1UGOA

Solution structure of the first murine bag domain of bcl2-associated athanogene 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bcl2-associated athanogene 5
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1ugoA00
1I6ZA 3FZKB 3LDQB 5AQIB 5AQPB 5AQTB 1T7SA 5AQOB 4HWFA 4HWDA 5AQJB 2D9DA 3M3ZB 3FZFB 1M7KA 5AQFB 4HWHA 3FZHB 5AQUB 1M62A 5AQQB 5AQHB 3FZLB 1UGOA 5AQGB 5AQNB 4HWCA 1UK5A 5AQSB 5AQRB 3FZMB 4HWIB 1HX1B 5AQKB 5AQVB 5AQLB 3A8YC 5AQMB
chains in the Genus database with same CATH superfamily
2K48A 4X65T 3EUHA 4B3TT 5HAXA 2LRLA 4EV6A 3AE6A 4EYUA 3IF8B 2KMFA 3CQCB 3TLSA 4U2YA 2XQYA 5CA1E 1OWAA 4DUYT 4KHZF 3UU8A 1BR2A 5AQRB 4QHOA 3TLUA 3EDUA 2CHNA 1LVFA 1KEYA 3ZYMA 2WB5A 2BDEA 1NAFA 1WFDA 4IL4A 3AAIA 2D5UA 1FIOA 1FMVA 3J9X1 3RIUA 3QUJA 2IDOB 2QGSA 2V8SV 3HL6A 3ZJ1A 2FUPA 2VKHA 3O1HA 5CFBA 2XAQB 3B5MA 3CIRA 3PU3A 2BKPA 3LFMA 4UEMA 1G8XA 3ONJA 4X1YE 3ZMUB 2UUCT 3N2OA 3X1DA 3PUQA 4O4HE 3K1SA 1IBLT 4JI7T 3AVSA 4UV9B 2DI4A 2V7JA 4LMJA 3EDVA 1H7CA 2BS2A 4YHHT 2X9XA 2XQ8A 4HFEA 4EXTA 3AE3A 4H9NC 3I9WA 2VVNA 3ZT6A 2ODUA 2PJQA 4ZXLA 5ADXL 2VQET 1Z0PA 5JDFA 4EZ4A 5LJMA 3NZQA 2YU1A 3KDSE 2V7KA 4DMWA 3B13A 1LVKA 5JR9A 4MALA 4LFCT 4F8HA 3PUZF 3N9QA 1WR6A 4AIUA 3ZEFB 4V1Av 5FYMA 3D0TA 5AQNB 3NZPA 2W66A 3V5SA 3RC3A 1MIVA 3ZT5A 3I0QA 4N78D 3LK2B 3AE9A 2XZEA 4C91A 4UR9A 2LM2A 4YSZA 3PUYF 3AVRA 3IBPA 3I1AA 3RQWA 3K3QC 2K3WA 4O4JE 1NEKA 1XNRT 2LKHA 1HNZT 2YINA 3W15B 4AQFA 2BVMA 2NW8A 3A8YC 5LBMA 2WU5A 4I50E 4DBQA 2GK9A 3P8CD 3OVUA 1AJ3A 4CN4A 4UV8B 3F2EA 1VCTA 5LG3A 3KBTA 4QXCB 2CPTA 1I6ZA 3UQ4A 4ILUA 1XMOT 1UUSA 3JC6C 3NRYA 3PJAA 4HFCA 5E0OA 4PK6A 2VL8A 2MAWA 4IDOA 5FP3A 3N5LA 2UXXB 5H6RB 5IYZE 2XUEA 1D0YA 5IWAT 3AA6B 3JC6D 4C90A 2NW7A 2JRKA 5F8PA 3SOLA 5ETWA 3EHZA 2ES0A 2X0HA 1E7PA 3AE2A 1YKEB 3AA0B 3AE1A 3FXEB 4DV5T 3AEBA 3VU7H 1N32T 2IC9A 5ABGA 1XDPA 4L0RA 5DJQC 3K3OA 1MNDA 2E8IA 3PUAA 5FXWA 4ZOLE 3PV0F 5LCYA 5HEUA 2Y8DA 2H89A 4QH5A 4PK5A 2WS3A 4CI2B 1IJ5A 5C8YE 3P50A 1HTJF 2W4XA 2WP9A 3Q5DA 4JBWF 2NR4A 3DTOA 3AA7B 3RIUC 4FJOA 5AQSB 5FVKA 3EAMA 5LJNA 1GQEA 3KINB 2YEVC 4HTEA 2LJLA 3LK42 2H7OA 1WCRA 3KFWX 4MLKA 2CXFA 5FY1A 2JQHA 2LRKA 2X67A 1M7KA 3VKGA 3CK6A 4YT0A 2CRBA 1W09A 3KV5A 2AE9A 3ABVA 2WBLA 3MJXA 4AQYT 2N2NA 1YW0A 3CQXC 4ZHQE 3O9XA 1T7SA 3S4UA 2L9QA 4DIDB 1WYBA 2MBGA 3ZC0A 4X5TA 3UFGA 5JVDE 4TX5A 5GONE 2BG9E 2DHRA 2UXBT 4P0BA 4GIWA 2V7MA 1B7TA 4IDPA 2XAFB 2WDVA 2IC6A 4QXHB 4IHJE 3VR9A 3FZLB 3OTOT 2M6IA 2VKJA 2BG9A 5JR9C 5AQMB 4OX9T 2W00A 4LF7T 5AQTB 2MTQA 4KP3C 3KV6A 3GWHA 3PUVF 4Q25A 2XY8B 2BVLA 3AE8A 1WRDA 4WW0A 5CJ5A 5HWXA 3F31A 4K0KT 4JI6T 1XZYA 3RH3A 3RQUA 5LHIB 3PTRB 5FKYA 3RKOA 3LDQB 3Q5EA 3FBZA 1IBMT 4NUUA 5BR8T 5FMNA 4HFDA 3VKHA 2XQ6A 1MMGA 4ZZCA 5JDNA 4PW8A 3G06A 2WAUA 3UTKA 4AQFC 2Z6EA 1CHUA 2V7LA 