1UGOA

Solution structure of the first murine bag domain of bcl2-associated athanogene 5
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
99
structure length
99
Chain Sequence
GSSGSSGMDMGNQHPSISRLQEIQREVKAIEPQVVGFSGLSDDKNYKRLERILTKQLFEIDSVDTEGKGDIQQARKRAAQETERLLKELEQNASGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The C-terminal BAG domain of BAG5 induces conformational changes of the Hsp70 nucleotide-binding domain for ADP-ATP exchange
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords Bcl2-associated athanogene 5
total genus 26
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2003-06-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 1ugoA00
5AQGB 1UGOA 5AQRB 1M62A 5AQLB 4HWIB 4HWDA 5AQSB 3LDQB 1M7KA 4HWCA 4HWFA 1I6ZA 5AQIB 4HWHA 5AQPB 3M3ZB 3FZHB 3FZMB 5AQOB 1HX1B 5AQNB 3FZFB 5AQHB 3FZKB 5AQKB 5AQQB 5AQVB 1UK5A 5AQFB 5AQJB 5AQMB 5AQUB 3A8YC 5AQTB 1T7SA 3FZLB 2D9DA
chains in the Genus database with same CATH superfamily
4ERRA 4AIUA 3ONLC 3P50A 1WCRA 2YU2A 3NVOA 1ZV4X 1M62A 1VOMA 5HXRA 5C2TA 2K24A 4HFVA 4O4LE 4ADZA 2IAKA 4BJNA 1UURA 2LM9A 3N9PA 5IUXA 1KFYA 1JNRA 1UUSA 2KWHA 2W0GA 3NRYA 2WU2A 4QHOA 4ZS3A 2BG9C 5LCYA 4CN6A 1MMDA 1YW0A 2ODVA 3PJAA 1MMGA 2MYSA 3NRXA 5LOVE 2AXDS 4DV2T 2ZMAA 3RYHE 2H3RA 3OJAA 3ZN0B 5HXSA 2MOZA 5F5WA 2V7MA 1IJ6A 1WRDA 3BQIA 2X0HA 2X68A 3F57A 3FZFB 3FZMB 3JAFA 4KBMB 5IYZE 3I9WA 1Y01A 3QNUA 4ILUA 3PDYA 4Z8XA 4DV5T 4ILCA 3ZSSA 1LKXA 2JRKA 2B1EA 2E9XB 2C5KT 2WP9A 4MHCA 3RGLA 1OXZA 2RPAA 4HFEA 2H88A 2SPCA 3UTKA 4COFA 1T98A 5L4EA 3D0TA 4O2AE 3ZCIA 3ZMUB 3UT5E 4E7ZA 4EV6A 4YHHT 4HWIB 4B3TT 2J62A 2XQ7A 2P9BA 4DV0T 4WNKA 4CQIA 4TUYE 4YY3T 2E9XA 5FL0A 3N9MA 3P4PA 3ZC0A 2M6BA 1O3XA 2ES0A 3NBXX 2CWYA 2M6IA 3O1HA 5GONE 5L3FB 2V7KA 3KDSE 4CI1B 4UVCB 2UXDT 2LT3A 2M67A 3HKCE 3K1SA 3Q5WA 5FY0A 4QX7B 3KINB 3PTRB 4DR3T 1T8BA 1SE7A 4TV8E 5HYAA 1XZYA 5HEUA 2UXBT 1HX1B 1GQEA 3EDVA 3O1IA 3OPCA 2C5JA 4ISTA 4EYUA 2YDQA 1X9BA 3E08A 1YXRA 3P4RA 5EZYE 5AQVB 3Q5XA 2KINB 5FXXA 5FXWA 3VKGA 3AVSA 5AQTB 2X9XA 3AE8A 2X9HA 4TV9E 1HNWT 4X5TA 2CBJA 3L3PA 2VVNA 3CVRA 1YKHB 3BQLA 3K8PC 4YTNA 3RF1A 1HF8A 4B3ST 3PUZF 3L8RA 4AKRB 1WYCA 2LEHA 3PUWF 3EDUA 4U3CA 5FY1A 5HCMA 4H9PC 1W0AA 2LRKA 3KV5A 3SFDA 5LP6E 3GWHA 1XNQT 3PUXF 2XSAA 2UUCT 2Y48B 3C4ZA 3ZT6A 5JRCB 2FBWA 2KLQA 1HX8A 2HN1A 1LRZA 2LOSA 2VB6A 4JI5T 4IREA 3O1JA 5L3GB 2WY2A 5JDNA 2LHNA 2IMLA 2W63A 5AQOB 5LGUB 1KK7A 2Q9QB 4PNIA 4QWNB 4Z91A 5EK3A 3RYIE 4E7SA 1WYBA 2DL1A 2PFVA 2WCAA 3AE2A 4KP3C 3TKLB 4CI2B 1UK5A 4DR1T 4KHPT 1XMOT 1SUMB 1SA0E 1D0ZA 3CKDA 3VR8A 4DR7T 4U33A 1MMNA 3AA7B 3FBZA 1HCIA 2FJDA 2ZLYA 1UGOA 3HKBE 2W67A 2WQYA 4OYKA 4ZS2A 2JMHA 2WS3A 3KVAA 4XZCA 4EZHA 4LF7T 1X79A 3PUYF 1Y64B 3NZQA 4I4TE 4B3MT 3LBXA 3GA8A 4GK5E 2XQYA 5FKYA 1HG5A 3ZMTB 3OYZA 4KUMB 4OX9T 2W2UA 3ETUA 2X9WA 3AEDA 2DNXA 2A2FX 