1UGOA

Solution structure of the first murine bag domain of bcl2-associated athanogene 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Bcl2-associated athanogene 5
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1ugoA00
5AQVB 3A8YC 3FZLB 5AQJB 5AQHB 3M3ZB 1I6ZA 5AQPB 3FZFB 5AQSB 1UGOA 5AQMB 5AQIB 5AQNB 2D9DA 4HWHA 5AQTB 1UK5A 5AQFB 1T7SA 5AQQB 4HWIB 1M62A 5AQKB 5AQLB 5AQOB 5AQGB 3FZMB 5AQUB 5AQRB 1HX1B 4HWFA 1M7KA 3LDQB 4HWCA 3FZHB 4HWDA 3FZKB
chains in the Genus database with same CATH superfamily
4ZEYA 2CEAA 1OEDE 2MOZA 1IBLT 3P7IA 3AE6A 1X79A 4TWHA 5AQHB 4LFBT 2XASB 1D0XA 2BBJA 3QUJA 4U2ZA 3RKOA 2DCFA 4A98A 4U72A 4ZI2D 3T1YT 4LFCT 2V6YA 2V7KA 2YOEA 2BS2A 3K3OA 3C50A 4H9RC 4B3MT 3ZMUB 4KMCA 4WW0A 3KV4A 4KHZF 3HR0A 3FBZA 4HEAA 4TUYE 4PFOA 5L4EA 3ONLC 4DV3T 4I50E 2LLYA 2V5CA 3KVBA 3RYFE 4X66T 3AVRA 2HN1A 2Y6XA 3RH3A 2VQET 2Q9QD 4I43B 4I55E 2H89A 2KINB 2HPJA 3CWZB 2XQ7A 4EIWA 2XZEA 3N9LA 4PK5A 4U74A 4B6XA 5A1LA 2PG8A 2WBLA 2X9XA 4ILBA 5FP3A 4DBRA 4EB6E 2FJEA 2MBGA 2EHOB 4G63A 5JR9C 2P9BA 3JC6D 3ANWB 2LSYA 2XHEB 2XQ8A 1VOMA 2EHOA 3EDVA 2LM2A 5AQVB 3RHWA 4EZHA 5FXZA 2XQ9A 5AQPB 4DVDA 4ILCA 3LK42 3MACA 3UFEA 2EHOC 2YU2A 2KT9A 3FZFB 5F8PA 1UGOA 3RQWA 5HXCA 3PJAA 1KF6A 1UUSA 4HFHA 2BG9B 4UVBB 4ISSA 5HWXA 1XNRT 3FHNA 3HKDE 5AQNB 2V7LA 5JTGA 3PUZF 4HFCA 1T7SA 3KDSE 3OYZA 1M62A 3QNUA 4IE6A 3N2OA 1ZOYA 4PJNA 2LOPA 3IBPA 4UELA 1HCIA 1N34T 3N9QA 5LHIB 2V7MA 3RLFF 3UU8A 3AEAA 3P8CD 1FMWA 2DLRA 5HWYA 5IUXA 5L3FB 3O9XA 4EXTA 1QUUA 3ZJ1A 1IBKT 4QH1A 3BQLA 4IE0A 1YKHB 4CXWA 2QYWA 3RPUA 2JQQA 1MNDA 4YTNA 2YK0A 3ZMSB 4HE8A 2XJ7A 5L3BB 4CQIA 2LHRA 4YHHT 4P1NA 3AEEA 4E7ZA 4LF8T 3LG7A 1AJ3A 2CPTA 3L8RA 3M3ZB 4IL9A 2KSRA 4CI3B 1HR0T 2CMRA 1IBMT 3NWIA 1ZEEA 2B76A 3LJCA 1NWMX 5F3JA 3PUGA 3UUMA 2UU9T 2ACZA 2NOXA 2A72A 4YY3T 5H6RB 1G73A 3AB3B 4GYSA 4OFZA 3ZLIA 5AQOB 3QB5A 1KFYA 4NXNT 4YFSA 4AKRB 4CI2B 4GKJT 1SUMB 2H7VC 3KBTA 3ZKRA 5BR8T 4DV5T 2V26A 2W63A 4AKGA 3CQXC 2JQHA 5JRCA 1R8IA 2XM2A 3UQ7A 2LKGA 2W00A 4IDZA 2BVMA 3SOLA 4X1IE 2CWYA 5FVLA 3BQIA 1US7B 2YDRA 3CPZA 1KNZA 2XQ6A 1YQ3A 4ZI7E 2VURA 4JI5T 3ZC0A 2VWAA 1OEDA 2C5IT 1LKXA 1WR0A 2HH7A 5FMNA 2QGSA 4TX5A 4DV4T 4JI3T 1IAPA 5JH7E 2CCQA 3HA4A 2A3DA 3I9YA 4H63H 1NENA 2A9UA 2WY2A 4N78D 3UUBA 2CHOA 3N9NA 2I6HA 4ZXLA 3RIAA 1HNXT 1YW0A 2JRKA 3CK6A 5LMNT 2UXBT 2E8IA 1CHUA 2CXLA 2RPAA 2XQ3A 3AE7A 3GA8A 3DTOA 3JCFA 4X62T 4B3TT 1MMGA 3R84B 3TLSA 4QKNA 4UV9B 5KX5E 1GQEA 3H3AA 3RI5A 3ZT5A 3C98B 3ZEFB 4PJJA 3RX6A 4MALA 1J5ET 2V7IA 4ZI2C 2BKPA 2K48A 1E7PA 3QB5K 1MIYA 5FVKA 1HNZT 2A2FX 2YDQA 4DV6T 2C0SA 2WZIA 3B13A 4YT0A 2D0TA 3V5UA 4JYAT 2FJAA 2XY8B 2BS3A 3A8YC 1Y01A 1MMNA 3GN5A 1T8BA 5C8YE 2LEHA 3GWHA 1YD8G 2M6BA 5LG4A 3N2GE 2V6XA 5HEOA 2WS3A 3VHLA 5AQMB 2K3WA 2X67A 4GOUA 3AE1A 4YTPA 2CM0A 