2WY2A

Nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
total genus 41
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2wy2A00
4NIQA 4U7YA 3ZT7A 4CN4A 3ZT5A 4ZEYA 2JQKA 3EABA 4U2YA 2LRLA 3K1SA 4WZXA 1YXRA 2W2UA 1WR0A 4IT4A 2XZEA 2JQ9A 1WFDA 3ZT6A 1WCRA 2WY2A 2LRKA 4U31A 2V6XA 4U7IA 2K3WA 4P1NA 4CN6A 5FVKA 2V6YA 2A9UA 2MPKA 2CRBA 2DL1A 5FVLA 5LB7B 4U3CA 2JQHA 4CN1A 2CPTA 5CGMA 2WWVA 2RPAA 4A5XA 5CJ5A 2V6YB 3ZSTA 3ZSSA 4U33A 4U2ZA
chains in the Genus database with same CATH superfamily
3AE8A 1G73A 2D9DA 4OX9T 3CVRA 4HFBA 3ZT6A 5J2UE 3KINB 1BR2A 2UUBT 2V7JA 4DV6T 2OLTA 3C64A 4MLKA 4UXNB 4PFOA 4ZS3A 2WM9A 4UIGA 5JDNA 3ZT5A 3AE9A 4U2YA 4UVCB 4DMWA 4EGWA 2EHOD 3AEFA 4LMKA 2HPLA 4PAGA 4DUZT 3RIUA 1KNRA 3AE4A 1IBKT 2YKSA 1MIYA 4QH1A 2LHRA 5HWXA 4H9NC 3C51A 2K9AA 3ZJ1A 5JRCB 2DCFA 3RI5A 3FZHB 5ABHA 5FY1A 2V7MA 2V7LA 4YJ3E 1IJ5A 4X64T 3N2OA 2CPTA 5FXXA 5KDMC 4Q25A 3RC8A 2XAJB 2YDSA 2LKGA 3MJXA 3H3AA 3LK3B 3AE7A 4KMCA 2LOPA 4K0UA 2DNXA 1XDOA 2C5KT 3HL6A 2X0LB 4IDPA 4TWHA 5EK2A 3FHNA 4EB6E 2VL8A 1KNZA 5JDGA 2XQ4A 2ACZA 3LK2B 3L8RA 5JR9C 3O9XA 3AAIA 3GMIA 1VCTA 4IE7A 2PTFA 5FYMA 2YK0A 3UU3A 2V5CA 2WZHA 4HFDA 4TV9E 2KMFA 2ODVA 3I9YA 3HKBE 4C91A 5LGUB 4BAYB 5AQFB 4AQFC 2JMKA 4GKKT 1J5ET 1IBLT 5FKYA 4UVBB 3CKDA 5HXSA 5F5WA 5FXZA 3SOLA 2VQFT 3F2EA 4LFCT 3ZMTB 5CJ5A 4PFPA 4AKIA 3MACA 4TWFA 4QXHB 4TWDA 2Q9QC 3ESLA 4TV8E 1HNWT 2X9YA 3B5MA 5HCJA 4U31A 4QXCB 3ONJA 2XM1A 2BG9A 1YW0A 3M65A 3VKHA 3RYFE 5F3JA 5J0ZA 4AQYT 4AKGA 3L39A 2YEVC 2NR4A 4H9RC 3OTOT 1HS7A 5FNVE 4DV3T 4HTEA 5KMGP 1T72A 3CWZB 1KNPA 4HFVA 2FJAA 3RYIE 2XHEB 3MK7C 3P4PA 3CX8B 3QB5A 3JADA 5JDHA 5C2TA 5LG3A 5BR8T 4LF5T 1UK5A 5JR9B 2BG9E 2XJ7A 1MMAA 2VB6A 4TX5A 3GN5B 4Z90A 1HX1B 1WRDA 2MTQA 5ETWA 4XZCA 3HA4A 3N2KE 1BR1A 3OKQA 3RYHE 1UCUA 5DJQC 4DR7T 4JI7T 4WZXA 1IJ6A 1MMDA 5IWAT 1R8IA 3AE3A 1E7PA 4DNDA 2WU5A 4HEAA 1M62A 2IDOB 3P8CD 2M6BA 4MFRA 3K8PC 1VCSA 3JAEA 4H63V 5CA0E 3AE2A 2I59A 3UFEA 2N1GA 5JTGA 2K3WA 2Q9QB 3UUXB 4JI5T 3PUSA 4WNKA 3AEAA 2D2SA 2KSRA 2IUBA 3E08A 2BKOA 4LF4T 5AQQB 1CUNA 4ANJA 3JAFA 2LLYA 2LKHA 4UELA 3WAJA 3AEGA 4A5XA 2WU2A 3BQLA 4U2ZA 4UV8B 4BJMA 4L5GA 4HFIA 2KT9A 1YXRA 2B1EA 2W67A 3W15B 3EUHA 4K0KT 3RGLA 1FEWA 3BQKA 4H9PC 3UQ4A 3P4WA 1W0AA 2QYWA 2XQAA 5FL1A 2LE8A 3ZYMA 3DP7A 3TLTA 2LSGA 4F6RC 3KVAA 2IMLA 3EVYA 2L3LA 4EIWA 2XAFB 1X9BA 2NWBA 2V26A 2LT3A 5M4YA 2ZM6T 3C98B 5L3FB 2XSBA 4CXYA 3KFWX 3G06A 1M7KA 4EV6A 2X68A 3C50A 5LA6E 1KF6A 4ILBA 4JI2T 3Q5DA 4Z8XA 4NXNT 1YKEB 3NBXX 2IW5B 4L9IA 3OBVE 2NP9A 5HXHA 2X9WA 2W61A 2XAQB 5ADXL 2VQET 1FMVA 3EABA 3AE6A 2HHHT 4ASKA 4I4TE 5FVLA 5LB7B 3BK9A 1XDPA 4HWDA 3FZMB 2HN1A 3Q5WA 2EHOA 4AXPA 1N36T 1LVKA 3TLWA 4IIJE 1US7B 5ABFA 4MBQA 2X9HA 4ZHQE 5AQPB 5FL0A 4A98A 3AVSA 2KXPB 2MBGA 2BKPA 4A56A 5FMNA 2I6HA 4YHHT 4DV1T 4XBFB 2XPKA 4HE8A 4IDOA 3FXDB 