2WY2A

Nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 41
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2wy2A00
2CRBA 2K3WA 3ZT5A 2V6YB 2WWVA 4A5XA 2JQ9A 4U3CA 5CGMA 2LRLA 3K1SA 5FVKA 2LRKA 2V6YA 1YXRA 4U7YA 3EABA 2JQHA 4P1NA 5FVLA 2JQKA 2W2UA 1WFDA 3ZSTA 2DL1A 2V6XA 2RPAA 4U33A 1WCRA 1WR0A 4CN4A 4U31A 4ZEYA 2XZEA 4NIQA 2CPTA 4U2YA 4CN6A 3ZT7A 2A9UA 4WZXA 4CN1A 3ZSSA 2MPKA 4IT4A 5LB7B 4U2ZA 3ZT6A 2WY2A 5CJ5A 4U7IA
chains in the Genus database with same CATH superfamily
4H9NC 4JV5T 4UELA 5AQOB 1KNZA 1OEDE 2BBHA 2IUBA 1HFAA 5FMNA 1MMDA 4X66T 2BG9A 5AQHB 1VRBA 2W61A 4ZI2C 1LVFA 4B3MT 2QVAA 4ILAA 4YLHA 4AIUA 3HL6A 4HKAA 4HTEA 2D9DA 3ZJ1A 3ANWA 4IDZA 5LHIB 4IE4A 3AE7A 2V7IA 2CXLA 2KINB 5L3EB 3HR0A 4UVCB 2NTYA 5L3GB 4TNVA 2LRLA 2IC6A 1MIWA 2LJLA 4YJ3E 3LG7A 3N2GE 3AEEA 1UCUA 3L09A 1UX4A 4M1PA 2V7KA 3CWZB 2KWIB 2UXCT 1QSDA 2BBJA 4NPPA 3ZMZB 2MYSA 1UX5A 3U3IA 5FY0A 4LF7T 5JDFA 2WMNA 3MACA 3RF1A 4DUZT 2H89A 3L3PA 5FXXA 3UU3A 4MBQA 3GMIA 5L3CB 1QLBA 4YSXA 3F2EA 4DR6T 5TAOA 4ISTA 4A5XA 4I4TE 1WYBA 5FXVA 3P8CD 1O3XA 1IJ5A 1E7PA 2A3DA 4P09A 4GIWA 4KMCA 3MZKB 4TV8E 4Z8XA 3LJCA 2CM0A 4WBOA 2EHOB 4EV6A 4O4LE 2UXXB 4ISSA 3Q2MA 3Q5XA 1MMGA 2WZHA 2OA5A 2X0LB 1W9RA 1M7KA 2VQET 3LDQB 4YJ2E 3CX8B 2JJ9A 5AQPB 4GK0E 2NOXA 5HXSA 4IDOA 2X9HA 5FL0A 4G63A 3MJXA 5C3JA 4U31A 4AQYT 1YW0A 2XQ9A 4P0AA 2ZM6T 4DR7T 4QXCB 3O1JA 2WCAA 3PUVF 2ACZA 2V6YB 4GKKT 3TKLB 4QXHB 2K5BB 3FXDB 2VKJA 2PFVA 3UU4A 4GYRA 3PV0F 2LEHA 1KFYA 2ODVA 1QUUA 5IWAT 2L8KA 2QGSA 2W62A 5H6RB 5HXRA 4H9PC 2M6BA 1H7CA 2FJBA 4DR4T 2DWGA 5EK2A 5HWYA 1AJ3A 2X9WA 3FXEB 2YDRA 1FJGT 4AKHA 3OTOT 1YXRA 4ILUA 2BG9B 4OYKA 4CXWA 3CX6B 4DR5T 3CQGB 2E5VA 2XQ3A 2XY8B 4DNDA 3LK42 5DJQC 5IUXA 2XAHB 2J62A 2XQAA 3VU7H 4PK4A 4Z91A 3ZMVB 5LOVE 4PAGA 5ABGA 4EOZB 3FZHB 2LM9A 3RYHE 4YSZA 3ZCJA 4X65T 5H6QB 4EXTA 4AI6A 3E0ZA 2YDSA 2X9XA 4EEBA 4ADZA 4MALA 3B5MA 5L47A 3WAJA 1HG2A 4TZ4C 4NIQA 2A72A 