1UGOA

Solution structure of the first murine bag domain of bcl2-associated athanogene 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Bcl2-associated athanogene 5
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1ugoA00
4HWHA 3M3ZB 5AQJB 5AQIB 4HWCA 1M7KA 1I6ZA 1T7SA 3FZMB 2D9DA 5AQHB 3A8YC 3FZKB 5AQUB 3LDQB 5AQSB 5AQFB 3FZFB 5AQVB 1UK5A 4HWDA 1HX1B 4HWIB 5AQPB 5AQRB 5AQQB 5AQOB 5AQKB 1M62A 3FZHB 4HWFA 3FZLB 5AQMB 5AQNB 5AQGB 1UGOA 5AQLB 5AQTB
chains in the Genus database with same CATH superfamily
4HE8A 1N36T 3C50A 3OJAA 2QGSA 1XNQT 2LOSA 4ZS2A 4LF5T 3FB2A 1WR0A 4BA9A 3JC6C 3NRYA 4H9QC 4B3TT 2PBIA 1KEYA 4DBRA 1S94A 3L8RA 3OTOT 1MMGA 3RHWA 4H9OC 4GYRA 1G8XA 3O4XE 5LG4A 2KINB 2WMNA 1KNPA 4HN9A 1M62A 4YFSA 2XJ7A 3UU6A 3LK42 5HEUA 2SPCA 2D5UA 5DJQC 4LF4T 1FMVA 1W09A 1YW0A 1CHUA 4PFPA 5HXEA 4DR1T 2C5IT 1MIYA 1B7TA 5AQMB 2W62A 4QXHB 2CHOA 3CMLA 3TLWA 4HKAA 4PJNA 4ZEYA 4B3MT 4XZCA 5FKYA 3P4PA 3V5UA 3PUYF 1N33T 3N5LA 4O2AE 3PUAA 1T72A 5LBQB 4EYYR 1ZKEA 1XZYA 1VCSA 4MBQA 4DR7T 3L39A 2DI4A 4KX6A 2HPJA 2W4XA 1QSDA 2UXCT 4K0UA 5AQVB 3CIRA 2YEVC 4O4HE 4OFZA 4E7SA 5LGUB 5FY1A 5HEHA 3O9XA 1NEKA 2YDQA 2Q9QB 4ZI3C 3MA9A 2HPLA 2JQHA 3P4SA 4TNVA 2CXFA 4JI8T 3VHLA 5J2TE 3UQ7A 2D0UA 4DR5T 1SE7A 5FXWA 4DUYT 5LHGB 1ZP0A 2YINA 3S4UA 2KNDA 5BR8T 3KINB 5JREA 2KWHA 3P8CD 4YSZA 3PUSA 2LHNA 2B76A 2NW7A 5HXRA 3NVOA 4HWCA 4I55E 2VQET 3RYCE 4NXMT 3AEDA 3RQUA 2WDVA 3CPZA 2FJEA 2JRKA 4AIUA 2X0LB 5ETWA 2V7MA 4U31A 4EOZB 1WCRA 2XQ9A 4H9PC 3QNUA 4Z91A 4CI2B 3J9X1 2LE8A 3VU7H 4C90A 5AQNB 3NZQA 5AQTB 2XPKA 3ONLC 5KDMC 1J1JA 5FNVE 4O4LE 3EABA 5FYMA 4JEHB 3AE2A 4QXBB 2ODVA 3UFEA 4PFOA 4EIWA 5CA1E 2WZIA 2CWOA 5AQPB 4JUYA 4LMJA 3I0QA 4X1YE 2F4VT 2RP4A 3N2GE 2FJAA 3Q5WA 4B3ST 3Q5EA 3AEGA 3N9PA 2H7VC 4ZZBA 5HXHA 3A8YC 4U74A 3C98B 2H89A 4PJJA 3P4QA 3UULA 5IWAT 2UUBT 2BKOA 5AQJB 5HWXA 2XAFB 5ABGA 2H3RA 2I6HA 3ONJA 5LB7B 1HCIA 1Z8UA 5LBMA 2E2AA 3AE4A 4DVDA 3Q5XA 5EK4A 3AA0B 2UUAT 5AQKB 2EHOA 3RIUC 1XMQT 2CPTA 5HCJA 2E9XC 1WLXA 2BG9B 3PU8A 4LFCT 4EZHA 2JQQA 4L9IA 3AE9A 3F57A 4PNIA 2QRXA 4IGUA 4DV1T 4TWFA 4YHHT 5AQLB 4QH5A 1D0XA 1EZ3A 2V6YA 4DV6T 1D1BA 3VRBA 2OLTA 4QWNB 1LKXA 3AEFA 3B5MA 3EVYA 3VRAA 4H9SE 3UUMA 2X0YA 2JMKA 3TLSA 2CA5A 2XQYA 2W2UA 2X9HA 4YXDA 3ZMVB 3FZMB 2HN1A 2ZM0A 4X20E 4P1NA 1U5PA 4TWDA 4TN7B 1Y64B 1UUSA 2IDOB 2D0TA 1MMNA 2VK9A 1D0YA 4JI3T 2VWAA 2C5KT 3PTRB 3RRCA 2BG9A 3H3MA 3ZLIA 3QC9A 2XASB 3Q2MA 3AA1B 2NTYA 3ZYMA 2DWGA 4GOUA 2VKOA 3UU5A 2ZLYA 5CA0E 4KP3C 3WAKA 3OYZA 4ERRA 5L3EB 4L0RA 1WYCA 4GKKT 4DV5T 1MNEA 2XQ5A 2XQ8A 1HR0T 2LOPA 2QYWA 4NIQA 2L3LA 2J47A 3N2OA 3RRWA 2J4GA 3PJAJ 2XAQB 2X68A 2WP9A 3CQXC 1QUUA 4DR6T 3D0TA 2X9YA 3PUXF 2W66A 4IDZA 2E9XB 1FMWA 2WBLA 2X67A 5L3DB 3AECA 4NUUA 3LG7A 2DCFA 4ZXLA 1LVFA 4HGAA 4U72A 3ESLA 1HTJF 