2XZEA 2YINA 3PUQA 4HWHA 3R84B 5C8YE 2CHNA 3MJXA 4H9RC 2OLTA 2YEVC 3B57A 4UVAB 3VHLA 1WR6A 3LBXB 3A7MA 2MPKA 3EVYA 2WWUA 4P09A 3K3OA 2XUEA 2EHOC 2UXNB 2A3DA 5CB4E 3SOLA 3ZYKA 3TLTA 2JPFA 3LK42 4OYJA 5IWAT 2NR4A 4DR4T 3C4XA 2V5DA 2BG9E 3PUSA 3Q5EA 4H63H 3AE9A 3AXJA 4PK5A 3RX6A 4X65T 1IJ5A 4ZZCA 3N2GE 2VL8A 5AQLB 4IL4A 2BBHA 5JDLA 2BVMA 1N33T 2CE7A 2VK9A 4MLKA 4EAHA 4QH4A 2IW5B 1Z0PA 4WZXA 4EB6E 3PURA 4DBRA 4GKKT 1E7PA 1YKEB 3EHZA 3NKZA 2MTQA 4NPPA 2DHRA 5F8PA 3CQCB 5L47A 4P0AA 3AAEB 1OEDB 2JQHA 3JCFA 5HEOA 3RYFE 3FZHB 3SFEA 2VQFT 1BR0A 4TWHA 4LF5T 2V6YA 3RI5A 2W61A 1D1AA 1FIOA 1W9RA 3UUMA 2V6YB 4HWFA 4P1NA 4BA9A 3ZJ2A 3GN5B 5ABFA 1J5ET 2XAJB 3MA9A 3CMLA 4IE5A 2LJLA 3CWZB 3P7IA 4IE6A 2QYWA 4NIQA 4QX8B 3KV6A 3L39A 3UFEA 5AQFB 3ONJA 2HHHT 2VKJA 1XMQT 5AQKB 1LVFA 1BR2A 2D5UA 1MNDA 2IC9A 2QRXA 4Z90A 4EEBA 2D0TA 4EYYR 2KT9A 2WAUA 1U5PA 2XJ7A 2X67A 3F2EA 3QB5A 4HWDA 4AQFC 4YTPA 5JDGA 3JC6D 1KNPA 4JI6T 2K5BB 4DV1T 4HKAA 4A5XA 4N78D 3CQGB 4AKLA 1L0VA 2Z6EA 4C91A 3N9QA 2XTLA 1AJ3A 2K3WA 2UXCT 3C64A 3AE3A 3RQUA 5BMVE 5LHIB 2VKDA 2F4VT 2CHOA 2PJQA 3AE4A 2UU9T 4KI0F 2HPLA 1FEWA 1ZHCA 5LMNT 4DR6T 2XAGB 3FXEB 2PTFA 5HWYA 3UU3A 2NTYA 2C0SA 3ZN1B 2CLYB 4EGWA 4JYAT 4AQFA 4JBWF 3AA1B 3C51A 4I43B 5HEGA 2YOEA 3PUVF 2J4GA 2NW7A 4IGUA 5AQJB 4YJ2E 4AKGA 2OA5A 2QVAA 3E22E 3FZLB 4PJNA 4TNVA 3O4XE 3MK7C 5J1GA 3JAEA 5JTGA 4G2AA 2XQ8A 2VVSA 2LLYA 4ZI7E 5AFUL 5J2TE 5JDHA 3RRCA 4Q25A 3VR9A 3UQ7A 2Y8DA 4U74A 4WW0A 2FUPA 2K48A 3N2KE 5ADXL 3N2OA 1HS7A 4DMVA 2VKHA 5FXVA 5FY7A 1MMAA 2N9DA 1T72A 5JDFA 2XQAA 3WAJA 3TLSA 1IZNB 3M3ZB 3PU8A 3ZT7A 5FNVE 4GYRA 2PBIA 5KX5E 4YLHA 3H3MA 5HWXA 1MIVA 3ZEFB 4L0RA 2E8IA 2CCQA 2LM2A 3ZT5A 4BAYB 2FJBA 2WU5A 2XQ6A 1HFAA 3N5LA 4JI7T 2RP4A 3V5SA 1Z8UA 4JEUB 4K0UA 4K0KT 2J47A 4H63V 1MIWA 2X0LB 3AEBA 4PK4A 4XAXB 3AAAB 1NENA 4YTMA 5AQMB 3ZMVB 3AE5A 5JR9B 2EHOB 3N9OA 4X1YE 3LJCA 2XQ4A 2XASB 4AQGA 4X64T 4U2YA 2IIUA 2CM0A 4UELA 1MIYA 5AQRB 4C90A 4DUZT 1HNZT 4JI1T 5LMUT 2BVLA 4O4IE 1JNZA 2ACZA 4U72A 5J2UE 5JR9C 1OEDA 2BKOA 2BBJA 1KNZA 1G73A 3LDQB 2V7LA 3G06A 3IBPA 2CXLA 3EI0A 4TZ4C 4JEHB 5LBMA 5HEJA 4DMWA 1W0BA 2KNDA 3IA3A 4TN7B 2DWKA 3OTOT 3RPUA 2MBGA 3VRAA 2E5VA 2KZ7B 3JADA 3ZSTA 2CEAA 4G63A 4ZOLE 2WM9A 2YN6A 1IAPA 3EABA 2BZBA 3K3NA 2IUBA 1FJGT 3P4QA 2NOXA 4P0BA 2CBIA 2V7JA 3DTOA 4IDPA 3N9LA 2VKOA 2HPJA 2NWBA 3EAMA 4ISSA 4IE4A 5AQQB 1HNXT 2DI4A 5FL1A 4LMLA 2VL0A 3O9XA 2HH7A 3ZYMA 3PUGA 1VRBA 2R6GF 4NUVA 4PW8A 4H9SE 2JJ9A 2D9DA 2LSKA 3AXJB 1CUNA 3AEFA 4IDOA 4JI8T 1LVKA 2OV9A 2XM2A 4HN9A 4CXYA 4HFIA 2ZM2A 4EXTA 4B3RT 1MNEA 1D1BA 4HFCA 3ONXA 1M7KA 4NXMT 4AISA 1VCSA 1XDOA 2W4XA 3EUHA 4O4HE 2A9UA 4EOZB 2V1DB 2VURA 4YSYA 3Q9DA 2D0UA 4LF8T 4QH1A 5LG3A 1US7B 1U4QA 2IDOB 4CN4A 4YT0A 2LSYA 3MACA 3QK6A 2BS3A 1ZP0A 2AE9A 2C5IT 2VWAA 3ABVA 4KHZF 4QXHB 4LFCT 3P4WA 1XNRT 1R8IA 3RIUC 1YQ4A 2X0YA 