3F31A

Crystal structure of the n-terminal region of alphaii-spectrin tetramerization domain
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
137
structure length
137
Chain Sequence
TAEDIQERRQQVLDRYHRFKELSTLRRQKLEDSYRFQFFQRDAEELEKWIQEKLQIASDENYKDPTNLQGKLQKHQAFEAEVQANSGAIVKLDETGNLMISEGHFASETIRTRLMELHRQWELLLEKMREKGIKLLQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the nonerythroid alpha-spectrin tetramerization site reveals differences between erythroid and nonerythroid spectrin tetramer formation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Actin binding, structural protein
molecule keywords Spectrin alpha chain, brain
total genus 56
structure length 137
sequence length 137
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00435 Spectrin Spectrin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.60 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3f31A00
2ODVA 3UUMA 3EDVA 1OWAA 3F31A 3UUNA 1U5PA 3UULA 1S35A 1HCIA 3PE0A 1CUNA 1AJ3A 1U4QA 1WLXA 2ODUA 1QUUA 3FB2A 3LBXA 3LBXB 2SPCA
chains in the Genus database with same CATH superfamily
4LFBT 2CXDA 4Z91A 4DV6T 4PK4A 2NOXA 5L3CB 2LEHA 2JMHA 3PTRB 4C90A 3NWIA 1X9BA 5IYZE 4DR1T 3RRCA 2X0YA 3ZN1B 5FY0A 4CXYA 2XUEA 3M3ZB 5LB7B 2X51A 3IF8B 2XM1A 1I94T 2K5BB 3EABA 1BR1A 1S94A 1M7KA 1NAFA 1VCSA 3K3NA 4IREA 5EK3A 5FKYA 4FI5A 2ZM2A 5H6QB 4DR6T 2CBJA 2DHRA 2JQHA 4ZI2D 5L3GB 2L8KA 2LRKA 4X20E 2K24A 3ESLA 4YLHA 3PUAA 4QH5A 1D0ZA 1B7TA 4DV7T 4JUYA 1IBMT 2MTQA 2GK9A 5LHIB 3ZMZB 4OYJA 2Q9QD 2CHOA 3RHWA 3FXDB 2QYWA 3GWHA 3BQLA 3TLVA 4YTPA 3AEEA 3AAEB 2BZBA 2LKHA 4Q25A 3A8YC 5F5WA 5IHYA 1KNPA 3N9NA 3ZLIA 4YSZA 3C50A 4PJMA 2ODVA 4JEUB 1W0BA 4WBNE 4DMWA 4ZS2A 2W67A 1BR4A 2Y8DA 2XAGB 4V1Av 4IE0A 1XZYA 1XNRT 3B13A 4I43B 4TV8E 3Q5XA 4PK5A 4ZS3A 2W62A 3FXEB 3RF1A 3RIUC 3WAJA 4WW0A 2WBLA 3Q2MA 2Z6EA 3L3PA 1V9DA 3ZJ2A 2WAUA 2N9DA 5FYMA 3LSVA 4LFAT 2XY8B 2E9XB 4GOUA 2LE8A 2BG9A 4JI8T 1SA0E 4DO0A 2JQKA 4BJMA 2YU1A 1S35A 4IHJE 3AE3A 2UU9T 5CA0E 2OA5A 2NP9A 3RYFE 1R8IA 4JI1T 4UV8B 1HS7A 3UT5E 3BQIA 2LRLA 1OEDC 1MMDA 5EZYE 5CB4E 4ASKA 1KEYA 3KVBA 4UVAB 3J9X1 3A7MA 3NBXX 2FUPA 2H88A 2QA7A 4KI0F 4PJLA 4B3RT 5HXSA 5C3JA 3ZYMA 3K1SA 5CJ5A 4HFBA 1LVKA 2EHOC 4I4TE 3WI3A 4HFIA 4LFCT 2XHEB 4O4HE 4U33A 1UX5A 4WYVA 3JAEA 5FXWA 5L4HA 2J62A 2VURA 2WWUA 5JQGE 2RPAA 2WZHA 3AXJA 4UV9B 3SOLA 4P0AA 1MMGA 3RKGA 1HNZT 5LMUT 4WBOA 2XAJB 3N5LA 2I6HA 4TV9E 3N2GE 2VKHA 1JNRA 2ZM6T 2JJ9A 2UXBT 5FVLA 2CWOA 1HX8A 3UU6A 4A5XA 4CXXA 4DVDA 4GKKT 3LG7A 5FNVE 5ABFB 3ONJA 5JR9A 3O1IA 4IE7A 2XZEA 4F6RC 4B3ST 4KHPT 1WRDA 1QLBA 2IHR1 5AQHB 5HEGA 2PG8A 1D0XA 3PUVF 5DABA 3ZMVB 4GK5E 4E7SA 3RC8A 3DTOA 4UXNB 5BMVE 2LSGA 4DV1T 3EHZA 4EYUA 4YXDA 3N9OA 1KFYA 4L0RA 3CK6A 3PJAA 3AXJB 5AQPB 4QXCB 2LJLA 3RQWA 5J0ZA 3AE6A 4TN7B 4H9PC 4TX5A 1XDPA 4LF7T 3FZHB 4AXPA 4AQYT 4LF5T 3UUNA 1J5WA 1LRZA 1LVFA 2XQ6A 3DJBA 4ADZA 5FL1A 1XWMA 4DR7T 2W63A 1H7CA 2WDRA 2V6YA 1HNXT 1BR0A 3QC9A 3NRXA 2E9XC 5AQUB 4ZI2C 2ZM8A 3KV6A 4HWDA 4IDOA 3QOFA 4P1NA 2BDEA 4WZXA 2H7VC 4LMKA 4OHFA 3ONLC 1T98A 2Q9QC 1IAPA 3HKDE 1HG5A 4AISA 2C5JA 1WLXA 2HHHT 1CHUA 3H3MA 3ANWA 2JQ9A 3OYXA 1ZEEA 1ZV4X 3QB5K 4TNWA 5AQIB 2V7LA 3RQUA 4DIDB 5JR9B 2M6BA 4HFHA 3AEBA 3KV9A 3Q5DA 3Q9DA 3P4WA 4K0UA 2UXDT 4L9IA 4UR9A 2XQ5A 3EDVA 2V7MA 4LF8T 3JCFA 2BG9E 1G8XA 3CQGB 4GYRA 3AE1A 3UUBA 1OXZA 3RIAA 5HXEA 2RA1A 3F31A 2V7IA 5JDFA 3CX7B 3PJAJ 4DV5T 3AVSA 4A98A 3RH3A 1QSDA 2BVMA 5HXRA 4X1IE 2QGSA 2FJEA 3GN5A 3KDSE 4HWIB 2F4VT 5ADXL 1M62A 2X68A 4BJNA 2W2UA 3ZKRA 2KWHA 4LF9T 2BBHA 1HCIA 2WM9A 2X9WA 1YQ3A 1LKXA 1Z0PA 2DWKA 2WQYA 2X0LB 3AB3B 3P7IA 5AQKB 5HCMA 3R84B 1FJGT 2HH7A 4O2BE 2WS3A 2B1EA 2JMKA 3RC3A 1U4QA 3UU3A 3W15B 4E7ZA 2VQFT 2D9DA 5AQLB 1QUUA 2V5DA 4X1YE 3LBXB 2OLTA 5JVDE 2SPCA 4DV4T 3AA1B 4ANJA 2BS4A 2D2SA 2NTYA 3PU3A 3S4UA 5JRCA 2W66A 2XM2A 5DQVA 4HFCA 2P9BA 2N2NA 3ZSSA 1BR2A 3V5UA 2WU5A 3AE9A 2DLRA 4ILCA 4QX8B 3UFEA 2UXXB 2KNDA 3N9PA 1HG2A 2V5CA 4H9QC 1YD8G 4ZOLE 4EYYR 3FZKB 1N34T 4IL4A 4LF4T 4XBFB 1ZHCA 3CQXC 4HTEA 4ILAA 5ABEA 4ILBA 4CN6A 1KNRA 2JQQA 2YU2A 4PFPA 4HFDA 4CZZB 3PU8A 1L0VA 4IDQA 5LG4A 2KWIB 2MAWA 1WFDA 2CRBA 2ACZA 1XNQT 2AE9A 4EXTA 5HYAA 3AE2A 2I59A 2X9YA 2YOEA 2WP9A 3FZFB 4KHZF 4AQFC 1W0AA 4OYKA 1Y01A 2W61A 3AE7A 4IIJE 3C98B 3VR9A 1XMQT 2CXLA 5ABHA 3C4WA 3LDQB 2CXFA 2RP4A 2XTLA 3GMIA 