3OVUA 2LSJA 5IHYA 4YLHA 3PV0F 2NW8A 3E0ZA 1EZ3A 4DR4T 4JI8T 3BQIA 2CHNA 2E8IA 4NUVA 1XNQT 2WSSV 4O4IE 4LFAT 2G0UA 1OEDC 3O1HA 2MAWA 2YINA 4DBQA 1Z8UA 4OHFA 4HGAA 2BBHA 5DQWA 4PJNA 3ZCIA 4P0BA 3RKGA 3PJAJ 2WB5A 1D0ZA 2VL0A 3SFDA 3PUYF 5LMUT 2XQ3A 2XQ5A 5AQGB 1Z0PA 2X67A 4DR5T 3QK6A 3DTOA 4DV7T 4P1NA 3RIAA 2Y48B 1HG5A 4YT0A 3UU8A 4F8HA 3O1JA 2WS3A 2Y8DA 4ZI3C 2KWIB 3ZMSB 4C90A 2J1DG 1WLXA 4JEHB 2JJ9A 3SWHA 2UXDT 3AA7B 3UU5A 1MMNA 3FB2A 5L3BB 5LGNB 4JV5T 2Q9QD 1D1AA 2NW7A 5C8YE 3AXJB 3AA0B 4QX8B 2BS3A 1HX8A 2JQQA 2XY8B 4DR2T 5CFBA 4CI2B 4KUMB 4ERRA 4CZZB 4HFHA 2PBIA 3NZQA 3LBXA 2V6YA 1VRBA 5FXVA 3RYCE 1MMGA 2UXXB 3UU4A 4P09A 2W00A 2YN6A 2QGSA 5JH7E 3ZCJA 4X66T 3VU7H 4L0RA 2DLRA 4UV9B 4ZS2A 1YKHB 2V6XA 3QNUA 2LM9A 2VURA 3K3QC 1V9DA 4TUYE 2NOXA 3AE1A 3PUVF 2WDVA 2LSIA 5AFUL 4YTMA 1HFAA 3OYXA 3WI3A 1ZKEA 5EK4A 1HTJF 2BS2A 4GKJT 2D5UA 4YXDA 1OEDB 2HN2A 3KVBA 3S4UA 3Q9DA 2KNDA 2IHR1 5LCYA 1OXZA 3L3PA 3PE0A 3PU3A 2RA1A 3N9MA 3R84B 2W63A 1W9RA 4LF6T 2LM2A 3VR9A 3F31A 4IT4A 4KHZF 3AE5A 4I0UA 4IREA 4IDZA 5FXWA 2W62A 3CQXC 1NWMX 3AA1B 3NWIA 5AQHB 3NVOA 3RQUA 1JNRA 4EXTA 4JI0T 3CQGB 3D0TA 5HEHA 4PNIA 2YOEA 4NPPA 1QLBA 1D0XA 1SUMB 4E7SA 1J1JA 2ZMAA 2C5JA 2KZ7B 3FBZA 2UXNB 1SE7A 4AKRB 4CI3B 5LJMA 4JYAT 2ACXA 3RC3A 2LRLA 2D0UA 3O1IA 4JI3T 2E5VA 5LHGB 2LHNA 3N9QA 4B6XA 3TLUA 3PUQA 3ZMUB 5JRCA 4DV2T 2WQYA 5ABEA 3C4ZA 3NZPA 3HKEE 3OPCA 2PJQA 5L4EA 3F57A 3UQ7A 3C4WA 5HEUA 4I55E 4A97A 4AKHA 5LNKA 2FJDA 1HCIA 2OV9A 2LSKA 4PK5A 1W09A 2MOZA 4NXMT 2LEHA 4YSZA 1U4QA 4UVAB 3LSVA 4QH4A 3WAKA 4O2AE 3A5XA 4KBMB 2IC9A 3I9WA 4KP3C 2W66A 2E9XC 4YTNA 2FBWA 5JDQA 3PUGA 3ETVA 3RF1A 1HNZT 1MIVA 2VWAA 3AB3B 3QOFA 4ZEYA 2XQ7A 2JPFA 3LFMA 2CHOA 5FY7A 3FZKB 2WBLA 3ZKRA 3SFEA 3E22E 4O4HE 4YJ2E 3A7MA 3UT5E 2CWOA 4X62T 4CXWA 3T1YT 2H7OA 3HI2A 3JC6C 2JQ9A 2WY2A 2LOSA 3ZMZB 3B57A 2ZM8A 1MNDA 3Q2MA 3MZKB 4YSXA 4O8SA 4UEMA 4ZZBA 3PTRB 2ZLYA 4O4JE 4UF0B 4ZOLE 2YU2A 5L3GB 3ONLC 2Z6EA 1D1BA 1WCRA 2N2NA 3EI0A 4HWFA 3PU8A 4EZHA 5AQMB 1Y64B 3J7Yq 5JDLA 1YQ3A 5LMNT 3OYZA 5LXTE 2ODUA 4I43B 2H89A 2B76A 1T7SA 2YDQA 4ISSA 3ZYKA 3H3MA 2RPAA 3AA6B 3AAEB 4E7ZA 4JBWF 4ZI2C 1XMQT 1AJ3A 1LRZA 4X1IE 5AQJB 4DUYT 5JREA 1L0VA 4DR1T 2CLYC 5LGTB 3RIUC 3FZFB 3ANWB 4P0AA 3Q5EA 4X5TA 2E9XB 2XSAA 5JR9A 2CMRA 4AIUA 3O4XE 4HFCA 4B3MT 2CXDA 3GN5A 4ADZA 1S35A 3LK42 2N9DA 4N78D 4HWCA 2CRBA 2SPCA 4QWNB 3N2GE 2UXCT 4HFEA 4H9OC 3ONXA 2HH7A 4EYYR 2OA5A 4AQFA 4DBRA 3LDQB 2A2FX 2UUAT 4EEBA 5H6QB 4ZI3D 3OJAA 5JDFA 2NTXA 3AAAB 2P9BA 3ZC1A 5CB4E 2R6GF 2VVSA 2VK9A 3UUBA 2Q9QA 3ZYLA 2W2UA 5F8PA 2XQ6A 1XNRT 4IE4A 5AQTB 3VR8A 1N34T 5LBMA 2UUCT 3V5SA 3IHRA 3CMLA 2CA5A 4MHCA 1ZEEA 3RHWA 2IC6A 5HXEA 2BKNA 1QUUA 4YFSA 2BDEA 4OFZA 4ZXLA 5AQNB 2VKJA 2YU1A 3KV4A 2PFVA 2XASB 4QHOA 2XM2A 3MA9A 4JI4T 1KK7A 2QA7A 3KV5A 3P7IA 2W0GA 2JIWA 3I0QA 1WFDA 2M6IA 