3F31A

Crystal structure of the n-terminal region of alphaii-spectrin tetramerization domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
137
Chain Sequence
TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Spectrin alpha chain, brain
publication title Crystal structure of the nonerythroid alpha-spectrin tetramerization site reveals differences between erythroid and nonerythroid spectrin tetramer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin binding, structural protein
total genus 56
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3f31A00
1WLXA 1HCIA 3F31A 3FB2A 1U5PA 3PE0A 2ODUA 3LBXB 3LBXA 3UUMA 3EDVA 1OWAA 2ODVA 1AJ3A 3UUNA 1CUNA 3UULA 2SPCA 1QUUA 1U4QA 1S35A
chains in the Genus database with same CATH superfamily
3Q5EA 4BAYB 5EK3A 1T8BA 1SA0E 3ONLC 4JI5T 2NP9A 4U33A 4YY3T 4JEHB 3AVSA 4UVCB 3FZFB 5J2TE 2WU5A 3MK7C 4EV6A 3NWIA 5HXCA 3VRAA 2CLYB 3ZT7A 3CK6A 3RYHE 1UUSA 4PFPA 2BZBA 5FYMA 2OV9A 5HEGA 2QA7A 1GQEA 1X9BA 4ZS2A 4TV8E 4AQYT 2C0SA 2KT9A 3HA4A 2BKPA 1D1CA 2LSKA 5LHIB 1XDOA 3C4XA 1WLXA 2XQ6A 1YXRA 4PJNA 3P8CD 1WYBA 2CXLA 2XQ9A 1QLBA 3TLSA 2YINA 2UXXB 4L0RA 4BA9A 3RRWA 4G2AA 3RC3A 2HH7A 1MMAA 2E9XB 3OYXA 4CQIA 2BBHA 3OBVE 4YSYA 4Q25A 3AA1B 3MZKB 3UQ7A 3AE7A 3KFWX 3K8PC 3H37A 5FL0A 1YQ3A 3ETUA 2VQET 4DV4T 2XPKA 2NOXA 1D1BA 3CKDA 4AKGA 1QSDA 5LJMA 2WM9A 2CM0A 1NWMX 3VR8A 2E5LT 5LG3A 3JAFA 2XZEA 1NEKA 2KMFA 4HWHA 5CA1E 2MPKA 2FUPA 2LHNA 1OEDE 3EABA 5CJ5A 2K5BB 4DR3T 2W0GA 4DR1T 1B7TA 3K3NA 4ANJA 3O1IA 1VRBA 2D5UA 4DIDB 3IEEA 4ZI3C 2XHEB 3HKEE 3ZYKA 2RA1A 2X51A 3VHLA 4QH5A 2FJEA 3Q2MA 3AE6A 2QYWA 1ZP0A 3ZEFB 4IHJE 2HPJA 1NAFA 4XZCA 4UXNB 2DI4A 3FZHB 3ZSTA 5LJNA 3AAIA 4NXMT 4LFAT 4O4LE 1W09A 3AAAB 2N9DA 2BG9C 4YFSA 2Q9QD 2L8KA 2V7KA 4A98A 3HKDE 1YW0A 2WU2A 1US7B 3I9YA 4AXPA 3ETVA 3HKBE 2NW8A 2HPLA 4QKNA 1T7SA 5C2TA 4EXTA 1HX8A 3RLFF 2B76A 3PUVF 5KMGP 4JI8T 5LMUT 2WS3A 1W0AA 4I0UA 1OEDA 4I50E 3PJAJ 1WYCA 3HR0A 3FHNA 1G8XA 5DQVA 1H7CA 3LFMA 2DWKA 1HNZT 4A5XA 4MHCA 4HWFA 4IDQA 3SS1A 3M3ZB 1YQ4A 2H89A 3GWHA 2M6IA 2WP9A 3V5UA 4YHJA 4NPPA 4GKKT 2LM9A 2CHOA 2YDRA 2ES0A 4DVDA 3AAEB 5AQKB 3M65A 2LSGA 2DL1A 3QB5A 4ZZBA 5EK2A 2WCAA 4TN7B 1R8IA 4TUYE 2XSAA 2V5CA 4QXHB 1MIWA 4MALA 1KFYA 3KDSE 2CBIA 5ETWA 3AEFA 4PK4A 3CQCB 3ZC0A 4IREA 3UUNA 4ADZA 4AKRB 5F8PA 4ZEYA 3C50A 2JIWA 5HEHA 3J9X1 2XQ7A 3RHWA 3UT5E 2NWBA 5JTGA 3I0OA 3I0QA 4UVBB 3A8YC 3ONXA 1O3XA 2WY2A 3U3IA 3AXJA 2I59A 2Z6EA 3BQLA 4H9PC 2XJ7A 3Q5DA 4HFCA 4KHZF 2VKOA 2A72A 4HFIA 4B6XA 2VL0A 3ZN1B 3QB5K 3W15B 2EHOC 2ZM6T 2IDOB 3BQIA 2XTLA 4TZ4C 4CZZB 2LE8A 4O2BE 1KF6A 4HFEA 3ZCJA 4X66T 5LMNT 3RYFE 3AA7B 5HXRA 2K9AA 3VKHA 5JRCA 4WYVA 1ZV4X 2IUBA 2JMKA 4DV5T 5JDQA 3OPCA 4HFHA 3AE1A 3N9QA 2BVMA 3QOFA 2LSJA 2ZM8A 2Q9QA 3NRXA 4CI2B 4TWFA 2BS3A 2YDQA 5DJQC 3RKGA 3JCFA 3AE8A 3ZJ2A 1IBKT 3PURA 3GA8A 3DP7A 3KVAA 3UULA 5FY0A 5JDGA 4XAXB 2WBLA 1IZNB 3PU3A 3ABVA 4G63A 4X1KE 5FY7A 5FL1A 3NZPA 4QWNB 1X79A 1J5WA 2J1DG 1MMNA 4JI1T 1ZOYA 3PUQA 4JV5T 4AKIA 4X65T 5LBMA 4PNIA 5BMVE 3PUAA 3P4WA 5L3EB 1OEDB 1W0BA 3CX8B 4ZZCA 4KX6A 1U5PA 3AB3B 3ZLIA 3PUYF 5L3BB 1MNEA 1VCSA 4UELA 3UQ4A 2UUBT 4ILBA 2RPAA 2IAKA 2CXDA 1WR0A 2WQYA 4X20E 4OFZA 4UV9B 3R6NA 3FZKB 2JQ9A 5AQIB 2NTYA 3N2OA 5JR9C 4HTEA 4YTNA 4COFA 2CE7A 5HXEA 2M67A 4L5GA 4K0UA 4KUMB 2XASB 2M6BA 2DLRA 4AIUA 1FJGT 1EZ3A 5AQQB 4DR6T 5HYAA 3DTOA 3ONJA 3VRBA 3UFEA 1Z0PA 3UUMA 3ZN0B 4CN4A 3RC8A 2XAHB 5KXJA 4AISA 3UU4A 2CXFA 4DV3T 1XDPA 3IBPA 1UK5A 5LP6E 4M1PA 2DWGA 3ZJ1A 3AXJB 4X5TA 1XMOT 2GK9A 2C5IT 4UVAB 2V8SV 1S35A 5DQWA 4CXWA 3AE5A 2UXDT 3PTRB 4EYUA 2D9DA 2BS4A 4EOZB 1ZKEA 2N1GA 1CUNA 3AA0B 4OX9T 4PFOA 2WAUA 3R84B 2BDEA 5JRCB 3UU5A 3O9XA 3ZMTB 5LGNB 4WZXA 1VCTA 1VOMA 4JI4T 4A56A 5JREA 5FVLA 4JYAT 2UXCT 2Q9QB 2WZHA 3ZT5A 3TLWA 4P0AA 2F4VT 3L8RA 5ABHA 1UX4A 3FB2A 1M62A 2VVSA 4TWDA 3RYIE 1N34T 3AE9A 5L3DB 4IE0A 3PJAA 3ZYMA 2FJBA 3QK6A 1U4QA 4PAGA 4BJNA 5AQMB 3HKCE 2NR4A 2HN1A 3CX7B 3RIUA 2VKJA 2H7VC 4ZOLE 1UGOA 1UCUA 4ASKA 4GKJT 2YN6A 4OYKA 3ZSSA 1XNRT 3G06A 4U74A 4H9OC 1SUMB 3PDYA 4NXNT 5FXXA 5EZYE 1JNZA 4QX8B 3I1AA 2FBWA 5AQVB 4U72A 1V9DA 2C5JA 1N32T 3ZMZB 1E7PA 2CRBA 2SPCA 1IAPA 2WDQA 4EZHA 4QH4A 4HGAA 3E22E 5LBQB 4ZI3D 2B1EA 5IYZE 1LRZA 2XY8B 4U2YA 1FEWA 2KLQA 2KNDA 5L3FB 2V7IA 4YJ3E 3X1DA 4CXYA 4YLHA 4IE6A 5J0ZA 