1UGOA

Solution structure of the first murine bag domain of bcl2-associated athanogene 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
b'GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNASGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Bcl2-associated athanogene 5
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1ugoA00
1T7SA 2D9DA 1UK5A 3FZLB 3FZMB 4HWIB 5AQMB 5AQFB 4HWCA 4HWFA 5AQJB 1UGOA 5AQRB 1HX1B 5AQQB 3FZFB 1I6ZA 5AQUB 1M62A 5AQHB 5AQTB 3FZHB 5AQKB 3A8YC 3M3ZB 5AQVB 3FZKB 5AQIB 4HWHA 4HWDA 5AQSB 5AQLB 3LDQB 5AQNB 5AQGB 5AQOB 5AQPB 1M7KA
chains in the Genus database with same CATH superfamily
4U74A 2MYSA 3BQIA 2B1EA 4IDPA 2EHOB 5FVLA 2M6BA 4MHCA 3CWZB 2CXFA 3L39A 4KUMB 3RRWA 2KLQA 5F3JA 2LSGA 4YFSA 3NZQA 2UXDT 2W00A 5JQGE 4ERRA 1UUSA 3ZC0A 5LB7B 5C2TA 1UGOA 3PU8A 3ABVA 2BKNA 4LF5T 2X68A 4FJOA 4DR3T 4O2BE 3ESLA 4ZZCA 2UUBT 4WYVA 2BBJA 1HFAA 2LHRA 2OV9A 1T72A 3C98B 5AQQB 1VCTA 3VKHA 4I0UA 4A97A 1KEYA 5LOVE 2NW7A 3FXDB 5AQSB 1VRBA 3B57A 1R8IA 4IDNA 3RPUA 4HKAA 4LMLA 4X62T 3OKQA 3C50A 3C4WA 4YTMA 2PJQA 4DR2T 2ZM2A 1MMGA 3SRZA 4HFVA 1I94T 3ZKRA 5HEHA 2IIUA 1UX5A 2WDQA 4CI1B 2LKGA 1HTJF 3ANWB 4NIQA 5FXXA 2CE7A 2B76A 2VL0A 3KBUA 4AI6A 1N33T 5CA1E 1XMOT 5JTGA 5LNKA 5HWYA 5AQIB 2LRLA 2IUBA 4HN9A 3EDUA 3RIAA 2GK9A 2LOSA 2QGSA 4WBOA 2YDSA 4WNKA 1J1JA 1NENA 4IT4A 3IHRA 2V7IA 5HXRA 1IBMT 4DVDA 5LG4A 4EEBA 3EAMA 5EZYE 4H63V 2D0TA 3RIUC 3AE5A 4DIDB 1D0XA 3H3AA 2X9YA 4P0AA 4X5TA 5IWAT 2UXBT 4HWIB 4BA9A 1IBKT 3CX8B 4JV5T 2WM9A 5FNVE 3F31A 4AKRB 4QXBB 3MZKB 4JI8T 1VOMA 5ABGA 5JDNA 3VU7H 2LM2A 1N36T 3QB5K 5DJQC 4CZZB 4EZHA 3P50A 1MNEA 4H9RC 4MFRA 4DR6T 3GWHA 3ZMUB 4M1PA 1IJ6A 1OEDE 3CMLA 4XBFB 2MAWA 2BVMA 3ZT5A 3LG7A 2JPFA 5FXVA 3ZC1A 4HFHA 3N2OA 3U3IA 2XM1A 4OYJA 3A8YC 2V5DA 3FZKB 4QXHB 3PUQA 3D0TA 4ZHQE 2K3WA 2Q9QA 2F4VT 3RKGA 2EHOD 3ETVA 3JCFA 1Y01A 1QLBA 1HNXT 3RX6A 3MKDA 3K3NA 2A72A 2V5CA 3HA4A 3FB2A 1ZKEA 4ZS3A 3TLWA 3I9YA 3TLVA 2VL8A 4PK6A 2BBHA 3FZHB 4IHJE 5FP3A 3PUXF 1IZNB 2XUEA 3JAFA 4UF0A 4CI2B 3ZCJA 4KI0F 1KNRA 4YJ2E 3OTOT 4GKKT 2D5UA 2BG9E 2WY2A 4ISTA 4DR1T 3ZEFB 3VR9A 3AAEB 4U72A 2I0MA 2NW9A 3RRCA 4B3ST 4UIGA 2WB5A 3AEEA 4JYAT 3Q5EA 5L47A 1KK7A 2VVNA 3KV9A 3PV0F 3RYHE 3OJAA 2N9DA 3AA7B 3ZYLA 2LM9A 4QX7B 3CX6B 4H9SE 4ZEYA 2J47A 2W67A 2CM0A 5EK2A 4P1NA 5FL1A 5L2LA 2V7MA 4B3RT 2XAGB 4QH1A 5IHYA 2H88A 2MTQA 4DR7T 2YK0A 3CQCB 1OXZA 2OLTA 3ZMZB 5CJ5A 3L09A 3AVRA 3N9QA 2WWVA 2CBIA 4O4LE 3RQUA 3RYIE 5FXZA 3ZJ1A 5FVKA 1CUNA 4MLKA 3GA8A 1KFYA 4JI7T 3P4SA 4IL9A 4TWFA 4U7IA 4DUZT 1LVKA 2WMNA 5H6RB 3LFMA 2IMLA 3L8RA 3LDQB 1NAFA 4O4JE 2E5LT 4X65T 2SPCA 2WBLA 3ONJA 5AQFB 4YTPA 2NOXA 2ODVA 4EB6E 3I1AA 4IGUA 2LHNA 3CQGB 1HCIA 1WR0A 4HTEA 3DTOA 1S94A 1HG2A 1CHUA 3KV6A 1FJGT 3AE3A 3ZMSB 4JI5T 1MMAA 3ZJ2A 5FMNA 4QXCB 1FIOA 3UQ4A 