1UGOA

Solution structure of the first murine bag domain of bcl2-associated athanogene 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bcl2-associated athanogene 5
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1ugoA00
5AQHB 1I6ZA 3FZLB 5AQJB 4HWCA 3LDQB 5AQKB 3FZFB 1M7KA 4HWDA 5AQIB 5AQFB 5AQGB 1M62A 5AQTB 4HWFA 1HX1B 3FZKB 3FZMB 3A8YC 5AQLB 5AQQB 5AQMB 5AQSB 1UK5A 5AQOB 3FZHB 5AQVB 5AQNB 4HWHA 5AQPB 5AQUB 2D9DA 5AQRB 1T7SA 4HWIB 1UGOA 3M3ZB
chains in the Genus database with same CATH superfamily
4O8SA 4BJNA 4PJNA 3PUSA 4WYVA 2FJAA 3C98B 4U7IA 4YT0A 3FXEB 1LRZA 4L5GA 2H7VC 1MMAA 3AB3B 4KBMB 5FY1A 4LMLA 4YTMA 2LSIA 5ABFA 2DWKA 5FP3A 3TKLB 4YLHA 3AVRA 2L9QA 5IUXA 1I6ZA 5LJNA 3UQ7A 4C91A 4PFOA 2D5UA 2BS4A 4OYKA 3KVBA 5L4HA 2XAFB 3L39A 3OVUA 3P7IA 2CXDA 3OBVE 4X1KE 3IF8B 5AQGB 3PURA 3A8YC 2LSKA 2ZMAA 3LJCA 2IMLA 3KFWX 5LMNT 3K3NA 3RYFE 4DIDB 3KDSE 2BKPA 2CLYC 3N5LA 1XMQT 3P4QA 2I6HA 2ZM2A 5BMVE 4I55E 2V5CA 3Q5EA 5DQWA 4ILCA 2XQAA 2QA7A 5JDHA 3UUMA 4LFAT 3B5MA 2BBJA 3TLTA 2N1GA 4CXXA 2JMKA 4TNVA 4I43B 4H9OC 3CKDA 3PJAA 4Z8XA 3SFDA 2V6YA 1N34T 4E7ZA 4YTPA 2V6YB 3VR9A 2NTXA 5L3BB 2NWBA 4UF0A 2E9XD 1ZHCA 2X0LB 4NXNT 4UF0B 3ZSTA 2YK0A 3SOLA 4WBNE 3G06A 3MXZA 5L4EA 5HWXA 4UIGA 5HEGA 2N2NA 4GYRA 4CI3B 2D0TA 4UV8B 2QRXA 4PJMA 5C2TA 1D1AA 2KT9A 4NXMT 3FBLA 3PUYF 2YDQA 4EV6A 2XZEA 4H9QC 3Q5WA 2LKGA 2W62A 3HKBE 1FJGT 3P4PA 2E2AA 4JI7T 2IDOB 4IHJE 2XAHB 2Y6XA 1QSDA 3EAMA 3T1YT 3VKHA 2XQ7A 4UXNB 2OA5A 1NENA 4LF9T 3MZKB 1UX4A 4DR1T 1HTJF 4GKJT 4ILUA 5E0OA 4U74A 4AI6A 3PUQA 2UXXB 3OYZA 3PV0F 1HR0T 3Q5DA 3MA9A 4DV5T 5BR8T 2XAJB 2VL8A 4IE7A 5FVKA 2IAKA 2E5LT 4HWDA 1ZEEA 3SS1A 5KMGP 4HKAA 4DR4T 3ZT6A 3DTOA 2L3LA 3N9QA 4NIQA 3ZMSB 1YKEB 3MK7C 5FXZA 4DV0T 5FY0A 3NKZA 2BG9C 3RGLA 3JC6D 5FNVE 2C0SA 4IDNA 4DR5T 2R6GF 3AE9A 5IHYA 3OPCA 4WW0A 3QC9A 3EVYA 1QLBA 1Y01A 3JAEA 2GK9A 4DBQA 3C4WA 3WI3A 4EZ4A 3RKOA 2CM0A 2A2FX 4G2AA 4JLEA 2NOXA 3KV4A 3QOFA 1SE7A 4BJMA 1WRDA 1LKXA 2W67A 4DVDA 4KI0F 4OYJA 2WS3A 3E0ZA 4LF5T 5H6RB 4X1IE 4XZCA 4U2ZA 3N2OA 4YHJA 2IHR1 4PAGA 2Y8DA 2KXPB 3ZSSA 4YFSA 1OEDC 4B3RT 2BG9A 4ILAA 1YKHB 2BG9B 2KLQA 2OV9A 1IBMT 1KFYA 2BS2A 5KX5E 5J2TE 1HG2A 5LJMA 5FXWA 4ASKA 2K5BB 3U3IA 3QNUA 3RIAA 2VASA 3RX6A 1T7SA 3KVAA 3LFMA 4DBRA 4J2CA 4F8HA 3QB5K 4DV4T 3UFGA 2IUBA 1X9BA 2WWVA 4QKNA 2IC6A 2CBIA 2HH7A 5H6QB 2RA1A 2Q9QC 5JDNA 1D0ZA 2V1DB 1OEDA 4DUYT 1OEDB 4HWCA 3RH3A 4HFBA 4HFEA 3OKQA 4DV6T 3O9XA 5EK4A 2EHOC 3PUWF 4COFA 1G73A 2PBIA 2IIUA 1AJ3A 3ANWB 3A7MA 2X66A 2M67A 4QX7B 2ODVA 4YJ2E 4CN1A 2MYSA 2JRKA 2BDEA 3RPUA 1CHUA 1J5WA 2DLRA 3C4ZA 1MNEA 3ZMUB 4BAYB 4JBWF 1ZV4X 2DHRA 3CX7B 3L3PA 5HXCA 2Q9QA 3CQXC 3ZMZB 1UGOA 2CBJA 4B6XA 2Q9QB 3I1AA 2C5JA 3HKDE 3L09A 5AQKB 2YDRA 3UQ4A 2EHOA 3CWZB 4EXTA 1XDPA 2EHOB 2WMNA 4MALA 2ODUA 