3F31A

Crystal structure of the n-terminal region of alphaii-spectrin tetramerization domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
137
Chain Sequence
TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Actin binding, structural protein
molecule keywords Spectrin alpha chain, brain
publication title Crystal structure of the nonerythroid alpha-spectrin tetramerization site reveals differences between erythroid and nonerythroid spectrin tetramer formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3f31A00
2ODVA 1U4QA 3PE0A 3FB2A 1HCIA 2ODUA 3UUNA 3UUMA 1U5PA 3F31A 3LBXA 1S35A 1WLXA 1CUNA 1QUUA 1OWAA 3LBXB 3UULA 2SPCA 3EDVA 1AJ3A
chains in the Genus database with same CATH superfamily
2BG9E 2DHRA 2I6HA 2KMFA 2X9YA 3N5LA 3CKDA 1ZOYA 4LMKA 4QHOA 4TN7B 3SOLA 4CI1B 4YHHT 2HHHT 5F5WA 4KHPT 4IDOA 2XQ7A 2Z6EA 3FXEB 5C2TA 3RYFE 1S94A 4BJMA 4AQYT 5LNKA 2GK9A 2B1EA 2JQKA 2LEHA 3CWZB 4HFCA 1W09A 2QYWA 4YFSA 3VU7H 5FXVA 2LSIA 2YOEA 3DTOA 4V1Av 3CQXC 4LFBT 2NWBA 3TLWA 2MOZA 3C64A 5AQPB 1XDPA 3V5UA 1KFYA 5IWAT 2Q9QC 2UXCT 2LLYA 3VRAA 5AQQB 2WM9A 4I50E 1NWMX 2W61A 4LF4T 2LJLA 2XQ4A 3QK6A 3H3MA 5AQHB 4DBQA 1LRZA 2JQQA 3RC3A 4CXXA 1SUMB 2KINB 4HFBA 2Y6XA 2A72A 3P4QA 5EK2A 1E7PA 1T98A 3OPCA 3ZPOA 2WB5A 4YSXA 3N9OA 5JRCA 1XWMA 5AQIB 3C4XA 3HL6A 1YQ3A 5JRCB 1XNRT 5C8YE 3KV6A 4AI6A 2D5UA 4NUUA 3HR0A 1HF8A 3UFGA 4GIWA 3BK9A 4BJNA 1HS7A 3FB2A 3RX6A 2J62A 2E9XC 4U74A 4YSYA 4DV4T 4IE5A 4PK5A 4IT4A 1W0BA 3ZMZB 3OJAA 2HN2A 3ZN0B 3QC9A 5ADXL 4CN4A 5LMUT 1HG2A 3BQLA 4DR5T 4CZZB 2J47A 1FMVA 4AQFA 4TZ4C 1FIOA 3GWHA 2VVNA 1XMOT 4YHJA 5FL1A 2PG8A 4JLEA 3CMLA 4FJOA 1J5WA 2BDEA 4ZEYA 2OV9A 5FXWA 3ZCIA 5AQGB 4IL4A 4HWIB 3K1SA 1LVKA 5AQKB 1GQEA 5JREA 2VKDA 2E2AA 2VVSA 1R8IA 1IBLT 5LOVE 2QA7A 1EZ3A 4DIDB 3AEEA 3CK6A 2VWAA 1BR1A 2V6YA 2WP9A 2W00A 2D2SA 3KVAA 3RC8A 3GA8A 1H7CA 5JDGA 4G2AA 5DQWA 2V8SV 2WWUA 1UGOA 2RP4A 3ZMVB 5LJMA 3P4WA 3AAIA 3C51A 3FHNA 5LCYA 4E7ZA 2FJAA 2XM2A 5L3DB 2UUCT 3AEDA 5KMGP 3ZJ1A 2LRLA 4PFPA 4DR7T 1D0ZA 3T1YT 3E0ZA 5IUXA 2XUEA 2BZBA 2YU2A 2D0TA 4J2CA 2CEAA 2E5VA 4GKJT 3L09A 5FKYA 2NOXA 2H88A 2VB6A 3P8CD 2W63A 3P50A 4UEMA 2LE8A 4OYJA 2KXPB 5JR9B 4OK0A 2XY8B 3AVSA 3LSVA 3ZEFB 4A97A 4U3CA 3ONLC 3MA9A 5HCJA 4QH5A 1SHZC 2LSKA 3ZMUB 3I0OA 3LDQB 3ONJA 2VKOA 4H9RC 4ZXLA 1MMNA 4HEAA 1HNZT 4B3RT 5LP6E 3M65A 1KNPA 4AKGA 4L9IA 4X66T 3NZQA 2ACXA 5L3BB 2VQFT 3LG7A 4B3MT 2A2FX 2E5LT 4BA9A 5J0ZA 3AA7B 2X51A 4X1YE 4NXMT 4JI4T 3SS1A 4KI0F 3CVRA 4AQFC 1XNQT 3PUSA 4EZ4A 5LXTE 5FY7A 4CI2B 1U5PA 1ZKEA 2JIWA 3GMIA 1HNXT 3PJAJ 1HTJF 5CJ5A 4HKAA 2BS2A 4HWFA 3AE7A 3RKGA 2KWHA 4EGWA 3QUJA 1G8XA 4TWHA 2CRBA 4ILAA 5J2UE 3AA0B 2CWOA 2W4XA 3PU8A 1OEDA 3I9YA 3OBVE 3EDVA 4EYUA 2JPFA 5AQLB 1G73A 2DNXA 3MACA 4Z91A 4CN1A 4UV8B 4I0UA 3PUGA 1UK5A 4IE6A 4TX5A 2QGSA 2H7OA 2LHRA 4NPPA 2YDQA 4H9QC 3RHWA 2L3LA 2Q9QA 4E7SA 2Q9QB 3KV5A 5CFBA 5CA1E 4JI3T 2LOSA 5LHHB 4GK5E 4CN6A 2MBGA 4JEUB 5EK4A 2FBWA 3VKHA 3KBTA 3RGLA 4ZHQE 2BBHA 3B13A 4XBFB 2XQ6A 3V5SA 2JQ9A 2C0SA 2NTYA 1QSDA 4YT0A 5FP3A 4DVDA 1T7SA 1N32T 2IIUA 2K3WA 4P0BA 3PJAA 4H9NC 4X1KE 5ABFA 2BG9A 2FJDA 3VRBA 2CLYC 4XAXB 3PUAA 2WU2A 4PJNA 1M7KA 1KEYA 2XQ3A 4XZCA 2ZM2A 3CPZA 1V9DA 4TUYE 3KBUA 1IZNB 3N9LA 4HE8A 3H3AA 3RRCA 3EVYA 2KWIB 1IJ6A 2E9XB 3PE0A 4ISTA 4G63A 4AKHA 4KX6A 5HWYA 2LOPA 4JI5T 5JDMA 5FYMA 4PFOA 2ODUA 4O8SA 4LMJA 4PK4A 1M62A 3HKCE 5ABHA 3P4PA 2W62A 5E0OA 4ZI3D 2X68A 4DR6T 2FUPA 1OEDC 1VRBA 3OYZA 3NBXX 4HFHA 2XAHB 1S35A 2CHOA 1DU2A 2CHNA 1WLXA 4O2BE 4MLKA 5HEHA 2ODVA 5AQJB 3P4SA 4HFIA 4K0UA 2XHEB 4DNDA 2XPKA 1Y01A 2CPTA 2ZM8A 5AFUL 4QH1A 4QKNA 3UU8A 2K9AA 4TWDA 3FZFB 3MZKB 5L4EA 3DJBA 4AKRB 3IA3A 1BR0A 2X0YA 4L5GA 2NP9A 3RF1A 4I43B 3GN5A 2BVLA 2XM1A 1UX4A 3GN5B 3RIAA 2WMOA 5IYZE 4IGUA 5LGTB 3WAJA 1U4QA 1KK7A 3U78A 4ANJA 4UVCB 2DI4A 3N2KE 5L3EB 2ZM0A 3N2GE 4X62T 3TLUA 4QWNB 2W67A 3AEFA 3FZMB 4U7IA 1OWAA 4AISA 2BG9C 3ETVA 1LVFA 4IE4A 2K48A 5FVKA 2M6BA 1X79A 2I0MA 4H9OC 4IE0A 5ETWA 2BKNA 4WBOA 3FBLA 4TV9E 3AE2A 1T8BA 5L47A 1Y64B 4Z90A 3HKDE 3C50A 1W9RA 2V7LA 1J1JA 3HKEE 2JRKA 1HX1B 5L3GB 3AEGA 5FXZA 4ISSA 3UTKA 5AQSB 3RH3A 2WBLA 1BR2A 3NZPA 3O9XA 2XASB 3QOFA 3AE9A 2VL8A 3LFMA 4IDQA 3PUZF 4EAHA 4ZZBA 3ZT7A 3PV0F 1D0YA 1WCRA 2NW7A 3UQ4A 4WBNE 3AA6B 1IJ5A 4ZOLE 5LGNB 3AE6A 4LF5T 4QXHB 2D9DA 1WYCA 3N9QA 3AE3A 2A3DA 2CMRA 4ZI7E 3CQCB 4CI3B 1CUNA 4DMVA 4EEDA 3FZHB 5LYJE 5AQUB 4LFCT 2KSRA 3QB5K 5LB7B 1MNDA 5HXSA 4IL9A 1O3XA 2J4GA 3ONXA 4B3TT 3BQKA 4CQIA 4LF7T 2V6YB 5LBQB 4AKLA 3R6NA 4ZI2D 4DR4T 1JNRA 4X1IE 3UT5E 3FXDB 3PUQA 2DLRA 4U31A 4WZXA 5HCMA 3SFEA 4HFVA 5HWXA 3F2EA 1T72A 3TLSA 4UVBB 2CXFA 2V1DB 2NW9A 2K24A 3UUMA 3LJCA 4TNWA 4UV9B 5JTGA 3JC6D 3E08A 1VCSA 2X9WA 3T1HT 2V5CA 4KHZF 1B7TA 3B5MA 4H63V 2BBJA 4DV6T 3RIFA 5HEGA 2XAJB 2RA1A 2PBIA 4MBQA 2H89A 5LHGB 4LMLA 2X67A 3C4ZA 4LFAT 2UXDT 2ZM6T 4TWFA 2M67A 4YSZA 3AXJA 4ASKA 4O4JE 4ZZCA 3O4XE 5BR8T 4DV5T 4ZS3A 3MKDA 4AIUA 5FXXA 1FEWA 4A98A 3CX6B 3Q2MA 3MXZA 5JDNA 2XQAA 5CGMA 2ES0A 4QX8B 4UF0A 2CLYB 4OHFA 3KINB 4IREA 4KP3C 5F3JA 3B57A 3SFDA 1NENA 1WFDA 4X5TA 2XSBA 3DP7A 2LT3A 3EABA 5LA6E 4F6RC 3F31A 3VR8A 2H3RA 2ZMAA 2EHOD 2V5DA 2B76A 2X66A 1QLBA 2XAFB 4O4IE 4OYKA 4JI7T 4Z8XA 4PK6A 5LHIB 3ZSSA 1NAFA 5JDLA 1LKXA 3TKLB 3RRWA 1N36T 4KBMB 4YLHA 3CQGB 2DWKA 3KVBA 1IAPA 5F8PA 2X9XA 5TAOA 2BKOA 4NUVA 2LHNA 5H6QB 3VKGA 3AVRA 3PUWF 1J5ET 3AAAB 3EAMA 2HPJA 5CA0E 1ZV4X 2W0GA 2P9BA 4WNKA 2Y48B 4F8HA 3EUHA 3WAKA 3UUNA 1MIYA 2JMKA 4HGAA 2NR4A 5A1LA 4ZI3C 4DR2T 4K0KT 1OEDB 1XDOA 3JAEA 2WZIA 2YINA 3ZMTB 5L4HA 5HEOA 3OYXA 4PJLA 3KV4A 3UQ7A 3K3NA 3AA1B 2WU5A 4JI1T 4WYVA 4EIWA 2N1GA 4JUYA 2C5KT 3ZC1A 3NRXA 3KDSE 2KLQA 4HTEA 2CA5A 4B3ST 3RYCE 3ZN1B 3LBXA 2VKJA 4U72A 1HX8A 1MMAA 2WZHA 4GYSA 3ZMSB 2WS3A 2L9QA 2E8IA 4DR3T 1SE7A 2QVAA 1HNWT 3J9X1 3RKOA 3PTRB 2YK0A 5CB4E 2MYSA 4TV8E 2LM9A 3WI3A 4MALA 2V7IA 2XQ8A 4OX9T 4EEBA 3Q5WA 2XAQB 3LK2B 4DV7T 4DR1T 1W0AA 4DV3T 4ILUA 1MIVA 1SA0E 4O4LE 1X9BA 4QH4A 2DCFA 3N9NA 5JQGE 4ILBA 5ABFB 3ZT6A 2BG9B 3HA4A 5HXHA 2CXDA 1YW0A 4JBWF 3X1DA 3VR9A 1VOMA 2DWGA 4PNIA 1I6ZA 3ZYMA 3K3OA 5AQTB 3I1AA 3K3QC 1FJGT 3PUVF 1YQ4A 4CXWA 2M6IA 3S4UA 2A9UA 4A5XA 4JV5T 4KUMB 2Y8DA 5FNVE 3ANWA 4M1PA 2CXLA 5DJQC 4PJJA 4U33A 5EZYE 2IC6A 1Z0PA 3PUYF 2WCAA 4IIJE 5JVDE 1HCIA 1MIWA 1MMGA 5BMVE 2XAGB 2EHOA 5FMNA 1D1AA 5L2LA 3NKZA 4P09A 5C3JA 2SPCA 2AE9A 3N2OA 2OLTA 4DO0A 1MNEA 5HEJA 2UUAT 2H7VC 5LG3A 1HFAA 2WY2A 3M3ZB 1WYBA 5DABA 5HXCA 4GYRA 4MHCA 2YEVC 4I55E 1KF6A 3ZSTA 4O4HE 5ABEA 5FVLA 5EK3A 4DUZT 3C98B 2WDRA 3A5XA 1YD8G 2K5BB 4FI5A 3SRZA 4Q25A 2NW8A 5H6RB 2YKSA 2X0LB 3OVUA 2AXDS 3AEAA 3ETUA 3PDYA 4EXTA 4ZI2C 3TLTA 1CHUA 2V26A 5KXJA 3O1IA 3P7IA 3O1HA 4H9PC 2UXBT 5L3FB 4DV1T 4IDZA 3QNUA 5FY1A 3UU6A 2BS4A 2I59A 3JCFA 4ADZA 4HN9A 2LSYA 3JC6C 2YU1A 3RYIE 4TNVA 2HH7A 5HAXA 5FY0A 1I94T 1NEKA 3CX8B 4QXCB 2IDOB 3L3PA 4PAGA 4QXBB 4UR9A 3AE4A 3UU5A 5AQFB 2NTXA 4GKKT 2ZLYA 4MFRA 5IHYA 3HI2A 2FJEA 1KNZA 1VCTA 2HN1A 4DUYT 5KX5E 3ZYKA 2XQ5A 3TLVA 2QRXA 5HYAA 3NWIA 2EHOC 4IE7A 5AQRB 2F4VT 4IDNA 1FMWA 1Z8UA 4JEHB 1YXRA 3UULA 3BQIA 2BVMA 4I4TE 3T8OA 3AECA 3NVOA 1JNZA 4EB6E 3EDUA 1MMDA 1QUUA 3RIUA 4IHJE 3F57A 1YKHB 2V7KA 5JDFA 3I9WA 5GONE 2W2UA 4AQGA 3AE5A 4DMWA 2CE7A 1KNRA 3OTOT 2N9DA 4UELA 4L0RA 2WWVA 3D0TA 1N33T 5J2TE 5LBMA 5LG4A 1HG5A 3Q5EA 5AQNB 3UUBA 2PFVA 2Q9QD 2IHR1 3AB3B 2MTQA 3MJXA 3EHZA 2V7MA 3FZKB 4C91A 3OKQA 4P1NA 3ZLIA 1AJ3A 3ZT5A 2WQYA 4H9SE 5HXRA 4AKIA 5JH7E 2LKHA 5DQVA 3PU3A 5JDHA 4YTPA 4X65T 4JI8T 2WSSV 3FBZA 2MAWA 1ZP0A 4C90A 4YY3T 3K8PC 2VK9A 4JI6T 5LMNT 3ESLA 2R6GF 1YKEB 3HKBE 3O1JA 1E2AA 1XZYA 3RPUA 2C5IT 3CIRA 1XMQT 3JAFA 3AE1A 2V7JA 1WRDA 3AXJB 3R84B 1UCUA 2YN6A 2FJBA 4JI2T 4NXNT 5JR9A 2C5JA 3U3IA 5FL0A 4KMCA 2BKPA 2W66A 4LF9T 2LM2A 3AAEB 2VASA 3Q5XA 3JADA 4UF0B 4ZS2A 2LSGA 3AE8A 2UXXB 2N2NA 4UIGA 2BS3A 1E1HB 3LK42 4U2ZA 1UURA 2E9XD 2XJ7A 1UUSA 2CCQA 2XZEA 3KFWX 2X0HA 3ZJ2A 4HWDA 2IC9A 3A8YC 3KV9A 5M4YA 3ZCJA 1D0XA 2L8KA 2OA5A 5JDQA 3UUXB 2HPLA 3Q9DA 4UXNB 2JQHA 2MPKA 2IAKA 4HWHA 4X64T 3I0QA 3PURA 2IMLA 3N9MA 2YDRA 4ERRA 4PJMA 5AQMB 2WDQA 3L39A 2VQET 1WR0A 3Q5DA 1N34T 3RIUC 3RYHE 3EI0A 3N9PA 4A56A 2LRKA 2YDSA 3P4RA 1D1BA 3MK7C 3AEBA 3ZYLA 4AXPA 3IEEA 4GK0E 3A7MA 4H63H 3G06A 1L0VA 4DV2T 3C4WA 4NIQA 2JJ9A 2UXNB 2KNDA 3W15B 4EOZB 2WMNA 2UU9T 4LF6T 3IF8B 4DV0T 3LBXB 3H37A 2XTLA 2VKHA 3QB5A 3SWHA 1WR6A 4YXDA 1IBKT 2G0UA 3ZKRA 3CX7B 4EZHA 5KDMC 3UFEA 4U2YA 4QX7B 2UUBT 3PUXF 2D0UA 3IBPA 4JI0T 4HFEA 4O2AE 5L3CB 4COFA 4PW8A 4GOUA 3VHLA 2WDVA 4EYYR 2LKGA 2RPAA 2CWYA 4HWCA 5LJNA 2PTFA 1US7B 4WW0A 4U7YA 2X9HA 3ABVA 2ACZA 1OEDE 3E22E 5JR9C 4UVAB 1HR0T 2KT9A 4LF8T 5HEUA 2DL1A 1ZEEA 4IDPA 2VURA 3RI5A 5ABGA 3FZLB 2PJQA 3UU3A 3RQUA 4BAYB 3L8RA 4X20E 2LSJA 3J7Yq 2CBIA 4DBRA 4YTNA 2XQYA 2XQ9A 3RLFF 1D1CA 3ANWB 3LK3B 4B6XA 5AQOB 5LGUB 3RQWA 3UU4A 2KZ7B 2IW5B 2XSAA 4EV6A 4YJ3E 4YJ2E 2EHOB 4YTMA 5AQVB 4HFDA 2WAUA 4OFZA 2E9XA 2J1DG 3ZC0A 4CXYA 2IUBA 2CBJA 3IHRA 4N78D 1UX5A 1ZHCA 2JMHA 1BR4A 2V6XA 1OXZA 3NRYA 2CM0A 4ILCA 1IBMT 4JYAT 5HXEA 5J1GA 2VL0A 4P0AA