4IE4A 4UXNB 2R6GF 4X5TA 5HCMA 2W2UA 5DQWA 3BQKA 5AQUB 3KBUA 4H63V 3RGLA 4WBOA 2N9DA 3KV5A 4CZZB 5KXJA 3O4XE 3X1DA 1N32T 2V8SV 4ISTA 4Z90A 4J2CA 1MNEA 2WZHA 2XQ4A 3CIRA 4HWCA 2KWIB 5E0OA 4U33A 4GIWA 3PUYF 2M6IA 5CFBA 4CXYA 4HWDA 5L3CB 4HKAA 4BJMA 3FXEB 4L9IA 2LSJA 3Q5XA 3W15B 2WM9A 2X9HA 5HYAA 3MXZA 3F31A 1W9RA 3ETUA 3KFWX 4X1YE 3SS1A 3O1JA 3ZMTB 4JI7T 4KUMB 3UULA 4O2BE 3AA0B 3ZMZB 2I0MA 3P4RA 5FY1A 5FL1A 2BKOA 3IF8B 2UXNB 5ABFA 1HS7A 1SA0E 3P4WA 2MTQA 3T8OA 3LK2B 4JI6T 4EOZB 4LFAT 4B3RT 5CGMA 3O1HA 2LJLA 3TKLB 3CQCB 4OYKA 2OA5A 3NRYA 5LGTB 5JRCB 4IDOA 3Q9DA 4JEHB 5GONE 1E2AA 1UCUA 4L5GA 2G0UA 4JBWF 2L8KA 4ZZCA 5AQFB 2WMNA 5DABA 2DI4A 1HG5A 1LVKA 2W4XA 2XAJB 1ZP0A 2YINA 3DP7A 1S35A 3FB2A 4IDNA 3RRCA 4DR4T 2LRKA 3LFMA 3UT5E 3ZN1B 4DR7T 2D5UA 4DBQA 4DUYT 3EDUA 4YJ3E 4F6RC 3AEFA 1D0ZA 2CXFA 4TN7B 4LMLA 2BG9A 2GK9A 2HPLA 3I0OA 5FXWA 3GMIA 3ONXA 4Q25A 5CB4E 5L47A 4YTMA 5LGUB 2LRLA 2VL0A 4HN9A 4AI6A 4KI0F 4BA9A 4ZS3A 2EHOD 3L09A 3LBXB 3ZCIA 3AE8A 2UXXB 5JDNA 5KMGP 4YLHA 1XWMA 2XAHB 2CXDA 1NEKA 3RQUA 3VR8A 5C2TA 3ZSTA 5JQGE 3FXDB 1B7TA 3FZMB 3EAMA 5HXEA 1XDOA 4AISA 4X64T 3IHRA 1U4QA 4B3ST 3VKGA 3OBVE 3PUQA 2E9XC 3E08A 2DL1A 1UURA 3B57A 4HFVA 2IC9A 3HL6A 4HGAA 3BK9A 5L3EB 1M7KA 3Q5EA 4UEMA 3ZJ2A 2ODUA 4UVCB 2M67A 5LNKA 4H9QC 3I0QA 2K9AA 2QRXA 3ZYMA 3CVRA 3OTOT 2XTLA 4KHPT 1X9BA 5HXSA 2XQAA 3ESLA 5J2UE 4BAYB 3PU3A 5JR9B 3FBLA 3HKCE 5L3GB 2D0UA 3P4QA 4WYVA 3O1IA 2LM9A 4DR6T 3JADA 1NAFA 4QH5A 5ETWA 4LF4T 4U2YA 1VCSA 2Q9QA 4OYJA 3WAKA 3JAEA 4JI1T 1UK5A 3OYXA 1FEWA 2CLYB 3HI2A 5AQKB 1ZV4X 4A56A 2KNDA 5HEUA 5AFUL 2X9YA 3KV9A 4QH4A 3AXJA 3NKZA 1L0VA 3C64A 2WDRA 5ADXL 3K3NA 3Q5WA 3PV0F 2NW8A 1D1AA 5EK3A 1UX5A 3KVAA 2XAFB 4EEBA 1Z8UA 4NIQA 5FXXA 4DIDB 3AA7B 2YN6A 2ZM8A 2QA7A 3JAFA 5LJMA 5EK2A 1W09A 3EUHA 3UUNA 3IA3A 4LMKA 4NUVA 4TWFA 4CI1B 3AE9A 1H7CA 3L3PA 5IWAT 1XMQT 2WB5A 4IDQA 5LG3A 4H9PC 2NWBA 4AKLA 4AXPA 3AEBA 4BJNA 4PK6A 3UU5A 3RC8A 3SWHA 4NXMT 2XQYA 3CX6B 4XZCA 4YXDA 4DO0A 4DV2T 2WQYA 3MK7C 5AQIB 2IC6A 4OK0A 5DQVA 2JPFA 2J1DG 5HXRA 2JMHA 3EI0A 3Q2MA 1HX8A 2PJQA 3NZPA 4X20E 4EGWA 2UXCT 5ABHA 1OXZA 3ZYKA 1MIVA 3I9WA 1J1JA 4WZXA 4AQFA 3PU8A 4O4HE 4UF0B 5AQRB 5J0ZA 1J5WA 1T72A 2KLQA 3C4XA 1D0YA 3MJXA 4TWDA 1G8XA 2E9XD 2KZ7B 4IE5A 1YXRA 3UQ4A 4FI5A 2LOSA 4IT4A 3GN5B 2JJ9A 2W61A 3PDYA 4HFBA 3FZKB 3PUWF 3Q5DA 4NPPA 3ZC1A 5JVDE 2YDSA 3FZLB 4LF9T 2PFVA 2XSBA 3E22E 4PFPA 4GYRA 3AECA 4ANJA 5M4YA 4O2AE 4LF7T 3VU7H 4P0BA 2XUEA 3KINB 5LJNA 3U78A 5LYJE 5AQSB 5FNVE 1MMAA 1E1HB 3CX7B 2BDEA 2DWKA 2VKOA 5LP6E 2UXDT 2RA1A 1U5PA 3AE2A 1OEDB 3HKEE 4LMJA 2VQFT 1WR6A 3PUSA 4MLKA 1HFAA 2ES0A 3ANWA 4ERRA 5C3JA 1YKEB 5JDLA 3PUXF 4L0RA 2H7OA 1S94A 5JDHA 3NBXX 2Q9QB 4HFIA 2FJDA 3NVOA 2Q9QC 5LCYA 3L39A 2HHHT 2NW9A 4DNDA 1HX1B 3K3QC 2DWGA 1FIOA 2FUPA 2CWOA 