3UU5A 3RGLA 3O1IA 2C5JA 2WZIA 3CIRA 5AQMB 4LFAT 2V7KA 5IYZE 3OYXA 2Y48B 2NW8A 3O9XA 3PURA 1MIYA 3RYFE 2FJAA 3TKLB 1BR1A 3PUAA 2K9AA 3Q9DA 5LGUB 4MALA 3VR8A 2CBJA 4LF7T 4UEMA 2XHEB 1WR6A 4LMJA 5LHIB 4JI3T 3TLUA 3X1DA 3I0QA 4U31A 2XSBA 5LGNB 3O1HA 1SA0E 2VKDA 2DWKA 4COFA 3EVYA 1D1BA 3KINB 2BVLA 5J2UE 2KT9A 2E5VA 3AB3B 3UTKA 3QOFA 3GMIA 4PNIA 1FMWA 3MXZA 2WP9A 3NBXX 2VVSA 3NRYA 5F5WA 3K1SA 4E7ZA 2Q9QC 3AA1B 1LVFA 3V5UA 3JADA 4X1IE 3CPZA 1Z8UA 3NRXA 3FHNA 2MBGA 2LSKA 2XQ3A 3ZN1B 2Q9QB 2HN2A 2XY8B 1YW0A 4YSZA 4Z91A 5HEJA 3AECA 2A3DA 3UFGA 5HCMA 2LLYA 5BMVE 3NWIA 2NR4A 3ZMTB 4F6RC 1O3XA 4GIWA 4OFZA 1X9BA 1QSDA 4TV9E 2R6GF 5J1GA 4KHZF 3CK6A 2NP9A 2XZEA 1GQEA 4AKGA 3AVSA 3UU4A 4H9QC 3R84B 2KMFA 3OVUA 2MPKA 1ZHCA 4AKHA 5E0OA 4C90A 1IJ5A 1WFDA 2LEHA 1XNQT 3MACA 3L3PA 5H6QB 3AE4A 3WI3A 4PFPA 5JRCA 3PU3A 2CHNA 4BJNA 4UF0B 5AQRB 3RF1A 2A9UA 4P0BA 5JH7E 1WLXA 3GN5A 4E7SA 1HF8A 2JQKA 3K3OA 2QVAA 3DJBA 4U7YA 1OEDA 4EYYR 3PUSA 4L9IA 5ABFA 3PUVF 4PJJA 3ZMVB 5AQLB 4A56A 4JBWF 1J5WA 1MNDA 3CVRA 4GOUA 4U2ZA 2UXCT 3A7MA 4HFBA 1YXRA 4ZOLE 2YDRA 4I50E 1W09A 2M67A 2WSSV 2W66A 5HAXA 3OYZA 4B3MT 1LKXA 2BDEA 4NXNT 2X0HA 3QK6A 5LJNA 1W0AA 4HFEA 3AA6B 2QA7A 4DNDA 4NPPA 4DV3T 1ZEEA 5C8YE 2CPTA 4UV9B 3RIFA 4ILAA 4CI3B 5KXJA 5L3DB 2BS4A 2ACXA 1YD8G 2FJBA 3ZT6A 3W15B 3PUGA 1FMVA 2JQ9A 3IA3A 5FXWA 5DQVA 5LBQB 3UULA 4MBQA 2LJLA 5HWXA 5HXHA 1T98A 4A5XA 4DUYT 3N9PA 2X9HA 4H9NC 2M6IA 2W63A 3AE2A 2YEVC 3TLSA 2WU2A 5JDFA 3SWHA 2XTLA 3BQKA 4GK5E 2JQQA 4HGAA 2RP4A 2ACZA 4DV1T 3KV4A 3ETUA 5HXEA 4TNWA 4CXYA 4AKIA 4LF9T 4PFOA 1UURA 2UUCT 1D0ZA 1W0BA 4AIUA 2VKOA 4XAXB 1AJ3A 2Q9QD 4ZI7E 2IHR1 2YKSA 2CWOA 1D0YA 2E9XA 3LK3B 5TAOA 3ZLIA 2CLYC 4U3CA 1HG5A 5JR9A 4F8HA 2XJ7A 2HPLA 4IL4A 1BR0A 1YQ4A 2LSJA 3ZPOA 1DU2A 5AQPB 4YTNA 3RC8A 1G8XA 5JDHA 4QHOA 4AXPA 4I55E 1HNWT 2H7OA 4ILCA 4TWDA 4IDZA 2W0GA 2W2UA 1J5ET 4UXNB 4ISSA 3N9NA 2D9DA 1UK5A 3AE7A 5HXSA 4WZXA 4TNVA 2PTFA 4DV5T 2QRXA 4DV6T 2C5KT 2NWBA 1YQ3A 3JAEA 2WCAA 5AQKB 1ZP0A 1KF6A 3N9LA 3PUZF 4YT0A 4ZI2C 3MK7C 5JVDE 4TN7B 2ZMAA 1XMQT 3LK42 4X66T 3AXJA 4YSXA 3HL6A 2WDRA 4QKNA 3FBZA 1NWMX 2NTYA 2XAFB 3H3MA 1BR2A 2Y6XA 4TX5A 1E1HB 2UXNB 3SFDA 3FZLB 4TWHA 5LJMA 4EIWA 5HYAA 2PG8A 2DWGA 4PJMA 3VHLA 4CQIA 4HEAA 2WAUA 3V5SA 1Z0PA 5HXCA 5FL0A 5FYMA 1YKEB 5LMNT 3HR0A 5JDLA 2L9QA 4HE8A 3G06A 2YU1A 5DQWA 3SS1A 4CXXA 5JRCB 4EGWA 1XZYA 5M4YA 4OYKA 1B7TA 5CFBA 3T8OA 1OEDC 3GN5B 2CXLA 4I4TE 2A2FX 4GK0E 2MOZA 1HS7A 3UUNA 5LP6E 4DV2T 1OEDB 5IUXA 2XQYA 2RPAA 3IBPA 1VCSA 1XNRT 3AEGA 2G0UA 5ABFB 1SE7A 3HKEE 3QNUA 2XAJB 3C51A 5HEUA 2JMHA 1U4QA 2N2NA 2V7JA 2JJ9A 5AQVB 1SHZC 2XPKA 3F2EA 2HPJA 2XAHB 3E0ZA 4H63H 4GYRA 4NUVA 4PJNA 2K24A 4OK0A 4YXDA 4LFCT 2LKHA 4IE6A 3Q5DA 5JDGA 3ZT7A 3KV5A 3OBVE 3PE0A 1IBLT 1T8BA 4J2CA 4L0RA 4LF8T 4IIJE 4UVCB 2DL1A 4JI4T 