chains in the Genus database with same CATH topology
2X67A 3C4ZA 1KNZA 2M67A 2DHRA 4H9QC 4O4JE 4ASKA 3O4XE 5KX5E 3ZYKA 2KMFA 3MKDA 4ZS3A 5FXXA 5HYAA 1FEWA 2X9YA 3N5LA 2EHOC 2L3LA 3CKDA 3CX6B 3Q2MA 4IE7A 3MXZA 2Q9QA 4QHOA 5JDNA 4E7SA 1FMWA 4TN7B 2ES0A 2Q9QB 4QX8B 3SOLA 4CI1B 4JEHB 4UF0A 2CLYB 3KV5A 3UULA 3BQIA 5CA1E 2BVMA 4OHFA 2Z6EA 3FXEB 2LOSA 3RYFE 5LHHB 1S94A 4GK5E 4BJMA 3KINB 4KP3C 4I4TE 5F3JA 2MBGA 4JEUB 3T8OA 3B57A 5EK4A 3VKHA 3KBTA 4ZHQE 5LNKA 2GK9A 3B13A 2B1EA 4EB6E 3CWZB 2LEHA 3DP7A 4XBFB 2LT3A 5LA6E 3EDUA 4YFSA 3V5SA 3VU7H 2C0SA 4F6RC 1MMDA 2NTYA 3F31A 1QSDA 2H3RA 2ZMAA 5FXVA 2EHOD 2LSIA 2X66A 3DTOA 1QUUA 4V1Av 2XAFB 4O4IE 5FP3A 4DVDA 3CQXC 4IHJE 4P0BA 3F57A 4H9NC 4OYKA 2NWBA 1YKHB 2MOZA 3C64A 4Z8XA 2V7KA 4X1KE 5JDFA 3V5UA 3I9WA 4PK6A 5LHIB 2Q9QC 1NAFA 5JDLA 1LKXA 2CLYC 3TKLB 4XAXB 5GONE 3RRWA 4KBMB 4AQGA 3PUAA 3CQGB 4YLHA 2DWKA 4DMWA 4PJNA 2CE7A 3KVBA 1IAPA 5F8PA 2X9XA 5TAOA 2N9DA 2WM9A 4I50E 4NUVA 2LHNA 4UELA 5H6QB 4L0RA 3VKGA 3D0TA 5J2TE 3AVRA 1NWMX 3AAAB 5LBMA 5LG4A 1HG5A 4XZCA 2HPJA 2W61A 2ZM2A 5CA0E 1ZV4X 3CPZA 2W0GA 1V9DA 2P9BA 4WNKA 2Y48B 2LJLA 2PFVA 3EUHA 3WAKA 3UUNA 1MIYA 2JMKA 2Q9QD 4HGAA 3AB3B 2MTQA 3MJXA 5A1LA 3QK6A 4TUYE 3KBUA 4ZI3C 4DBQA 1IZNB 3N9LA 2V7MA 4HE8A 4C91A 1LRZA 3H3AA 3OKQA 2JQQA 3RRCA 3ZLIA 2YINA 1AJ3A 3RC3A 3ZMTB 3EVYA 4CXXA 4H9SE 5HXRA 4AKIA 2KWIB 2KINB 1IJ6A 2E9XB 3PE0A 4ISTA 5JH7E 4G63A 4AKHA 5DQVA 3PU3A 5HWYA 2LOPA 2Y6XA 2A72A 5JDHA 5JDMA 5FYMA 3OYXA 4PFOA 5EK2A 2WSSV 2ODUA 4PJLA 3FBZA 3KV4A 3ZPOA 1T98A 4O8SA 4C90A 3K8PC 4PK4A 3K3NA 3AA1B 2VK9A 3N9OA 5JRCA 3C4XA 3ESLA 3HL6A 3HKCE 1YKEB 3HKBE 5JRCB 5C8YE 3KV6A 2W62A 3O1JA 2D5UA 4AI6A 5E0OA 4NUUA 3HR0A 4ZI3D 1HF8A 4EIWA 2N1GA 4JUYA 2C5KT 3RPUA 2C5IT 4GIWA 3BK9A 2X68A 3ZC1A 4BJNA 3NRXA 3KDSE 2KLQA 4HTEA 2CA5A 2V7JA 1WRDA 1HS7A 3R84B 3RYCE 1UCUA 3FB2A 3ZN1B 1VRBA 3OYZA 3NBXX 2XAHB 3LBXA 2VKJA 1S35A 4U72A 5JR9A 2C5JA 3RX6A 1HX8A 1MMAA 3U3IA 1WLXA 2E9XC 4KMCA 4U74A 4O2BE 4MLKA 4GYSA 3ZMSB 4IE5A 4PK5A 2L9QA 2E8IA 3AAEB 2VASA 3Q5XA 2ODVA 4UF0B 3ZMZB 3OJAA 4ZS2A 3ZN0B 2LSGA 3QC9A 5ADXL 4K0UA 2UXXB 2XHEB 3J9X1 4DNDA 3RKOA 2ZM8A 3PTRB 2N2NA 2YK0A 4UIGA 5CB4E 1HG2A 3BQLA 5AFUL 1E1HB 2MYSA 4TV8E 1FMVA 3LK42 4AQFA 4CZZB 4TZ4C 1FIOA 2LM9A 4QKNA 3WI3A 3GWHA 2K9AA 4MALA 2V7IA 3MZKB 4YHJA 3Q5WA 2XAQB 2PG8A 3LK2B 4JLEA 3CMLA 4FJOA 2E9XD 3DJBA 4AKRB 2BDEA 5FXWA 1BR0A 2CCQA 4ILUA 3KFWX 1MIVA 1SA0E 4O4LE 4L5GA 2NP9A 3ZCIA 3ZJ2A 2IC9A 1LVKA 2DCFA 3N9NA 3GN5A 3KV9A 4I43B 5JQGE 5JREA 3HA4A 5HXHA 2BVLA 1UX4A 3GN5B 5M4YA 3ZCJA 1D0XA 2L8KA 2CXDA 1YW0A 2OA5A 2VKDA 2WMOA 5JDQA 1VOMA 3UUXB 2HPLA 3Q9DA 2DWGA 4UXNB 5IYZE 4PNIA 2IAKA 4IGUA 5LGTB 3WAJA 5LOVE 2QA7A 1EZ3A 3ZYMA 1U4QA 3K3OA 1KK7A 3I0QA 3PURA 2VWAA 3I1AA 3K3QC 3U78A 4ANJA 1BR1A 3N9MA 4UVCB 4ERRA 2DI4A 3N2KE 4PJMA 5L3EB 2W00A 2ZM0A 2D2SA 4CXWA 3KVAA 3N2GE 3RC8A 3S4UA 4KUMB 2Y8DA 4QWNB 5FNVE 3GA8A 3ANWA 1H7CA 4M1PA 3RYHE 5JDGA 4G2AA 2CXLA 1OWAA 5DQWA 5DJQC 2WWUA 3N9PA 5LJMA 2RP4A 3ZMVB 4A56A 4PJJA 3ETVA 5EZYE 2IC6A 1LVFA 1Z0PA 3AAIA 4IE4A 1D1BA 2K48A 4IIJE 3MK7C 1X79A 5JVDE 1HCIA 1MIWA 3C51A 1MMGA 3FHNA 5LCYA 4E7ZA 4H9OC 3ZYLA 2XAGB 5BMVE 2EHOA 5L3DB 4IE0A 5FMNA 5ETWA 1D1AA 4WBOA 4AXPA 3FBLA 3IEEA 4TV9E 5L2LA 4GK0E 4P09A 3ZJ1A 5KMGP 4H63H 2SPCA 4PFPA 3N2OA 1D0ZA 1Y64B 3E0ZA 4DO0A 3C4WA 1MNEA 2XUEA 3HKDE 3C50A 2BZBA 2JJ9A 2V7LA 2YU2A 2UXNB 2KNDA 2D0TA 3W15B 4J2CA 2H7VC 2CEAA 4EOZB 3L09A 2WMNA 3HKEE 2JRKA 5L3GB 1HFAA 2NOXA 1WYBA 3IF8B 2VB6A 3P8CD 5FXZA 5DABA 5HXCA 4GYRA 4MHCA 2YEVC 2W63A 4ISSA 3UTKA 3LBXB 4I55E 4UEMA 2WBLA 3RH3A 1BR2A 3NZPA 3O9XA 2LE8A 3H37A 2KXPB 4OYJA 5JR9B 2XASB 2XTLA 2VKHA 4OK0A 2VL8A 3LFMA 3SWHA 1WR6A 4EAHA 2G0UA 4O4HE 4EZHA 3CX7B 3AVSA 5KDMC 3UFEA 4QX7B 5EK3A 3C98B 2D0UA 3IBPA 3ZEFB 1D0YA 3A5XA 1YD8G 4O2AE 3MA9A 2K5BB 1SHZC 5L3CB 4FI5A 4PW8A 2NW7A 4GOUA 3VHLA 4EYYR 2LSKA 3SRZA 3ZMUB 