4C90A 5IWAT 2QVAA 1LVKA 3P4SA 1XMQT 4XBFB 4DV0T 3IF8B 1BR0A 3AVRA 3J7Yq 2YDSA 2W66A 3LBXA 3LSVA 5FXWA 2LOSA 4B3ST 1E1HB 3MXZA 3UUXB 4HKAA 1Y64B 2V6YA 2LSIA 4QH1A 3ZKRA 2V7LA 4H9RC 4ERRA 3JC6C 3AE2A 4QX7B 1HNXT 3S4UA 4Z8XA 3E08A 4KBMB 3A7MA 5HCMA 1HNWT 2Y6XA 5LYJE 2VB6A 4TX5A 4LMLA 4DR4T 4LF5T 2W61A 2XM2A 2LHRA 4B3MT 5IHYA 3T1HT 3PE0A 2XAQB 4IL4A 4WBNE 2LJLA 5JDHA 2PBIA 2CHNA 3F2EA 2BG9E 1IJ6A 4LF6T 5LGUB 3MKDA 3O4XE 1D0XA 2LLYA 4H63H 2NW9A 2CLYC 3I9WA 1IJ5A 1E2AA 2K24A 3KV9A 4P09A 3HL6A 2X0HA 5E0OA 2ZMAA 3UUBA 2JPFA 5ABEA 2FJAA 5DABA 1IBMT 4Z91A 3K3OA 3N9LA 3IA3A 2LT3A 5AQLB 3WAKA 3UFGA 3P7IA 2YK0A 4DBQA 4LF9T 2YU2A 2CWOA 2X0YA 4BJMA 4OYJA 1HG2A 4IDPA 3FBLA 5FKYA 1XNQT 2UU9T 4YSXA 1HX1B 1UURA 2E9XC 3A5XA 2KZ7B 1I94T 4IGUA 3RQWA 4LF7T 2EHOD 3ESLA 5HAXA 2LEHA 2D0UA 1OWAA 5LHGB 5KX5E 5LNKA 3CMLA 5AQJB 4E7SA 5L4HA 1XWMA 5LA6E 3ZC1A 2ZM0A 4O8SA 3MJXA 3TLTA 2QGSA 4PW8A 4O4JE 2JMHA 3AEBA 3NRYA 1S94A 2RP4A 4H9SE 1WRDA 5AQTB 4E7ZA 2BG9A 2A9UA 2WSSV 1KEYA 3T8OA 1HFAA 3UU8A 4DV6T 4AQFC 3FZMB 5L2LA 4JEUB 5LCYA 2H7OA 3LBXB 3LK3B 4Z90A 3PUWF 2VWAA 2CCQA 2YU1A 5ABGA 4O2AE 2XAFB 2P9BA 2BVLA 5AQPB 3RIFA 3GMIA 4HEAA 4HFBA 4X62T 2K48A 4JI6T 2LKGA 3N9NA 2V6YB 3V5SA 1MIVA 3RF1A 5JH7E 5L3GB 2OA5A 3P4QA 3EI0A 4FJOA 2V6XA 3RGLA 4DO0A 4YT0A 4IE4A 3CQGB 3RYCE 4DNDA 4U7IA 1I6ZA 5F5WA 4DBRA 4UF0A 3PU8A 2LRKA 3NBXX 4YTPA 5JDMA 3FBZA 1ZEEA 4FI5A 2BBJA 3PUGA 5ABFB 3OVUA 3DJBA 4QXCB 2WWVA 3CPZA 4ZHQE 3AEEA 3C98B 3ZMVB 2W00A 5FP3A 2ACXA 4MBQA 4X1IE 3UU3A 3EDUA 1KNZA 2WDRA 2E2AA 3LK2B 3F57A 3O1JA 5CGMA 3MACA 2CEAA 4CXXA 3PUZF 3RKOA 3FXDB 1FIOA 5HWYA 3Q5WA 4IL9A 2Y8DA 2W4XA 2V5DA 2X9HA 1Z8UA 3OYZA 3LDQB 5JDNA 4ZS3A 1MIYA 4HN9A 1M7KA 4JI7T 3VKGA 3RQUA 2XAJB 4EIWA 2EHOA 3E0ZA 2KWIB 4WNKA 2DNXA 1N36T 3ZCIA 2Y48B 4ZI2C 3FXEB 2WZIA 2WMOA 2A2FX 2FJDA 2DHRA 3KBTA 3CQXC 3EAMA 2KSRA 3JADA 4PJMA 2ZM2A 4LF4T 2XQ8A 5KDMC 4U2ZA 2J4GA 3N2KE 2IMLA 3C4WA 3AEAA 2MTQA 4ILUA 3RIAA 3EDVA 3RH3A 1YKEB 3AEGA 2AXDS 2IIUA 3OJAA 4TNWA 3NKZA 4K0KT 1QUUA 2JJ9A 3GN5A 4DV1T 2UXNB 2JQHA 3WAJA 3ANWB 4AI6A 3AE4A 3SFDA 4B3TT 2YEVC 2L3LA 2VASA 3KV5A 2BG9B 1HR0T 1MMDA 1J5ET 4HWCA 5LHHB 5J1GA 3D0TA 4IIJE 4IT4A 4PJLA 3VU7H 1ZHCA 5EK4A 2OLTA 2LOPA 2BKNA 5FMNA 4YHHT 4IDNA 2L9QA 4ZXLA 3RPUA 2XM1A 1KK7A 1Y01A 3QC9A 4GOUA 4OK0A 5J2UE 2E5VA 1KNRA 5IUXA 2CPTA 1JNRA 2VKHA 4DMVA 4PJJA 1DU2A 2IW5B 4UF0B 3OTOT 4JUYA 4YSZA 2W67A 5JR9A 2W63A 3CWZB 4GK0E 3LG7A 3WI3A 1HF8A 4U31A 4DUYT 3LJCA 1W9RA 4DR2T 3MA9A 4IE7A 3VR9A 4UR9A 4L9IA 4X1YE 5L4EA 4JI0T 4LFCT 4P1NA 2KWHA 4HE8A 4JBWF 4CI3B 1OEDC 2KXPB 1IBLT 2HN2A 1WFDA 2XQ5A 1D0ZA 4J2CA 5FXVA 1HS7A 3KV6A 1XZYA 2NW7A 4WW0A 3SRZA 2X0LB 3AA6B 4B3RT 2LKHA 5LGTB 1D0YA 2D0TA 5H6QB 3P4PA 1WCRA 3AE3A 2N2NA 2PG8A 4DMWA 5A1LA 4EGWA 2CWYA 3L3PA 5LG4A 2XAGB 5JDFA 3T1YT 1G73A 4EAHA 3ZYLA 5HWXA 2EHOB 5TAOA 1YD8G 3RX6A 2XQAA 3O1HA 3N2GE 5AQRB 5JVDE 4GYSA 5AQUB 4H63V 3C4ZA 1UX5A 3B5MA 5CB4E 3JC6D 4CN6A 2H88A 2X68A 2WWUA 4CN1A 1HTJF 3QNUA 3PUXF 5AQOB 3NZQA 4IDOA 3KINB 4EB6E 4EEBA 4X64T 2WB5A 1WR6A 2LRLA 1D1AA 2CMRA 2D2SA 3GN5B 5HEUA 2BS2A 5FVKA 4LMJA 2C5KT 2MBGA 1BR1A 4TNVA 3KBUA 2R6GF 2LSYA 5BR8T 5ABFA 4A97A 2W62A 4DUZT 4PK5A 1OXZA 2VKDA 1FMVA 4LFBT 1L0VA 4DV2T 5C3JA 4O4IE 5LOVE 4OHFA 1N33T 3N9MA 2JQKA 2JQQA 2V7MA 3QUJA 4DR7T 4ILAA 4V1Av 3UTKA 4YXDA 2J47A 4LF8T 2Q9QC 4NUVA 4U7YA 5JDLA 5ADXL 4WBOA 4F8HA 5L47A 4N78D 2E8IA 2VVNA 4MLKA 2ODUA 2XSBA 5HEJA 3TLVA 5JQGE 2YKSA 4AQGA 1CHUA 5JR9B 2MAWA 2PJQA 3F31A 2E9XD 3H3MA 3PV0F 5AQFB 3U78A 2ODVA 3AEDA 2XUEA 2CA5A 2DCFA 3SFEA 4KP3C 5FNVE 2JRKA 4EZ4A 1LKXA 1SE7A 5HXSA 4NIQA 2AE9A 2ACZA 2WDVA 3ZMSB 4GIWA 5LXTE 3ZMUB 2VQFT 3OKQA 3HI2A 4YJ2E 4DR5T 4UEMA 3ZPOA 3P4RA 2V26A 3PUSA 2X9YA 4LMKA 3ANWA 5H6RB 5F3JA 2UUAT 2KINB 4P0BA 5CA0E 2X9XA 2I6HA 4AKHA 3B57A 3C64A 3EHZA 1FMWA 4UV8B 4QHOA 4CI1B 3RI5A 2MOZA 4GK5E 3C51A 4I43B 3L39A 4EYYR 5FY1A 2X67A 3SOLA 3IHRA 2G0UA 3ZT6A 2MYSA 1T72A 4QXBB 2IC6A 1T98A 4ISSA 5AQHB 1BR2A 1J1JA 1LVFA 2V1DB 4GYRA 3BK9A 4F6RC 3H3AA 3LK42 3FZLB 5LB7B 4IE5A 3Q9DA 4JI2T 3L09A 1HG5A 5HCJA 5HXHA 3UU6A 4I55E 2PTFA 3P50A 3N5LA 5AQSB 2ZLYA 4I4TE 2W2UA 4DV7T 1NENA 4KI0F 2PFVA 4C91A 3BQKA 5AQGB 4ISTA 3RRCA 4EEDA 3K3QC 3CIRA 4H9NC 4AKLA 1AJ3A 2H3RA 2UUCT 4IDZA 1KNPA 4TV9E 2CBJA 3KVBA 2YOEA 2E9XA 2I0MA 2HHHT 3CX6B 3N9OA 2UXBT 4HFDA 2X66A 4O4HE 4ZI2D 1MMGA 2VURA 4NUUA 5AQNB 5GONE 2IC9A 5CFBA 3N9PA 3K1SA 1HCIA 3RIUC 2V7JA 4MFRA 4KMCA 5FXZA 3NVOA 3JAEA 4HWDA 3SWHA 3TKLB 2NTXA 2J62A 5L3CB 4AQFA 4UIGA 4ZI7E 5C8YE 4U3CA 3TLUA 2QRXA 3Q5XA 4PK6A 3CVRA 3KV4A 1MNDA 4ILCA 5M4YA 2K3WA 5HEOA 4TWHA 2LM2A 2IHR1 2WMNA 2XQ4A 2X9WA 4H9QC 3B13A 3EVYA 5AFUL 4HWIB 1BR4A 2VK9A 2XQYA 1YKHB 2BKOA 3EUHA 4YTMA 2VL8A 4KHPT 2A3DA 3AECA 2XQ3A 4JI3T 4HFVA 4JLEA 1SHZC
