2WY2A

Nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
total genus 41
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2wy2A00
1WFDA 1WR0A 5FVKA 2CPTA 4CN1A 2V6XA 4U2ZA 4ZEYA 2WWVA 4A5XA 4CN4A 5LB7B 3ZT5A 3EABA 4U7YA 3ZSTA 3ZT6A 3ZSSA 2K3WA 2MPKA 2W2UA 2WY2A 5CGMA 2JQHA 2CRBA 2JQKA 4WZXA 3K1SA 4U7IA 4U33A 2V6YB 4CN6A 2A9UA 5FVLA 3ZT7A 4U31A 4NIQA 2LRLA 2LRKA 4U2YA 5CJ5A 1YXRA 1WCRA 2DL1A 2JQ9A 2V6YA 4U3CA 2XZEA 4IT4A 4P1NA 2RPAA
chains in the Genus database with same CATH superfamily
1XZYA 4YTNA 3WI3A 3M3ZB 5JDQA 4ILCA 1NAFA 4U2ZA 4TV8E 4DVDA 3J9X1 2VVNA 4CN4A 4IDQA 5EK2A 1I94T 1MIVA 3P4WA 3EABA 4PJJA 3ZMVB 1IBMT 5LG4A 3PUQA 2PG8A 4CXYA 3PUWF 2HN1A 3RF1A 2UXBT 3FBZA 2KINB 2X9WA 1N32T 3AA7B 4X65T 4U7IA 1IAPA 2AXDS 1VRBA 2V7MA 2BG9A 3CIRA 2CA5A 1FJGT 2BKNA 4UV9B 5HXHA 3EHZA 2W62A 4U2YA 4ZI2C 3AEDA 4B3TT 4JI0T 3OPCA 3ZMZB 2PTFA 4U3CA 2FJBA 4P1NA 4LF5T 1OEDC 3B13A 4OYJA 4MLKA 4QXCB 3ANWB 1E7PA 1VOMA 4PK4A 5HWXA 1DU2A 3AE4A 1WFDA 4DUYT 3QUJA 2NTXA 5J1GA 1IJ6A 4AISA 1HNWT 4COFA 3L8RA 2BKOA 4UXNB 2XM1A 4LF6T 1IZNB 4IGUA 2C0SA 5HYAA 2H89A 2KLQA 2QA7A 3F31A 4AKRB 1HNZT 1QUUA 2K48A 2W2UA 5CGMA 1Z8UA 2J1DG 3AXJA 3I1AA 4ISSA 4ZI7E 4DR5T 3VKHA 3SFDA 3AA0B 4H9NC 3WAJA 4GKJT 1OWAA 4O2BE 5HEOA 5FVLA 5FY0A 5TAOA 4CZZB 2UXXB 3Q5DA 4ERRA 5LMUT 4AI6A 5JRCB 3PUVF 3PUGA 4JI2T 2V7JA 3CX6B 4UR9A 3C64A 3OVUA 4AQFA 4ZZBA 2N1GA 2PJQA 4V1Av 4DV5T 2LSGA 2VKOA 3U78A 4EAHA 3ZMUB 5FXZA 2KSRA 4YXDA 2M67A 2RPAA 1EZ3A 3T1HT 2HHHT 2BBHA 1WR0A 4MALA 4TWDA 5AQQB 2CM0A 2N9DA 2X51A 3FXDB 5E0OA 1UUSA 4P0AA 2V6XA 4OX9T 3ZCJA 5JDFA 3QK6A 1SA0E 2IHR1 5FKYA 4KUMB 2Q9QB 3EDUA 2WBLA 1MMDA 2ODUA 3N5LA 5FMNA 3RYFE 4ASKA 4Z8XA 3PE0A 5J0ZA 3PUAA 4JEHB 1LRZA 4ILBA 2CRBA 5JQGE 1YKHB 3I0QA 3MK7C 4F6RC 4WNKA 5DQWA 4YT0A 2NW7A 5LGTB 2B76A 1D1AA 2A9UA 2ZM8A 3OYZA 2X68A 3RYHE 5CB4E 4JI3T 3EAMA 3PURA 5ABHA 4PJLA 5AFUL 5CJ5A 3DTOA 2XHEB 3NVOA 5AQVB 1N36T 1LVKA 4IDNA 2WDQA 2WZHA 2BZBA 3UUBA 1CUNA 1R8IA 2CLYC 2D0TA 3FZMB 4YJ2E 3UULA 5EZYE 4DR1T 3CPZA 3IF8B 4CI3B 3IBPA 5L3CB 4DV3T 4HWHA 2C5KT 3ETVA 4EEBA 1XNRT 4YY3T 3A8YC 2XAJB 3TKLB 4LFCT 5M4YA 2RA1A 5CA0E 2NW8A 1LKXA 2YKSA 2KMFA 3AEEA 4JEUB 4GIWA 2XPKA 4A56A 3ZT5A 4AXPA 4EGWA 5ABEA 4EV6A 3U3IA 3UU5A 2QYWA 4DO0A 1UURA 2UXCT 2Q9QD 2EHOC 3F57A 4AKHA 2CE7A 3O4XE 4IREA 4IDZA 4ZS2A 1FEWA 2I0MA 1ZOYA 4EZ4A 4U74A 2CCQA 2X0LB 5AQNB 4X1YE 3HKEE 5CA1E 2LKHA 4P0BA 4KX6A 3RYIE 1UK5A 4O4IE 2W00A 1LVFA 2PBIA 3GWHA 1Z0PA 3PUYF 4NIQA 4U31A 5DQVA 5ABGA 4WBNE 4JI6T 1WYCA 4HTEA 2GK9A 4MFRA 3RIUA 4EZHA 3CK6A 1B7TA 2IAKA 2XUEA 3RQWA 3MJXA 3UUNA 4JUYA 3WAKA 5LGNB 5HAXA 5LMNT 2I59A 2H3RA 4LF7T 3MKDA 4GYSA 4X5TA 5FP3A 3FZLB 4PK6A 4L9IA 4GKKT 5KDMC 4X66T 5L3GB 3UU6A 5F8PA 5J2TE 5CFBA 2F4VT 3RGLA 4CI2B 5C2TA 4TN7B 4F8HA 4O4HE 3RKGA 2ZM6T 2JQHA 2X0YA 5FXWA 3HL6A 3O1IA 5LCYA 3S4UA 