2VKHA 2WCAA 4LFBT 5JDLA 1KK7A 3I9YA 3K8PC 5LGUB 4XAXB 4UV9B 2X68A 4DMWA 4EYUA 5LHIB 3SFEA 2CWYA 4HFIA 1HFAA 3RRCA 3AE3A 2RPAA 3UU4A 5AQFB 2VWAA 5DJQC 1E2AA 3RIFA 2FJEA 4HN9A 2C5IT 4ZZBA 5ABEA 3ZYKA 4HFHA 3FBZA 2WWUA 5TAOA 4ZI7E 4TWFA 3RI5A 4JEHB 3JADA 4PJJA 5AQJB 5FMNA 2XQ4A 1MMGA 4HTEA 4ZHQE 5FYMA 4M1PA 3R84B 3AEDA 3P50A 1JNRA 3NWIA 3NRYA 5AQNB 4IL9A 1X79A 4X20E 1IZNB 3IEEA 2J62A 4AQFC 5DQVA 3AE7A 1MNDA 3RKGA 5EZYE 3I0QA 4QH4A 2SPCA 2WZIA 4Q25A 5CFBA 3RF1A 4TNWA 3ZC1A 4EIWA 3NZPA 3VU7H 3BK9A 1XDOA 3O1HA 1E1HB 2CE7A 1HG5A 2XUEA 3UTKA 1MIWA 5FKYA 4DMVA 4IREA 2BZBA 3QB5A 5LCYA 1LVFA 4PK5A 2D0UA 2D9DA 5L3EB 5JR9C 4AQFA 1XNQT 1YD8G 4OFZA 1WLXA 4DV7T 2H7OA 4U7YA 1VCTA 3S4UA 1UCUA 2LHNA 2V7IA 4MHCA 4H9PC 3RQUA 4JEUB 2XQ8A 3OTOT 2YINA 3HR0A 2X9XA 4GOUA 2KINB 5ABFB 1IJ5A 2KNDA 5JTGA 1KNRA 1GQEA 3UUXB 3RIUC 2V7LA 2CXFA 4DR2T 3ZCIA 4AKIA 3RC3A 3TLUA 2PFVA 2XQYA 3VR8A 2W66A 2XQ5A 2LJLA 3Q2MA 3A5XA 5JR9A 4UVAB 3HKEE 3NRXA 1IBKT 3RQWA 5JR9B 3KINB 4DNDA 4YSXA 3MACA 4LF8T 4DR7T 5AQQB 2V5DA 5F3JA 4C90A 5JDFA 3PTRB 1OXZA 3GWHA 4PJLA 2MTQA 1KF6A 3ZMVB 1WCRA 4LMJA 2DCFA 3FZFB 3AA6B 3RIUA 1S94A 2FUPA 4HWFA 2X9YA 2BKOA 2UXCT 3E22E 3O1JA 4NUVA 3LG7A 3T1HT 4AIUA 5HWYA 4HFDA 4B3MT 4AISA 2DL1A 3ZJ2A 4YTNA 1BR0A 4ADZA 2XPKA 1CUNA 4GK0E 5A1LA 2JQHA 4U31A 4GYSA 4DV3T 3F57A 1D0XA 2CLYB 4YJ3E 2V7JA 2VURA 2UXNB 2VKJA 2WM9A 1VRBA 5HYAA 5LGNB 3ETVA 3X1DA 1HNZT 2C5KT 4JI3T 2RP4A 4KX6A 3SWHA 5J1GA 4UEMA 2V8SV 3HL6A 2XTLA 3LK2B 2A72A 1S35A 5FXVA 4CXWA 1Z0PA 4GKKT 4DR6T 2A3DA 3AE6A 2WDVA 2ZM0A 2UU9T 3KV9A 5ABGA 2ZM6T 2N9DA 4HEAA 5FY7A 2YEVC 2WY2A 3P4RA 1EZ3A 3JAFA 4U3CA 3UFEA 2I59A 5J2UE 1XZYA 4QH1A 4LF6T 1NEKA 4DV2T 3EUHA 3I9WA 3J7Yq 3AXJA 4AKLA 3EDVA 3AXJB 3J9X1 4OK0A 3AE1A 4IE6A 3LK42 2W63A 4ZXLA 4PK4A 1M62A 3RYHE 4ZI3C 2A9UA 4ISTA 1MMNA 2D2SA 4YXDA 3RLFF 1SUMB 4ILBA 4EOZB 3CX8B 3AAAB 5CJ5A 3AE4A 3ZT7A 2XY8B 2DNXA 2IC9A 4UVCB 3AEGA 2LE8A 1N32T 4U33A 1B7TA 1E7PA 2WDRA 5HEOA 1XWMA 2WSSV 1WFDA 2CCQA 3M65A 3FZMB 2W61A 2BG9E 2J47A 4Z90A 3UT5E 5EK2A 2X9HA 4KUMB 4ZI2D 5JDGA 4P09A 3WAJA 2LHRA 4YHHT 3PUZF 2K24A 5JH7E 1YQ4A 2JQQA 3N9LA 4WNKA 3ZYMA 2NTYA 2ZM8A 2ACZA 5FVLA 1O3XA 1M7KA 4HGAA 1T98A 4IT4A 1OEDE 2AXDS 2CWOA 4UELA 2M6IA 4MFRA 5DABA 2PTFA 3BQIA 2Y48B 2E5VA 4YSZA 3EI0A 4V1Av 3Q9DA 4JI2T 3EDUA 1OWAA 3V5UA 1W9RA 3PUAA 2UXBT 2X51A 4GK5E 2DWGA 3KV6A 5AQMB 4K0KT 4B3ST 1NAFA 3IBPA 5LXTE 2LLYA 1N36T 1Y64B 3ONXA 2BVMA 3PU3A 2BBHA 3CVRA 3K3OA 3F31A 2E9XC 3UU5A 4IIJE 5FL1A 2NR4A 4AKHA 5CGMA 5C3JA 1W0AA 3M3ZB 4NPPA 4CI1B 4JI6T 3HA4A 3OYXA 1MMDA 5L3DB 4QWNB 1XNRT 5L2LA 3UUNA 1J1JA 1IBLT 1HNWT 2E8IA 4DR3T 4HWHA 4FJOA 4ANJA 5EK3A 4EAHA 4HE8A 3LSVA 4TZ4C 2CXLA 3QK6A 3D0TA 3TLSA 5M4YA 5KDMC 1ZOYA 3K3QC 4MBQA 2E9XA 5LOVE 3R6NA 2QYWA 2E9XB 2H88A 3GN5A 3H3AA 1L0VA 3GN5B 