4WBNE 2CWYA 3I0OA 2NW8A 2VKOA 4H9RC 5H6RB 3AA6B 1IJ5A 4WW0A 1MMNA 1US7B 4HEAA 4ZOLE 5LJNA 2X0LB 5LGNB 5LP6E 3M65A 4QXHB 3ETUA 1WYCA 4AKGA 3N9QA 2X9HA 4L9IA 3NZQA 3PDYA 2ACXA 3E22E 5JR9C 4EXTA 2A3DA 4UVAB 2CMRA 5L3BB 2KT9A 4ZI2C 4ZI7E 3LG7A 2V26A 2A2FX 3O1IA 3P7IA 3O1HA 3CQCB 4BA9A 4H9PC 4CI3B 1CUNA 4DMVA 5L3FB 5LYJE 1ZEEA 3AA7B 2X51A 4X1YE 2PJQA 3SS1A 4BAYB 1MNDA 5HXSA 1O3XA 3ONXA 3CVRA 4IDZA 4X20E 4AQFC 3PUSA 2LSJA 4EZ4A 3BQKA 5LXTE 5FY7A 5FY1A 4CQIA 3J7Yq 2I59A 4CI2B 1U5PA 4ADZA 4HN9A 4DBRA 5LBQB 1ZKEA 2LSYA 3JC6C 4AKLA 2XQYA 3R6NA 4ZI2D 3GMIA 3FXDB 3PUQA 4X1IE 2DLRA 1D1CA 2YU1A 3UT5E 3ANWB 1HTJF 3LK3B 4B6XA 4HKAA 3RYIE 5LGUB 2KZ7B 2KWHA 4HFVA 5HWXA 3F2EA 2IW5B 3QUJA 1G8XA 4UVBB 5J2UE 4YJ3E 3AA0B 2CXFA 2V1DB 2CWOA 2NW9A 2HH7A 2K24A 3UUMA 5HAXA 4YJ2E 5FY0A 3LJCA 3PU8A 3CX8B 4QXCB 4UV9B 2EHOB 3L3PA 3I9YA 4PAGA 3OBVE 2WAUA 4OFZA 2E9XA 2J1DG 3JC6D 3E08A 3EDVA 4EYUA 2JPFA 2X9WA 4QXBB 3ZC0A 4CXYA 1B7TA 1G73A 3IHRA 2DNXA 3MACA 4N78D 1UX5A 1ZHCA 2JMHA 2NTXA 4H63V 1BR4A 4UV8B 2ZLYA 1OXZA 3NRYA 3PUGA 4IE6A 2CM0A 4MFRA 4TX5A 5IHYA 2XAJB 2RA1A 2PBIA 4MBQA 5HXEA 2QGSA 5J1GA 2H7OA 3HI2A 2LHRA 5LHGB 4P0AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODV A;  1U4Q A;  3PE0 A;  3FB2 A;  1HCI A;  2ODU A;  3UUN A;  3UUM A;  1U5P A;  3F31 A;  3LBX A;  1S35 A;  1WLX A;  1CUN A;  1QUU A;  1OWA A;  3LBX B;  3UUL A;  2SPC A;  3EDV A;  1AJ3 A; 
#chains in the Genus database with same CATH topology
 2BG9 E;  2DHR A;  2I6H A;  2KMF A;  2X9Y A;  3N5L A;  3CKD A;  1ZOY A;  4LMK A;  4QHO A;  4TN7 B;  3SOL A;  4CI1 B;  4YHH T;  2HHH T;  5F5W A;  4KHP T;  4IDO A;  2XQ7 A;  2Z6E A;  3FXE B;  5C2T A;  3RYF E;  1S94 A;  4BJM A;  4AQY T;  5LNK A;  2GK9 A;  2B1E A;  2JQK A;  2LEH A;  3CWZ B;  4HFC A;  1W09 A;  2QYW A;  4YFS A;  3VU7 H;  5FXV A;  2LSI A;  2YOE A;  3DTO A;  4V1A v;  3CQX C;  4LFB T;  2NWB A;  3TLW A;  2MOZ A;  3C64 A;  5AQP B;  1XDP A;  3V5U A;  1KFY A;  5IWA T;  2Q9Q C;  2UXC T;  2LLY A;  3VRA A;  5AQQ B;  2WM9 A;  4I50 E;  1NWM X;  2W61 A;  4LF4 T;  2LJL A;  2XQ4 A;  3QK6 A;  3H3M A;  5AQH B;  4DBQ A;  1LRZ A;  2JQQ A;  3RC3 A;  4CXX A;  1SUM B;  2KIN B;  4HFB A;  2Y6X A;  2A72 A;  3P4Q A;  5EK2 A;  1E7P A;  1T98 A;  3OPC A;  3ZPO A;  2WB5 A;  4YSX A;  3N9O A;  5JRC A;  1XWM A;  5AQI B;  3C4X A;  3HL6 A;  1YQ3 A;  5JRC B;  1XNR T;  5C8Y E;  3KV6 A;  4AI6 A;  2D5U A;  4NUU A;  3HR0 A;  1HF8 A;  3UFG A;  4GIW A;  3BK9 A;  4BJN A;  1HS7 A;  3FB2 A;  3RX6 A;  2J62 A;  2E9X C;  4U74 A;  4YSY A;  4DV4 T;  4IE5 A;  4PK5 A;  4IT4 A;  1W0B A;  3ZMZ B;  3OJA A;  2HN2 A;  3ZN0 B;  3QC9 A;  5ADX L;  4CN4 A;  5LMU T;  1HG2 A;  3BQL A;  4DR5 T;  4CZZ B;  2J47 A;  1FMV A;  4AQF A;  4TZ4 C;  1FIO A;  3GWH A;  2VVN A;  1XMO T;  4YHJ A;  5FL1 A;  2PG8 A;  4JLE A;  3CML A;  4FJO A;  1J5W A;  2BDE A;  4ZEY A;  2OV9 A;  5FXW A;  3ZCI A;  5AQG B;  4IL4 A;  4HWI B;  3K1S A;  1LVK A;  5AQK B;  1GQE A;  5JRE A;  2VKD A;  2E2A A;  2VVS A;  1R8I A;  1IBL T;  5LOV E;  2QA7 A;  1EZ3 A;  4DID B;  3AEE A;  3CK6 A;  2VWA A;  1BR1 A;  2V6Y A;  2WP9 A;  2W00 A;  2D2S A;  3KVA A;  3RC8 A;  3GA8 A;  1H7C A;  5JDG A;  4G2A A;  5DQW A;  2V8S V;  2WWU A;  1UGO A;  2RP4 A;  3ZMV B;  5LJM A;  3P4W A;  3AAI A;  3C51 A;  3FHN A;  5LCY A;  4E7Z A;  2FJA A;  2XM2 A;  5L3D B;  2UUC T;  3AED A;  5KMG P;  3ZJ1 A;  2LRL A;  4PFP A;  4DR7 T;  1D0Z A;  3T1Y T;  3E0Z A;  5IUX A;  2XUE A;  2BZB A;  2YU2 A;  2D0T A;  4J2C A;  2CEA A;  2E5V A;  4GKJ T;  3L09 A;  5FKY A;  2NOX A;  2H88 A;  2VB6 A;  3P8C D;  2W63 A;  3P50 A;  4UEM A;  2LE8 A;  4OYJ A;  2KXP B;  5JR9 B;  4OK0 A;  2XY8 B;  3AVS A;  3LSV A;  3ZEF B;  4A97 A;  4U3C A;  3ONL C;  3MA9 A;  5HCJ A;  4QH5 A;  1SHZ C;  2LSK A;  3ZMU B;  3I0O A;  3LDQ B;  3ONJ A;  2VKO A;  4H9R C;  4ZXL A;  1MMN A;  4HEA A;  1HNZ T;  4B3R T;  5LP6 E;  3M65 A;  1KNP A;  4AKG A;  4L9I A;  4X66 T;  3NZQ A;  2ACX A;  5L3B B;  2VQF T;  3LG7 A;  4B3M T;  2A2F X;  2E5L T;  4BA9 A;  5J0Z A;  3AA7 B;  2X51 A;  4X1Y E;  4NXM T;  4JI4 T;  3SS1 A;  4KI0 F;  3CVR A;  4AQF C;  1XNQ T;  3PUS A;  4EZ4 A;  5LXT E;  5FY7 A;  4CI2 B;  1U5P A;  1ZKE A;  2JIW A;  3GMI A;  1HNX T;  3PJA J;  1HTJ F;  5CJ5 A;  4HKA A;  2BS2 A;  4HWF A;  3AE7 A;  3RKG A;  