4U33A 5C3JA 5BR8T 2KXPB 4EAHA 3VKGA 2BG9C 2XQAA 2YN6A 5J0ZA 4LFBT 2N1GA 3P7IA 5FY0A 2IC6A 5LGTB 4QH4A 3U78A 5L4EA 2YU2A 4IE5A 2KINB 1NEKA 4N78D 4QWNB 4ADZA 1Y64B 2X0YA 4UV8B 3RH3A 3AE6A 2X66A 4ZXLA 3MA9A 2CEAA 1KNZA 1MIWA 2WDVA 3KBTA 4B6XA 3ZSSA 3EABA 2J62A 2V7LA 1H7CA 3AAAB 2DHRA 4ZI2D 2FJDA 3AE1A 3SOLA 3NZPA 1X79A 1W9RA 3N2GE 4FI5A 5AQJB 3T1YT 2E9XC 3Q5WA 3ZSTA 2LRKA 2VK9A 5JR9C 3J9X1 2YDQA 4GKJT 4PW8A 2I6HA 1HX8A 2E9XB 4XZCA 5JR9B 4IREA 4DV4T 2KZ7B 4ILUA 1MMNA 3N9MA 5JDQA 2IC9A 2LSYA 2HHHT 3AEAA 5LXTE 3K3QC 3T1HT 5ABEA 1OWAA 3S4UA 2BS2A 4KX6A 5HEOA 2BKOA 2K48A 2KWIB 2V6XA 1G73A 4JI6T 1WCRA 5AQHB 5ABHA 4IE0A 4CN1A 2XASB 2VKHA 4DMVA 3RLFF 4TZ4C 5KX5E 3IF8B 2DI4A 2IAKA 2XQ5A 2LT3A 4O2AE 3PJAJ 4K0UA 2L3LA 3I0OA 4QH5A 2KSRA 5EK3A 1XWMA 5LHGB 3MJXA 2IDOB 3AAIA 4IDQA 2DLRA 1U5PA 2ZM6T 4DV7T 5LG3A 4GYSA 3AXJB 4TUYE 2X0LB 4UELA 3Q5XA 1T7SA 3SFEA 3ZN0B 2H3RA 3M65A 4DMWA 1FEWA 3KVAA 3O1JA 1XDPA 2HN1A 3I9WA 4JUYA 5EK4A 3PUWF 4DV0T 2W61A 1XDOA 5L3GB 5AQNB 4UVBB 1QUUA 3FZMB 4WBNE 1UCUA 3ONXA 2C5IT 2YOEA 2W62A 4AQFA 2E2AA 3Q2MA 2ZM0A 3PUYF 4P09A 4KP3C 4AKLA 4JEUB 5LA6E 2P9BA 4LF6T 2FBWA 3AEFA 1D1CA 3P8CD 4K0KT 3EUHA 2WWUA 2VASA 4DBQA 4CN6A 2H7VC 2XM2A 2PBIA 2CHOA 3UU3A 3PTRB 5AQUB 5L3EB 4JI2T 5CB4E 4Z8XA 4ZI3C 4HFCA 2BG9A 3P4RA 4PK5A 4EEDA 3OPCA 4YHHT 3A5XA 2JMKA 1E2AA 2V8SV 3CKDA 3BQLA 3LJCA 1E7PA 4ZS2A 4TV8E 5LYJE 3C64A 3FZFB 1I6ZA 2XQ6A 2ES0A 2V6YA 4YJ3E 2D0UA 4HWDA 5JREA 3LBXA 2VURA 5CA0E 2CMRA 2UXXB 3JC6C 2XSAA 4O8SA 4X64T 1UX4A 1MMDA 4HFIA 3J7Yq 4BAYB 4HWHA 3AEBA 4LMKA 4X20E 2FJEA 1MIVA 2BS3A 1WRDA 3AE8A 4B3TT 3E08A 2JQHA 3EI0A 3FXEB 3N5LA 4HWCA 2C0SA 4PAGA 2WS3A 1N32T 2E9XD 5LHHB 3N2KE 2OA5A 2NTXA 4JI1T 4H9OC 2XQ9A 4ANJA 2D2SA 5FKYA 2EHOA 3K8PC 2CLYB 5J2TE 1JNZA 2VB6A 2QYWA 2WZHA 4JLEA 3AE9A 4C91A 2CA5A 3HKDE 3C4ZA 3P4PA 2DNXA 2AE9A 2WMOA 4YY3T 2PFVA 4AQYT 2V26A 3O4XE 2CRBA 4UR9A 4EZ4A 5L3BB 2Z6EA 5AFUL 2VQET 3H37A 3F57A 5LCYA 2L8KA 3VRBA 3B13A 2XQ4A 4G63A 5AQTB 4DO0A 5FY7A 3RQWA 4DBRA 2X9XA 4AQGA 3AEDA 2V1DB 3TLTA 2ODUA 3UUBA 4A98A 2W4XA 3HKBE 3UU6A 5L3FB 2VQFT 2J1DG 4JEHB 3UT5E 4IDOA 3ANWA 2KNDA 1WYBA 4H9PC 1IAPA 2LOPA 4IE4A 1D1AA 4ILBA 1L0VA 4CN4A 4Z90A 2WU5A 1M62A 2ZLYA 2XQ8A 1EZ3A 2Y8DA 2LSIA 5L4HA 4O4IE 2JIWA 1ZOYA 4KMCA 4JI0T 4HFDA 3C4XA 4V1Av 3QB5A 3UFEA 1KNPA 5GONE 4X1YE 3PDYA 5ADXL 2XAQB 1HNZT 3AA0B 3RKOA 2DCFA 2K5BB 3RIUA 3LSVA 4ZI3D 2ZM8A 2UUAT 3QUJA 5LMUT 5AQOB 3BK9A 1N34T 5DABA 5L3CB 1ZV4X 3RYCE 5ETWA 2UU9T 4OHFA 1HX1B 3UUXB 3RHWA 2BZBA 4YHJA 4U2YA 2IW5B 3KVBA 3RC3A 3QC9A 1M7KA 4EYUA 3WAKA 3B5MA 4PJLA 3CX7B 3FBLA 2BKPA 3E22E 4AQFC 3JC6D 4L5GA 2VKJA 3UUMA 3ZCIA 4DR4T 3N9OA 3M3ZB 3HKCE 1HR0T 1SUMB 3EDVA 1BR4A 3UU8A 4EXTA 4CXWA 3ZYMA 4X1KE 2XQ7A 2J4GA 5F8PA 3P4WA 1V9DA 3UQ7A 2KWHA 2CWYA 3EHZA 5FY1A 5AQGB 4YSYA 4KBMB 3LK2B 