4KMCA 4KHZF 5ABHA 4IE5A 2PG8A 5F8PA 2XM2A 4FI5A 2BVLA 2H89A 2I0MA 4TUYE 4A56A 3UU6A 1ZP0A 4IDZA 5LBQB 4JI0T 4ZOLE 5AQUB 2KWIB 1T72A 4YY3T 4P1NA 3AEEA 5HCJA 2ACXA 3C50A 2LM9A 3CK6A 1WR0A 1V9DA 3EHZA 1WYBA 3CPZA 2WAUA 5AQVB 2CHOA 3FXDB 3OJAA 4TN7B 3JC6C 4LMKA 1IAPA 2OLTA 3AAIA 3VRBA 5LHHB 3RYCE 3RYIE 4IDQA 3N2GE 1WR6A 4P0AA 3K1SA 1WYCA 1FEWA 4JI4T 4LF4T 4BA9A 5ADXL 2HPLA 3F2EA 5AQOB 3MJXA 3HI2A 2CEAA 1D1BA 4X62T 3PUXF 4HFCA 3B57A 1YXRA 2VKOA 3AEFA 2QVAA 3ESLA 4JYAT 2KWHA 3ETUA 2JJ9A 1DU2A 2LKHA 4O2AE 2X9WA 3NZQA 2LOPA 2VKDA 4EEBA 2XQ3A 3SRZA 2J1DG 4A97A 2WZHA 5HCMA 3I0OA 2NW7A 1FMWA 1HX1B 3ZT5A 3UU8A 5AQSB 2LOSA 4G63A 2W00A 4LFCT 5AQRB 2XAQB 5AQHB 3ZN1B 4E7SA 2VB6A 3P8CD 3ZC0A 1HX8A 2LSJA 2H3RA 3C4XA 3KBTA 4HWIB 4CN4A 2IW5B 2BS3A 5JRCA 5JRCB 4I4TE 3W15B 1UURA 3NVOA 2NW9A 3N9NA 3PJAJ 3PUVF 3LK3B 2KMFA 4OX9T 4ZS2A 2WU2A 2FJBA 4O2BE 1VCSA 5IWAT 5ETWA 4CN6A 2YKSA 3AECA 3AEAA 4DO0A 4A5XA 2Q9QD 3MKDA 1BR1A 4IE0A 3H3MA 4LF7T 2UXDT 1NWMX 3Q5XA 5LG3A 1Z8UA 4X66T 2EHOD 2V6XA 3VHLA 2KSRA 3FZLB 1MIVA 2W2UA 4O4HE 2MAWA 4UVBB 1G8XA 1VOMA 5LP6E 1HCIA 4PFPA 1IJ6A 1BR2A 2W0GA 3TLWA 2XM1A 2UUAT 4TV9E 4CQIA 4O4JE 1ZKEA 5HXEA 2YDSA 3GA8A 5CA1E 5JQGE 4H9NC 3IA3A 4IDOA 2CPTA 1T8BA 2LSYA 5FL0A 4ISSA 4AXPA 3PE0A 2PJQA 1I94T 4IE4A 3VRAA 4H9SE 1SA0E 4OHFA 3ZPOA 1UUSA 3UUBA 1R8IA 2DI4A 4TWHA 5LG4A 4A98A 2WBLA 2HN1A 5HEJA 3CMLA 2XQ6A 3U78A 3ZKRA 3IHRA 3WAKA 3AA0B 2LSGA 4N78D 5HXHA 2XSAA 3AA7B 2XJ7A 3P4SA 2V7KA 2VL0A 1JNZA 4YSYA 4IL4A 4EZHA 5L3FB 2CRBA 2ES0A 4ZS3A 4NUUA 4PW8A 4F6RC 2JIWA 3FHNA 4TWDA 2ZLYA 3O1IA 5KXJA 3FB2A 1HNXT 4X5TA 2UUBT 3AVSA 3KV5A 2LRLA 2LM2A 4QHOA 3CX6B 4I50E 1MIYA 1FIOA 2XASB 4AKRB 2WQYA 2X67A 5L3GB 4ZZCA 5HXRA 1J5ET 3P4WA 4TV8E 4X64T 5L47A 3FZKB 3ONLC 2HPJA 5JDMA 2VK9A 4HFVA 4H9RC 3N2KE 4X65T 2JMHA 2W4XA 4O4IE 1KNPA 1US7B 3AE2A 2NP9A 2YU1A 5HAXA 5HEUA 3O4XE 1U5PA 4EYYR 5AQLB 2F4VT 1UK5A 2HN2A 2K48A 4JI1T 1QUUA 2YN6A 3C51A 3ZCJA 5LNKA 4U72A 3ABVA 3UULA 2LT3A 1FMVA 2J4GA 2NW8A 3JCFA 5FXXA 1W09A 4KP3C 5J0ZA 2V7MA 1SHZC 4MLKA 2V26A 1XMOT 4JV5T 4U2YA 4TX5A 5LHGB 5JDQA 2JQ9A 3GMIA 3T8OA 4DUZT 3AA1B 2UUCT 3CIRA 2XQ9A 3DJBA 2WB5A 1LVKA 3H37A 3LDQB 3N9PA 4I0UA 4CZZB 1D1CA 4Z91A 2FJDA 3QUJA 3DP7A 3ANWA 3BQLA 2X0HA 1U4QA 4AQYT 4IDPA 5LA6E 3LBXA 3RRWA 3AE8A 2G0UA 2LEHA 3LBXB 2BKNA 4PK6A 2MBGA 5L3CB 2QGSA 2B76A 4L9IA 5JVDE 2VQET 3NBXX 2CMRA 4WZXA 2L8KA 2YOEA 2P9BA 3ZN0B 4QX8B 5HXSA 3EABA 5GONE 4EEDA 5HEHA 1N33T 2VVNA 2XHEB 2MPKA 2K9AA 3ONJA 4IGUA 2FBWA 5LB7B 1YW0A 3PU8A 4UR9A 4EGWA 4JUYA 3FZHB 4AQGA 3ZYLA 2WDQA 4CXYA 3N9MA 2HHHT 2CA5A 3VKGA 5AFUL 5C8YE 4XBFB 3N9OA 4JI5T 3B13A 3CQGB 3V5SA 2VVSA 3E08A 4ERRA 2XAGB 5LBMA 4H63H 5IYZE 3ZLIA 1KNZA 4P0BA 3L8RA 4KHPT 4EB6E 4PNIA 4DV1T 5AQIB 5CA0E 2XSBA 2WU5A 3PUGA 2WMOA 3TLVA 1UX5A 2KZ7B 1D0YA 3HKCE 2YU2A 3C64A 3UU3A 3RC8A 3AAEB 4O4LE 4QXBB 3CQCB 3BQKA 5LYJE 4QH5A 5F5WA 2Z6EA 4QXCB 4B3TT 1BR4A 2CHNA 3RHWA 5JREA 4GIWA 5AQTB 4ZI2C 1H7CA 2JQKA 3PDYA 3ZJ1A 2LRKA 3AE5A 2M6BA 2VQFT 2X0YA 3KBUA 1KEYA 2JPFA 4ZI3D 4JI8T 2K3WA 5LGTB 3ZMTB 5CB4E 4X1YE 2B1EA 4CI2B 4L0RA 4WBOA 2AE9A 4AKGA 1HS7A 1HF8A 2WP9A 2MOZA 5LMUT 1W0BA 1YQ3A 3ZEFB 4QXHB 5AQPB 4K0UA 4H63V 3AEBA 4ZEYA