3AAAB 3PJAA 4G2AA 3RC3A 1XMQT 1HX1B 2NWBA 4X20E 4X5TA 3KBUA 2VURA 3N9NA 4OHFA 3NWIA 3M65A 5EZYE 2V26A 4ASKA 5LGNB 2LE8A 3EUHA 4L9IA 2EHOC 5AQFB 3JAFA 3R6NA 3ZT7A 1UUSA 4LF9T 2D0UA 3KV6A 4DO0A 2K9AA 5FXWA 3MXZA 1J5ET 1FMWA 4X1YE 2CE7A 2XAQB 4AISA 2DL1A 5IHYA 2J4GA 4JI4T 4IHJE 4PJJA 2KSRA 3QUJA 3RYFE 3JC6D 4WW0A 3ABVA 2LOPA 3SFEA 4DV7T 3AE3A 2YU1A 4AKIA 3C4WA 5LYJE 2QA7A 3RRCA 5E0OA 4Z90A 2IMLA 2W66A 1US7B 3QNUA 2UUAT 3CPZA 4U2YA 5DABA 2MPKA 5LP6E 3RKGA 4O8SA 4O2AE 5LJMA 4TUYE 4O4JE 2KNDA 4IGUA 1YQ4A 4U72A 4DV6T 3J9X1 4JI1T 3VHLA 5AQUB 5HYAA 4V1Av 3AE9A 3PJAJ 4JLEA 2E9XC 3UUBA 1BR4A 5LMUT 3Q9DA 2DLRA 4H63V 4DV3T 4YXDA 2VL8A 4LFAT 5LXTE 5JH7E 4UEMA 3E08A 4KX6A 2KZ7B 2B76A 4CI2B 4H63H 2CXFA 5JDMA 3AECA 4F6RC 2QRXA 4EEDA 1Z8UA 4B3ST 2C5KT 3UU5A 4B3RT 3RIFA 1LKXA 3P4RA 1B7TA 3GWHA 2UUCT 3FBLA 3E22E 2BZBA 2UUBT 3HKDE 2KLQA 2X67A 3SOLA 2CA5A 4PK6A 4YTPA 5L4EA 2SPCA 2C5IT 4QXBB 4DMVA 2OV9A 3ZYLA 2ACXA 2WAUA 3EABA 1XDOA 4IE0A 2EHOA 4GOUA 4E7SA 3AB3B 2CPTA 2KXPB 4YT0A 1T72A 5LGTB 3OYXA 4LF8T 3OYZA 3NBXX 2I6HA 2CLYB 5FL1A 3BK9A 4H9OC 3LSVA 3AE6A 3OBVE 3V5SA 1D1CA 2FBWA 1UK5A 2BS2A 3ZT6A 2UXDT 3UU8A 4K0KT 1BR1A 1D1BA 2VASA 4U7YA 2YU2A 4TWFA 3H3MA 2WDRA 5HAXA 3QK6A 1KNPA 1BR0A 5DQWA 2R6GF 1UURA 5LB7B 2XAGB 2IIUA 2K48A 2RP4A 1N33T 2CHOA 1MNEA 4PW8A 3ETUA 1D0XA 1N32T 4IIJE 2ZMAA 3B57A 4HN9A 5AQRB 2ODUA 3K3OA 2H3RA 3ZN1B 1NWMX 3ZC1A 3WAKA 2E9XA 5J2TE 2J47A 1W09A 5ABFA 2VWAA 5LBQB 5JR9C 3RLFF 5FY7A 5J0ZA 1NENA 3DP7A 2JRKA 4AXPA 2XAFB 1OEDC 2JMHA 2NP9A 4IL9A 3K1SA 3UU6A 1KEYA 4ZHQE 4O4IE 4B6XA 3ESLA 3MA9A 5AFUL 3UQ7A 4JUYA 2YEVC 3PUQA 2DNXA 3ONXA 3AE2A 2BVLA 2NW8A 1HF8A 3CQXC 3JADA 4PJMA 1D0YA 1MIYA 5JRCA 2N2NA 3KDSE 4PNIA 3C4ZA 4P0BA 2WS3A 2Q9QD 5L3BB 2E5LT 1EZ3A 3OPCA 5A1LA 4NXNT 5FY1A 5LNKA 2G0UA 3AA6B 2WDQA 5AQLB 3T1HT 3ZSTA 2V6XA 2RPAA 2IHR1 3PU8A 2C5JA 3FZMB 3J7Yq 1DU2A 4ZS2A 3AEDA 5M4YA 2CLYC 3AAIA 3A5XA 3IBPA 4HWFA 3P4PA 4KI0F 