4FJOA 3RPUA 5JR9C 4AKGA 5AFUL 2KT9A 2VQET 3UQ4A 4JI3T 2QRXA 4DR2T 2IIUA 4YTNA 3VRBA 3FHNA 5H6RB 2WMOA 4CQIA 2JPFA 2LSKA 2BKPA 1J5ET 1MMNA 4A97A 2XAFB 4H63V 3AVRA 2XQ7A 3EI0A 4QHOA 2IW5B 3RLFF 4ISTA 2WU2A 4O4IE 3ZCJA 5J2UE 3NKZA 2FJAA 4HGAA 3P4PA 4YJ3E 4WNKA 3AA7B 3ZN0B 4YT0A 3OPCA 4IDNA 3RYCE 3SWHA 4CXWA 2PBIA 3EDUA 5DQWA 4NPPA 3OKQA 3N9LA 2WDVA 4HWHA 1G73A 1E2AA 3NVOA 4JI5T 4TWFA 2MYSA 2YDSA 2WB5A 5KDMC 3JAFA 1MIWA 3O4XE 3ZEFB 4EGWA 3CX8B 5IWAT 2PFVA 4IT4A 3L8RA 5LGUB 2V7JA 3CIRA 1UURA 2KSRA 2R6GF 3FZLB 4OX9T 1SHZC 2ODUA 5ETWA 3LBXA 3OBVE 3AEAA 5LXTE 4P09A 2CHNA 2ZM0A 1HR0T 2X66A 3I9YA 4YHHT 4EAHA 2BKNA 2VASA 2YDRA 2V26A 1E7PA 1UUSA 1IZNB 2XASB 3MK7C 5FVKA 5AQFB 3KBUA 5LP6E 3VKGA 2BS3A 4DMVA 3RIUA 4U74A 3OVUA 3ONXA 3AA6B 4CN1A 2L3LA 2V1DB 2V8SV 2BG9C 2E5LT 3I0OA 2ACXA 3SFDA 3LFMA 2W0GA 4M1PA 2N1GA 4KUMB 4UF0A 5JDGA 2VK9A 3AAAB 2L9QA 5AQQB 5JH7E 2VB6A 2LM2A 3OYZA 1SE7A 2WY2A 3ETUA 4ILUA 2E9XD 3M65A 3O1JA 2EHOB 4JEHB 4MFRA 1OEDE 1YKHB 2C5KT 2OV9A 5JDQA 2HN2A 3R6NA 1ZP0A 2IMLA 4BAYB 5LJMA 2CMRA 5CGMA 3VKHA 2UUBT 3NZQA 1D1AA 2BKOA 5AQOB 3KV4A 3LK3B 4PAGA 2J4GA 5L3FB 4HWCA 4UVCB 2BBJA 5EK2A 3MA9A 4COFA 2HPJA 3FBZA 5ABFA 5BR8T 3C64A 2XQ8A 2XQAA 3RYIE 2Y6XA 4MHCA 3O9XA 2YINA 3UULA 4G2AA 4NUVA 3PV0F 3EUHA 4TUYE 3ZJ1A 4ERRA 4ZI3C 5LG3A 2M67A 2YKSA 3CMLA 2WWVA 2UUAT 3AAIA 1W09A 3L09A 3L39A 4U31A 4GYSA 2V6XA 5AQJB 3EAMA 4G63A 4ZI7E 4PFOA 2VL0A 2D0TA 2I0MA 2FJBA 3IHRA 1DU2A 1T8BA 3ABVA 5GONE 5LGNB 1YQ4A 1UK5A 3AECA 3H37A 3O1HA 2VWAA 3B5MA 3AE5A 3RRWA 2WCAA 4A56A 4GKJT 5HXHA 1WYCA 3EVYA 4H9OC 3FZMB 4GK0E 4O4LE 3I9WA 2LSJA 3RIFA 5M4YA 4HFVA 3QUJA 3QK6A 4IGUA 3HI2A 3ZCIA 3MJXA 2C5IT 2YDQA 3VHLA 4DV2T 4AIUA 4H9RC 3P4RA 3HKEE 2UUCT 1KF6A 1WR6A 2E8IA 2NR4A 2JIWA 4JI4T 3K8PC 5HEHA 1E1HB 4HKAA 5AQMB 4JI0T 4IL9A 2H3RA 4AKHA 2E9XA 3ANWB 3QB5A 1MNDA 2VKOA 1EZ3A 1N36T 4U7YA 4BA9A 2ES0A 4O4JE 3N2OA 1MMAA 1OEDB 2CM0A 2DNXA 2NW9A 2NW7A 4HE8A 5L4EA 4JBWF 1WYBA 3AEFA 2XAHB 5AQNB 2XSBA 5AQVB 2B76A 3VR8A 1FIOA 3X1DA 4AI6A 4LMLA 3TLTA 2V7KA 3AEDA 4PJNA 4X65T 2CA5A 4DBQA 4U72A 4NXNT 4TZ4C 3D0TA 1FEWA 3AE4A 5L3EB 5FY1A 2DWGA 3HA4A 2XJ7A 5LCYA 3I0QA 3LJCA 3N9MA 3UFGA 4KP3C 2X67A 5EK4A 4K0KT 4B3TT 3BK9A 3RGLA 2K48A 3HKCE 3RI5A 5JDHA 5LMNT 4QX7B 4YJ2E 1UGOA 3MKDA 4EOZB 2C0SA 1NEKA 3BQKA 2PTFA 4QKNA 5LOVE 5C2TA 4CI2B 4HEAA 3G06A 3SFEA 2CLYC 2NTXA 1CUNA 2MPKA 3PE0A 4O8SA 4U3CA 5FY7A 3SRZA 5JTGA 3TLUA 2WDQA 2VVSA 3UQ7A 2XQ4A 1X79A 2IC9A 2MOZA 1D1CA 2UXCT 3SS1A 1HNWT 4JLEA 4EEDA 3UU8A 2XQYA 3T1YT 2LSIA 4UELA 2KZ7B 3KBTA 3VU7H 3E22E 5CA1E 3MXZA 2IDOB 2CEAA 5JDNA 3AA0B 3RX6A 4YFSA 5J1GA 3ZT6A 1FMWA 3P8CD 4MBQA 3JADA 5F8PA 4XAXB 5C8YE 3PUGA 3CPZA 2DCFA 1KNZA 1HF8A 2WSSV 3PUSA 3RYHE 4X66T 5LA6E 4Z90A 2NW8A 3V5SA 4H9NC 5AQRB 4X62T 4H9SE 1MNEA 3ZT7A 2G0UA 4YSXA 1D0YA 2D0UA 3KFWX 5JREA 3CX6B 3PUXF 4AQGA 5KX5E 1N32T 1OEDA 2KXPB 1IJ6A 4ISSA 5HAXA 3T1HT 1IBLT 4H63H 4X5TA 3ZT5A 2IAKA 5L47A 4DUYT 5IUXA 3GA8A 2X0HA 5JDLA 2CWYA 4KBMB 5HCJA 2VVNA 1Z8UA 4J2CA 4UIGA 5J2TE 1J1JA 1FMVA 2EHOA 3PUQA 3UUMA 2K9AA 4NXMT 4QH4A 1Y64B 1MIVA 3AE8A 1XDOA 4AKLA 4IDZA 4DR4T 1VRBA 1YKEB 1T7SA 2XQ9A 1VOMA 5HEUA 3U3IA 4AKRB 2HN1A 4UEMA 2EHOD 4EEBA 3ETVA 1ZKEA 5FMNA 3JC6D 4OK0A 4DBRA 3LK2B 1IBKT 2MBGA 4MLKA 1GQEA 3UU5A 4AKIA 1UX4A 4EIWA 2LHRA 1MIYA 1T72A 2E5VA 2CCQA 4PJJA 2M6IA 3J7Yq 3N2KE 1NENA 1IJ5A 2KLQA 2IC6A 2X9HA 3HR0A 4LF6T 4HFEA 1JNZA 4NUUA 4KMCA 2BS2A 2FJDA 2W4XA 3NZPA 5ABGA 4CN4A 4ZI3D 3UTKA 2FBWA 3E08A 3IEEA 4KX6A 4PW8A 4Z8XA 2YK0A 2WZIA 1I6ZA 4U2ZA 2ZMAA 3GN5B 3MACA 1HX1B 2WMNA 5E0OA 3Q5EA 4U2YA 4P0BA 5HEOA 3KV5A 2QVAA 4XZCA 4DR5T 4GIWA 1O3XA 4NIQA 4QXHB 3ZMTB 4EZHA 2LHNA 2LM9A 4EB6E 5CFBA 4DV3T 3IA3A 3PUYF 3PURA 4B6XA 1N33T 1XMOT 3JC6C 4IE6A 1YXRA 3UU4A 5LGTB 3TLWA 3OTOT 4JYAT 5L2LA 3PUWF 3TLSA 1U5PA 2VL8A 4F8HA 2K3WA 2DI4A 2BG9B 2D5UA 5LBMA 4TWHA 5FXVA 3HL6A 4YSYA 3P4SA 4ZEYA 4DUZT 3FBLA 3PDYA 3CQCB 2A72A 3CVRA 4IE4A 2A2FX 2YN6A 2CLYB 4TWDA 3ZC0A 2Q9QA 4ZHQE 4L5GA 3ZSTA 1W9RA 2VKJA 3I1AA 3TKLB 3U78A 3FB2A 4O2AE 5KXJA 2H89A 5LJNA 3KINB 2CBIA 4U7IA 3ZYKA 3UUXB 2XQ3A 2A9UA 3C4ZA 3ZMUB 1WR0A 3F57A 3LK42 5L3BB 2A3DA 1SUMB 2ZLYA 3PUZF 2LT3A 4IE5A 3QNUA 4JI6T 3NRYA 2JRKA 4TNVA 2BVLA 5HXCA 2XSAA 5F3JA 1D1BA 2H7OA 2UXNB 4DV0T 5L3DB 2IUBA 4JV5T 5FL0A 5AQTB 4YTMA 4YY3T 4CI3B 3ZYLA 3CWZB 1VCTA 3OJAA 2XPKA 3A5XA 5LYJE 2YEVC 