1YKHB 4LF4T 1JNRA 2I59A 3NKZA 2BG9B 4I43B 4UVAB 4AISA 5A1LA 4G2AA 4WW0A 4OX9T 2X9WA 3KDSE 5KDMC 3ZYKA 4ASKA 2E8IA 3DP7A 3KFWX 3CQXC 4Q25A 2JRKA 5CGMA 2V6YB 5KMGP 2VWAA 2HH7A 3R6NA 1WYCA 5JDMA 2AXDS 3LBXB 1LRZA 3RI5A 4O4HE 2CXDA 2CCQA 4ZZBA 2H89A 1S35A 3HI2A 3IEEA 3ONLC 4BJMA 4NXMT 4NUUA 2YINA 5HCJA 2X67A 4QX8B 4IE7A 3PJAA 4DR5T 5LBMA 4EOZB 4HWFA 2LE8A 3NVOA 4YLHA 4EV6A 3P4QA 2FUPA 4PK4A 2WQYA 1US7B 2RA1A 4KHPT 5HEGA 2X51A 3VRAA 2EHOC 3WAJA
chains in the Genus database with same CATH topology
1T7SA 2D9DA 1UK5A 3FZLB 3FZMB 4HWIB 5AQMB 5AQFB 4HWCA 4HWFA 5AQJB 1UGOA 5AQRB 1HX1B 5AQQB 3FZFB 1I6ZA 5AQUB 1M62A 5AQHB 5AQTB 3FZHB 5AQKB 3A8YC 3M3ZB 5AQVB 3FZKB 5AQIB 4HWHA 4HWDA 5AQSB 5AQLB 3LDQB 5AQNB 5AQGB 5AQOB 5AQPB 1M7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T7S A;  2D9D A;  1UK5 A;  3FZL B;  3FZM B;  4HWI B;  5AQM B;  5AQF B;  4HWC A;  4HWF A;  5AQJ B;  1UGO A;  5AQR B;  1HX1 B;  5AQQ B;  3FZF B;  1I6Z A;  5AQU B;  1M62 A;  5AQH B;  5AQT B;  3FZH B;  5AQK B;  3A8Y C;  3M3Z B;  5AQV B;  3FZK B;  5AQI B;  4HWH A;  4HWD A;  5AQS B;  5AQL B;  3LDQ B;  5AQN B;  5AQG B;  5AQO B;  5AQP B;  1M7K A; 
#chains in the Genus database with same CATH topology
 4U74 A;  2MYS A;  3BQI A;  2B1E A;  4IDP A;  2EHO B;  5FVL A;  2M6B A;  4MHC A;  3CWZ B;  2CXF A;  3L39 A;  4KUM B;  3RRW A;  2KLQ A;  5F3J A;  2LSG A;  4YFS A;  3NZQ A;  2UXD T;  2W00 A;  5JQG E;  4ERR A;  1UUS A;  3ZC0 A;  5LB7 B;  5C2T A;  1UGO A;  3PU8 A;  3ABV A;  2BKN A;  4LF5 T;  2X68 A;  4FJO A;  4DR3 T;  4O2B E;  3ESL A;  4ZZC A;  2UUB T;  4WYV A;  2BBJ A;  1HFA A;  2LHR A;  2OV9 A;  1T72 A;  3C98 B;  5AQQ B;  1VCT A;  3VKH A;  4I0U A;  4A97 A;  1KEY A;  5LOV E;  2NW7 A;  3FXD B;  5AQS B;  1VRB A;  3B57 A;  1R8I A;  4IDN A;  3RPU A;  4HKA A;  4LML A;  4X62 T;  3OKQ A;  3C50 A;  3C4W A;  4YTM A;  2PJQ A;  4DR2 T;  2ZM2 A;  1MMG A;  3SRZ A;  4HFV A;  1I94 T;  3ZKR A;  5HEH A;  2IIU A;  1UX5 A;  2WDQ A;  4CI1 B;  2LKG A;  1HTJ F;  3ANW B;  4NIQ A;  5FXX A;  2CE7 A;  2B76 A;  2VL0 A;  3KBU A;  4AI6 A;  1N33 T;  5CA1 E;  1XMO T;  5JTG A;  5LNK A;  5HWY A;  5AQI B;  2LRL A;  2IUB A;  4HN9 A;  3EDU A;  3RIA A;  2GK9 A;  2LOS A;  2QGS A;  4WBO A;  2YDS A;  4WNK A;  1J1J A;  1NEN A;  4IT4 A;  3IHR A;  2V7I A;  5HXR A;  1IBM T;  4DVD A;  5LG4 A;  4EEB A;  3EAM A;  5EZY E;  4H63 V;  2D0T A;  3RIU C;  3AE5 A;  4DID B;  1D0X A;  3H3A A;  2X9Y A;  4P0A A;  4X5T A;  5IWA T;  2UXB T;  4HWI B;  4BA9 A;  1IBK T;  3CX8 B;  4JV5 T;  2WM9 A;  5FNV E;  3F31 A;  4AKR B;  4QXB B;  3MZK B;  4JI8 T;  1VOM A;  5ABG A;  5JDN A;  3VU7 H;  2LM2 A;  1N36 T;  3QB5 K;  5DJQ C;  4CZZ B;  4EZH A;  3P50 A;  1MNE A;  4H9R C;  4MFR A;  4DR6 T;  3GWH A;  3ZMU B;  4M1P A;  1IJ6 A;  1OED E;  3CML A;  4XBF B;  2MAW