3AA0B 4NXNT 5LG4A 3AVRA 4BJMA 4DV6T 2I0MA 2XY8B 5DABA 3RHWA 3CPZA 2LOPA 2V6XA 3AB3B 3ZPOA 2XPKA 4I55E 1G8XA 4L5GA 4ILAA 4QH5A 4UXNB 2X9YA 3S4UA 2XAFB 2ZM8A 5CFBA 3ZYLA 4DVDA 3CK6A 3LG7A 4DV4T 4OFZA 3IHRA 2GK9A 5HXCA 3T8OA 4CZZB 4JV5T 4HFBA 4JLEA 4ZI2D 1J1JA 5ABHA 4AI6A 1QUUA 3AEAA 2L9QA 5FMNA 5HEHA 2IC6A 2V26A 4HGAA 2LKGA 5A1LA 2DLRA 4KMCA 4PFPA 4X20E 1D1CA 2W00A 4DBQA 4AKHA 3ZC1A 4EZ4A 4EIWA 2JQKA 4LFBT 1E1HB 3AAIA 5JVDE 5FVLA 3R6NA 3ANWB 3RC3A 2CRBA 5CA1E 4X1IE 4JUYA 3FHNA 4GK0E 4ZI3C 4JI3T 4YSXA 3H37A 3H3AA 3ZKRA 3TLWA 2XQ3A 3OBVE 2Q9QC 4IE7A 3K3QC 4H9NC 4OHFA 5ETWA 3KV9A 4CXWA 2XHEB 3VRBA 4HTEA 4U7IA 3U3IA 2KMFA 3UFGA 3ETVA 3TLVA 3OKQA 1S35A 5DJQC 5KMGP 1OEDC 3C50A 4UF0A 2BS2A 4HE8A 2WB5A 2YKSA 2YDSA 5E0OA 5JR9A 1YD8G 3I0QA 3RLFF 5LGNB 1I6ZA 1NAFA 2BKPA 2JQQA 5LGTB 4PK6A 2H89A 3C98B 4O4JE 2WWVA 3VKHA 4WBOA 2W62A 4HFHA 4X1KE 4H9QC 2LSIA 1WR0A 4YFSA 2XQ9A 2E9XC 2LHRA 4MBQA 4H9OC 4ZZBA 3MXZA 1OWAA 4YSZA 5JQGE 4YXDA 2WSSV 3M65A 5LBQB 5L3BB 3CX7B 1IBKT 2H7VC 5JRCA 3WI3A 4YJ3E 3Q2MA 3SWHA 3ZMSB 4ZXLA 3J7Yq 4AQYT 3J9X1 2Y6XA 3QB5K 4DV3T 2KXPB 2LE8A 2WZIA 5ABEA 4GIWA 2V7IA 1D0XA 2CXFA 2X51A 3ZLIA 4XBFB 2QA7A 1CHUA 4UF0B 5JDQA 1KF6A 5KXJA 1UCUA 1KNRA 2W66A 3X1DA 2YU1A 2X66A 4A98A 3ZCJA 5BR8T 5JDMA 2IHR1 4YHJA 5LA6E 3I0OA 3LFMA 1HR0T 4JI2T 4I50E 4OK0A 2XSBA 5LXTE 3DJBA 4DV7T 3HR0A 1BR4A 5L3DB 4IHJE 3UUXB 4LF9T 3RKOA 4U2ZA 3PE0A 4A56A 5LNKA 4PJJA 4QXBB 4UIGA 5AQHB 1BR1A 3NZPA 5AQNB 3UQ4A 4CXXA 4WBNE 3UUBA 4CI3B 3RIUA 3OVUA 3UU8A 1EZ3A 2JIWA 2XAQB 3ANWA 4KX6A 2JMKA 4PAGA 3UUNA 3UULA 4GOUA 4B6XA 4FJOA 4HFDA 5FXZA 5AQUB 4ZEYA 1T7SA 1FMVA 5CJ5A 5ABFB 4JI4T 3PUAA 3CQXC 1W09A 1ZEEA 2FJAA 3SS1A 1VCTA 4PFOA 4CN1A 2BG9B 2CA5A 2RA1A 1WFDA 3KVBA 2B76A 4ANJA 1UX4A 3IF8B 3MZKB 1J5WA 2ACXA 4UR9A 4ZI3D 5L3CB 3FXDB 2ZM6T 3I1AA 2J1DG 3UU5A 3RIFA 1DU2A 3AEGA 5AQIB 4LFAT 3PJAJ 5L4HA 2EHOD 2H7OA 2XM1A 4TWFA 2I6HA 2A72A 5CGMA 3C4WA 2UUBT 2YK0A 2L8KA 2WDQA 5M4YA 4M1PA 3KBUA 5HXEA 3DP7A 1OEDE 2KWIB 5LJNA 3FZKB 1I94T 2YDRA 3AEEA 2N1GA 4V1Av 4ZI2C 4ZHQE 2BKNA 2WZHA 4LMKA 4U7YA 5KDMC 1HG2A 2HN2A 3UU4A 3P4SA 2MAWA 2I59A 5IHYA 2CMRA 1YQ3A 5C3JA 1IBLT 2Q9QA 2EHOA 4TX5A 5ABGA 2BG9A 3AECA 4GYSA 4F8HA 2V8SV 2DWGA 2V5CA 2QGSA 3T1HT 3Q5DA 3KFWX 3P8CD 4UEMA 5AQSB 2G0UA 3CIRA 4HWCA 3F31A 2LSGA 3FB2A 4A97A 4O2BE 5JREA 2VQET 4JI0T 1NWMX 4FI5A 2E2AA 3QUJA 2XQ5A 1N32T 1V9DA 3CX6B 3AE7A 4UVBB 4AXPA 1D0YA 1ZOYA 3OYXA 3RIAA 5LJMA 2Q9QD 3E0ZA 4IL9A 5H6RB 3RYCE 4UV9B 3WAKA 3GMIA 4EEDA 5TAOA 1FMWA 1HTJF 2BDEA 2PG8A 3RRWA 4IIJE 3RC8A 3BQKA 3HI2A 4O8SA 5HXHA 3B13A 1UX5A 3LK2B 5HCJA 4X62T 5FYMA 2E5LT 5F3JA 5LYJE 1N34T 3IEEA 5H6QB 3KBTA 5LB7B 2NTXA 2D2SA 4IE0A 3HKEE 4QKNA 3CX8B 5AQGB 5CA0E 4LF4T 1SHZC 3ESLA 3TLUA 2LSJA 2KSRA 2N2NA 4IDQA 4L9IA 3HL6A 5FP3A 2WDVA 3ZJ1A 1XWMA 2WDRA 4WYVA 4TNWA 1H7CA 3HKDE 2XAHB 3L09A 1QSDA 2JQ9A 