1R8IA 4YHHT 3HKBE 3QB5K 1G8XA 2BVMA 2DI4A 1IZNB 5LHGB 3I1AA 3FZLB 2LHRA 2VKOA 4EAHA 3K8PC 4O4HE 4ZXLA 2YN6A 3LK3B 5CGMA 5FKYA 1ZKEA 3JCFA 4AQFC 4ZZBA 4QKNA 5AQSB 2FUPA 1J5WA 1HR0T 4U33A 1VCTA 2FJAA 2UXBT 5AQTB 4XBFB 4BAYB 3N9PA 3T8OA 3EDUA 1J1JA 3LFMA 3UUXB 3ZYKA 4IL4A 4ZOLE 2FJDA 5CB4E 4DBRA 4HGAA 3AXJA 1T7SA 4FJOA 5JVDE 3TLUA 3V5UA 1KNRA 5HEGA 5J1GA 2XJ7A 5CFBA 3VR9A 5HXCA 4OX9T 1VOMA 4LMJA 5HEJA 3I0QA 4IDNA 4WBNE 5HWXA 3AVSA 4GKJT 5JDNA 4HFEA 3A8YC 5HEUA 1YKHB 5JR9A 4ZI3C 5LA6E 3PE0A 3AE4A 1OEDA 5FP3A 2MAWA 3RQUA 3IHRA 2E9XB 2M67A 4X1IE 4DV2T 2XM1A 4QWNB 5F8PA 3KV9A 5ABFB 4L0RA 3ZMTB 2LSGA 3O1IA 4HFCA 1Z0PA 5LG3A 3UUNA 2A9UA 4GK5E 3GN5B 3EHZA 4DIDB 4GYSA 4LF6T 2UXNB 5EK4A 1OXZA 4IE6A 4HWDA 1MIVA 3PUSA 2VKHA 3BQLA 4CN4A 2JMKA 3RC8A 5JTGA 3G06A 3NVOA 2CEAA 2XM2A 4AQGA 4X62T 5LJNA 2W63A 1MNDA 5IYZE 5JRCB 1YD8G 2WU2A 4U2ZA 4IDPA 2YOEA 4BA9A 2DCFA 4JBWF 4ILCA 3ETVA 3QC9A 4LFCT 3A7MA 1S94A 2LLYA 2LT3A 2NR4A 5JDGA 2XSAA 3AA1B 2MBGA 3ZJ2A 1G73A 3FZFB 4AQFA 2YINA 2VVSA 3KVBA 3EVYA 4EZ4A 1LRZA 3CX7B 4A56A 3NZPA 4I0UA 2N9DA 1WCRA 2XSBA 2NW9A 2XUEA 4EB6E 4CI1B 4ZI2D 3K3NA 1XWMA 5AQJB 2BG9E 3TLTA 1HCIA 4LF5T 2LKHA 4ZZCA 3AE5A 2VQFT 2HHHT 4HWIB 3N9OA 4UVAB 1N34T 4UIGA 1FEWA 4ZS3A 1W0AA 5AQIB 3LK2B 2QYWA 2KWHA 3RGLA 3AXJB 3P4SA 1SE7A 5C2TA 2WWUA 3LBXA 2P9BA 1ZEEA 4E7ZA 5BR8T 4CN6A 3Q5EA 1V9DA 2KT9A 3HI2A 4J2CA 4L5GA 3I9YA 3FBZA 3RPUA 4U3CA 3JAEA 3ZMSB 3AEBA 2LSIA 4IE5A 2LSYA 5JR9B 1I6ZA 4H9SE 1XNRT 1OEDB 2IW5B 3FB2A 2GK9A 4CI3B 5CJ5A 2CWOA 5JREA 3ZT5A 4EGWA 2LRKA 3Q5DA 1SUMB 2IDOB 3VR8A 3RYCE 1ZV4X 5L3DB 3HA4A 5ABEA 2X68A 1SA0E 2BS4A 3C64A 1MMNA 5AQQB 4I55E 4IE7A 3P4QA 2CRBA 2W4XA 5AQMB 1IBKT 3PUXF 3EDVA 1UGOA 3RIAA 4HWCA 3N9QA 1Y64B 4CQIA 4UF0A 5AQGB 3CMLA 3KFWX 4NUVA 5L2LA 2XQ8A 2XQYA 4CN1A 2M6IA 4TNWA 2Y48B 1I94T 4N78D 3RRWA 2LSKA 1T98A 3OKQA 3GA8A 1MMAA 3AE1A 4EZHA 3DJBA 2C0SA 3C51A 2WBLA 2RA1A 4AKGA 3W15B 2ZM8A 3P50A 5KDMC 