A;  2BVM A;  3ZT5 A;  3LG7 A;  2JPF A;  5FXV A;  3ZC1 A;  4HFH A;  3N2O A;  3U3I A;  2XM1 A;  4OYJ A;  3A8Y C;  2V5D A;  3FZK B;  4QXH B;  3PUQ A;  3D0T A;  4ZHQ E;  2K3W A;  2Q9Q A;  2F4V T;  3RKG A;  2EHO D;  3ETV A;  3JCF A;  1Y01 A;  1QLB A;  1HNX T;  3RX6 A;  3MKD A;  3K3N A;  2A72 A;  2V5C A;  3HA4 A;  3FB2 A;  1ZKE A;  4ZS3 A;  3TLW A;  3I9Y A;  3TLV A;  2VL8 A;  4PK6 A;  2BBH A;  3FZH B;  4IHJ E;  5FP3 A;  3PUX F;  1IZN B;  2XUE A;  3JAF A;  4UF0 A;  4CI2 B;  3ZCJ A;  4KI0 F;  1KNR A;  4YJ2 E;  3OTO T;  4GKK T;  2D5U A;  2BG9 E;  2WY2 A;  4IST A;  4DR1 T;  3ZEF B;  3VR9 A;  3AAE B;  4U72 A;  2I0M A;  2NW9 A;  3RRC A;  4B3S T;  4UIG A;  2WB5 A;  3AEE A;  4JYA T;  3Q5E A;  5L47 A;  1KK7 A;  2VVN A;  3KV9 A;  3PV0 F;  3RYH E;  3OJA A;  2N9D A;  3AA7 B;  3ZYL A;  2LM9 A;  4QX7 B;  3CX6 B;  4H9S E;  4ZEY A;  2J47 A;  2W67 A;  2CM0 A;  5EK2 A;  4P1N A;  5FL1 A;  5L2L A;  2V7M A;  4B3R T;  2XAG B;  4QH1 A;  5IHY A;  2H88 A;  2MTQ A;  4DR7 T;  2YK0 A;  3CQC B;  1OXZ A;  2OLT A;  3ZMZ B;  5CJ5 A;  3L09 A;  3AVR A;  3N9Q A;  2WWV A;  2CBI A;  4O4L E;  3RQU A;  3RYI E;  5FXZ A;  3ZJ1 A;  5FVK A;  1CUN A;  4MLK A;  3GA8 A;  1KFY A;  4JI7 T;  3P4S A;  4IL9 A;  4TWF A;  4U7I A;  4DUZ T;  1LVK A;  2WMN A;  5H6R B;  3LFM A;  2IML A;  3L8R A;  3LDQ B;  1NAF A;  4O4J E;  2E5L T;  4X65 T;  2SPC A;  2WBL A;  3ONJ A;  5AQF B;  4YTP A;  2NOX A;  2ODV A;  4EB6 E;  3I1A A;  4IGU A;  2LHN A;  3CQG B;  1HCI A;  1WR0 A;  4HTE A;  3DTO A;  1S94 A;  1HG2 A;  1CHU A;  3KV6 A;  1FJG T;  3AE3 A;  3ZMS B;  4JI5 T;  1MMA A;  3ZJ2 A;  5FMN A;  4QXC B;  1FIO A;  3UQ4 A;  3UU5 A;  3RGL A;  3O1I A;  2C5J A;  2WZI A;  3CIR A;  5AQM B;  4LFA T;  2V7K A;  5IYZ E;  3OYX A;  2Y48 B;  2NW8 A;  3O9X A;  3PUR A;  1MIY A;  3RYF E;  2FJA A;  3TKL B;  1BR1 A;  3PUA A;  2K9A A;  3Q9D A;  5LGU B;  4MAL A;  3VR8 A;  2CBJ A;  4LF7 T;  4UEM A;  2XHE B;  1WR6 A;  4LMJ A;  5LHI B;  4JI3 T;  3TLU A;  3X1D A;  3I0Q A;  4U31 A;  2XSB A;  5LGN B;  3O1H A;  1SA0 E;  2VKD A;  2DWK A;  4COF A;  3EVY A;  1D1B A;  3KIN B;  2BVL A;  5J2U E;  2KT9 A;  2E5V A;  3AB3 B;  3UTK A;  3QOF A;  3GMI A;  4PNI A;  1FMW A;  3MXZ A;  2WP9 A;  3NBX X;  2VVS A;  3NRY A;  5F5W A;  3K1S A;  4E7Z A;  2Q9Q C;  3AA1 B;  1LVF A;  3V5U A;  3JAD A;  4X1I E;  3CPZ A;  1Z8U A;  3NRX A;  3FHN A;  2MBG A;  2LSK A;  2XQ3 A;  3ZN1 B;  2Q9Q B;  2HN2 A;  2XY8 B;  1YW0 A;  4YSZ A;  4Z91 A;  5HEJ A;  3AEC A;  2A3D A;  3UFG A;  5HCM A;  2LLY A;  5BMV E;  3NWI A;  2NR4 A;  3ZMT B;  4F6R C;  1O3X A;  4GIW A;  4OFZ A;  1X9B A;  1QSD A;  4TV9 E;  2R6G F;  5J1G A;  4KHZ F;  3CK6 A;  2NP9 A;  2XZE A;  1GQE A;  4AKG A;  3AVS A;  3UU4 A;  4H9Q C;  3R84 B;  2KMF A;  3OVU A;  2MPK A;  1ZHC A;  4AKH A;  5E0O A;  4C90 A;  1IJ5 A;  