3VRBA 1UX5A 2C5KT 2OLTA 4AKGA 2A3DA 3PUGA 3HKEE 5L3BB 1VRBA 3CKDA 2BS4A 2CXLA 2KNDA 4WBOA 3FBLA 3P4QA 4AQGA 2QYWA 4AKLA 3UUXB 5HXCA 2XM2A 4DMVA 4GKKT 2XQ3A 3F57A 3Q2MA 3AEAA 3EI0A 3ETVA 3L3PA 2YDQA 1MIWA 4O2AE 1J1JA 2KWHA 4EAHA 4YSXA 5HEJA 5ABEA 3BQKA 2VQFT 2WZIA 1EZ3A 1LRZA 4DR1T 4WBNE 4OFZA 5KXJA 4HWCA 4WYVA 4E7ZA 5AQKB 4YTMA 4JI1T 3C51A 4OYKA 4TWDA 5TAOA 4BJNA 3C4XA 4HWDA 2KSRA 3KV9A 3WI3A 3OJAA 3RRCA 3LSVA 4QXBB 2H88A 4YHJA 4ILAA 3UUBA 1HNWT 3A7MA 2IUBA 2K24A 2W67A 1UX4A 2KT9A 1D1CA 2NWBA 2FJDA 3RPUA 2W62A 4HWHA 5LB7B 1W9RA 2DWGA 1XDOA 2RPAA 1X79A 4PAGA 4U2ZA 5HXRA 2MYSA 4ZI2C 2Y48B 4ZS2A 2QVAA 5F5WA 4UVBB 3P4PA 5AQQB 4ASKA 5FXVA 5LA6E 3UU6A 1SHZC 2LHRA 4YTPA 4MHCA 2H7VC 4TV9E 4COFA 1T98A 4ZI2D 1WR0A 4J2CA 5CB4E 5FL1A 2UUAT 3CVRA 4PNIA 1Z8UA 1BR0A 5FL0A 4U33A 4NPPA 3RYCE 3ESLA 2WQYA 3C50A 4IE0A 4JEUB 2ZM8A 5EZYE 5LHGB 4IL9A 3PE0A 2W61A 4EB6E 3VR8A 4TNWA 4IDZA 2YN6A 3ZMTB 4I55E 1N36T 3O1JA 4B6XA 4H9RC 1Y64B 4PJMA 3AXJB 3C4WA 5L3EB 3ZN0B 4JI2T 3Q9DA 2WU2A 2LEHA 2WMOA 3AEGA 2DNXA 4HE8A 3LJCA 4GK5E 4H9OC 5LGUB 5LP6E 1V9DA 2Q9QC 5LGNB 3TLTA 4TWFA 2BG9C 3HKCE 4BAYB 1FMWA 4EOZB 4LMKA 2CCQA 4HFVA 3GN5A 3PU8A 3KV4A 1FJGT 2HN1A 2M67A 2C5JA 4JUYA 3P4WA 2BS3A 4ERRA 5F3JA 4UXNB 3HKDE 4EEDA 3AAAB 2HHHT 4IE5A 1XNQT 2HPLA 5AQPB 4UIGA 3UUNA 2OA5A 3B57A 4WNKA 5L3CB 2JQKA 2LM9A 1IZNB 2BKOA 4DR4T 4FI5A 2EHOA 5ABFB 4BJMA 4JI8T 1R8IA 1S35A 4U7IA 4PFOA 3UULA 4GK0E 1FEWA 1KNZA 5J1GA 5LMNT 2E5LT 2WWUA 2LSKA 5KDMC 4KI0F 4KBMB 2DCFA 5J2UE 1L0VA 2K5BB 1KFYA 2YK0A 4YY3T 4HFIA 3AE7A 4PJJA 5AQUB 2NTXA 3RGLA 2HPJA 1WLXA 3ZYKA 5IHYA 2LSJA 3AEEA 3CMLA 2UXNB 1ZKEA 2Q9QB 4JI0T 5M4YA 4K0UA 4IDNA 3PUSA 2BG9B 3PURA 5EK3A 2MPKA 2VKOA 4U7YA 3JCFA 1OEDE 1XWMA 2DWKA 3RYHE 4JYAT 3ZT7A 2B76A 4U74A 1ZV4X 4CN1A 1CUNA 1W0AA 3ONLC 2VK9A 3IHRA 2A9UA 1UCUA 5CGMA 3OYXA 4L5GA 5HEOA 3QOFA 4KX6A 2F4VT 1N33T 4U3CA 4AKIA 1KF6A 2CHOA 5AQJB 3AXJA 2JPFA 4TNVA 1OEDA 3N2GE 5JDHA 2IMLA 4LMLA 1I94T 5C2TA 1UK5A 3HKBE 2M6BA 1YKHB 3QNUA 4YJ3E 2RP4A 4DBRA 4DV4T 1ZOYA 1HCIA 2VKDA 3JAFA 3GMIA 1HF8A 1YQ3A 3OPCA 2XHEB 1HG2A 3MACA 4JI5T 1BR1A 3O1IA 1O3XA 5AFUL 1IBKT 3I9YA 4TWHA 3E22E 1US7B 3RIAA 4DR2T 2D0UA 3M65A 4OYJA 1OXZA 3SS1A 3PUWF 1U4QA 4Z91A 4JEHB 4HGAA 2FBWA 2ODVA 4MFRA 5AQFB 2LKGA 3NRXA 4TN7B 3H37A 3TLVA 4UELA 3J7Yq 5ABFA 2XQAA 2LE8A 3ZC1A 5LG4A 3RX6A 1MNEA 5JH7E 2XPKA 2X51A 5J2TE 5FY0A 3N9NA 3QB5K 4Z8XA 4AISA 4JI4T 1QSDA 1YD8G 4XZCA 3U78A 4NXMT 4F6RC 2QRXA 2KINB 2CM0A 3ZJ2A 3SFDA 5JDGA 1HNXT 3MZKB 5HXSA 2CE7A 4DR5T 4EGWA 4ZI3C 4HWFA 3MKDA 2X9HA 5A1LA 2VVSA 2I6HA 2XSAA 2NTYA 4TZ4C 4AI6A 2C5IT 1J5ET 2Q9QA 4HWIB 2VWAA 4CXYA 4QH4A 2NP9A 2MOZA 3PDYA 4EYYR 5L3DB 3HI2A 2I59A 3N2KE 3LK3B 1WYCA 2EHOC 4X66T 3AEDA 4UF0B 2CXDA 3FB2A 4X1IE 2YKSA 5FXXA 4YFSA 4OHFA 5L3GB 2YDRA 1HFAA 5LYJE 