4U31A 4QWNB 3SFEA 2BZBA 2IMLA 2KXPB 2ZLYA 4OX9T 5IHYA 3PJAJ 3N9OA 2K5BB 3CQGB 5HEHA 4HFDA 3AE3A 2OV9A 2B1EA 4EYYR 5LMUT 2F4VT 5FKYA 3C4WA 2IUBA 2VKDA 2X0HA 3UFGA 4DR3T 1ZHCA 3CKDA 2VVNA 2CRBA 3PUVF 5J1GA 3ZYLA 4NUUA 4DMWA 5EK4A 2K24A 1SHZC 1W0AA 2VL8A 4KP3C 5AQTB 4P0AA 1XNQT 4YJ2E 5FY0A 2NW7A 4U3CA 5DJQC 2LT3A 4ADZA 2BVLA 3P50A 3B5MA 5AQGB 5L3DB 2WSSV 5HAXA 3TLUA 2BG9E 3MZKB 5ABGA 5J2TE 2LHNA 2IW5B 2CHNA 1JNZA 4IDPA 1DU2A 4HWFA 3U3IA 1WYCA 2JMKA 4GK0E 3H3MA 3QC9A 4GK5E 3RKGA 1BR0A 2IIUA 5JDQA 3ZT6A 5IYZE 2WP9A 1LRZA 2E5VA 2D2SA 1SE7A 1EZ3A 2VB6A 4U7IA 4UR9A 1WFDA 3RC3A 5LB7B 3PE0A 5L2LA 2CA5A 4ILUA 1I6ZA 3EABA 4CXXA 2V6YB 1CUNA 4JUYA 4G2AA 2VVSA 4QX8B 3CMLA 1D1CA 4QXHB 4JLEA 2N1GA 1VRBA 2LKHA 3M65A 3E0ZA 4QXBB 4HWHA 4YSXA 4XBFB 1FMVA 2E9XB 3F57A 4MHCA 5AQLB 2LSGA 4Z91A 5JDGA 2E9XA 3NRXA 5CA1E 1N36T 4TV9E 3LK3B 4JI4T 3MKDA 1XMOT 5ABFB 3AAIA 2WAUA 4ZS2A 1FJGT 2PTFA 2X0YA 4K0UA 4FJOA 4C91A 2WDVA 5FXVA 1WLXA 1MIWA 2CLYC 2XAGB 3EVYA 4TNVA 4A5XA 2BKNA 3ZT7A 4AIUA 3LDQB 4MBQA 3NZQA 4UVAB 5FY7A 3VKHA 3ZN0B 4DV0T 3EHZA 1HG2A 5L4HA 3ZCJA 1ZKEA 4JI8T 3N2KE 3IEEA 4P09A 3AEDA 4Z8XA 2DHRA 4I4TE 5AQJB 4AKHA 4TNWA 1IZNB 4E7SA 3C4ZA 2CE7A 3OVUA 2XQ5A 4IL4A 4PW8A 2C5JA 5JR9A 5LHGB 5HEGA 1D1BA 2NP9A 2V7JA 4DMVA 2DNXA 4HTEA 2X0LB 3PURA 3AA1B 2MPKA 2NTYA 4UF0A 2V5DA 5LA6E 3UU3A 3AXJB 1N33T 2UUBT 2L9QA 2VKJA 4IREA 5KDMC 5AQQB 3UU6A 4ZHQE 2MYSA 2H3RA 2WDQA 4JV5T 1UX4A 1HNWT 3OJAA 1VCTA 2J47A 2KMFA 5BMVE 3H37A 5EZYE 4ZI3C 4X65T 2IHR1 3SRZA 3V5SA 3PUAA 3R6NA 1IJ6A 5TAOA 3VR9A 4A97A 3DJBA 2BBHA 4AQYT 1WCRA 4DV1T 4QHOA 4WBNE 1KEYA 2W67A 3A5XA 4M1PA 2CBJA 1LVFA 4UV8B 4EAHA 3S4UA 5LHHB 3A7MA 2BG9C 2ODVA 3ABVA 4X1KE 5LOVE 2J62A 2KWHA 5HCJA 4GKKT 3J7Yq 1BR4A 5ABEA 4TV8E 2L3LA 2PBIA 3RIFA 1KNPA 4AQFC 3WAJA 4DV7T 1XZYA 3WI3A 4H9NC 1OWAA 2D9DA 3MA9A 2VKHA 2ZMAA 2X66A 4JEUB 5FL0A 4DR2T 4IE7A 5HEJA 4PJLA 1MMDA 4O4JE 5LBMA 2FBWA 2J4GA 4O8SA 1BR1A 2VK9A 1BR2A 3LBXA 2X68A 3KV6A 3SFDA 1OEDC 3VRAA 2UUCT 4I0UA 4LF5T 4CN1A 1WRDA 2XPKA 2W66A 2Z6EA 4KBMB 3J9X1 3ZSSA 2QVAA 4JI0T 2LSIA 2YEVC 2E5LT 2X51A 3K1SA 4QXCB 4JI2T 3UUXB 4COFA 4H9OC 3TLWA 4CN6A 2IAKA 2Y8DA 3CX8B 2AXDS 4AKIA 2AE9A 2I59A 2JQ9A 2VASA 2X9WA 2XAQB 3P4SA 3RRWA 4PK4A 3AA6B 4IGUA 4TZ4C 3P4PA 3HKBE 4AQGA 3K8PC 5JDMA 3ETVA 5LXTE 5FYMA 2UUAT 2XM1A 4PNIA 4DR1T 1QSDA 4OHFA 2WMOA 2IDOB 2OLTA 3D0TA 1Y64B 3F2EA 3RIUC 3RYIE 2HN2A 4V1Av 1O3XA 4DUZT 5F5WA 4EV6A 2ZM6T 1V9DA 3ONJA 3I1AA 3RIUA 3ZMVB 5CJ5A 3QK6A 2NTXA 4PAGA 4IIJE 3G06A 3N9MA 3T1HT 4U7YA 1HTJF 2WWUA 4XAXB 4ZOLE 2ZM0A 2XSAA 2YKSA 3C51A 3FZHB 3JC6C 5LBQB 2C5KT 3RYCE 4ZZBA 4UIGA 3TLTA 1Z0PA 3QOFA 2FJBA 1QLBA 1T98A 2MAWA 2N2NA 2RP4A 1WYBA 4ASKA 1JNRA 3AVSA 4YSYA 4YHJA 3RYHE 2W0GA 1KK7A 4QX7B 1I94T 3TLVA 5H6QB 2E2AA 3AAEB 3AE4A 3UTKA 4ZI3D 2Y48B 2BS4A 2LE8A 3AAAB 4IHJE 4F8HA 5JREA 1XDPA 3LSVA 4WNKA 2WCAA 3OPCA 1HF8A 4DR5T 3RF1A 4ILAA 4O4IE 5LGNB 4EEDA 3AEGA 2ZM2A 3VRBA 4HWIB 2WU5A 4EYUA 4EZ4A 4CN4A 4YSZA 2SPCA 2V1DB 4KX6A 4HFEA 2WWVA 5HXHA 5JDFA 3N9PA 3ZPOA 1YQ4A 3AE5A 4O4LE 1KNRA 4PJMA 2ACXA 5CA0E 3N5LA 4H9SE 2CBIA 3PTRB 4MFRA 4LF6T 2JIWA 2NR4A 2W62A 2YU1A 3UU4A 2LSKA 4K0KT 2WU2A 1IJ5A 2H88A 2JQKA 1W0BA 4C90A 3OKQA