2YU2A 3AE1A 3ZKRA 2LJLA 1YKEB 5DQWA 4DR3T 2X0HA 2YOEA 1H7CA 3BQLA 2FUPA 3A7MA 3N9MA 1MIWA 1KK7A 2V5DA 5LOVE 2ZMAA 1HNZT 4H63V 5LMNT 2OA5A 2CCQA 5L4EA 2LSJA 3QB5A 2B1EA 1NWMX 3BQIA 4OK0A 4CXXA 2KMFA 3ZCJA 4BAYB 4CI3B 3T1YT 3ANWA 4WW0A 2BG9E 4PK6A 4JV5T 4IE7A 3B13A 4EAHA 5L3CB 4TUYE 2J62A 4OX9T 4TX5A 1XWMA 4H63H 5M4YA 2C0SA 5LA6E 2UXBT 3ETVA 2Q9QC 2MYSA 4MLKA 2N2NA 2BS2A 3Q5DA 3ZMTB 2YK0A 2WB5A 3B57A 4EB6E 3F2EA 3PJAA 2BBHA 2JPFA 5E0OA 4A97A 2UUCT 1XDPA 4ANJA 3MKDA 2V5CA 2E5LT 3HI2A 1IZNB 4DV7T 5AQRB 4TNWA 5JRCA 4X1KE 1OWAA 2IC6A 4IE0A 2NR4A 4AKRB 5L4HA 5FY0A 1BR0A 3O1HA 3CK6A 3AE7A 3P7IA 5LJMA 3RX6A 2NW9A 3IA3A 5FXZA 2Z6EA 2EHOC 4PJLA 2VL0A 5FY7A 5LNKA 2VKHA 5KMGP 4WYVA 5IUXA 4JI2T 1IJ5A 2NP9A 3AEBA 3HKEE 1IAPA 1XDOA 3FZHB 2CHNA 3SS1A 2CWYA 2CXLA 5CJ5A 2ACZA 1I94T 3PDYA 3UQ4A 3LK3B 1OXZA 2WQYA 3C4WA 3UUXB 2XQ7A 5HEGA 3O1JA 2LEHA 2WDRA 4A98A 3VR8A 4N78D 4GK5E 2BZBA 3ONXA 3L3PA 4DV3T 1UX5A 3DJBA 2NW8A 3CKDA 3CX6B 2YDRA 2A9UA 3AAAB 4KUMB 5LYJE 1WYBA 5ABHA 2KZ7B 2CLYB 1FEWA 1E1HB 2I59A 2FJDA 3R84B 5EK2A 1UGOA 3RYIE 4IE4A 4JI4T 2LRLA 3K8PC 3CVRA 4YJ2E 3EUHA 2AE9A 2A3DA 2N9DA 2YN6A 4F6RC 2KT9A 3LJCA 4YLHA 2BG9C 1YKHB 5HAXA 4LMKA 5CB4E 4IDOA 2MAWA 4ZZCA 4ILCA 3UFGA 4YHJA 1FIOA 5BMVE 4HFEA 5FL0A 3ZN0B 1KNZA 1V9DA 4U3CA 3AEEA 4UEMA 3P50A 2Y48B 2BS3A 3K3OA 2V1DB 4X65T 3IBPA 2J1DG 1XMOT 2CXDA 3UU3A 4YY3T 3FHNA 2V26A 2DLRA 4ISTA 2XTLA 2CEAA 1D0ZA 2EHOB 2IAKA 3HKBE 5EZYE 3RKGA 2JMHA 3ZC1A 1VCTA 5CFBA 3IEEA 2VB6A 2MOZA 2XSBA 3UUBA 2E8IA 2UU9T 5KXJA 2PJQA 3KVAA 5AQUB 1QLBA 1XNRT 4HWIB 4PAGA 5JR9A 1BR4A 3GWHA 3IHRA 3PUGA 2MPKA 5KX5E 4LMLA 4ZHQE 2V6YB 4JI5T 2M6IA 1Z0PA 5LHHB 2YDSA 3RIFA 2WU2A 3CX8B 3ZPOA 3SRZA 4YSYA 4ZI2D 3ZMSB 3W15B 4HFVA 1GQEA 3MACA 2LT3A 2XHEB 3RKOA 2DNXA 1SHZC 3H37A 3KV4A 3PE0A 3PUWF 3R6NA 2RPAA 5GONE 2XUEA 4DR2T 3FZLB 3AAIA 5IHYA 3EDUA 2BVMA 3ZCIA 3AB3B 4JEUB 4ZS3A 3OYXA 3I0OA 1CUNA 1OEDB 2ACXA 4AQYT 5HXSA 2IUBA 2HHHT 1T98A 5IYZE 1WFDA 2VKJA 4JLEA 3I9YA 2Q9QD 5L3BB 4UV9B 3HKCE 4I50E 4JI6T 2WDQA 4IE6A 3CQGB 4B6XA 3U78A 3N2KE 4BJNA 2WWUA 2XY8B 2LKGA 2IHR1 4AKIA 1VRBA 4IT4A 4UF0B 3VKHA 4UVCB 3NBXX 3JC6D 2A2FX 4UIGA 2BVLA 5C3JA 5AQOB 4YTMA 4CN1A 4AI6A 1MIVA 2C5JA 3GA8A 1HNXT 3N9LA 4ILAA 1LVKA 3UU8A 4XAXB 3AE3A 2V7KA 3G06A 4UXNB 3C51A 1OEDA 1NENA 2V7IA 4U7YA 2CM0A 2V8SV 2H7OA 2RA1A 3E22E 3OKQA 3I1AA 2VVNA 5LJNA 4ZI7E 4AKLA 4OYJA 2UXDT 2YKSA 4QX8B 3CWZB 1KFYA 1US7B 4YT0A 4Z8XA 3RQWA 4B3RT 4DV2T 3ANWB 5JDQA 4PJMA 4IL4A 1HFAA 3E0ZA 4UF0A 1MMDA 4LF7T 1YD8G 1X9BA 4UR9A 3ZYKA 2H88A 5JDHA 4V1Av 5JDNA 2PG8A 2LM2A 4LFAT 4AQFA 3EI0A 1W9RA 2X9WA 2LHRA 1MMAA 1IJ6A 2KLQA 3N9NA 4EEBA 3AE5A 4AQGA 4ZI3D 3WAJA 2XAJB 2XQ3A 3ZN1B 4DV4T 4DNDA 2FJBA 5JRCB 1BR1A 5JDLA 4EXTA 3K3NA 1T8BA 5HCMA 3RI5A 3K3QC 3JCFA 2LSYA 3RLFF 4OHFA 5EK3A 4WBOA 