chains in the Genus database with same CATH topology
5L3EB 2E9XC 3CX8B 5CB4E 3JC6D 3A5XA 2KZ7B 4BAYB 5EK3A 4IGUA 1SA0E 1U5PA 2EHOD 2NP9A 3AB3B 3ZLIA 2X68A 3ESLA 5HAXA 2LEHA 5L3BB 1MNEA 2D0UA 4JEHB 1OWAA 2WWUA 3AVSA 4UELA 4UVCB 5LHGB 1HTJF 5KX5E 3NZQA 5J2TE 2IAKA 3KINB 5LNKA 4EB6E 3MK7C 2CXDA 3CMLA 1WR6A 4X20E 4E7SA 1D1AA 5HXCA 2CMRA 2D2SA 3GN5B 4OFZA 4UV9B 3R6NA 2CLYB 5LA6E 3ZC1A 2ZM0A 3RYHE 4O8SA 2NTYA 3N2OA 5JR9C 3MJXA 4HTEA 2QGSA 2C5KT 4PW8A 4O4JE 4PFPA 2JMHA 2BZBA 5FYMA 2CE7A 3NRYA 1S94A 2MBGA 2RP4A 5HXEA 1BR1A 2QA7A 2M67A 3KBUA 4ZS2A 4H9SE 4L5GA 4TV8E 2LSYA 1WRDA 4K0UA 4KUMB 4E7ZA 2C0SA 2XASB 2WSSV 2KT9A 2W62A 2DLRA 3HA4A 4PK5A 1OXZA 3T8OA 2VKDA 1EZ3A 1D1CA 1FMVA 1HFAA 2LSKA 5LHIB 3C4XA 1WLXA 4PJNA 3P8CD 4O4IE 4AQFC 5HYAA 5LOVE 3DTOA 4OHFA 1WYBA 5L2LA 3N9MA 2CXLA 4JEUB 5LCYA 2YINA 2H7OA 2UXXB 3UFEA 4L0RA 2JQQA 3LBXB 2V7MA 3QUJA 1Z0PA 3LK3B 3UUMA 3ZN0B 2VWAA 2CCQA 2YU1A 4BA9A 3RRWA 4G2AA 4V1Av 3UTKA 3RC8A 3RC3A 4O2AE 2XAFB 2P9BA 2BVLA 2Q9QC 2HH7A 4NUVA 3GMIA 1MMAA 2E9XB 4HEAA 5ADXL 5JDLA 3OYXA 4WBOA 4CQIA 2XAHB 3OBVE 4N78D 2E8IA 4MLKA 2K48A 3AA1B 3MZKB 3N9NA 3V5SA 1MIVA 2ODUA 5JH7E 3KFWX 3K8PC 2CXFA 3H37A 5L3GB 3IBPA 3ETUA 5JQGE 2OA5A 5LP6E 4M1PA 2DWGA 3ZJ1A 4AQGA 4FJOA 2NOXA 1D1BA 4DO0A 3CKDA 4IE4A 2GK9A 3CQGB 2C5IT 1QSDA 3RYCE 4DNDA 5LJMA 4AKGA 4DBRA 4UF0A 4UVAB 3PU8A 3NBXX 2WM9A 2CM0A 1NWMX 5JR9B 1S35A 2KMFA 5DQWA 4CXWA 2PJQA 3F31A 2E9XD 5CA1E 3PUAA 5JDMA 2LHNA 3FBZA 1ZEEA 3PTRB 4EYUA 4FI5A 3U78A 3PUGA 2K5BB 2W0GA 2ODVA 4EOZB 1ZKEA 2XUEA 3DJBA 4QXCB 1B7TA 3K3NA 4ANJA 2N1GA 1CUNA 3AA0B 4PFOA 2WAUA 2CA5A 2DCFA 3O1IA 3R84B 1VRBA 2D5UA 3CPZA 2BDEA 4ZHQE 4KP3C 5FNVE 2JRKA 3C98B 3IEEA 4ZI3C 5JRCB 3ZMVB 4EZ4A 1LKXA 2W00A 2XHEB 5FP3A 3O9XA 3HKEE 2ACXA 4MBQA 3ZYKA 2RA1A 3ZMTB 4X1IE 2X51A 3VHLA 5HXSA 5LGNB 3EDUA 1KNZA 1VOMA 3Q2MA 4A56A 3LK2B 5JREA 2Q9QB 3F57A 3ZMSB 4GIWA 3O1JA 5LXTE 3ZMUB 3OKQA 3HI2A 3ZEFB 4YJ2E 4P0AA 4UEMA 3ZPOA 4IHJE 2HPJA 3MACA 1UX4A 3FB2A 1NAFA 2CEAA 2V26A 4XZCA 4CXXA 3PUSA 4UXNB 3RYIE 2X9YA 2DI4A 3RKOA 3ANWA 5L3DB 3FXDB 4IE0A 5H6RB 5F3JA 1FIOA 5LJNA 5HWYA 3Q5WA 2Y8DA 3AAIA 2KINB 4P0BA 5CA0E 2X9HA 2X9XA 4O4LE 4AKHA 3OYZA 3B57A 3AAAB 3C64A 2N9DA 3ZYMA 5JDNA 4ZS3A 1FMWA 4YFSA 3QK6A 1U4QA 4PAGA 4UV8B 1MIYA 4QHOA 4CI1B 2Q9QD 2L8KA 4HN9A 4BJNA 2V7KA 3VKGA 2XAJB 3HKCE 2MOZA 3HKDE 4GK5E 1YW0A 2EHOA 4EIWA 3E0ZA 1US7B 3I9YA 4AXPA 3ETVA 3CX7B 3C51A 4I43B 2KWIB 2VKJA 2H7VC 3HKBE 4WNKA 2DNXA 2NW8A 4EYYR 4ZOLE 3ZCIA 2Y48B 5FY1A 1UCUA 2X67A 4ASKA 4ZI2C 3FXEB 4OYKA 2WMOA 2HPLA 2A2FX 4QKNA 3SOLA 4EXTA 1HX8A 3IHRA 2G0UA 2DHRA 4U74A 4H9OC 3KBTA 3PDYA 3CQXC 5KMGP 2MYSA 5FXXA 4PJMA 2ZM2A 4QXBB 5EZYE 4QX8B 3I1AA 2IC6A 1T98A 4ISSA 5KDMC 4I50E 1BR2A 3N2KE 1WYCA 3C4WA 3HR0A 1LVFA 3FHNA 2MTQA 4ILUA 1G8XA 2V1DB 4U72A 5DQVA 1V9DA 4GYRA 1H7CA 2C5JA 3BK9A 2DWKA 3LFMA 3EDVA 3RH3A 3ZMZB 1YKEB 4MHCA 2SPCA 1IAPA 4F6RC 3H3AA 3SS1A 4EZHA 3OJAA 1QUUA 2JJ9A 3LK42 4HGAA 3E22E 5LBQB 3GN5A 2UXNB 4IE5A 4ZI3D 2B1EA 3Q9DA 3GWHA 5IYZE 3L09A 1HG5A 3V5UA 4YHJA 5HXHA 3ANWB 3WAJA 4I55E 4AI6A 2LM9A 1LRZA 2YEVC 2L3LA 2VASA 1FEWA 2KLQA 3N5LA 2ES0A 4DVDA 2KNDA 3AAEB 2ZLYA 5L3FB 4I4TE 2V7IA 4YJ3E 3KV5A 3M65A 4CXYA 4YLHA 2LSGA 4IE6A 1MMDA 5EK2A 4TN7B 2PFVA 5LHHB 4C91A 3BQKA 4C90A 4TUYE 1LVKA 4ISTA 3RRCA 3K3QC 3D0TA 4IIJE 4PJLA 5J1GA 4XBFB 3IF8B 1BR0A 3AVRA 4QXHB 3VU7H 1MIWA 1ZHCA 4MALA 3KDSE 3J7Yq 5EK4A 4H9NC 4AKLA 2LOPA 3LBXA 5ETWA 5FMNA 1AJ3A 2L9QA 4PK4A 2H3RA 3CQCB 3ZC0A 4IDZA 3UUNA 4ADZA 4AKRB 4TV9E 5F8PA 3KVBA 5FXWA 2LOSA 3C50A 3RPUA 2E9XA 1KK7A 3J9X1 1E1HB 3QC9A 4GOUA 4OK0A 5J2UE 3UT5E 3MXZA 2NWBA 3CX6B 4HKAA 3N9OA 3UUXB 1Y64B 3I0OA 3I0QA 2X66A 4UVBB 2LSIA 4O4HE 2VKHA 4DMVA 3ONXA 4ZI2D 4PJJA 1MMGA 1O3XA 3U3IA 2V7LA 2I59A 4NUUA 2IW5B 2Z6EA 4H9RC 3BQLA 4UF0B 4H9PC 5GONE 2IC9A 4ERRA 4JUYA 3N9PA 5JR9A 3JC6C 2VKOA 2A72A 1HCIA 