2BZBA 2NOXA 4IT4A 2V7IA 4MBQA 4JV5T 3CWZB 5DQWA 3KVAA 2XAHB 1QLBA 3KVBA 2DLRA 1D1BA 4EIWA 5AQGB 2PFVA 2W0GA 5HWYA 4EZHA 2JMHA 1NENA 3ZKRA 1ZP0A 3GA8A 3ANWB 1D0ZA 5LNKA 3FHNA 3GN5B 4HFBA 3FZFB 4HEAA 2LT3A 1UGOA 2CBIA 2V5DA 2WCAA 4KUMB 2W63A 5LMUT 3R6NA 1Y01A 3E08A 4NXNT 1OEDC 2R6GF 3UU5A 3AE5A 2ZMAA 2C0SA 1M62A 4PK4A 3NWIA 3DP7A 5HEHA 3N9LA 2CLYC 4LF6T 1G73A 2DL1A 3KBUA 3OYZA 3AECA 3CPZA 1T8BA 2IW5B 2CA5A 2EHOB 1KNRA 4CZZB 3IA3A 2XQ5A 3P4RA 3LBXB 5HXHA 4XBFB 3ZPOA 2XQ9A 3WAJA 5J0ZA 3JAEA 1NWMX 2XSBA 2WWVA 3AB3B 4CQIA 3RI5A 2LSIA 3Q5XA 4HFHA 2LHNA 3ZCJA 2E9XB 4YXDA 1XMQT 3H3MA 4LF9T 3C64A 2VURA 2G0UA 3QK6A 4NIQA 4QH1A 3UU3A 5AQLB 5L47A 4XAXB 5KMGP 2UXDT 3T1HT 2JQ9A 4NUVA 4LFAT 4YSYA 2FJEA 1MIYA 3TLWA 2J62A 4O2BE 2FJBA 1LKXA 4UF0A 4H9SE 5BMVE 4A97A 2FJAA 4IE6A 4DR6T 2L8KA 2JIWA 4G2AA 4AKRB 3UU4A 4X1KE 1MMDA 3P4SA 4DV1T 3JADA 1D1AA 4CN6A 4GYSA 4ZZBA 3QC9A 1OEDB 3Q5WA 2UUBT 4IIJE 5JDQA 5KX5E 3RC8A 4IREA 4H9QC 2VB6A 3H3AA 3L8RA 2CLYB 4ADZA 4P1NA 3U3IA 2X0LB 3AAEB 3VRAA 2YU2A 4DVDA 2HH7A 4YJ2E 2B1EA 4GOUA 3N9OA 3ANWA 2X68A 4EEBA 2ZM6T 2LSYA 3ZSSA 3A5XA 3CX6B 1IJ6A 2CBJA 4LF8T 3NBXX 4CI1B 2J4GA 4HKAA 3UT5E 4X20E 3T1YT 4DV7T 2Q9QD 4OK0A 2X66A 2K9AA 2PTFA 2JQQA 2WDRA 2LOSA 4U72A 4BA9A 1BR4A 3PJAJ 1E2AA 4DNDA 5C3JA 5L4HA 2JMKA 4H9PC 1E1HB 5HYAA 3RKGA 5HXEA 5ABHA 1YQ4A 3DJBA 1HS7A 3LBXA 3P7IA 5LOVE 2IHR1 5FVLA 4PJNA 2UU9T 3CQGB 3BQIA 5JDMA 3EABA 2XQ4A 5JQGE 5JRCB 3NKZA 2LOPA 4HN9A 2J47A 2KLQA 2V6YA 2E9XA 3HA4A 3IEEA 2PBIA 3I0OA 2VL0A 1ZHCA 3LG7A 3ZCIA 4A56A 1HR0T 3ZMSB 4ZI7E 4O4LE 2W2UA 4ILBA 4IDQA 1W0BA 3OBVE 3UFEA 2IAKA 4IE7A 3RYIE 2ACZA 5JREA 3K8PC 2BKNA 3SWHA 1HX8A 3C4ZA 2WY2A 4H63V 2V6XA 4ZS3A 2ACXA 3FZHB 2KZ7B 4B3MT 2CMRA 3ONXA 2I0MA 2N9DA 3ETUA 3CX7B 3OKQA 2HN2A 1YXRA 2N1GA 1U5PA 4PFPA 4TUYE 1JNZA 2IIUA 3WAKA 3BQLA 5L3FB 3N9PA 3HR0A 3O4XE 3RRWA 2LSGA 4M1PA 1SE7A 4O4IE 4U31A 4IGUA 4GKJT 1UURA 2ZM0A 3UQ7A 4X64T 5AQOB 4I43B 2KXPB 5DABA 4ISSA 2BBHA 4B3ST 2NW9A 1HX1B 5DQVA 2QA7A 4O8SA 2V5CA 1SA0E 5LHHB 3VHLA 5AQIB 3RLFF 2XAGB 4KMCA 5HCMA 2J1DG 4AXPA 5IUXA 5H6QB 3AA1B 5FNVE 5CA0E 3L39A 2L3LA 1DU2A 3CX8B 2X0YA 3RHWA 3UUMA 3MK7C 4ANJA 5FY7A 3AEFA 4ILCA 2X9YA 3FZMB 5EK4A 3RIFA 5JRCA 2D0TA 2JJ9A 3RF1A 4GYRA 3FXDB 1ZEEA 3RYFE 5LGTB 2P9BA 4DV0T 4QKNA 3E0ZA 3NVOA 2WDQA 1SUMB 4TV8E 2X9WA 3SRZA 1J5WA 1KNPA 2KWIB 3K3NA 5AQHB 4LFBT 4A98A 4DO0A 2ZLYA 4ZEYA 3FZKB 4QWNB 4CI3B 5L4EA 4QX8B 4DUZT 2D9DA 4ZI3D 2WSSV 2Y6XA 2AXDS 2SPCA 5HCJA 4P0AA 2XTLA 2WMNA 2LLYA 5EK2A 3MXZA 2XJ7A 2UXCT 2XM1A 3AE4A 2XAJB 2VASA 4JI3T 3L09A 1MMNA 4PJLA 3SFEA 5JTGA 4G63A 4YTNA 2ZM2A 3R84B 1MMAA 4UVAB 2WZHA 2EHOD 2CWOA 2H3RA 3ZN1B 3PUXF 2E9XC 4Z90A 2D2SA 1D0XA 4YLHA 3M3ZB 2OV9A 5L2LA 3C98B 2CEAA 4JLEA 3V5UA 2CWYA 1X9BA 1QUUA 3BK9A 4DV2T 2E5VA 4A5XA 4UVCB 2WM9A 4DV6T 3QB5A 2E9XD 4B3RT 4CXWA 4DV3T 2PG8A 5HEGA 1KK7A 5LBQB 1IAPA 2V1DB 4WZXA 2RA1A 2BBJA 5JDLA 3T8OA 3N9MA 4I4TE 2A72A 2XQ7A 2A2FX 4DR7T 4E7SA 2XASB 3ZLIA 4LF5T 3EVYA 4ISTA 4KHPT 1N34T 5JR9B 4P09A 1HG5A 3ZYLA 3MA9A 4I0UA 2E2AA 1JNRA 4QX7B 2YDSA 5FXZA 4IE4A 1VCSA 2YOEA 3TKLB 4H63H 4L9IA 3ZMZB 1S94A 2V26A 3ZMVB 2V6YB 1VOMA 5AQVB 4DR3T 3ZSTA 4CXXA 4X62T 4AKHA 5LXTE 1T72A 4LF4T