3RYFE 5L47A 2I0MA 3EHZA 2ZM2A 3LK2B 1OEDE 3UU4A 4UVBB 2MBGA 3HL6A 2LLYA 3DP7A 1D1AA 3MK7C 4H9RC 2CLYC 3ZT5A 4G63A 4A5XA 4DV0T 2DWKA 4EGWA 2IIUA 3LDQB 3C64A 3AXJA 2IMLA 4GYSA 3JAEA 3Q9DA 4O4JE 5JR9C 4MALA 4XBFB 1IBLT 2K24A 1M7KA 3GN5A 4IREA 3P4WA 4IHJE 4CN4A 4FJOA 2CMRA 3NKZA 4YJ3E 3J7Yq 4IDNA 5FMNA 4UVAB 3ZC0A 4ILUA 3VKGA 3OBVE 2VL8A 1IBMT 1YXRA 3M3ZB 4JI7T 3TLTA 4QKNA 2WS3A 4JI1T 4HEAA 5F3JA 4IIJE 3ZMZB 1BR2A 2BDEA 2MTQA 5LGTB 2JQKA 1SUMB 3ZT7A 2XQ4A 2CBJA 3C4ZA 2LSGA 4O8SA 3ZYLA 3C4XA 4NPPA 5FL1A 2AXDS 1L0VA 5JTGA 1G73A 1ZHCA 1IBKT 1AJ3A 2KXPB 1HX1B 2XAGB 3RC8A 3PU3A 4UELA 2W67A 5H6RB 4CZZB 2VQFT 2E9XD 5ADXL 4DR4T 3QOFA 3SFEA 4F8HA 3QB5K 2X66A 1HG5A 3JADA 1J5ET 3PURA 3LBXA 3HKDE 1N32T 4WBNE 1J5WA 5AQHB 4I43B 2WAUA 4IDPA 4A56A 4X64T 3ZEFB 3LSVA 3O1IA 3RYHE 5JQGE 1FJGT 4P0BA 3H3AA 3RF1A 5AFUL 2VVSA 4X5TA 4GKJT 3EAMA 2BBJA 4ILBA 3RIAA 1I6ZA 2IW5B 4IL9A 2NOXA 4HFHA 2JJ9A 3ABVA 2X9XA 3KVBA 3KDSE 3MXZA 5JR9B 4DO0A 5FXXA 1YQ3A 2VASA 2K9AA 1OEDC 3E08A 2HH7A 3FBZA 3QK6A 3MJXA 5HXCA 4KHPT 4KI0F 4O2BE 1UK5A 2M6BA 4NXNT 2ZM8A 3M65A 3AEAA 3IF8B 5CGMA 4EV6A 2XQ6A 2WWVA 5DABA 4JYAT 3AAEB 3NRXA 2XM1A 4EEDA 4I0UA 5F8PA 1Y01A 5AQQB 4YSXA 2A72A 2UXXB 3X1DA 4EYUA 4C91A 2E5VA 4DBQA 5AQGB 4ADZA 3RH3A 3WI3A 4J2CA 1DU2A 4AQFC 2PTFA 2V7LA 1WRDA 4KHZF 3AA7B 1ZEEA 4KMCA 1HS7A 4M1PA 1JNRA 2K48A 2K3WA 2D2SA 4KBMB 2Q9QA 4TV8E 2BKPA 2BKNA 5JDFA 1UCUA 4P09A 2X51A 4JBWF 4ASKA 4HFIA 3NZPA 1NAFA 2R6GF 2CRBA 2V7JA 3GMIA 5JDMA 5HWYA 2UXNB 2W63A 4WNKA 3MZKB 3V5SA 1VOMA 3BK9A 5JH7E 3FZFB 5FP3A 1HNWT 2FBWA 2WY2A 4PW8A 5C2TA 3KFWX 1R8IA 1YQ4A 2LSKA 3OPCA 1HF8A 3FXDB 1W0AA 1U4QA 2QA7A 2ES0A 2Y8DA 5J0ZA 2N1GA 2DHRA 2YU1A 5AQFB 5HYAA 4HWDA 3KBUA 2LSIA 4H9NC 4GIWA 3ETUA 4PK5A 2W0GA 5A1LA 4X66T 4U2ZA 4CXYA 5LMUT 1HX8A 1O3XA 5L2LA 5J1GA 5LG3A 2JQ9A 1ZOYA 2IC9A 4BJMA 3SWHA 3PUVF 4AISA 3TLVA 1KF6A 3KV6A 5F5WA 3K1SA 3PV0F 4JI0T 4LFBT 5TAOA 2XM2A 4GK0E 3FZKB 2ODUA 4YTPA 3NWIA 4HTEA 4CI1B 4DMVA 3N9QA 4CN6A 5JDGA 2KWIB 4EZ4A 2LRKA 4OYKA 3TKLB 5L3FB 4ISSA 1N34T 5FVKA 2NWBA 2NTXA 5AQIB 2WSSV 3KV9A 3SFDA 2XAHB 1UURA 2KSRA 5JVDE 4LF9T 3ZJ1A 3AVSA 3RC3A 3U3IA 2JIWA 2XSAA 3EDVA 2EHOD 4HWHA 4NUVA 2HN2A 2OV9A 4FI5A 4DUZT 5AQSB 1W0BA 3HA4A 4UV8B 4HFBA 4U2YA 3HR0A 4QHOA 4U7IA 5J2UE 2CE7A 4LF6T 4G2AA 2BS4A 1WR6A 2DL1A 4QXCB 2CBIA 3PUQA 2Y6XA 5HEOA 4TZ4C 1E7PA 4PK4A 3QUJA 3UUNA 5L3GB 1HG2A 4Q25A 5HEJA 3SOLA 4CXWA 4AXPA 2WZHA 4IDQA 1E2AA 4ZOLE 4X62T 2M67A 4TWHA 2ZM6T 3A5XA 3TLUA 1KNRA 4MHCA 4HFDA 2PFVA 3AXJB 5LHIB 3N9OA 3RGLA 5ABFB 2WCAA 3UT5E 1UX4A 4MFRA 4I4TE 4WZXA 3ZSSA 2XZEA 1MNDA 3AE6A 5LP6E 3GN5B 3KBTA 4QH4A 2K5BB 5LXTE 3UTKA 1S35A 5DQVA 2D9DA 5H6QB 3OVUA 5C8YE 4E7ZA 3P4RA 2LM9A 4ZI2C 2L9QA 3KV5A 1SA0E 3PUZF 2WU5A 4HWFA 2W61A 1ZV4X 2P9BA 3ZJ2A 2GK9A 1X79A 1JNZA 4DMWA 3FBLA 3DTOA 2VURA 3T1HT 4COFA 3FXEB 2W00A 4QX7B 4AKHA 3ZT6A 4O4IE 3ZSTA 2L8KA 3CQCB 4CQIA 3CX7B 5LCYA 2WMOA 3I9WA 2G0UA 2XQAA 1T7SA 4Z90A 5FVLA 3L09A 2V6XA 4L5GA 4YTNA 2WM9A 4LF8T 4TV9E 3RIUA 5ABFA 3VR9A 1LRZA 3LFMA 4AKGA 5LGNB 1D1CA 2QVAA 3BQKA 4QH1A 2E9XA 2VKDA 3AVRA 4U33A 3ZMUB 5ABEA 2LKHA 3F31A 3AA6B 4DIDB 4K0KT 4IE5A 5FXVA 4P0AA 3RPUA 3T8OA 3LBXB 3AE8A 4HFCA 4X1IE 3JAFA