2KWH A;  4EGW A;  3QUJ A;  1G8X A;  4TWH A;  2CRB A;  4ILA A;  5J2U E;  3AA0 B;  2CWO A;  2W4X A;  3PU8 A;  1OED A;  3I9Y A;  3OBV E;  3EDV A;  4EYU A;  2JPF A;  5AQL B;  1G73 A;  2DNX A;  3MAC A;  4Z91 A;  4CN1 A;  4UV8 B;  4I0U A;  3PUG A;  1UK5 A;  4IE6 A;  4TX5 A;  2QGS A;  2H7O A;  2LHR A;  4NPP A;  2YDQ A;  4H9Q C;  3RHW A;  2L3L A;  2Q9Q A;  4E7S A;  2Q9Q B;  3KV5 A;  5CFB A;  5CA1 E;  4JI3 T;  2LOS A;  5LHH B;  4GK5 E;  4CN6 A;  2MBG A;  4JEU B;  5EK4 A;  2FBW A;  3VKH A;  3KBT A;  3RGL A;  4ZHQ E;  2BBH A;  3B13 A;  4XBF B;  2XQ6 A;  3V5S A;  2JQ9 A;  2C0S A;  2NTY A;  1QSD A;  4YT0 A;  5FP3 A;  4DVD A;  1T7S A;  1N32 T;  2IIU A;  2K3W A;  4P0B A;  3PJA A;  4H9N C;  4X1K E;  5ABF A;  2BG9 A;  2FJD A;  3VRB A;  2CLY C;  4XAX B;  3PUA A;  2WU2 A;  4PJN A;  1M7K A;  1KEY A;  2XQ3 A;  4XZC A;  2ZM2 A;  3CPZ A;  1V9D A;  4TUY E;  3KBU A;  1IZN B;  3N9L A;  4HE8 A;  3H3A A;  3RRC A;  3EVY A;  2KWI B;  1IJ6 A;  2E9X B;  3PE0 A;  4IST A;  4G63 A;  4AKH A;  4KX6 A;  5HWY A;  2LOP A;  4JI5 T;  5JDM A;  5FYM A;  4PFO A;  2ODU A;  4O8S A;  4LMJ A;  4PK4 A;  1M62 A;  3HKC E;  5ABH A;  3P4P A;  2W62 A;  5E0O A;  4ZI3 D;  2X68 A;  4DR6 T;  2FUP A;  1OED C;  1VRB A;  3OYZ A;  3NBX X;  4HFH A;  2XAH B;  1S35 A;  2CHO A;  1DU2 A;  2CHN A;  1WLX A;  4O2B E;  4MLK A;  5HEH A;  2ODV A;  5AQJ B;  3P4S A;  4HFI A;  4K0U A;  2XHE B;  4DND A;  2XPK A;  1Y01 A;  2CPT A;  2ZM8 A;  5AFU L;  4QH1 A;  4QKN A;  3UU8 A;  2K9A A;  4TWD A;  3FZF B;  3MZK B;  5L4E A;  3DJB A;  4AKR B;  3IA3 A;  1BR0 A;  2X0Y A;  4L5G A;  2NP9 A;  3RF1 A;  4I43 B;  3GN5 A;  2BVL A;  2XM1 A;  1UX4 A;  3GN5 B;  3RIA A;  2WMO A;  5IYZ E;  4IGU A;  5LGT B;  3WAJ A;  1U4Q A;  1KK7 A;  3U78 A;  4ANJ A;  4UVC B;  2DI4 A;  3N2K E;  5L3E B;  2ZM0 A;  3N2G E;  4X62 T;  3TLU A;  4QWN B;  2W67 A;  3AEF A;  3FZM B;  4U7I A;  1OWA A;  4AIS A;  2BG9 C;  3ETV A;  1LVF A;  4IE4 A;  2K48 A;  5FVK A;  2M6B A;  1X79 A;  2I0M A;  4H9O C;  4IE0 A;  5ETW A;  2BKN A;  4WBO A;  3FBL A;  4TV9 E;  3AE2 A;  1T8B A;  5L47 A;  1Y64 B;  4Z90 A;  3HKD E;  3C50 A;  1W9R A;  2V7L A;  1J1J A;  3HKE E;  2JRK A;  1HX1 B;  5L3G B;  3AEG A;  5FXZ A;  4ISS A;  3UTK A;  5AQS B;  3RH3 A;  2WBL A;  1BR2 A;  3NZP A;  3O9X A;  2XAS B;  3QOF A;  3AE9 A;  2VL8 A;  3LFM A;  4IDQ A;  3PUZ F;  4EAH A;  4ZZB A;  3ZT7 A;  3PV0 F;  1D0Y A;  1WCR A;  2NW7 A;  3UQ4 A;  4WBN E;  3AA6 B;  1IJ5 A;  4ZOL E;  5LGN B;  3AE6 A;  4LF5 T;  4QXH B;  2D9D A;  1WYC A;  3N9Q A;  3AE3 A;  2A3D A;  2CMR A;  4ZI7 E;  3CQC B;  4CI3 B;  1CUN A;  4DMV A;  4EED A;  3FZH B;  5LYJ E;  5AQU B;  4LFC T;  2KSR A;  3QB5 K;  5LB7 B;  1MND A;  5HXS A;  4IL9 A;  1O3X A;  2J4G A;  3ONX A;  4B3T T;  3BQK A;  4CQI A;  4LF7 T;  2V6Y B;  5LBQ B;  4AKL A;  3R6N A;  4ZI2 D;  4DR4 T;  1JNR A;  4X1I E;  3UT5 E;  3FXD B;  3PUQ A;  2DLR A;  4U31 A;  4WZX A;  5HCM A;  3SFE A;  4HFV A;  5HWX A;  3F2E A;  1T72 A;  3TLS A;  4UVB B;  2CXF A;  2V1D B;  2NW9 A;  2K24 A;  3UUM A;  3LJC A;  4TNW A;  4UV9 B;  5JTG A;  3JC6 D;  3E08 A;  1VCS A;  2X9W A;  3T1H T;  2V5C A;  4KHZ F;  1B7T A;  3B5M A;  4H63 V;  2BBJ A;  4DV6 T;  3RIF A;  5HEG A;  2XAJ B;  2RA1 A;  2PBI A;  4MBQ A;  2H89 A;  5LHG B;  4LML A;  2X67 A;  3C4Z A;  4LFA T;  2UXD T;  2ZM6 T;  4TWF A;  2M67 A;  4YSZ A;  3AXJ A;  4ASK A;  4O4J E;  4ZZC A;  3O4X E;  5BR8 T;  4DV5 T;  4ZS3 A;  3MKD A;  4AIU A;  5FXX A;  1FEW A;  4A98 A;  3CX6 B;  3Q2M A;  3MXZ A;  5JDN A;  2XQA A;  5CGM A;  2ES0 A;  4QX8 B;  4UF0 A;  2CLY B;  4OHF A;  3KIN B;  4IRE A;  4KP3 C;  5F3J A;  3B57 A;  3SFD A;  1NEN A;  1WFD A;  4X5T A;  2XSB A;  3DP7 A;  2LT3 A;  3EAB A;  5LA6 E;  4F6R C;  3F31 A;  3VR8 A;  2H3R A;  2ZMA A;  2EHO D;  2V5D A;  2B76 A;  2X66 A;  1QLB A;  2XAF B;  4O4I E;  4OYK A;  4JI7 T;  4Z8X A;  4PK6 A;  5LHI B;  3ZSS A;  1NAF A;  5JDL A;  1LKX A;  3TKL B;  3RRW A;  1N36 T;  4KBM B;  4YLH A;  3CQG B;  2DWK A;  3KVB A;  1IAP A;  5F8P A;  2X9X A;  5TAO A;  2BKO A;  4NUV A;  2LHN A;  5H6Q B;  3VKG A;  3AVR A;  3PUW F;  1J5E T;  3AAA B;  3EAM A;  2HPJ A;  5CA0 E;  1ZV4 X;  2W0G A;  2P9B A;  4WNK A;  2Y48 B;  4F8H A;  3EUH A;  3WAK A;  3UUN A;  1MIY A;  2JMK A;  4HGA A;  2NR4 A;  5A1L A;  4ZI3 C;  4DR2 T;  4K0K