chains in the Genus database with same CATH topology
5AQHB 1I6ZA 3FZLB 5AQJB 4HWCA 3LDQB 5AQKB 3FZFB 1M7KA 4HWDA 5AQIB 5AQFB 5AQGB 1M62A 5AQTB 4HWFA 1HX1B 3FZKB 3FZMB 3A8YC 5AQLB 5AQQB 5AQMB 5AQSB 1UK5A 5AQOB 3FZHB 5AQVB 5AQNB 4HWHA 5AQPB 5AQUB 2D9DA 5AQRB 1T7SA 4HWIB 1UGOA 3M3ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQH B;  1I6Z A;  3FZL B;  5AQJ B;  4HWC A;  3LDQ B;  5AQK B;  3FZF B;  1M7K A;  4HWD A;  5AQI B;  5AQF B;  5AQG B;  1M62 A;  5AQT B;  4HWF A;  1HX1 B;  3FZK B;  3FZM B;  3A8Y C;  5AQL B;  5AQQ B;  5AQM B;  5AQS B;  1UK5 A;  5AQO B;  3FZH B;  5AQV B;  5AQN B;  4HWH A;  5AQP B;  5AQU B;  2D9D A;  5AQR B;  1T7S A;  4HWI B;  1UGO A;  3M3Z B; 
#chains in the Genus database with same CATH topology
 4O8S A;  4BJN A;  4PJN A;  3PUS A;  4WYV A;  2FJA A;  3C98 B;  4U7I A;  4YT0 A;  3FXE B;  1LRZ A;  4L5G A;  2H7V C;  1MMA A;  3AB3 B;  4KBM B;  5FY1 A;  4LML A;  4YTM A;  2LSI A;  5ABF A;  2DWK A;  5FP3 A;  3TKL B;  4YLH A;  3AVR A;  2L9Q A;  5IUX A;  1I6Z A;  5LJN A;  3UQ7 A;  4C91 A;  4PFO A;  2D5U A;  2BS4 A;  4OYK A;  3KVB A;  5L4H A;  2XAF B;  3L39 A;  3OVU A;  3P7I A;  2CXD A;  3OBV E;  4X1K E;  3IF8 B;  5AQG B;  3PUR A;  3A8Y C;  2LSK A;  2ZMA A;  3LJC A;  2IML A;  3KFW X;  5LMN T;  3K3N A;  3RYF E;  4DID B;  3KDS E;  2BKP A;  2CLY C;  3N5L A;  1XMQ T;  3P4Q A;  2I6H A;  2ZM2 A;  5BMV E;  4I55 E;  2V5C A;  3Q5E A;  5DQW A;  4ILC A;  2XQA A;  2QA7 A;  5JDH A;  3UUM A;  4LFA T;  3B5M A;  2BBJ A;  3TLT A;  2N1G A;  4CXX A;  2JMK A;  4TNV A;  4I43 B;  4H9O C;  3CKD A;  3PJA A;  4Z8X A;  3SFD A;  2V6Y A;  1N34 T;  4E7Z A;  4YTP A;  2V6Y B;  3VR9 A;  2NTX A;  5L3B B;  2NWB A;  4UF0 A;  2E9X D;  1ZHC A;  2X0L B;  4NXN T;  4UF0 B;  3ZST A;  2YK0 A;  3SOL A;  4WBN E;  3G06 A;  3MXZ A;  5L4E A;  5HWX A;  4UIG A;  5HEG A;  2N2N A;  4GYR A;  4CI3 B;  2D0T A;  4UV8 B;  2QRX A;  4PJM A;  5C2T A;  1D1A A;  2KT9 A;  4NXM T;  3FBL A;  3PUY F;  2YDQ A;  4EV6 A;  2XZE A;  4H9Q C;  3Q5W A;  2LKG A;  2W62 A;  3HKB E;  1FJG T;  3P4P A;  2E2A A;  4JI7 T;  2IDO B;  4IHJ E;  2XAH B;  2Y6X A;  1QSD A;  3EAM A;  3T1Y T;  3VKH A;  2XQ7 A;  4UXN B;  2OA5 A;  1NEN A;  4LF9 T;  3MZK B;  1UX4 A;  4DR1 T;  1HTJ F;  4GKJ T;  4ILU A;  5E0O A;  4U74 A;  4AI6 A;  3PUQ A;  2UXX B;  3OYZ A;  3PV0 F;  1HR0 T;  3Q5D A;  3MA9 A;  4DV5 T;  5BR8 T;  2XAJ B;  2VL8 A;  4IE7 A;  