4G6DA 3GYHX 3ZPLA 1Z91A 2FRHA 1J7KA 4R79A 2KRFA 2XGXA 2VODA 4N0BA 2DW4A 2WTEA 2IRFG 3GX4X 1YS7A 2EV6A 4IF4A 2L01A 1FLIA 2GA1A 1IAWA 2HTSA 3VODA 2Z5UA 1VTNC 4RAZA 5FB2A 4DQ2A 1S7OA 1KU2A 1R00A 4ZYDA 1FT9A 4CXFA 5J8CA 5EEHA 2M5WA 3SZPA 2ZKZA 3F8BA 1QZYA 4RGUA 1EH8A 2R7DA 4CZZA 3EYIA 2ELHA 1Z1DA 4UUVA 2V1XA 4ENJA 2WWYA 4IJAA 1YW7A 2QVOA 1EH6A 3KP2A 1W7PB 2NNNA 4M9XA 4HX7A 3I53A 3R60A 5L3DA 2YU3A 2R3SA 4HF2A 4KN7X 3ELKA 2IVMA 4L0ZB 4KFCA 2IPQX 4M71A 3CO6C 3F8NA 4NHJA 3RKWA 1YG2A 2ZO4A 4BQAA 1XGOA 3K1PA 1P2FA 1K78B 4IHSA 2WV0A 2XASA 2QENA 3Q5FA 5D6FA 4HDVA 1JE8A 4LJZF 4BHBA 5E1XA 3JTGA 4PGGA 4NB5A 3HRSA 5DUKA 1O7FA 3DQVC 5LHIA 4G7HF 2IA2A 3SQNA 1HKSA 1BC8C 2XAFA 1G3WA 2JZYA 1MD0A 3I4PA 5ILVA 1TNTA 4P9UA 3BJ6A 2PG4A 2H94A 4A12A 3KP7A 3CUOA 1WI9A 3ECOA 3PQKA 1CF7A 4DNCA 1H9TA 3M7GA 5ICCA 4A0YA 4G8XA 3U2RA 2GZWA 4EJUA 3HTSB 3HRTA 1D5VA 4PDKA 1SD6A 2ZBKA 4RS8A 3LSTA 1EV7A 3ZMDA 3IHUA 2A61A 2GWRA 1LB2A 4O5VA 4A0XA 2STWA 1TQPA 3BJOA 5DD4A 4S05A 3RDIA 1FSEA 3E6DA 3WTTC 4Y17A 4A6DA 3IWZA 1IXRC 2QQAA 2CG4A 5J8FA 4B8XA 4RB3C 2DT5A 4L18B 4L5IA 4PCQA 1TBXA 2CYYA 2O0YA 2G7HA 4RB1A 4GYGA 2X0LA 3G3ZA 2OD5A 1XB4A 4H0EA 4ASNA 3WGIA 4EJWA 4I0AA 3QPHA 2K4BA 3VEPA 2KIMA 2GAUA 3CUQB 3GUDA 4L5JA 1F4KA 3FXRA 2RKHA 3D0SA 1IW7F 2G9WA 3JSOA 2PBIA 1P4XA 2JT1A 1MJ9A 4WK8F 3RPQA 2EA4A 1U3EM 4HLXA 4A0ZA 4KUMA 5D4SA 2Z9OA 3LFKA 5JI6A 3KP6A 1LDKB 3BJAA 4XBFA 1TQIA 5E8IA 2NAZA 1W5TA 4EGYA 3P9IA 1T38A 2PI0A 1KU3A 4LFUA 1Z9CA 4ZZLA 2ZFWA 2P8TA 1GHCA 5DCMB 2V1UA 2E1NA 2M1BA 5FD5A 2DQRA 4XSXF 4EJVA 1UHWA 2HDCA 3KCCA 4R1HA 5F6FA 3VOEA 4MEYF 1SMYF 3T8TA 3HSRA 3E3VA 4CO8A 2DBBA 3DEUA 4HF1A 3W6JB 3ROUA 5D8LB 2IJLA 1YO5C 1ON2A 2LSOA 1IXSB 1P92A 4QLCU 1XDSA 5LBQA 2M87A 3KLNA 4Q48A 1UCRA 2NYXA 4O6JA 1O7LA 4N9HA 1BI3A 4OOIA 1IZ1A 2QBYA 4AIJA 1DPRA 3FF5A 4Z2YA 2HFHA 3TDZC 4YFKF 4M6XA 4NQWA 3GZ6A 4ESJA 5DEQA 3CLOA 1B6AA 3ZMSA 3IC7A 1O3TA 3SZTA 3HRUA 3PFIA 1Z7UA 2FA5A 3FX3A 1B1BA 4JK1X 3HUGA 4YFNF 1IN4A 3P9CA 1IN8A 1XMKA 3DPLC 4CDGA 1XCBA 1ZG5A 1FP1D 3JAMZ 3E6MA 5LGNA 2A07F 1J59A 3V7RA 3ULQB 2XAJA 3EDPA 3TO9A 3JAMK 4LD5A 1ZLKA 2ZNYA 5CYVA 1K7AA 1USTA 2UXNA 4WWCA 1PP7U 2W85A 1DDNA 2QUFA 2HQNA 3WU0A 4CICA 4XRFA 4CYDA 1TNSA 4N9IA 5FFXA 4UXNA 2GIVA 2L4AA 3FHZA 3T0YA 3Q9SA 3F3XA 1RUOA 3I71A 5L3EA 2HOEA 1G6NA 4A2UA 3RYPA 2P7VB 1YFHA 3HSFA 1MDMB 3TO7A 3NQOA 1W7PD 1ODDA 1W7PA 3GFJA 1FYLA 3QPTA 2PEXA 3LQQA 5AONA 4CGZA 4E70A 1V3FA 5K5OA 3F72A 3WG9A 2HS5A 4UHTA 3I59B 3GZ5A 1IN7A 3M1EA 1ZH5A 2DU9A 4EJOA 4PGHA 2FMYA 1OKRA 1USSA 4RB2C 2JTVA 1WRJA 2RV8A 1K78A 2CSOA 2Y0MA 1OYWA 4EV0A 3RI4A 3COAC 2MA3A 2FBIA 2KKOA 1WWXA 4UV9A 3TO6A 3WTSC 2VBYA 2FE3A 1HQCA 3F6OA 2PFBA 5BQTA 2FXAA 3DF8A 3J80Z 4KNYA 2OZ6A 3C1DA 3V8JA 3J80K 3TOAA 2ZMEB 2EA2A 4ESBA 2MBFA 2M45A 1R5GA 2VC0A 1U8RA 3GO5A 5LGTA 3L7WA 3WE3A 2DTRA 4WXHA 2FBKA 3WU1B 1RUNA 1OMIA 4I98B 3KE2A 3E5UA 1FBQA 2HWVA 5LHGA 5E20A 4MQVA 4A5MA 1QO0D 2O8XA 1A04A 1R22A 3C18A 3L9FA 2VT2A 2FNPA 3I64A 2W24A 5HDKA 1O3QA 2A6EF 3L09A 3FM5A 2PMUA 3DP7A 1PDNC 2BV6A 2CFXA 3D5LA 3HHGA 3P7NA 1R7JA 1SD7A 1HW1A 4BYYA 2UXXA 2EFPA 3SHFA 3AAFA 2V6CA 5CVVA 4AWXB 3IKTA 2FNAA 1LDDA 3KEQA 2BEOA 4D0PA 1XMAA 1FBSA 4BHCA 2KIUA 1HKQA 3JW4A 3V7SA 5JHUA 3L00A 1Z05A 2JRTA 4OU0A 2Q0OA 1I27A 4G7OF 3TQNA 3BROA 3FMQA 3BPXA 2QZ8A 3CUQA 2OA4A 5ERIA 3FWEA 4HQEA 3KP4A 2UZKA 2EFOA 3T8RA 2DPDA 3T5XA 1R1TA 2P5LC 1H9GA 1B4AA 1HSJA 2E7WA 4WXCA 5D6EA 4UVBA 2VE9A 3BY6A 2GA2A 1RIOH 5K5RA 1U5TB 3DFGA 3E97A 2K27A 5DCMA 2PLYA 2F5FA 2A68F 4A6EA 2JPCA 1FNNA 3EQLF 5DCFA 4IRHA 3TOBA 1G3YA 3KFWX 4IPAA 3J81Z 3BDDA 1J5YA 1ZGJA 1OR7A 2QWWA 1T6SA 3HOSA 4XLPF 3J81K 1T0FA 3WE2A 5L3FA 2ESNA 1XGMA 3FZVA 2BE5F 2ESHA 3OV8A 3V7CA 1X3UA 1XSVA 2MH9A 2DAOA 3R6SA 1NHAA 2F5EA 4ZH4F 5D8KB 4JBAA 5HS9A 1BI1A 3QAHA 3BWGA 3ABTA 3ERED 4KYWA 1JHHA 4I02A 1S7AA 5IT9Z 2Y75A 4P9FA 1OYYA 4M73A 1TQMA 5D5WB 2XHKA 1FSHA 3V8LA 1UB9A 3NRVA 4FHTA 4HV5A 5IT9K 2DK5A 4UV8A 4HBLA 3M9AA 3ZMUA 4BXUA 3L2CA 1GXPA 4HQMA 2STTA 3S2WA 1JXSA 1LVAA 2AS5F 1ZG3A 2JSCA 1ONVA 1G3SA 2XAGA 3MZHA 2P6SA 1V4RA 1MJBA 2A6HF 1QGPA 4LK0F 1J9IA 4YFXF 3SFZA 2BYVE 2V1DA 2GXGA 2IT0A 2CO5A 4U7DA 1BM9A 1T98A 3F6VA 3K1NA 1HKTA 3ECHA 1SFEA 3E5QA 1DUXC 4U7BA 5DYMA 4G94A 3K0LA 1P4WA 2CW0F 1S3JA 1KYWA 2LNBA 3E6BA 2FSWA 2D45A 5ICFA 1U78A 1SD5A 4FX0A 1J0RA 3GVAA 2XKPA 1LQ1A 1S6LA 2A3SA 1MDMA 3GLXA 4FT8A 2HKOA 3O3KA 4OIQF 3ZMTA 3K1MA 4KMFA 2FBHA 3F22A 5K5QA 2EJRA 1WSUA 4XSZF 1Z6RA 3LA7A 4U0WA 1YTYA 1DP7P 2VONA 1D3YA 1KQ9A 2LKPA 2EFQA 2L4MA 1L0OC 2DFIA 2L3DA 2PN6A 3I59A 2V9VA 1TW3A 2H27A 2L54A 2RQPA 4LG0B 4ON0A 1ZRCA 4EM0B 4M9ZA 3K2ZA 3I5UA 1JHFA 1EH7A 3BZ6A 1RZ4A 2OAZA 1KGSA 1BI0A 4XLNF 3GFLA 2M8EA 4RGSA 1I6XA 5LEKA 1ZG1A 2DI3A 3WODF 1YLFA 2BBYA 