chains in the Genus database with same CATH topology
5AQVB 3A8YC 3FZLB 5AQJB 5AQHB 3M3ZB 1I6ZA 5AQPB 3FZFB 5AQSB 1UGOA 5AQMB 5AQIB 5AQNB 2D9DA 4HWHA 5AQTB 1UK5A 5AQFB 1T7SA 5AQQB 4HWIB 1M62A 5AQKB 5AQLB 5AQOB 5AQGB 3FZMB 5AQUB 5AQRB 1HX1B 4HWFA 1M7KA 3LDQB 4HWCA 3FZHB 4HWDA 3FZKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQV B;  3A8Y C;  3FZL B;  5AQJ B;  5AQH B;  3M3Z B;  1I6Z A;  5AQP B;  3FZF B;  5AQS B;  1UGO A;  5AQM B;  5AQI B;  5AQN B;  2D9D A;  4HWH A;  5AQT B;  1UK5 A;  5AQF B;  1T7S A;  5AQQ B;  4HWI B;  1M62 A;  5AQK B;  5AQL B;  5AQO B;  5AQG B;  3FZM B;  5AQU B;  5AQR B;  1HX1 B;  4HWF A;  1M7K A;  3LDQ B;  4HWC A;  3FZH B;  4HWD A;  3FZK B; 
#chains in the Genus database with same CATH topology
 4ZEY A;  2CEA A;  1OED E;  2MOZ A;  1IBL T;  3P7I A;  3AE6 A;  1X79 A;  4TWH A;  5AQH B;  4LFB T;  2XAS B;  1D0X A;  2BBJ A;  3QUJ A;  4U2Z A;  3RKO A;  2DCF A;  4A98 A;  4U72 A;  4ZI2 D;  3T1Y T;  4LFC T;  2V6Y A;  2V7K A;  2YOE A;  2BS2 A;  3K3O A;  3C50 A;  4H9R C;  4B3M T;  3ZMU B;  4KMC A;  4WW0 A;  3KV4 A;  4KHZ F;  3HR0 A;  3FBZ A;  4HEA A;  4TUY E;  4PFO A;  5L4E A;  3ONL C;  4DV3 T;  4I50 E;  2LLY A;  2V5C A;  3KVB A;  3RYF E;  4X66 T;  3AVR A;  2HN1 A;  2Y6X A;  3RH3 A;  2VQE T;  2Q9Q D;  4I43 B;  4I55 E;  2H89 A;  2KIN B;  2HPJ A;  3CWZ B;  2XQ7 A;  4EIW A;  2XZE A;  3N9L A;  4PK5 A;  4U74 A;  4B6X A;  5A1L A;  2PG8 A;  2WBL A;  2X9X A;  4ILB A;  5FP3 A;  4DBR A;  4EB6 E;  2FJE A;  2MBG A;  2EHO B;  4G63 A;  5JR9 C;  2P9B A;  3JC6 D;  3ANW B;  2LSY A;  2XHE B;  2XQ8 A;  1VOM A;  2EHO A;  3EDV A;  2LM2 A;  5AQV B;  3RHW A;  4EZH A;  5FXZ A;  2XQ9 A;  5AQP B;  4DVD A;  4ILC A;  3LK4 2;  3MAC A;  3UFE A;  2EHO C;  2YU2 A;  2KT9 A;  3FZF B;  5F8P A;  1UGO A;  3RQW A;  5HXC A;  3PJA A;  1KF6 A;  1UUS A;  4HFH A;  2BG9 B;  4UVB B;  4ISS A;  5HWX A;  1XNR T;  3FHN A;  3HKD E;  5AQN B;  2V7L A;  5JTG A;  3PUZ F;  4HFC A;  1T7S A;  3KDS E;  3OYZ A;  1M62 A;  3QNU A;  4IE6 A;  3N2O A;  1ZOY A;  4PJN A;  2LOP A;  3IBP A;  4UEL A;  1HCI A;  1N34 T;  3N9Q A;  5LHI B;  2V7M A;  3RLF F;  3UU8 A;  3AEA A;  3P8C D;  1FMW A;  2DLR A;  5HWY A;  5IUX A;  5L3F B;  3O9X A;  4EXT A;  1QUU A;  3ZJ1 A;  1IBK T;  4QH1 A;  3BQL A;  4IE0 A;  1YKH B;  4CXW A;  2QYW A;  3RPU A;  2JQQ A;  1MND A;  4YTN A;  2YK0 A;  3ZMS B;  4HE8 A;  2XJ7 A;  5L3B B;  4CQI A;  