5FVK A;  2IAK A;  2E5L T;  4HWD A;  1ZEE A;  3SS1 A;  5KMG P;  4HKA A;  4DR4 T;  3ZT6 A;  3DTO A;  2L3L A;  3N9Q A;  4NIQ A;  3ZMS B;  1YKE B;  3MK7 C;  5FXZ A;  4DV0 T;  5FY0 A;  3NKZ A;  2BG9 C;  3RGL A;  3JC6 D;  5FNV E;  2C0S A;  4IDN A;  4DR5 T;  2R6G F;  3AE9 A;  5IHY A;  3OPC A;  4WW0 A;  3QC9 A;  3EVY A;  1QLB A;  1Y01 A;  3JAE A;  2GK9 A;  4DBQ A;  3C4W A;  3WI3 A;  4EZ4 A;  3RKO A;  2CM0 A;  2A2F X;  4G2A A;  4JLE A;  2NOX A;  3KV4 A;  3QOF A;  1SE7 A;  4BJM A;  1WRD A;  1LKX A;  2W67 A;  4DVD A;  4KI0 F;  4OYJ A;  2WS3 A;  3E0Z A;  4LF5 T;  5H6R B;  4X1I E;  4XZC A;  4U2Z A;  3N2O A;  4YHJ A;  2IHR 1;  4PAG A;  2Y8D A;  2KXP B;  3ZSS A;  4YFS A;  1OED C;  4B3R T;  2BG9 A;  4ILA A;  1YKH B;  2BG9 B;  2KLQ A;  2OV9 A;  1IBM T;  1KFY A;  2BS2 A;  5KX5 E;  5J2T E;  1HG2 A;  5LJM A;  5FXW A;  4ASK A;  2K5B B;  3U3I A;  3QNU A;  3RIA A;  2VAS A;  3RX6 A;  1T7S A;  3KVA A;  3LFM A;  4DBR A;  4J2C A;  4F8H A;  3QB5 K;  4DV4 T;  3UFG A;  2IUB A;  1X9B A;  2WWV A;  4QKN A;  2IC6 A;  2CBI A;  2HH7 A;  5H6Q B;  2RA1 A;  2Q9Q C;  5JDN A;  1D0Z A;  2V1D B;  1OED A;  4DUY T;  1OED B;  4HWC A;  3RH3 A;  4HFB A;  4HFE A;  3OKQ A;  4DV6 T;  3O9X A;  5EK4 A;  2EHO C;  3PUW F;  4COF A;  1G73 A;  2PBI A;  2IIU A;  1AJ3 A;  3ANW B;  3A7M A;  2X66 A;  2M67 A;  4QX7 B;  2ODV A;  4YJ2 E;  4CN1 A;  2MYS A;  2JRK A;  2BDE A;  3RPU A;  1CHU A;  1J5W A;  2DLR A;  3C4Z A;  1MNE A;  3ZMU B;  4BAY B;  4JBW F;  1ZV4 X;  2DHR A;  3CX7 B;  3L3P A;  5HXC A;  2Q9Q A;  3CQX C;  3ZMZ B;  1UGO A;  2CBJ A;  4B6X A;  2Q9Q B;  3I1A A;  2C5J A;  3HKD E;  3L09 A;  5AQK B;  2YDR A;  3UQ4 A;  2EHO A;  3CWZ B;  4EXT A;  1XDP A;  2EHO B;  2WMN A;  4MAL A;  2ODU A;  2VKH A;  2WCA A;  4LFB T;  5JDL A;  1KK7 A;  3I9Y A;  3K8P C;  5LGU B;  4XAX B;  4UV9 B;  2X68 A;  4DMW A;  4EYU A;  5LHI B;  3SFE A;  2CWY A;  4HFI A;  1HFA A;  3RRC A;  3AE3 A;  2RPA A;  3UU4 A;  5AQF B;  2VWA A;  5DJQ C;  1E2A A;  3RIF A;  2FJE A;  4HN9 A;  2C5I T;  4ZZB A;  5ABE A;  3ZYK A;  4HFH A;  3FBZ A;  2WWU A;  5TAO A;  4ZI7 E;  4TWF A;  3RI5 A;  4JEH B;  3JAD A;  4PJJ A;  5AQJ B;  5FMN A;  2XQ4 A;  1MMG A;  4HTE A;  4ZHQ E;  5FYM A;  4M1P A;  3R84 B;  3AED A;  3P50 A;  1JNR A;  3NWI A;  3NRY A;  5AQN B;  4IL9 A;  1X79 A;  4X20 E;  1IZN B;  3IEE A;  2J62 A;  4AQF C;  5DQV A;  3AE7 A;  1MND A;  3RKG A;  5EZY E;  3I0Q A;  4QH4 A;  2SPC A;  2WZI A;  4Q25 A;  5CFB A;  3RF1 A;  4TNW A;  3ZC1 A;  4EIW A;  3NZP A;  3VU7 H;  3BK9 A;  1XDO A;  3O1H A;  1E1H B;  2CE7 A;  1HG5 A;  2XUE A;  3UTK A;  1MIW A;  5FKY A;  4DMV A;  4IRE A;  2BZB A;  3QB5 A;  5LCY A;  1LVF A;  4PK5 A;  2D0U A;  2D9D A;  5L3E B;  5JR9 C;  4AQF A;  1XNQ T;  1YD8 G;  4OFZ A;  1WLX A;  4DV7 T;  2H7O A;  4U7Y A;  1VCT A;  