4B6XA 3ZN1B 4QX7B 3W15B 2EHOC 3S4UA 2W63A 3BQIA 3CWZB 4Z8XA 2XTLA 4TZ4C 2V7JA 3E08A 4MFRA 4KMCA 4GK0E 3LG7A 4CZZB 2LE8A 4KBMB 4O2BE 1HF8A 5FXZA 3WI3A 3ZCJA 2Y6XA 3LJCA 5LYJE 2VB6A 4TX5A 3SWHA 3RYFE 3AA7B 5HXRA 3TKLB 2K9AA 3MA9A 4IE7A 3VKHA 2NTXA 5JRCA 2W61A 4AQFA 5L3CB 1ZV4X 4L9IA 4X1YE 2LHRA 5IHYA 2JMKA 4UIGA 2KWHA 4HE8A 5JDQA 4CI3B 2KXPB 3PE0A 4ZI7E 5C8YE 3N9QA 2XAQB 4WBNE 2LJLA 2BVMA 1D0ZA 2PBIA 5JDHA 4J2CA 2LSJA 3Q5XA 2ZM8A 4PK6A 2Q9QA 3CVRA 3F2EA 3KV4A 5FXVA 1IJ6A 1MNDA 3NRXA 5LGUB 1HS7A 4CI2B 3KV6A 5M4YA 2NW7A 3MKDA 3O4XE 4WW0A 1D0XA 3SRZA 2X0LB 3AA6B 5DJQC 4H63H 5LGTB 2NW9A 2CLYC 3I9WA 1IJ5A 1D0YA 2D0TA 2K24A 5H6QB 3ZJ2A 3KV9A 3PURA 4P09A 3HL6A 3GA8A 5E0OA 2ZMAA 2N2NA 2PG8A 3DP7A 4DMWA 5A1LA 2JPFA 2WMNA 2CWYA 3L3PA 5LG4A 3KVAA 2XAGB 2X9WA 5JDFA 5DABA 4H9QC 3UULA 3B13A 5FY0A 5JDGA 4XAXB 2WBLA 3EVYA 1IZNB 1G73A 3K3OA 3N9LA 5AFUL 1BR4A 2LT3A 2VK9A 2XQYA 4EAHA 3ZYLA 1YKHB 3PU3A 5HWXA 2EHOB 5TAOA 1YD8G 4G63A 4X1KE 5FY7A 3RX6A 3WAKA 3NZPA 3P7IA 3O1HA 4QWNB 2YK0A 1X79A 4DBQA 2YU2A 2CWOA 3N2GE 3EUHA 4BJMA 4OYJA 2J1DG 1MMNA 2VL8A 5JVDE 3PUQA 4GYSA 2A3DA 1HG2A 4AKIA 4HFVA 4H63V 3FBLA 5LBMA 3C4ZA 4PNIA 5BMVE 4JLEA 1UX5A 1SHZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WLX A;  1HCI A;  3F31 A;  3FB2 A;  1U5P A;  3PE0 A;  2ODU A;  3LBX B;  3LBX A;  3UUM A;  3EDV A;  1OWA A;  2ODV A;  1AJ3 A;  3UUN A;  1CUN A;  3UUL A;  2SPC A;  1QUU A;  1U4Q A;  1S35 A; 
#chains in the Genus database with same CATH topology
 3Q5E A;  4BAY B;  5EK3 A;  1T8B A;  1SA0 E;  3ONL C;  4JI5 T;  2NP9 A;  4U33 A;  4YY3 T;  4JEH B;  3AVS A;  4UVC B;  3FZF B;  5J2T E;  2WU5 A;  3MK7 C;  4EV6 A;  3NWI A;  5HXC A;  3VRA A;  2CLY B;  3ZT7 A;  3CK6 A;  3RYH E;  1UUS A;  4PFP A;  2BZB A;  5FYM A;  2OV9 A;  5HEG A;  2QA7 A;  1GQE A;  1X9B A;  4ZS2 A;  4TV8 E;  4AQY T;  2C0S A;  2KT9 A;  3HA4 A;  2BKP A;  1D1C A;  2LSK A;  5LHI B;  1XDO A;  3C4X A;  1WLX A;  2XQ6 A;  1YXR A;  4PJN A;  3P8C D;  1WYB A;  2CXL A;  2XQ9 A;  1QLB A;  3TLS A;  2YIN A;  2UXX B;  4L0R A;  4BA9 A;  3RRW A;  4G2A A;  3RC3 A;  2HH7 A;  1MMA A;  2E9X B;  3OYX A;  4CQI A;  2BBH A;  3OBV E;  4YSY A;  4Q25 A;  3AA1 B;  3MZK B;  3UQ7 A;  3AE7 A;  3KFW X;  3K8P C;  3H37 A;  5FL0 A;  1YQ3 A;  3ETU A;  2VQE T;  4DV4 T;  2XPK A;  2NOX A;  1D1B A;  3CKD A;  4AKG A;  1QSD A;  5LJM A;  2WM9 A;  2CM0 A;  1NWM X;  3VR8 A;  2E5L T;  5LG3 A;  3JAF A;  2XZE A;  1NEK A;  2KMF A;  4HWH A;  5CA1 E;  2MPK A;  2FUP A;  2LHN A;  1OED E;  3EAB A;  5CJ5 A;  2K5B B;  4DR3 T;  2W0G A;  4DR1 T;  1B7T A;  3K3N A;  4ANJ A;  3O1I A;  1VRB A;  2D5U A;  4DID B;  3IEE A;  4ZI3 C;  2XHE B;  3HKE E;  3ZYK A;  2RA1 A;  2X51 A;  3VHL A;  4QH5 A;  2FJE A;  3Q2M A;  3AE6 A;  2QYW A;  1ZP0 A;  3ZEF B;  4IHJ E;  2HPJ A;  1NAF A;  4XZC A;  4UXN B;  2DI4 A;  3FZH B;  3ZST A;  5LJN A;  3AAI A;  4NXM T;  4LFA T;  4O4L E;  1W09 A;  3AAA B;  2N9D A;  2BG9 C;  4YFS A;  2Q9Q D;  2L8K A;  2V7K A;  4A98 A;  3HKD E;  1YW0 A;  2WU2 A;  1US7 B;  3I9Y A;  4AXP A;  3ETV A;  3HKB E;  2NW8 A;  2HPL A;  4QKN A;  1T7S A;  5C2T A;  4EXT A;  1HX8 A;  3RLF F;  2B76 A;  3PUV F;  5KMG P;  4JI8 T;  5LMU T;  2WS3 A;  1W0A A;  4I0U A;  1OED A;  4I50 E;  3PJA J;  1WYC A;  3HR0 A;  3FHN A;  1G8X A;  5DQV A;  1H7C A;  3LFM A;  2DWK A;  1HNZ T;  4A5X A;  4MHC A;  4HWF A;  4IDQ A;  3SS1 A;  3M3Z B;  1YQ4 A;  2H89 A;  3GWH A;  2M6I A;  2WP9 A;  3V5U A;  4YHJ A;  4NPP A;  4GKK T;  2LM9 A;  2CHO A;  2YDR A;  2ES0 A;  4DVD A;  3AAE B;  5AQK B;  3M65 A;  2LSG A;  2DL1 A;  3QB5 A;  4ZZB A;  5EK2 A;  2WCA A;  4TN7 B;  1R8I A;  4TUY E;  2XSA A;  2V5C A;  4QXH B;  1MIW A;  4MAL A;  1KFY A;  3KDS E;  2CBI A;  5ETW A;  3AEF A;  4PK4 A;  3CQC B;  3ZC0 A;  4IRE A;  3UUN A;  4ADZ A;  4AKR B;  5F8P A;  4ZEY A;  3C50 A;  2JIW A;  5HEH A;  3J9X 1;  2XQ7 A;  3RHW A;  3UT5 E;  2NWB A;  5JTG A;  3I0O A;  3I0Q A;  4UVB B;  3A8Y C;  3ONX A;  1O3X A;  2WY2 A;  3U3I A;  3AXJ A;  2I59 A;  2Z6E A;  3BQL A;  4H9P C;  2XJ7 A;  3Q5D A;  4HFC A;  4KHZ F;  2VKO A;  2A72 A;  4HFI A;  4B6X A;  2VL0 A;  3ZN1 B;  3QB5 K;  3W15 B;  2EHO C;  2ZM6 T;  2IDO B;  3BQI A;  2XTL A;  4TZ4 C;  4CZZ B;  2LE8 A;  4O2B E;  1KF6 A;  4HFE A;  3ZCJ A;  4X66 T;  5LMN T;  3RYF E;  3AA7 B;  5HXR