5DJQC 2XAQB 1ZOYA 2J47A 3MZKB 4HN9A 3WAKA 3E0ZA 5LHGB 3Q5WA 5HWYA 1KK7A 5LNKA 3B57A 3ZMSB 2J1DG 3DP7A 4QWNB 5HWXA 4ZXLA 2LLYA 2V6YB 2DL1A 2LOSA 3AEGA 4X1KE 5AQGB 4C91A 5LHHB 3VRAA 2E2AA 2LSYA 3C51A 2X9XA 3C4XA 4QH1A 5FP3A 2AXDS 2LOPA 4IDPA 3IBPA 1YW0A 3CKDA 4UVBB 3N9QA 4PK6A 4B3MT 3ZC1A 1OWAA 5KMGP 1WCRA 3K3QC 4DNDA 5HEJA 2KINB 3ZPOA 1HTJF 4X64T 2W00A 4PNIA 4UF0B 2NWBA 4MALA 4OFZA 3HKBE 4CI1B 3T8OA 3P4QA 2CPTA 5JDMA 2VKDA 2LKGA 3K3OA 4QXBB 5AQSB 4HWFA 4I55E 4EV6A 3RKOA 1UCUA 4N78D 4ZZBA 5TAOA 5FXXA 3P50A 4I50E 2Q9QB 4JI2T 1NWMX 4AQFA 1AJ3A 2HPLA 2Y48B 3KVAA 2PJQA 4YHJA 4EZ4A 4JI7T 5FXZA 5JRCB 1US7B 4DR3T 3H3AA 5LBQB 4LMJA 4I0UA 4ZZCA 5A1LA 1HFAA 3F2EA 2CE7A 2KMFA
chains in the Genus database with same CATH topology
2CXDA 4PK4A 2NOXA 5L3CB 2LEHA 2JMHA 3PTRB 4C90A 5IYZE 3RRCA 3ZN1B 5FY0A 4CXYA 2XUEA 2X51A 3IF8B 2K5BB 5EK3A 1BR1A 1S94A 1NAFA 3K3NA 3ZC1A 5JRCB 5H6QB 4FI5A 2ZM2A 2DHRA 4ZI2D 5L3GB 2L8KA 4X20E 4YLHA 2K24A 3ESLA 3PUAA 1D0ZA 1B7TA 4JUYA 2MTQA 2GK9A 5LHIB 3ZMZB 4OYJA 2Q9QD 3FXDB 3GWHA 3BQLA 3AAEB 2BZBA 3ZLIA 5IHYA 3N9NA 3C50A 4PJMA 2ODVA 4JEUB 4WBNE 4DMWA 4ZS2A 2Y8DA 1BR4A 4V1Av 2XAGB 4IE0A 3B13A 4I43B 4TV8E 3Q5XA 4PK5A 4ZS3A 2W62A 3FXEB 3WAJA 4WW0A 2WBLA 3Q2MA 2Z6EA 3L3PA 1V9DA 3ZJ2A 2WAUA 2N9DA 5FYMA 2E9XB 4GOUA 2LE8A 1SA0E 4DO0A 4BJMA 2YU1A 1S35A 4IHJE 5CA0E 2OA5A 2NP9A 3RYFE 4UV8B 1HS7A 3UT5E 3BQIA 5EZYE 4ASKA 1MMDA 5CB4E 3KVBA 4UVAB 3J9X1 3NBXX 2QA7A 4PJLA 5HXSA 3ZYMA 1LVKA 2EHOC 4I4TE 3WI3A 2XHEB 4O4HE 1UX5A 5FXWA 2WWUA 5JQGE 3SOLA 4UV9B 4P0AA 1MMGA 4WBOA 2XAJB 3N5LA 4TV9E 3N2GE 2VKHA 2JJ9A 4DVDA 2CWOA 1HX8A 4CXXA 3LG7A 5FNVE 5JR9A 3O1IA 4IE7A 4F6RC 1WRDA 2PG8A 1D0XA 5DABA 3ZMVB 4GK5E 4E7SA 3RC8A 3DTOA 4UXNB 5BMVE 2LSGA 4EYUA 3N9OA 4L0RA 4QXCB 2LJLA 4TN7B 4H9PC 4TX5A 4AXPA 3UUNA 1LRZA 1LVFA 3DJBA 4ADZA 2W63A 1H7CA 1BR0A 3QC9A 3NRXA 2E9XC 4ZI2C 2ZM8A 3KV6A 2BDEA 2H7VC 4OHFA 1T98A 2Q9QC 1IAPA 3HKDE 1HG5A 2C5JA 1WLXA 3ANWA 3OYXA 5JR9B 1ZEEA 1ZV4X 2V7LA 3KV9A 3Q9DA 4K0UA 4L9IA 3EDVA 2V7MA 1G8XA 3CQGB 4GYRA 5HXEA 1OXZA 2RA1A 3F31A 2V7IA 5JDFA 3CX7B 3AVSA 3RH3A 1QSDA 2BVMA 5HXRA 4X1IE 2QGSA 3GN5A 3KDSE 5ADXL 2X68A 4BJNA 2KWHA 2X9WA 1HCIA 2WM9A 3AB3B 1LKXA 1Z0PA 2DWKA 2X0LB 3R84B 3P7IA 2HH7A 4O2BE 2B1EA 2JMKA 3RC3A 1U4QA 3W15B 4E7ZA 1QUUA 4X1YE 3LBXB 5JVDE 2SPCA 3AA1B 4ANJA 2D2SA 2NTYA 3PU3A 3S4UA 5JRCA 5DQVA 2P9BA 2N2NA 1BR2A 3V5UA 2DLRA 4QX8B 3UFEA 2UXXB 2KNDA 3N9PA 1HG2A 4H9QC 4ZOLE 1YD8G 4EYYR 4XBFB 1ZHCA 3CQXC 4HTEA 2JQQA 2YU2A 4PFPA 4CZZB 3PU8A 5LG4A 2KWIB 4EXTA 5HYAA 2I59A 2X9YA 4AQFC 4OYKA 2W61A 4IIJE 3C98B 2CXLA 3C4WA 2CXFA 2RP4A 2XTLA 3GMIA 4FJOA 3RPUA 5JR9C 4AKGA 5AFUL 2KT9A 3FHNA 5H6RB 2WMOA 4CQIA 2JPFA 2LSKA 1MMNA 2XAFB 4H63V 3AVRA 4QHOA 2IW5B 4ISTA 4O4IE 3ZCJA 5J2UE 4HGAA 4YJ3E 4WNKA 3AA7B 3ZN0B 3RYCE 4CXWA 3SWHA 2PBIA 3EDUA 5DQWA 3OKQA 3N9LA 1G73A 2MYSA 5KDMC 3O4XE 1MIWA 3ZEFB 3CX8B 2PFVA 5LGUB 2V7JA 1SHZC 2ODUA 5ETWA 3LBXA 3OBVE 5LXTE 4P09A 2ZM0A 2X66A 3I9YA 4EAHA 2VASA 2V26A 1IZNB 2XASB 3MK7C 5LP6E 3KBUA 3VKGA 4DMVA 4U74A 3ONXA 3AA6B 2L3LA 2V1DB 3I0OA 2ACXA 3LFMA 2W0GA 4M1PA 2N1GA 4KUMB 4UF0A 5JDGA 2VK9A 3AAAB 2L9QA 5JH7E 2VB6A 3OYZA 3ETUA 4ILUA 2E9XD 3M65A 3O1JA 2EHOB 4JEHB 4MFRA 2C5KT 1YKHB 5JDQA 3R6NA 4BAYB 5LJMA 2CMRA 3VKHA 3NZQA 1D1AA 3KV4A 3LK3B 4PAGA 5L3FB 4UVCB 5EK2A 3MA9A 2HPJA 3FBZA 3C64A 3RYIE 2Y6XA 4MHCA 3O9XA 2YINA 3UULA 4G2AA 4NUVA 4TUYE 3EUHA 3ZJ1A 4ERRA 4ZI3C 2M67A 3CMLA 3AAIA 3L09A 4GYSA 4G63A 4ZI7E 4PFOA 2D0TA 3IHRA 5GONE 5LGNB 3H37A 3O1HA 2VWAA 3RRWA 4A56A 5HXHA 1WYCA 3EVYA 4H9OC 4GK0E 4O4LE 3I9WA 2LSJA 5M4YA 4HFVA 3QUJA 3QK6A 4IGUA 3HI2A 3ZCIA 3MJXA 2C5IT 3VHLA 4H9RC 3HKEE 1WR6A 2E8IA 3K8PC 1E1HB 4HKAA 2H3RA 4AKHA 2E9XA 3ANWB 1MNDA 2VKOA 1EZ3A 4BA9A 2ES0A 4O4JE 3N2OA 1MMAA 2CM0A 2DNXA 2NW9A 2NW7A 4HE8A 1WYBA 2XAHB 1FIOA 4AI6A 2V7KA 4PJNA 2CA5A 4DBQA 4U72A 4TZ4C 3D0TA 1FEWA 5L3EB 5FY1A 2DWGA 3HA4A 5LCYA 3I0QA 3LJCA 3N9MA 4KP3C 2X67A 5EK4A 3BK9A 2K48A 3HKCE 5JDHA 4QX7B 4YJ2E 3MKDA 4EOZB 2C0SA 4QKNA 3BQKA 5LOVE 4CI2B 4HEAA 2CLYC 2NTXA 1CUNA 3PE0A 4O8SA 5FY7A 3SRZA 1X79A 2IC9A 2MOZA 1D1CA 3SS1A 4JLEA 2XQYA 2LSIA 4UELA 2KZ7B 3KBTA 3VU7H 3E22E 5CA1E 3MXZA 2CEAA 5JDNA 3AA0B 3RX6A 4YFSA 5J1GA 1FMWA 3P8CD 4MBQA 5C8YE 5F8PA 4XAXB 3PUGA 3CPZA 2DCFA 1KNZA 1HF8A 2WSSV 3PUSA 3RYHE 5LA6E 2NW8A 3V5SA 4H9NC 4H9SE 1MNEA 5JREA 