3S4U A;  1UCU A;  2LHN A;  2V7I A;  4MHC A;  4H9P C;  3RQU A;  4JEU B;  2XQ8 A;  3OTO T;  2YIN A;  3HR0 A;  2X9X A;  4GOU A;  2KIN B;  5ABF B;  1IJ5 A;  2KND A;  5JTG A;  1KNR A;  1GQE A;  3UUX B;  3RIU C;  2V7L A;  2CXF A;  4DR2 T;  3ZCI A;  4AKI A;  3RC3 A;  3TLU A;  2PFV A;  2XQY A;  3VR8 A;  2W66 A;  2XQ5 A;  2LJL A;  3Q2M A;  3A5X A;  5JR9 A;  4UVA B;  3HKE E;  3NRX A;  1IBK T;  3RQW A;  5JR9 B;  3KIN B;  4DND A;  4YSX A;  3MAC A;  4LF8 T;  4DR7 T;  5AQQ B;  2V5D A;  5F3J A;  4C90 A;  5JDF A;  3PTR B;  1OXZ A;  3GWH A;  4PJL A;  2MTQ A;  1KF6 A;  3ZMV B;  1WCR A;  4LMJ A;  2DCF A;  3FZF B;  3AA6 B;  3RIU A;  1S94 A;  2FUP A;  4HWF A;  2X9Y A;  2BKO A;  2UXC T;  3E22 E;  3O1J A;  4NUV A;  3LG7 A;  3T1H T;  4AIU A;  5HWY A;  4HFD A;  4B3M T;  4AIS A;  2DL1 A;  3ZJ2 A;  4YTN A;  1BR0 A;  4ADZ A;  2XPK A;  1CUN A;  4GK0 E;  5A1L A;  2JQH A;  4U31 A;  4GYS A;  4DV3 T;  3F57 A;  1D0X A;  2CLY B;  4YJ3 E;  2V7J A;  2VUR A;  2UXN B;  2VKJ A;  2WM9 A;  1VRB A;  5HYA A;  5LGN B;  3ETV A;  3X1D A;  1HNZ T;  2C5K T;  4JI3 T;  2RP4 A;  4KX6 A;  3SWH A;  5J1G A;  4UEM A;  2V8S V;  3HL6 A;  2XTL A;  3LK2 B;  2A72 A;  1S35 A;  5FXV A;  4CXW A;  1Z0P A;  4GKK T;  4DR6 T;  2A3D A;  3AE6 A;  2WDV A;  2ZM0 A;  2UU9 T;  3KV9 A;  5ABG A;  2ZM6 T;  2N9D A;  4HEA A;  5FY7 A;  2YEV C;  2WY2 A;  3P4R A;  1EZ3 A;  3JAF A;  4U3C A;  3UFE A;  2I59 A;  5J2U E;  1XZY A;  4QH1 A;  4LF6 T;  1NEK A;  4DV2 T;  3EUH A;  3I9W A;  3J7Y q;  3AXJ A;  4AKL A;  3EDV A;  3AXJ B;  3J9X 1;  4OK0 A;  3AE1 A;  4IE6 A;  3LK4 2;  2W63 A;  4ZXL A;  4PK4 A;  1M62 A;  3RYH E;  4ZI3 C;  2A9U A;  4IST A;  1MMN A;  2D2S A;  4YXD A;  3RLF F;  1SUM B;  4ILB A;  4EOZ B;  3CX8 B;  3AAA B;  5CJ5 A;  3AE4 A;  3ZT7 A;  2XY8 B;  2DNX A;  2IC9 A;  4UVC B;  3AEG A;  2LE8 A;  1N32 T;  4U33 A;  1B7T A;  1E7P A;  2WDR A;  5HEO A;  1XWM A;  2WSS V;  1WFD A;  2CCQ A;  3M65 A;  3FZM B;  2W61 A;  2BG9 E;  2J47 A;  4Z90 A;  3UT5 E;  5EK2 A;  2X9H A;  4KUM B;  4ZI2 D;  5JDG A;  4P09 A;  3WAJ A;  2LHR A;  4YHH T;  3PUZ F;  2K24 A;  5JH7 E;  1YQ4 A;  2JQQ A;  3N9L A;  4WNK A;  3ZYM A;  2NTY A;  2ZM8 A;  2ACZ A;  5FVL A;  1O3X A;  1M7K A;  4HGA A;  1T98 A;  4IT4 A;  1OED E;  2AXD S;  2CWO A;  4UEL A;  2M6I A;  4MFR A;  5DAB A;  2PTF A;  3BQI A;  2Y48 B;  2E5V A;  4YSZ A;  3EI0 A;  4V1A v;  3Q9D A;  4JI2 T;  3EDU A;  1OWA A;  3V5U A;  1W9R A;  3PUA A;  2UXB T;  2X51 A;  4GK5 E;  2DWG A;  3KV6 A;  5AQM B;  4K0K T;  4B3S T;  1NAF A;  3IBP A;  5LXT E;  2LLY A;  1N36 T;  1Y64 B;  3ONX A;  2BVM A;  3PU3 A;  2BBH A;  3CVR A;  3K3O A;  3F31 A;  2E9X C;  3UU5 A;  4IIJ E;  5FL1 A;  2NR4 A;  4AKH A;  5CGM A;  5C3J A;  1W0A A;  3M3Z B;  4NPP A;  4CI1 B;  4JI6 T;  3HA4 A;  3OYX A;  1MMD A;  5L3D B;  