chains in the Genus database with same CATH topology
1I6ZA 3FZKB 3LDQB 5AQIB 5AQPB 5AQTB 1T7SA 5AQOB 4HWFA 4HWDA 5AQJB 2D9DA 3M3ZB 3FZFB 1M7KA 5AQFB 4HWHA 3FZHB 5AQUB 1M62A 5AQQB 5AQHB 3FZLB 1UGOA 5AQGB 5AQNB 4HWCA 1UK5A 5AQSB 5AQRB 3FZMB 4HWIB 1HX1B 5AQKB 5AQVB 5AQLB 3A8YC 5AQMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I6Z A;  3FZK B;  3LDQ B;  5AQI B;  5AQP B;  5AQT B;  1T7S A;  5AQO B;  4HWF A;  4HWD A;  5AQJ B;  2D9D A;  3M3Z B;  3FZF B;  1M7K A;  5AQF B;  4HWH A;  3FZH B;  5AQU B;  1M62 A;  5AQQ B;  5AQH B;  3FZL B;  1UGO A;  5AQG B;  5AQN B;  4HWC A;  1UK5 A;  5AQS B;  5AQR B;  3FZM B;  4HWI B;  1HX1 B;  5AQK B;  5AQV B;  5AQL B;  3A8Y C;  5AQM B; 
#chains in the Genus database with same CATH topology
 2K48 A;  4X65 T;  3EUH A;  4B3T T;  5HAX A;  2LRL A;  4EV6 A;  3AE6 A;  4EYU A;  3IF8 B;  2KMF A;  3CQC B;  3TLS A;  4U2Y A;  2XQY A;  5CA1 E;  1OWA A;  4DUY T;  4KHZ F;  3UU8 A;  1BR2 A;  5AQR B;  4QHO A;  3TLU A;  3EDU A;  2CHN A;  1LVF A;  1KEY A;  3ZYM A;  2WB5 A;  2BDE A;  1NAF A;  1WFD A;  4IL4 A;  3AAI A;  2D5U A;  1FIO A;  1FMV A;  3J9X 1;  3RIU A;  3QUJ A;  2IDO B;  2QGS A;  2V8S V;  3HL6 A;  3ZJ1 A;  2FUP A;  2VKH A;  3O1H A;  5CFB A;  2XAQ B;  3B5M A;  3CIR A;  3PU3 A;  2BKP A;  3LFM A;  4UEM A;  1G8X A;  3ONJ A;  4X1Y E;  3ZMU B;  2UUC T;  3N2O A;  3X1D A;  3PUQ A;  4O4H E;  3K1S A;  1IBL T;  4JI7 T;  3AVS A;  4UV9 B;  2DI4 A;  2V7J A;  4LMJ A;  3EDV A;  1H7C A;  2BS2 A;  4YHH T;  2X9X A;  2XQ8 A;  4HFE A;  4EXT A;  3AE3 A;  4H9N C;  3I9W A;  2VVN A;  3ZT6 A;  2ODU A;  2PJQ A;  4ZXL A;  5ADX L;  2VQE T;  1Z0P A;  5JDF A;  4EZ4 A;  5LJM A;  3NZQ A;  2YU1 A;  3KDS E;  2V7K A;  4DMW A;  3B13 A;  1LVK A;  5JR9 A;  4MAL A;  4LFC T;  4F8H A;  3PUZ F;  3N9Q A;  1WR6 A;  4AIU A;  3ZEF B;  4V1A v;  5FYM A;  3D0T A;  5AQN B;  3NZP A;  2W66 A;  3V5S A;  3RC3 A;  1MIV A;  3ZT5 A;  3I0Q A;  4N78 D;  3LK2 B;  3AE9 A;  2XZE A;  4C91 A;  4UR9 A;  2LM2 A;  4YSZ A;  3PUY F;  3AVR A;  3IBP A;  3I1A A;  3RQW A;  3K3Q C;  2K3W A;  4O4J E;  1NEK A;  1XNR T;  2LKH A;  1HNZ T;  2YIN A;  3W15 B;  4AQF A;  2BVM A;  2NW8 A;  3A8Y C;  5LBM A;  2WU5 A;  4I50 E;  4DBQ A;  2GK9 A;  3P8C D;  3OVU A;  1AJ3 A;  4CN4 A;  4UV8 B;  3F2E A;  1VCT A;  5LG3 A;  3KBT A;  4QXC B;  2CPT A;  1I6Z A;  3UQ4 A;  4ILU A;  1XMO T;  1UUS A;  3JC6 C;  3NRY A;  3PJA A;  4HFC A;  