1WFD A;  2LEH A;  1XNQ T;  3MAC A;  3L3P A;  5H6Q B;  3AE4 A;  3WI3 A;  4PFP A;  5JRC A;  3PU3 A;  2CHN A;  4BJN A;  4UF0 B;  5AQR B;  3RF1 A;  2A9U A;  4P0B A;  5JH7 E;  1WLX A;  3GN5 A;  4E7S A;  1HF8 A;  2JQK A;  3K3O A;  2QVA A;  3DJB A;  4U7Y A;  1OED A;  4EYY R;  3PUS A;  4L9I A;  5ABF A;  3PUV F;  4PJJ A;  3ZMV B;  5AQL B;  4A56 A;  4JBW F;  1J5W A;  1MND A;  3CVR A;  4GOU A;  4U2Z A;  2UXC T;  3A7M A;  4HFB A;  1YXR A;  4ZOL E;  2YDR A;  4I50 E;  1W09 A;  2M67 A;  2WSS V;  2W66 A;  5HAX A;  3OYZ A;  4B3M T;  1LKX A;  2BDE A;  4NXN T;  2X0H A;  3QK6 A;  5LJN A;  1W0A A;  4HFE A;  3AA6 B;  2QA7 A;  4DND A;  4NPP A;  4DV3 T;  1ZEE A;  5C8Y E;  2CPT A;  4UV9 B;  3RIF A;  4ILA A;  4CI3 B;  5KXJ A;  5L3D B;  2BS4 A;  2ACX A;  1YD8 G;  2FJB A;  3ZT6 A;  3W15 B;  3PUG A;  1FMV A;  2JQ9 A;  3IA3 A;  5FXW A;  5DQV A;  5LBQ B;  3UUL A;  4MBQ A;  2LJL A;  5HWX A;  5HXH A;  1T98 A;  4A5X A;  4DUY T;  3N9P A;  2X9H A;  4H9N C;  2M6I A;  2W63 A;  3AE2 A;  2YEV C;  3TLS A;  2WU2 A;  5JDF A;  3SWH A;  2XTL A;  3BQK A;  4GK5 E;  2JQQ A;  4HGA A;  2RP4 A;  2ACZ A;  4DV1 T;  3KV4 A;  3ETU A;  5HXE A;  4TNW A;  4CXY A;  4AKI A;  4LF9 T;  4PFO A;  1UUR A;  2UUC T;  1D0Z A;  1W0B A;  4AIU A;  2VKO A;  4XAX B;  1AJ3 A;  2Q9Q D;  4ZI7 E;  2IHR 1;  2YKS A;  2CWO A;  1D0Y A;  2E9X A;  3LK3 B;  5TAO A;  3ZLI A;  2CLY C;  4U3C A;  1HG5 A;  5JR9 A;  4F8H A;  2XJ7 A;  2HPL A;  4IL4 A;  1BR0 A;  1YQ4 A;  2LSJ A;  3ZPO A;  1DU2 A;  5AQP B;  4YTN A;  3RC8 A;  1G8X A;  5JDH A;  4QHO A;  4AXP A;  4I55 E;  1HNW T;  2H7O A;  4ILC A;  4TWD A;  4IDZ A;  2W0G A;  2W2U A;  1J5E T;  4UXN B;  4ISS A;  3N9N A;  2D9D A;  1UK5 A;  3AE7 A;  5HXS A;  4WZX A;  4TNV A;  2PTF A;  4DV5 T;  2QRX A;  4DV6 T;  2C5K T;  2NWB A;  1YQ3 A;  3JAE A;  2WCA A;  5AQK B;  1ZP0 A;  1KF6 A;  3N9L A;  3PUZ F;  4YT0 A;  4ZI2 C;  3MK7 C;  5JVD E;  4TN7 B;  2ZMA A;  1XMQ T;  3LK4 2;  4X66 T;  3AXJ A;  4YSX A;  3HL6 A;  2WDR A;  4QKN A;  3FBZ A;  1NWM X;  2NTY A;  2XAF B;  3H3M A;  1BR2 A;  2Y6X A;  4TX5 A;  1E1H B;  2UXN B;  3SFD A;  3FZL B;  4TWH A;  5LJM A;  4EIW A;  5HYA A;  2PG8 A;  2DWG A;  4PJM A;  3VHL A;  4CQI A;  4HEA A;  2WAU A;  3V5S A;  1Z0P A;  5HXC A;  5FL0 A;  5FYM A;  1YKE B;  5LMN T;  3HR0 A;  5JDL A;  2L9Q A;  4HE8 A;  3G06 A;  2YU1 A;  5DQW A;  3SS1 A;  4CXX A;  5JRC B;  4EGW A;  1XZY A;  5M4Y A;  4OYK A;  1B7T A;  5CFB A;  3T8O A;  1OED C;  3GN5 B;  2CXL A;  4I4T E;  2A2F X;  4GK0 E;  2MOZ A;  1HS7 A;  3UUN A;  5LP6 E;  4DV2 T;  1OED B;  5IUX A;  2XQY A;  2RPA A;  3IBP A;  1VCS A;  1XNR T;  3AEG A;  2G0U A;  5ABF B;  1SE7 A;  3HKE E;  3QNU A;  2XAJ B;  3C51 A;  5HEU A;  2JMH A;  1U4Q A;  2N2N A;  2V7J A;  2JJ9 A;  5AQV B;  1SHZ C;  2XPK A;  3F2E A;  2HPJ A;  2XAH B;  3E0Z