3JC6C 4TWDA 4X66T 4ASKA 4DIDB 3QC9A 3NWIA 2ODUA 5DQVA 2CXDA 3AE6A 3RH3A 2WBLA 2WMNA 1XDPA 4DR2T 5LHHB 3RKGA 1S94A 3PV0F 2K9AA 3B5MA 5L3EB 1WLXA 2FJEA 4PJLA 2ZM0A 2BS4A 3AA6B 4GKJT 1E2AA 3LSVA 1QLBA 4DNDA 3RQWA 4NUUA 3GN5A 2L3LA 4QXCB 5DQWA 1NEKA 4IT4A 3N9NA 4DR5T 4AKIA 3KV4A 4DO0A 2LKHA 2UUAT 3BK9A 2CPTA 2WMOA 3U78A 1KEYA 5J0ZA 2CWOA 2CLYC 4IDNA 5LHGB 1N36T 2LRLA 4DUYT 3AE1A 3PU3A 5FVKA 2E9XD 3QOFA 3HA4A 2VASA 4J2CA 4U31A 5AQPB 3V5UA 5HAXA 3ZMZB 3LK3B 5EK4A 4PJMA 2NW9A 3VU7H 1IBMT 3SRZA 2UXXB 3I9YA 4MFRA 4I0UA 1B7TA 1ZKEA 3MKDA 3UU6A 4HEAA 4LMJA 4F6RC 5EK2A 4UV8B 5JH7E 5L2LA 3T1YT 3FBLA 2DCFA 2NP9A 2NW8A 4MALA 3W15B 3A5XA 3A8YC 4ILBA 4LF6T 4IDZA
chains in the Genus database with same CATH topology
5AQGB 1UGOA 5AQRB 1M62A 5AQLB 4HWIB 4HWDA 5AQSB 3LDQB 1M7KA 4HWCA 4HWFA 1I6ZA 5AQIB 4HWHA 5AQPB 3M3ZB 3FZHB 3FZMB 5AQOB 1HX1B 5AQNB 3FZFB 5AQHB 3FZKB 5AQKB 5AQQB 5AQVB 1UK5A 5AQFB 5AQJB 5AQMB 5AQUB 3A8YC 5AQTB 1T7SA 3FZLB 2D9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AQG B;  1UGO A;  5AQR B;  1M62 A;  5AQL B;  4HWI B;  4HWD A;  5AQS B;  3LDQ B;  1M7K A;  4HWC A;  4HWF A;  1I6Z A;  5AQI B;  4HWH A;  5AQP B;  3M3Z B;  3FZH B;  3FZM B;  5AQO B;  1HX1 B;  5AQN B;  3FZF B;  5AQH B;  3FZK B;  5AQK B;  5AQQ B;  5AQV B;  1UK5 A;  5AQF B;  5AQJ B;  5AQM B;  5AQU B;  3A8Y C;  5AQT B;  1T7S A;  3FZL B;  2D9D A; 
#chains in the Genus database with same CATH topology
 4ERR A;  4AIU A;  3ONL C;  3P50 A;  1WCR A;  2YU2 A;  3NVO A;  1ZV4 X;  1M62 A;  1VOM A;  5HXR A;  5C2T A;  2K24 A;  4HFV A;  4O4L E;  4ADZ A;  2IAK A;  4BJN A;  1UUR A;  2LM9 A;  3N9P A;  5IUX A;  1KFY A;  1JNR A;  1UUS A;  2KWH A;  2W0G A;  3NRY A;  2WU2 A;  4QHO A;  4ZS3 A;  2BG9 C;  5LCY A;  4CN6 A;  1MMD A;  1YW0 A;  2ODV A;  3PJA A;  1MMG A;  2MYS A;  3NRX A;  5LOV E;  2AXD S;  4DV2 T;  2ZMA A;  3RYH E;  2H3R A;  3OJA A;  3ZN0 B;  5HXS A;  2MOZ A;  5F5W A;  2V7M A;  1IJ6 A;  1WRD A;  3BQI A;  2X0H A;  2X68 A;  3F57 A;  3FZF B;  3FZM B;  3JAF A;  4KBM B;  5IYZ E;  3I9W A;  1Y01 A;  3QNU A;  4ILU A;  3PDY A;  4Z8X A;  4DV5 T;  4ILC A;  3ZSS A;  1LKX A;  2JRK A;  2B1E A;  2E9X B;  2C5K T;  2WP9 A;  4MHC A;  3RGL A;  1OXZ A;  2RPA A;  4HFE A;  2H88 A;  2SPC A;  3UTK A;  4COF A;  1T98 A;  5L4E A;  3D0T A;  4O2A E;  3ZCI A;  3ZMU B;  3UT5 E;  4E7Z A;  4EV6 A;  4YHH T;  4HWI B;  4B3T T;  2J62 A;  2XQ7 A;  2P9B A;  4DV0 T;  4WNK A;  4CQI A;  4TUY E;  4YY3 T;  2E9X A;  5FL0 A;  3N9M A;  3P4P A;  3ZC0 A;  2M6B A;  1O3X A;  2ES0 A;  3NBX X;  2CWY A;  2M6I A;  3O1H A;  5GON E;  5L3F B;  2V7K A;  3KDS E;  4CI1 B;  4UVC B;  2UXD T;  2LT3 A;  2M67 A;  3HKC E;  3K1S A;  3Q5W A;  5FY0 A;  4QX7 B;  3KIN B;  3PTR B;  4DR3 T;  1T8B A;  1SE7 A;  4TV8 E;  5HYA A;  1XZY A;  5HEU A;  2UXB T;  1HX1 B;  1GQE A;  3EDV A;  3O1I A;  3OPC A;  