5E0O A;  4PK6 A;  2VL8 A;  2MAW A;  4IDO A;  5FP3 A;  3N5L A;  2UXX B;  5H6R B;  5IYZ E;  2XUE A;  1D0Y A;  5IWA T;  3AA6 B;  3JC6 D;  4C90 A;  2NW7 A;  2JRK A;  5F8P A;  3SOL A;  5ETW A;  3EHZ A;  2ES0 A;  2X0H A;  1E7P A;  3AE2 A;  1YKE B;  3AA0 B;  3AE1 A;  3FXE B;  4DV5 T;  3AEB A;  3VU7 H;  1N32 T;  2IC9 A;  5ABG A;  1XDP A;  4L0R A;  5DJQ C;  3K3O A;  1MND A;  2E8I A;  3PUA A;  5FXW A;  4ZOL E;  3PV0 F;  5LCY A;  5HEU A;  2Y8D A;  2H89 A;  4QH5 A;  4PK5 A;  2WS3 A;  4CI2 B;  1IJ5 A;  5C8Y E;  3P50 A;  1HTJ F;  2W4X A;  2WP9 A;  3Q5D A;  4JBW F;  2NR4 A;  3DTO A;  3AA7 B;  3RIU C;  4FJO A;  5AQS B;  5FVK A;  3EAM A;  5LJN A;  1GQE A;  3KIN B;  2YEV C;  4HTE A;  2LJL A;  3LK4 2;  2H7O A;  1WCR A;  3KFW X;  4MLK A;  2CXF A;  5FY1 A;  2JQH A;  2LRK A;  2X67 A;  1M7K A;  3VKG A;  3CK6 A;  4YT0 A;  2CRB A;  1W09 A;  3KV5 A;  2AE9 A;  3ABV A;  2WBL A;  3MJX A;  4AQY T;  2N2N A;  1YW0 A;  3CQX C;  4ZHQ E;  3O9X A;  1T7S A;  3S4U A;  2L9Q A;  4DID B;  1WYB A;  2MBG A;  3ZC0 A;  4X5T A;  3UFG A;  5JVD E;  4TX5 A;  5GON E;  2BG9 E;  2DHR A;  2UXB T;  4P0B A;  4GIW A;  2V7M A;  1B7T A;  4IDP A;  2XAF B;  2WDV A;  2IC6 A;  4QXH B;  4IHJ E;  3VR9 A;  3FZL B;  3OTO T;  2M6I A;  2VKJ A;  2BG9 A;  5JR9 C;  5AQM B;  4OX9 T;  2W00 A;  4LF7 T;  5AQT B;  2MTQ A;  4KP3 C;  3KV6 A;  3GWH A;  3PUV F;  4Q25 A;  2XY8 B;  2BVL A;  3AE8 A;  1WRD A;  4WW0 A;  5CJ5 A;  5HWX A;  3F31 A;  4K0K T;  4JI6 T;  1XZY A;  3RH3 A;  3RQU A;  5LHI B;  3PTR B;  5FKY A;  3RKO A;  3LDQ B;  3Q5E A;  3FBZ A;  1IBM T;  4NUU A;  5BR8 T;  5FMN A;  4HFD A;  3VKH A;  2XQ6 A;  1MMG A;  4ZZC A;  5JDN A;  4PW8 A;  3G06 A;  2WAU A;  3UTK A;  4AQF C;  2Z6E A;  1CHU A;  2V7L A;  3VRB A;  1UX5 A;  2C5K T;  2OLT A;  4AKG A;  2A3D A;  3PUG A;  3HKE E;  5L3B B;  1VRB A;  3CKD A;  2BS4 A;  2CXL A;  2KND A;  4WBO A;  3FBL A;  3P4Q A;  4AQG A;  2QYW A;  4AKL A;  3UUX B;  5HXC A;  2XM2 A;  4DMV A;  4GKK T;  2XQ3 A;  3F57 A;  3Q2M A;  3AEA A;  3EI0 A;  3ETV A;  3L3P A;  2YDQ A;  1MIW A;  4O2A E;  1J1J A;  2KWH A;  4EAH A;  4YSX A;  5HEJ A;  5ABE A;  3BQK A;  2VQF T;  2WZI A;  1EZ3 A;  1LRZ A;  4DR1 T;  4WBN E;  4OFZ A;  5KXJ A;  4HWC A;  4WYV A;  4E7Z A;  5AQK B;  4YTM A;  4JI1 T;  3C51 A;  4OYK A;  4TWD A;  5TAO A;  4BJN A;  3C4X A;  4HWD A;  2KSR A;  3KV9 A;  3WI3 A;  3OJA A;  3RRC A;  3LSV A;  4QXB B;  2H88 A;  4YHJ A;  4ILA A;  3UUB A;  1HNW T;  3A7M A;  2IUB A;  2K24 A;  2W67 A;  1UX4 A;  2KT9 A;  1D1C A;  2NWB A;  2FJD A;  3RPU A;  2W62 A;  4HWH A;  5LB7 B;  1W9R A;  2DWG A;  1XDO A;  2RPA A;  1X79 A;  4PAG A;  4U2Z A;  5HXR A;  2MYS A;  4ZI2 C;  2Y48 B;  4ZS2 A;  2QVA A;  5F5W A;  4UVB B;  3P4P A;  5AQQ B;  4ASK A;  5FXV A;  5LA6 E;  3UU6 A;  1SHZ C;  2LHR A;  4YTP A;  