4QWN B;  1XNR T;  5L2L A;  3UUN A;  1J1J A;  1IBL T;  1HNW T;  2E8I A;  4DR3 T;  4HWH A;  4FJO A;  4ANJ A;  5EK3 A;  4EAH A;  4HE8 A;  3LSV A;  4TZ4 C;  2CXL A;  3QK6 A;  3D0T A;  3TLS A;  5M4Y A;  5KDM C;  1ZOY A;  3K3Q C;  4MBQ A;  2E9X A;  5LOV E;  3R6N A;  2QYW A;  2E9X B;  2H88 A;  3GN5 A;  3H3A A;  1L0V A;  3GN5 B;  4KMC A;  4KHZ F;  5ABH A;  4IE5 A;  2PG8 A;  5F8P A;  2XM2 A;  4FI5 A;  2BVL A;  2H89 A;  2I0M A;  4TUY E;  4A56 A;  3UU6 A;  1ZP0 A;  4IDZ A;  5LBQ B;  4JI0 T;  4ZOL E;  5AQU B;  2KWI B;  1T72 A;  4YY3 T;  4P1N A;  3AEE A;  5HCJ A;  2ACX A;  3C50 A;  2LM9 A;  3CK6 A;  1WR0 A;  1V9D A;  3EHZ A;  1WYB A;  3CPZ A;  2WAU A;  5AQV B;  2CHO A;  3FXD B;  3OJA A;  4TN7 B;  3JC6 C;  4LMK A;  1IAP A;  2OLT A;  3AAI A;  3VRB A;  5LHH B;  3RYC E;  3RYI E;  4IDQ A;  3N2G E;  1WR6 A;  4P0A A;  3K1S A;  1WYC A;  1FEW A;  4JI4 T;  4LF4 T;  4BA9 A;  5ADX L;  2HPL A;  3F2E A;  5AQO B;  3MJX A;  3HI2 A;  2CEA A;  1D1B A;  4X62 T;  3PUX F;  4HFC A;  3B57 A;  1YXR A;  2VKO A;  3AEF A;  2QVA A;  3ESL A;  4JYA T;  2KWH A;  3ETU A;  2JJ9 A;  1DU2 A;  2LKH A;  4O2A E;  2X9W A;  3NZQ A;  2LOP A;  2VKD A;  4EEB A;  2XQ3 A;  3SRZ A;  2J1D G;  4A97 A;  2WZH A;  5HCM A;  3I0O A;  2NW7 A;  1FMW A;  1HX1 B;  3ZT5 A;  3UU8 A;  5AQS B;  2LOS A;  4G63 A;  2W00 A;  4LFC T;  5AQR B;  2XAQ B;  5AQH B;  3ZN1 B;  4E7S A;  2VB6 A;  3P8C D;  3ZC0 A;  1HX8 A;  2LSJ A;  2H3R A;  3C4X A;  3KBT A;  4HWI B;  4CN4 A;  2IW5 B;  2BS3 A;  5JRC A;  5JRC B;  4I4T E;  3W15 B;  1UUR A;  3NVO A;  2NW9 A;  3N9N A;  3PJA J;  3PUV F;  3LK3 B;  2KMF A;  4OX9 T;  4ZS2 A;  2WU2 A;  2FJB A;  4O2B E;  1VCS A;  5IWA T;  5ETW A;  4CN6 A;  2YKS A;  3AEC A;  3AEA A;  4DO0 A;  4A5X A;  2Q9Q D;  3MKD A;  1BR1 A;  4IE0 A;  3H3M A;  4LF7 T;  2UXD T;  1NWM X;  3Q5X A;  5LG3 A;  1Z8U A;  4X66 T;  2EHO D;  2V6X A;  3VHL A;  2KSR A;  3FZL B;  1MIV A;  2W2U A;  4O4H E;  2MAW A;  4UVB B;  1G8X A;  1VOM A;  5LP6 E;  1HCI A;  4PFP A;  1IJ6 A;  1BR2 A;  2W0G A;  3TLW A;  2XM1 A;  2UUA T;  4TV9 E;  4CQI A;  4O4J E;  1ZKE A;  5HXE A;  2YDS A;  3GA8 A;  5CA1 E;  5JQG E;  4H9N C;  3IA3 A;  4IDO A;  2CPT A;  1T8B A;  2LSY A;  5FL0 A;  4ISS A;  4AXP A;  3PE0 A;  2PJQ A;  1I94 T;  4IE4 A;  3VRA A;  4H9S E;  1SA0 E;  4OHF A;  3ZPO A;  1UUS A;  3UUB A;  1R8I A;  2DI4 A;  4TWH A;  5LG4 A;  4A98 A;  2WBL A;  2HN1 A;  5HEJ A;  3CML A;  2XQ6 A;  3U78 A;  3ZKR A;  3IHR A;  3WAK A;  3AA0 B;  2LSG A;  4N78 D;  5HXH A;  2XSA A;  3AA7 B;  2XJ7 A;  3P4S A;  2V7K A;  2VL0 A;  1JNZ A;  4YSY A;  4IL4 A;  4EZH A;  5L3F B;  2CRB A;  2ES0 A;  4ZS3 A;  4NUU A;  4PW8 A;  4F6R C;  2JIW A;  3FHN A;  4TWD A;  2ZLY A;  3O1I A;  5KXJ A;  3FB2 A;  1HNX T;  4X5T A;  2UUB T;  3AVS A;  3KV5 A;  2LRL A;  2LM2 