1FX7A 3H92A 1LNWA 3RYRA 4R8HA 1YW9A 1BIBA 1STZA 3ML6A 3RJPA 4IXAA 1XD7A 3WGGA 3KZZA 5L3CA 4ENMA 2EV5A 2D2WA 5BPIA 4KICA 2VXZA 3N97A 1F5TA 3CTAA 5CVIA 4LK1F 2ZMEA 5HOOA 1BC7C 5F1RA 4KIBA 1B59A 3MFKA 1YQAA 2KIFA 3SXYA 3MZYA 2HQRA 5HLGA 2MLKA 3VFZA 3I58A 1B9MA 3B73A 4M74A 5FO5A 5JFRA 1G3TA 3QU3A 3GF2A 3LAPA 1QNTA 5F64A 2DPUA 4WX9A 5AIQA 4LLGF 2VBWA 3O6BB 2K4JA 1OYIA 2F5DA 3RKXA 3R0AA 1R1VA 1KU7A 4CHUA 3Q9VA 5J6XA 3H3UA 4HW0A 4RGRA 2CQKA 4EM2A 1BBYA 1KQ0A 3CUQC 2HTJA 4ETSA 1ZARA 1O3RA 1L3LA 2HKXA 3HHHA 4RB0A 1R36A 4UNOA 2LF7A 1ULYA 1YS6A 2H6BA 2O61A 4G7ZF 2UWMA 2K02A 3TKYA 4PZJA 1OPCA 2ACJA 2A5YB 3M8FA 2ISYA 2PMHA 5HVQC 4O3MA 3DKWA 5L3GA 4UVCA 5LHHA 4HF0A 1SFUA 1K6OA 2OQGA 5LEJA 5KK1A 1W4MA 1KA8A 2EB7A 4JQFA 4KT5C 2NNYA 4HYEA 2YX7A 3KLOA 4Y13A 1QQIA 1B9NA 1FZPB 2VBXA 3H3ZA 3NEUA 1MZBA 1TW2A 2P5VA 2FEZA 2WC2A 1D8JA 3IL2A 4I0BA 5D5XB 2ADUA 2O3FA 3DPTA 4EVIA 3F21A 3FXQA 2DQLA 2HYFA 2K86A 2NRAC 1XSXA 5KVRA 2F5CA 1RNLA 1FYMA 1LEAA 4KN4X 1U5TA 5H6QA 4ZYGA 3ZQ7A 5CVRA 2QQBA 1PUEE 5E8GA 2Z3YA 3FM3A 4ENKA 3KETA 1R23A 1IF1A 3GXOA 2L02A 1D8KA 2P7CB 4YG2F 3WTYC 3LA2A 3MWMA 6PAXA 2XAHA 5E1WA 5IT3A 5LRRA 4OIRF 4P55A 4AIHA 2XIGA 2H6CA 1LEBA 4KIFA 3F8CA 1SAXA 1C0WA 3O2PE 1O3SA 1Z6TA 4GCVA 3ZN0A 4EM1A 3ZP5A 2B0LA 3R4KA 4MHGA 1SD4A 4P96A 3IWFA 1CGPA 3HOTA 1FOKA 1FY7A 3QP6A 4AD9A 1TLHB 3J7AO 4L9VA 4P5OA 1QPMA 4LB5A 2EFNA 1U2WA 2EWNA 3EYYA 4ZYEA 4A5NA 1E2XA 1WKMA 5BMZA 4LB6B 5DD8A 2PJPA 5HDGA 3WTWC 4F7ZA 4WCGA 2COMA 1RI7A 3E5XA 3E6CC 2MD5A 1F9NA 2RNJA 3C3WA 2YSRA 2Z33A 2HZTA 5HLHA 4LGWA 3U1DA 1FP2A 1HSTA 2VN2A 1I1SA 4I7HA 2D1VA 5JVTA 2PQ8A 2EFWA 4S04A 1BJAA 2MLGA 3CDHA 3BPVA 1IN5A 3LQRA 3R61A 1BN5A 2YR2A 4EQQA 2NS0A 1ZGAA 2FOKA 3WTVC 2V79A 3FXUA 2ZJ2A 3GWZA 3KZYA 4HDUA 1UFMA 4M72A 3I0TA 2P4WA 4GGGA 4KDPA 2D1HA 2HYGD 4LMYA 1LDJA 3RKYA
chains in the Genus database with same CATH superfamily
2X6WA 3CC7I 3MM7B 2GO8A 2HNZB 2DGXA 5FLXZ 2W67A 3HVTB 3IM9A 4ZVSB 1L5UA 2OUMA 4UVAB 2X6OA 1IKWB 3NNHA 1GVJA 2E2AA 3RIRA 3HHEA 4YSYA 4Q44A 2KSRA 2CXEA 3EGZA 2BQRA 2P5KA 4MYUA 2QLXA 3WIVA 3GTPJ 3RZAA 1ZELA 3BH6B 4HWIB 3LA3A 2HOSA 2Y48B 4GO7X 2QLZA 1LPQA 2O3DA 3C16B 2ZJRQ 4YIFA 4KPYA 1SHZC 4IRGA 3CO7C 1ZAVA 4EI2A 3QYEA 4F3OA 1J5ET 5L1IA 2KISA 1MN9A 1HF0A 1DQUA 3NAIA 3AVRA 4CYUB 5JR9A 5M2PA 4GYIA 3W66A 5CH7B 2R2RA 1HHTP 2J7KA 4MFDA 3QRFF 2LLYA 4JYAF 4HFBA 1HLWA 4R25A 3JTOA 4CO0A 1R31A 4JI6F 2D3OR 1XQIA 1I1GA 3WAKA 4P7VA 4X66F 1WJBA 1WDDA 2DEJA 2V4JA 1ZKEA 4TWDA 3IRRA 2COLA 2DO7A 2I6WA 2HVQA 1ZREA 3HYIA 1TL1A 1WC4A 2ZHAA 2C42A 4IDNA 4PZVA 3D6HB 3VB2A 4N5SA 4F7VA 2OPTA 2CGPA 2XMTA 2CXDA 4ZA1A 2ZMEC 3RAQA 3T6BA 2ZXHA 1HNIA 1Q1KA 4BBRJ 1F3VA 3AA7B 3VR9A 1FXRA 2KWHA 3Q86A 2N2NA 3CLQA 2LHNA 4JV5F 4WF2A 2AX1A 2FLPA 3QLHA 2YKNA 3CQZJ 3OL6A 4ERDA 2MH2A 1LFUP 3S2HJ 4UUSB 4IO1A 4O4RA 5A2QZ 1LXNA 5CA1E 3H2LA 3K5PA 3ULHA 1YJVA 2RKIB 2LVWA 4CO5A 4C8NA 3WHIA 3RIUC 1OS5A 3REOA 3KUHA 2IW5A 4U95A 1W7WA 1GX5A 3GTYX 4FNHA 3CX8B 3BZQA 3CVKA 2M6IA 4EMSA 3N9OA 4RAFA 4F25A 3TZZA 1IRFA 1M0SA 2NVTJ 2E36A 4OI2A 2EQRA 1J2XA 3CJSA 4EWTA 4CYCA 2EG1A 5LLQA 2QSHX 1JI8A 3S1QJ 1O8BA 2JRKA 1KTQA 2ZHOA 3W3CA 2DA7A 3UVJA 4U72A 2Z16A 5E1ZB 2H5IB 1DBDA 4GOUA 2GX8A 4HRIA 2V94A 4NZ0A 1UVMA 2P8IA 2WBMA 1T9WA 3DRXA 3DPUA 2VQEJ 4K7QA 4HHJA 2NTXA 1X7VA 1S6PA 1JLBB 2M34A 4U3CA 3SQOP 1VIOA 5A8KA 2KPMA 2OU2A 2JA2A 2W2NP 4XLHA 2L9RA 4BAYA 3LMMA 4LMKA 4WKRA 4Q4ZF 3HCXA 3SI8A 3SYZA 3CCJI 4QR1A 2E7XA 4JI2J 1YRXA 2CWKA 3MVPA 2EFGA 3QSYB 2ZBCA 4I99C 1WZ2A 4AQGA 5M2RA 4OMZA 5LB7B 1MMGA 1W5SA 4EGZA 1IUYA 4RBOA 4NLYA 3DOKB 4YHHJ 4ESFA 4ITSA 2BGCA 3RKOA 4I4BA 1HXDA 5E5NA 3S3OA 3JSMB 4ZPWR 1LNQA 2FQ4A 3GTJJ 1Y56A 1GMWD 4KJIA 2OLWA 2HNYB 5J2NB 5E3RA 1HOMA 4HOBA 1WC0A 1MMLA 2HZVA 4BHQA 1FKOA 4ELVA 3W9JA 2R7FA 2QQ9A 3OBVE 1QZZA 4DHVA 1F5CA 1PKUA 3SFEA 2WBRA 4CXXA 2TCTA 4QOTA 1UELB 2FVSA 2VVSA 4HA8A 3KP3A 1KTVA 2UUWA 4YY3J 3BG6A 4A8YA 1UVNA 3ETMA 4K4YA 5LG3A 2MXYA 4L74A 3F2EA 5B08A 4HN9A 3ABKH 1MNMC 2XZDB 2IA1A 3FMSA 2LH9A 3DI6B 2PMZD 4TWHA 4HFIA 3KWMA 2CKWA 4HX8A 5DETA 2ZJQF 4IH6A 4ILRA 2NXCA 4U88A 4YXDA 5HBMA 3VCDA 4F0KA 4L9NA 2H88A 2CHOA 4ADZA 3CJ3A 4A3FJ 2RDIA 3I96A 1P6TA 1RHMB 2MEWA 3ZZOA 2OTJI 4TYAA 1WSVA 4I2QB 4MGRA 3R0JA 3HSEA 2ZNZA 3P4PA 3K8WA 1ZTRA 2A2DA 2K3PA 2CPHA 1X4BA 3RTRA 2H1KA 5LCYA 1XMBA 2OD6A 1NK4A 3A03A 1YJWI 3QRRA 4ECWA 2AYEA 2W9BA 3G6EI 1X4PA 4B9SA 1Q5YA 4DUYJ 2VG5A 4RR5A 4UOFA 5IT4A 4CI2B 2IUBA 5HAXA 2OEMA 4RWXA 2XLKA 4RUHA 4IDPA 4ICLA 4KA4A 3V6HA 2LKHA 4YMEA 3UWTA 1REVB 3G6XA 2XSDC 2C0SA 2KN4A 2OV9A 3RPUA 5K14B 1QUUA 4KR0B 4R8UB 3A3NB 5EF6A 4QH5A 5AIPA 1R7IA 4DR1T 1NK2P 3AXMA 2KU7A 2GFFA 1M5OC 2QA4I 1A6LA 3M1CA 1JIHA 4QWQA 1I5ZA 1S77D 2XKOA 3J7A1 5B0BA 1GNKA 2JLEA 2CBIA 