A;  4H63 H;  4GYR A;  4NUV A;  4PJN A;  2K24 A;  4OK0 A;  4YXD A;  4LFC T;  2LKH A;  4IE6 A;  3Q5D A;  5JDG A;  3ZT7 A;  3KV5 A;  3OBV E;  3PE0 A;  1IBL T;  1T8B A;  4J2C A;  4L0R A;  4LF8 T;  4IIJ E;  4UVC B;  2DL1 A;  4JI4 T;  4U33 A;  5C3J A;  5BR8 T;  2KXP B;  4EAH A;  3VKG A;  2BG9 C;  2XQA A;  2YN6 A;  5J0Z A;  4LFB T;  2N1G A;  3P7I A;  5FY0 A;  2IC6 A;  5LGT B;  4QH4 A;  3U78 A;  5L4E A;  2YU2 A;  4IE5 A;  2KIN B;  1NEK A;  4N78 D;  4QWN B;  4ADZ A;  1Y64 B;  2X0Y A;  4UV8 B;  3RH3 A;  3AE6 A;  2X66 A;  4ZXL A;  3MA9 A;  2CEA A;  1KNZ A;  1MIW A;  2WDV A;  3KBT A;  4B6X A;  3ZSS A;  3EAB A;  2J62 A;  2V7L A;  1H7C A;  3AAA B;  2DHR A;  4ZI2 D;  2FJD A;  3AE1 A;  3SOL A;  3NZP A;  1X79 A;  1W9R A;  3N2G E;  4FI5 A;  5AQJ B;  3T1Y T;  2E9X C;  3Q5W A;  3ZST A;  2LRK A;  2VK9 A;  5JR9 C;  3J9X 1;  2YDQ A;  4GKJ T;  4PW8 A;  2I6H A;  1HX8 A;  2E9X B;  4XZC A;  5JR9 B;  4IRE A;  4DV4 T;  2KZ7 B;  4ILU A;  1MMN A;  3N9M A;  5JDQ A;  2IC9 A;  2LSY A;  2HHH T;  3AEA A;  5LXT E;  3K3Q C;  3T1H T;  5ABE A;  1OWA A;  3S4U A;  2BS2 A;  4KX6 A;  5HEO A;  2BKO A;  2K48 A;  2KWI B;  2V6X A;  1G73 A;  4JI6 T;  1WCR A;  5AQH B;  5ABH A;  4IE0 A;  4CN1 A;  2XAS B;  2VKH A;  4DMV A;  3RLF F;  4TZ4 C;  5KX5 E;  3IF8 B;  2DI4 A;  2IAK A;  2XQ5 A;  2LT3 A;  4O2A E;  3PJA J;  4K0U A;  2L3L A;  3I0O A;  4QH5 A;  2KSR A;  5EK3 A;  1XWM A;  5LHG B;  3MJX A;  2IDO B;  3AAI A;  4IDQ A;  2DLR A;  1U5P A;  2ZM6 T;  4DV7 T;  5LG3 A;  4GYS A;  3AXJ B;  4TUY E;  2X0L B;  4UEL A;  3Q5X A;  1T7S A;  3SFE A;  3ZN0 B;  2H3R A;  3M65 A;  4DMW A;  1FEW A;  3KVA A;  3O1J A;  1XDP A;  2HN1 A;  3I9W A;  4JUY A;  5EK4 A;  3PUW F;  4DV0 T;  2W61 A;  1XDO A;  5L3G B;  5AQN B;  4UVB B;  1QUU A;  3FZM B;  4WBN E;  1UCU A;  3ONX A;  2C5I T;  2YOE A;  2W62 A;  4AQF A;  2E2A A;  3Q2M A;  2ZM0 A;  3PUY F;  4P09 A;  4KP3 C;  4AKL A;  4JEU B;  5LA6 E;  2P9B A;  4LF6 T;  2FBW A;  3AEF A;  1D1C A;  3P8C D;  4K0K T;  3EUH A;  2WWU A;  2VAS A;  4DBQ A;  4CN6 A;  2H7V C;  2XM2 A;  2PBI A;  2CHO A;  3UU3 A;  3PTR B;  5AQU B;  5L3E B;  4JI2 T;  5CB4 E;  4Z8X A;  4ZI3 C;  4HFC A;  2BG9 A;  3P4R A;  4PK5 A;  4EED A;  3OPC A;  4YHH T;  3A5X A;  2JMK A;  1E2A A;  2V8S V;  3CKD A;  3BQL A;  3LJC A;  1E7P A;  4ZS2 A;  4TV8 E;  5LYJ E;  3C64 A;  3FZF B;  1I6Z A;  2XQ6 A;  2ES0 A;  2V6Y A;  4YJ3 E;  2D0U A;  4HWD A;  5JRE A;  3LBX A;  2VUR A;  5CA0 E;  2CMR A;  2UXX B;  3JC6 C;  2XSA A;  4O8S A;  4X64 T;  1UX4 A;  1MMD A;  4HFI A;  3J7Y q;  4BAY B;  4HWH A;  3AEB A;  4LMK A;  4X20 E;  2FJE A;  1MIV A;  2BS3 A;  1WRD A;  3AE8 A;  4B3T T;  3E08 A;  2JQH A;  3EI0 A;  3FXE B;  3N5L A;  4HWC A;  2C0S A;  4PAG A;  2WS3 A;  1N32 T;  2E9X D;  5LHH B;  3N2K E;  2OA5 A;  2NTX A;  4JI1 T;  4H9O C;  