3LBXA 4GYRA 4CXXA 2LT3A 2JMKA 1E2AA 3AEGA 3JC6D 5FY1A 2MBGA 4JI5T 5AQKB 4CN6A 4X62T 2E5LT 2IC9A 3QOFA 2YDRA 4H9RC 1CHUA 1HG2A 1W0AA 2X0HA 3R6NA 1I6ZA 4AKLA 4AIUA 3E08A 3RIUC 2VQET 4I4TE 1MIWA 4OYKA 2CXDA 4ILUA 3SS1A 2V5DA 3LDQB 3PJAA 3PV0F 3RI5A 1HX8A 2XQ8A 4HWDA 2E2AA 4XAXB 2FUPA 3N9PA 4ZS3A 1HF8A 2IDOB 4HKAA 3ZYLA 1E1HB 2LSJA 4IDPA 2P9BA 2UUBT 1WRDA 3P7IA 2XQ6A 2KT9A 1NWMX 4NUVA 4YSYA 4JI8T 2NR4A 3PUXF 4X64T 5LYJE 1YD8G 2HN2A 4DMWA 4HWFA 1N34T 1ZKEA 2LSKA 2NWBA 3P4QA 4GK0E 3AB3B 2ACXA 2WS3A 4EB6E 4U33A 1MNDA 2DNXA 4X1KE 3RH3A 2FJEA 2XASB 3RQUA 1T72A 4EYYR 2UXDT 1FMWA 2XQ4A 3BK9A 3N9NA 2VURA 5AQJB 2EHOB 1KF6A 1US7B 2VWAA 1YXRA 2J4GA 3AE5A 3C50A 4B6XA 3VKGA 4M1PA 5IHYA 5LXTE 3P4RA 4ZI3D 3P4SA 5HXCA 3JC6C 3QB5A 2N2NA 2DLRA 4TWFA 2XQAA 4FJOA 4TUYE 4YLHA 3ZKRA 1X79A 2LM2A 4B3ST 1J5WA 3C51A 3FHNA 5C8YE 3VR9A 5A1LA 1VCSA 2MTQA 2JMHA 4QX8B 3ZSTA 4H9QC 4LMJA 4ZOLE 3ZJ1A 3ETUA 1T98A 2LHNA 3I9YA 4IHJE 5L3BB 4LF4T 4NUUA 4EEDA 3OBVE 5HXSA 4G2AA 1OXZA 3K1SA 5LNKA 3HA4A 4GOUA 4K0KT 5JRCA 2UUCT 4TNVA 3BQIA 2XTLA 4IL4A 5AQIB 3CWZB 4DR4T 4AKIA 2YEVC 2JQQA 4IE6A 3GN5B 4N78D 4DBRA 1N33T 2LRKA 4WYVA 3RPUA 4QXHB 3KV5A 3ZYKA 1WCRA 3HKBE 1BR1A 5H6QB 5FXVA 2LHRA 2V7KA 3P50A 2EHOA 2LM9A 2WZIA 5H6RB 3KFWX 3NBXX 3Q9DA 3X1DA 5C3JA 2VKJA 3PJAJ 2VL0A 5L4HA 2H88A 4DNDA 3PU8A 2W67A 5LHIB 4X20E 3UTKA 2G0UA 2V7IA 2E9XD 1JNRA 3L09A 4I50E 3NRXA 5AQOB 5L2LA 2CLYB 5L3FB 3TLVA 1XMQT 1BR2A 3B57A 3NZQA 4TX5A 4WBOA 5HXRA 3T8OA 4DBQA 3ZMSB 5JREA 3T1YT 5HEUA 1S35A 2JQKA 2ZM2A 3AA1B 3C4XA 5JTGA 5LHHB 1UX5A 3LJCA 3Q5EA 2XQYA 4IE5A 2MOZA 4HWCA 2YK0A 3OJAA 4LMKA 4ILAA 1BR0A 4OK0A 4X1IE 3UFEA 3V5SA 2XM2A 5F3JA 2J47A 2V1DB 1HFAA 3A5XA 2W0GA 2I6HA 3GN5A 3HR0A 3KV6A 3QC9A 3QNUA 4PAGA 2CXLA 2UXNB 3D0TA 1SUMB 2OA5A 4TNWA 1WYBA 3PUZF 4DV6T 2E9XC 4FI5A 1WLXA 4PJMA 4CI1B 3A7MA 4P09A 4DV7T 3CX7B 1U5PA 4QXBB 3SOLA 4HFHA 2HPJA 4BJNA 3H37A 5ABFB 3HKDE 4OHFA 4JLEA 3ZT6A 3IHRA 4L5GA 2DCFA 2BVMA 2C5JA 2JRKA 3H3AA 3UUMA 3K8PC 2M6IA 5FNVE 5KX5E 3P4PA 1IBLT 2D9DA 4UF0B 2MYSA 3FZFB 4Q25A 4ANJA 4O8SA 5HWYA 4E7ZA 1IBKT 2DHRA 2X66A 1T8BA 2W63A 1MMAA 2B1EA 4BAYB 3QB5K 2IW5B 3TLTA 3NRYA 4IE0A 3OKQA 4QKNA 1WR6A 4PJNA 2QVAA 4LFAT 1XNQT 3PTRB 4YFSA 3RLFF 2VB6A 3K3OA 5AQRB 1L0VA 4A97A 4JI4T 1ZV4X 3C4WA 2H7OA 2V8SV 3N2KE 2XAHB 3JADA 3KDSE 2BBJA 2IIUA 2IMLA 2ZLYA 4HFEA 2NTYA 3OYXA 1G8XA 2K5BB 4MBQA 5JDNA 4UIGA 2HPLA 4UVAB 4HN9A 1NEKA 4CN1A 1ZHCA 4DR6T 1KNPA 2WB5A 5LB7B 3RYCE 1KNRA 3LK3B 3ZC0A 2BKPA 4O2AE 1D0YA 2VVSA 3JCFA 3LBXB 3AE7A 5ABFA 2K3WA 1M7KA 2MPKA 2PFVA 3O1JA 2MAWA 3ABVA 5ETWA 2BDEA 2XQ9A 2SPCA 4HFDA 2CHNA 5LGUB 4ZHQE 3OTOT 5L3DB 3RHWA 2WU2A 3PDYA 2LKGA 3AAAB 4O4JE 4JV5T 2BVLA 5J2UE 3AA6B 4QX7B 3AVSA 1W09A 2XY8B 4YSXA 2JQ9A 4K0UA 2L3LA 4G63A 3CQGB 2Y6XA 3BQLA 2VL8A 2XAFB 3F2EA 3M65A 4PK5A 3K3QC 4YHJA 3AE6A 5JVDE 2D0UA 