2P6TA 2O1PA 2Y9YA 4DR2T 3IN5A 1C0TA 2K24A 5KX5E 4DS5A 4OI4A 3ZMVA 1R9TJ 1XMOT 3RRGA 4UUXA 2X9WA 5E41A 4DIQA 4F3QA 2LF8A 2HHHF 4RUCA 1JTXA 5LMUJ 5IWAF 1KQGB 1UVIA 3KNGA 1XCVA 1HFAA 3ADAC 3PX4A 2XGPA 3CULA 2EK5A 1QAIA 4JI4F 3MMJA 1UURA 2YOEA 4CCJA 3QC9A 3ZN1A 4PEOA 4IOAF 1LXJA 4P9SA 2G0CA 5IV4A 2UUBT 1A0OB 3SYTA 2VFSA 3F8FA 2DR9A 3ZOBA 2N3LA 1JNRA 2VOOA 1QLBA 1DPUA 2X4HA 5K7HA 2KFDA 2C1EB 5HS8A 2AJ4A 4I55E 3VAMA 1I94F 2BA9A 3GN5B 1FDBA 1WG5A 1FNXH 3MM9A 1F5AA 1MJAA 1V3ZA 4ELTA 1UVJA 4L3NA 2O01C 1TV6A 3R97A 5HN0A 2VI6A 5JDFA 3K4NA 2K1RB 5CJ9A 2ISZA 3R84B 1B0PA 3OYGA 4F67A 3MKYB 3P96A 4ZN1A 1FRIA 3CMYA 5HXCA 4MHCA 2HS3A 3K3QC 1UFLA 3QP5A 4CLFA 3FZLB 4BDYA 5HMXA 4XIDA 3DTOA 2A0FB 3CD6S 1HWJA 2DNGA 5L4HA 1S7HA 4WBOA 1FJGJ 2RRAA 2ILZA 3TNVA 4UY85 4IL9A 3PXGa 4ER8A 3ISNC 1MWZA 2DA2A 2VIHA 5ETSA 3HKCE 1PJ5A 3VSLA 4BGDA 1XIQA 1ACMB 2W9AA 2J6TA 2BS3A 3TJAA 2YNGB 1Z91A 1NK8A 4OJHA 3OKQA 4R79A 3NZQA 3MKWB 4U8YA 2HN2A 5KG7A 1BR4A 4N0BA 2MGZB 1YKEB 3SRZA 2L48A 2XAJB 1BHNA 5KFEA 1WI8A 1YS7A 3FK6A 2V2ZA 3I5AA 1KVKA 3NMRA 2J0WA 1XNRF 2UXNB 1NH8A 1S10A 5KFGA 1RDRA 3C51A 5IV3A 4PK6A 3POTA 2HN1A 4ZZCA 3IBCB 4DU8A 2IJNA 3EPZA 3PHTA 1S7OA 3KYCB 2DITA 1UK5A 4ZYDA 1SUQB 2RRBA 4V19J 2ZM6F 5J2MB 4KY3A 1PYOB 4JV2A 3CCUS 4TQSA 2F4VT 1DARA 4RUBA 5EN1A 1Y6IA 3EJMA 2BABA 2QJ3A 1JGGA 4H63H 1XJWB 2WAFA 3LOCA 3EYIA 3T1HF 2BY0A 4D5CA 1TT0A 4KT0C 4ZN3A 1URNA 4H9OC 1TQLA 3CCEI 1SA0E 4LBPA 1NPKA 1RT2A 2VL1A 2G0UA 3W2WB 2DIVA 2OSQA 5HROA 1M90T 2L0KA 2J7UA 4PG7A 5F8HA 4M9XA 4KT6A 1IBMT 4NXNJ 3K4CA 3ZR8X 2ZUGA 3CXCR 4IIJE 1H7XA 1RADB 1X3WB 3R60A 3W61A 1I39A 2FVQA 2OPQA 2CW8A 2HVRA 1R5ID 1WLXA 4L0ZB 3AAEB 2O5DA 4HHUA 2FIUA 4IH7A 1XGOA 1B7YB 3AOCA 3C2BA 3UFEA 4HWHA 3GTMJ 2NOGA 2JL9A 4DR6J 2X1AA 1VCTA 1U9OA 1K78B 4IHSA 2MLYA 3H20A 4F4ZA 2DA4A 3FBNB 2JHEA 5HL7Q 2EC0A 3SDBA 2XASA 1RT5B 1JNZA 3FQKA 5FLVA 2QENA 3N2OA 1RWVB 1JE8A 1S79A 4GKKF 4BHBA 5E1XA 2Y69H 2IBDA 1LW0A 3T1AA 5CCMA 1S1VA 1U9NA 4UV9B 4ED7A 2UU9T 3AG4H 5DUKA 1T0TV 1HTJF 4YEAA 2AZ3A 3V5UA 2ZWOA 2MG4A 4YELA 3MDFA 5J2PB 1QHGA 4LF5T 4E7LA 1HKSA 3DTKA 4EYIB 1S76D 3CQCB 3OS2A 2PEHA 2X66A 4X4NA 2RUSA 2DYRH 4PJNA 5FD1A 3JAFA 3CUOA 3KV5A 4C8LA 1NB2A 4ZXLA 1Y5NB 3MMAB 1VQMS 2RAEA 2XSJC 2FVPA 1T56A 3H9JA 4LFBF 2VL8A 2J0XA 4ECZA 3TLTA 4A0YA 2X6YA 3PIPQ 4DV4J 4II3A 2M4KA 2GHPA 3TEDA 2N4DA 3BYRA 3M30B 3CO0P 2YPYA 4RS8A 2KYXA 1U1MA 2HG4A 1KFDA 1D09B 1EV7A 3ZMDA 1S49A 2CRGA 3TZXA 5RUBA 2OTLI 3R2CJ 4RNFA 1LB2A 4IDOA 1H3DA 2P81A 4A0XA 3E2EA 2GMJA 3PVXA 3CC2I 2WMNA 3RDIA 1WOOA 2JVHA 2RNEA 2ZFHA 2K9SA 1MWQA 2H4WB 2GIZA 2XY5A 2WTFA 3R6LB 2CG4A 5J8FA 2Y9HA 1LW2B 5FVKA 1WF0A 5L1LA 4L18B 4L5IA 1JLFA 1ETKA 1TBXA 3OYXA 2MSTA 2O0YA 2B5JB 3VZHA 4NI2B 4P73A 2MKSA 2MYSA 4QX7B 3QO9B 2BDEA 1XB4A 4TV9E 2UXXB 3P5TL 4RL1A 2I9SA 3QMQA 1X31C 3O5TB 4J37A 2QF7A 1UP1A 3M2UB 3M2RA 3OY9A 4ASNA 3WGIA 3LA0A 1HNXF 3TAMB 3H25A 4ECTA 2V6YA 2ZE2B 1RAGB 4RW8B 3C4WA 2YNIA 1OCCH 3LP2B 3ENWA 4CIOA 3Q83A 2DGSA 4WFYA 1SC6A 1WJCA 3NG8A 1X3ZB 4CNZA 3N9UC 3CJKA 4DV3T 2C5IT 5EG0A 1F4KA 1E1HB 3PO3J 4H4OB 4OX6A 4WK1A 3SDEA 4HLBA 4KP3C 1SQGA 2Z56B 2PFVA 1RTJA 4GKJF 3FSYA 1F3FA 2ASYA 1RAHB 4YUDA 2XZEA 1D1CA 3QPSA 3A12A 3BYPA 2IVYA 5KFRA 4A0ZA 5D4SA 4K4XA 3LFKA 4OQJA 3KP6A 3BJAA 2GHVC 4I56A 1OEDA 4M5HA 1V9OA 4UVBB 2BW7A 3PUYF 5E7OB 3M2VA 3AJDA 5E8IA 5IP6A 4IG0B 2NAZA 4F4YA 1W5TA 5CHCB 1V5EA 1JB0C 4PPZA 5FY7A 4DVDA 5HVHA 3P9IA 2PI0A 4LFUA 2ZFWA 2XQ9A 5GTIC 3LF0A 1JT6A 5KFCA 4V1Av 1KK7A 2FJAA 3R5BA 2XAFB 4IFYA 2HHXA 1YJUA 2M1BA 4BBSJ 5FMNA 4ZHQE 2JQKA 4FN5A 3N4WA 3OL9A 3KUEA 4XSXF 4EJVA 3KCCA 2XY6A 4TQRA 4CWBA 5LXTE 1RXOB 2DWKA 4DR3J 4BLGA 3FZKB 3HBLA 4C30A 4CP5A 5I3UB 2UV1A 3VRBA 4U67Q 3NGUA 2KB2A 3W6JB 4EMDA 4IE7A 3K70D 2SPCA 3UD5A 4X62J 2QIFA 5D8LB 4JP8A 1YO5C 1HCIA 2Z0GA 3UQSA 4MK8A 3I9ZA 1R4MB 3RR8A 1JLAB 2BS2A 2Y0BB 3PO2J 3A7MA 4WCEQ 2ZSHB 3QB5K 1XDSA 4IQJA 5ETTA 2R8JA 1LWFB 3DU6A 3MR3A 3CE8A 2OELA 1BMQB 3BG7A 4E98A 2KM8C 4F8RA 1BI3A 1UG0A 3SFDA 5DM6F 1X8DA 2V5CA 3WQPA 3NL0A 1YX3A 2HVSA 2CXLA 3E01A 4BEHA 3JC6D 4QH4A 3S17J 1LQ9A 2QEXI 4AIJA 1SL2A 1ZS6A 1G2HA 2QMXA 1X4DA 1HI1A 4Y65A 3CP2A 4CLZA 2H51B 4CLSA 3GZ6A 1I6ZA 3QFHA 2XF5A 5G0RA 4Y28C 5GADI 4QPTA 1XR7A 2CRLA 3JCFA 3F73A 4UV8B 1O3TA 4EYYR 2CQCA 3SWHA 3HRUA 4X4OA 1Z7UA 3GP9A 5F9LA 3FX3A 2LM2A 3HUGA 1N0UA 4USKA 3CPWR 4QHOA 4J01A 4A46A 1IN8A 4TU9A 3DPLC 4P2FA 4K2JA 3J7YJ 3PNVA 3EZOA 1YRUA 3CX6B 5BR8J 3IG1A 4B3ST 2YKAA 3CCZA 3W3SA 2NXEA 2UXDT 3DMJB 2EPFA 1FP1D 2HURA 4NC7A 4CO1A 1OMSA 5HYAA 1YRTA 2HWHA 1J59A 2IPOB 1CS4B 1SL1A 4Y2MA 4N4NB 3OTEA 4LD5A 1ZLKA 3PJ9A 2ZNYA 5CYVA 3CCWA 1K7AA 4M3EA 3VGTA 1WTBA 1AZSB 4WWCA 1QAYA 1PP7U 1NH3A 3T5JA 1T11A 1DDNA 3W2AA 4N41A 1MMSA 2QUFA 3TLWA 