4JI8T 3O1HA 4QH5A 4LF4T 2A2FX 2V7LA 2N1GA 2WSSV 3NRXA 2XZEA 1CHUA 1GQEA 4F8HA 3MKDA 4X64T 3L8RA 3VRAA 3TLSA 2IC9A 3JC6C 2E2AA 4TX5A 2JIWA 5L4HA 1N36T 3SS1A 3C50A 3PUGA 4QH1A 2VL0A 4H9RC 3IEEA 1D0ZA 5HCJA 5JDQA 2XPKA 4JI3T 1HNWT 5HEOA 3AEFA 3UQ4A 4QX8B 2X51A 4LMLA 2YDQA 3KVAA 2BKNA 3K3QC 4XAXB 3RH3A 3OJAA 2K3WA 3LBXB 3GN5A 3UFGA 3UT5E 5KX5E 5KMGP 5JDLA 1HTJF 3PUWF 1U5PA 1IBMT 5F3JA 4HFBA 3P4WA 1WR6A 1ZOYA 2IAKA 4I50E 1E1HB 1XZYA 4HFIA 2VK9A 3AEAA 4DV5T 4X1KE 3PTRB 2ZM0A 5HCMA 3TLWA 4YSYA 4OFZA 5CA1E 4FI5A 4HFVA 5KXJA 4PFPA 1S35A 2H88A 2HPLA 3ZSSA 4DR2T 2EHOD 3N9LA 3AEGA 3U78A 2LOSA 1KK7A 2VKDA 5FVLA 4MHCA 4BJMA 2HPJA 1D1AA 3CQCB 3NKZA 4KHPT 1L0VA 4K0UA 3QOFA 4DV1T 5C8YE 4WNKA 2AXDS 3MK7C 4U7IA 3UFEA 2E8IA 2LM2A 1HS7A 4UF0B 4WYVA 4TV9E 1HX8A 5HXHA 2LKGA 2WQYA 2I59A 4IDQA 4UVBB 3EI0A 4HFDA 1X79A 2XQ4A 3SFDA 2WM9A 3ZEFB 2BDEA 4CZZB 3AA0B 4QH4A 5DQVA 3CK6A 2Q9QB 4ILBA 2JQQA 2L3LA 4HE8A 3T1YT 2WB5A 4HFHA 4B3TT 5GONE 2PG8A 3OVUA 1CUNA 3N2OA 2Z6EA 2UU9T 2ZM2A 2HN1A 3PDYA 3VRBA 2X9YA 2CHNA 3RIUC 2WP9A 3ZKRA 4DUYT 2K24A 2E9XD 4Q25A 4NXMT 5HEHA 5J2UE 2PBIA 1JNZA 4IT4A 2D5UA 5FYMA 2W00A 3RHWA 1SHZC 3CVRA 3ZYMA 3AA7B 3ZCIA 4YFSA 2W2UA 4HEAA 4QX7B 1WRDA 5L3FB 2CWYA 1WR0A 3I0OA 3AVRA 4UV9B 4DV4T 4JYAT 4H9QC 4TWHA 3QB5A 3CKDA 4XZCA 2H7OA 1ZP0A 2KMFA 2HH7A 3PUZF 4JEUB 2CCQA 2BKOA 2V8SV 4PFOA 3ONLC 4KBMB 1WFDA 5AQNB 3VKGA 1IBLT 3PUYF 4ZEYA 2MOZA 4EIWA 4JI7T 1HNZT 4JEHB 3H3AA 4COFA 4C91A 3ONJA 3P7IA 1YKEB 1X9BA 2WU5A 1JNRA 3SRZA 2BS3A 3ANWB 3KINB 2V7MA 4PJNA 5F5WA 2J1DG 4HWHA 4MLKA 3AE8A 4JI0T 3IA3A 4KP3C 3IF8B 3KV5A 4P1NA 2XASB 5ABHA 4AKLA 1M62A 3N2KE 1Y01A 2FJEA 2MTQA 3ZC0A 5ETWA 2W0GA 2L9QA 1WLXA 2JQ9A 1XMOT 2V5CA 4BJNA 2D0TA 1YQ3A 4DR1T 4ANJA 4A98A 4LMKA 5AQKB 5FNVE 2XTLA 2Q9QC 2ZLYA 5LG4A 4MFRA 1VCSA 5CA0E 2H7VC 3C98B 1NAFA 2VB6A 3UTKA 2Y6XA 3L39A 2JQHA 1NEKA 2ES0A 3FHNA 4CXXA 2X0HA 4DMWA 3WI3A 2WY2A 4CXYA 3I9WA 3SWHA 3RIUA 5FVKA 3PU3A 