chains in the Genus database with same CATH topology
4HWHA 3M3ZB 5AQJB 5AQIB 4HWCA 1M7KA 1I6ZA 1T7SA 3FZMB 2D9DA 5AQHB 3A8YC 3FZKB 5AQUB 3LDQB 5AQSB 5AQFB 3FZFB 5AQVB 1UK5A 4HWDA 1HX1B 4HWIB 5AQPB 5AQRB 5AQQB 5AQOB 5AQKB 1M62A 3FZHB 4HWFA 3FZLB 5AQMB 5AQNB 5AQGB 1UGOA 5AQLB 5AQTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWH A;  3M3Z B;  5AQJ B;  5AQI B;  4HWC A;  1M7K A;  1I6Z A;  1T7S A;  3FZM B;  2D9D A;  5AQH B;  3A8Y C;  3FZK B;  5AQU B;  3LDQ B;  5AQS B;  5AQF B;  3FZF B;  5AQV B;  1UK5 A;  4HWD A;  1HX1 B;  4HWI B;  5AQP B;  5AQR B;  5AQQ B;  5AQO B;  5AQK B;  1M62 A;  3FZH B;  4HWF A;  3FZL B;  5AQM B;  5AQN B;  5AQG B;  1UGO A;  5AQL B;  5AQT B; 
#chains in the Genus database with same CATH topology
 4HE8 A;  1N36 T;  3C50 A;  3OJA A;  2QGS A;  1XNQ T;  2LOS A;  4ZS2 A;  4LF5 T;  3FB2 A;  1WR0 A;  4BA9 A;  3JC6 C;  3NRY A;  4H9Q C;  4B3T T;  2PBI A;  1KEY A;  4DBR A;  1S94 A;  3L8R A;  3OTO T;  1MMG A;  3RHW A;  4H9O C;  4GYR A;  1G8X A;  3O4X E;  5LG4 A;  2KIN B;  2WMN A;  1KNP A;  4HN9 A;  1M62 A;  4YFS A;  2XJ7 A;  3UU6 A;  3LK4 2;  5HEU A;  2SPC A;  2D5U A;  5DJQ C;  4LF4 T;  1FMV A;  1W09 A;  1YW0 A;  1CHU A;  4PFP A;  5HXE A;  4DR1 T;  2C5I T;  1MIY A;  1B7T A;  5AQM B;  2W62 A;  4QXH B;  2CHO A;  3CML A;  3TLW A;  4HKA A;  4PJN A;  4ZEY A;  4B3M T;  4XZC A;  5FKY A;  3P4P A;  3V5U A;  3PUY F;  1N33 T;  3N5L A;  4O2A E;  3PUA A;  1T72 A;  5LBQ B;  4EYY R;  1ZKE A;  1XZY A;  1VCS A;  4MBQ A;  4DR7 T;  3L39 A;  2DI4 A;  4KX6 A;  2HPJ A;  2W4X A;  1QSD A;  2UXC T;  4K0U A;  5AQV B;  3CIR A;  2YEV C;  4O4H E;  4OFZ A;  4E7S A;  5LGU B;  5FY1 A;  5HEH A;  3O9X A;  1NEK A;  2YDQ A;  2Q9Q B;  4ZI3 C;  3MA9 A;  2HPL A;  2JQH A;  3P4S A;  4TNV A;  2CXF A;  4JI8 T;  3VHL A;  5J2T E;  3UQ7 A;  2D0U A;  4DR5 T;  1SE7 A;  5FXW A;  4DUY T;  5LHG B;  1ZP0 A;  2YIN A;  3S4U A;  2KND A;  5BR8 T;  3KIN B;  5JRE A;  2KWH A;  3P8C D;  4YSZ A;  3PUS A;  2LHN A;  2B76 A;  2NW7 A;  5HXR A;  3NVO A;  4HWC A;  4I55 E;  2VQE T;  3RYC E;  4NXM T;  3AED A;  3RQU A;  2WDV A;  3CPZ A;  2FJE A;  2JRK A;  4AIU A;  2X0L B;  5ETW A;  2V7M A;  4U31 A;  4EOZ B;  1WCR A;  2XQ9 A;  4H9P C;  3QNU A;  4Z91 A;  4CI2 B;  3J9X 1;  2LE8 A;  3VU7 H;  4C90 A;  5AQN B;  3NZQ A;  5AQT B;  2XPK A;  3ONL C;  5KDM C;  1J1J A;  5FNV E;  4O4L E;  3EAB A;  5FYM A;  4JEH B;  3AE2 A;  