3EI0A 5DQHA 4N77A 3Q5EA 2MZJA 2ZDPA 3ZT6A 1HBNA 4LBIA 1P27B 2WB1D 3IAM9 3QZ7A 5FFXA 3H4DA 1FA0A 2ERRA 3F3XA 3LTOA 1NENA 1RUOA 3TARA 5D0RA 3L1PA 4PWDA 4WFZA 4OX9F 2WW8A 4HACA 4IDZA 2X0HA 1VQ6S 1IKXA 1X4GA 2DYAA 4DUZT 2P7VB 3SCLE 3PFOA 2R5ZB 1TUWA 2ZOMA 1RTIA 2PJRA 3EUKL 4DOZA 4LF4J 1FYLA 1VC0A 1HR0F 1U7LA 2PMWA 4CI1B 5K8NA 2X9XA 3ITHB 4O3SA 4QYZK 1KLNA 4OAYA 5GAGI 5J1NA 1KLMA 4BACA 3MAAA 3T41A 4A3IJ 5DQVA 5AQLB 1SVMA 3K8PC 2DU9A 2W61A 3O9XA 1D3WA 3D3BJ 1WRJA 2RV8A 5FXWA 4EV6A 4XM3A 4JI2F 4ILMA 2Y0MA 3GIKA 4NNJA 4EV0A 1PAEX 2XQAA 4DZJA 2GV1A 2AQFA 2VKRA 5AT1B 2FBIA 4YSXA 1VJWA 1NMEB 3CCYA 2E66A 2CW7A 2KKOA 4WFAQ 4A8WA 1WWXA 4A3GJ 4IUFA 2VBYA 5L1KA 2APOA 4U7YA 1ENHA 4QWNB 4XR6A 2CWYA 4K4UA 5FKOA 3EM1A 2B6AA 4XDCA 3DF8A 2HAIA 3J80Z 3AQOA 4KNYA 3E3XA 2OZ6A 3C1DA 2X9DA 2IM1A 1M1HA 3V8JA 5J1GA 3AY0A 2JJ7A 4OIXA 3B54A 1ZPWX 2CNKB 1WEZA 2EEYA 2HIQA 3C14A 3JR9A 2IJFA 3HD2A 2AQ4A 2ELJA 3HX9A 2W4DA 2MBFA 1NKBA 1NG7A 1HA8A 1VF9A 1R5GA 5F8LA 1IJ5A 4EZHA 1BGXT 5H9EJ 1SKRA 2W62A 5GADU 2DTRA 4WXHA 1AXQA 3C4ZA 3KBTA 3PU3A 3UDEA 3A02A 2GMLA 3KVAA 3D5MA 1JJ8C 2QA4G 1UVKA 3GFXA 1CJUB 1E6VA 4XLCA 3DDNA 1TKDA 2NPIA 3OLAA 3ONXA 2HWVA 3WI3A 3N9PA 2Y0SN 3OYFA 3AVSA 5E20A 1JTYA 3IS9A 5HO4A 2I2YA 4NCAA 2XS2A 3G4SS 4A3JJ 2VPZB 3I0SB 3H5SA 1RU2A 3GWCA 2V8DA 1IXKA 1UCNA 2W24A 4CCMA 1VMBA 3HKEE 3HO1A 3WG7H 2LEHA 1RAOA 3W5ZA 4I0WA 5KFWA 3R5JB 4YFUA 4DQRA 3FM5A 1A36A 1FEWA 1PDNC 4P2SA 2JLGA 3D6MB 1CJTA 2ACXA 1WDTA 3AD7C 2V6CA 2YU9J 5CVVA 1JK9B 1N36T 2HQFA 5BYQA 3IKTA 1F60B 1LDDA 4UUWA 4MFRA 3D0HE 1HMVA 2KIUA 1HKQA 4JI5J 3S01A 4WZXA 1HBUB 3MZKB 2GK9A 4OU0A 4XKBA 4WBFA 2CM0A 2JPFA 2KXHA 2DNZA 5IC4B 1FXLA 2EXUA 3CD5A 5GAHI 1VQLS 4DL7A 2EHOA 3HA4A 3FMQA 3LFUA 5L3GB 4BS9A 5JVDE 4HNTA 5GAEU 3PV0F 3NGTA 1HNVB 2FZKB 5J1RA 1JXLA 2UZKA 1EHWA 3I0RB 3T8RA 2RHQB 3OV7A 3ZTPA 4LF9F 4ZP7A 3FBIB 1LFWA 1IO2A 3RKGA 5DQIA 3ZXSA 2CPEA 4WXCA 4HKAA 5D6EA 2C2RA 5LMUF 4NA3A 3HK2A 2LSJA 3OTOT 1Y7PA 2DJNA 3H3AA 3OYBA 2HHUA 1B8IB 1RABB 4K0KT 4AYBN 1WI3A 5B0AA 2LSGA 1X1BA 1S5ZA 1N34J 4Y2CA 3GYGA 1U5TB 3U02A 4CCOA 1J09A 4H4MB 4HYKA 4IL4A 1OYEA 3DFGA 2G9OA 5DCMA 2XYGB 2CJJA 2WHOA 2DMQA 2LU2A 2GGPB 4JP0A 2E2HJ 1BR1A 5B5EC 5AQFB 2J9CA 3RBZA 3HFVA 3TOBA 1LKZA 4YN3B 1QM9A 3DRSB 3MXZA 1N33T 3L95X 1J5YA 1ZGJA 3Q5XA 5CFBA 2DISA 2QWWA 2AGPA 1WHXA 2KVIA 1YITI 4XLPF 2XF6A 2VQLA 4Q25A 3G9CA 3S4UA 3HI9A 2N4CA 4EAHA 1B7FA 4CXWA 4MLOA 1K44A 2HPIA 2ESHA 5FKNA 1G59A 4WP9A 3OV8A 1UPMB 4ZHRB 1XSVA 1DGWY 3V4IA 3UPFA 2DAOA 1VZ0A 3GG1A 2ZJQQ 3RRWA 4ZMMA 4IDKA 5D8KB 5HS9A 1LWEB 1BI1A 4P2XA 4Z37A 2IS1A 3CCQI 1FNOA 3OIQA 1HF8A 3SFIA 1SQEA 3NZPA 2DRDA 2W9CB 2WRMA 1S7AA 3H1CA 2LFVA 5FKMA 5IT9Z 1IM6A 1GTHA 3CDEA 2Y75A 3QQAA 4H63V 5KFOA 1QZEA 1TQMA 2XHKA 2BJDA 5C42B 1N32T 2AEJA 2UUCT 2DK5A 3H5RA 1TP7A 3A01B 4OJ3A 3HVAA 3OSGA 2LXFA 3MHYA 4RW9B 2MYFA 3M9AA 3U1KA 3BO4A 2JC0A 1QHHD 3B4DA 2V4RA 1SJ1A 4DR5F 1W0BA 5BMVE 4V2GA 1YJ9S 4B48A 1LVAA 3BQIA 1ONVA 1TKTB 2Q6BA 3CVRA 3DLGB 1RT7B 4ZDOA 2P6SA 3C6TA 3DRRA 1HIYA 3VQTA 2XQ4A 2HPUA 2VJJA 2CWXA 5EWGA 3CDIA 1MJBA 2A6HF 1XMQJ 1FRHA 5GVQA 4UQTA 3VVUA 5KFKA 3J80U 5CA0E 2VA3A 5LJ5Y 1FOWA 2CAJA 1RCXB 4K4TA 1WH5A 2F9DA 2GXGA 2IT0A 2FGCA 3HXMA 1T98A 2AJ1A 2ASJA 4M5NA 1YRNA 2FHOB 4E7JA 1HKTA 2CUYA 3HZGA 4DV6F 4P6QA 1E2AA 3R7NB 5KG3A 1RT3B 2JEIA 3AE8A 3RAXA 4IOAQ 4G94A 1UZHA 4NXNF 4JI3T 2KFYA 1S3JA 1HNZJ 3P4SA 3V81A 3H2UB 3EX7B 5CZXA 3E6BA 5JH7E 1S1XA 1MBHA 3OQ2A 5GMKa 2MQMA 5CD4H 1TWAJ 2VU5A 3VAJA 2DMPA 3SZGA 1HQ2A 1S9GA 1FTRA 1R6YA 5FRNA 3EICA 2A3SA 1MDMA 5D6GA 4TX5A 2UXCF 2H89A 3ZCJA 1ETXA 4FT8A 2QGUA 4LF8T 2VASA 4J9OA 3K1MA 5JDGA 2E9XD 1W9RA 4LRAA 4ZPDA 4URSA 3QT7A 4AQYF 4M94A 2YWFA 5JR9B 1JKQC 3VSKA 3EPGA 4GYSA 5HQLA 1KQ9A 1C1BA 2XB2D 8ATCB 2RP4A 2EFQA 2KLOA 3W6VA 4UF0A 2DFIA 2KFNA 4DIDB 3I59A 2V9VA 3F0CA 2RQPA 1U48A 2OKQA 4WYVA 4O8SA 2NXNA 5F8GA 4CH0S 1OPZA 2V4JB 1TU0B 1TL1B 2QG9B 1RZ4A 4XNFA 1KGSA 2BQ3A 1J27A 3CX7B 2LRDA 2E5NA 3RG6A 2XSJA 1HNIB 2W2QP 1MBFA 3SOLA 3DEWA 5LEKA 1HARA 1BW6A 2GOXB 2GVZA 2AD9A 1XWLA 3QLHB 2BBYA 2YKNB 4PXCA 3R7SB 4LF1A 1SKUB 5LMNF 2E9ZA 2JEFA 5KOXA 4C7QA 3J81Y 5AQGB 1AW0A 1UFWA 4S0HB 4IRKA 4EYUA 4DV1J 3GE9A 4ENMA 3EWGA 4RX6A 4ZVQB 1X4EA 2EV5A 3TW7A 4KICA 1XC9A 2IAIA 1KONA 2CZ9A 5AFUL 4DV0T 1RPWA 2BG9A 3CTAA 5CVIA 4LK1F 2YWEA 3LAMA 2FDNA 4B3TF 2IW5B 1B59A 4DBQA 3MFKA 3BCBA 4H54A 4ZCLA 2XCAA 4OHZA 4GK0E 1T08B 1WHYA 4JUZA 3VTIA 2PT0A 1HDPA 4O3OA 3I9V9 3EHZA 4CYCB 3B73A 2MQPA 1GAOA 5FO5A 2ODVA 2HK2A 1G3TA 3QU3A 3DRYA 5KAIC 2RDJA 4LSNA 2OEKA 3UVJB 4BE2A 5HQMA 2VBWA 3GV8B 3O6BB 4V19K 2PGCA 3Q8SB 3GTGJ 2G4BA 1RTDA 3FZHB 2KNDA 3ETUA 2BACA 3MECA 4IHXA 3Q9VA 4UR9A 5FLMJ 1S6PB 1NZ8A 1HI0P 5TGTA 2CG8A 4C91A 2JEJA 1N5YA 1F36A 3FCHA 