2F4VT 3PUAA 2I0MA 3BQKA 3H37A 3O4XE 4OK0A 5LCYA 3VKHA 2B1EA 2LHNA 4NUUA 1FMVA 3RKOA 1BR2A 1KF6A 4YTNA 3Q5WA 4DBQA 2LSJA 3R84B 1E2AA 3DTOA 2D2SA 4TWDA 2YKSA 2BG9C 5FXZA 3ZMUB 4A97A 5BMVE 4IREA 2XQ7A 2WMOA 3RYIE 1IAPA 3RI5A 3KBTA 1T8BA 1OWAA 2YK0A 2W67A 4DV0T 3UUMA 1WYCA 4QHOA 2XHEB 3O9XA 5LMNT 2X66A 2WZIA 4UR9A 1FIOA 5HXEA 2DHRA 5LHHB 2Y8DA 2WWVA 4JI2T 3HKEE 3FZKB 4LFBT 2JPFA 4YY3T 3KV4A 4KUMB 1XDPA 2NW7A 2OLTA 2V1DB 3BQIA 3RQWA 3PURA 2XAJB 4UXNB 2NTXA 4PK5A 3C4XA 3D0TA 5AQVB 4YHJA 2CBJA 1U4QA 4I43B 3ZLIA 1W0BA 4C90A 4DR3T 5LBMA 1IJ6A 2DWKA 2JQKA 5JDHA 2HN2A 2WDVA 3UULA 2XQ6A 3NRYA 2PTFA 2BKPA 3S4UA 3N9MA 2PJQA 4UV8B 1ZHCA 3F57A 2CBIA 5JQGE 4EYUA 4ERRA 3AAEB 2VVNA 4OYJA 2Q9QA 4DVDA 2V7JA 2CXDA 4O2BE 4WZXA 3F31A 2V5DA 2CMRA 2X0YA 4ZI7E 3EAMA 4KHZF 4YTMA 2XQ5A 4AKRB 3M3ZB 3ZPOA 1HG5A 4U74A 5LGUB 4TN7B 4EYYR 2AE9A 3TLVA 3X1DA 1LVKA 3N5LA 2V6YA 5EK3A 3HKCE 5ADXL 3RX6A 3NZQA 3ZN0B 3CIRA 3B13A 1XNQT 1HNXT 4PJLA 4JI5T 4ZI3D 4JI6T
chains in the Genus database with same CATH topology
2CRBA 2K3WA 3ZT5A 2V6YB 2WWVA 4A5XA 2JQ9A 4U3CA 5CGMA 2LRLA 3K1SA 5FVKA 2LRKA 2V6YA 1YXRA 4U7YA 3EABA 2JQHA 4P1NA 5FVLA 2JQKA 2W2UA 1WFDA 3ZSTA 2DL1A 2V6XA 2RPAA 4U33A 1WCRA 1WR0A 4CN4A 4U31A 4ZEYA 2XZEA 4NIQA 2CPTA 4U2YA 4CN6A 3ZT7A 2A9UA 4WZXA 4CN1A 3ZSSA 2MPKA 4IT4A 5LB7B 4U2ZA 3ZT6A 2WY2A 5CJ5A 4U7IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CRB A;  2K3W A;  3ZT5 A;  2V6Y B;  2WWV A;  4A5X A;  2JQ9 A;  4U3C A;  5CGM A;  2LRL A;  3K1S A;  5FVK A;  2LRK A;  2V6Y A;  1YXR A;  4U7Y A;  3EAB A;  2JQH A;  4P1N A;  5FVL A;  2JQK A;  2W2U A;  1WFD A;  3ZST A;  2DL1 A;  2V6X A;  2RPA A;  4U33 A;  1WCR A;  1WR0 A;  4CN4 A;  4U31 A;  4ZEY A;  2XZE A;  4NIQ A;  2CPT A;  4U2Y A;  4CN6 A;  3ZT7 A;  2A9U A;  4WZX A;  4CN1 A;  3ZSS A;  2MPK A;  4IT4 A;  5LB7 B;  4U2Z A;  3ZT6 A;  2WY2 A;  5CJ5 A;  4U7I A; 
#chains in the Genus database with same CATH topology