2LHR A;  4YHH T;  4P1N A;  3AEE A;  4E7Z A;  4LF8 T;  3LG7 A;  1AJ3 A;  2CPT A;  3L8R A;  3M3Z B;  4IL9 A;  2KSR A;  4CI3 B;  1HR0 T;  2CMR A;  1IBM T;  3NWI A;  1ZEE A;  2B76 A;  3LJC A;  1NWM X;  5F3J A;  3PUG A;  3UUM A;  2UU9 T;  2ACZ A;  2NOX A;  2A72 A;  4YY3 T;  5H6R B;  1G73 A;  3AB3 B;  4GYS A;  4OFZ A;  3ZLI A;  5AQO B;  3QB5 A;  1KFY A;  4NXN T;  4YFS A;  4AKR B;  4CI2 B;  4GKJ T;  1SUM B;  2H7V C;  3KBT A;  3ZKR A;  5BR8 T;  4DV5 T;  2V26 A;  2W63 A;  4AKG A;  3CQX C;  2JQH A;  5JRC A;  1R8I A;  2XM2 A;  3UQ7 A;  2LKG A;  2W00 A;  4IDZ A;  2BVM A;  3SOL A;  4X1I E;  2CWY A;  5FVL A;  3BQI A;  1US7 B;  2YDR A;  3CPZ A;  1KNZ A;  2XQ6 A;  1YQ3 A;  4ZI7 E;  2VUR A;  4JI5 T;  3ZC0 A;  2VWA A;  1OED A;  2C5I T;  1LKX A;  1WR0 A;  2HH7 A;  5FMN A;  2QGS A;  4TX5 A;  4DV4 T;  4JI3 T;  1IAP A;  5JH7 E;  2CCQ A;  3HA4 A;  2A3D A;  3I9Y A;  4H63 H;  1NEN A;  2A9U A;  2WY2 A;  4N78 D;  3UUB A;  2CHO A;  3N9N A;  2I6H A;  4ZXL A;  3RIA A;  1HNX T;  1YW0 A;  2JRK A;  3CK6 A;  5LMN T;  2UXB T;  2E8I A;  1CHU A;  2CXL A;  2RPA A;  2XQ3 A;  3AE7 A;  3GA8 A;  3DTO A;  3JCF A;  4X62 T;  4B3T T;  1MMG A;  3R84 B;  3TLS A;  4QKN A;  4UV9 B;  5KX5 E;  1GQE A;  3H3A A;  3RI5 A;  3ZT5 A;  3C98 B;  3ZEF B;  4PJJ A;  3RX6 A;  4MAL A;  1J5E T;  2V7I A;  4ZI2 C;  2BKP A;  2K48 A;  1E7P A;  3QB5 K;  1MIY A;  5FVK A;  1HNZ T;  2A2F X;  2YDQ A;  4DV6 T;  2C0S A;  2WZI A;  3B13 A;  4YT0 A;  2D0T A;  3V5U A;  4JYA T;  2FJA A;  2XY8 B;  2BS3 A;  3A8Y C;  1Y01 A;  1MMN A;  3GN5 A;  1T8B A;  5C8Y E;  2LEH A;  3GWH A;  1YD8 G;  2M6B A;  5LG4 A;  3N2G E;  2V6X A;  5HEO A;  2WS3 A;  3VHL A;  5AQM B;  2K3W A;  2X67 A;  4GOU A;  3AE1 A;  4YTP A;  2CM0 A;  4IE4 A;  4UXN B;  2R6G F;  4X5T A;  5HCM A;  2W2U A;  5DQW A;  3BQK A;  5AQU B;  3KBU A;  4H63 V;  3RGL A;  4WBO A;  2N9D A;  3KV5 A;  4CZZ B;  5KXJ A;  3O4X E;  3X1D A;  1N32 T;  2V8S V;  4IST A;  4Z90 A;  4J2C A;  1MNE A;  2WZH A;  2XQ4 A;  3CIR A;  4HWC A;  2KWI B;  5E0O A;  4U33 A;  4GIW A;  3PUY F;  2M6I A;  5CFB A;  4CXY A;  4HWD A;  5L3C B;  4HKA A;  4BJM A;  3FXE B;  4L9I A;  2LSJ A;  3Q5X A;  3W15 B;  2WM9 A;  2X9H A;  5HYA A;  3MXZ A;  3F31 A;  1W9R A;  3ETU A;  3KFW X;  4X1Y E;  3SS1 A;  3O1J A;  3ZMT B;  4JI7 T;  4KUM B;  3UUL A;  4O2B E;  3AA0 B;  3ZMZ B;  2I0M A;  3P4R A;  5FY1 A;  5FL1 A;  2BKO A;  3IF8 B;  2UXN B;  5ABF A;  1HS7 A;  1SA0 E;  3P4W A;  2MTQ A;  3T8O A;  3LK2 B;  4JI6 T;  4EOZ B;  4LFA T;  4B3R T;  5CGM A;  3O1H A;  2LJL A;  3TKL B;  3CQC B;  4OYK A;  2OA5 A;  3NRY A;  5LGT B;  5JRC B;  4IDO A;  3Q9D A;  4JEH B;  5GON E;  1E2A A;  1UCU A;  4L5G A;  2G0U A;  4JBW F;  2L8K A;  4ZZC A;  5AQF B;  2WMN A;  5DAB A;  2DI4 A;  1HG5 A;  1LVK A;  2W4X A;  2XAJ B;  1ZP0 A;  