A;  2K9A A;  3VKH A;  5JRC A;  4WYV A;  1ZV4 X;  2IUB A;  2JMK A;  4DV5 T;  5JDQ A;  3OPC A;  4HFH A;  3AE1 A;  3N9Q A;  2BVM A;  3QOF A;  2LSJ A;  2ZM8 A;  2Q9Q A;  3NRX A;  4CI2 B;  4TWF A;  2BS3 A;  2YDQ A;  5DJQ C;  3RKG A;  3JCF A;  3AE8 A;  3ZJ2 A;  1IBK T;  3PUR A;  3GA8 A;  3DP7 A;  3KVA A;  3UUL A;  5FY0 A;  5JDG A;  4XAX B;  2WBL A;  1IZN B;  3PU3 A;  3ABV A;  4G63 A;  4X1K E;  5FY7 A;  5FL1 A;  3NZP A;  4QWN B;  1X79 A;  1J5W A;  2J1D G;  1MMN A;  4JI1 T;  1ZOY A;  3PUQ A;  4JV5 T;  4AKI A;  4X65 T;  5LBM A;  4PNI A;  5BMV E;  3PUA A;  3P4W A;  5L3E B;  1OED B;  1W0B A;  3CX8 B;  4ZZC A;  4KX6 A;  1U5P A;  3AB3 B;  3ZLI A;  3PUY F;  5L3B B;  1MNE A;  1VCS A;  4UEL A;  3UQ4 A;  2UUB T;  4ILB A;  2RPA A;  2IAK A;  2CXD A;  1WR0 A;  2WQY A;  4X20 E;  4OFZ A;  4UV9 B;  3R6N A;  3FZK B;  2JQ9 A;  5AQI B;  2NTY A;  3N2O A;  5JR9 C;  4HTE A;  4YTN A;  4COF A;  2CE7 A;  5HXE A;  2M67 A;  4L5G A;  4K0U A;  4KUM B;  2XAS B;  2M6B A;  2DLR A;  4AIU A;  1FJG T;  1EZ3 A;  5AQQ B;  4DR6 T;  5HYA A;  3DTO A;  3ONJ A;  3VRB A;  3UFE A;  1Z0P A;  3UUM A;  3ZN0 B;  4CN4 A;  3RC8 A;  2XAH B;  5KXJ A;  4AIS A;  3UU4 A;  2CXF A;  4DV3 T;  1XDP A;  3IBP A;  1UK5 A;  5LP6 E;  4M1P A;  2DWG A;  3ZJ1 A;  3AXJ B;  4X5T A;  1XMO T;  2GK9 A;  2C5I T;  4UVA B;  2V8S V;  1S35 A;  5DQW A;  4CXW A;  3AE5 A;  2UXD T;  3PTR B;  4EYU A;  2D9D A;  2BS4 A;  4EOZ B;  1ZKE A;  2N1G A;  1CUN A;  3AA0 B;  4OX9 T;  4PFO A;  2WAU A;  3R84 B;  2BDE A;  5JRC B;  3UU5 A;  3O9X A;  3ZMT B;  5LGN B;  4WZX A;  1VCT A;  1VOM A;  4JI4 T;  4A56 A;  5JRE A;  5FVL A;  4JYA T;  2UXC T;  2Q9Q B;  2WZH A;  3ZT5 A;  3TLW A;  4P0A A;  2F4V T;  3L8R A;  5ABH A;  1UX4 A;  3FB2 A;  1M62 A;  2VVS A;  4TWD A;  3RYI E;  1N34 T;  3AE9 A;  5L3D B;  4IE0 A;  3PJA A;  3ZYM A;  2FJB A;  3QK6 A;  1U4Q A;  4PAG A;  4BJN A;  5AQM B;  3HKC E;  2NR4 A;  2HN1 A;  3CX7 B;  3RIU A;  2VKJ A;  2H7V C;  4ZOL E;  1UGO A;  1UCU A;  4ASK A;  4GKJ T;  2YN6 A;  4OYK A;  3ZSS A;  1XNR T;  3G06 A;  4U74 A;  4H9O C;  1SUM B;  3PDY A;  4NXN T;  5FXX A;  5EZY E;  1JNZ A;  4QX8 B;  3I1A A;  2FBW A;  5AQV B;  4U72 A;  1V9D A;  2C5J A;  1N32 T;  3ZMZ B;  1E7P A;  2CRB A;  2SPC A;  1IAP A;  2WDQ A;  4EZH A;  4QH4 A;  4HGA A;  3E22 E;  5LBQ B;  4ZI3 D;  2B1E A;  5IYZ E;  1LRZ A;  2XY8 B;  4U2Y A;  1FEW A;  2KLQ A;  2KND A;  5L3F B;  2V7I A;  4YJ3 E;  3X1D A;  4CXY A;  4YLH A;  4IE6 A;  5J0Z A;  4C90 A;  5IWA T;  2QVA A;  1LVK A;  3P4S A;  1XMQ T;  4XBF B;  4DV0 T;  3IF8 B;  1BR0 A;  3AVR A;  3J7Y q;  2YDS A;  2W66 A;  3LBX A;  3LSV A;  5FXW A;  2LOS A;  4B3S T;  1E1H B;  3MXZ A;  3UUX B;  4HKA A;  1Y64 B;  2V6Y A;  2LSI A;  4QH1 A;  3ZKR A;  2V7L A;  4H9R C;  4ERR A;  3JC6 C;  3AE2 A;  4QX7 B;  1HNX T;  3S4U A;  4Z8X A;  3E08 A;  4KBM B;  3A7M A;  5HCM A;  1HNW T;  2Y6X A;  5LYJ E;  2VB6 A;  4TX5 A;  4LML A;  4DR4 T;  4LF5 T;  2W61 A;  2XM2 A;  2LHR A;  4B3M T;  5IHY A;  3T1H T;  3PE0 A;  2XAQ B;  4IL4 A;  4WBN E;  2LJL A;  5JDH A;  2PBI A;  2CHN A;  3F2E A;  2BG9 E;  1IJ6 A;  4LF6 T;  5LGU B;  3MKD A;  3O4X E;  1D0X A;  2LLY A;  4H63 H;  2NW9 A;  2CLY C;  3I9W A;  1IJ5 A;  1E2A A;  2K24 A;  3KV9 A;  4P09 A;  3HL6 A;  2X0H A;  5E0O A;  2ZMA A;  3UUB A;  2JPF A;  5ABE A;  2FJA A;  5DAB A;  1IBM T;  4Z91 A;  3K3O A;  3N9L A;  3IA3 A;  2LT3 A;  5AQL B;  3WAK A;  3UFG A;  3P7I A;  2YK0 A;  4DBQ A;  4LF9 T;  2YU2 A;  2CWO A;  2X0Y A;  4BJM A;  4OYJ A;  1HG2 A;  4IDP A;  3FBL A;  5FKY A;  1XNQ T;  2UU9 T;  4YSX A;  1HX1 B;  1UUR A;  2E9X C;  3A5X A;  2KZ7 B;  1I94 T;  4IGU A;  3RQW A;  4LF7 T;  2EHO D;  3ESL A;  5HAX A;  2LEH A;  2D0U A;  1OWA A;  5LHG B;  5KX5 E;  5LNK A;  3CML A;  5AQJ B;  4E7S A;  5L4H A;  1XWM A;  5LA6 E;  3ZC1 A;  2ZM0 A;  4O8S A;  3MJX A;  3TLT A;  2QGS A;  4PW8 A;  4O4J E;  2JMH A;  3AEB A;  3NRY A;  1S94 A;  2RP4 A;  4H9S E;  1WRD A;  5AQT B;  4E7Z A;  2BG9 A;  2A9U A;  2WSS V;  1KEY A;  3T8O A;  1HFA A;  3UU8 A;  4DV6 T;  4AQF C;  3FZM B;  5L2L A;  4JEU B;  5LCY A;  2H7O A;  3LBX B;  3LK3 B;  4Z90 A;  3PUW F;  2VWA A;  2CCQ A;  2YU1 A;  5ABG A;  4O2A E;  2XAF B;  2P9B A;  2BVL A;  5AQP B;  3RIF A;  3GMI A;  4HEA A;  4HFB A;  4X62 T;  2K48 A;  4JI6 T;  2LKG A;  3N9N A;  2V6Y