5FVKA 2CLYB 3KBTA 3U78A 2BG9C 5HEOA 5AQRB 5AQSB 3ZPOA 2V5DA 1I94T 3K3NA 3P4SA 1O3XA 2V1DB 1U5PA 4BJNA 4WBOA 3HKCE 5J1GA 3JCFA 5LBQB 4H9QC 3K3OA 3NKZA 1JNZA 4TZ4C 3CQCB 4DV4T 3CK6A 4PJJA 5EZYE 4EAHA 3PUAA 2JMHA 2V7KA 1GQEA 4CN6A 1XZYA 3Q5XA 4IL9A 3P50A 4LF9T 5CGMA 4ILAA 2DWKA 1CHUA 3P4QA 2H3RA 1T8BA 4X1KE 4H9SE 2H88A 2X9XA 3ZMVB 4X20E 3B13A 3T8OA 4JI1T 2ES0A 2W4XA 2KWHA 3GA8A 4HKAA 4JUYA 5LOVE 4DV5T 5AQIB 3M3ZB 2XUEA 4CI1B 1E2AA 3V5UA 1WYCA 2VKDA 3LJCA 1FJGT 2VASA 4CN1A 4ZI7E 4MALA 4J2CA 3ZJ2A 3IA3A 2LSYA 4AQGA 2DI4A 2FUPA 3EHZA 2WCAA 5TAOA 3UU6A 3UUNA 5L3EB 4OYKA 4TN7B 2E2AA 2BVLA 2UU9T 1FIOA 2DWGA 2VKOA 4GYSA 2E9XD 3N5LA 2L8KA 4TNVA 3ETUA 3K1SA 2BG9B 4JI6T 4G63A 3ZN0B 1KFYA 3RLFF 3RKOA 4U3CA 3RRCA 4B3TT 2CXFA 4GOUA 3R6NA 1Y01A 4DR6T 2X0HA 2J47A 5J2TE 4WYVA 2VKHA 2XQYA 2VVNA 4IGUA 2AE9A 3J9X1 4KI0F 3I0OA 4EYUA 5LP6E 3T1HT 3RQWA 4EOZB 3JC6D 5HEJA 4ILUA 2V7IA 4CXXA 3MXZA 3CPZA 4OYJA 3AVRA 1B7TA 4DIDB 3AXJA 3RH3A 2JRKA 2E5LT 1SA0E 4DVDA 2QVAA 1VOMA 1BR4A 3MKDA 2CCQA 3SRZA 5IUXA 1D1CA 2C0SA 3I1AA 4OK0A 4PK4A 3P4RA 2CEAA 3IF8B 3TKLB 3KDSE 4LFBT 5L2LA 2WDQA 4DR3T 4LF7T 2H7VC 3LG7A 3NRXA 3QUJA 5AQKB 2CBIA 5L4HA 4PJMA 3VHLA 4B3RT 3DJBA 4ZI2D 5JQGE 4U72A 3N9NA 3AEBA 4GK0E 5ABGA 3ZN1B 3RPUA 1NENA 2EHOC 5JDMA 4IE0A 1NAFA 1BR0A 5HWYA 1MIWA 4IE5A 1OEDA 2BS4A 1XMOT 3ABVA 4DV0T 1LVFA 3PUWF 4HN9A 1SHZC 5HCMA 4HWHA 3L09A 2BVMA 2X51A 5AQUB 3H37A 2DL1A 2V8SV 4QKNA 3HR0A 3VKGA 3QB5K 2WZIA 3PJAA 5DQVA 4M1PA 3ZSSA 1DU2A 5LHIB 2AXDS 5E0OA 5CA1E 3PUZF 3NRYA 3TLVA 5DABA 3ZC0A 1UURA 1HF8A 2XAGB 5H6RB 2GK9A 4GYRA 4Z91A 5EK3A 1YD8G 1IZNB 2MYSA 4YY3T 1WR0A 2HPJA 1E1HB 5L3DB 3C4XA 1OEDE 2A3DA 4HWIB 3RIFA 2X66A 4AISA 4U74A 3RRWA 4U7YA 2XQ9A 2CE7A 3AEDA 2CM0A 2QRXA 5LJNA 2K5BB 3CX6B 4YSYA 2LRKA 4GK5E 4U7IA 3UUMA 1IBMT 1XWMA 3PURA 2CXLA 4YTPA 2BBJA 4JEUB 1UGOA 2K48A 4CN4A 4IDNA 4EEDA 4WBNE 2WWUA 4G2AA 1T98A 3KV6A 4QH5A 3CX7B 4X65T 2PG8A 3IBPA 3RX6A 1X79A 4H63H 2BZBA 3ZLIA 5IYZE 3A8YC 2EHOB 3FBLA 1S94A 4TNWA 3FXEB 4NUUA 5AQLB 3AECA 1W0BA 4PJLA 3EDVA 2A9UA 5ABFB 4IHJE 2UXBT 3N9PA 2WDRA 4COFA 4DMVA 3U3IA 4B3ST 4DO0A 4QXBB 5A1LA 3KV9A 1YQ4A 4X1YE 2WMOA 2FJBA 3UTKA 4I50E 5KX5E 3AEEA 3ZEFB 4IDQA 3ZSTA 2NW9A 2X0YA 3GWHA 5LYJE 2YDRA 3TLSA 5BMVE 4QX7B 3N9OA 2FJEA 4FI5A 1J5WA 4UF0A 4FJOA 4IL4A 2C5IT 1G8XA 4V1Av 4CQIA 2IIUA 4NIQA 3ZT7A 2CWYA 2JQKA 2D0TA 1ZV4X 5HYAA 1HG2A 1D0YA 4WW0A 2XTLA 1ZP0A 1OWAA 3PUXF 2Y6XA 4U33A 1WYBA 1IAPA 1ZHCA 2LJLA 4IE6A 5GONE 1KEYA 2K24A 2XZEA 3KBUA 5JVDE 4AI6A 4ISTA 4YHJA 1UX4A 5L47A 4O4LE 5AQVB 1UX5A 1HR0T 5HEGA 2L9QA 2JQHA 2KLQA 3EDUA 4ILCA 4LMLA 4PK6A 4O2BE 2J4GA 3ANWA 1QSDA 2WP9A 2F4VT 4UR9A 5AQOB 4AKLA 2E9XA 4GIWA 3UULA 3QC9A 1WR6A 1ZOYA 4PW8A 4XAXB 2I0MA 2WAUA 3LBXB 5KXJA 2V6YB 3FZLB 5L3CB 4KX6A 2XQ8A 3HKDE 4KHPT 2NTYA 2M67A 3EAMA 5FY0A 3VRBA 4LMJA 2DHRA 3X1DA 5FP3A 1N32T 2WWVA 3IEEA 2IAKA 5C3JA 2ZM0A 1N33T 4BA9A 4EZ4A 1H7CA 3PDYA 1I6ZA 2A72A 2ZM2A 3SS1A 2RP4A 4ZZCA 3CIRA 2MPKA 2CBJA 1NEKA 2XAHB 5HXCA 5HAXA 5HXRA 2WMNA 3VRAA 3UFGA 5LG4A 1UUSA 3N9LA 1HNXT 1MNEA 1FMWA 2J62A 2KINB 4LF8T 4JLEA 1LKXA 5LHHB