2YIN A;  3DP7 A;  1S35 A;  3FB2 A;  4IDN A;  3RRC A;  4DR4 T;  2LRK A;  3LFM A;  3UT5 E;  3ZN1 B;  4DR7 T;  2D5U A;  4DBQ A;  4DUY T;  3EDU A;  4YJ3 E;  4F6R C;  3AEF A;  1D0Z A;  2CXF A;  4TN7 B;  4LML A;  2BG9 A;  2GK9 A;  2HPL A;  3I0O A;  5FXW A;  3GMI A;  3ONX A;  4Q25 A;  5CB4 E;  5L47 A;  4YTM A;  5LGU B;  2LRL A;  2VL0 A;  4HN9 A;  4AI6 A;  4KI0 F;  4BA9 A;  4ZS3 A;  2EHO D;  3L09 A;  3LBX B;  3ZCI A;  3AE8 A;  2UXX B;  5JDN A;  5KMG P;  4YLH A;  1XWM A;  2XAH B;  2CXD A;  1NEK A;  3RQU A;  3VR8 A;  5C2T A;  3ZST A;  5JQG E;  3FXD B;  1B7T A;  3FZM B;  3EAM A;  5HXE A;  1XDO A;  4AIS A;  4X64 T;  3IHR A;  1U4Q A;  4B3S T;  3VKG A;  3OBV E;  3PUQ A;  2E9X C;  3E08 A;  2DL1 A;  1UUR A;  3B57 A;  4HFV A;  2IC9 A;  3HL6 A;  4HGA A;  3BK9 A;  5L3E B;  1M7K A;  3Q5E A;  4UEM A;  3ZJ2 A;  2ODU A;  4UVC B;  2M67 A;  5LNK A;  4H9Q C;  3I0Q A;  2K9A A;  2QRX A;  3ZYM A;  3CVR A;  3OTO T;  2XTL A;  4KHP T;  1X9B A;  5HXS A;  2XQA A;  3ESL A;  5J2U E;  4BAY B;  3PU3 A;  5JR9 B;  3FBL A;  3HKC E;  5L3G B;  2D0U A;  3P4Q A;  4WYV A;  3O1I A;  2LM9 A;  4DR6 T;  3JAD A;  1NAF A;  4QH5 A;  5ETW A;  4LF4 T;  4U2Y A;  1VCS A;  2Q9Q A;  4OYJ A;  3WAK A;  3JAE A;  4JI1 T;  1UK5 A;  3OYX A;  1FEW A;  2CLY B;  3HI2 A;  5AQK B;  1ZV4 X;  4A56 A;  2KND A;  5HEU A;  5AFU L;  2X9Y A;  3KV9 A;  4QH4 A;  3AXJ A;  3NKZ A;  1L0V A;  3C64 A;  2WDR A;  5ADX L;  3K3N A;  3Q5W A;  3PV0 F;  2NW8 A;  1D1A A;  5EK3 A;  1UX5 A;  3KVA A;  2XAF B;  4EEB A;  1Z8U A;  4NIQ A;  5FXX A;  4DID B;  3AA7 B;  2YN6 A;  2ZM8 A;  2QA7 A;  3JAF A;  5LJM A;  5EK2 A;  1W09 A;  3EUH A;  3UUN A;  3IA3 A;  4LMK A;  4NUV A;  4TWF A;  4CI1 B;  3AE9 A;  1H7C A;  3L3P A;  5IWA T;  1XMQ T;  2WB5 A;  4IDQ A;  5LG3 A;  4H9P C;  2NWB A;  4AKL A;  4AXP A;  3AEB A;  4BJN A;  4PK6 A;  3UU5 A;  3RC8 A;  3SWH A;  4NXM T;  2XQY A;  3CX6 B;  4XZC A;  4YXD A;  4DO0 A;  4DV2 T;  2WQY A;  3MK7 C;  5AQI B;  2IC6 A;  4OK0 A;  5DQV A;  2JPF A;  2J1D G;  5HXR A;  2JMH A;  3EI0 A;  3Q2M A;  1HX8 A;  2PJQ A;  3NZP A;  4X20 E;  4EGW A;  2UXC T;  5ABH A;  1OXZ A;  3ZYK A;  1MIV A;  3I9W A;  1J1J A;  4WZX A;  4AQF A;  3PU8 A;  4O4H E;  4UF0 B;  5AQR B;  5J0Z A;  1J5W A;  1T72 A;  2KLQ A;  3C4X A;  1D0Y A;  3MJX A;  4TWD A;  1G8X A;  2E9X D;  2KZ7 B;  4IE5 A;  1YXR A;  3UQ4 A;  4FI5 A;  2LOS A;  4IT4 A;  3GN5 B;  2JJ9 A;  2W61 A;  3PDY A;  4HFB A;  3FZK B;  3PUW F;  3Q5D A;  4NPP A;  3ZC1 A;  5JVD E;  2YDS A;  3FZL B;  4LF9 T;  2PFV A;  2XSB A;  3E22 E;  4PFP A;  4GYR A;  3AEC A;  4ANJ A;  5M4Y A;  4O2A E;  4LF7 T;  3VU7 H;  4P0B A;  2XUE A;  3KIN B;  5LJN A;  3U78 A;  5LYJ E;  5AQS B;  5FNV E;  1MMA A;  1E1H B;  3CX7 B;  2BDE A;  2DWK A;  2VKO A;  5LP6 E;  2UXD T;  2RA1 A;  1U5P A;  3AE2 A;  