1KSPA 3EXCX 5A8KB 4OZJA 2HTJA 4ETSA 3UFGA 2ZH7A 4ZPTR 1ZARA 2JOQA 4BAYB 2LE8A 3QT6A 2XMAA 1L3LA 2HKXA 4DV7F 3CCVI 3BPDA 3JSYA 4DYRA 1JLGA 4FF2A 2LF7A 2IC3A 2O61A 2HEKA 1AROP 3BF4A 3FUYA 3AE3A 2K02A 1U1QA 1GXUA 3IA3A 2C2OB 2Y6XA 2HHVA 2J1DG 3ZQFA 4LFAJ 1RAIB 4YDXA 3HJEA 2BS4A 1U8BA 5HVQC 2V7IA 5E2QA 2E5LT 2HBYB 3E7LA 3UDVA 4I76A 5HJXA 4OLPA 5LHHA 1PYTA 1K6OA 3AFGA 2PMZN 1T9XA 2OQGA 3CMES 1PYSB 5C3JA 1CQNA 1M1GA 1VFJA 1FKOB 4Y13A 1S9FA 5KMGP 4ED5A 5E3LA 2VBXA 1MZBA 5HXRA 3RB0A 4KH0B 2KG1A 4ECXA 3KMQA 3W15B 3QOEA 4DR3F 2E2JJ 2MQ8A 3ZTOA 2WSEC 5D4OA 2GIRA 4XKWA 4X1KE 1TK5A 1TAUA 2HYFA 3AD8C 1XSXA 3FEZA 2DHRA 2UUAT 2HZAA 5H6QA 4RBUA 1T0FC 4IOBA 5CVRA 2QQBA 2JRSA 3GB0A 4MFEA 5E8GA 2Z3YA 3CDLA 4C0HA 2B7CB 3FM3A 1IBKT 2HNZA 4ANEA 4ZP9A 4ENKA 2XC7A 3ONLC 3GQCA 3HKZD 2ME0A 2C2DA 2HU9A 2MSSA 3KHRA 1T3NA 1ETYA 2G2OA 1UEKA 1WVRA 1U8SA 2XM3A 2YU1A 5KOWA 5LM7E 3LA2A 4MIWA 3T3FA 4IHWA 4DI6A 3CCSS 2OCCH 3K7RA 1K1QA 5LOQA 1KHWA 2ATLA 2C2NA 2XAHA 3V6KA 2CPTA 2UXBT 2POKA 3M8RA 4M5JA 3R1LA 3ZRGA 2NVUB 1WSRA 2NS1B 1VQPS 4AYBA 1T05A 2IGKA 4TXSA 1V55H 3ESLA 3VF0B 2W9BB 2XY8B 2YWGA 3F8CA 2OJED 1C0WA 2VG5B 4ZDPA 1O3SA 1WKKA 1GXLA 2B43A 4WTYA 3HM5A 4KJZA 3FDSA 2AWZA 4M1KA 3VZIA 4FETA 3NCRA 5LXRA 4WFNQ 1NEKA 4JI6T 4OV6A 4X64J 2KO1A 3EDRB 1KNZA 1SC4B 4X66T 2CEAA 1NU4A 3IWFA 1CGPA 1D1AA 3ZYMA 1E6YA 4A3EJ 3HT0A 1FOKA 5CABA 3QP6A 1PILA 1TLHB 4XL9A 3J7AO 4DR7F 2ZD1A 3AA0B 3OR2A 2AXDS 1RR8C 2E34A 2EFNA 2IVFB 2HGNA 1C0TB 4EBCA 1WR6A 3T19A 1TR0A 2EWNA 3ZMVB 1T8IA 4P74A 2BXYA 5BMZA 1WOSA 5DDOC 3EUNA 2Q9QA 2QL5B 1NEEA 1MN7A 5DD8A 8AT1B 4JV5T 2YDSA 2DN0A 3BC8A 2BQUA 3WTWC 1EJ7L 3BQKA 4OYMA 1EKRA 1X79A 4O4GA 3Q0VA 3G2XA 4RJVA 4LR8A 3ZN1B 4DF4A 4J9VA 4O3PA 1JKHA 3QBCA 2QSWA 1PUFA 5HLHA 3D67A 2MZ1A 3C46A 3WU2C 2BHYA 2IS4A 5IT0A 2MFZA 4ZVOB 1J5EJ 3GZ7A 2VXDA 1IWGA 1K47A 5FL0A 2CUEA 4AXIA 4P2MA 2PQ8A 2EFWA 1JNRB 4N78D 2R2SA 2MLGA 1IV6A 2E71A 1EJ9A 4USUA 3KJNB 1BN5A 4EQQA 1ZGAA 2LKXA 3WTVC 2V79A 1HQEA 3GONA 3CD0A 2A5WA 1XS9A 1K1SA 5F8JA 2BANA 1PJ6A 3MM9B 3GWZA 3E51A 4FP9A 3DWLE 3I0TA 2JRMA 1TV6B 4KDPA 3CF5Q 1DRZA 5K7ZA 1VQOI 1ZR2A 5KTQA 4LMYA 4XK4A 2FLLA 4EXTA 1JX4A 2R7ZJ 3IMQJ 3TQEA 3LANA 2ACYA 4XLEA 1RHRB 3H9GA 3J7Z5 2RQ4A 4BH9A 3SEQA 1ZRDA 2X9HA 1RLDA 2A10A 4ZCIA 3B82A 4MIMA 1TL3A 1TFYA 3EUHA 1WOPA 4QU6A 1DURA 4UT4A 2V2KA 4A8MP 2HH7A 1XN7A 2IY5B 2F2EA 2XG8A 4WXOA 2OPRA 4G6QA 1US7B 3DEEA 4CH1A 2LHRA 1YW8A 2XQ6A 4NOHA 2D5VA 3HPOA 5DM6Q 3KEOA 2V2VA 3D6TB 3CQXC 4I2OA 4TN2A 3JC6C 4OWRB 4TZ4C 2CV0A 4TNVA 4OX8A 4AKRB 1RKTA 1NTCA 3H8YA 2MB0B 3CCMS 1P1LA 4M5IA 3K2YA 3W63A 2OPPA 4ZZDA 1Q95G 5D15A 2XGDA 5DUIA 2BM1A 2ASLA 1HW5A 1LOUA 4MO7A 3TP0A 2LSIA 3QYFA 3POTB 3BGRA 4Y7NJ 3U78A 5F04A 2FJWA 2DK2A 5BOXA 5HLFA 2G7UA 2F9JA 5IS2A 1UW4A 1APSA 1G1XA 2QYOA 2VG7A 2DNLA 2ZH9A 1T02A 4W1UA 2KKHA 3RU0A 1UJ8A 2WCAA 4OLOA 1MMAA 3PKMA 4MTDA 1T2KA 2BRKA 1H98A 2KT3A 2WSSV 1U1NA 1ITYA 2KJBA 3D5RC 3N4MA 5LA6E 3OPCA 3MF5A 4Y3CA 3SBMA 2Q8KA 3MCSA 1RT2B 2FQ3A 3RRKA 5HROB 2GQQA 4AL5A 4OIOF 1FRXA 1NRKA 1XDUA 4M3DA 1HBXG 3QU6A 2VOPA 3NGDA 1UPPA 4Q5VA 1OSCA 2V0NA 3KP5A 2I5UA 2E1AA 2OPQB 2E9TA 4WZQA 3DGPA 1CEZA 4NYOA 1UJ5A 2V9WA 4NZ6A 1X9MA 3LWFA 2W0GA 3F23A 1U6GA 4CI3B 3MCNA 3GV5B 4IQMA 3Q0UA 3LWMA 3T9ZA 2KWIB 3AEBA 3PG9A 2NREA 3C6UA 1TTYA 1OSDA 2BW2A 3LO3A 1KQ8A 2XASB 1JNZB 3PJAJ 2FLOA 3KLIA 5JLXA 4YLHA 2HZDA 1FTZA 2YU2A 3IBWA 1LW0B 2BJ7A 3BBCA 4D5FA 2MTQA 1S1VB 4ANDA 4TN7B 2RVCA 2MC3A 5FRMA 4DG1A 1ZM9A 3DBHB 3CJRA 2V5HG 2OQRA 2MD0A 2E60A 1VQ9I 2ADBA 4ZVFA 1MW7A 2BJ1A 4NASA 1NK6A 3WZ0A 3CMAS 1SMTA 2CH0A 1FOXA 5JRCA 3HJFA 5KFXA 2L9NA 2IAJA 1WRDA 1V5IB 2JN6A 4FKYA 3OOPA 2KDOA 2YWHA 1IVZA 2K9AA 4LF6F 5IHYA 4I43B 1O57A 4BWJA 2MOZA 3WTZA 5DS9A 3PO5A 3I5BA 3DDIA 1KWMA 2DTJA 4PXDA 1VQKS 5D4RA 4AIKA 4YTNA 1K0TA 1RK8A 3ZTRA 5HMWA 2VKJA 2VIXA 5H6RA 4ID5A 5KFQA 1G2EA 5IWAT 4DNDA 3JTHA 4BQOA 1GMWA 1U5TC 1JQGA 3BSOA 4IG3A 3RRCA 4JI4T 5ETLA 4YEJA 2QLWA 1VRTA 3NCQA 4KO0A 4QCLA 4Z7YA 3H5XA 1RZMA 5FL1A 1RKWA 2GHWA 1JJ4A 3OYMA 2ZOGA 1UGOA 2UUTA 2MY7A 1NLKL 2XUBA 2RDPA 1ZA1B 3K4MA 3RR7A 2G13A 4KYZA 5F1JA 3JTNA 1JLFB 1NHUA 3BPSP 5ICGA 1U25A 4CM2A 1I94T 2KZZA 4COFA 2JQ9A 4Y6IA 2EV0A 4L0YB 4LBHA 2EILH 5F8NA 3TP2A 2J5OA 4DR1J 3MOJB 3UU8A 4YIRX 2O5RA 3S6EA 2JPBA 3M2RB 2ZCWA 2PMZA 2P9BA 2H3RA 4F0MA 3FBLA 2YX4A 3MAHA 2V6YB 4DR2J 3RW7A 2YNIB 1PP8F 4G1IA 1XMOJ 3N2GE 5H9EK 1SFXA 3BTJA 3EETA 3FC9A 4LITA 5GONE 3WDOA 1YG0A 3H90A 2LVSA 4PXBA 4O4IE 1TL7A 3CJKB 1UVLA 1R58A 1FO1A 4LSZB 2MJUA 1IBCB 5EG0B 1OO0B 3FRZA 4IHTA 3SDEB 3FHNA 2AEFA 2FF4A 4HV6A 1MIYA 1PJRA 1KC8T 3PQJA 3PUVF 5ABGA 3LWLA 4M6YA 1RTJB 4DLGA 4DQPA 4OI1A 2XHEB 1R8BA 4MK9A 2Z99A 3ZNJ1 2UUBJ 4CLKA 1FTTA 3QRPA 3RZOJ 5ILSA 5EEGA 2JA8J 