chains in the Genus database with same CATH topology
4NIQA 4U7YA 3ZT7A 4CN4A 3ZT5A 4ZEYA 2JQKA 3EABA 4U2YA 2LRLA 3K1SA 4WZXA 1YXRA 2W2UA 1WR0A 4IT4A 2XZEA 2JQ9A 1WFDA 3ZT6A 1WCRA 2WY2A 2LRKA 4U31A 2V6XA 4U7IA 2K3WA 4P1NA 4CN6A 5FVKA 2V6YA 2A9UA 2MPKA 2CRBA 2DL1A 5FVLA 5LB7B 4U3CA 2JQHA 4CN1A 2CPTA 5CGMA 2WWVA 2RPAA 4A5XA 5CJ5A 2V6YB 3ZSTA 3ZSSA 4U33A 4U2ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NIQ A;  4U7Y A;  3ZT7 A;  4CN4 A;  3ZT5 A;  4ZEY A;  2JQK A;  3EAB A;  4U2Y A;  2LRL A;  3K1S A;  4WZX A;  1YXR A;  2W2U A;  1WR0 A;  4IT4 A;  2XZE A;  2JQ9 A;  1WFD A;  3ZT6 A;  1WCR A;  2WY2 A;  2LRK A;  4U31 A;  2V6X A;  4U7I A;  2K3W A;  4P1N A;  4CN6 A;  5FVK A;  2V6Y A;  2A9U A;  2MPK A;  2CRB A;  2DL1 A;  5FVL A;  5LB7 B;  4U3C A;  2JQH A;  4CN1 A;  2CPT A;  5CGM A;  2WWV A;  2RPA A;  4A5X A;  5CJ5 A;  2V6Y B;  3ZST A;  3ZSS A;  4U33 A;  4U2Z A; 
#chains in the Genus database with same CATH topology
 3AE8 A;  1G73 A;  2D9D A;  4OX9 T;  3CVR A;  4HFB A;  3ZT6 A;  5J2U E;  3KIN B;  1BR2 A;  2UUB T;  2V7J A;  4DV6 T;  2OLT A;  3C64 A;  4MLK A;  4UXN B;  4PFO A;  4ZS3 A;  2WM9 A;  4UIG A;  5JDN A;  3ZT5 A;  3AE9 A;  4U2Y A;  4UVC B;  4DMW A;  4EGW A;  2EHO D;  3AEF A;  4LMK A;  2HPL A;  4PAG A;  4DUZ T;  3RIU A;  1KNR A;  3AE4 A;  1IBK T;  2YKS A;  1MIY A;  4QH1 A;  2LHR A;  5HWX A;  4H9N C;  3C51 A;  2K9A A;  3ZJ1 A;  5JRC B;  2DCF A;  3RI5 A;  3FZH B;  5ABH A;  5FY1 A;  2V7M A;  2V7L A;  4YJ3 E;  1IJ5 A;  4X64 T;  3N2O A;  2CPT A;  5FXX A;  5KDM C;  4Q25 A;  3RC8 A;  2XAJ B;  2YDS A;  2LKG A;  3MJX A;  3H3A A;  3LK3 B;  3AE7 A;  4KMC A;  2LOP A;  4K0U A;  2DNX A;  1XDO A;  2C5K T;  3HL6 A;  2X0L B;  4IDP A;  4TWH A;  5EK2 A;  3FHN A;  4EB6 E;  2VL8 A;  1KNZ A;  5JDG A;  2XQ4 A;  2ACZ A;  3LK2 B;  3L8R A;  5JR9 C;  3O9X A;  3AAI A;  3GMI A;  1VCT A;  4IE7 A;  2PTF A;  5FYM A;  2YK0 A;  3UU3 A;  2V5C A;  2WZH A;  4HFD A;  4TV9 E;  2KMF A;  2ODV A;  3I9Y A;  3HKB E;  4C91 A;  5LGU B;  4BAY B;  5AQF B;  4AQF C;  2JMK A;  4GKK T;  1J5E T;  1IBL T;  5FKY A;  4UVB B;  3CKD A;  5HXS A;  5F5W A;  5FXZ A;  3SOL A;  2VQF T;  3F2E A;  4LFC T;  3ZMT B;  5CJ5 A;  4PFP A;  4AKI A;  3MAC A;  4TWF A;  4QXH B;  4TWD A;  2Q9Q C;  3ESL A;  4TV8 E;  1HNW T;  2X9Y A;  3B5M A;  5HCJ A;  4U31 A;  4QXC B;  3ONJ A;  2XM1 A;  2BG9 A;  1YW0 A;  3M65 A;  3VKH A;  3RYF E;  5F3J A;  5J0Z A;  4AQY T;  4AKG A;  3L39 A;  2YEV C;  2NR4 A;  4H9R C;  3OTO T;  1HS7 A;  5FNV E;  4DV3 T;  4HTE A;  5KMG P;  1T72 A;  3CWZ B;  1KNP A;  4HFV A;  2FJA