3NWIA 3LFMA 4QWNB 2NW9A 4HFBA 4DV0T 2HH7A 2AE9A 3N9MA 1IJ5A 3AEAA 2WM9A 3P8CD 2WSSV 5JDGA 4L0RA 4PFPA 3J7Yq 4DR7T 4ZEYA 2WWVA 3ZCIA 3VHLA 5LG3A 2KWHA 2L9QA 4KI0F 4LMLA 4QH4A 5GONE 1YKEB 2WDRA 3DJBA 2D2SA 4JBWF 4UV8B 4DV4T 1FMVA 2WQYA 4ZI3C 1MMNA 3KBTA 5AQPB 1HG5A 4I0UA 5AQUB 3LSVA 3UUXB 3NKZA 2KNDA 2LSYA 3ONXA 5DABA 3ZEFB 4ZZCA 4UVCB 3ONJA 1KK7A 2IC6A 2WP9A 3DP7A 3FZHB 3KV9A 4YHHT 1KNZA 2WU5A 5FL0A 3VU7H 3O9XA 2R6GF 2WMOA 3UQ4A 4LF8T 3C4ZA 1UCUA 3EDVA 4TV9E 5HCMA 2CEAA 2V6YA 2LE8A 4HE8A 3ZN0B 4DR2T 1MMGA 3N2GE 5LBMA 1HX1B 1D0ZA 5LOVE 3ZLIA 5JH7E 2X67A 1D1BA 2LSIA 5JR9C 3MXZA 2CPTA 1QSDA 4IDOA 1G73A 2ODVA 2ZMAA 4UVBB 4C90A 2CBJA 4A5XA 5JR9B 2L8KA 1SHZC 4EXTA 2X9HA 4IE4A 2VK9A 3VRBA 1HTJF 4HGAA 3ZSSA 4BJMA 4OFZA 1JNZA 4AKGA 3FXEB 4HFCA 3GA8A 3AAIA 4KMCA 3SWHA 4HEAA 5DJQC 4LFBT 5FL1A 2NOXA 4WZXA 2OLTA 4PW8A 2ZM0A 4BA9A 4UEMA 1YQ4A 2UU9T 3N2OA 1Y01A 3JAFA 1XWMA 3NZPA 4A98A 1YW0A 1OEDA 2E9XA 4KHPT 4NPPA 3ESLA 2CWYA 3EVYA 2CHOA 4U72A 2KWIB 2XZEA 2V7LA 3AE2A 1KFYA 4NXNT 2QGSA 2NP9A 3FZKB 3LK42 3N9LA 2JJ9A 2BG9C 4KP3C 4O4LE 4UF0A 3UU4A 5AQLB 5L4EA 2XAQB 2A2FX 3CQXC 2XQ7A 3I0OA 1S94A 4E7SA 4PNIA 2Z6EA 5AQTB 3CQCB 4EIWA 3CVRA 4DV2T 3MZKB 4TZ4C 1AJ3A 2M6BA 2QRXA 3PUSA 5HCJA 5JDMA 2WY2A 2XQ3A 3KVBA 1X9BA 3L39A 5IWAT 4WW0A 2ES0A 2FJDA 5AQGB 2H7VC 5KMGP 3ONLC 2VKHA 5JDLA 4NXMT 2W66A 1U4QA 2XJ7A 3HKCE 3I9WA 4IE7A 2ACZA 3H3MA 3AEBA 3W15B 3ZJ2A 5HEGA 5IYZE 3O1HA 2CWOA 1MIYA 2KXPB 3CMLA 3KVAA 5FXXA 2RP4A 1XDOA 3LG7A 2XAGB 4QH5A 2FBWA 3AE9A 3CX8B 1Y64B 2WWUA 3KBUA 2E9XB 1D0XA 2Q9QC 2Y48B 5BR8T 2IUBA 4KBMB 5FY7A 2VKDA 1W0BA 5EK4A 4TWHA 2V5CA 2A72A 1BR4A 5LBQB 5JDHA 3FBLA 2E8IA 1ZP0A 4DR3T 3ZYMA 4GK5E 3CKDA 3RKOA 1VCTA 3UT5E 2WAUA 4U7YA 1W9RA 4ISTA 3EI0A 4B3RT 3E22E 4C91A 3UQ7A 4XBFB 2VQFT 2Q9QA 5HXEA 4EYUA 3IEEA 5LJNA 4B3MT 3AVRA 4H9SE 5AQSB 1J5ET 4PFOA 3VR8A 2VASA 3RIAA 3EUHA 4IIJE 5JR9A 3KINB 4KHZF 3RRWA 4YSZA 5LJMA 3ZT7A 4DIDB 4H63H 3TLSA 3IA3A 5HEHA 4DUZT 3Q2MA 4IL9A 4JYAT 2X9YA 1UX4A 3PU3A 4HFVA 4CQIA 2DL1A 3TLWA 2LEHA 4JI7T 3RC3A 3AXJB 2BS2A 2LJLA 2YU1A 3UFGA 4DV1T 3FB2A 2YU2A 3RRCA 5LP6E 1MNEA 3SFEA 3JAEA 4DMVA 2DWGA 2YINA 4ZXLA 1J1JA 1HCIA 5FVKA 1HR0T 2D5UA 4ZI2D 1QLBA 4XZCA 2UUAT 4LF9T 1KEYA 3ZPOA 2W61A 2C5IT 2K9AA 2E5VA 3C98B 4H63V 2CBIA 1D1CA 2BG9B 2LLYA 3BQKA 3Q5WA 3AAEB 3HI2A 4QHOA 5AQHB 3N9OA 3UU3A 5F5WA 3ZMTB 4ADZA 4JI1T 2V26A 2LOPA 1ZEEA 2X9XA 2LOSA 4UELA 2YDQA 3LK2B 1GQEA 2YDSA 3SRZA 3AECA 5L3EB 5IUXA 1OEDE 2V6YB 4EOZB 4MHCA 2XSAA 3UU8A 3RC8A 1HS7A 2FJAA 1UGOA 2LRLA 1M62A 3MACA 2BS4A 5LA6E 3V5UA 4YTPA 3Q5XA 3R84B 4HWIB 1XMOT 3AE8A 4H9PC 5KXJA 2YN6A 5L47A 2OV9A 2W4XA 2WDVA 2WMNA 3E0ZA 1H7CA 2JPFA 1HNXT 3N9QA 4I43B 4YJ3E 2KZ7B 5LHGB 2J62A 2JIWA 3ZN1B 2CMRA 3AE1A 4HFIA 5ADXL 2A3DA 1SE7A 4J2CA 1T7SA 4QH1A 5AQFB 3RIFA 4H9OC 2K24A 2WCAA 1YQ3A 2DWKA 5EK3A 3VRAA 3ZC1A 4AQGA 1OEDB 3MA9A 3AEFA 4Z90A 2Y8DA 1FIOA 2CXFA 5FYMA 3KV4A 1NENA 3L3PA 3B5MA 3TLUA 3G06A 4I55E 1O3XA 5AQMB 2YOEA 2XQ5A 2BS3A 4AQFC 3GMIA 3ANWA 4YTMA 4CXWA 2BG9E 1V9DA 3RX6A 5BMVE 4AQYT 2XSBA 4IT4A 1XDPA 2EHOD 4Z91A 5HEJA 3AE3A 2DI4A 3K3NA