1CJVA 2V9PA 5CYQA 3LG7A 1OEDB 4OI0A 1DU2A 4OINF 2IBKA 1UHMA 1P9QC 1FMWA 3M2VB 4RW6A 1REPC 4UY8I 2XLIA 1XGSA 3RCOA 1WYCA 5AQMB 1N75A 4BHPA 1XNRT 1WELA 2ZH8A 3HT3A 2XPWA 4M9SA 1DTTA 1N8RT 3RF1A 3CMMA 2FJAB 2O6GE 1AFJA 1S72I 3DXJF 4IFYB 5J4VA 3H5YA 4WFBQ 2LRLA 4MIAA 3RBDA 1CQTA 3RYIE 2ZM6T 2EKNA 4FTHA 2Y3YA 3AEAA 2HZCA 2ZOFA 1M5VC 2PX9A 3M8ZA 3IR7B 4L5EA 3T1HT 4QIWD 4LLLA 3P5BP 5CYMA 1SKSA 1H2UX 5ILUA 1EA3A 1R8HA 3NGKA 3AA8A 3O8HA 1Y0UA 2GZOA 4TV8E 2XV4S 1SVLA 1KQKA 5ABEA 2K06A 5KT4A 4D3HA 2JQHA 2HS0A 2J5PA 2MMYA 3G6YA 2MABA 1H0MA 2VQCA 2AX0A 2ASDA 3W6KB 1SIZA 2OMLA 4L9TA 2LA6A 1WJFA 2V4QA 3N0VA 5LSOA 1W0AA 2LBFA 2OCEA 3HXLA 5D8HB 4BS2A 1IR0A 3N6LA 3MCZA 5IYDJ 3K17A 2CMPA 5LNKA 4Y15A 1IG7A 3HSZA 5ICEA 1OXZA 3MUMP 1OR7C 2ZBRA 5KFVA 4C3KA 4RGXA 1OISA 1OYDA 3PEHA 4U7CA 4FI5A 3NBPA 3RB6A 1WPKA 3E01B 3L2RA 1FI4A 3FXLA 4BEHB 3TUPA 1S4EA 2DNMA 3MMBA 3MXHP 4AQFA 5L46A 2MQLA 3FNNA 2G2ZA 3O1LA 4KGXB 2F4VJ 3QZ8A 4GKKT 5G0RB 5FROA 4EIWA 2ADCA 2XMKA 4B09A 2K9NA 3BOQA 5CLSA 4TNWA 2W7NA 4QZVB 1ZAOA 3K89A 3OVUA 3FVYA 3P6YC 2R5YA 3HUGB 2WONA 1T9UA 2LMDA 2WB1N 2V4JC 4HLYA 2O03A 1T33A 1JUMA 3GFHA 2Y8DA 2ZWPA 1W26A 3KV4A 4OIPF 1ZLJA 4QWCA 3IG1B 3V4MA 4OYWA 4LREA 1QU3A 2KRRA 5DG9A 2A9UA 1HBOA 4RKUC 5U47A 1IBMJ 1TUGB 3OBIA 1S5LC 5C44J 1J7KA 2CLYC 2VODA 3B6AA 2HFUA 2QLBB 3OXGA 3I9YA 2DW4A 3BR5A 1S97A 5FXXA 2W4PA 3THPA 1XNQF 2R7TA 2WTEA 4JV0A 4LFBT 2VQGA 3GX4X 2EV6A 2BKOA 4IF4A 2L01A 1HW9A 1FLIA 2GA1A 1WJAA 3GTLJ 3W65A 4F4XA 3GJRB 3T8OA 5FB2A 4QXCB 1O0PA 2E7VA 2HIYA 4YP3A 4DQ2A 4RW7A 2IRXA 1SJ4P 3I56I 5DRKA 1HBNB 1KU2A 1R00A 3L7OA 3LUYA 3K59A 4CXFA 4K50A 3FGVA 5J8CA 5EEHA 3AE4A 1PJ7A 3F8BA 2QX0A 2Z8QA 4DMZA 4BQNA 3QIDA 2HLUA 3WIUA 3VHLA 2UU9J 1EH8A 3HHNB 1XZYA 4PWDB 2F8EX 3DLKA 2M52A 2R7DA 2QKMB 4EO6A 4HACB 4IE5A 1ZKGA 1IKXB 2KT0A 2V1XA 2ZM2A 5M4YA 4NC6A 1KRPA 4ZOSA 1FKAF 5KFAA 2WCXA 3BTCA 1A6QA 2YKQA 4JI0F 1HWLA 1RTIB 2B63J 2PJRB 2DO4A 1NXIA 2NNNA 3KK1A 4G3IA 1Y00A 3HFZB 1NKCA 2AE9A 2NS7A 3I53A 3FZFB 1HNXT 5EGOA 5L3DA 2YU3A 2R3SA 4A5XA 4ZEYA 2G1DA 4YJ2E 2IVMA 1GFWB 1KLMB 2CJYB 4PWWA 4J9QA 1KP6A 3JADA 4J9KA 1OQ6A 1FTCA 2RVJA 4S0MA 1R0AA 3SCIE 4X1IE 1WCMJ 5FKYA 2IMLA 1IN0A 2ABYA 1P2FA 5K8MA 4WNKA 2P9GA 2DIUA 5C2TA 1DQ8A 2ICWG 4IOCQ 1X5OA 4EK2A 1R71A 2YH0A 3G1LA 4MBQA 3MR2A 4GKJT 4RWWA 3LK3B 1S6QA 2E9XC 3UW1A 1O7FA 3DQVC 5LHIA 2B76A 2B6AB 1BUXA 2XEXA 4P71A 2MJNA 2WVEA 3SFGA 1E3PA 3TW6A 2OI2A 3AE7A 2XAFA 4LMLA 4C3JJ 1LWXA 4B3OA 1IBLJ 2ID6A 4A12A 1SUMB 3KP7A 2ES0A 5JDQA 3OYKA 2JQQA 2JX2A 3C14B 4I67A 4M1PA 1U2FA 5F3ZA 4MKAA 5C2GA 3U1MA 4DNCA 1IV8A 2GMHA 4H4KC 3VR8A 5ICCA 5M3MJ 3AJ1A 2W2MP 4G8XA 2ZH3A 3BK9A 2BY1A 3HTSB 4Z91A 1E6VB 3MOZA 4PDKA 3BQYA 4Y0FA 1SD6A 2WVFA 2ZBKA 3KOAA 4DV3J 2JJ9A 2RPAA 5CYJA 3ZQIA 3UUMA 3EZUA 3IS9B 4PKDB 2NXJA 2A61A 3WC2A 1M1KT 2DXFA 2AHOB 3LFMA 2STWA 1TQPA 1PG5B 3M6UA 5DD4A 1RWNB 4S05A 1B99A 4YOEA 3NWSA 3G71S 2FZGB 2X1BA 3WTTC 1KFSA 4A6DA 1CG2A 3IWZA 3PTWA 1IKVA 1D9AA 4TY8A 3VHQA 2V8GA 3NKYA 4RB3C 3K4JA 2PTFA 4ZZBA 2DT5A 3CIMA 1YE9A 4BXFA 2M2EA 2D7SA 3C8YA 2MZTA 1NZAA 3FFIA 4U74A 3BO3A 5A8RA 2VL0A 3PDNA 5T7LA 4EATA 2P9EA 3GTOJ 2H7OA 1CJTB 3D28A 3VWBA 3O1JA 4ZCKA 2GCFA 4I4TE 2P2CB 1T9YA 1DY3A 1D1BA 2NVQJ 1G73A 1HX1B 1HMVB 2D41A 4EJWA 2O66A 3LBXA 3PUQA 2NUUG 1SC7A 3IRWP 1R6RA 3TEGA 1RWMB 5JLWA 1Y1WJ 1VFCA 3HC7A 3OL7A 1YHQS 1YGYA 2XHCA 1GMVA 3NWRA 3KHLA 5HWXA 2CPXA 4I7FA 3DCAA 1WFDA 1N5SA 3E08A 4X64F 2EHOB 3QUJA 3M9NB 2GAUA 1KFYA 4URQU 4H9PC 4X20E 4IZZA 4L5JA 3MI7X 1W09A 2XSFA 3UCGA 2YY3A 5H1SV 2PDAA 1ZTWA 2G9WA 4I69A 3JSOA 2PBIA 4B3MF 4RNNA 2W00A 1G8XA 4UOHA 4WK8F 2M8DB 3OSPA 2EA4A 1KHVA 1ZOTA 1VRQC 3B78A 1WH7A 5J0ZA 3ZYLA 2L9WA 3HPGA 2DOAA 1HD0A 1V3SA 3MN2A 5JI6A 4XBFA 3ZTSA 4DN9A 3CJ5A 4XOPA 1TTHB 1F9HA 2QKLB 1VI7A 4HL9A 4DJBA 2ZBIA 4HI2A 1HPZA 3RJMB 1JKPC 2L7FP 2V1NA 3K4BA 4YT0A 5EGYA 2XHWA 1GHCA 4CQ1A 4JBWF 5DCMB 2Y1LB 4CT9A 5FD5A 2XS7A 4FYWB 5B0GA 2V6XA 1YX5A 3BSNA 4PNIA 4WJBA 1NDPA 2AGQA 3W9HA 1MMNA 3J7YI 4F52A 3M8SA 2EZHA 2N82B 3VOEA 1ZYQA 1YJ7A 1CVJA 1SMYF 1ZM2A 2LY9A 4OX9T 2R5ZA 3SEOA 2DXIA 4YRVA 3IF8B 2DNYA 2WVBA 1HNWF 1QA6A 1EIYB 1NG6A 4FBTA 2JFDA 3K3NA 3H36A 2E8IA 1PIEA 4L5GA 2DGWA 1ON2A 1PC4A 2WZ1A 1NSQA 3V5RA 3CP8A 3JRDA 1ZAWA 2DO0A 4B3SJ 5BNGA 2UXDJ 4BC7A 4C97A 1HR0T 5IM0A 3V4IB 3MUVP 5LBQA 4ZPAA 5H9FJ 4CA0A 1NPRA 2ZB9A 4IDKB 5B0EA 3G96A 4IO9F 1UMJA 1VQNI 3ZLIA 1YSJA 4OOIA 2ZMAA 1S7EA 5DQWA 4MFBA 5ETKA 1JMTA 3VAFA 3GIJA 4I64A 2XF7A 1S1TA 3HZEA 2QC3A 2G2YA 1S6UA 3KLHA 3Q22A 3FF5A 4HFDA 2A2CA 2K7JA 1RTHA 3TDZC 4L75A 3QAUA 4C2UA 4M6XA 2MKHA 4PK5A 5DZ6A 2K85A 3OYEA 3CLOA 2NXUA 3MTKA 3ZMSA 1KVJA 3SCKE 4CDIA 4AC0A 4DQQA 2E5GA 3SZTA 3X1LB 2CQ2A 2V26A 2KL4A 4PQUA 1A6IA 2BX6A 4TWFA 4DUZJ 3P9CA 