 4H9N C;  4JV5 T;  4UEL A;  5AQO B;  1KNZ A;  1OED E;  2BBH A;  2IUB A;  1HFA A;  5FMN A;  1MMD A;  4X66 T;  2BG9 A;  5AQH B;  1VRB A;  2W61 A;  4ZI2 C;  1LVF A;  4B3M T;  2QVA A;  4ILA A;  4YLH A;  4AIU A;  3HL6 A;  4HKA A;  4HTE A;  2D9D A;  3ZJ1 A;  3ANW A;  4IDZ A;  5LHI B;  4IE4 A;  3AE7 A;  2V7I A;  2CXL A;  2KIN B;  5L3E B;  3HR0 A;  4UVC B;  2NTY A;  5L3G B;  4TNV A;  2LRL A;  2IC6 A;  1MIW A;  2LJL A;  4YJ3 E;  3LG7 A;  3N2G E;  3AEE A;  1UCU A;  3L09 A;  1UX4 A;  4M1P A;  2V7K A;  3CWZ B;  2KWI B;  2UXC T;  1QSD A;  2BBJ A;  4NPP A;  3ZMZ B;  2MYS A;  1UX5 A;  3U3I A;  5FY0 A;  4LF7 T;  5JDF A;  2WMN A;  3MAC A;  3RF1 A;  4DUZ T;  2H89 A;  3L3P A;  5FXX A;  3UU3 A;  4MBQ A;  3GMI A;  5L3C B;  1QLB A;  4YSX A;  3F2E A;  4DR6 T;  5TAO A;  4IST A;  4A5X A;  4I4T E;  1WYB A;  5FXV A;  3P8C D;  1O3X A;  1IJ5 A;  1E7P A;  2A3D A;  4P09 A;  4GIW A;  4KMC A;  3MZK B;  4TV8 E;  4Z8X A;  3LJC A;  2CM0 A;  4WBO A;  2EHO B;  4EV6 A;  4O4L E;  2UXX B;  4ISS A;  3Q2M A;  3Q5X A;  1MMG A;  2WZH A;  2OA5 A;  2X0L B;  1W9R A;  1M7K A;  2VQE T;  3LDQ B;  4YJ2 E;  3CX8 B;  2JJ9 A;  5AQP B;  4GK0 E;  2NOX A;  5HXS A;  4IDO A;  2X9H A;  5FL0 A;  4G63 A;  3MJX A;  5C3J A;  4U31 A;  4AQY T;  1YW0 A;  2XQ9 A;  4P0A A;  2ZM6 T;  4DR7 T;  4QXC B;  3O1J A;  2WCA A;  3PUV F;  2ACZ A;  2V6Y B;  4GKK T;  3TKL B;  4QXH B;  2K5B B;  3FXD B;  2VKJ A;  2PFV A;  3UU4 A;  4GYR A;  3PV0 F;  2LEH A;  1KFY A;  2ODV A;  1QUU A;  5IWA T;  2L8K A;  2QGS A;  2W62 A;  5H6R B;  5HXR A;  4H9P C;  2M6B A;  1H7C A;  2FJB A;  4DR4 T;  2DWG A;  5EK2 A;  5HWY A;  1AJ3 A;  2X9W A;  3FXE B;  2YDR A;  1FJG T;  4AKH A;  3OTO T;  1YXR A;  4ILU A;  2BG9 B;  4OYK A;  4CXW A;  3CX6 B;  4DR5 T;  3CQG B;  2E5V A;  2XQ3 A;  2XY8 B;  4DND A;  3LK4 2;  5DJQ C;  5IUX A;  2XAH B;  2J62 A;  2XQA A;  3VU7 H;  4PK4 A;  4Z91 A;  3ZMV B;  5LOV E;  4PAG A;  5ABG A;  