2C5J A;  4IST A;  4EYU A;  2YDQ A;  1X9B A;  3E08 A;  1YXR A;  3P4R A;  5EZY E;  5AQV B;  3Q5X A;  2KIN B;  5FXX A;  5FXW A;  3VKG A;  3AVS A;  5AQT B;  2X9X A;  3AE8 A;  2X9H A;  4TV9 E;  1HNW T;  4X5T A;  2CBJ A;  3L3P A;  2VVN A;  3CVR A;  1YKH B;  3BQL A;  3K8P C;  4YTN A;  3RF1 A;  1HF8 A;  4B3S T;  3PUZ F;  3L8R A;  4AKR B;  1WYC A;  2LEH A;  3PUW F;  3EDU A;  4U3C A;  5FY1 A;  5HCM A;  4H9P C;  1W0A A;  2LRK A;  3KV5 A;  3SFD A;  5LP6 E;  3GWH A;  1XNQ T;  3PUX F;  2XSA A;  2UUC T;  2Y48 B;  3C4Z A;  3ZT6 A;  5JRC B;  2FBW A;  2KLQ A;  1HX8 A;  2HN1 A;  1LRZ A;  2LOS A;  2VB6 A;  4JI5 T;  4IRE A;  3O1J A;  5L3G B;  2WY2 A;  5JDN A;  2LHN A;  2IML A;  2W63 A;  5AQO B;  5LGU B;  1KK7 A;  2Q9Q B;  4PNI A;  4QWN B;  4Z91 A;  5EK3 A;  3RYI E;  4E7S A;  1WYB A;  2DL1 A;  2PFV A;  2WCA A;  3AE2 A;  4KP3 C;  3TKL B;  4CI2 B;  1UK5 A;  4DR1 T;  4KHP T;  1XMO T;  1SUM B;  1SA0 E;  1D0Z A;  3CKD A;  3VR8 A;  4DR7 T;  4U33 A;  1MMN A;  3AA7 B;  3FBZ A;  1HCI A;  2FJD A;  2ZLY A;  1UGO A;  3HKB E;  2W67 A;  2WQY A;  4OYK A;  4ZS2 A;  2JMH A;  2WS3 A;  3KVA A;  4XZC A;  4EZH A;  4LF7 T;  1X79 A;  3PUY F;  1Y64 B;  3NZQ A;  4I4T E;  4B3M T;  3LBX A;  3GA8 A;  4GK5 E;  2XQY A;  5FKY A;  1HG5 A;  3ZMT B;  3OYZ A;  4KUM B;  4OX9 T;  2W2U A;  3ETU A;  2X9W A;  3AED A;  2DNX A;  2A2F X;  2XZE A;  2YIN A;  3PUQ A;  4HWH A;  3R84 B;  5C8Y E;  2CHN A;  3MJX A;  4H9R C;  2OLT A;  2YEV C;  3B57 A;  4UVA B;  3VHL A;  1WR6 A;  3LBX B;  3A7M A;  2MPK A;  3EVY A;  2WWU A;  4P09 A;  3K3O A;  2XUE A;  2EHO C;  2UXN B;  2A3D A;  5CB4 E;  3SOL A;  3ZYK A;  3TLT A;  2JPF A;  3LK4 2;  4OYJ A;  5IWA T;  2NR4 A;  4DR4 T;  3C4X A;  2V5D A;  2BG9 E;  3PUS A;  3Q5E A;  4H63 H;  3AE9 A;  3AXJ A;  4PK5 A;  3RX6 A;  4X65 T;  1IJ5 A;  4ZZC A;  3N2G E;  2VL8 A;  5AQL B;  4IL4 A;  2BBH A;  5JDL A;  2BVM A;  1N33 T;  2CE7 A;  2VK9 A;  4MLK A;  4EAH A;  4QH4 A;  2IW5 B;  1Z0P A;  4WZX A;  4EB6 E;  3PUR A;  4DBR A;  4GKK T;  1E7P A;  1YKE B;  3EHZ A;  3NKZ A;  2MTQ A;  4NPP A;  2DHR A;  5F8P A;  3CQC B;  5L47 A;  4P0A A;  3AAE B;  1OED B;  2JQH A;  3JCF A;  5HEO A;  3RYF E;  3FZH B;  3SFE A;  2VQF T;  1BR0 A;  4TWH A;  4LF5 T;  2V6Y A;  3RI5 A;  2W61 A;  1D1A A;  1FIO A;  1W9R A;  3UUM A;  2V6Y B;  4HWF A;  4P1N A;  4BA9 A;  3ZJ2 A;  3GN5 B;  5ABF A;  1J5E T;  2XAJ B;  3MA9 A;  3CML A;  4IE5 A;  2LJL A;  3CWZ B;  3P7I A;  4IE6 A;  2QYW A;  4NIQ A;  4QX8 B;  3KV6 A;  3L39 A;  3UFE A;  5AQF B;  3ONJ A;  2HHH T;  2VKJ A;  1XMQ T;  5AQK B;  1LVF A;  1BR2 A;  2D5U A;  1MND A;  2IC9 A;  2QRX A;  4Z90 A;  4EEB A;  2D0T A;  4EYY R;  2KT9 A;  2WAU A;  1U5P A;  2XJ7 A;  2X67 A;  3F2E A;  3QB5 A;  4HWD A;  4AQF C;  4YTP A;  5JDG A;  3JC6 D;  1KNP A;  4JI6 T;  2K5B B;  4DV1 T;  4HKA A;  4A5X A;  4N78 D;  3CQG B;  4AKL A;  