B;  3V5S A;  1MIV A;  3RF1 A;  5JH7 E;  5L3G B;  2OA5 A;  3P4Q A;  3EI0 A;  4FJO A;  2V6X A;  3RGL A;  4DO0 A;  4YT0 A;  4IE4 A;  3CQG B;  3RYC E;  4DND A;  4U7I A;  1I6Z A;  5F5W A;  4DBR A;  4UF0 A;  3PU8 A;  2LRK A;  3NBX X;  4YTP A;  5JDM A;  3FBZ A;  1ZEE A;  4FI5 A;  2BBJ A;  3PUG A;  5ABF B;  3OVU A;  3DJB A;  4QXC B;  2WWV A;  3CPZ A;  4ZHQ E;  3AEE A;  3C98 B;  3ZMV B;  2W00 A;  5FP3 A;  2ACX A;  4MBQ A;  4X1I E;  3UU3 A;  3EDU A;  1KNZ A;  2WDR A;  2E2A A;  3LK2 B;  3F57 A;  3O1J A;  5CGM A;  3MAC A;  2CEA A;  4CXX A;  3PUZ F;  3RKO A;  3FXD B;  1FIO A;  5HWY A;  3Q5W A;  4IL9 A;  2Y8D A;  2W4X A;  2V5D A;  2X9H A;  1Z8U A;  3OYZ A;  3LDQ B;  5JDN A;  4ZS3 A;  1MIY A;  4HN9 A;  1M7K A;  4JI7 T;  3VKG A;  3RQU A;  2XAJ B;  4EIW A;  2EHO A;  3E0Z A;  2KWI B;  4WNK A;  2DNX A;  1N36 T;  3ZCI A;  2Y48 B;  4ZI2 C;  3FXE B;  2WZI A;  2WMO A;  2A2F X;  2FJD A;  2DHR A;  3KBT A;  3CQX C;  3EAM A;  2KSR A;  3JAD A;  4PJM A;  2ZM2 A;  4LF4 T;  2XQ8 A;  5KDM C;  4U2Z A;  2J4G A;  3N2K E;  2IML A;  3C4W A;  3AEA A;  2MTQ A;  4ILU A;  3RIA A;  3EDV A;  3RH3 A;  1YKE B;  3AEG A;  2AXD S;  2IIU A;  3OJA A;  4TNW A;  3NKZ A;  4K0K T;  1QUU A;  2JJ9 A;  3GN5 A;  4DV1 T;  2UXN B;  2JQH A;  3WAJ A;  3ANW B;  4AI6 A;  3AE4 A;  3SFD A;  4B3T T;  2YEV C;  2L3L A;  2VAS A;  3KV5 A;  2BG9 B;  1HR0 T;  1MMD A;  1J5E T;  4HWC A;  5LHH B;  5J1G A;  3D0T A;  4IIJ E;  4IT4 A;  4PJL A;  3VU7 H;  1ZHC A;  5EK4 A;  2OLT A;  2LOP A;  2BKN A;  5FMN A;  4YHH T;  4IDN A;  2L9Q A;  4ZXL A;  3RPU A;  2XM1 A;  1KK7 A;  1Y01 A;  3QC9 A;  4GOU A;  4OK0 A;  5J2U E;  2E5V A;  1KNR A;  5IUX A;  2CPT A;  1JNR A;  2VKH A;  4DMV A;  4PJJ A;  1DU2 A;  2IW5 B;  4UF0 B;  3OTO T;  4JUY A;  4YSZ A;  2W67 A;  5JR9 A;  2W63 A;  3CWZ B;  4GK0 E;  3LG7 A;  3WI3 A;  1HF8 A;  4U31 A;  4DUY T;  3LJC A;  1W9R A;  4DR2 T;  3MA9 A;  4IE7 A;  3VR9 A;  4UR9 A;  4L9I A;  4X1Y E;  5L4E A;  4JI0 T;  4LFC T;  4P1N A;  2KWH A;  4HE8 A;  4JBW F;  4CI3 B;  1OED C;  2KXP B;  1IBL T;  2HN2 A;  1WFD A;  2XQ5 A;  1D0Z A;  4J2C A;  5FXV A;  1HS7 A;  3KV6 A;  1XZY A;  2NW7 A;  4WW0 A;  3SRZ A;  2X0L B;  3AA6 B;  4B3R T;  2LKH A;  5LGT B;  1D0Y A;  2D0T A;  5H6Q B;  3P4P A;  1WCR A;  3AE3 A;  2N2N A;  2PG8 A;  4DMW A;  5A1L A;  4EGW A;  2CWY A;  3L3P A;  5LG4 A;  2XAG B;  5JDF A;  3T1Y T;  1G73 A;  4EAH A;  3ZYL A;  5HWX A;  2EHO B;  5TAO A;  1YD8 G;  3RX6 A;  2XQA A;  3O1H A;  3N2G E;  5AQR B;  5JVD E;  4GYS A;  5AQU B;  4H63 V;  3C4Z A;  1UX5 A;  3B5M A;  5CB4 E;  3JC6 D;  4CN6 A;  2H88 A;  2X68 A;  2WWU A;  4CN1 A;  1HTJ F;  3QNU A;  3PUX F;  5AQO B;  3NZQ A;  4IDO A;  3KIN B;  4EB6 E;  4EEB A;  4X64 T;  2WB5 A;  1WR6 A;  2LRL A;  1D1A A;  2CMR A;  2D2S A;  3GN5 B;  5HEU A;  2BS2 A;  5FVK A;  4LMJ A;  2C5K T;  2MBG A;  1BR1 A;  4TNV A;  3KBU A;  2R6G F;  2LSY A;  5BR8 T;  5ABF A;  4A97 A;  2W62 A;  4DUZ T;  4PK5 A;  1OXZ A;  2VKD A;  1FMV A;  4LFB T;  1L0V A;  4DV2 T;  5C3J A;  4O4I E;  5LOV E;  4OHF A;  1N33 T;  3N9M A;  2JQK A;  2JQQ A;  2V7M A;  3QUJ A;  4DR7 T;  4ILA A;  4V1A v;  3UTK A;  4YXD A;  2J47 A;  4LF8 T;  2Q9Q C;  4NUV A;  4U7Y A;  5JDL A;  5ADX L;  4WBO A;  4F8H A;  5L47 A;  4N78 D;  2E8I A;  2VVN A;  4MLK A;  2ODU A;  2XSB A;  5HEJ A;  3TLV A;  5JQG E;  2YKS A;  4AQG A;  1CHU A;  5JR9 B;  2MAW A;  2PJQ A;  3F31 A;  2E9X D;  3H3M A;  3PV0 F;  5AQF B;  3U78 A;  2ODV A;  3AED A;  2XUE A;  2CA5 A;  2DCF A;  3SFE A;  4KP3 C;  5FNV E;  2JRK A;  4EZ4 A;  1LKX A;  1SE7 A;  5HXS A;  4NIQ A;  2AE9 A;  2ACZ A;  2WDV A;  3ZMS B;  4GIW A;  5LXT E;  3ZMU B;  2VQF T;  3OKQ A;  3HI2 A;  4YJ2 E;  4DR5 T;  4UEM A;  3ZPO A;  3P4R A;  2V26 A;  3PUS A;  2X9Y A;  4LMK A;  3ANW A;  5H6R B;  5F3J A;  2UUA T;  2KIN B;  4P0B A;  5CA0 E;  2X9X A;  2I6H A;  4AKH A;  3B57 A;  3C64 A;  3EHZ A;  1FMW A;  4UV8 B;  4QHO A;  4CI1 B;  3RI5 A;  2MOZ A;  4GK5 E;  3C51 A;  4I43 B;  3L39 A;  4EYY R;  5FY1 A;  2X67 A;  3SOL A;  3IHR A;  2G0U A;  3ZT6 A;  2MYS A;  1T72 A;  4QXB B;  2IC6 A;  1T98 A;  4ISS A;  5AQH B;  1BR2 A;  1J1J A;  1LVF A;  2V1D B;  4GYR A;  3BK9 A;  4F6R C;  3H3A A;  3LK4 2;  3FZL B;  5LB7 B;  4IE5 A;  3Q9D A;  4JI2 T;  3L09 A;  1HG5 A;  5HCJ A;  5HXH A;  3UU6 A;  4I55 E;  2PTF