T;  1OED B;  1XDO A;  3JAE A;  2WZI A;  2YIN A;  3ZMT B;  5L4H A;  5HEO A;  3OYX A;  4PJL A;  3KV4 A;  3UQ7 A;  3K3N A;  3AA1 B;  2WU5 A;  4JI1 T;  4WYV A;  4EIW A;  2N1G A;  4JUY A;  2C5K T;  3ZC1 A;  3NRX A;  3KDS E;  2KLQ A;  4HTE A;  2CA5 A;  4B3S T;  3RYC E;  3ZN1 B;  3LBX A;  2VKJ A;  4U72 A;  1HX8 A;  1MMA A;  2WZH A;  4GYS A;  3ZMS B;  2WS3 A;  2L9Q A;  2E8I A;  4DR3 T;  1SE7 A;  2QVA A;  1HNW T;  3J9X 1;  3RKO A;  3PTR B;  2YK0 A;  5CB4 E;  2MYS A;  4TV8 E;  2LM9 A;  3WI3 A;  4MAL A;  2V7I A;  2XQ8 A;  4OX9 T;  4EEB A;  3Q5W A;  2XAQ B;  3LK2 B;  4DV7 T;  4DR1 T;  1W0A A;  4DV3 T;  4ILU A;  1MIV A;  1SA0 E;  4O4L E;  1X9B A;  4QH4 A;  2DCF A;  3N9N A;  5JQG E;  4ILB A;  5ABF B;  3ZT6 A;  2BG9 B;  3HA4 A;  5HXH A;  2CXD A;  1YW0 A;  4JBW F;  3X1D A;  3VR9 A;  1VOM A;  2DWG A;  4PNI A;  1I6Z A;  3ZYM A;  3K3O A;  5AQT B;  3I1A A;  3K3Q C;  1FJG T;  3PUV F;  1YQ4 A;  4CXW A;  2M6I A;  3S4U A;  2A9U A;  4A5X A;  4JV5 T;  4KUM B;  2Y8D A;  5FNV E;  3ANW A;  4M1P A;  2CXL A;  5DJQ C;  4PJJ A;  4U33 A;  5EZY E;  2IC6 A;  1Z0P A;  3PUY F;  2WCA A;  4IIJ E;  5JVD E;  1HCI A;  1MIW A;  1MMG A;  5BMV E;  2XAG B;  2EHO A;  5FMN A;  1D1A A;  5L2L A;  3NKZ A;  4P09 A;  5C3J A;  2SPC A;  2AE9 A;  3N2O A;  2OLT A;  4DO0 A;  1MNE A;  5HEJ A;  2UUA T;  2H7V C;  5LG3 A;  1HFA A;  2WY2 A;  3M3Z B;  1WYB A;  5DAB A;  5HXC A;  4GYR A;  4MHC A;  2YEV C;  4I55 E;  1KF6 A;  3ZST A;  4O4H E;  5ABE A;  5FVL A;  5EK3 A;  4DUZ T;  3C98 B;  2WDR A;  3A5X A;  1YD8 G;  2K5B B;  4FI5 A;  3SRZ A;  4Q25 A;  2NW8 A;  5H6R B;  2YKS A;  2X0L B;  3OVU A;  2AXD S;  3AEA A;  3ETU A;  3PDY A;  4EXT A;  4ZI2 C;  3TLT A;  1CHU A;  2V26 A;  5KXJ A;  3O1I A;  3P7I A;  3O1H A;  4H9P C;  2UXB T;  5L3F B;  4DV1 T;  4IDZ A;  3QNU A;  5FY1 A;  3UU6 A;  2BS4 A;  2I59 A;  3JCF A;  4ADZ A;  4HN9 A;  2LSY A;  3JC6 C;  2YU1 A;  3RYI E;  4TNV A;  2HH7 A;  5HAX A;  5FY0 A;  1I94 T;  1NEK A;  3CX8 B;  4QXC B;  2IDO B;  3L3P A;  4PAG A;  4QXB B;  4UR9 A;  3AE4 A;  3UU5 A;  5AQF B;  2NTX A;  4GKK T;  2ZLY A;  4MFR A;  5IHY A;  3HI2 A;  2FJE A;  1KNZ A;  1VCT A;  2HN1 A;  4DUY T;  5KX5 E;  3ZYK A;  2XQ5 A;  3TLV A;  2QRX A;  5HYA A;  3NWI A;  2EHO C;  4IE7 A;  5AQR B;  2F4V T;  4IDN A;  1FMW A;  1Z8U A;  4JEH B;  1YXR A;  3UUL A;  3BQI A;  2BVM A;  4I4T E;  3T8O A;  3AEC A;  3NVO A;  1JNZ A;  4EB6 E;  3EDU A;  1MMD A;  1QUU A;  3RIU A;  4IHJ E;  3F57 A;  1YKH B;  2V7K A;  5JDF A;  3I9W A;  5GON E;  2W2U A;  4AQG A;  3AE5 A;  4DMW A;  2CE7 A;  1KNR A;  3OTO T;  2N9D A;  4UEL A;  4L0R A;  2WWV A;  3D0T A;  1N33 T;  5J2T E;  5LBM A;  5LG4 A;  1HG5 A;  3Q5E A;  5AQN B;  3UUB A;  2PFV A;  2Q9Q D;  2IHR 1;  3AB3 B;  2MTQ A;  3MJX A;  3EHZ A;  2V7M A;  3FZK B;  4C91 A;  3OKQ A;  4P1N A;  3ZLI A;  1AJ3 A;  3ZT5 A;  2WQY A;  4H9S E;  5HXR A;  4AKI A;  5JH7 E;  2LKH A;  5DQV A;  3PU3 A;  5JDH A;  4YTP A;  4X65 T;  4JI8 T;  2WSS V;  3FBZ A;  2MAW A;  1ZP0 A;  4C90 A;  4YY3 T;  3K8P C;  2VK9 A;  4JI6 T;  5LMN T;  3ESL A;  2R6G F;  1YKE B;  3HKB E;  3O1J A;  1E2A A;  1XZY A;  3RPU A;  2C5I T;  3CIR A;  1XMQ T;  3JAF A;  3AE1 A;  2V7J A;  1WRD A;  3AXJ B;  3R84 B;  1UCU A;  2YN6 A;  2FJB A;  4JI2 T;  4NXN T;  5JR9 A;  2C5J A;  3U3I A;  5FL0 A;  4KMC A;  2BKP A;  2W66 A;  4LF9 T;  2LM2 A;  3AAE B;  2VAS A;  3Q5X A;  3JAD A;  4UF0 B;  4ZS2 A;  2LSG A;  3AE8 A;  2UXX B;  2N2N A;  4UIG A;  2BS3 A;  1E1H B;  3LK4 2;  4U2Z A;  1UUR A;  2E9X D;  2XJ7 A;  1UUS A;  2CCQ A;  2XZE A;  3KFW X;  2X0H A;  3ZJ2 A;  4HWD A;  2IC9 A;  3A8Y C;  3KV9 A;  5M4Y A;  3ZCJ A;  1D0X A;  2L8K A;  2OA5 A;  5JDQ A;  3UUX B;  2HPL A;  3Q9D A;  4UXN B;  2JQH A;  2MPK A;  2IAK A;  4HWH A;  4X64 T;  3I0Q A;  3PUR A;  2IML A;  3N9M A;  2YDR A;  4ERR A;  4PJM A;  5AQM B;  2WDQ A;  3L39 A;  2VQE T;  1WR0 A;  3Q5D A;  1N34 T;  3RIU C;  3RYH E;  3EI0 A;  3N9P A;  4A56 A;  2LRK A;  2YDS A;  3P4R A;  1D1B A;  3MK7 C;  3AEB A;  3ZYL A;  4AXP A;  3IEE A;  4GK0 E;  3A7M A;  4H63 H;  3G06 A;  1L0V A;  4DV2 T;  3C4W A;  4NIQ A;  2JJ9 A;  2UXN B;  2KND A;  3W15 B;  4EOZ B;  2WMN A;  2UU9 T;  4LF6 T;  3IF8 B;  4DV0 T;  3LBX B;  3H37 A;  2XTL A;  2VKH A;  3QB5 A;  3SWH A;  1WR6 A;  4YXD A;  1IBK T;  2G0U A;  3ZKR A;  