A;  4QHO A;  3CX6 B;  4I50 E;  1MIY A;  1FIO A;  2XAS B;  4AKR B;  2WQY A;  2X67 A;  5L3G B;  4ZZC A;  5HXR A;  1J5E T;  3P4W A;  4TV8 E;  4X64 T;  5L47 A;  3FZK B;  3ONL C;  2HPJ A;  5JDM A;  2VK9 A;  4HFV A;  4H9R C;  3N2K E;  4X65 T;  2JMH A;  2W4X A;  4O4I E;  1KNP A;  1US7 B;  3AE2 A;  2NP9 A;  2YU1 A;  5HAX A;  5HEU A;  3O4X E;  1U5P A;  4EYY R;  5AQL B;  2F4V T;  1UK5 A;  2HN2 A;  2K48 A;  4JI1 T;  1QUU A;  2YN6 A;  3C51 A;  3ZCJ A;  5LNK A;  4U72 A;  3ABV A;  3UUL A;  2LT3 A;  1FMV A;  2J4G A;  2NW8 A;  3JCF A;  5FXX A;  1W09 A;  4KP3 C;  5J0Z A;  2V7M A;  1SHZ C;  4MLK A;  2V26 A;  1XMO T;  4JV5 T;  4U2Y A;  4TX5 A;  5LHG B;  5JDQ A;  2JQ9 A;  3GMI A;  3T8O A;  4DUZ T;  3AA1 B;  2UUC T;  3CIR A;  2XQ9 A;  3DJB A;  2WB5 A;  1LVK A;  3H37 A;  3LDQ B;  3N9P A;  4I0U A;  4CZZ B;  1D1C A;  4Z91 A;  2FJD A;  3QUJ A;  3DP7 A;  3ANW A;  3BQL A;  2X0H A;  1U4Q A;  4AQY T;  4IDP A;  5LA6 E;  3LBX A;  3RRW A;  3AE8 A;  2G0U A;  2LEH A;  3LBX B;  2BKN A;  4PK6 A;  2MBG A;  5L3C B;  2QGS A;  2B76 A;  4L9I A;  5JVD E;  2VQE T;  3NBX X;  2CMR A;  4WZX A;  2L8K A;  2YOE A;  2P9B A;  3ZN0 B;  4QX8 B;  5HXS A;  3EAB A;  5GON E;  4EED A;  5HEH A;  1N33 T;  2VVN A;  2XHE B;  2MPK A;  2K9A A;  3ONJ A;  4IGU A;  2FBW A;  5LB7 B;  1YW0 A;  3PU8 A;  4UR9 A;  4EGW A;  4JUY A;  3FZH B;  4AQG A;  3ZYL A;  2WDQ A;  4CXY A;  3N9M A;  2HHH T;  2CA5 A;  3VKG A;  5AFU L;  5C8Y E;  4XBF B;  3N9O A;  4JI5 T;  3B13 A;  3CQG B;  3V5S A;  2VVS A;  3E08 A;  4ERR A;  2XAG B;  5LBM A;  4H63 H;  5IYZ E;  3ZLI A;  1KNZ A;  4P0B A;  3L8R A;  4KHP T;  4EB6 E;  4PNI A;  4DV1 T;  5AQI B;  5CA0 E;  2XSB A;  2WU5 A;  3PUG A;  2WMO A;  3TLV A;  1UX5 A;  2KZ7 B;  1D0Y A;  3HKC E;  2YU2 A;  3C64 A;  3UU3 A;  3RC8 A;  3AAE B;  4O4L E;  4QXB B;  3CQC B;  3BQK A;  5LYJ E;  4QH5 A;  5F5W A;  2Z6E A;  4QXC B;  4B3T T;  1BR4 A;  2CHN A;  3RHW A;  5JRE A;  4GIW A;  5AQT B;  4ZI2 C;  1H7C A;  2JQK A;  3PDY A;  3ZJ1 A;  2LRK A;  3AE5 A;  2M6B A;  2VQF T;  2X0Y A;  3KBU A;  1KEY A;  2JPF A;  4ZI3 D;  4JI8 T;  2K3W A;  5LGT B;  3ZMT B;  5CB4 E;  4X1Y E;  2B1E A;  4CI2 B;  4L0R A;  4WBO A;  2AE9 A;  4AKG A;  1HS7 A;  1HF8 A;  2WP9 A;  2MOZ A;  5LMU T;  1W0B A;  1YQ3 A;  3ZEF B;  4QXH B;  5AQP B;  4K0U A;  4H63 V;  3AEB A;  4ZEY A; 
#chains in the Genus database with same CATH homology
 5AQH B;  1I6Z A;  3FZL B;  5AQJ B;  4HWC A;  3LDQ B;  5AQK B;  3FZF B;  1M7K A;  4HWD A;  5AQI B;  5AQF B;  5AQG B;  1M62 A;  5AQT B;  4HWF A;  1HX1 B;  3FZK B;  3FZM B;  3A8Y C;  5AQL B;  5AQQ B;  5AQM B;  5AQS B;  1UK5 A;  5AQO B;  3FZH B;  5AQV B;  5AQN B;  4HWH A;  5AQP B;  5AQU B;  2D9D A;  5AQR B;  1T7S A;  4HWI B;  1UGO A;  3M3Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...