4MHC A;  2H7V C;  4TV9 E;  4COF A;  1T98 A;  4ZI2 D;  1WR0 A;  4J2C A;  5CB4 E;  5FL1 A;  2UUA T;  3CVR A;  4PNI A;  1Z8U A;  1BR0 A;  5FL0 A;  4U33 A;  4NPP A;  3RYC E;  3ESL A;  2WQY A;  3C50 A;  4IE0 A;  4JEU B;  2ZM8 A;  5EZY E;  5LHG B;  4IL9 A;  3PE0 A;  2W61 A;  4EB6 E;  3VR8 A;  4TNW A;  4IDZ A;  2YN6 A;  3ZMT B;  4I55 E;  1N36 T;  3O1J A;  4B6X A;  4H9R C;  1Y64 B;  4PJM A;  3AXJ B;  3C4W A;  5L3E B;  3ZN0 B;  4JI2 T;  3Q9D A;  2WU2 A;  2LEH A;  2WMO A;  3AEG A;  2DNX A;  4HE8 A;  3LJC A;  4GK5 E;  4H9O C;  5LGU B;  5LP6 E;  1V9D A;  2Q9Q C;  5LGN B;  3TLT A;  4TWF A;  2BG9 C;  3HKC E;  4BAY B;  1FMW A;  4EOZ B;  4LMK A;  2CCQ A;  4HFV A;  3GN5 A;  3PU8 A;  3KV4 A;  1FJG T;  2HN1 A;  2M67 A;  2C5J A;  4JUY A;  3P4W A;  2BS3 A;  4ERR A;  5F3J A;  4UXN B;  3HKD E;  4EED A;  3AAA B;  2HHH T;  4IE5 A;  1XNQ T;  2HPL A;  5AQP B;  4UIG A;  3UUN A;  2OA5 A;  3B57 A;  4WNK A;  5L3C B;  2JQK A;  2LM9 A;  1IZN B;  2BKO A;  4DR4 T;  4FI5 A;  2EHO A;  5ABF B;  4BJM A;  4JI8 T;  1R8I A;  1S35 A;  4U7I A;  4PFO A;  3UUL A;  4GK0 E;  1FEW A;  1KNZ A;  5J1G A;  5LMN T;  2E5L T;  2WWU A;  2LSK A;  5KDM C;  4KI0 F;  4KBM B;  2DCF A;  5J2U E;  1L0V A;  2K5B B;  1KFY A;  2YK0 A;  4YY3 T;  4HFI A;  3AE7 A;  4PJJ A;  5AQU B;  2NTX A;  3RGL A;  2HPJ A;  1WLX A;  3ZYK A;  5IHY A;  2LSJ A;  3AEE A;  3CML A;  2UXN B;  1ZKE A;  2Q9Q B;  4JI0 T;  5M4Y A;  4K0U A;  4IDN A;  3PUS A;  2BG9 B;  3PUR A;  5EK3 A;  2MPK A;  2VKO A;  4U7Y A;  3JCF A;  1OED E;  1XWM A;  2DWK A;  3RYH E;  4JYA T;  3ZT7 A;  2B76 A;  4U74 A;  1ZV4 X;  4CN1 A;  1CUN A;  1W0A A;  3ONL C;  2VK9 A;  3IHR A;  2A9U A;  1UCU A;  5CGM A;  3OYX A;  4L5G A;  5HEO A;  3QOF A;  4KX6 A;  2F4V T;  1N33 T;  4U3C A;  4AKI A;  1KF6 A;  2CHO A;  5AQJ B;  3AXJ A;  2JPF A;  4TNV A;  1OED A;  3N2G E;  5JDH A;  2IML A;  4LML A;  1I94 T;  5C2T A;  1UK5 A;  3HKB E;  2M6B A;  1YKH B;  3QNU A;  4YJ3 E;  2RP4 A;  4DBR A;  4DV4 T;  1ZOY A;  1HCI A;  2VKD A;  3JAF A;  3GMI A;  1HF8 A;  1YQ3 A;  3OPC A;  2XHE B;  1HG2 A;  3MAC A;  4JI5 T;  1BR1 A;  3O1I A;  1O3X A;  5AFU L;  1IBK T;  3I9Y A;  4TWH A;  3E22 E;  1US7 B;  3RIA A;  4DR2 T;  2D0U A;  3M65 A;  4OYJ A;  1OXZ A;  3SS1 A;  3PUW F;  1U4Q A;  4Z91 A;  4JEH B;  4HGA A;  2FBW A;  2ODV A;  4MFR A;  5AQF B;  2LKG A;  3NRX A;  4TN7 B;  3H37 A;  3TLV A;  4UEL A;  3J7Y q;  5ABF A;  2XQA A;  2LE8 A;  3ZC1 A;  5LG4 A;  3RX6 A;  1MNE A;  5JH7 E;  2XPK A;  2X51 A;  5J2T E;  5FY0 A;  3N9N A;  3QB5 K;  4Z8X A;  4AIS A;  4JI4 T;  1QSD A;  1YD8 G;  4XZC A;  3U78 A;  4NXM T;  4F6R C;  2QRX A;  2KIN B;  2CM0 A;  3ZJ2 A;  3SFD A;  5JDG A;  1HNX T;  3MZK B;  5HXS A;  2CE7 A;  4DR5 T;  4EGW A;  4ZI3 C;  4HWF A;  3MKD A;  2X9H A;  5A1L A;  2VVS A;  2I6H A;  