2X68A 3FIWA 1BQMA 2ILYA 2MKYA 5D3GA 4CDGA 2HFSA 3C6TB 3DRRB 4PJJA 3H59A 2LEAA 3H5AA 3E0ZA 2B8QA 1Z0PA 1ZG5A 4USVA 3E6MA 2K8GA 2WWUA 1TT5B 3IEEA 1W1WE 3OYNA 9RUBA 3EDPA 2GA7A 3RYHE 2CWOA 3JAMK 2DCFA 3RQIA 3L2QA 1USTA 3NNAA 1Q7LB 1GXTA 3N6NA 3AEDA 4WP8A 5ABFA 1YRNB 2HBZB 2VK9A 4USHA 3WU0A 4CICA 5E33A 4XRFA 3ZPOA 4N9IA 4UXNA 2VICA 2WB1A 2L4AA 4AXJA 4ED1A 4UEMA 3I1AA 1MWYA 3ZT7A 1RA7A 5GPAA 3V81B 3I71A 3HD1A 1Q81T 5M5XJ 3HG9A 1S1XB 2A2FX 3VAKA 4GO5X 4LRCA 3SV4A 3AXJA 5A8WA 3FXKA 2DR5A 3N5FA 3C98B 3DM2A 3RYPA 1S9GB 2WA0A 1MDMB 3TO7A 2FLNA 1PAUB 2CQQA 3ENAA 1Y4ZB 1W7PD 3CJ2A 3FBBA 5FVLA 4CGZA 4JOMA 3DN9A 3T6JA 3F72A 3W5XA 4DV5F 2HS5A 3KG1A 2YNHA 2XQ8A 4DCJB 5J1YA 1C1BB 4UF0B 2BYCA 4UHTA 5DZ7A 1VQ8S 3I59B 1IN7A 1Z3YA 3PNIA 6FDRA 2E1MB 3ZQLA 2H3EB 3QFWA 4EJOA 3IH4A 1LUJB 4PGHA 2HFOA 3CC4I 2NXNB 2BY2A 4BE1A 1VQ5I 1NK3P 3CCLI 3I55I 1Y11A 3C64A 1IDZA 2OAUA 5J1EA 2PA3A 1OY9A 1AJ3A 2YWKA 2OMOA 2MA3A 1FX4A 2JA6J 1S0OA 2XSJB 4ERRA 2ZXIA 4PG5A 2NS8A 4XZCA 3G8SA 4XRSG 5HANA 2YNFA 4QWBA 5KFYA 4CCHA 4LF9T 3WTSC 1H2VZ 4A8OA 2QVAA 4NQWB 2ME6A 1EETA 1P9YA 2H1YA 1HQCA 2RT3A 5IZHA 3CF2A 1O6XA 3OTBA 3AAIA 2PFBA 3DGVA 3HHLD 3RQWA 4M5LA 4WKYA 3S1NJ 3BR3A 2ZM8A 2JFKA 2Z2LA 2A3JA 3CNQP 5F8MA 3TOAA 4AKIA 2YX1A 5KFFA 4OI3A 3KDOA 2QLJB 1N36J 2BG9B 2UVWA 4DDFA 2Q43A 2W66A 5K8PA 5E79C 2QQ8A 3W64A 2V6AA 3DOMA 5JMNA 2M45A 3ZQHA 2VC0A 2COBA 2XAUA 3GO5A 5LGTA 1TKXA 2BW3A 4OYKA 3WU1B 1ZK8A 1OMIA 1RKJA 3ILLA 3KE2A 1SC3B 1FBQA 2CADA 2EK1A 5LHGA 4L9IA 4DL4A 3S1TA 4LSNB 1VC6A 4MQVA 2ECBA 4A5MA 4NLRA 2WZIA 4DPOA 4MJKA 4G6TB 2D3UA 4DLEA 2EIMH 2JK3A 1VYAA 4DR2F 3C18A 2VT2A 1RTDB 3NAUA 2MQQA 2DFFA 2WY8Q 3I64A 3MECB 2HXOA 5L4EA 2CQGA 2I1RA 2H65B 4XDDA 2KXFA 3JRIA 2FB0A 3L09A 1VBZA 1FRMA 4PFPA 1ETQA 1N5YB 1NSPA 1JJHA 4QYRA 2CFXA 3D5LA 3DKXA 3HHGA 2XCPA 3KHHA 1Q4RA 3VGVA 2CDQA 3SHFA 1VI0A 3AAFA 2EIKH 4M8LA 3MTJA 1RETA 4AWXB 4MKBA 1JLGB 4KISA 3LP1A 1SPBP 2HBQB 5KFJA 1FBSA 2UUBF 3K3OA 2IC3B 2WVCA 3JW4A 1T7PA 3EAMA 4B3AA 3QPIA 5B0CA 5JHUA 1ZM3A 1Z05A 5FIIA 4N47A 3W5YA 1OCOH 2NSCA 1OEDC 4G7OF 3CUNA 1ZP0A 1N33J 4FKXA 1VK3A 2CV1A 3KLEA 2UV8A 1S99A 3BPXA 1N78A 2OA4A 4NMLA 1I6HJ 5LHHB 5IY5H 2V9KA 5ERIA 4AKLA 2V63A 3AB3B 3CT9A 4DR5T 2VPXB 3DKDA 2XI2A 4HQEA 4Y00A 4MKVA 3OJAA 1AUDA 2HHWA 4CO4A 2BOAA 2QTWA 4OYJA 1B4AA 1AT1B 3MFIA 2E7WA 3C19A 2VE9A 3BY6A 4OZ5A 2XBPA 3GYXB 2WBLA 1S6OA 3U1NA 4K4SA 3H2VE 3N28A 1K4SA 5EZYE 5H6QB 4ZPCA 5JDHA 3E97A 2K27A 1SE7A 4PUSA 2FJBA 4DV6T 1HA1A 2LYVA 1UJ6A 2V34A 1ZA2B 2CS3A 1ZAXA 4DXLA 1VQ7S 2XQ5A 4NXNT 1B0VA 1GX6A 4OHVA 3EQLF 2JA5J 2C3YA 1N32J 2UUCJ 2VFRA 3W1YC 4IQ4A 1Y5LB 2VH7A 4NC8A 4HFHA 2QYGA 3I82A 4RNMA 3KFWX 3OJSA 1TWCJ 3J81Z 3BR2A 3KINB 2KM8B 1BWEA 2XAHB 2KL8A 1OR7A 2BV3A 1T6SA 2YKOA 3HOSA 5IP7J 2X3DA 4ZI3D 5BJRA 1H73A 5KG6A 2UXCT 2ZEJA 1T05B 2U2FA 1O51A 4C3LA 2CPFA 3AEGA 3B8HA 4XN3A 2QRXA 2CV2A 2DGUA 4AQYT 1NDKA 5JDMA 2JMWA 1NAFA 1X19A 4ZH4F 3IAS9 3JS9A 3FDYA 3GTKJ 5FYMA 3DLHA 3PURA 3BWGA 3FSIA 2IMWP 3CSKA 4OZLA 1VHIA 4PUOA 4Y34A 3D1OA 3M6WA 3UUNA 4KYWA 1JHHA 1QD1A 1E6YB 2Y8YA 5HCMA 1N25A 2OFHX 4ZLLA 2DWGA 2PE8A 1N5VA 2ZD1B 2A05A 3OR2B 5D5WB 2AYBA 1UB9A 4AKHA 3Q9DA 3C50A 1GUUA 4OZ0A 5AQRB 4NA1A 2RIJA 1CSJA 2Q9QB 2BE7D 4A3DJ 3DTIA 1I5OB 4HBLA 3LALA 1GXPA 3OS1A 2PA8D 1LVFA 3F57A 5LMNT 2DHSA 2VF3A 4ED3A 4O4GB 4R0JA 2W4CA 4X1YE 1S7IA 1CBKA 5DGAA 1W0UA 2YTCA 3K5LA 3JTPA 1ZG3A 4HT5A 2JSCA 1JKHB 5L1JA 3HFKA 1PUFB 1AU7A 2ZSIB 3MZHA 2WSCC 1GT0C 4FCYA 5CXTA 3NMAA 5HXEA 1V4RA 3WX4A 1NHKL 4QBUA 5EX0A 4J9NA 2M67A 1QGPA 1TAQA 4B3TT 4A8XA 2OPSA 4LK0F 4B3RF 4DX8H 4FPRA 2HYJA 2HQGA 1J9IA 4YFXF 1EZZB 3DNCA 4DL2A 3Q2TC 4J90A 2LEBA 1U6FA 1XG1A 2BYVE 2V1DA 3WC0A 1HQEB 4DR4F 1VQ4I 5F3JA 2DHHA 4U7DA 2BANB 2HVHA 3OL3A 4KX6A 3MEDA 2YK0A 2CUJA 2LMIA 5EEAA 3HKDE 3FB2A 2MZQA 3G2BA 3K58A 1B4SA 2CE7A 3CK6A 5DYMA 2VVNA 4ED6A 3FQLA 2WDRA 2D9DA 4Q8EA 1P4WA 4ZI2D 3IAM2 1YQ4A 3FXMA 4BUPA 2WW4A 1KYWA 1R3NA 2LNBA 3MPYA 3KJVA 1X4OA 4R5PA 2D45A 2V8SV 5ICFA 4HEAA 3DHWC 1NJIT 1TL3B 3GVAA 5ETPA 4WE1A 3W62A 3SZ2A 5HEJA 3AE5A 4OZ3A 4CLPA 5HWYA 2OO4A 1RYSA 1QSDA 1I3OB 2OPRB 2L9QA 2Z2ZA 2XQCA 3Q5DA 2PFFB 1R8IA 1X4CA 2HKOA 4DV7T 2MW8A 3O3KA 4OIQF 5LYJE 5JVGQ 3JREA 2FBHA 3PUAA 5HEOA 3C3LA 3ETVA 3ABLH 2UVUA 2E9XA 2EWHA 1YIJS 3ZCIA 3D68A 4M3GA 3UULA 1VR6A 2RD5C 3D2WA 2V67A 2PN6A 2ZKUA 1TW3A 2H27A 1IZNB 4ON0A 1TVRA 2OPPB 4ILLA 4JI1J 5AQVB 3PACA 3H0PA 4E7HA 2EIJH 4YB7A 4ILCA 3PRDA 3TRGA 3BGRB 1IBLF 1YJTA 1EH7A 4QPQA 4EFAC 1QAJA 4DW6A 4XTTA 5HLFB 3WAJA 3RIFA 3EXYA 1X0PA 4XLNF 2VG7B 3JAEA 1IQTA 4H4KA 3PCOB 1FX2A 1FRKA 3QIPA 1YVFA 2DI3A 4C4WA 3WODF 2KHCA 4YR2A 3CCRS 3PRVA 2NZ4A 4R8HA 1HG2A 4IEJA 5HCJA 1GEHA 4NLGA 1STZA 2DMUA 2DGQA 1XD7A 5FJ8J 3N6MA 3FXEB 4HG2A 