chains in the Genus database with same CATH topology
1WFDA 1WR0A 5FVKA 2CPTA 4CN1A 2V6XA 4U2ZA 4ZEYA 2WWVA 4A5XA 4CN4A 5LB7B 3ZT5A 3EABA 4U7YA 3ZSTA 3ZT6A 3ZSSA 2K3WA 2MPKA 2W2UA 2WY2A 5CGMA 2JQHA 2CRBA 2JQKA 4WZXA 3K1SA 4U7IA 4U33A 2V6YB 4CN6A 2A9UA 5FVLA 3ZT7A 4U31A 4NIQA 2LRLA 2LRKA 4U2YA 5CJ5A 1YXRA 1WCRA 2DL1A 2JQ9A 2V6YA 4U3CA 2XZEA 4IT4A 4P1NA 2RPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WFD A;  1WR0 A;  5FVK A;  2CPT A;  4CN1 A;  2V6X A;  4U2Z A;  4ZEY A;  2WWV A;  4A5X A;  4CN4 A;  5LB7 B;  3ZT5 A;  3EAB A;  4U7Y A;  3ZST A;  3ZT6 A;  3ZSS A;  2K3W A;  2MPK A;  2W2U A;  2WY2 A;  5CGM A;  2JQH A;  2CRB A;  2JQK A;  4WZX A;  3K1S A;  4U7I A;  4U33 A;  2V6Y B;  4CN6 A;  2A9U A;  5FVL A;  3ZT7 A;  4U31 A;  4NIQ A;  2LRL A;  2LRK A;  4U2Y A;  5CJ5 A;  1YXR A;  1WCR A;  2DL1 A;  2JQ9 A;  2V6Y A;  4U3C A;  2XZE A;  4IT4 A;  4P1N A;  2RPA A; 
#chains in the Genus database with same CATH topology
 1XZY A;  4YTN A;  3WI3 A;  3M3Z B;  5JDQ A;  4ILC A;  1NAF A;  4U2Z A;  4TV8 E;  4DVD A;  3J9X 1;  2VVN A;  4CN4 A;  4IDQ A;  5EK2 A;  1I94 T;  1MIV A;  3P4W A;  3EAB A;  4PJJ A;  3ZMV B;  1IBM T;  5LG4 A;  3PUQ A;  2PG8 A;  4CXY A;  3PUW F;  2HN1 A;  3RF1 A;  2UXB T;  3FBZ A;  2KIN B;  2X9W A;  1N32 T;  3AA7 B;  4X65 T;  4U7I A;  1IAP A;  2AXD S;  1VRB A;  2V7M A;  2BG9 A;  3CIR A;  2CA5 A;  1FJG T;  2BKN A;  4UV9 B;  5HXH A;  3EHZ A;  2W62 A;  4U2Y A;  4ZI2 C;  3AED A;  4B3T T;  4JI0 T;  3OPC A;  3ZMZ B;  2PTF A;  4U3C A;  2FJB A;  4P1N A;  4LF5 T;  1OED C;  3B13 A;  4OYJ A;  4MLK A;  4QXC B;  3ANW B;  1E7P A;  1VOM A;  4PK4 A;  5HWX A;  1DU2 A;  3AE4 A;  1WFD A;  4DUY T;  3QUJ A;  2NTX A;  5J1G A;  1IJ6 A;  4AIS A;  1HNW T;  4COF A;  3L8R A;  2BKO A;  4UXN B;  2XM1 A;  4LF6 T;  1IZN B;  4IGU A;  2C0S A;  5HYA A;  2H89 A;  2KLQ A;  2QA7 A;  3F31 A;  4AKR B;  1HNZ T;  1QUU A;  2K48 A;  2W2U A;  5CGM A;  1Z8U A;  2J1D G;  3AXJ A;  3I1A A;  4ISS A;  4ZI7 E;  4DR5 T;  3VKH A;  3SFD A;  3AA0 B;  4H9N C;  3WAJ A;  4GKJ T;  1OWA A;  4O2B E;  5HEO A;  5FVL A;  5FY0 A;  5TAO A;  4CZZ B;  2UXX B;  3Q5D A;  4ERR A;  5LMU T;  4AI6 A;  5JRC B;  3PUV F;  3PUG A;  4JI2 T;  2V7J A;  3CX6 B;  4UR9 A;  3C64 A;  3OVU A;  4AQF A;  4ZZB A;  2N1G A;  2PJQ A;  4V1A v;  4DV5 T;  2LSG A;  2VKO A;  3U78 A;  4EAH A;  3ZMU B;  5FXZ A;  2KSR A;  4YXD A;  2M67 A;  2RPA A;  1EZ3 A;  3T1H T;  2HHH T;  2BBH A;  1WR0 A;  4MAL A;  4TWD A;  5AQQ B;  2CM0 A;  2N9D A;  2X51 A;  3FXD B;  5E0O A;  1UUS A;  4P0A A;  2V6X A;  4OX9 T;  3ZCJ A;  5JDF