A;  3P50 A;  3N5L A;  5AQS B;  2ZLY A;  4I4T E;  2W2U A;  4DV7 T;  1NEN A;  4KI0 F;  2PFV A;  4C91 A;  3BQK A;  5AQG B;  4IST A;  3RRC A;  4EED A;  3K3Q C;  3CIR A;  4H9N C;  4AKL A;  1AJ3 A;  2H3R A;  2UUC T;  4IDZ A;  1KNP A;  4TV9 E;  2CBJ A;  3KVB A;  2YOE A;  2E9X A;  2I0M A;  2HHH T;  3CX6 B;  3N9O A;  2UXB T;  4HFD A;  2X66 A;  4O4H E;  4ZI2 D;  1MMG A;  2VUR A;  4NUU A;  5AQN B;  5GON E;  2IC9 A;  5CFB A;  3N9P A;  3K1S A;  1HCI A;  3RIU C;  2V7J A;  4MFR A;  4KMC A;  5FXZ A;  3NVO A;  3JAE A;  4HWD A;  3SWH A;  3TKL B;  2NTX A;  2J62 A;  5L3C B;  4AQF A;  4UIG A;  4ZI7 E;  5C8Y E;  4U3C A;  3TLU A;  2QRX A;  3Q5X A;  4PK6 A;  3CVR A;  3KV4 A;  1MND A;  4ILC A;  5M4Y A;  2K3W A;  5HEO A;  4TWH A;  2LM2 A;  2IHR 1;  2WMN A;  2XQ4 A;  2X9W A;  4H9Q C;  3B13 A;  3EVY A;  5AFU L;  4HWI B;  1BR4 A;  2VK9 A;  2XQY A;  1YKH B;  2BKO A;  3EUH A;  4YTM A;  2VL8 A;  4KHP T;  2A3D A;  3AEC A;  2XQ3 A;  4JI3 T;  4HFV A;  4JLE A;  1SHZ C; 
#chains in the Genus database with same CATH homology
 5L3E B;  2E9X C;  3CX8 B;  5CB4 E;  3JC6 D;  3A5X A;  2KZ7 B;  4BAY B;  5EK3 A;  4IGU A;  1SA0 E;  1U5P A;  2EHO D;  2NP9 A;  3AB3 B;  3ZLI A;  2X68 A;  3ESL A;  5HAX A;  2LEH A;  5L3B B;  1MNE A;  2D0U A;  4JEH B;  1OWA A;  2WWU A;  3AVS A;  4UEL A;  4UVC B;  5LHG B;  1HTJ F;  5KX5 E;  3NZQ A;  5J2T E;  2IAK A;  3KIN B;  5LNK A;  4EB6 E;  3MK7 C;  2CXD A;  3CML A;  1WR6 A;  4X20 E;  4E7S A;  1D1A A;  5HXC A;  2CMR A;  2D2S A;  3GN5 B;  4OFZ A;  4UV9 B;  3R6N A;  2CLY B;  5LA6 E;  3ZC1 A;  2ZM0 A;  3RYH E;  4O8S A;  2NTY A;  3N2O A;  5JR9 C;  3MJX A;  4HTE A;  2QGS A;  2C5K T;  4PW8 A;  4O4J E;  4PFP A;  2JMH A;  2BZB A;  5FYM A;  2CE7 A;  3NRY A;  1S94 A;  2MBG A;  2RP4 A;  5HXE A;  1BR1 A;  2QA7 A;  2M67 A;  3KBU A;  4ZS2 A;  4H9S E;  4L5G A;  4TV8 E;  2LSY A;  1WRD A;  4K0U A;  4KUM B;  4E7Z A;  2C0S A;  2XAS B;  2WSS V;  2KT9 A;  2W62 A;  2DLR A;  3HA4 A;  4PK5 A;  1OXZ A;  3T8O A;  2VKD A;  1EZ3 A;  1D1C A;  1FMV A;  1HFA A;  2LSK A;  5LHI B;  3C4X A;  1WLX A;  4PJN A;  3P8C D;  4O4I E;  4AQF C;  5HYA A;  5LOV E;  3DTO A;  4OHF A;  1WYB A;  5L2L A;  3N9M A;  2CXL A;  4JEU B;  5LCY A;  2YIN A;  2H7O A;  2UXX B;  3UFE A;  4L0R A;  2JQQ A;  3LBX B;  2V7M A;  3QUJ A;  1Z0P A;  3LK3 B;  3UUM A;  3ZN0 B;  2VWA A;  2CCQ A;  2YU1 A;  4BA9 A;  3RRW A;  4G2A A;  4V1A v;  3UTK A;  3RC8 A;  3RC3 A;  4O2A E;  2XAF B;  2P9B A;  2BVL A;  2Q9Q C;  2HH7 A;  4NUV A;  3GMI A;  1MMA A;  2E9X B;  4HEA A;  5ADX L;  5JDL A;  3OYX A;  4WBO A;  4CQI A;  2XAH B;  3OBV E;  4N78 D;  2E8I A;  4MLK A;  2K48 A;  3AA1 B;  3MZK B;  3N9N A;  3V5S A;  1MIV A;  2ODU A;  5JH7 E;  3KFW X;  3K8P C;  2CXF A;  3H37 A;  5L3G B;  3IBP A;  3ETU A;  5JQG E;  2OA5 A;  5LP6 E;  4M1P A;  2DWG A;  3ZJ1 A;  4AQG A;  4FJO A;  2NOX A;  1D1B A;  4DO0 A;  3CKD A;  4IE4 A;  2GK9 A;  3CQG B;  2C5I T;  1QSD A;  3RYC E;  4DND A;  5LJM A;  4AKG A;  4DBR A;  4UF0 A;  4UVA B;  3PU8 A;  3NBX X;  2WM9 A;  2CM0 A;  1NWM X;  5JR9 B;  1S35 A;  2KMF A;  5DQW A;  4CXW A;  2PJQ A;  3F31 A;  2E9X D;  5CA1 E;  3PUA A;  5JDM A;  2LHN A;  3FBZ A;  1ZEE A;  3PTR B;  4EYU A;  4FI5 A;  3U78 A;  3PUG A;  2K5B B;  2W0G A;  2ODV A;  4EOZ B;  1ZKE A;  2XUE A;  3DJB A;  4QXC B;  1B7T A;  3K3N A;  4ANJ A;  2N1G A;  1CUN A;  3AA0 B;  4PFO A;  2WAU A;  2CA5 A;  2DCF A;  3O1I A;  3R84 B;  1VRB A;  2D5U A;  3CPZ A;  2BDE A;  4ZHQ E;  4KP3 C;  5FNV E;  2JRK A;  3C98 B;  3IEE A;  4ZI3 C;  5JRC B;  3ZMV B;  4EZ4 A;  1LKX A;  2W00 A;  2XHE B;  5FP3 A;  3O9X A;  3HKE E;  2ACX A;  4MBQ A;  3ZYK A;  2RA1 A;  3ZMT B;  4X1I E;  2X51 A;  3VHL A;  5HXS A;  5LGN B;  3EDU A;  1KNZ A;  1VOM A;  3Q2M A;  4A56 A;  3LK2 B;  5JRE A;  2Q9Q B;  3F57 A;  3ZMS B;  4GIW A;  3O1J A;  5LXT E;  3ZMU B;  3OKQ A;  3HI2 A;  3ZEF B;  4YJ2 E;  4P0A A;  4UEM A;  3ZPO A;  4IHJ E;  2HPJ A;  3MAC A;  1UX4 A;  3FB2 A;  1NAF A;  2CEA A;  2V26 A;  4XZC A;  4CXX A;  3PUS A;  4UXN B;  3RYI E;  2X9Y A;  2DI4 A;  3RKO A;  3ANW A;  5L3D B;  3FXD B;  4IE0 A;  5H6R B;  5F3J A;  1FIO A;  5LJN A;  5HWY A;  3Q5W A;  2Y8D A;  3AAI A;  2KIN B;  4P0B A;  5CA0 E;  2X9H A;  2X9X A;  4O4L E;  4AKH A;  3OYZ A;  3B57 A;  3AAA B;  3C64 A;  2N9D A;  3ZYM A;  5JDN