A;  3RYI E;  2XHE B;  3MK7 C;  3P4P A;  3CX8 B;  3QB5 A;  3JAD A;  5JDH A;  5C2T A;  5LG3 A;  5BR8 T;  4LF5 T;  1UK5 A;  5JR9 B;  2BG9 E;  2XJ7 A;  1MMA A;  2VB6 A;  4TX5 A;  3GN5 B;  4Z90 A;  1HX1 B;  1WRD A;  2MTQ A;  5ETW A;  4XZC A;  3HA4 A;  3N2K E;  1BR1 A;  3OKQ A;  3RYH E;  1UCU A;  5DJQ C;  4DR7 T;  4JI7 T;  4WZX A;  1IJ6 A;  1MMD A;  5IWA T;  1R8I A;  3AE3 A;  1E7P A;  4DND A;  2WU5 A;  4HEA A;  1M62 A;  2IDO B;  3P8C D;  2M6B A;  4MFR A;  3K8P C;  1VCS A;  3JAE A;  4H63 V;  5CA0 E;  3AE2 A;  2I59 A;  3UFE A;  2N1G A;  5JTG A;  2K3W A;  2Q9Q B;  3UUX B;  4JI5 T;  3PUS A;  4WNK A;  3AEA A;  2D2S A;  2KSR A;  2IUB A;  3E08 A;  2BKO A;  4LF4 T;  5AQQ B;  1CUN A;  4ANJ A;  3JAF A;  2LLY A;  2LKH A;  4UEL A;  3WAJ A;  3AEG A;  4A5X A;  2WU2 A;  3BQL A;  4U2Z A;  4UV8 B;  4BJM A;  4L5G A;  4HFI A;  2KT9 A;  1YXR A;  2B1E A;  2W67 A;  3W15 B;  3EUH A;  4K0K T;  3RGL A;  1FEW A;  3BQK A;  4H9P C;  3UQ4 A;  3P4W A;  1W0A A;  2QYW A;  2XQA A;  5FL1 A;  2LE8 A;  3ZYM A;  3DP7 A;  3TLT A;  2LSG A;  4F6R C;  3KVA A;  2IML A;  3EVY A;  2L3L A;  4EIW A;  2XAF B;  1X9B A;  2NWB A;  2V26 A;  2LT3 A;  5M4Y A;  2ZM6 T;  3C98 B;  5L3F B;  2XSB A;  4CXY A;  3KFW X;  3G06 A;  1M7K A;  4EV6 A;  2X68 A;  3C50 A;  5LA6 E;  1KF6 A;  4ILB A;  4JI2 T;  3Q5D A;  4Z8X A;  4NXN T;  1YKE B;  3NBX X;  2IW5 B;  4L9I A;  3OBV E;  2NP9 A;  5HXH A;  2X9W A;  2W61 A;  2XAQ B;  5ADX L;  2VQE T;  1FMV A;  3EAB A;  3AE6 A;  2HHH T;  4ASK A;  4I4T E;  5FVL A;  5LB7 B;  3BK9 A;  1XDP A;  4HWD A;  3FZM B;  2HN1 A;  3Q5W A;  2EHO A;  4AXP A;  1N36 T;  1LVK A;  3TLW A;  4IIJ E;  1US7 B;  5ABF A;  4MBQ A;  2X9H A;  4ZHQ E;  5AQP B;  5FL0 A;  4A98 A;  3AVS A;  2KXP B;  2MBG A;  2BKP A;  4A56 A;  5FMN A;  2I6H A;  4YHH T;  4DV1 T;  4XBF B;  2XPK A;  4HE8 A;  4IDO A;  3FXD B;  3OVU A;  2LSJ A;  5IHY A;  4YLH A;  3PV0 F;  2NW8 A;  3E0Z A;  1EZ3 A;  4DR4 T;  4JI8 T;  3BQI A;  2CHN A;  2E8I A;  4NUV A;  1XNQ T;  2WSS V;  4O4I E;  4LFA T;  2G0U A;  1OED C;  3O1H A;  2MAW A;  2YIN A;  4DBQ A;  1Z8U A;  4OHF A;  4HGA A;  2BBH A;  5DQW A;  4PJN A;  3ZCI A;  4P0B A;  3RKG A;  3PJA J;  2WB5 A;  1D0Z A;  2VL0 A;  3SFD A;  3PUY F;  5LMU T;  2XQ3 A;  2XQ5 A;  5AQG B;  1Z0P A;  2X67 A;  4DR5 T;  3QK6 A;  3DTO A;  4DV7 T;  4P1N A;  3RIA A;  2Y48 B;  1HG5 A;  4YT0 A;  3UU8 A;  4F8H A;  3O1J A;  2WS3 A;  2Y8D A;  4ZI3 C;  2KWI B;  3ZMS B;  4C90 A;  2J1D G;  1WLX A;  4JEH B;  2JJ9 A;  3SWH A;  2UXD T;  3AA7 B;  3UU5 A;  1MMN A;  3FB2 A;  5L3B B;  5LGN B;  4JV5 T;  2Q9Q D;  1D1A A;  2NW7 A;  5C8Y E;  3AXJ B;  3AA0 B;  4QX8 B;  2BS3 A;  1HX8 A;  2JQQ A;  2XY8 B;  4DR2 T;  5CFB A;  4CI2 B;  4KUM B;  4ERR A;  4CZZ B;  4HFH A;  2PBI A;  3NZQ A;  3LBX A;  2V6Y A;  1VRB A;  5FXV A;  3RYC E;  1MMG A;  2UXX B;  3UU4 