2G0UA 1D0YA 2D0UA 3KFWX 3CX6B 4AQGA 5KX5E 2KXPB 1IJ6A 4ISSA 5HAXA 4H63H 2IAKA 3GA8A 5JDLA 2CWYA 4KBMB 4J2CA 4UIGA 5J2TE 2EHOA 1FMVA 3PUQA 3UUMA 2K9AA 1Y64B 1MIVA 4AKLA 4IDZA 1VRBA 1YKEB 3U3IA 4AKRB 1VOMA 4UEMA 2EHOD 3ETVA 1ZKEA 5FMNA 3JC6D 4OK0A 4DBRA 3LK2B 2MBGA 4MLKA 4AKIA 1UX4A 4EIWA 2LHRA 1MIYA 2CCQA 4PJJA 3J7Yq 3N2KE 1IJ5A 2KLQA 2IC6A 2X9HA 3HR0A 4NUUA 4KMCA 3NZPA 4ZI3D 3UTKA 3E08A 3IEEA 4PW8A 4Z8XA 2YK0A 5E0OA 2ZMAA 3GN5B 3MACA 2WMNA 4P0BA 3KV5A 4XZCA 4GIWA 1O3XA 4QXHB 3ZMTB 4EZHA 2LHNA 2LM9A 4EB6E 4B6XA 3PURA 3JC6C 4IE6A 5LGTB 5L2LA 1U5PA 2VL8A 2DI4A 2D5UA 5LBMA 5FXVA 3HL6A 3FBLA 3PDYA 3CQCB 2A72A 3CVRA 4IE4A 2A2FX 3ZC0A 2CLYB 2Q9QA 4ZHQE 4L5GA 2VKJA 3I1AA 3TKLB 3U78A 3FB2A 4O2AE 5LJNA 3KINB 3ZYKA 3UUXB 3ZMUB 3C4ZA 3F57A 3LK42 5L3BB 2A3DA 2ZLYA 2LT3A 4IE5A 3NRYA 2JRKA 2BVLA 5HXCA 5F3JA 1D1BA 2H7OA 2UXNB 5L3DB 4CI3B 3ZYLA 3CWZB 3OJAA 3A5XA 5LYJE 2YEVC 5DJQC 2XAQB 3MZKB 4HN9A 3WAKA 3E0ZA 5LHGB 3Q5WA 5HWYA 1KK7A 5LNKA 3B57A 3ZMSB 2J1DG 3DP7A 4QWNB 5HWXA 5LHHB 4C91A 2LOSA 4X1KE 5FP3A 2LSYA 3C51A 2X9XA 3C4XA 2LOPA 3IBPA 1YW0A 3CKDA 4UVBB 3N9QA 4PK6A 1OWAA 5KMGP 3K3QC 4DNDA 2KINB 3ZPOA 1HTJF 2W00A 4PNIA 4UF0B 2NWBA 4MALA 4OFZA 3HKBE 4CI1B 3T8OA 5JDMA 2VKDA 3K3OA 4QXBB 4I55E 3RKOA 1UCUA 4N78D 5TAOA 5FXXA 4I50E 2Q9QB 4AQFA 1NWMX 1AJ3A 2HPLA 2Y48B 3KVAA 2PJQA 4YHJA 4EZ4A 5FXZA 1US7B 3H3AA 5LBQB 5A1LA 1HFAA 3F2EA 2CE7A 2KMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ODV A;  3UUM A;  3EDV A;  1OWA A;  3F31 A;  3UUN A;  1U5P A;  3UUL A;  1S35 A;  1HCI A;  3PE0 A;  1CUN A;  1AJ3 A;  1U4Q A;  1WLX A;  2ODU A;  1QUU A;  3FB2 A;  3LBX A;  3LBX B;  2SPC A; 
#chains in the Genus database with same CATH topology
 4LFB T;  2CXD A;  4Z91 A;  4DV6 T;  4PK4 A;  2NOX A;  5L3C B;  2LEH A;  2JMH A;  3PTR B;  4C90 A;  3NWI A;  1X9B A;  5IYZ E;  4DR1 T;  3RRC A;  2X0Y A;  3ZN1 B;  5FY0 A;  4CXY A;  2XUE A;  3M3Z B;  5LB7 B;  2X51 A;  3IF8 B;  2XM1 A;  1I94 T;  2K5B B;  3EAB A;  1BR1 A;  1S94 A;  1M7K A;  1NAF A;  1VCS A;  3K3N A;  4IRE A;  5EK3 A;  5FKY A;  4FI5 A;  2ZM2 A;  5H6Q B;  4DR6 T;  2CBJ A;  2DHR A;  2JQH A;  4ZI2 D;  5L3G B;  2L8K A;  2LRK A;  4X20 E;  2K24 A;  3ESL A;  4YLH A;  3PUA A;  4QH5 A;  1D0Z A;  1B7T A;  4DV7 T;  4JUY A;  1IBM T;  2MTQ A;  2GK9 A;  5LHI B;  3ZMZ B;  4OYJ A;  2Q9Q D;  2CHO A;  3RHW A;  3FXD B;  2QYW A;  3GWH A;  3BQL A;  3TLV A;  4YTP A;  3AEE A;  3AAE B;  2BZB A;  2LKH A;  4Q25 A;  3A8Y C;  5F5W A;  5IHY A;  1KNP A;  3N9N A;  3ZLI A;  4YSZ A;  3C50 A;  4PJM A;  2ODV A;  4JEU B;  1W0B A;  4WBN E;  4DMW A;  4ZS2 A;  2W67 A;  1BR4 A;  2Y8D A;  2XAG B;  4V1A v;  4IE0 A;  1XZY A;  1XNR T;  3B13 A;  4I43 B;  4TV8 E;  3Q5X A;  4PK5 A;  4ZS3 A;  2W62 A;  3FXE B;  3RF1 A;  3RIU C;  3WAJ A;  4WW0 A;  2WBL A;  3Q2M A;  2Z6E A;  3L3P A;  1V9D A;  3ZJ2 A;  2WAU A;  2N9D A;  5FYM A;  3LSV A;  4LFA T;  2XY8 B;  2E9X B;  4GOU A;  2LE8 A;  2BG9 A;  4JI8 T;  1SA0 E;  4DO0 A;  2JQK A;  4BJM A;  2YU1 A;  1S35 A;  4IHJ E;  3AE3 A;  2UU9 T;  5CA0 E;  2OA5 A;  2NP9 A;  3RYF E;  1R8I A;  4JI1 T;  4UV8 B;  1HS7 A;  3UT5 E;  3BQI A;  2LRL A;  1OED C;  1MMD A;  5EZY E;  5CB4 E;  4ASK A;  1KEY A;  3KVB A;  4UVA B;  3J9X 1;  3A7M A;  3NBX X;  2FUP A;  2H88 A;  2QA7 A;  4KI0 F;  4PJL A;  4B3R T;  5HXS A;  5C3J A;  3ZYM A;  3K1S A;  5CJ5 A;  4HFB A;  1LVK A;  2EHO C;  4I4T E;  3WI3 A;  4HFI A;  4LFC T;  2XHE B;  4O4H E;  4U33 A;  1UX5 A;  4WYV A;  3JAE A;  5FXW A;  5L4H A;  2J62 A;  2VUR A;  2WWU A;  5JQG E;  2RPA A;  2WZH A;  3AXJ A;  4UV9 B;  3SOL A;  4P0A A;  1MMG A;  3RKG A;  1HNZ T;  5LMU T;  4WBO A;  2XAJ B;  3N5L A;  2I6H A;  4TV9 E;  3N2G E;  2VKH A;  1JNR A;  2ZM6 T;  2JJ9 A;  2UXB T;  5FVL A;  2CWO A;  1HX8 A;  3UU6 A;  4A5X A;  4CXX A;  4DVD A;  4GKK T;  3LG7 A;  5FNV E;  5ABF B;  3ONJ A;  5JR9 A;  3O1I A;  4IE7 A;  2XZE A;  4F6R C;  4B3S T;  4KHP T;  1WRD A;  1QLB A;  2IHR 1;  5AQH B;  5HEG A;  2PG8 A;  1D0X A;  3PUV F;  5DAB A;  3ZMV B;  4GK5 E;  4E7S A;  3RC8 A;  3DTO A;  4UXN B;  5BMV E;  2LSG A;  4DV1 T;  3EHZ A;  4EYU A;  4YXD A;  3N9O A;  1KFY A;  4L0R A;  3CK6 A;  3PJA A;  3AXJ B;  5AQP B;  4QXC B;  2LJL A;  3RQW A;  5J0Z A;  3AE6 A;  4TN7 B;  4H9P C;  4TX5 A;  1XDP A;  4LF7 T;  3FZH B;  4AXP A;  4AQY T;  4LF5 T;  3UUN A;  1J5W A;  1LRZ A;  1LVF A;  2XQ6 A;  3DJB A;  4ADZ A;  5FL1 A;  1XWM A;  4DR7 T;  2W63 A;  1H7C A;  2WDR A;  2V6Y A;  1HNX T;  1BR0 A;  3QC9 A;  3NRX A;  2E9X C;  5AQU B;  4ZI2 C;  2ZM8 A;  3KV6 A;  4HWD A;  4IDO A;  3QOF A;  4P1N A;  2BDE A;  4WZX A;  2H7V C;  4LMK A;  4OHF A;  3ONL C;  1T98 A;  2Q9Q C;  1IAP A;  3HKD E;  1HG5 A;  4AIS A;  2C5J A;  1WLX A;  2HHH T;  1CHU A;  3H3M A;  3ANW A;  2JQ9 A;  3OYX A;  1ZEE A;  1ZV4 X;  3QB5 K;  4TNW A;  5AQI B;  2V7L A;  3RQU A;  4DID B;  5JR9 B;  2M6B A;  4HFH A;  3AEB A;  3KV9 A;  3Q5D A;  3Q9D A;  3P4W A;  4K0U A;  2UXD T;  4L9I A;  4UR9 A;  2XQ5 A;  3EDV A;  2V7M A;  4LF8 T;  3JCF A;  2BG9 E;  1G8X A;  3CQG B;  4GYR A;  3AE1 A;  3UUB A;  1OXZ A;  3RIA A;  5HXE A;  2RA1 A;  3F31 A;  2V7I A;  5JDF A;  3CX7 B;  3PJA J;  4DV5 T;  3AVS A;  4A98 A;  3RH3 A;  1QSD A;  2BVM A;  5HXR A;  4X1I E;  2QGS A;  2FJE A;  3GN5 A;  3KDS E;  4HWI B;  2F4V T;  5ADX L;  1M62 A;  2X68 A;  4BJN A;  2W2U A;  3ZKR A;  2KWH A;  4LF9 T;  2BBH A;  1HCI A;  2WM9 A;  2X9W A;  1YQ3 A;  1LKX A;  1Z0P A;  2DWK A;  2WQY A;  2X0L B;  3AB3 B;  3P7I A;  5AQK B;  5HCM A;  3R84 B;  1FJG T;  2HH7 A;  4O2B E;  2WS3 A;  2B1E A;  2JMK A;  3RC3 A;  1U4Q A;  3UU3 A;  3W15 B;  4E7Z A;  2VQF T;  2D9D A;  5AQL B;  1QUU A;  2V5D A;  4X1Y E;  3LBX B;  2OLT A;  5JVD E;  2SPC A;  4DV4 T;  3AA1 B;  4ANJ A;  2BS4 A;  2D2S A;  2NTY A;  3PU3 A;  3S4U A;  5JRC A;  2W66 A;  2XM2 A;  5DQV A;  4HFC A;  2P9B A;  2N2N A;  3ZSS A;  1BR2 A;  3V5U A;  2WU5 A;  3AE9 A;  2DLR A;  4ILC A;  4QX8 B;  3UFE A;  2UXX B;  2KND A;  3N9P A;  1HG2 A;  2V5C A;  4H9Q C;  1YD8 G;  4ZOL E;  4EYY R;  3FZK B;  1N34 T;  4IL4 A;  4LF4 T;  4XBF B;  1ZHC A;  3CQX C;  4HTE A;  4ILA A;  5ABE A;  4ILB A;  4CN6 A;  1KNR A;  2JQQ A;  2YU2 A;  4PFP A;  4HFD A;  4CZZ B;  3PU8 A;  1L0V A;  4IDQ A;  5LG4 A;  2KWI B;  2MAW A;  1WFD A;  2CRB A;  2ACZ A;  1XNQ T;  2AE9 A;  4EXT A;  5HYA A;  3AE2 A;  2I59 A;  2X9Y A;  2YOE A;  2WP9 A;  3FZF B;  4KHZ F;  4AQF C;  1W0A A;  4OYK A;  1Y01 A;  2W61 A;  3AE7 A;  4IIJ E;  3C98 B;  3VR9 A;  1XMQ T;  2CXL A;  5ABH A;  3C4W A;  3LDQ B;  2CXF A;  2RP4 A;  2XTL A;  3GMI A;  4FJO A;  3RPU A;  5JR9 C;  4AKG A;  5AFU L;  2KT9 A;  2VQE T;  3UQ4 A;  4JI3 T;  2QRX A;  4DR2 T;  2IIU A;  4YTN A;  3VRB A;  3FHN A;  5H6R B;  2WMO A;  4CQI A;  2JPF A;  2LSK A;  2BKP A;  1J5E T;  1MMN A;  4A97 A;  2XAF B;  4H63 V;  3AVR A;  2XQ7 A;  3EI0 A;  4QHO A;  2IW5 B;  3RLF F;  4IST A;  2WU2 A;  4O4I E;  3ZCJ A;  5J2U E;  3NKZ A;  2FJA A;  4HGA A;  3P4P A;  4YJ3 E;  4WNK A;  3AA7 B;  3ZN0 B;  4YT0 A;  3OPC A;  4IDN A;  3RYC E;  3SWH A;  4CXW A;  2PBI A;  3EDU A;  5DQW A;  4NPP A;  3OKQ A;  3N9L A;  2WDV A;  4HWH A;  1G73 A;  1E2A A;  3NVO A;  4JI5 T;  4TWF A;  2MYS A;  2YDS A;  2WB5 A;  5KDM C;  3JAF A;  1MIW A;  3O4X E;  3ZEF B;  4EGW A;  3CX8 B;  5IWA T;  2PFV A;  4IT4 A;  3L8R A;  5LGU B;  2V7J A;  3CIR A;  1UUR A;  2KSR A;  2R6G F;  3FZL B;  4OX9 T;  1SHZ C;  2ODU A;  5ETW A;  3LBX A;  3OBV E;  3AEA A;  5LXT E;  4P09 A;  2CHN A;  2ZM0 A;  1HR0 T;  2X66 A;  3I9Y A;  4YHH T;  4EAH A;  2BKN A;  2VAS A;  2YDR A;  2V26 A;  1E7P A;  1UUS A;  1IZN B;  2XAS B;  3MK7 C;  5FVK A;  5AQF B;  3KBU A;  5LP6 E;  3VKG A;  2BS3 A;  4DMV A;  3RIU A;  4U74 A;  3OVU A;  3ONX A;  3AA6 B;  4CN1 A;  2L3L A;  2V1D B;  2V8S V;  2BG9 C;  2E5L T;  3I0O A;  2ACX A;  3SFD A;  3LFM A;  2W0G A;  4M1P A;  2N1G A;  4KUM B;  4UF0 A;  5JDG A;  2VK9 A;  3AAA B;  2L9Q A;  5AQQ B;  5JH7 E;  2VB6 A;  2LM2 A;  3OYZ A;  1SE7 A;  2WY2 A;  3ETU A;  4ILU A;  2E9X D;  3M65 A;  3O1J A;  2EHO B;  4JEH B;  4MFR A;  1OED E;  1YKH B;  2C5K T;  2OV9 A;  5JDQ A;  2HN2 A;  3R6N A;  1ZP0 A;  2IML A;  4BAY B;  5LJM A;  2CMR A;  5CGM A;  3VKH A;  2UUB T;  3NZQ A;  1D1A A;  2BKO A;  5AQO B;  3KV4 A;  3LK3 B;  4PAG A;  2J4G A;  5L3F B;  4HWC A;  4UVC B;  2BBJ A;  5EK2 A;  3MA9 A;  4COF A;  2HPJ A;  3FBZ A;  5ABF A;  5BR8 T;  3C64 A;  2XQ8 A;  2XQA A;  3RYI E;  2Y6X A;  4MHC A;  3O9X A;  2YIN A;  3UUL A;  4G2A A;  4NUV A;  3PV0 F;  3EUH A;  4TUY E;  3ZJ1 A;  4ERR A;  4ZI3 C;  5LG3 A;  2M67 A;  2YKS A;  3CML A;  2WWV A;  2UUA T;  3AAI A;  1W09 A;  3L09 A;  3L39 A;  4U31 A;  4GYS A;  2V6X A;  5AQJ B;  3EAM A;  4G63 A;  4ZI7 E;  4PFO A;  2VL0 A;  2D0T A;  