1L0V A;  2Z6E A;  4C91 A;  3N9Q A;  2XTL A;  1AJ3 A;  2K3W A;  2UXC T;  3C64 A;  3AE3 A;  3RQU A;  5BMV E;  5LHI B;  2VKD A;  2F4V T;  2CHO A;  2PJQ A;  3AE4 A;  2UU9 T;  4KI0 F;  2HPL A;  1FEW A;  1ZHC A;  5LMN T;  4DR6 T;  2XAG B;  3FXE B;  2PTF A;  5HWY A;  3UU3 A;  2NTY A;  2C0S A;  3ZN1 B;  2CLY B;  4EGW A;  4JYA T;  4AQF A;  4JBW F;  3AA1 B;  3C51 A;  4I43 B;  5HEG A;  2YOE A;  3PUV F;  2J4G A;  2NW7 A;  4IGU A;  5AQJ B;  4YJ2 E;  4AKG A;  2OA5 A;  2QVA A;  3E22 E;  3FZL B;  4PJN A;  4TNV A;  3O4X E;  3MK7 C;  5J1G A;  3JAE A;  5JTG A;  4G2A A;  2XQ8 A;  2VVS A;  2LLY A;  4ZI7 E;  5AFU L;  5J2T E;  5JDH A;  3RRC A;  4Q25 A;  3VR9 A;  3UQ7 A;  2Y8D A;  4U74 A;  4WW0 A;  2FUP A;  2K48 A;  3N2K E;  5ADX L;  3N2O A;  1HS7 A;  4DMV A;  2VKH A;  5FXV A;  5FY7 A;  1MMA A;  2N9D A;  1T72 A;  5JDF A;  2XQA A;  3WAJ A;  3TLS A;  1IZN B;  3M3Z B;  3PU8 A;  3ZT7 A;  5FNV E;  4GYR A;  2PBI A;  5KX5 E;  4YLH A;  3H3M A;  5HWX A;  1MIV A;  3ZEF B;  4L0R A;  2E8I A;  2CCQ A;  2LM2 A;  3ZT5 A;  4BAY B;  2FJB A;  2WU5 A;  2XQ6 A;  1HFA A;  3N5L A;  4JI7 T;  2RP4 A;  3V5S A;  1Z8U A;  4JEU B;  4K0U A;  4K0K T;  2J47 A;  4H63 V;  1MIW A;  2X0L B;  3AEB A;  4PK4 A;  4XAX B;  3AAA B;  1NEN A;  4YTM A;  5AQM B;  3ZMV B;  3AE5 A;  5JR9 B;  2EHO B;  3N9O A;  4X1Y E;  3LJC A;  2XQ4 A;  2XAS B;  4AQG A;  4X64 T;  4U2Y A;  2IIU A;  2CM0 A;  4UEL A;  1MIY A;  5AQR B;  4C90 A;  4DUZ T;  1HNZ T;  4JI1 T;  5LMU T;  2BVL A;  4O4I E;  1JNZ A;  2ACZ A;  4U72 A;  5J2U E;  5JR9 C;  1OED A;  2BKO A;  2BBJ A;  1KNZ A;  1G73 A;  3LDQ B;  2V7L A;  3G06 A;  3IBP A;  2CXL A;  3EI0 A;  4TZ4 C;  4JEH B;  5LBM A;  5HEJ A;  4DMW A;  1W0B A;  2KND A;  3IA3 A;  4TN7 B;  2DWK A;  3OTO T;  3RPU A;  2MBG A;  3VRA A;  2E5V A;  2KZ7 B;  3JAD A;  3ZST A;  2CEA A;  4G63 A;  4ZOL E;  2WM9 A;  2YN6 A;  1IAP A;  3EAB A;  2BZB A;  3K3N A;  2IUB A;  1FJG T;  3P4Q A;  2NOX A;  4P0B A;  2CBI A;  2V7J A;  3DTO A;  4IDP A;  3N9L A;  2VKO A;  2HPJ A;  2NWB A;  3EAM A;  4ISS A;  4IE4 A;  5AQQ B;  1HNX T;  2DI4 A;  5FL1 A;  4LML A;  2VL0 A;  3O9X A;  2HH7 A;  3ZYM A;  3PUG A;  1VRB A;  2R6G F;  4NUV A;  4PW8 A;  4H9S E;  2JJ9 A;  2D9D A;  2LSK A;  3AXJ B;  1CUN A;  3AEF A;  4IDO A;  4JI8 T;  1LVK A;  2OV9 A;  2XM2 A;  4HN9 A;  4CXY A;  4HFI A;  2ZM2 A;  4EXT A;  4B3R T;  1MNE A;  1D1B A;  4HFC A;  3ONX A;  1M7K A;  4NXM T;  4AIS A;  1VCS A;  1XDO A;  2W4X A;  3EUH A;  4O4H E;  2A9U A;  4EOZ B;  2V1D B;  2VUR A;  4YSY A;  3Q9D A;  2D0U A;  4LF8 T;  4QH1 A;  5LG3 A;  1US7 B;  1U4Q A;  2IDO B;  4CN4 A;  4YT0 A;  2LSY A;  3MAC A;  3QK6 A;  2BS3 A;  1ZP0 A;  2AE9 A;  2C5I T;  2VWA A;  3ABV A;  4KHZ F;  4QXH B;  4LFC T;  3P4W A;  1XNR T;  1R8I A;  3RIU C;  1YQ4 A;  2X0Y A;  3AA0 B;  4NXN T;  5LG4 A;  3AVR A;  4BJM A;  4DV6 T;  2I0M A;  2XY8 