3CX7 B;  4EZH A;  5KDM C;  3UFE A;  4U2Y A;  4QX7 B;  2UUB T;  3PUX F;  2D0U A;  3IBP A;  4JI0 T;  4HFE A;  4O2A E;  5L3C B;  4COF A;  4PW8 A;  4GOU A;  3VHL A;  2WDV A;  4EYY R;  2LKG A;  2RPA A;  2CWY A;  4HWC A;  5LJN A;  2PTF A;  1US7 B;  4WW0 A;  4U7Y A;  2X9H A;  3ABV A;  2ACZ A;  1OED E;  3E22 E;  5JR9 C;  4UVA B;  1HR0 T;  2KT9 A;  4LF8 T;  5HEU A;  2DL1 A;  1ZEE A;  4IDP A;  2VUR A;  3RI5 A;  5ABG A;  3FZL B;  2PJQ A;  3UU3 A;  3RQU A;  4BAY B;  3L8R A;  4X20 E;  2LSJ A;  3J7Y q;  2CBI A;  4DBR A;  4YTN A;  2XQY A;  2XQ9 A;  3RLF F;  1D1C A;  3ANW B;  3LK3 B;  4B6X A;  5AQO B;  5LGU B;  3RQW A;  3UU4 A;  2KZ7 B;  2IW5 B;  2XSA A;  4EV6 A;  4YJ3 E;  4YJ2 E;  2EHO B;  4YTM A;  5AQV B;  4HFD A;  2WAU A;  4OFZ A;  2E9X A;  2J1D G;  3ZC0 A;  4CXY A;  2IUB A;  2CBJ A;  3IHR A;  4N78 D;  1UX5 A;  1ZHC A;  2JMH A;  1BR4 A;  2V6X A;  1OXZ A;  3NRY A;  2CM0 A;  4ILC A;  1IBM T;  4JYA T;  5HXE A;  5J1G A;  2VL0 A;  4P0A A; 
#chains in the Genus database with same CATH homology
 2X67 A;  3C4Z A;  1KNZ A;  2M67 A;  2DHR A;  4H9Q C;  4O4J E;  4ASK A;  3O4X E;  5KX5 E;  3ZYK A;  2KMF A;  3MKD A;  4ZS3 A;  5FXX A;  5HYA A;  1FEW A;  2X9Y A;  3N5L A;  2EHO C;  2L3L A;  3CKD A;  3CX6 B;  3Q2M A;  4IE7 A;  3MXZ A;  2Q9Q A;  4QHO A;  5JDN A;  4E7S A;  1FMW A;  4TN7 B;  2ES0 A;  2Q9Q B;  4QX8 B;  3SOL A;  4CI1 B;  4JEH B;  4UF0 A;  2CLY B;  3KV5 A;  3UUL A;  3BQI A;  5CA1 E;  2BVM A;  4OHF A;  2Z6E A;  3FXE B;  2LOS A;  3RYF E;  5LHH B;  1S94 A;  4GK5 E;  4BJM A;  3KIN B;  4KP3 C;  4I4T E;  5F3J A;  2MBG A;  4JEU B;  3T8O A;  3B57 A;  5EK4 A;  3VKH A;  3KBT A;  4ZHQ E;  5LNK A;  2GK9 A;  3B13 A;  2B1E A;  4EB6 E;  3CWZ B;  2LEH A;  3DP7 A;  4XBF B;  2LT3 A;  5LA6 E;  3EDU A;  4YFS A;  3V5S A;  3VU7 H;  2C0S A;  4F6R C;  1MMD A;  2NTY A;  3F31 A;  1QSD A;  2H3R A;  2ZMA A;  5FXV A;  2EHO D;  2LSI A;  2X66 A;  3DTO A;  1QUU A;  4V1A v;  2XAF B;  4O4I E;  5FP3 A;  4DVD A;  3CQX C;  4IHJ E;  4P0B A;  3F57 A;  4H9N C;  4OYK A;  2NWB A;  1YKH B;  2MOZ A;  3C64 A;  4Z8X A;  2V7K A;  4X1K E;  5JDF A;  3V5U A;  3I9W A;  4PK6 A;  5LHI B;  2Q9Q C;  1NAF A;  5JDL A;  1LKX A;  2CLY C;  3TKL B;  4XAX B;  5GON E;  3RRW A;  4KBM B;  4AQG A;  3PUA A;  3CQG B;  4YLH A;  2DWK A;  4DMW A;  4PJN A;  2CE7 A;  3KVB A;  1IAP A;  5F8P A;  2X9X A;  5TAO A;  2N9D A;  2WM9 A;  4I50 E;  4NUV A;  2LHN A;  4UEL A;  5H6Q B;  4L0R A;  3VKG A;  3D0T A;  5J2T E;  3AVR A;  1NWM X;  3AAA B;  5LBM A;  5LG4 A;  1HG5 A;  4XZC A;  2HPJ A;  2W61 A;  2ZM2 A;  5CA0 E;  1ZV4 X;  3CPZ A;  2W0G A;  1V9D A;  2P9B A;  4WNK A;  2Y48 B;  2LJL A;  2PFV A;  3EUH A;  3WAK A;  3UUN A;  1MIY A;  2JMK A;  2Q9Q D;  4HGA A;  3AB3 B;  2MTQ A;  3MJX A;  5A1L A;  3QK6 A;  4TUY E;  3KBU A;  4ZI3 C;  4DBQ A;  1IZN B;  3N9L A;  2V7M A;  4HE8 A;  4C91 A;  1LRZ A;  3H3A A;  3OKQ A;  2JQQ A;  3RRC A;  3ZLI A;  2YIN A;  1AJ3 A;  3RC3 A;  3ZMT B;  3EVY A;  4CXX A;  4H9S E;  5HXR A;  4AKI A;  2KWI B;  2KIN B;  1IJ6 A;  2E9X B;  3PE0 A;  4IST A;  5JH7 E;  4G63 A;  4AKH A;  5DQV A;  3PU3 A;  5HWY A;  2LOP A;  2Y6X A;  2A72 A;  5JDH A;  5JDM A;  5FYM A;  3OYX A;  4PFO A;  5EK2 A;  2WSS V;  2ODU A;  4PJL A;  3FBZ A;  3KV4 A;  3ZPO A;  1T98 A;  4O8S A;  4C90 A;  3K8P C;  4PK4 A;  3K3N A;  3AA1 B;  2VK9 A;  3N9O A;  5JRC A;  3C4X A;  3ESL A;  3HL6 A;  3HKC E;  1YKE B;  3HKB E;  5JRC B;  5C8Y E;  3KV6 A;  2W62 A;  3O1J A;  2D5U A;  4AI6 A;  5E0O A;  4NUU A;  3HR0 A;  4ZI3 D;  1HF8 A;  4EIW A;  2N1G A;  4JUY A;  2C5K T;  3RPU A;  2C5I T;  4GIW A;  3BK9 A;  2X68 A;  3ZC1 A;  4BJN A;  3NRX A;  3KDS E;  2KLQ A;  4HTE A;  2CA5 A;  2V7J A;  1WRD A;  1HS7 A;  3R84 B;  3RYC E;  1UCU A;  3FB2 A;  3ZN1 B;  1VRB A;  3OYZ A;  3NBX X;  2XAH B;  3LBX A;  2VKJ A;  1S35 A;  4U72 A;  5JR9 A;  2C5J A;  3RX6 A;  1HX8 A;  1MMA A;  3U3I A;  1WLX A;  2E9X C;  4KMC A;  4U74 A;  4O2B E;  4MLK A;  4GYS A;  3ZMS B;  4IE5 A;  4PK5 A;  2L9Q A;  2E8I A;  3AAE B;  2VAS A;  3Q5X A;  2ODV A;  4UF0 B;  3ZMZ B;  3OJA A;  4ZS2 A;  3ZN0 B;  2LSG A;  3QC9 A;  5ADX L;  4K0U A;  2UXX B;  2XHE B;  3J9X 1;  4DND A;  3RKO A;  2ZM8 A;  3PTR B;  2N2N A;  2YK0 A;  4UIG A;  5CB4 E;  1HG2 A;  3BQL A;  5AFU L;  1E1H B;  2MYS A;  4TV8 E;  