2I0M A;  2FJB A;  3IHR A;  1DU2 A;  1T8B A;  3ABV A;  5GON E;  5LGN B;  1YQ4 A;  1UK5 A;  3AEC A;  3H37 A;  3O1H A;  2VWA A;  3B5M A;  3AE5 A;  3RRW A;  2WCA A;  4A56 A;  4GKJ T;  5HXH A;  1WYC A;  3EVY A;  4H9O C;  3FZM B;  4GK0 E;  4O4L E;  3I9W A;  2LSJ A;  3RIF A;  5M4Y A;  4HFV A;  3QUJ A;  3QK6 A;  4IGU A;  3HI2 A;  3ZCI A;  3MJX A;  2C5I T;  2YDQ A;  3VHL A;  4DV2 T;  4AIU A;  4H9R C;  3P4R A;  3HKE E;  2UUC T;  1KF6 A;  1WR6 A;  2E8I A;  2NR4 A;  2JIW A;  4JI4 T;  3K8P C;  5HEH A;  1E1H B;  4HKA A;  5AQM B;  4JI0 T;  4IL9 A;  2H3R A;  4AKH A;  2E9X A;  3ANW B;  3QB5 A;  1MND A;  2VKO A;  1EZ3 A;  1N36 T;  4U7Y A;  4BA9 A;  2ES0 A;  4O4J E;  3N2O A;  1MMA A;  1OED B;  2CM0 A;  2DNX A;  2NW9 A;  2NW7 A;  4HE8 A;  5L4E A;  4JBW F;  1WYB A;  3AEF A;  2XAH B;  5AQN B;  2XSB A;  5AQV B;  2B76 A;  3VR8 A;  1FIO A;  3X1D A;  4AI6 A;  4LML A;  3TLT A;  2V7K A;  3AED A;  4PJN A;  4X65 T;  2CA5 A;  4DBQ A;  4U72 A;  4NXN T;  4TZ4 C;  3D0T A;  1FEW A;  3AE4 A;  5L3E B;  5FY1 A;  2DWG A;  3HA4 A;  2XJ7 A;  5LCY A;  3I0Q A;  3LJC A;  3N9M A;  3UFG A;  4KP3 C;  2X67 A;  5EK4 A;  4K0K T;  4B3T T;  3BK9 A;  3RGL A;  2K48 A;  3HKC E;  3RI5 A;  5JDH A;  5LMN T;  4QX7 B;  4YJ2 E;  1UGO A;  3MKD A;  4EOZ B;  2C0S A;  1NEK A;  3BQK A;  2PTF A;  4QKN A;  5LOV E;  5C2T A;  4CI2 B;  4HEA A;  3G06 A;  3SFE A;  2CLY C;  2NTX A;  1CUN A;  2MPK A;  3PE0 A;  4O8S A;  4U3C A;  5FY7 A;  3SRZ A;  5JTG A;  3TLU A;  2WDQ A;  2VVS A;  3UQ7 A;  2XQ4 A;  1X79 A;  2IC9 A;  2MOZ A;  1D1C A;  2UXC T;  3SS1 A;  1HNW T;  4JLE A;  4EED A;  3UU8 A;  2XQY A;  3T1Y T;  2LSI A;  4UEL A;  2KZ7 B;  3KBT A;  3VU7 H;  3E22 E;  5CA1 E;  3MXZ A;  2IDO B;  2CEA A;  5JDN A;  3AA0 B;  3RX6 A;  4YFS A;  5J1G A;  3ZT6 A;  1FMW A;  3P8C D;  4MBQ A;  3JAD A;  5F8P A;  4XAX B;  5C8Y E;  3PUG A;  3CPZ A;  2DCF A;  1KNZ A;  1HF8 A;  2WSS V;  3PUS A;  3RYH E;  4X66 T;  5LA6 E;  4Z90 A;  2NW8 A;  3V5S A;  4H9N C;  5AQR B;  4X62 T;  4H9S E;  1MNE A;  3ZT7 A;  2G0U A;  4YSX A;  1D0Y A;  2D0U A;  3KFW X;  5JRE A;  3CX6 B;  3PUX F;  4AQG A;  5KX5 E;  1N32 T;  1OED A;  2KXP B;  1IJ6 A;  4ISS A;  5HAX A;  3T1H T;  1IBL T;  4H63 H;  4X5T A;  3ZT5 A;  2IAK A;  5L47 A;  4DUY T;  5IUX A;  3GA8 A;  2X0H A;  5JDL A;  2CWY A;  4KBM B;  5HCJ A;  2VVN A;  1Z8U A;  4J2C A;  4UIG A;  5J2T E;  1J1J A;  1FMV A;  2EHO A;  3PUQ A;  3UUM A;  2K9A A;  4NXM T;  4QH4 A;  1Y64 B;  1MIV A;  3AE8 A;  1XDO A;  4AKL A;  4IDZ A;  4DR4 T;  1VRB A;  1YKE B;  1T7S A;  2XQ9 A;  1VOM A;  5HEU A;  3U3I A;  4AKR B;  2HN1 A;  4UEM A;  2EHO D;  4EEB A;  3ETV A;  1ZKE A;  5FMN A;  3JC6 D;  4OK0 A;  4DBR A;  3LK2 B;  1IBK T;  2MBG A;  4MLK A;  1GQE A;  3UU5 A;  4AKI A;  1UX4 A;  4EIW A;  2LHR A;  1MIY A;  1T72 A;  2E5V A;  2CCQ A;  4PJJ A;  2M6I A;  3J7Y q;  3N2K E;  1NEN A;  1IJ5 A;  2KLQ A;  2IC6 A;  2X9H A;  3HR0 A;  4LF6 T;  4HFE A;  1JNZ A;  4NUU A;  4KMC A;  2BS2 A;  2FJD A;  2W4X A;  3NZP A;  5ABG A;  4CN4 A;  4ZI3 D;  3UTK A;  2FBW A;  3E08 A;  3IEE A;  4KX6 A;  4PW8 A;  4Z8X A;  2YK0 A;  2WZI A;  1I6Z A;  4U2Z A;  2ZMA A;  3GN5 B;  3MAC A;  1HX1 B;  2WMN A;  5E0O A;  3Q5E A;  4U2Y A;  4P0B A;  5HEO A;  3KV5 A;  2QVA A;  4XZC A;  4DR5 T;  4GIW A;  1O3X A;  4NIQ A;  4QXH B;  3ZMT B;  4EZH A;  2LHN A;  2LM9 A;  4EB6 E;  5CFB A;  4DV3 T;  3IA3 A;  3PUY F;  3PUR A;  4B6X A;  1N33 T;  1XMO T;  3JC6 C;  4IE6 A;  1YXR A;  3UU4 A;  5LGT B;  3TLW A;  3OTO T;  4JYA T;  5L2L A;  3PUW F;  3TLS A;  1U5P A;  2VL8 A;  4F8H A;  2K3W A;  2DI4 A;  2BG9 B;  2D5U A;  5LBM A;  4TWH A;  5FXV A;  3HL6 A;  4YSY A;  3P4S A;  4ZEY A;  4DUZ T;  3FBL A;  3PDY A;  3CQC B;  2A72 A;  3CVR A;  4IE4 A;  2A2F X;  2YN6 A;  2CLY B;  4TWD A;  3ZC0 A;  2Q9Q A;  4ZHQ E;  4L5G A;  3ZST A;  1W9R A;  2VKJ A;  3I1A A;  3TKL B;  3U78 A;  3FB2 A;  4O2A E;  5KXJ A;  2H89 A;  5LJN A;  3KIN B;  2CBI A;  4U7I A;  3ZYK A;  3UUX B;  2XQ3 A;  2A9U A;  3C4Z A;  3ZMU B;  1WR0 A;  3F57 A;  3LK4 2;  5L3B B;  2A3D A;  1SUM B;  2ZLY A;  3PUZ F;  2LT3 A;  4IE5 A;  3QNU A;  4JI6 T;  3NRY A;  2JRK A;  4TNV A;  2BVL A;  5HXC A;  2XSA A;  5F3J A;  1D1B A;  2H7O A;  2UXN B;  4DV0 T;  5L3D B;  2IUB A;  4JV5 T;  5FL0 A;  5AQT B;  4YTM A;  4YY3 T;  4CI3 B;  3ZYL A;  3CWZ B;  1VCT A;  3OJA A;  2XPK A;  3A5X