4EOZ B;  3FZH B;  2LM9 A;  3RYH E;  4YSZ A;  3ZCJ A;  4X65 T;  5H6Q B;  4EXT A;  4AI6 A;  3E0Z A;  2YDS A;  2X9X A;  4EEB A;  4ADZ A;  4MAL A;  3B5M A;  5L47 A;  3WAJ A;  1HG2 A;  4TZ4 C;  4NIQ A;  2A72 A;  3AAA B;  3PJA A;  4G2A A;  3RC3 A;  1XMQ T;  1HX1 B;  2NWB A;  4X20 E;  4X5T A;  3KBU A;  2VUR A;  3N9N A;  4OHF A;  3NWI A;  3M65 A;  5EZY E;  2V26 A;  4ASK A;  5LGN B;  2LE8 A;  3EUH A;  4L9I A;  2EHO C;  5AQF B;  3JAF A;  3R6N A;  3ZT7 A;  1UUS A;  4LF9 T;  2D0U A;  3KV6 A;  4DO0 A;  2K9A A;  5FXW A;  3MXZ A;  1J5E T;  1FMW A;  4X1Y E;  2CE7 A;  2XAQ B;  4AIS A;  2DL1 A;  5IHY A;  2J4G A;  4JI4 T;  4IHJ E;  4PJJ A;  2KSR A;  3QUJ A;  3RYF E;  3JC6 D;  4WW0 A;  3ABV A;  2LOP A;  3SFE A;  4DV7 T;  3AE3 A;  2YU1 A;  4AKI A;  3C4W A;  5LYJ E;  2QA7 A;  3RRC A;  5E0O A;  4Z90 A;  2IML A;  2W66 A;  1US7 B;  3QNU A;  2UUA T;  3CPZ A;  4U2Y A;  5DAB A;  2MPK A;  5LP6 E;  3RKG A;  4O8S A;  4O2A E;  5LJM A;  4TUY E;  4O4J E;  2KND A;  4IGU A;  1YQ4 A;  4U72 A;  4DV6 T;  3J9X 1;  4JI1 T;  3VHL A;  5AQU B;  5HYA A;  4V1A v;  3AE9 A;  3PJA J;  4JLE A;  2E9X C;  3UUB A;  1BR4 A;  5LMU T;  3Q9D A;  2DLR A;  4H63 V;  4DV3 T;  4YXD A;  2VL8 A;  4LFA T;  5LXT E;  5JH7 E;  4UEM A;  3E08 A;  4KX6 A;  2KZ7 B;  2B76 A;  4CI2 B;  4H63 H;  2CXF A;  5JDM A;  3AEC A;  4F6R C;  2QRX A;  4EED A;  1Z8U A;  4B3S T;  2C5K T;  3UU5 A;  4B3R T;  3RIF A;  1LKX A;  3P4R A;  1B7T A;  3GWH A;  2UUC T;  3FBL A;  3E22 E;  2BZB A;  2UUB T;  3HKD E;  2KLQ A;  2X67 A;  3SOL A;  2CA5 A;  4PK6 A;  4YTP A;  5L4E A;  2SPC A;  2C5I T;  4QXB B;  4DMV A;  2OV9 A;  3ZYL A;  2ACX A;  2WAU A;  3EAB A;  1XDO A;  4IE0 A;  2EHO A;  4GOU A;  4E7S A;  3AB3 B;  2CPT A;  2KXP B;  4YT0 A;  1T72 A;  5LGT B;  3OYX A;  4LF8 T;  3OYZ A;  3NBX X;  2I6H A;  2CLY B;  5FL1 A;  3BK9 A;  4H9O C;  3LSV A;  3AE6 A;  3OBV E;  3V5S A;  1D1C A;  2FBW A;  1UK5 A;  2BS2 A;  3ZT6 A;  2UXD