A;  3QK6 A;  1SA0 E;  2IHR 1;  5FKY A;  4KUM B;  2Q9Q B;  3EDU A;  2WBL A;  1MMD A;  2ODU A;  3N5L A;  5FMN A;  3RYF E;  4ASK A;  4Z8X A;  3PE0 A;  5J0Z A;  3PUA A;  4JEH B;  1LRZ A;  4ILB A;  2CRB A;  5JQG E;  1YKH B;  3I0Q A;  3MK7 C;  4F6R C;  4WNK A;  5DQW A;  4YT0 A;  2NW7 A;  5LGT B;  2B76 A;  1D1A A;  2A9U A;  2ZM8 A;  3OYZ A;  2X68 A;  3RYH E;  5CB4 E;  4JI3 T;  3EAM A;  3PUR A;  5ABH A;  4PJL A;  5AFU L;  5CJ5 A;  3DTO A;  2XHE B;  3NVO A;  5AQV B;  1N36 T;  1LVK A;  4IDN A;  2WDQ A;  2WZH A;  2BZB A;  3UUB A;  1CUN A;  1R8I A;  2CLY C;  2D0T A;  3FZM B;  4YJ2 E;  3UUL A;  5EZY E;  4DR1 T;  3CPZ A;  3IF8 B;  4CI3 B;  3IBP A;  5L3C B;  4DV3 T;  4HWH A;  2C5K T;  3ETV A;  4EEB A;  1XNR T;  4YY3 T;  3A8Y C;  2XAJ B;  3TKL B;  4LFC T;  5M4Y A;  2RA1 A;  5CA0 E;  2NW8 A;  1LKX A;  2YKS A;  2KMF A;  3AEE A;  4JEU B;  4GIW A;  2XPK A;  4A56 A;  3ZT5 A;  4AXP A;  4EGW A;  5ABE A;  4EV6 A;  3U3I A;  3UU5 A;  2QYW A;  4DO0 A;  1UUR A;  2UXC T;  2Q9Q D;  2EHO C;  3F57 A;  4AKH A;  2CE7 A;  3O4X E;  4IRE A;  4IDZ A;  4ZS2 A;  1FEW A;  2I0M A;  1ZOY A;  4EZ4 A;  4U74 A;  2CCQ A;  2X0L B;  5AQN B;  4X1Y E;  3HKE E;  5CA1 E;  2LKH A;  4P0B A;  4KX6 A;  3RYI E;  1UK5 A;  4O4I E;  2W00 A;  1LVF A;  2PBI A;  3GWH A;  1Z0P A;  3PUY F;  4NIQ A;  4U31 A;  5DQV A;  5ABG A;  4WBN E;  4JI6 T;  1WYC A;  4HTE A;  2GK9 A;  4MFR A;  3RIU A;  4EZH A;  3CK6 A;  1B7T A;  2IAK A;  2XUE A;  3RQW A;  3MJX A;  3UUN A;  4JUY A;  3WAK A;  5LGN B;  5HAX A;  5LMN T;  2I59 A;  2H3R A;  4LF7 T;  3MKD A;  4GYS A;  4X5T A;  5FP3 A;  3FZL B;  4PK6 A;  4L9I A;  4GKK T;  5KDM C;  4X66 T;  5L3G B;  3UU6 A;  5F8P A;  5J2T E;  5CFB A;  2F4V T;  3RGL A;  4CI2 B;  5C2T A;  4TN7 B;  4F8H A;  4O4H E;  3RKG A;  2ZM6 T;  2JQH A;  2X0Y A;  5FXW A;  3HL6 A;  3O1I A;  5LCY A;  3S4U A;  3LBX A;  4GYR A;  4CXX A;  2LT3 A;  2JMK A;  1E2A A;  3AEG A;  3JC6 D;  5FY1 A;  2MBG A;  4JI5 T;  5AQK B;  4CN6 A;  4X62 T;  2E5L T;  2IC9 A;  3QOF A;  2YDR A;  4H9R C;  1CHU A;  1HG2 A;  1W0A A;  2X0H A;  3R6N A;  1I6Z A;  4AKL A;  4AIU A;  3E08 A;  3RIU C;  2VQE T;  4I4T E;  1MIW A;  4OYK A;  2CXD A;  4ILU A;  3SS1 A;  2V5D A;  3LDQ B;  3PJA A;  3PV0 F;  3RI5 A;  1HX8 A;  2XQ8 A;  4HWD A;  2E2A A;  4XAX B;  2FUP A;  3N9P A;  4ZS3 A;  1HF8 A;  2IDO B;  4HKA A;  3ZYL A;  1E1H B;  2LSJ A;  4IDP A;  2P9B A;  2UUB T;  1WRD A;  3P7I A;  2XQ6 A;  2KT9 A;  1NWM X;  4NUV A;  4YSY A;  4JI8 T;  2NR4 A;  3PUX F;  4X64 T;  5LYJ E;  1YD8 G;  2HN2 A;  4DMW A;  4HWF A;  1N34 T;  1ZKE A;  2LSK A;  2NWB A;  3P4Q A;  4GK0 E;  3AB3 B;  2ACX A;  2WS3 A;  4EB6 E;  4U33 A;  1MND A;  2DNX A;  4X1K E;  3RH3 A;  2FJE A;  2XAS B;  3RQU A;  1T72 A;  4EYY R;  2UXD T;  1FMW A;  2XQ4 A;  3BK9 A;  3N9N A;  2VUR A;  5AQJ B;  2EHO B;  1KF6 A;  1US7 