4QXB B;  2ODV A;  3UFE A;  4PFO A;  4EIW A;  5CA1 E;  2WZI A;  2CWO A;  5AQP B;  4JUY A;  4LMJ A;  3I0Q A;  4X1Y E;  2F4V T;  2RP4 A;  3N2G E;  2FJA A;  3Q5W A;  4B3S T;  3Q5E A;  3AEG A;  3N9P A;  2H7V C;  4ZZB A;  5HXH A;  3A8Y C;  4U74 A;  3C98 B;  2H89 A;  4PJJ A;  3P4Q A;  3UUL A;  5IWA T;  2UUB T;  2BKO A;  5AQJ B;  5HWX A;  2XAF B;  5ABG A;  2H3R A;  2I6H A;  3ONJ A;  5LB7 B;  1HCI A;  1Z8U A;  5LBM A;  2E2A A;  3AE4 A;  4DVD A;  3Q5X A;  5EK4 A;  3AA0 B;  2UUA T;  5AQK B;  2EHO A;  3RIU C;  1XMQ T;  2CPT A;  5HCJ A;  2E9X C;  1WLX A;  2BG9 B;  3PU8 A;  4LFC T;  4EZH A;  2JQQ A;  4L9I A;  3AE9 A;  3F57 A;  4PNI A;  2QRX A;  4IGU A;  4DV1 T;  4TWF A;  4YHH T;  5AQL B;  4QH5 A;  1D0X A;  1EZ3 A;  2V6Y A;  4DV6 T;  1D1B A;  3VRB A;  2OLT A;  4QWN B;  1LKX A;  3AEF A;  3B5M A;  3EVY A;  3VRA A;  4H9S E;  3UUM A;  2X0Y A;  2JMK A;  3TLS A;  2CA5 A;  2XQY A;  2W2U A;  2X9H A;  4YXD A;  3ZMV B;  3FZM B;  2HN1 A;  2ZM0 A;  4X20 E;  4P1N A;  1U5P A;  4TWD A;  4TN7 B;  1Y64 B;  1UUS A;  2IDO B;  2D0T A;  1MMN A;  2VK9 A;  1D0Y A;  4JI3 T;  2VWA A;  2C5K T;  3PTR B;  3RRC A;  2BG9 A;  3H3M A;  3ZLI A;  3QC9 A;  2XAS B;  3Q2M A;  3AA1 B;  2NTY A;  3ZYM A;  2DWG A;  4GOU A;  2VKO A;  3UU5 A;  2ZLY A;  5CA0 E;  4KP3 C;  3WAK A;  3OYZ A;  4ERR A;  5L3E B;  4L0R A;  1WYC A;  4GKK T;  4DV5 T;  1MNE A;  2XQ5 A;  2XQ8 A;  1HR0 T;  2LOP A;  2QYW A;  4NIQ A;  2L3L A;  2J47 A;  3N2O A;  3RRW A;  2J4G A;  3PJA J;  2XAQ B;  2X68 A;  2WP9 A;  3CQX C;  1QUU A;  4DR6 T;  3D0T A;  2X9Y A;  3PUX F;  2W66 A;  4IDZ A;  2E9X B;  1FMW A;  2WBL A;  2X67 A;  5L3D B;  3AEC A;  4NUU A;  3LG7 A;  2DCF A;  4ZXL A;  1LVF A;  4HGA A;  4U72 A;  3ESL A;  1HTJ F;  2YU2 A;  3AE1 A;  3ZKR A;  2LJL A;  1YKE B;  5DQW A;  4DR3 T;  2X0H A;  2YOE A;  1H7C A;  3BQL A;  2FUP A;  3A7M A;  3N9M A;  1MIW A;  1KK7 A;  2V5D A;  5LOV E;  2ZMA A;  1HNZ T;  4H63 V;  5LMN T;  2OA5 A;  2CCQ A;  5L4E A;  2LSJ A;  3QB5 A;  2B1E A;  1NWM X;  3BQI A;  4OK0 A;  4CXX A;  2KMF A;  3ZCJ A;  4BAY B;  4CI3 B;  3T1Y T;  3ANW A;  4WW0 A;  2BG9 E;  4PK6 A;  4JV5 T;  4IE7 A;  3B13 A;  4EAH A;  5L3C B;  4TUY E;  2J62 A;  4OX9 T;  4TX5 A;  1XWM A;  4H63 H;  5M4Y A;  2C0S A;  5LA6 E;  2UXB T;  3ETV A;  2Q9Q C;  2MYS A;  4MLK A;  2N2N A;  2BS2 A;  3Q5D A;  3ZMT B;  2YK0 A;  2WB5 A;  3B57 A;  4EB6 E;  3F2E A;  3PJA A;  2BBH A;  2JPF A;  5E0O A;  4A97 A;  2UUC T;  1XDP A;  4ANJ A;  3MKD A;  2V5C A;  2E5L T;  3HI2 A;  1IZN B;  4DV7 T;  5AQR B;  4TNW A;  5JRC A;  4X1K E;  1OWA A;  2IC6 A;  4IE0 A;  2NR4 A;  4AKR B;  5L4H A;  5FY0 A;  1BR0 A;  3O1H A;  3CK6 A;  3AE7 A;  3P7I A;  5LJM A;  3RX6 A;  2NW9 A;  3IA3 A;  5FXZ A;  2Z6E A;  2EHO C;  4PJL A;  2VL0 A;  5FY7 A;  5LNK A;  2VKH A;  5KMG P;  