A;  4P09 A;  2W00 A;  2YN6 A;  2QGS A;  5JH7 E;  3ZCJ A;  4X66 T;  3VU7 H;  4L0R A;  2DLR A;  4UV9 B;  4ZS2 A;  1YKH B;  2V6X A;  3QNU A;  2LM9 A;  2VUR A;  3K3Q C;  1V9D A;  4TUY E;  2NOX A;  3AE1 A;  3PUV F;  2WDV A;  2LSI A;  5AFU L;  4YTM A;  1HFA A;  3OYX A;  3WI3 A;  1ZKE A;  5EK4 A;  1HTJ F;  2BS2 A;  4GKJ T;  2D5U A;  4YXD A;  1OED B;  2HN2 A;  3KVB A;  3S4U A;  3Q9D A;  2KND A;  2IHR 1;  5LCY A;  1OXZ A;  3L3P A;  3PE0 A;  3PU3 A;  2RA1 A;  3N9M A;  3R84 B;  2W63 A;  1W9R A;  4LF6 T;  2LM2 A;  3VR9 A;  3F31 A;  4IT4 A;  4KHZ F;  3AE5 A;  4I0U A;  4IRE A;  4IDZ A;  5FXW A;  2W62 A;  3CQX C;  1NWM X;  3AA1 B;  3NWI A;  5AQH B;  3NVO A;  3RQU A;  1JNR A;  4EXT A;  4JI0 T;  3CQG B;  3D0T A;  5HEH A;  4PNI A;  2YOE A;  4NPP A;  1QLB A;  1D0X A;  1SUM B;  4E7S A;  1J1J A;  2ZMA A;  2C5J A;  2KZ7 B;  3FBZ A;  2UXN B;  1SE7 A;  4AKR B;  4CI3 B;  5LJM A;  4JYA T;  2ACX A;  3RC3 A;  2LRL A;  2D0U A;  3O1I A;  4JI3 T;  2E5V A;  5LHG B;  2LHN A;  3N9Q A;  4B6X A;  3TLU A;  3PUQ A;  3ZMU B;  5JRC A;  4DV2 T;  2WQY A;  5ABE A;  3C4Z A;  3NZP A;  3HKE E;  3OPC A;  2PJQ A;  5L4E A;  3F57 A;  3UQ7 A;  3C4W A;  5HEU A;  4I55 E;  4A97 A;  4AKH A;  5LNK A;  2FJD A;  1HCI A;  2OV9 A;  2LSK A;  4PK5 A;  1W09 A;  2MOZ A;  4NXM T;  2LEH A;  4YSZ A;  1U4Q A;  4UVA B;  3LSV A;  4QH4 A;  3WAK A;  4O2A E;  3A5X A;  4KBM B;  2IC9 A;  3I9W A;  4KP3 C;  2W66 A;  2E9X C;  4YTN A;  2FBW A;  5JDQ A;  3PUG A;  3ETV A;  3RF1 A;  1HNZ T;  1MIV A;  2VWA A;  3AB3 B;  3QOF A;  4ZEY A;  2XQ7 A;  2JPF A;  3LFM A;  2CHO A;  5FY7 A;  3FZK B;  2WBL A;  3ZKR A;  3SFE A;  3E22 E;  4O4H E;  4YJ2 E;  3A7M A;  3UT5 E;  2CWO A;  4X62 T;  4CXW A;  3T1Y T;  2H7O A;  3HI2 A;  3JC6 C;  2JQ9 A;  2WY2 A;  2LOS A;  3ZMZ B;  3B57 A;  2ZM8 A;  1MND A;  3Q2M A;  3MZK B;  4YSX A;  4O8S A;  4UEM A;  4ZZB A;  3PTR B;  2ZLY A;  4O4J E;  4UF0 B;  4ZOL E;  2YU2 A;  5L3G B;  3ONL C;  2Z6E A;  1D1B A;  1WCR A;  2N2N A;  3EI0 A;  4HWF A;  3PU8 A;  4EZH A;  5AQM B;  1Y64 B;  3J7Y q;  5JDL A;  1YQ3 A;  5LMN T;  3OYZ A;  5LXT E;  2ODU A;  4I43 B;  2H89 A;  2B76 A;  1T7S A;  2YDQ A;  4ISS A;  3ZYK A;  3H3M A;  2RPA A;  3AA6 B;  3AAE B;  4E7Z A;  4JBW F;  4ZI2 C;  1XMQ T;  1AJ3 A;  1LRZ A;  4X1I E;  5AQJ B;  4DUY T;  5JRE A;  1L0V A;  4DR1 T;  2CLY C;  5LGT B;  3RIU C;  3FZF B;  3ANW B;  4P0A A;  3Q5E A;  4X5T A;  2E9X B;  2XSA A;  5JR9 A;  2CMR A;  4AIU A;  3O4X E;  4HFC A;  4B3M T;  2CXD A;  3GN5 A;  4ADZ A;  1S35 A;  3LK4 2;  2N9D A;  4N78 D;  4HWC A;  2CRB A;  2SPC A;  4QWN B;  3N2G E;  2UXC T;  4HFE A;  4H9O C;  3ONX A;  2HH7 A;  4EYY R;  2OA5 A;  4AQF A;  4DBR A;  3LDQ B;  2A2F X;  2UUA T;  4EEB A;  5H6Q B;  4ZI3 D;  3OJA A;  5JDF A;  2NTX A;  3AAA B;  2P9B A;  3ZC1 A;  5CB4 E;  2R6G F;  2VVS A;  2VK9 A;  3UUB