B;  2VWA A;  1YXR A;  2J4G A;  3AE5 A;  3C50 A;  4B6X A;  3VKG A;  4M1P A;  5IHY A;  5LXT E;  3P4R A;  4ZI3 D;  3P4S A;  5HXC A;  3JC6 C;  3QB5 A;  2N2N A;  2DLR A;  4TWF A;  2XQA A;  4FJO A;  4TUY E;  4YLH A;  3ZKR A;  1X79 A;  2LM2 A;  4B3S T;  1J5W A;  3C51 A;  3FHN A;  5C8Y E;  3VR9 A;  5A1L A;  1VCS A;  2MTQ A;  2JMH A;  4QX8 B;  3ZST A;  4H9Q C;  4LMJ A;  4ZOL E;  3ZJ1 A;  3ETU A;  1T98 A;  2LHN A;  3I9Y A;  4IHJ E;  5L3B B;  4LF4 T;  4NUU A;  4EED A;  3OBV E;  5HXS A;  4G2A A;  1OXZ A;  3K1S A;  5LNK A;  3HA4 A;  4GOU A;  4K0K T;  5JRC A;  2UUC T;  4TNV A;  3BQI A;  2XTL A;  4IL4 A;  5AQI B;  3CWZ B;  4DR4 T;  4AKI A;  2YEV C;  2JQQ A;  4IE6 A;  3GN5 B;  4N78 D;  4DBR A;  1N33 T;  2LRK A;  4WYV A;  3RPU A;  4QXH B;  3KV5 A;  3ZYK A;  1WCR A;  3HKB E;  1BR1 A;  5H6Q B;  5FXV A;  2LHR A;  2V7K A;  3P50 A;  2EHO A;  2LM9 A;  2WZI A;  5H6R B;  3KFW X;  3NBX X;  3Q9D A;  3X1D A;  5C3J A;  2VKJ A;  3PJA J;  2VL0 A;  5L4H A;  2H88 A;  4DND A;  3PU8 A;  2W67 A;  5LHI B;  4X20 E;  3UTK A;  2G0U A;  2V7I A;  2E9X D;  1JNR A;  3L09 A;  4I50 E;  3NRX A;  5AQO B;  5L2L A;  2CLY B;  5L3F B;  3TLV A;  1XMQ T;  1BR2 A;  3B57 A;  3NZQ A;  4TX5 A;  4WBO A;  5HXR A;  3T8O A;  4DBQ A;  3ZMS B;  5JRE A;  3T1Y T;  5HEU A;  1S35 A;  2JQK A;  2ZM2 A;  3AA1 B;  3C4X A;  5JTG A;  5LHH B;  1UX5 A;  3LJC A;  3Q5E A;  2XQY A;  4IE5 A;  2MOZ A;  4HWC A;  2YK0 A;  3OJA A;  4LMK A;  4ILA A;  1BR0 A;  4OK0 A;  4X1I E;  3UFE A;  3V5S A;  2XM2 A;  5F3J A;  2J47 A;  2V1D B;  1HFA A;  3A5X A;  2W0G A;  2I6H A;  3GN5 A;  3HR0 A;  3KV6 A;  3QC9 A;  3QNU A;  4PAG A;  2CXL A;  2UXN B;  3D0T A;  1SUM B;  2OA5 A;  4TNW A;  1WYB A;  3PUZ F;  4DV6 T;  2E9X C;  4FI5 A;  1WLX A;  4PJM A;  4CI1 B;  3A7M A;  4P09 A;  4DV7 T;  3CX7 B;  1U5P A;  4QXB B;  3SOL A;  4HFH A;  2HPJ A;  4BJN A;  3H37 A;  5ABF B;  3HKD E;  4OHF A;  4JLE A;  3ZT6 A;  3IHR A;  4L5G A;  2DCF A;  2BVM A;  2C5J A;  2JRK A;  3H3A A;  3UUM A;  3K8P C;  2M6I A;  5FNV E;  5KX5 E;  3P4P A;  1IBL T;  2D9D A;  4UF0 B;  2MYS A;  3FZF B;  4Q25 A;  4ANJ A;  4O8S A;  5HWY A;  4E7Z A;  1IBK T;  2DHR A;  2X66 A;  1T8B A;  2W63 A;  1MMA A;  2B1E A;  4BAY B;  3QB5 K;  2IW5 B;  3TLT A;  3NRY A;  4IE0 A;  3OKQ A;  4QKN A;  1WR6 A;  4PJN A;  2QVA A;  4LFA T;  1XNQ T;  3PTR B;  4YFS A;  3RLF F;  2VB6 A;  3K3O A;  5AQR B;  1L0V A;  4A97 A;  4JI4 T;  1ZV4 X;  3C4W A;  2H7O A;  2V8S V;  3N2K E;  2XAH B;  3JAD A;  3KDS E;  2BBJ A;  2IIU A;  2IML A;  2ZLY A;  4HFE A;  2NTY A;  3OYX A;  1G8X A;  2K5B B;  4MBQ A;  5JDN A;  4UIG A;  2HPL A;  4UVA B;  4HN9 A;  1NEK A;  4CN1 A;  1ZHC A;  4DR6 T;  1KNP A;  2WB5 A;  5LB7 B;  3RYC E;  1KNR A;  3LK3 B;  3ZC0 A;  2BKP A;  4O2A E;  1D0Y A;  2VVS A;  3JCF A;  3LBX B;  3AE7 A;  5ABF A;  2K3W A;  1M7K A;  2MPK