1OED B;  3HKE E;  4LMJ A;  2VQF T;  1WR6 A;  3PUS A;  4MLK A;  1HFA A;  2ES0 A;  3ANW A;  4ERR A;  5C3J A;  1YKE B;  5JDL A;  3PUX F;  4L0R A;  2H7O A;  1S94 A;  5JDH A;  3NBX X;  2Q9Q B;  4HFI A;  2FJD A;  3NVO A;  2Q9Q C;  5LCY A;  3L39 A;  2HHH T;  2NW9 A;  4DND A;  1HX1 B;  3K3Q C;  2DWG A;  1FIO A;  2FUP A;  2CWO A;  4U31 A;  4QWN B;  3SFE A;  2BZB A;  2IML A;  2KXP B;  2ZLY A;  4OX9 T;  5IHY A;  3PJA J;  3N9O A;  2K5B B;  3CQG B;  5HEH A;  4HFD A;  3AE3 A;  2OV9 A;  2B1E A;  4EYY R;  5LMU T;  2F4V T;  5FKY A;  3C4W A;  2IUB A;  2VKD A;  2X0H A;  3UFG A;  4DR3 T;  1ZHC A;  3CKD A;  2VVN A;  2CRB A;  3PUV F;  5J1G A;  3ZYL A;  4NUU A;  4DMW A;  5EK4 A;  2K24 A;  1SHZ C;  1W0A A;  2VL8 A;  4KP3 C;  5AQT B;  4P0A A;  1XNQ T;  4YJ2 E;  5FY0 A;  2NW7 A;  4U3C A;  5DJQ C;  2LT3 A;  4ADZ A;  2BVL A;  3P50 A;  3B5M A;  5AQG B;  5L3D B;  2WSS V;  5HAX A;  3TLU A;  2BG9 E;  3MZK B;  5ABG A;  5J2T E;  2LHN A;  2IW5 B;  2CHN A;  1JNZ A;  4IDP A;  1DU2 A;  4HWF A;  3U3I A;  1WYC A;  2JMK A;  4GK0 E;  3H3M A;  3QC9 A;  4GK5 E;  3RKG A;  1BR0 A;  2IIU A;  5JDQ A;  3ZT6 A;  5IYZ E;  2WP9 A;  1LRZ A;  2E5V A;  2D2S A;  1SE7 A;  1EZ3 A;  2VB6 A;  4U7I A;  4UR9 A;  1WFD A;  3RC3 A;  5LB7 B;  3PE0 A;  5L2L A;  2CA5 A;  4ILU A;  1I6Z A;  3EAB A;  4CXX A;  2V6Y B;  1CUN A;  4JUY A;  4G2A A;  2VVS A;  4QX8 B;  3CML A;  1D1C A;  4QXH B;  4JLE A;  2N1G A;  1VRB A;  2LKH A;  3M65 A;  3E0Z A;  4QXB B;  4HWH A;  4YSX A;  4XBF B;  1FMV A;  2E9X B;  3F57 A;  4MHC A;  5AQL B;  2LSG A;  4Z91 A;  5JDG A;  2E9X A;  3NRX A;  5CA1 E;  1N36 T;  4TV9 E;  3LK3 B;  4JI4 T;  3MKD A;  1XMO T;  5ABF B;  3AAI A;  2WAU A;  4ZS2 A;  1FJG T;  2PTF A;  2X0Y A;  4K0U A;  4FJO A;  4C91 A;  2WDV A;  5FXV A;  1WLX A;  1MIW A;  2CLY C;  2XAG B;  3EVY A;  4TNV A;  4A5X A;  2BKN A;  3ZT7 A;  4AIU A;  3LDQ B;  4MBQ A;  3NZQ A;  4UVA B;  5FY7 A;  3VKH A;  3ZN0 B;  4DV0 T;  3EHZ A;  1HG2 A;  5L4H A;  3ZCJ A;  1ZKE A;  4JI8 T;  3N2K E;  3IEE A;  4P09 A;  3AED A;  4Z8X A;  2DHR A;  4I4T E;  5AQJ B;  4AKH A;  4TNW A;  1IZN B;  4E7S A;  3C4Z A;  2CE7 A;  3OVU A;  2XQ5 A;  4IL4 A;  4PW8 A;  2C5J A;  5JR9 A;  5LHG B;  5HEG A;  1D1B A;  2NP9 A;  2V7J A;  4DMV A;  2DNX A;  4HTE A;  2X0L B;  3PUR A;  3AA1 B;  2MPK A;  2NTY A;  4UF0 A;  2V5D A;  5LA6 E;  3UU3 A;  3AXJ B;  1N33 T;  2UUB T;  2L9Q A;  2VKJ A;  4IRE A;  5KDM C;  5AQQ B;  3UU6 A;  4ZHQ E;  2MYS A;  2H3R A;  2WDQ A;  4JV5 T;  1UX4 A;  1HNW T;  3OJA A;  1VCT A;  2J47 A;  2KMF A;  5BMV E;  3H37 A;  5EZY E;  4ZI3 C;  4X65 T;  2IHR 1;  3SRZ A;  3V5S A;  3PUA A;  3R6N A;  1IJ6 A;  5TAO A;  3VR9 A;  4A97 A;  3DJB A;  2BBH A;  4AQY T;  1WCR A;  4DV1 T;  4QHO A;  4WBN E;  1KEY A;  2W67 A;  3A5X A;  4M1P A;  2CBJ A;  1LVF A;  