2XSA A;  2NTY A;  4TZ4 C;  4AI6 A;  2C5I T;  1J5E T;  2Q9Q A;  4HWI B;  2VWA A;  4CXY A;  4QH4 A;  2NP9 A;  2MOZ A;  3PDY A;  4EYY R;  5L3D B;  3HI2 A;  2I59 A;  3N2K E;  3LK3 B;  1WYC A;  2EHO C;  4X66 T;  3AED A;  4UF0 B;  2CXD A;  3FB2 A;  4X1I E;  2YKS A;  5FXX A;  4YFS A;  4OHF A;  5L3G B;  2YDR A;  1HFA A;  5LYJ E;  2BZB A;  2NOX A;  4IT4 A;  2V7I A;  4MBQ A;  4JV5 T;  3CWZ B;  5DQW A;  3KVA A;  2XAH B;  1QLB A;  3KVB A;  2DLR A;  1D1B A;  4EIW A;  5AQG B;  2PFV A;  2W0G A;  5HWY A;  4EZH A;  2JMH A;  1NEN A;  3ZKR A;  1ZP0 A;  3GA8 A;  3ANW B;  1D0Z A;  5LNK A;  3FHN A;  3GN5 B;  4HFB A;  3FZF B;  4HEA A;  2LT3 A;  1UGO A;  2CBI A;  2V5D A;  2WCA A;  4KUM B;  2W63 A;  5LMU T;  3R6N A;  1Y01 A;  3E08 A;  4NXN T;  1OED C;  2R6G F;  3UU5 A;  3AE5 A;  2ZMA A;  2C0S A;  1M62 A;  4PK4 A;  3NWI A;  3DP7 A;  5HEH A;  3N9L A;  2CLY C;  4LF6 T;  1G73 A;  2DL1 A;  3KBU A;  3OYZ A;  3AEC A;  3CPZ A;  1T8B A;  2IW5 B;  2CA5 A;  2EHO B;  1KNR A;  4CZZ B;  3IA3 A;  2XQ5 A;  3P4R A;  3LBX B;  5HXH A;  4XBF B;  3ZPO A;  2XQ9 A;  3WAJ A;  5J0Z A;  3JAE A;  1NWM X;  2XSB A;  2WWV A;  3AB3 B;  4CQI A;  3RI5 A;  2LSI A;  3Q5X A;  4HFH A;  2LHN A;  3ZCJ A;  2E9X B;  4YXD A;  1XMQ T;  3H3M A;  4LF9 T;  3C64 A;  2VUR A;  2G0U A;  3QK6 A;  4NIQ A;  4QH1 A;  3UU3 A;  5AQL B;  5L47 A;  4XAX B;  5KMG P;  2UXD T;  3T1H T;  2JQ9 A;  4NUV A;  4LFA T;  4YSY A;  2FJE A;  1MIY A;  3TLW A;  2J62 A;  4O2B E;  2FJB A;  1LKX A;  4UF0 A;  4H9S E;  5BMV E;  4A97 A;  2FJA A;  4IE6 A;  4DR6 T;  2L8K A;  2JIW A;  4G2A A;  4AKR B;  3UU4 A;  4X1K E;  1MMD A;  3P4S A;  4DV1 T;  3JAD A;  1D1A A;  4CN6 A;  4GYS A;  4ZZB A;  3QC9 A;  1OED B;  3Q5W A;  2UUB T;  4IIJ E;  5JDQ A;  5KX5 E;  3RC8 A;  4IRE A;  4H9Q C;  2VB6 A;  3H3A A;  3L8R A;  2CLY B;  4ADZ A;  4P1N A;  3U3I A;  2X0L B;  3AAE B;  3VRA A;  2YU2 A;  4DVD A;  2HH7 A;  4YJ2 E;  2B1E A;  4GOU A;  3N9O A;  3ANW A;  2X68 A;  4EEB A;  2ZM6 T;  2LSY A;  3ZSS A;  3A5X A;  3CX6 B;  1IJ6 A;  2CBJ A;  4LF8 T;  3NBX X;  4CI1 B;  2J4G A;  4HKA A;  3UT5 E;  4X20 E;  3T1Y T;  4DV7 T;  2Q9Q D;  4OK0 A;  2X66 A;  2K9A A;  2PTF A;  2JQQ A;  2WDR A;  2LOS A;  4U72 A;  4BA9 A;  1BR4 A;  3PJA J;  1E2A A;  4DND A;  5C3J A;  5L4H A;  2JMK A;  4H9P C;  1E1H B;  5HYA A;  3RKG A;  5HXE A;  5ABH A;  1YQ4 A;  3DJB A;  1HS7 A;  3LBX A;  3P7I A;  5LOV E;  2IHR 1;  5FVL A;  4PJN A;  2UU9 T;  3CQG B;  3BQI A;  5JDM A;  3EAB A;  2XQ4 A;  5JQG E;  5JRC B;  3NKZ A;  2LOP A;  4HN9 A;  2J47 A;  2KLQ A;  2V6Y A;  2E9X A;  3HA4 A;  3IEE A;  2PBI A;  3I0O A;  2VL0 A;  1ZHC A;  3LG7 A;  3ZCI A;  4A56 A;  1HR0 T;  3ZMS B;  4ZI7 E;  4O4L E;  2W2U A;  4ILB A;  4IDQ A;  1W0B A;  3OBV E;  3UFE A;  2IAK A;  4IE7 A;  3RYI E;  2ACZ A;  5JRE A;  