1FMV A;  3LK4 2;  4AQF A;  4CZZ B;  4TZ4 C;  1FIO A;  2LM9 A;  4QKN A;  3WI3 A;  3GWH A;  2K9A A;  4MAL A;  2V7I A;  3MZK B;  4YHJ A;  3Q5W A;  2XAQ B;  2PG8 A;  3LK2 B;  4JLE A;  3CML A;  4FJO A;  2E9X D;  3DJB A;  4AKR B;  2BDE A;  5FXW A;  1BR0 A;  2CCQ A;  4ILU A;  3KFW X;  1MIV A;  1SA0 E;  4O4L E;  4L5G A;  2NP9 A;  3ZCI A;  3ZJ2 A;  2IC9 A;  1LVK A;  2DCF A;  3N9N A;  3GN5 A;  3KV9 A;  4I43 B;  5JQG E;  5JRE A;  3HA4 A;  5HXH A;  2BVL A;  1UX4 A;  3GN5 B;  5M4Y A;  3ZCJ A;  1D0X A;  2L8K A;  2CXD A;  1YW0 A;  2OA5 A;  2VKD A;  2WMO A;  5JDQ A;  1VOM A;  3UUX B;  2HPL A;  3Q9D A;  2DWG A;  4UXN B;  5IYZ E;  4PNI A;  2IAK A;  4IGU A;  5LGT B;  3WAJ A;  5LOV E;  2QA7 A;  1EZ3 A;  3ZYM A;  1U4Q A;  3K3O A;  1KK7 A;  3I0Q A;  3PUR A;  2VWA A;  3I1A A;  3K3Q C;  3U78 A;  4ANJ A;  1BR1 A;  3N9M A;  4UVC B;  4ERR A;  2DI4 A;  3N2K E;  4PJM A;  5L3E B;  2W00 A;  2ZM0 A;  2D2S A;  4CXW A;  3KVA A;  3N2G E;  3RC8 A;  3S4U A;  4KUM B;  2Y8D A;  4QWN B;  5FNV E;  3GA8 A;  3ANW A;  1H7C A;  4M1P A;  3RYH E;  5JDG A;  4G2A A;  2CXL A;  1OWA A;  5DQW A;  5DJQ C;  2WWU A;  3N9P A;  5LJM A;  2RP4 A;  3ZMV B;  4A56 A;  4PJJ A;  3ETV A;  5EZY E;  2IC6 A;  1LVF A;  1Z0P A;  3AAI A;  4IE4 A;  1D1B A;  2K48 A;  4IIJ E;  3MK7 C;  1X79 A;  5JVD E;  1HCI A;  1MIW A;  3C51 A;  1MMG A;  3FHN A;  5LCY A;  4E7Z A;  4H9O C;  3ZYL A;  2XAG B;  5BMV E;  2EHO A;  5L3D B;  4IE0 A;  5FMN A;  5ETW A;  1D1A A;  4WBO A;  4AXP A;  3FBL A;  3IEE A;  4TV9 E;  5L2L A;  4GK0 E;  4P09 A;  3ZJ1 A;  5KMG P;  4H63 H;  2SPC A;  4PFP A;  3N2O A;  1D0Z A;  1Y64 B;  3E0Z A;  4DO0 A;  3C4W A;  1MNE A;  2XUE A;  3HKD E;  3C50 A;  2BZB A;  2JJ9 A;  2V7L A;  2YU2 A;  2UXN B;  2KND A;  2D0T A;  3W15 B;  4J2C A;  2H7V C;  2CEA A;  4EOZ B;  3L09 A;  2WMN A;  3HKE E;  2JRK A;  5L3G B;  1HFA A;  2NOX A;  1WYB A;  3IF8 B;  2VB6 A;  3P8C D;  5FXZ A;  5DAB A;  5HXC A;  4GYR A;  4MHC A;  2YEV C;  2W63 A;  4ISS A;  3UTK A;  3LBX B;  4I55 E;  4UEM A;  2WBL A;  3RH3 A;  1BR2 A;  3NZP A;  3O9X A;  2LE8 A;  3H37 A;  2KXP B;  4OYJ A;  5JR9 B;  2XAS B;  2XTL A;  2VKH A;  4OK0 A;  2VL8 A;  3LFM A;  3SWH A;  1WR6 A;  4EAH A;  2G0U A;  4O4H E;  4EZH A;  3CX7 B;  3AVS A;  5KDM C;  3UFE A;  4QX7 B;  5EK3 A;  3C98 B;  2D0U A;  3IBP A;  3ZEF B;  1D0Y A;  3A5X A;  1YD8 G;  4O2A E;  3MA9 A;  2K5B B;  1SHZ C;  5L3C B;  4FI5 A;  4PW8 A;  2NW7 A;  4GOU A;  3VHL A;  4EYY R;  2LSK A;  3SRZ A;  3ZMU B;  4WBN E;  2CWY A;  3I0O A;  2NW8 A;  2VKO A;  4H9R C;  5H6R B;  3AA6 B;  1IJ5 A;  4WW0 A;  1MMN A;  1US7 B;  4HEA A;  4ZOL E;  5LJN A;  2X0L B;  5LGN B;  5LP6 E;  3M65 A;  4QXH B;  3ETU A;  1WYC A;  4AKG A;  3N9Q A;  2X9H A;  4L9I A;  3NZQ A;  3PDY A;  2ACX A;  3E22 E;  5JR9 C;  4EXT A;  2A3D A;  4UVA B;  2CMR A;  5L3B B;  2KT9 A;  4ZI2 C;  4ZI7 E;  3LG7 A;  2V26 A;  2A2F X;  3O1I A;  3P7I A;  3O1H A;  3CQC B;  4BA9 A;  4H9P C;  4CI3 B;  1CUN A;  4DMV A;  5L3F B;  5LYJ E;  1ZEE A;  3AA7 B;  2X51 A;  4X1Y E;  2PJQ A;  3SS1 A;  4BAY B;  1MND A;  5HXS A;  1O3X A;  3ONX A;  3CVR A;  4IDZ A;  4X20 E;  4AQF C;  3PUS A;  2LSJ A;  4EZ4 A;  3BQK A;  5LXT E;  5FY7 A;  5FY1 A;  4CQI A;  3J7Y q;  2I59 A;  4CI2 B;  1U5P A;  4ADZ A;  4HN9 A;  4DBR A;  5LBQ B;  1ZKE A;  2LSY A;  3JC6 C;  4AKL A;  2XQY A;  3R6N A;  4ZI2 D;  3GMI A;  3FXD B;  3PUQ A;  4X1I E;  2DLR A;  1D1C A;  2YU1 A;  3UT5 E;  3ANW B;  1HTJ F;  3LK3 B;  4B6X A;  4HKA A;  3RYI E;  5LGU B;  2KZ7 B;  2KWH A;  4HFV A;  5HWX A;  3F2E A;  2IW5 B;  3QUJ A;  1G8X A;  4UVB B;  5J2U E;  4YJ3 E;  3AA0 B;  2CXF A;  2V1D B;  2CWO A;  2NW9 A;  2HH7 A;  2K24 A;  3UUM A;  5HAX A;  4YJ2 E;  5FY0 A;  3LJC A;  3PU8 A;  3CX8 B;  4QXC B;  4UV9 B;  2EHO B;  3L3P A;  3I9Y A;  4PAG A;  3OBV E;  2WAU A;  4OFZ A;  2E9X A;  2J1D G;  3JC6 D;  3E08 A;  3EDV A;  4EYU A;  2JPF A;  2X9W A;  4QXB B;  3ZC0 A;  4CXY A;  1B7T A;  1G73 A;  3IHR A;  2DNX A;  3MAC A;  4N78 D;  1UX5 A;  1ZHC A;  2JMH A;  2NTX A;  4H63 V;  1BR4 A;  4UV8 B;  2ZLY A;  1OXZ A;  3NRY A;  3PUG A;  4IE6 A;  2CM0 A;  4MFR A;  4TX5 A;  5IHY A;  2XAJ B;  2RA1 A;  2PBI A;  4MBQ A;  5HXE A;  2QGS A;  5J1G A;  2H7O A;  3HI2 A;  2LHR A;  5LHG B;  4P0A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...