4WYV A;  5IUX A;  4JI2 T;  1IJ5 A;  2NP9 A;  3AEB A;  3HKE E;  1IAP A;  1XDO A;  3FZH B;  2CHN A;  3SS1 A;  2CWY A;  2CXL A;  5CJ5 A;  2ACZ A;  1I94 T;  3PDY A;  3UQ4 A;  3LK3 B;  1OXZ A;  2WQY A;  3C4W A;  3UUX B;  2XQ7 A;  5HEG A;  3O1J A;  2LEH A;  2WDR A;  4A98 A;  3VR8 A;  4N78 D;  4GK5 E;  2BZB A;  3ONX A;  3L3P A;  4DV3 T;  1UX5 A;  3DJB A;  2NW8 A;  3CKD A;  3CX6 B;  2YDR A;  2A9U A;  3AAA B;  4KUM B;  5LYJ E;  1WYB A;  5ABH A;  2KZ7 B;  2CLY B;  1FEW A;  1E1H B;  2I59 A;  2FJD A;  3R84 B;  5EK2 A;  1UGO A;  3RYI E;  4IE4 A;  4JI4 T;  2LRL A;  3K8P C;  3CVR A;  4YJ2 E;  3EUH A;  2AE9 A;  2A3D A;  2N9D A;  2YN6 A;  4F6R C;  2KT9 A;  3LJC A;  4YLH A;  2BG9 C;  1YKH B;  5HAX A;  4LMK A;  5CB4 E;  4IDO A;  2MAW A;  4ZZC A;  4ILC A;  3UFG A;  4YHJ A;  1FIO A;  5BMV E;  4HFE A;  5FL0 A;  3ZN0 B;  1KNZ A;  1V9D A;  4U3C A;  3AEE A;  4UEM A;  3P50 A;  2Y48 B;  2BS3 A;  3K3O A;  2V1D B;  4X65 T;  3IBP A;  2J1D G;  1XMO T;  2CXD A;  3UU3 A;  4YY3 T;  3FHN A;  2V26 A;  2DLR A;  4IST A;  2XTL A;  2CEA A;  1D0Z A;  2EHO B;  2IAK A;  3HKB E;  5EZY E;  3RKG A;  2JMH A;  3ZC1 A;  1VCT A;  5CFB A;  3IEE A;  2VB6 A;  2MOZ A;  2XSB A;  3UUB A;  2E8I A;  2UU9 T;  5KXJ A;  2PJQ A;  3KVA A;  5AQU B;  1QLB A;  1XNR T;  4HWI B;  4PAG A;  5JR9 A;  1BR4 A;  3GWH A;  3IHR A;  3PUG A;  2MPK A;  5KX5 E;  4LML A;  4ZHQ E;  2V6Y B;  4JI5 T;  2M6I A;  1Z0P A;  5LHH B;  2YDS A;  3RIF A;  2WU2 A;  3CX8 B;  3ZPO A;  3SRZ A;  4YSY A;  4ZI2 D;  3ZMS B;  3W15 B;  4HFV A;  1GQE A;  3MAC A;  2LT3 A;  2XHE B;  3RKO A;  2DNX A;  1SHZ C;  3H37 A;  3KV4 A;  3PE0 A;  3PUW F;  3R6N A;  2RPA A;  5GON E;  2XUE A;  4DR2 T;  3FZL B;  3AAI A;  5IHY A;  3EDU A;  2BVM A;  3ZCI A;  3AB3 B;  4JEU B;  4ZS3 A;  3OYX A;  3I0O A;  1CUN A;  1OED B;  2ACX A;  4AQY T;  5HXS A;  2IUB A;  2HHH T;  1T98 A;  5IYZ E;  1WFD A;  2VKJ A;  4JLE A;  3I9Y A;  2Q9Q D;  5L3B B;  4UV9 B;  3HKC E;  4I50 E;  4JI6 T;  2WDQ A;  4IE6 A;  3CQG B;  4B6X A;  3U78 A;  3N2K E;  4BJN A;  2WWU A;  2XY8 B;  2LKG A;  2IHR 1;  4AKI A;  1VRB A;  4IT4 A;  4UF0 B;  3VKH A;  4UVC B;  3NBX X;  3JC6 D;  2A2F X;  4UIG A;  2BVL A;  5C3J A;  5AQO B;  4YTM A;  4CN1 A;  4AI6 A;  1MIV A;  2C5J A;  3GA8 A;  1HNX T;  3N9L A;  4ILA A;  1LVK A;  3UU8 A;  4XAX B;  3AE3 A;  2V7K A;  3G06 A;  4UXN B;  3C51 A;  1OED A;  1NEN A;  2V7I A;  4U7Y A;  2CM0 A;  2V8S V;  2H7O A;  2RA1 A;  3E22 E;  3OKQ A;  3I1A A;  2VVN A;  5LJN A;  4ZI7 E;  4AKL A;  4OYJ A;  2UXD T;  2YKS A;  4QX8 B;  3CWZ B;  1KFY A;  1US7 B;  4YT0 A;  4Z8X A;  3RQW A;  4B3R T;  4DV2 T;  3ANW B;  5JDQ A;  4PJM A;  4IL4 A;  1HFA A;  3E0Z A;  4UF0 A;  1MMD A;  4LF7 T;  1YD8 G;  1X9B A;  4UR9 A;  3ZYK A;  2H88 A;  5JDH A;  4V1A v;  5JDN A;  2PG8 A;  2LM2 A;  4LFA T;  4AQF A;  3EI0 A;  1W9R A;  2X9W A;  2LHR A;  1MMA A;  1IJ6 A;  2KLQ A;  3N9N A;  4EEB A;  3AE5 A;  4AQG A;  4ZI3 D;  3WAJ A;  2XAJ B;  2XQ3 A;  3ZN1 B;  4DV4 T;  4DND A;  2FJB A;  5JRC B;  1BR1 A;  5JDL A;  4EXT A;  3K3N A;  1T8B A;  5HCM A;  3RI5 A;  3K3Q C;  3JCF A;  2LSY A;  3RLF F;  4OHF A;  5EK3 A;  4WBO A;  3RYF E;  5L47 A;  2I0M A;  3EHZ A;  2ZM2 A;  3LK2 B;  1OED E;  3UU4 A;  4UVB B;  2MBG A;  3HL6 A;  2LLY A;  3DP7 A;  1D1A A;  3MK7 C;  4H9R C;  2CLY C;  3ZT5 A;  4G63 A;  4A5X A;  4DV0 T;  2DWK A;  4EGW A;  2IIU A;  3LDQ B;  3C64 A;  3AXJ A;  2IML A;  4GYS A;  3JAE A;  3Q9D A;  4O4J E;  5JR9 C;  4MAL A;  4XBF B;  1IBL T;  2K24 A;  1M7K A;  3GN5 A;  4IRE A;  3P4W A;  4IHJ E;  4CN4 A;  4FJO A;  2CMR A;  3NKZ A;  4YJ3 E;  3J7Y q;  4IDN A;  5FMN A;  4UVA B;  3ZC0 A;  4ILU A;  3VKG A;  3OBV E;  2VL8 A;  1IBM T;  1YXR A;  3M3Z B;  4JI7 T;  3TLT A;  4QKN A;  2WS3 A;  4JI1 T;  4HEA A;  5F3J A;  4IIJ E;  3ZMZ B;  1BR2 A;  2BDE A;  2MTQ A;  5LGT B;  2JQK A;  1SUM B;  3ZT7 A;  2XQ4 A;  2CBJ A;  3C4Z A;  2LSG A;  4O8S A;  3ZYL A;  3C4X A;  4NPP A;  5FL1 A;  2AXD S;  1L0V A;  5JTG A;  1G73 A;  1ZHC A;  1IBK T;  1AJ3 A;  2KXP B;  1HX1 B;  2XAG B;  3RC8 A;  3PU3 A;  4UEL A;  2W67 A;  5H6R B;  4CZZ B;  2VQF T;  2E9X D;  5ADX L;  4DR4 T;  3QOF A;  3SFE A;  4F8H A;  3QB5 K;  2X66 A;  1HG5 A;  3JAD A;  1J5E T;  3PUR A;  3LBX A;  3HKD E;  1N32 T;  4WBN E;  1J5W A;  5AQH B;  4I43 B;  2WAU A;  4IDP A;  4A56 A;  4X64 T;  3ZEF B;  3LSV A;  3O1I A;  3RYH E;  5JQG E;  1FJG T;  4P0B A;  3H3A A;  3RF1 A;  5AFU L;  2VVS A;  4X5T A;  4GKJ T;  3EAM A;  2BBJ A;  4ILB A;  3RIA A;  1I6Z A;  2IW5 B;  4IL9 A;  2NOX A;  4HFH A;  2JJ9 A;  3ABV A;  2X9X A;  3KVB A;  3KDS E;  3MXZ A;  5JR9 B;  4DO0 A;  5FXX A;  1YQ3 A;  2VAS A;  2K9A A;  1OED C;  3E08 A;  2HH7 A;  3FBZ A;  3QK6 A;  3MJX A;  5HXC A;  4KHP T;  4KI0 F;  4O2B E;  1UK5 A;  2M6B A;  4NXN T;  2ZM8 A;  3M65 A;  3AEA A;  3IF8 B;  5CGM A;  4EV6 A;  2XQ6 A;  2WWV A;  5DAB A;  4JYA T;  3AAE B;  3NRX A;  2XM1 A;  4EED A;  4I0U A;  5F8P A;  1Y01 A;  5AQQ B;  4YSX A;  2A72 A;  2UXX B;  3X1D A;  4EYU A;  4C91 A;  2E5V A;  4DBQ A;  5AQG B;  4ADZ A;  3RH3 A;  3WI3 A;  4J2C A;  1DU2 A;  4AQF C;  2PTF A;  2V7L A;  1WRD A;  4KHZ F;  3AA7 B;  1ZEE A;  4KMC A;  1HS7 A;  4M1P A;  1JNR A;  2K48 A;  2K3W A;  2D2S A;  4KBM B;  2Q9Q A;  4TV8 E;  2BKP A;  2BKN A;  5JDF A;  1UCU A;  4P09 A;  2X51 A;  4JBW F;  4ASK A;  4HFI A;  3NZP A;  1NAF A;  2R6G F;  2CRB A;  2V7J A;  3GMI A;  5JDM A;  5HWY A;  2UXN B;  2W63 A;  4WNK A;  3MZK B;  3V5S A;  1VOM A;  3BK9 A;  5JH7 E;  3FZF B;  5FP3 A;  1HNW T;  2FBW A;  2WY2 A;  4PW8 A;  5C2T A;  3KFW X;  1R8I A;  1YQ4 A;  2LSK A;  3OPC A;  1HF8 A;  3FXD B;  1W0A A;  