3K8P C;  2BKN A;  3SWH A;  1HX8 A;  3C4Z A;  2WY2 A;  4H63 V;  2V6X A;  4ZS3 A;  2ACX A;  3FZH B;  2KZ7 B;  4B3M T;  2CMR A;  3ONX A;  2I0M A;  2N9D A;  3ETU A;  3CX7 B;  3OKQ A;  2HN2 A;  1YXR A;  2N1G A;  1U5P A;  4PFP A;  4TUY E;  1JNZ A;  2IIU A;  3WAK A;  3BQL A;  5L3F B;  3N9P A;  3HR0 A;  3O4X E;  3RRW A;  2LSG A;  4M1P A;  1SE7 A;  4O4I E;  4U31 A;  4IGU A;  4GKJ T;  1UUR A;  2ZM0 A;  3UQ7 A;  4X64 T;  5AQO B;  4I43 B;  2KXP B;  5DAB A;  4ISS A;  2BBH A;  4B3S T;  2NW9 A;  1HX1 B;  5DQV A;  2QA7 A;  4O8S A;  2V5C A;  1SA0 E;  5LHH B;  3VHL A;  5AQI B;  3RLF F;  2XAG B;  4KMC A;  5HCM A;  2J1D G;  4AXP A;  5IUX A;  5H6Q B;  3AA1 B;  5FNV E;  5CA0 E;  3L39 A;  2L3L A;  1DU2 A;  3CX8 B;  2X0Y A;  3RHW A;  3UUM A;  3MK7 C;  4ANJ A;  5FY7 A;  3AEF A;  4ILC A;  2X9Y A;  3FZM B;  5EK4 A;  3RIF A;  5JRC A;  2D0T A;  2JJ9 A;  3RF1 A;  4GYR A;  3FXD B;  1ZEE A;  3RYF E;  5LGT B;  2P9B A;  4DV0 T;  4QKN A;  3E0Z A;  3NVO A;  2WDQ A;  1SUM B;  4TV8 E;  2X9W A;  3SRZ A;  1J5W A;  1KNP A;  2KWI B;  3K3N A;  5AQH B;  4LFB T;  4A98 A;  4DO0 A;  2ZLY A;  4ZEY A;  3FZK B;  4QWN B;  4CI3 B;  5L4E A;  4QX8 B;  4DUZ T;  2D9D A;  4ZI3 D;  2WSS V;  2Y6X A;  2AXD S;  2SPC A;  5HCJ A;  4P0A A;  2XTL A;  2WMN A;  2LLY A;  5EK2 A;  3MXZ A;  2XJ7 A;  2UXC T;  2XM1 A;  3AE4 A;  2XAJ B;  2VAS A;  4JI3 T;  3L09 A;  1MMN A;  4PJL A;  3SFE A;  5JTG A;  4G63 A;  4YTN A;  2ZM2 A;  3R84 B;  1MMA A;  4UVA B;  2WZH A;  2EHO D;  2CWO A;  2H3R A;  3ZN1 B;  3PUX F;  2E9X C;  4Z90 A;  2D2S A;  1D0X A;  4YLH A;  3M3Z B;  2OV9 A;  5L2L A;  3C98 B;  2CEA A;  4JLE A;  3V5U A;  2CWY A;  1X9B A;  1QUU A;  3BK9 A;  4DV2 T;  2E5V A;  4A5X A;  4UVC B;  2WM9 A;  4DV6 T;  3QB5 A;  2E9X D;  4B3R T;  4CXW A;  4DV3 T;  2PG8 A;  5HEG A;  1KK7 A;  5LBQ B;  1IAP A;  2V1D B;  4WZX A;  2RA1 A;  2BBJ A;  5JDL A;  3T8O A;  3N9M A;  4I4T E;  2A72 A;  2XQ7 A;  2A2F X;  4DR7 T;  4E7S A;  2XAS B;  3ZLI A;  4LF5 T;  3EVY A;  4IST A;  4KHP T;  1N34 T;  5JR9 B;  4P09 A;  1HG5 A;  3ZYL A;  3MA9 A;  4I0U A;  2E2A A;  1JNR A;  4QX7 B;  2YDS A;  5FXZ A;  4IE4 A;  1VCS A;  2YOE A;  3TKL B;  4H63 H;  4L9I A;  3ZMZ B;  1S94 A;  2V26 A;  3ZMV B;  2V6Y B;  1VOM A;  5AQV B;  4DR3 T;  3ZST A;  4CXX A;  4X62 T;  4AKH A;  5LXT E;  1T72 A;  4LF4 T; 
#chains in the Genus database with same CATH homology
 1I6Z A;  3FZK B;  3LDQ B;  5AQI B;  5AQP B;  5AQT B;  1T7S A;  5AQO B;  4HWF A;  4HWD A;  5AQJ B;  2D9D A;  3M3Z B;  3FZF B;  1M7K A;  5AQF B;  4HWH A;  3FZH B;  5AQU B;  1M62 A;  5AQQ B;  5AQH B;  3FZL B;  1UGO A;  5AQG B;  5AQN B;  4HWC A;  1UK5 A;  5AQS B;  5AQR B;  3FZM B;  4HWI B;  1HX1 B;  5AQK B;  5AQV B;  5AQL B;  3A8Y C;  5AQM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...