A;  5LYJ E;  2YEV C;  5DJQ C;  2XAQ B;  1ZOY A;  2J47 A;  3MZK B;  4HN9 A;  3WAK A;  3E0Z A;  5LHG B;  3Q5W A;  5HWY A;  1KK7 A;  5LNK A;  3B57 A;  3ZMS B;  2J1D G;  3DP7 A;  4QWN B;  5HWX A;  4ZXL A;  2LLY A;  2V6Y B;  2DL1 A;  2LOS A;  3AEG A;  4X1K E;  5AQG B;  4C91 A;  5LHH B;  3VRA A;  2E2A A;  2LSY A;  3C51 A;  2X9X A;  3C4X A;  4QH1 A;  5FP3 A;  2AXD S;  2LOP A;  4IDP A;  3IBP A;  1YW0 A;  3CKD A;  4UVB B;  3N9Q A;  4PK6 A;  4B3M T;  3ZC1 A;  1OWA A;  5KMG P;  1WCR A;  3K3Q C;  4DND A;  5HEJ A;  2KIN B;  3ZPO A;  1HTJ F;  4X64 T;  2W00 A;  4PNI A;  4UF0 B;  2NWB A;  4MAL A;  4OFZ A;  3HKB E;  4CI1 B;  3T8O A;  3P4Q A;  2CPT A;  5JDM A;  2VKD A;  2LKG A;  3K3O A;  4QXB B;  5AQS B;  4HWF A;  4I55 E;  4EV6 A;  3RKO A;  1UCU A;  4N78 D;  4ZZB A;  5TAO A;  5FXX A;  3P50 A;  4I50 E;  2Q9Q B;  4JI2 T;  1NWM X;  4AQF A;  1AJ3 A;  2HPL A;  2Y48 B;  3KVA A;  2PJQ A;  4YHJ A;  4EZ4 A;  4JI7 T;  5FXZ A;  5JRC B;  1US7 B;  4DR3 T;  3H3A A;  5LBQ B;  4LMJ A;  4I0U A;  4ZZC A;  5A1L A;  1HFA A;  3F2E A;  2CE7 A;  2KMF A; 
#chains in the Genus database with same CATH homology
 2CXD A;  4PK4 A;  2NOX A;  5L3C B;  2LEH A;  2JMH A;  3PTR B;  4C90 A;  5IYZ E;  3RRC A;  3ZN1 B;  5FY0 A;  4CXY A;  2XUE A;  2X51 A;  3IF8 B;  2K5B B;  5EK3 A;  1BR1 A;  1S94 A;  1NAF A;  3K3N A;  3ZC1 A;  5JRC B;  5H6Q B;  4FI5 A;  2ZM2 A;  2DHR A;  4ZI2 D;  5L3G B;  2L8K A;  4X20 E;  4YLH A;  2K24 A;  3ESL A;  3PUA A;  1D0Z A;  1B7T A;  4JUY A;  2MTQ A;  2GK9 A;  5LHI B;  3ZMZ B;  4OYJ A;  2Q9Q D;  3FXD B;  3GWH A;  3BQL A;  3AAE B;  2BZB A;  3ZLI A;  5IHY A;  3N9N A;  3C50 A;  4PJM A;  2ODV A;  4JEU B;  4WBN E;  4DMW A;  4ZS2 A;  2Y8D A;  1BR4 A;  4V1A v;  2XAG B;  4IE0 A;  3B13 A;  4I43 B;  4TV8 E;  3Q5X A;  4PK5 A;  4ZS3 A;  2W62 A;  3FXE B;  3WAJ A;  4WW0 A;  2WBL A;  3Q2M A;  2Z6E A;  3L3P A;  1V9D A;  3ZJ2 A;  2WAU A;  2N9D A;  5FYM A;  2E9X B;  4GOU A;  2LE8 A;  1SA0 E;  4DO0 A;  4BJM A;  2YU1 A;  1S35 A;  4IHJ E;  5CA0 E;  2OA5 A;  2NP9 A;  3RYF E;  4UV8 B;  1HS7 A;  3UT5 E;  3BQI A;  5EZY E;  4ASK A;  1MMD A;  5CB4 E;  3KVB A;  4UVA B;  3J9X 1;  3NBX X;  2QA7 A;  4PJL A;  5HXS A;  3ZYM A;  1LVK A;  2EHO C;  4I4T E;  3WI3 A;  2XHE B;  4O4H E;  1UX5 A;  5FXW A;  2WWU A;  5JQG E;  3SOL A;  4UV9 B;  4P0A A;  1MMG A;  4WBO A;  2XAJ B;  3N5L A;  4TV9 E;  3N2G E;  2VKH A;  2JJ9 A;  4DVD A;  2CWO A;  1HX8 A;  4CXX A;  3LG7 A;  5FNV E;  5JR9 A;  3O1I A;  4IE7 A;  4F6R C;  1WRD A;  2PG8 A;  1D0X A;  5DAB A;  3ZMV B;  4GK5 E;  4E7S A;  3RC8 A;  3DTO A;  4UXN B;  5BMV E;  2LSG A;  4EYU A;  3N9O A;  4L0R A;  4QXC B;  2LJL A;  4TN7 B;  4H9P C;  4TX5 A;  4AXP A;  3UUN A;  1LRZ A;  1LVF A;  3DJB A;  4ADZ A;  2W63 A;  1H7C A;  1BR0 A;  3QC9 A;  3NRX A;  2E9X C;  4ZI2 C;  2ZM8 A;  3KV6 A;  2BDE A;  2H7V C;  4OHF A;  1T98 A;  2Q9Q C;  1IAP A;  3HKD E;  1HG5 A;  2C5J A;  1WLX A;  3ANW A;  3OYX A;  5JR9 B;  1ZEE A;  1ZV4 X;  2V7L A;  3KV9 A;  3Q9D A;  4K0U A;  4L9I A;  3EDV A;  2V7M A;  1G8X A;  3CQG B;  4GYR A;  5HXE A;  1OXZ A;  2RA1 A;  3F31 A;  2V7I A;  5JDF A;  3CX7 B;  3AVS A;  3RH3 A;  1QSD A;  2BVM A;  5HXR A;  4X1I E;  2QGS A;  3GN5 A;  3KDS E;  5ADX L;  2X68 A;  4BJN A;  2KWH A;  2X9W A;  1HCI A;  2WM9 A;  3AB3 B;  1LKX A;  1Z0P A;  2DWK A;  2X0L B;  3R84 B;  3P7I A;  2HH7 A;  4O2B E;  2B1E A;  2JMK A;  3RC3 A;  1U4Q A;  3W15 B;  4E7Z A;  1QUU A;  4X1Y E;  3LBX B;  5JVD E;  2SPC A;  3AA1 B;  4ANJ A;  2D2S A;  2NTY A;  3PU3 A;  3S4U A;  5JRC A;  5DQV A;  2P9B A;  2N2N A;  1BR2 A;  3V5U A;  2DLR A;  4QX8 B;  3UFE A;  2UXX B;  2KND A;  3N9P A;  1HG2 A;  4H9Q C;  4ZOL E;  1YD8 G;  4EYY R;  4XBF B;  1ZHC A;  3CQX C;  4HTE A;  2JQQ A;  2YU2 A;  4PFP A;  4CZZ B;  3PU8 A;  5LG4 A;  2KWI B;  4EXT A;  5HYA A;  2I59 A;  2X9Y A;  4AQF C;  4OYK A;  2W61 A;  4IIJ E;  3C98 B;  2CXL A;  3C4W A;  2CXF A;  2RP4 A;  2XTL A;  3GMI A;  4FJO A;  3RPU A;  5JR9 C;  4AKG A;  5AFU L;  2KT9 A;  3FHN A;  5H6R B;  2WMO A;  4CQI A;  2JPF A;  2LSK A;  1MMN A;  2XAF B;  4H63 V;  3AVR A;  4QHO A;  2IW5 B;  4IST A;  4O4I E;  3ZCJ A;  5J2U E;  4HGA A;  4YJ3 E;  4WNK A;  3AA7 B;  3ZN0 B;  3RYC E;  4CXW A;  3SWH A;  2PBI A;  3EDU A;  5DQW A;  3OKQ A;  3N9L A;  1G73 A;  2MYS A;  5KDM C;  3O4X E;  1MIW A;  3ZEF B;  3CX8 B;  