1U4Q A;  2QA7 A;  2ES0 A;  2Y8D A;  5J0Z A;  2N1G A;  2DHR A;  2YU1 A;  5AQF B;  5HYA A;  4HWD A;  3KBU A;  2LSI A;  4H9N C;  4GIW A;  3ETU A;  4PK5 A;  2W0G A;  5A1L A;  4X66 T;  4U2Z A;  4CXY A;  5LMU T;  1HX8 A;  1O3X A;  5L2L A;  5J1G A;  5LG3 A;  2JQ9 A;  1ZOY A;  2IC9 A;  4BJM A;  3SWH A;  3PUV F;  4AIS A;  3TLV A;  1KF6 A;  3KV6 A;  5F5W A;  3K1S A;  3PV0 F;  4JI0 T;  4LFB T;  5TAO A;  2XM2 A;  4GK0 E;  3FZK B;  2ODU A;  4YTP A;  3NWI A;  4HTE A;  4CI1 B;  4DMV A;  3N9Q A;  4CN6 A;  5JDG A;  2KWI B;  4EZ4 A;  2LRK A;  4OYK A;  3TKL B;  5L3F B;  4ISS A;  1N34 T;  5FVK A;  2NWB A;  2NTX A;  5AQI B;  2WSS V;  3KV9 A;  3SFD A;  2XAH B;  1UUR A;  2KSR A;  5JVD E;  4LF9 T;  3ZJ1 A;  3AVS A;  3RC3 A;  3U3I A;  2JIW A;  2XSA A;  3EDV A;  2EHO D;  4HWH A;  4NUV A;  2HN2 A;  2OV9 A;  4FI5 A;  4DUZ T;  5AQS B;  1W0B A;  3HA4 A;  4UV8 B;  4HFB A;  4U2Y A;  3HR0 A;  4QHO A;  4U7I A;  5J2U E;  2CE7 A;  4LF6 T;  4G2A A;  2BS4 A;  1WR6 A;  2DL1 A;  4QXC B;  2CBI A;  3PUQ A;  2Y6X A;  5HEO A;  4TZ4 C;  1E7P A;  4PK4 A;  3QUJ A;  3UUN A;  5L3G B;  1HG2 A;  4Q25 A;  5HEJ A;  3SOL A;  4CXW A;  4AXP A;  2WZH A;  4IDQ A;  1E2A A;  4ZOL E;  4X62 T;  2M67 A;  4TWH A;  2ZM6 T;  3A5X A;  3TLU A;  1KNR A;  4MHC A;  4HFD A;  2PFV A;  3AXJ B;  5LHI B;  3N9O A;  3RGL A;  5ABF B;  2WCA A;  3UT5 E;  1UX4 A;  4MFR A;  4I4T E;  4WZX A;  3ZSS A;  2XZE A;  1MND A;  3AE6 A;  5LP6 E;  3GN5 B;  3KBT A;  4QH4 A;  2K5B B;  5LXT E;  3UTK A;  1S35 A;  5DQV A;  2D9D A;  5H6Q B;  3OVU A;  5C8Y E;  4E7Z A;  3P4R A;  2LM9 A;  4ZI2 C;  2L9Q A;  3KV5 A;  1SA0 E;  3PUZ F;  2WU5 A;  4HWF A;  2W61 A;  1ZV4 X;  2P9B A;  3ZJ2 A;  2GK9 A;  1X79 A;  1JNZ A;  4DMW A;  3FBL A;  3DTO A;  2VUR A;  3T1H T;  4COF A;  3FXE B;  2W00 A;  4QX7 B;  4AKH A;  3ZT6 A;  4O4I E;  3ZST A;  2L8K A;  3CQC B;  4CQI A;  3CX7 B;  5LCY A;  2WMO A;  3I9W A;  2G0U A;  2XQA A;  1T7S A;  4Z90 A;  5FVL A;  3L09 A;  2V6X A;  4L5G A;  4YTN A;  2WM9 A;  4LF8 T;  4TV9 E;  3RIU A;  5ABF A;  3VR9 A;  1LRZ A;  3LFM A;  4AKG A;  5LGN B;  1D1C A;  2QVA A;  3BQK A;  4QH1 A;  2E9X A;  2VKD A;  3AVR A;  4U33 A;  3ZMU B;  5ABE A;  2LKH A;  3F31 A;  3AA6 B;  4DID B;  4K0K T;  4IE5 A;  5FXV A;  4P0A A;  3RPU A;  3T8O A;  3LBX B;  3AE8 A;  4HFC A;  4X1I E;  3JAF A; 
#chains in the Genus database with same CATH homology
 4HWH A;  3M3Z B;  5AQJ B;  5AQI B;  4HWC A;  1M7K A;  1I6Z A;  1T7S A;  3FZM B;  2D9D A;  5AQH B;  3A8Y C;  3FZK B;  5AQU B;  3LDQ B;  5AQS B;  5AQF B;  3FZF B;  5AQV B;  1UK5 A;  4HWD A;  1HX1 B;  4HWI B;  5AQP B;  5AQR B;  5AQQ B;  5AQO B;  5AQK B;  1M62 A;  3FZH B;  4HWF A;  3FZL B;  5AQM B;  5AQN B;  5AQG B;  1UGO A;  5AQL B;  5AQT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...