2XQ9 A;  4ANJ A;  2D2S A;  5FKY A;  2EHO A;  3K8P C;  2CLY B;  5J2T E;  1JNZ A;  2VB6 A;  2QYW A;  2WZH A;  4JLE A;  3AE9 A;  4C91 A;  2CA5 A;  3HKD E;  3C4Z A;  3P4P A;  2DNX A;  2AE9 A;  2WMO A;  4YY3 T;  2PFV A;  4AQY T;  2V26 A;  3O4X E;  2CRB A;  4UR9 A;  4EZ4 A;  5L3B B;  2Z6E A;  5AFU L;  2VQE T;  3H37 A;  3F57 A;  5LCY A;  2L8K A;  3VRB A;  3B13 A;  2XQ4 A;  4G63 A;  5AQT B;  4DO0 A;  5FY7 A;  3RQW A;  4DBR A;  2X9X A;  4AQG A;  3AED A;  2V1D B;  3TLT A;  2ODU A;  3UUB A;  4A98 A;  2W4X A;  3HKB E;  3UU6 A;  5L3F B;  2VQF T;  2J1D G;  4JEH B;  3UT5 E;  4IDO A;  3ANW A;  2KND A;  1WYB A;  4H9P C;  1IAP A;  2LOP A;  4IE4 A;  1D1A A;  4ILB A;  1L0V A;  4CN4 A;  4Z90 A;  2WU5 A;  1M62 A;  2ZLY A;  2XQ8 A;  1EZ3 A;  2Y8D A;  2LSI A;  5L4H A;  4O4I E;  2JIW A;  1ZOY A;  4KMC A;  4JI0 T;  4HFD A;  3C4X A;  4V1A v;  3QB5 A;  3UFE A;  1KNP A;  5GON E;  4X1Y E;  3PDY A;  5ADX L;  2XAQ B;  1HNZ T;  3AA0 B;  3RKO A;  2DCF A;  2K5B B;  3RIU A;  3LSV A;  4ZI3 D;  2ZM8 A;  2UUA T;  3QUJ A;  5LMU T;  5AQO B;  3BK9 A;  1N34 T;  5DAB A;  5L3C B;  1ZV4 X;  3RYC E;  5ETW A;  2UU9 T;  4OHF A;  1HX1 B;  3UUX B;  3RHW A;  2BZB A;  4YHJ A;  4U2Y A;  2IW5 B;  3KVB A;  3RC3 A;  3QC9 A;  1M7K A;  4EYU A;  3WAK A;  3B5M A;  4PJL A;  3CX7 B;  3FBL A;  2BKP A;  3E22 E;  4AQF C;  3JC6 D;  4L5G A;  2VKJ A;  3UUM A;  3ZCI A;  4DR4 T;  3N9O A;  3M3Z B;  3HKC E;  1HR0 T;  1SUM B;  3EDV A;  1BR4 A;  3UU8 A;  4EXT A;  4CXW A;  3ZYM A;  4X1K E;  2XQ7 A;  2J4G A;  5F8P A;  3P4W A;  1V9D A;  3UQ7 A;  2KWH A;  2CWY A;  3EHZ A;  5FY1 A;  5AQG B;  4YSY A;  4KBM B;  3LK2 B;  1YKH B;  4LF4 T;  1JNR A;  2I59 A;  3NKZ A;  2BG9 B;  4I43 B;  4UVA B;  4AIS A;  5A1L A;  4G2A A;  4WW0 A;  4OX9 T;  2X9W A;  3KDS E;  5KDM C;  3ZYK A;  4ASK A;  2E8I A;  3DP7 A;  3KFW X;  3CQX C;  4Q25 A;  2JRK A;  5CGM A;  2V6Y B;  5KMG P;  2VWA A;  2HH7 A;  3R6N A;  1WYC A;  5JDM A;  2AXD S;  3LBX B;  1LRZ A;  3RI5 A;  4O4H E;  2CXD A;  2CCQ A;  4ZZB A;  2H89 A;  1S35 A;  3HI2 A;  3IEE A;  3ONL C;  4BJM A;  4NXM T;  4NUU A;  2YIN A;  5HCJ A;  2X67 A;  4QX8 B;  4IE7 A;  3PJA A;  4DR5 T;  5LBM A;  4EOZ B;  4HWF A;  2LE8 A;  3NVO A;  4YLH A;  4EV6 A;  3P4Q A;  2FUP A;  4PK4 A;  2WQY A;  1US7 B;  2RA1 A;  4KHP T;  5HEG A;  2X51 A;  3VRA A;  2EHO C;  3WAJ A; 
#chains in the Genus database with same CATH homology
 1T7S A;  2D9D A;  1UK5 A;  3FZL B;  3FZM B;  4HWI B;  5AQM B;  5AQF B;  4HWC A;  4HWF A;  5AQJ B;  1UGO A;  5AQR B;  1HX1 B;  5AQQ B;  3FZF B;  1I6Z A;  5AQU B;  1M62 A;  5AQH B;  5AQT B;  3FZH B;  5AQK B;  3A8Y C;  3M3Z B;  5AQV B;  3FZK B;  5AQI B;  4HWH A;  4HWD A;  5AQS B;  5AQL B;  3LDQ B;  5AQN B;  5AQG B;  5AQO B;  5AQP B;  1M7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...