A;  2Q9Q A;  3ZYL A;  2W2U A;  5F8P A;  2XQ6 A;  1XNR T;  4IE4 A;  5AQT B;  3VR8 A;  1N34 T;  5LBM A;  2UUC T;  3V5S A;  3IHR A;  3CML A;  2CA5 A;  4MHC A;  1ZEE A;  3RHW A;  2IC6 A;  5HXE A;  2BKN A;  1QUU A;  4YFS A;  2BDE A;  4OFZ A;  4ZXL A;  5AQN B;  2VKJ A;  2YU1 A;  3KV4 A;  2PFV A;  2XAS B;  4QHO A;  2XM2 A;  3MA9 A;  4JI4 T;  1KK7 A;  2QA7 A;  3KV5 A;  3P7I A;  2W0G A;  2JIW A;  3I0Q A;  1WFD A;  2M6I A;  5FVK A;  2CLY B;  3KBT A;  3U78 A;  2BG9 C;  5HEO A;  5AQR B;  5AQS B;  3ZPO A;  2V5D A;  1I94 T;  3K3N A;  3P4S A;  1O3X A;  2V1D B;  1U5P A;  4BJN A;  4WBO A;  3HKC E;  5J1G A;  3JCF A;  5LBQ B;  4H9Q C;  3K3O A;  3NKZ A;  1JNZ A;  4TZ4 C;  3CQC B;  4DV4 T;  3CK6 A;  4PJJ A;  5EZY E;  4EAH A;  3PUA A;  2JMH A;  2V7K A;  1GQE A;  4CN6 A;  1XZY A;  3Q5X A;  4IL9 A;  3P50 A;  4LF9 T;  5CGM A;  4ILA A;  2DWK A;  1CHU A;  3P4Q A;  2H3R A;  1T8B A;  4X1K E;  4H9S E;  2H88 A;  2X9X A;  3ZMV B;  4X20 E;  3B13 A;  3T8O A;  4JI1 T;  2ES0 A;  2W4X A;  2KWH A;  3GA8 A;  4HKA A;  4JUY A;  5LOV E;  4DV5 T;  5AQI B;  3M3Z B;  2XUE A;  4CI1 B;  1E2A A;  3V5U A;  1WYC A;  2VKD A;  3LJC A;  1FJG T;  2VAS A;  4CN1 A;  4ZI7 E;  4MAL A;  4J2C A;  3ZJ2 A;  3IA3 A;  2LSY A;  4AQG A;  2DI4 A;  2FUP A;  3EHZ A;  2WCA A;  5TAO A;  3UU6 A;  3UUN A;  5L3E B;  4OYK A;  4TN7 B;  2E2A A;  2BVL A;  2UU9 T;  1FIO A;  2DWG A;  2VKO A;  4GYS A;  2E9X D;  3N5L A;  2L8K A;  4TNV A;  3ETU A;  3K1S A;  2BG9 B;  4JI6 T;  4G63 A;  3ZN0 B;  1KFY A;  3RLF F;  3RKO A;  4U3C A;  3RRC A;  4B3T T;  2CXF A;  4GOU A;  3R6N A;  1Y01 A;  4DR6 T;  2X0H A;  2J47 A;  5J2T E;  4WYV A;  2VKH A;  2XQY A;  2VVN A;  4IGU A;  2AE9 A;  3J9X 1;  4KI0 F;  3I0O A;  4EYU A;  5LP6 E;  3T1H T;  3RQW A;  4EOZ B;  3JC6 D;  5HEJ A;  4ILU A;  2V7I A;  4CXX A;  3MXZ A;  3CPZ A;  4OYJ A;  3AVR A;  1B7T A;  4DID B;  3AXJ A;  3RH3 A;  2JRK A;  2E5L T;  1SA0 E;  4DVD A;  2QVA A;  1VOM A;  1BR4 A;  3MKD A;  2CCQ A;  3SRZ A;  5IUX A;  1D1C A;  2C0S A;  3I1A A;  4OK0 A;  4PK4 A;  3P4R A;  2CEA A;  3IF8 B;  3TKL B;  3KDS E;  4LFB T;  5L2L A;  2WDQ A;  4DR3 T;  4LF7 T;  2H7V C;  3LG7 A;  3NRX A;  3QUJ A;  5AQK B;  2CBI A;  5L4H A;  4PJM A;  3VHL A;  4B3R T;  3DJB A;  4ZI2 D;  5JQG E;  4U72 A;  3N9N A;  3AEB A;  4GK0 E;  5ABG A;  3ZN1 B;  3RPU A;  1NEN A;  2EHO C;  5JDM A;  4IE0 A;  1NAF A;  1BR0 A;  5HWY A;  1MIW A;  4IE5 A;  1OED A;  2BS4 A;  1XMO T;  3ABV A;  4DV0 T;  1LVF A;  3PUW F;  4HN9 A;  1SHZ C;  5HCM A;  4HWH A;  3L09 A;  2BVM A;  2X51 A;  5AQU B;  3H37 A;  2DL1 A;  2V8S V;  4QKN A;  3HR0 A;  3VKG A;  3QB5 K;  2WZI A;  3PJA A;  5DQV A;  4M1P A;  3ZSS A;  1DU2 A;  5LHI B;  2AXD S;  5E0O A;  5CA1 E;  3PUZ F;  3NRY A;  3TLV A;  5DAB A;  3ZC0 A;  1UUR A;  1HF8 A;  2XAG B;  5H6R B;  2GK9 A;  4GYR A;  4Z91 A;  5EK3 