B;  5DAB A;  3RHW A;  3CPZ A;  2LOP A;  2V6X A;  3AB3 B;  3ZPO A;  2XPK A;  4I55 E;  1G8X A;  4L5G A;  4ILA A;  4QH5 A;  4UXN B;  2X9Y A;  3S4U A;  2XAF B;  2ZM8 A;  5CFB A;  3ZYL A;  4DVD A;  3CK6 A;  3LG7 A;  4DV4 T;  4OFZ A;  3IHR A;  2GK9 A;  5HXC A;  3T8O A;  4CZZ B;  4JV5 T;  4HFB A;  4JLE A;  4ZI2 D;  1J1J A;  5ABH A;  4AI6 A;  1QUU A;  3AEA A;  2L9Q A;  5FMN A;  5HEH A;  2IC6 A;  2V26 A;  4HGA A;  2LKG A;  5A1L A;  2DLR A;  4KMC A;  4PFP A;  4X20 E;  1D1C A;  2W00 A;  4DBQ A;  4AKH A;  3ZC1 A;  4EZ4 A;  4EIW A;  2JQK A;  4LFB T;  1E1H B;  3AAI A;  5JVD E;  5FVL A;  3R6N A;  3ANW B;  3RC3 A;  2CRB A;  5CA1 E;  4X1I E;  4JUY A;  3FHN A;  4GK0 E;  4ZI3 C;  4JI3 T;  4YSX A;  3H37 A;  3H3A A;  3ZKR A;  3TLW A;  2XQ3 A;  3OBV E;  2Q9Q C;  4IE7 A;  3K3Q C;  4H9N C;  4OHF A;  5ETW A;  3KV9 A;  4CXW A;  2XHE B;  3VRB A;  4HTE A;  4U7I A;  3U3I A;  2KMF A;  3UFG A;  3ETV A;  3TLV A;  3OKQ A;  1S35 A;  5DJQ C;  5KMG P;  1OED C;  3C50 A;  4UF0 A;  2BS2 A;  4HE8 A;  2WB5 A;  2YKS A;  2YDS A;  5E0O A;  5JR9 A;  1YD8 G;  3I0Q A;  3RLF F;  5LGN B;  1I6Z A;  1NAF A;  2BKP A;  2JQQ A;  5LGT B;  4PK6 A;  2H89 A;  3C98 B;  4O4J E;  2WWV A;  3VKH A;  4WBO A;  2W62 A;  4HFH A;  4X1K E;  4H9Q C;  2LSI A;  1WR0 A;  4YFS A;  2XQ9 A;  2E9X C;  2LHR A;  4MBQ A;  4H9O C;  4ZZB A;  3MXZ A;  1OWA A;  4YSZ A;  5JQG E;  4YXD A;  2WSS V;  3M65 A;  5LBQ B;  5L3B B;  3CX7 B;  1IBK T;  2H7V C;  5JRC A;  3WI3 A;  4YJ3 E;  3Q2M A;  3SWH A;  3ZMS B;  4ZXL A;  3J7Y q;  4AQY T;  3J9X 1;  2Y6X A;  3QB5 K;  4DV3 T;  2KXP B;  2LE8 A;  2WZI A;  5ABE A;  4GIW A;  2V7I A;  1D0X A;  2CXF A;  2X51 A;  3ZLI A;  4XBF B;  2QA7 A;  1CHU A;  4UF0 B;  5JDQ A;  1KF6 A;  5KXJ A;  1UCU A;  1KNR A;  2W66 A;  3X1D A;  2YU1 A;  2X66 A;  4A98 A;  3ZCJ A;  5BR8 T;  5JDM A;  2IHR 1;  4YHJ A;  5LA6 E;  3I0O A;  3LFM A;  1HR0 T;  4JI2 T;  4I50 E;  4OK0 A;  2XSB A;  5LXT E;  3DJB A;  4DV7 T;  3HR0 A;  1BR4 A;  5L3D B;  4IHJ E;  3UUX B;  4LF9 T;  3RKO A;  4U2Z A;  3PE0 A;  4A56 A;  5LNK A;  4PJJ A;  4QXB B;  4UIG A;  5AQH B;  1BR1 A;  3NZP A;  5AQN B;  3UQ4 A;  4CXX A;  4WBN E;  3UUB A;  4CI3 B;  3RIU A;  3OVU A;  3UU8 A;  1EZ3 A;  2JIW A;  2XAQ B;  3ANW A;  4KX6 A;  2JMK A;  4PAG A;  3UUN A;  3UUL A;  4GOU A;  4B6X A;  4FJO A;  4HFD A;  5FXZ A;  5AQU B;  4ZEY A;  1T7S A;  1FMV A;  5CJ5 A;  5ABF B;  4JI4 T;  3PUA A;  3CQX C;  1W09 A;  1ZEE A;  2FJA A;  3SS1 A;  1VCT A;  4PFO A;  4CN1 A;  2BG9 B;  2CA5 A;  2RA1 A;  1WFD A;  3KVB A;  2B76 A;  4ANJ A;  1UX4 A;  3IF8 B;  3MZK B;  1J5W A;  2ACX A;  4UR9 A;  4ZI3 D;  5L3C B;  3FXD B;  2ZM6 T;  3I1A A;  2J1D G;  3UU5 A;  3RIF A;  1DU2 A;  3AEG A;  5AQI B;  4LFA T;  3PJA J;  5L4H A;  2EHO D;  2H7O A;  2XM1 A;  4TWF A;  2I6H A;  2A72 A;  5CGM A;  3C4W A;  2UUB T;  2YK0 A;  2L8K A;  2WDQ A;  5M4Y A;  4M1P A;  3KBU A;  5HXE A;  3DP7 A;  1OED E;  2KWI B;  5LJN A;  3FZK B;  1I94 T;  2YDR A;  3AEE A;  2N1G A;  4V1A v;  4ZI2 C;  4ZHQ E;  2BKN A;  2WZH A;  4LMK A;  4U7Y A;  5KDM C;  1HG2 A;  2HN2 A;  3UU4 A;  3P4S A;  2MAW A;  2I59 A;  5IHY A;  2CMR A;  1YQ3 A;  5C3J A;  1IBL T;  2Q9Q A;  2EHO A;  4TX5 A;  5ABG A;  2BG9 A;  3AEC A;  4GYS A;  4F8H A;  2V8S V;  2DWG A;  2V5C A;  2QGS A;  3T1H T;  3Q5D A;  3KFW X;  3P8C D;  4UEM A;  5AQS B;  2G0U A;  3CIR A;  4HWC A;  3F31 A;  2LSG A;  3FB2 A;  4A97 A;  4O2B E;  5JRE A;  2VQE T;  4JI0 T;  1NWM X;  4FI5 A;  2E2A A;  3QUJ A;  2XQ5 A;  1N32 T;  1V9D A;  3CX6 B;  3AE7 A;  4UVB B;  4AXP A;  1D0Y A;  1ZOY A;  3OYX A;  3RIA A;  5LJM A;  2Q9Q D;  3E0Z A;  4IL9 A;  5H6R B;  3RYC E;  4UV9 B;  3WAK A;  3GMI A;  4EED A;  5TAO A;  1FMW A;  1HTJ F;  2BDE A;  2PG8 A;  3RRW A;  4IIJ E;  3RC8 A;  3BQK A;  3HI2 A;  4O8S A;  5HXH A;  3B13 A;  1UX5 A;  3LK2 B;  5HCJ A;  4X62 T;  5FYM A;  2E5L T;  5F3J A;  5LYJ E;  1N34 T;  3IEE A;  5H6Q B;  3KBT A;  5LB7 B;  2NTX A;  2D2S A;  4IE0 A;  3HKE E;  4QKN A;  3CX8 B;  5AQG B;  5CA0 E;  4LF4 T;  1SHZ C;  3ESL A;  3TLU A;  2LSJ A;  2KSR A;  2N2N A;  4IDQ A;  4L9I A;  3HL6 A;  5FP3 A;  2WDV A;  3ZJ1 A;  1XWM A;  2WDR A;  4WYV A;  4TNW A;  1H7C A;  3HKD E;  2XAH B;  3L09 A;  1QSD A;  2JQ9 A;  3JC6 C;  4TWD A;  4X66 T;  4ASK A;  4DID B;  3QC9 A;  3NWI A;  2ODU A;  5DQV A;  2CXD A;  3AE6 A;  3RH3 A;  2WBL A;  2WMN A;  1XDP A;  4DR2 T;  5LHH B;  3RKG A;  1S94 A;  3PV0 F;  2K9A A;  3B5M A;  5L3E B;  1WLX A;  2FJE A;  4PJL A;  2ZM0 A;  2BS4 A;  3AA6 B;  4GKJ T;  1E2A A;  3LSV A;  1QLB A;  4DND A;  3RQW A;  4NUU A;  3GN5 A;  2L3L A;  4QXC B;  5DQW A;  1NEK A;  4IT4 A;  3N9N A;  4DR5 T;  4AKI A;  3KV4 A;  4DO0 A;  2LKH A;  2UUA T;  3BK9 A;  2CPT A;  2WMO A;  3U78 A;  1KEY A;  5J0Z A;  2CWO A;  2CLY C;  4IDN A;  5LHG B;  1N36 T;  2LRL A;  4DUY T;  3AE1 A;  3PU3 A;  5FVK A;  2E9X D;  3QOF A;  3HA4 A;  2VAS A;  4J2C A;  4U31 A;  5AQP B;  3V5U A;  5HAX A;  3ZMZ B;  3LK3 B;  5EK4 A;  4PJM A;  2NW9 A;  3VU7 H;  1IBM T;  3SRZ A;  2UXX B;  3I9Y A;  4MFR A;  4I0U A;  1B7T A;  1ZKE A;  3MKD A;  3UU6 A;  4HEA A;  4LMJ A;  4F6R C;  5EK2 A;  4UV8 B;  5JH7 E;  5L2L A;  3T1Y T;  3FBL A;  2DCF A;  2NP9 A;  2NW8 A;  4MAL A;  3W15 B;  3A5X A;  3A8Y C;  4ILB A;  4LF6 T;  4IDZ A; 
#chains in the Genus database with same CATH homology
 5AQG B;  1UGO A;  5AQR B;  1M62 A;  5AQL B;  4HWI B;  4HWD A;  5AQS B;  3LDQ B;  1M7K A;  4HWC A;  4HWF A;  1I6Z A;  5AQI B;  4HWH A;  5AQP B;  3M3Z B;  3FZH B;  3FZM B;  5AQO B;  1HX1 B;  5AQN B;  3FZF B;  5AQH B;  3FZK B;  5AQK B;  5AQQ B;  5AQV B;  1UK5 A;  5AQF B;  5AQJ B;  5AQM B;  5AQU B;  3A8Y C;  5AQT B;  1T7S A;  3FZL B;  2D9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...