2PFV A;  5LGU B;  2V7J A;  1SHZ C;  2ODU A;  5ETW A;  3LBX A;  3OBV E;  5LXT E;  4P09 A;  2ZM0 A;  2X66 A;  3I9Y A;  4EAH A;  2VAS A;  2V26 A;  1IZN B;  2XAS B;  3MK7 C;  5LP6 E;  3KBU A;  3VKG A;  4DMV A;  4U74 A;  3ONX A;  3AA6 B;  2L3L A;  2V1D B;  3I0O A;  2ACX A;  3LFM A;  2W0G A;  4M1P A;  2N1G A;  4KUM B;  4UF0 A;  5JDG A;  2VK9 A;  3AAA B;  2L9Q A;  5JH7 E;  2VB6 A;  3OYZ A;  3ETU A;  4ILU A;  2E9X D;  3M65 A;  3O1J A;  2EHO B;  4JEH B;  4MFR A;  2C5K T;  1YKH B;  5JDQ A;  3R6N A;  4BAY B;  5LJM A;  2CMR A;  3VKH A;  3NZQ A;  1D1A A;  3KV4 A;  3LK3 B;  4PAG A;  5L3F B;  4UVC B;  5EK2 A;  3MA9 A;  2HPJ A;  3FBZ A;  3C64 A;  3RYI E;  2Y6X A;  4MHC A;  3O9X A;  2YIN A;  3UUL A;  4G2A A;  4NUV A;  4TUY E;  3EUH A;  3ZJ1 A;  4ERR A;  4ZI3 C;  2M67 A;  3CML A;  3AAI A;  3L09 A;  4GYS A;  4G63 A;  4ZI7 E;  4PFO A;  2D0T A;  3IHR A;  5GON E;  5LGN B;  3H37 A;  3O1H A;  2VWA A;  3RRW A;  4A56 A;  5HXH A;  1WYC A;  3EVY A;  4H9O C;  4GK0 E;  4O4L E;  3I9W A;  2LSJ A;  5M4Y A;  4HFV A;  3QUJ A;  3QK6 A;  4IGU A;  3HI2 A;  3ZCI A;  3MJX A;  2C5I T;  3VHL A;  4H9R C;  3HKE E;  1WR6 A;  2E8I A;  3K8P C;  1E1H B;  4HKA A;  2H3R A;  4AKH A;  2E9X A;  3ANW B;  1MND A;  2VKO A;  1EZ3 A;  4BA9 A;  2ES0 A;  4O4J E;  3N2O A;  1MMA A;  2CM0 A;  2DNX A;  2NW9 A;  2NW7 A;  4HE8 A;  1WYB A;  2XAH B;  1FIO A;  4AI6 A;  2V7K A;  4PJN A;  2CA5 A;  4DBQ A;  4U72 A;  4TZ4 C;  3D0T A;  1FEW A;  5L3E B;  5FY1 A;  2DWG A;  3HA4 A;  5LCY A;  3I0Q A;  3LJC A;  3N9M A;  4KP3 C;  2X67 A;  5EK4 A;  3BK9 A;  2K48 A;  3HKC E;  5JDH A;  4QX7 B;  4YJ2 E;  3MKD A;  4EOZ B;  2C0S A;  4QKN A;  3BQK A;  5LOV E;  4CI2 B;  4HEA A;  2CLY C;  2NTX A;  1CUN A;  3PE0 A;  4O8S A;  5FY7 A;  3SRZ A;  1X79 A;  2IC9 A;  2MOZ A;  1D1C A;  3SS1 A;  4JLE A;  2XQY A;  2LSI A;  4UEL A;  2KZ7 B;  3KBT A;  3VU7 H;  3E22 E;  5CA1 E;  3MXZ A;  2CEA A;  5JDN A;  3AA0 B;  3RX6 A;  4YFS A;  5J1G A;  1FMW A;  3P8C D;  4MBQ A;  5C8Y E;  5F8P A;  4XAX B;  3PUG A;  3CPZ A;  2DCF A;  1KNZ A;  1HF8 A;  2WSS V;  3PUS A;  3RYH E;  5LA6 E;  2NW8 A;  3V5S A;  4H9N C;  4H9S E;  1MNE A;  5JRE A;  2G0U A;  1D0Y A;  2D0U A;  3KFW X;  3CX6 B;  4AQG A;  5KX5 E;  2KXP B;  1IJ6 A;  4ISS A;  5HAX A;  4H63 H;  2IAK A;  3GA8 A;  5JDL A;  2CWY A;  4KBM B;  4J2C A;  4UIG A;  5J2T E;  2EHO A;  1FMV A;  3PUQ A;  3UUM A;  2K9A A;  1Y64 B;  1MIV A;  4AKL A;  4IDZ A;  1VRB A;  1YKE B;  3U3I A;  4AKR B;  1VOM A;  4UEM A;  2EHO D;  3ETV A;  1ZKE A;  5FMN A;  3JC6 D;  4OK0 A;  4DBR A;  3LK2 B;  2MBG A;  4MLK A;  4AKI A;  1UX4 A;  4EIW A;  2LHR A;  1MIY A;  2CCQ A;  4PJJ A;  3J7Y q;  3N2K E;  1IJ5 A;  2KLQ A;  2IC6 A;  2X9H A;  3HR0 A;  4NUU A;  4KMC A;  3NZP A;  4ZI3 D;  3UTK A;  3E08 A;  3IEE A;  4PW8 A;  4Z8X A;  2YK0 A;  5E0O A;  2ZMA A;  3GN5 B;  3MAC A;  2WMN A;  4P0B A;  3KV5 A;  4XZC A;  4GIW A;  1O3X A;  4QXH B;  3ZMT B;  4EZH A;  2LHN A;  2LM9 A;  4EB6 E;  4B6X A;  3PUR A;  3JC6 C;  4IE6 A;  5LGT B;  5L2L A;  1U5P A;  2VL8 A;  2DI4 A;  2D5U A;  5LBM A;  5FXV A;  3HL6 A;  3FBL A;  3PDY A;  3CQC B;  2A72 A;  3CVR A;  4IE4 A;  2A2F X;  3ZC0 A;  2CLY B;  2Q9Q A;  4ZHQ E;  4L5G A;  2VKJ A;  3I1A A;  3TKL B;  3U78 A;  3FB2 A;  4O2A E;  5LJN A;  3KIN B;  3ZYK A;  3UUX B;  3ZMU B;  3C4Z A;  3F57 A;  3LK4 2;  5L3B B;  2A3D A;  2ZLY A;  2LT3 A;  4IE5 A;  3NRY A;  2JRK A;  2BVL A;  5HXC A;  5F3J A;  1D1B A;  2H7O A;  2UXN B;  5L3D B;  4CI3 B;  3ZYL A;  3CWZ B;  3OJA A;  3A5X A;  5LYJ E;  2YEV C;  5DJQ C;  2XAQ B;  3MZK B;  4HN9 A;  3WAK A;  3E0Z A;  5LHG B;  3Q5W A;  5HWY A;  1KK7 A;  5LNK A;  3B57 A;  3ZMS B;  2J1D G;  3DP7 A;  4QWN B;  5HWX A;  5LHH B;  4C91 A;  2LOS A;  4X1K E;  5FP3 A;  2LSY A;  3C51 A;  2X9X A;  3C4X A;  2LOP A;  3IBP A;  1YW0 A;  3CKD A;  4UVB B;  3N9Q A;  4PK6 A;  1OWA A;  5KMG P;  3K3Q C;  4DND A;  2KIN B;  3ZPO A;  1HTJ F;  2W00 A;  4PNI A;  4UF0 B;  2NWB A;  4MAL A;  4OFZ A;  3HKB E;  4CI1 B;  3T8O A;  5JDM A;  2VKD A;  3K3O A;  4QXB B;  4I55 E;  3RKO A;  1UCU A;  4N78 D;  5TAO A;  5FXX A;  4I50 E;  2Q9Q B;  4AQF A;  1NWM X;  1AJ3 A;  2HPL A;  2Y48 B;  3KVA A;  2PJQ A;  4YHJ A;  4EZ4 A;  5FXZ A;  1US7 B;  3H3A A;  5LBQ B;  5A1L A;  1HFA A;  3F2E A;  2CE7 A;  2KMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...