A;  1YD8 G;  1IZN B;  2MYS A;  4YY3 T;  1WR0 A;  2HPJ A;  1E1H B;  5L3D B;  3C4X A;  1OED E;  2A3D A;  4HWI B;  3RIF A;  2X66 A;  4AIS A;  4U74 A;  3RRW A;  4U7Y A;  2XQ9 A;  2CE7 A;  3AED A;  2CM0 A;  2QRX A;  5LJN A;  2K5B B;  3CX6 B;  4YSY A;  2LRK A;  4GK5 E;  4U7I A;  3UUM A;  1IBM T;  1XWM A;  3PUR A;  2CXL A;  4YTP A;  2BBJ A;  4JEU B;  1UGO A;  2K48 A;  4CN4 A;  4IDN A;  4EED A;  4WBN E;  2WWU A;  4G2A A;  1T98 A;  3KV6 A;  4QH5 A;  3CX7 B;  4X65 T;  2PG8 A;  3IBP A;  3RX6 A;  1X79 A;  4H63 H;  2BZB A;  3ZLI A;  5IYZ E;  3A8Y C;  2EHO B;  3FBL A;  1S94 A;  4TNW A;  3FXE B;  4NUU A;  5AQL B;  3AEC A;  1W0B A;  4PJL A;  3EDV A;  2A9U A;  5ABF B;  4IHJ E;  2UXB T;  3N9P A;  2WDR A;  4COF A;  4DMV A;  3U3I A;  4B3S T;  4DO0 A;  4QXB B;  5A1L A;  3KV9 A;  1YQ4 A;  4X1Y E;  2WMO A;  2FJB A;  3UTK A;  4I50 E;  5KX5 E;  3AEE A;  3ZEF B;  4IDQ A;  3ZST A;  2NW9 A;  2X0Y A;  3GWH A;  5LYJ E;  2YDR A;  3TLS A;  5BMV E;  4QX7 B;  3N9O A;  2FJE A;  4FI5 A;  1J5W A;  4UF0 A;  4FJO A;  4IL4 A;  2C5I T;  1G8X A;  4V1A v;  4CQI A;  2IIU A;  4NIQ A;  3ZT7 A;  2CWY A;  2JQK A;  2D0T A;  1ZV4 X;  5HYA A;  1HG2 A;  1D0Y A;  4WW0 A;  2XTL A;  1ZP0 A;  1OWA A;  3PUX F;  2Y6X A;  4U33 A;  1WYB A;  1IAP A;  1ZHC A;  2LJL A;  4IE6 A;  5GON E;  1KEY A;  2K24 A;  2XZE A;  3KBU A;  5JVD E;  4AI6 A;  4IST A;  4YHJ A;  1UX4 A;  5L47 A;  4O4L E;  5AQV B;  1UX5 A;  1HR0 T;  5HEG A;  2L9Q A;  2JQH A;  2KLQ A;  3EDU A;  4ILC A;  4LML A;  4PK6 A;  4O2B E;  2J4G A;  3ANW A;  1QSD A;  2WP9 A;  2F4V T;  4UR9 A;  5AQO B;  4AKL A;  2E9X A;  4GIW A;  3UUL A;  3QC9 A;  1WR6 A;  1ZOY A;  4PW8 A;  4XAX B;  2I0M A;  2WAU A;  3LBX B;  5KXJ A;  2V6Y B;  3FZL B;  5L3C B;  4KX6 A;  2XQ8 A;  3HKD E;  4KHP T;  2NTY A;  2M67 A;  3EAM A;  5FY0 A;  3VRB A;  4LMJ A;  2DHR A;  3X1D A;  5FP3 A;  1N32 T;  2WWV A;  3IEE A;  2IAK A;  5C3J A;  2ZM0 A;  1N33 T;  4BA9 A;  4EZ4 A;  1H7C A;  3PDY A;  1I6Z A;  2A72 A;  2ZM2 A;  3SS1 A;  2RP4 A;  4ZZC A;  3CIR A;  2MPK A;  2CBJ A;  1NEK A;  2XAH B;  5HXC A;  5HAX A;  5HXR A;  2WMN A;  3VRA A;  3UFG A;  5LG4 A;  1UUS A;  3N9L A;  1HNX T;  1MNE A;  1FMW A;  2J62 A;  2KIN B;  4LF8 T;  4JLE A;  1LKX A;  5LHH B; 
#chains in the Genus database with same CATH homology
 4NIQ A;  4U7Y A;  3ZT7 A;  4CN4 A;  3ZT5 A;  4ZEY A;  2JQK A;  3EAB A;  4U2Y A;  2LRL A;  3K1S A;  4WZX A;  1YXR A;  2W2U A;  1WR0 A;  4IT4 A;  2XZE A;  2JQ9 A;  1WFD A;  3ZT6 A;  1WCR A;  2WY2 A;  2LRK A;  4U31 A;  2V6X A;  4U7I A;  2K3W A;  4P1N A;  4CN6 A;  5FVK A;  2V6Y A;  2A9U A;  2MPK A;  2CRB A;  2DL1 A;  5FVL A;  5LB7 B;  4U3C A;  2JQH A;  4CN1 A;  2CPT A;  5CGM A;  2WWV A;  2RPA A;  4A5X A;  5CJ5 A;  2V6Y B;  3ZST A;  3ZSS A;  4U33 A;  4U2Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...