A;  4ZS3 A;  1FMW A;  4YFS A;  3QK6 A;  1U4Q A;  4PAG A;  4UV8 B;  1MIY A;  4QHO A;  4CI1 B;  2Q9Q D;  2L8K A;  4HN9 A;  4BJN A;  2V7K A;  3VKG A;  2XAJ B;  3HKC E;  2MOZ A;  3HKD E;  4GK5 E;  1YW0 A;  2EHO A;  4EIW A;  3E0Z A;  1US7 B;  3I9Y A;  4AXP A;  3ETV A;  3CX7 B;  3C51 A;  4I43 B;  2KWI B;  2VKJ A;  2H7V C;  3HKB E;  4WNK A;  2DNX A;  2NW8 A;  4EYY R;  4ZOL E;  3ZCI A;  2Y48 B;  5FY1 A;  1UCU A;  2X67 A;  4ASK A;  4ZI2 C;  3FXE B;  4OYK A;  2WMO A;  2HPL A;  2A2F X;  4QKN A;  3SOL A;  4EXT A;  1HX8 A;  3IHR A;  2G0U A;  2DHR A;  4U74 A;  4H9O C;  3KBT A;  3PDY A;  3CQX C;  5KMG P;  2MYS A;  5FXX A;  4PJM A;  2ZM2 A;  4QXB B;  5EZY E;  4QX8 B;  3I1A A;  2IC6 A;  1T98 A;  4ISS A;  5KDM C;  4I50 E;  1BR2 A;  3N2K E;  1WYC A;  3C4W A;  3HR0 A;  1LVF A;  3FHN A;  2MTQ A;  4ILU A;  1G8X A;  2V1D B;  4U72 A;  5DQV A;  1V9D A;  4GYR A;  1H7C A;  2C5J A;  3BK9 A;  2DWK A;  3LFM A;  3EDV A;  3RH3 A;  3ZMZ B;  1YKE B;  4MHC A;  2SPC A;  1IAP A;  4F6R C;  3H3A A;  3SS1 A;  4EZH A;  3OJA A;  1QUU A;  2JJ9 A;  3LK4 2;  4HGA A;  3E22 E;  5LBQ B;  3GN5 A;  2UXN B;  4IE5 A;  4ZI3 D;  2B1E A;  3Q9D A;  3GWH A;  5IYZ E;  3L09 A;  1HG5 A;  3V5U A;  4YHJ A;  5HXH A;  3ANW B;  3WAJ A;  4I55 E;  4AI6 A;  2LM9 A;  1LRZ A;  2YEV C;  2L3L A;  2VAS A;  1FEW A;  2KLQ A;  3N5L A;  2ES0 A;  4DVD A;  2KND A;  3AAE B;  2ZLY A;  5L3F B;  4I4T E;  2V7I A;  4YJ3 E;  3KV5 A;  3M65 A;  4CXY A;  4YLH A;  2LSG A;  4IE6 A;  1MMD A;  5EK2 A;  4TN7 B;  2PFV A;  5LHH B;  4C91 A;  3BQK A;  4C90 A;  4TUY E;  1LVK A;  4IST A;  3RRC A;  3K3Q C;  3D0T A;  4IIJ E;  4PJL A;  5J1G A;  4XBF B;  3IF8 B;  1BR0 A;  3AVR A;  4QXH B;  3VU7 H;  1MIW A;  1ZHC A;  4MAL A;  3KDS E;  3J7Y q;  5EK4 A;  4H9N C;  4AKL A;  2LOP A;  3LBX A;  5ETW A;  5FMN A;  1AJ3 A;  2L9Q A;  4PK4 A;  2H3R A;  3CQC B;  3ZC0 A;  4IDZ A;  3UUN A;  4ADZ A;  4AKR B;  4TV9 E;  5F8P A;  3KVB A;  5FXW A;  2LOS A;  3C50 A;  3RPU A;  2E9X A;  1KK7 A;  3J9X 1;  1E1H B;  3QC9 A;  4GOU A;  4OK0 A;  5J2U E;  3UT5 E;  3MXZ A;  2NWB A;  3CX6 B;  4HKA A;  3N9O A;  3UUX B;  1Y64 B;  3I0O A;  3I0Q A;  2X66 A;  4UVB B;  2LSI A;  4O4H E;  2VKH A;  4DMV A;  3ONX A;  4ZI2 D;  4PJJ A;  1MMG A;  1O3X A;  3U3I A;  2V7L A;  2I59 A;  4NUU A;  2IW5 B;  2Z6E A;  4H9R C;  3BQL A;  4UF0 B;  4H9P C;  5GON E;  2IC9 A;  4ERR A;  4JUY A;  3N9P A;  5JR9 A;  3JC6 C;  2VKO A;  2A72 A;  1HCI A;  4B6X A;  3ZN1 B;  4QX7 B;  3W15 B;  2EHO C;  3S4U A;  2W63 A;  3BQI A;  3CWZ B;  4Z8X A;  2XTL A;  4TZ4 C;  2V7J A;  3E08 A;  4MFR A;  4KMC A;  4GK0 E;  3LG7 A;  4CZZ B;  2LE8 A;  4KBM B;  4O2B E;  1HF8 A;  5FXZ A;  3WI3 A;  3ZCJ A;  2Y6X A;  3LJC A;  5LYJ E;  2VB6 A;  4TX5 A;  3SWH A;  3RYF E;  3AA7 B;  5HXR A;  3TKL B;  2K9A A;  3MA9 A;  4IE7 A;  3VKH A;  2NTX A;  5JRC A;  2W61 A;  4AQF A;  5L3C B;  1ZV4 X;  4L9I A;  4X1Y E;  2LHR A;  5IHY A;  2JMK A;  4UIG A;  2KWH A;  4HE8 A;  5JDQ A;  4CI3 B;  2KXP B;  3PE0 A;  4ZI7 E;  5C8Y E;  3N9Q A;  2XAQ B;  4WBN E;  2LJL A;  2BVM A;  1D0Z A;  2PBI A;  5JDH A;  4J2C A;  2LSJ A;  3Q5X A;  2ZM8 A;  4PK6 A;  2Q9Q A;  3CVR A;  3F2E A;  3KV4 A;  5FXV A;  1IJ6 A;  1MND A;  3NRX A;  5LGU B;  1HS7 A;  4CI2 B;  3KV6 A;  5M4Y A;  2NW7 A;  3MKD A;  3O4X E;  4WW0 A;  1D0X A;  3SRZ A;  2X0L B;  3AA6 B;  5DJQ C;  4H63 H;  5LGT B;  2NW9 A;  2CLY C;  3I9W A;  1IJ5 A;  1D0Y A;  2D0T A;  2K24 A;  5H6Q B;  3ZJ2 A;  3KV9 A;  3PUR A;  4P09 A;  3HL6 A;  3GA8 A;  5E0O A;  2ZMA A;  2N2N A;  2PG8 A;  3DP7 A;  4DMW A;  5A1L A;  2JPF A;  2WMN A;  2CWY A;  3L3P A;  5LG4 A;  3KVA A;  2XAG B;  2X9W A;  5JDF A;  5DAB A;  4H9Q C;  3UUL A;  3B13 A;  5FY0 A;  5JDG A;  4XAX B;  2WBL A;  3EVY A;  1IZN B;  1G73 A;  3K3O A;  3N9L A;  5AFU L;  1BR4 A;  2LT3 A;  2VK9 A;  2XQY A;  4EAH A;  3ZYL A;  1YKH B;  3PU3 A;  5HWX A;  2EHO B;  5TAO A;  1YD8 G;  4G63 A;  4X1K E;  5FY7 A;  3RX6 A;  3WAK A;  3NZP A;  3P7I A;  3O1H A;  4QWN B;  2YK0 A;  1X79 A;  4DBQ A;  2YU2 A;  2CWO A;  3N2G E;  3EUH A;  4BJM A;  4OYJ A;  2J1D G;  1MMN A;  2VL8 A;  5JVD E;  3PUQ A;  4GYS A;  2A3D A;  1HG2 A;  4AKI A;  4HFV A;  4H63 V;  3FBL A;  5LBM A;  3C4Z A;  4PNI A;  5BMV E;  4JLE A;  1UX5 A;  1SHZ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...