2NLWA 1F5TA 3R6GB 5HOOA 1BC7C 1L3UA 4O2BE 4KIBA 4LVOP 3BSCA 3H9QA 3MZYA 3DGPB 3GPAA 4QR2A 3I58A 1B9MA 4OYIA 3KLVA 3IH3A 2E5LJ 1HYSA 1RWUA 2BM0A 4FE4A 4M74A 3GF2A 2I5JA 5F64A 2DPUA 2OF7A 3C6UB 3IBPA 3HVRA 1SEUA 5AIQA 4P7TA 2GJFA 3N9NA 3T1YF 2K4JA 3RKXA 3KLIB 1V6HA 1CQMA 2RF2A 4NEZA 3J81U 4B02A 3R0AA 1RUSA 1QTMA 4CHUA 1UTAA 4QW8A 1RWWB 3EZ5A 3ZZZA 3UQ4A 4WP3A 4DG1B 4M5MA 1YI2S 1YD8G 2WS3A 2XZTB 1TL5A 3CJRB 4EM2A 2KHDA 2EHOC 3JQJA 4N8OA 1CPZA 3CO9A 2B56A 4LSLA 3KK3A 3AJ2A 1O3RA 2L7ZA 5AQOB 2Y31A 2UUAJ 4Q8FA 4RB0A 5JRCB 3UKGA 2BMBA 4DWIA 1ZR4A 2IAJB 3OS0A 1ULYA 1H8AC 4ISSA 2FUG9 3L2WA 3H42A 4F26A 4HFCA 4DR7T 3QGIA 3I32A 4F3MA 1O5JA 1CC7A 1OPCA 1NDLA 2V8HA 1OJ4A 1V5VA 2QA2A 2BEFA 1DTQA 3N79A 4MK7A 5JTGA 2R7VA 3VR1A 3KTQA 2ISYA 3PUGA 3PFYA 4ECQA 3ANWA 3DKWA 1Z4UA 2HRTA 3H0GJ 5H6RB 4ID5B 4UVCA 4HF0A 2FYXA 2UXBJ 5KK1A 2J9EA 2Q1LA 4IG3B 1KA8A 4KT5C 3GMIA 2V50A 1VRTB 4KO0B 2WQYA 4G63A 3EDVA 1FZPB 1PC5A 3H3ZA 3EPIA 5FKKA 3NCPA 2MKIA 1TW2A 1LFBA 1D8YA 2FEZA 2WC2A 5CQGA 3J7AN 1RP5A 2V7KA 2XZWA 5K7FA 4DL0C 3HOVJ 3RGLA 3QSIA 3BO2A 2W1OA 3O8WA 3R6NA 5AQUB 2CQHA 1VRUA 2DQLA 1CULA 1FRJA 4JI6J 1TL8A 3CJQA 5LL6d 3RUBL 3NWTA 4IE6A 4USTA 4X66J 1RAEB 2HPJA 1YJNS 2DA1A 3ZC0A 1TK8A 1X9SA 2C5KT 3ZO7A 1KVIA 1VGYA 1R23A 4LMZA 2MY8A 2UXDF 2WB5A 2L02A 3HKZA 3N5BA 2L7MP 1W2IA 2B4OA 3BTLA 5B1AH 4Q43A 2QFIA 4OYXA 4O44A 4KGKA 4FS2A 5GAEJ 2DT6A 2O7OA 2F5GA 1DFDA 1XR5A 5D4NA 5HNHA 4OHXA 4JV5J 2VJIA 2KH9A 3LGNA 2QA7A 2RQMA 5DDPC 3CIRA 1R6VA 4OIRF 4Z2XA 5ABHA 1TL7B 1U1KA 4P55A 5M2UA 4HWDA 1OIAA 2NOXA 5AXLA 2Z57B 2Y9ZA 4G65A 1HCRA 4AIHA 2XIGA 2D2SA 2NR4A 4WK3A 4KIFA 5LD2C 3UFCX 1PBAA 4H9RC 3LSRA 2BUNA 2LU1A 1P7IA 3J7ZI 2XMWA 4ES1A 1RA6A 3I4NJ 1DP3A 1CJVB 2V7LA 3M8YA 4RW4A 5CYQB 1FDDA 4C90A 2KMUA 4NCGA 4ED8A 4GCVA 4WYWA 4FYXB 4DFMA 4TY9A 3ZN0A 3ZP5A 4RW6B 4MHGA 4I6ZA 3F9KA 4G6VB 2NPFA 4NYPA 1NNDA 3AOBA 4P96A 1ZZNA 2IAKA 4ED2A 4ILAA 4C2TA 1DTTB 1SB6A 2QA1A 4P5OA 4BC9A 1BA5A 2VDHA 1FIOA 1HBMA 4LB5A 3IGNA 2JVOA 3SQGA 3OR1A 3FBCA 1EP4A 3UT5E 4B3XA 3GCWP 2DGOA 4Q7AA 4LB6B 3QT5A 2WK4A 4UW2A 4Z8XA 2PJPA 2W2OP 3GCXP 4G2AA 3LP0A 5HDGA 3KHGA 4F7ZA 3OFEA 1RI7A 2FUPA 3TX0A 2MD5A 5CYMB 3W9IA 2RNJA 3PY8A 2SXLA 3C3WA 1WWHA 2XSAA 5JDNA 2X9YA 4I1TA 2CPIA 2NW8A 4PAAA 2XMUA 4F04B 3SSQA 3AB4B 1HSTA 1E7PA 2VJVA 4I7HA 5JVTA 3SFUA 2CQIA 1WCRA 1VIXA 5CA5A 2LBFB 3BPVA 2NS0A 3AECA 2N7YA 3TAQA 2J0SD 2ZJ2A 4FBUA 2P4WA 3CPZA 2Y8WA 4GGGA 3NBPB 4ZKAA 1W25A 1KN6A 1LDJA 1E3HA 4Y52J 1X4HA 3HI2A 3JAMU 2RQCA 3MMBB 2PG8A 1P4AA 3G1MA 2PC6A 2RJZA 4NPPA 4CUGA 2C6YA 4OYZA 4LF7F 1FHTA 4TYBA 1DLOA 3MFHA 5FLXK 2CZ4A 1DU6A 1FBUA 2E1MC 1X1PA 3TA2A 3C15A 2O9LA 1IM4A 2XVCA 3MEGA 3IRQA 1AOYA 2R5YB 2WONB 4YB6A 4CH7A 1N4LA 4IKAA 4DV2F 4IO9Q 1P7JA 3LGHA 4LLNA 3O44A 3PW0A 2A6MA 4Z7CA 2LXIA 2K7LA 3J7Yq 5FY0A 2JDJA 4AKGA 1HBOB 2K9QA 3JB9k 4JI8F 1X2NA 4LF6T 1DZ5A 2W57A 2ZZMA 3NEKA 4XOTA 1ZQ3P 5H9FK 3N05A 2YPRA 4XPEA 4IRIA 4LG0A 4NLXA 5HLIA 1G4DA 4NYZA 3A8YC 4RMNA 1FEEA 1KQFB 3ISND 3GEZA 1FPQA 1DAXA 2HOTA 5B1BH 2AP6A 4HT7A 3RQ4A 1DQAA 4RW7B 4BDPA 1QBJA 5EZGA 1Q8IA 4ZS6A 3LSHA 3FMBA 1KR4A 4MQ9F 2BG9C 4KIGA 4OV1A 1IRGA 1BQXA 4RLFA 5CJ5A 2IJRA 1H6KX 3HTUA 3OYJA 2HS4A 4MTPA 3DLKB 5ETQA 3U21A 5KT3A 1G3OA 4ILBA 1D0EA 4HEA2 4RDUA 5LXYA 4WWSA 4DFPA 4BY7J 4KI0F 2K7KA 1ZHCA 2LC2A 3ABUA 1BOAA 3CWJA 4HTEA 4XRMA 1CJKA 4KBMB 2H09A 3B5MA 5KT7A 5A2QK 4KB7A 5KCMA 3KK1B 4J9RA 2DA5A 2VT3A 4GO1A 2HNDA 2VKEA 3BR8A 3ISPA 3MEEA 2DXEA 5AJ3F 5EGOB 5L3DB 4KC5A 1IUFA 3HRMA 4M6VA 2Q2EA 4OK0A 1HL6A 3LPYA 4LIWA 1U5PA 3I0QA 3MAJA 5FNVE 2NVYJ 5E0OA 4ZYAA 2ZXJA 1R0AB 4QW9A 2DCEA 2XGQA 2GXBA 4RAYA 3I9V2 5IWAJ 3L2UA 2VD3A 5JR3A 1W2BR 3C66A 3M8JA 2R8KA 4ZS2A 1WUUA 4DFJA 1BC6A 3DV8A 3TJ8A 3CJTA 3EMTA 2MAWA 3P50A 1W36C 2JMKA 3HR0A 4ANJA 3BJYA 1WJDA 3MM8A 2F1FA 1S0VA 1ZPVA 1U24A 3D6FB 7AT1B 4NXMF 2VE8A 5B0FA 2LM9A 1S4FA 4BJMA 1V54H 1S6QB 1X4FA 3G82A 4IDQA 1N33F 2KJCA 4ED4A 2J8AA 5JHFA 3T1BA 1Z7LA 3ZT5A 1K79A 5LHIB 1KYZA 1ULRA 3Q89A 5AE1A 4DX7A 5C3EJ 1YKWA 1I94J 1P6RA 2J6UA 2OZUA 1UFKA 4B6XA 2NR0A 4B3OB 4ISTA 2Z4PA 4U0YA 1S29A 5E18F 3WTUC 5KXJA 1Y9OA 1S8NA 5E3CA 1BI2A 5HJYA 1Y10A 3PYDA 3QAEA 2IEKA 3P8CD 4KMCA 4QPOA 3GFIA 5CVUA 3CC7S 2AZ1A 3FXJA 3PYFA 1E3OC 1XN9A 2XWYA 4BWMA 4TLRA 3CF5F 1SJQA 3DHXA 2HEOA 1S57A 4DZPA 2GXAA 5IYBJ 3M3YJ 2DY1A 4RA2A 1MKMA 2DGTA 2W84A 2F4FA 1Y64B 2K2PA 2A18A 4BJNA 4LVNP 4A3KJ 5KG2A 3QJPA 3NOCA 1MIVA 3G87A 2LKGA 4I6YA 3TDUC 4UZBA 3SV3A 3CD6I 2YQ0A 3NWIA 1ZYRF 1IKVB 2HAFA 3GA8A 3KLGA 4TY8B 3B57A 2KRHA 4WBNE 1WD6A 3X3UA 4A98A 2GM4A 3KV9A 2VJ4A 1Y8QB 3FFIB 5E3AA 5A8RB 1LFPA 5T7LB 5ETNA 2IM3A 4XLAA 5EWEA 1HQUA 3NS5A 3R5CA 4CM0A 1XNRJ 5F0FA 2IC9A 2GC8A 4PRFA 4GC6A 4FZVA 6FD1A 4ES3A 3OVAA 2HWIA 1N6QA 2QV6A