4UV8 B;  4EAH A;  3S4U A;  5LHH B;  3A7M A;  2BG9 C;  2ODV A;  3ABV A;  4X1K E;  5LOV E;  2J62 A;  2KWH A;  5HCJ A;  4GKK T;  3J7Y q;  1BR4 A;  5ABE A;  4TV8 E;  2L3L A;  2PBI A;  3RIF A;  1KNP A;  4AQF C;  3WAJ A;  4DV7 T;  1XZY A;  3WI3 A;  4H9N C;  1OWA A;  2D9D A;  3MA9 A;  2VKH A;  2ZMA A;  2X66 A;  4JEU B;  5FL0 A;  4DR2 T;  4IE7 A;  5HEJ A;  4PJL A;  1MMD A;  4O4J E;  5LBM A;  2FBW A;  2J4G A;  4O8S A;  1BR1 A;  2VK9 A;  1BR2 A;  3LBX A;  2X68 A;  3KV6 A;  3SFD A;  1OED C;  3VRA A;  2UUC T;  4I0U A;  4LF5 T;  4CN1 A;  1WRD A;  2XPK A;  2W66 A;  2Z6E A;  4KBM B;  3J9X 1;  3ZSS A;  2QVA A;  4JI0 T;  2LSI A;  2YEV C;  2E5L T;  2X51 A;  3K1S A;  4QXC B;  4JI2 T;  3UUX B;  4COF A;  4H9O C;  3TLW A;  4CN6 A;  2IAK A;  2Y8D A;  3CX8 B;  2AXD S;  4AKI A;  2AE9 A;  2I59 A;  2JQ9 A;  2VAS A;  2X9W A;  2XAQ B;  3P4S A;  3RRW A;  4PK4 A;  3AA6 B;  4IGU A;  4TZ4 C;  3P4P A;  3HKB E;  4AQG A;  3K8P C;  5JDM A;  3ETV A;  5LXT E;  5FYM A;  2UUA T;  2XM1 A;  4PNI A;  4DR1 T;  1QSD A;  4OHF A;  2WMO A;  2IDO B;  2OLT A;  3D0T A;  1Y64 B;  3F2E A;  3RIU C;  3RYI E;  2HN2 A;  4V1A v;  1O3X A;  4DUZ T;  5F5W A;  4EV6 A;  2ZM6 T;  1V9D A;  3ONJ A;  3I1A A;  3RIU A;  3ZMV B;  5CJ5 A;  3QK6 A;  2NTX A;  4PAG A;  4IIJ E;  3G06 A;  3N9M A;  3T1H T;  4U7Y A;  1HTJ F;  2WWU A;  4XAX B;  4ZOL E;  2ZM0 A;  2XSA A;  2YKS A;  3C51 A;  3FZH B;  3JC6 C;  5LBQ B;  2C5K T;  3RYC E;  4ZZB A;  4UIG A;  3TLT A;  1Z0P A;  3QOF A;  2FJB A;  1QLB A;  1T98 A;  2MAW A;  2N2N A;  2RP4 A;  1WYB A;  4ASK A;  1JNR A;  3AVS A;  4YSY A;  4YHJ A;  3RYH E;  2W0G A;  1KK7 A;  4QX7 B;  1I94 T;  3TLV A;  5H6Q B;  2E2A A;  3AAE B;  3AE4 A;  3UTK A;  4ZI3 D;  2Y48 B;  2BS4 A;  2LE8 A;  3AAA B;  4IHJ E;  4F8H A;  5JRE A;  1XDP A;  3LSV A;  4WNK A;  2WCA A;  3OPC A;  1HF8 A;  4DR5 T;  3RF1 A;  4ILA A;  4O4I E;  5LGN B;  4EED A;  3AEG A;  2ZM2 A;  3VRB A;  4HWI B;  2WU5 A;  4EYU A;  4EZ4 A;  4CN4 A;  4YSZ A;  2SPC A;  2V1D B;  4KX6 A;  4HFE A;  2WWV A;  5HXH A;  5JDF A;  3N9P A;  3ZPO A;  1YQ4 A;  3AE5 A;  4O4L E;  1KNR A;  4PJM A;  2ACX A;  5CA0 E;  3N5L A;  4H9S E;  2CBI A;  3PTR B;  4MFR A;  4LF6 T;  2JIW A;  2NR4 A;  2W62 A;  2YU1 A;  3UU4 A;  2LSK A;  4K0K T;  2WU2 A;  1IJ5 A;  2H88 A;  2JQK A;  1W0B A;  4C90 A;  3OKQ A; 
#chains in the Genus database with same CATH homology
 5AQV B;  3A8Y C;  3FZL B;  5AQJ B;  5AQH B;  3M3Z B;  1I6Z A;  5AQP B;  3FZF B;  5AQS B;  1UGO A;  5AQM B;  5AQI B;  5AQN B;  2D9D A;  4HWH A;  5AQT B;  1UK5 A;  5AQF B;  1T7S A;  5AQQ B;  4HWI B;  1M62 A;  5AQK B;  5AQL B;  5AQO B;  5AQG B;  3FZM B;  5AQU B;  5AQR B;  1HX1 B;  4HWF A;  1M7K A;  3LDQ B;  4HWC A;  3FZH B;  4HWD A;  3FZK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...