A;  2PFV A;  3O1J A;  2MAW A;  3ABV A;  5ETW A;  2BDE A;  2XQ9 A;  2SPC A;  4HFD A;  2CHN A;  5LGU B;  4ZHQ E;  3OTO T;  5L3D B;  3RHW A;  2WU2 A;  3PDY A;  2LKG A;  3AAA B;  4O4J E;  4JV5 T;  2BVL A;  5J2U E;  3AA6 B;  4QX7 B;  3AVS A;  1W09 A;  2XY8 B;  4YSX A;  2JQ9 A;  4K0U A;  2L3L A;  4G63 A;  3CQG B;  2Y6X A;  3BQL A;  2VL8 A;  2XAF B;  3F2E A;  3M65 A;  4PK5 A;  3K3Q C;  4YHJ A;  3AE6 A;  5JVD E;  2D0U A;  3NWI A;  3LFM A;  4QWN B;  2NW9 A;  4HFB A;  4DV0 T;  2HH7 A;  2AE9 A;  3N9M A;  1IJ5 A;  3AEA A;  2WM9 A;  3P8C D;  2WSS V;  5JDG A;  4L0R A;  4PFP A;  3J7Y q;  4DR7 T;  4ZEY A;  2WWV A;  3ZCI A;  3VHL A;  5LG3 A;  2KWH A;  2L9Q A;  4KI0 F;  4LML A;  4QH4 A;  5GON E;  1YKE B;  2WDR A;  3DJB A;  2D2S A;  4JBW F;  4UV8 B;  4DV4 T;  1FMV A;  2WQY A;  4ZI3 C;  1MMN A;  3KBT A;  5AQP B;  1HG5 A;  4I0U A;  5AQU B;  3LSV A;  3UUX B;  3NKZ A;  2KND A;  2LSY A;  3ONX A;  5DAB A;  3ZEF B;  4ZZC A;  4UVC B;  3ONJ A;  1KK7 A;  2IC6 A;  2WP9 A;  3DP7 A;  3FZH B;  3KV9 A;  4YHH T;  1KNZ A;  2WU5 A;  5FL0 A;  3VU7 H;  3O9X A;  2R6G F;  2WMO A;  3UQ4 A;  4LF8 T;  3C4Z A;  1UCU A;  3EDV A;  4TV9 E;  5HCM A;  2CEA A;  2V6Y A;  2LE8 A;  4HE8 A;  3ZN0 B;  4DR2 T;  1MMG A;  3N2G E;  5LBM A;  1HX1 B;  1D0Z A;  5LOV E;  3ZLI A;  5JH7 E;  2X67 A;  1D1B A;  2LSI A;  5JR9 C;  3MXZ A;  2CPT A;  1QSD A;  4IDO A;  1G73 A;  2ODV A;  2ZMA A;  4UVB B;  4C90 A;  2CBJ A;  4A5X A;  5JR9 B;  2L8K A;  1SHZ C;  4EXT A;  2X9H A;  4IE4 A;  2VK9 A;  3VRB A;  1HTJ F;  4HGA A;  3ZSS A;  4BJM A;  4OFZ A;  1JNZ A;  4AKG A;  3FXE B;  4HFC A;  3GA8 A;  3AAI A;  4KMC A;  3SWH A;  4HEA A;  5DJQ C;  4LFB T;  5FL1 A;  2NOX A;  4WZX A;  2OLT A;  4PW8 A;  2ZM0 A;  4BA9 A;  4UEM A;  1YQ4 A;  2UU9 T;  3N2O A;  1Y01 A;  3JAF A;  1XWM A;  3NZP A;  4A98 A;  1YW0 A;  1OED A;  2E9X A;  4KHP T;  4NPP A;  3ESL A;  2CWY A;  3EVY A;  2CHO A;  4U72 A;  2KWI B;  2XZE A;  2V7L A;  3AE2 A;  1KFY A;  4NXN T;  2QGS A;  2NP9 A;  3FZK B;  3LK4 2;  3N9L A;  2JJ9 A;  2BG9 C;  4KP3 C;  4O4L E;  4UF0 A;  3UU4 A;  5AQL B;  5L4E A;  2XAQ B;  2A2F X;  3CQX C;  2XQ7 A;  3I0O A;  1S94 A;  4E7S A;  4PNI A;  2Z6E A;  5AQT B;  3CQC B;  4EIW A;  3CVR A;  4DV2 T;  3MZK B;  4TZ4 C;  1AJ3 A;  2M6B A;  2QRX A;  3PUS A;  5HCJ A;  5JDM A;  2WY2 A;  2XQ3 A;  3KVB A;  1X9B A;  3L39 A;  5IWA T;  4WW0 A;  2ES0 A;  2FJD A;  5AQG B;  2H7V C;  5KMG P;  3ONL C;  2VKH A;  5JDL A;  4NXM T;  2W66 A;  1U4Q A;  2XJ7 A;  3HKC E;  3I9W A;  4IE7 A;  2ACZ A;  3H3M A;  3AEB A;  3W15 B;  3ZJ2 A;  5HEG A;  5IYZ E;  3O1H A;  2CWO A;  1MIY A;  2KXP B;  3CML A;  3KVA A;  5FXX A;  2RP4 A;  1XDO A;  3LG7 A;  2XAG B;  4QH5 A;  2FBW A;  3AE9 A;  3CX8 B;  1Y64 B;  2WWU A;  3KBU A;  2E9X B;  1D0X A;  2Q9Q C;  2Y48 B;  5BR8 T;  2IUB A;  4KBM B;  5FY7 A;  2VKD A;  1W0B A;  5EK4 A;  4TWH A;  2V5C A;  2A72 A;  1BR4 A;  5LBQ B;  5JDH A;  3FBL A;  2E8I A;  1ZP0 A;  4DR3 T;  3ZYM A;  4GK5 E;  3CKD A;  3RKO A;  1VCT A;  3UT5 E;  2WAU A;  4U7Y A;  1W9R A;  4IST A;  3EI0 A;  4B3R T;  3E22 E;  4C91 A;  3UQ7 A;  4XBF B;  2VQF T;  2Q9Q A;  5HXE A;  4EYU A;  3IEE A;  5LJN A;  4B3M T;  3AVR A;  4H9S E;  5AQS B;  1J5E T;  4PFO A;  3VR8 A;  2VAS A;  3RIA A;  3EUH A;  4IIJ E;  5JR9 A;  3KIN B;  4KHZ F;  3RRW A;  4YSZ A;  5LJM A;  3ZT7 A;  4DID B;  4H63 H;  3TLS A;  3IA3 A;  5HEH A;  4DUZ T;  3Q2M A;  4IL9 A;  4JYA T;  2X9Y A;  1UX4 A;  3PU3 A;  4HFV A;  4CQI A;  2DL1 A;  3TLW A;  2LEH A;  4JI7 T;  3RC3 A;  3AXJ B;  2BS2 A;  2LJL A;  2YU1 A;  3UFG A;  4DV1 T;  3FB2 A;  2YU2 A;  3RRC A;  5LP6 E;  1MNE A;  3SFE A;  3JAE A;  4DMV A;  2DWG A;  2YIN A;  4ZXL A;  1J1J A;  1HCI A;  5FVK A;  1HR0 T;  2D5U A;  4ZI2 D;  1QLB A;  4XZC A;  2UUA T;  4LF9 T;  1KEY A;  3ZPO A;  2W61 A;  2C5I T;  2K9A A;  2E5V A;  3C98 B;  4H63 V;  2CBI A;  1D1C A;  2BG9 B;  2LLY A;  3BQK A;  3Q5W A;  3AAE B;  3HI2 A;  4QHO A;  5AQH B;  3N9O A;  3UU3 A;  5F5W A;  3ZMT B;  4ADZ A;  4JI1 T;  2V26 A;  2LOP A;  1ZEE A;  2X9X A;  2LOS A;  4UEL A;  2YDQ A;  3LK2 B;  1GQE A;  2YDS A;  3SRZ A;  3AEC A;  5L3E B;  5IUX A;  1OED E;  2V6Y B;  4EOZ B;  4MHC A;  2XSA A;  3UU8 A;  3RC8 A;  1HS7 A;  2FJA A;  1UGO A;  2LRL A;  1M62 A;  3MAC A;  2BS4 A;  5LA6 E;  3V5U A;  4YTP A;  3Q5X A;  3R84 B;  4HWI B;  1XMO T;  3AE8 A;  4H9P C;  5KXJ A;  2YN6 A;  5L47 A;  2OV9 A;  2W4X A;  2WDV A;  2WMN A;  3E0Z A;  1H7C A;  2JPF A;  1HNX T;  3N9Q A;  4I43 B;  4YJ3 E;  2KZ7 B;  5LHG B;  2J62 A;  2JIW A;  3ZN1 B;  2CMR A;  3AE1 A;  4HFI A;  5ADX L;  2A3D A;  1SE7 A;  4J2C A;  1T7S A;  4QH1 A;  5AQF B;  3RIF A;  4H9O C;  2K24 A;  2WCA A;  1YQ3 A;  2DWK A;  5EK3 A;  3VRA A;  3ZC1 A;  4AQG A;  1OED B;  3MA9 A;  3AEF A;  4Z90 A;  2Y8D A;  1FIO A;  2CXF A;  5FYM A;  3KV4 A;  1NEN A;  3L3P A;  3B5M A;  3TLU A;  3G06 A;  4I55 E;  1O3X A;  5AQM B;  2YOE A;  2XQ5 A;  2BS3 A;  4AQF C;  3GMI A;  3ANW A;  4YTM A;  4CXW A;  2BG9 E;  1V9D A;  3RX6 A;  5BMV E;  4AQY T;  2XSB A;  4IT4 A;  1XDP A;  2EHO D;  4Z91 A;  5HEJ A;  3AE3 A;  2DI4 A;  3K3N A; 
#chains in the Genus database with same CATH homology
 1WFD A;  1WR0 A;  5FVK A;  2CPT A;  4CN1 A;  2V6X A;  4U2Z A;  4ZEY A;  2WWV A;  4A5X A;  4CN4 A;  5LB7 B;  3ZT5 A;  3EAB A;  4U7Y A;  3ZST A;  3ZT6 A;  3ZSS A;  2K3W A;  2MPK A;  2W2U A;  2WY2 A;  5CGM A;  2JQH A;  2CRB A;  2JQK A;  4WZX A;  3K1S A;  4U7I A;  4U33 A;  2V6Y B;  4CN6 A;  2A9U A;  5FVL A;  3ZT7 A;  4U31 A;  4NIQ A;  2LRL A;  2LRK A;  4U2Y A;  5CJ5 A;  1YXR A;  1WCR A;  2DL1 A;  2JQ9 A;  2V6Y A;  4U3C A;  2XZE A;  4IT4 A;  4P1N A;  2RPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...