T;  3UU8 A;  4K0K T;  1BR1 A;  1D1B A;  2VAS A;  4U7Y A;  2YU2 A;  4TWF A;  3H3M A;  2WDR A;  5HAX A;  3QK6 A;  1KNP A;  1BR0 A;  5DQW A;  2R6G F;  1UUR A;  5LB7 B;  2XAG B;  2IIU A;  2K48 A;  2RP4 A;  1N33 T;  2CHO A;  1MNE A;  4PW8 A;  3ETU A;  1D0X A;  1N32 T;  4IIJ E;  2ZMA A;  3B57 A;  4HN9 A;  5AQR B;  2ODU A;  3K3O A;  2H3R A;  3ZN1 B;  1NWM X;  3ZC1 A;  3WAK A;  2E9X A;  5J2T E;  2J47 A;  1W09 A;  5ABF A;  2VWA A;  5LBQ B;  5JR9 C;  3RLF F;  5FY7 A;  5J0Z A;  1NEN A;  3DP7 A;  2JRK A;  4AXP A;  2XAF B;  1OED C;  2JMH A;  2NP9 A;  4IL9 A;  3K1S A;  3UU6 A;  1KEY A;  4ZHQ E;  4O4I E;  4B6X A;  3ESL A;  3MA9 A;  5AFU L;  3UQ7 A;  4JUY A;  2YEV C;  3PUQ A;  2DNX A;  3ONX A;  3AE2 A;  2BVL A;  2NW8 A;  1HF8 A;  3CQX C;  3JAD A;  4PJM A;  1D0Y A;  1MIY A;  5JRC A;  2N2N A;  3KDS E;  4PNI A;  3C4Z A;  4P0B A;  2WS3 A;  2Q9Q D;  5L3B B;  2E5L T;  1EZ3 A;  3OPC A;  5A1L A;  4NXN T;  5FY1 A;  5LNK A;  2G0U A;  3AA6 B;  2WDQ A;  5AQL B;  3T1H T;  3ZST A;  2V6X A;  2RPA A;  2IHR 1;  3PU8 A;  2C5J A;  3FZM B;  3J7Y q;  1DU2 A;  4ZS2 A;  3AED A;  5M4Y A;  2CLY C;  3AAI A;  3A5X A;  3IBP A;  4HWF A;  3P4P A;  4KI0 F;  1R8I A;  4YHH T;  3HKB E;  3QB5 K;  1G8X A;  2BVM A;  2DI4 A;  1IZN B;  5LHG B;  3I1A A;  3FZL B;  2LHR A;  2VKO A;  4EAH A;  3K8P C;  4O4H E;  4ZXL A;  2YN6 A;  3LK3 B;  5CGM A;  5FKY A;  1ZKE A;  3JCF A;  4AQF C;  4ZZB A;  4QKN A;  5AQS B;  2FUP A;  1J5W A;  1HR0 T;  4U33 A;  1VCT A;  2FJA A;  2UXB T;  5AQT B;  4XBF B;  4BAY B;  3N9P A;  3T8O A;  3EDU A;  1J1J A;  3LFM A;  3UUX B;  3ZYK A;  4IL4 A;  4ZOL E;  2FJD A;  5CB4 E;  4DBR A;  4HGA A;  3AXJ A;  1T7S A;  4FJO A;  5JVD E;  3TLU A;  3V5U A;  1KNR A;  5HEG A;  5J1G A;  2XJ7 A;  5CFB A;  3VR9 A;  5HXC A;  4OX9 T;  1VOM A;  4LMJ A;  5HEJ A;  3I0Q A;  4IDN A;  4WBN E;  5HWX A;  3AVS A;  4GKJ T;  5JDN A;  4HFE A;  3A8Y C;  5HEU A;  1YKH B;  5JR9 A;  4ZI3 C;  5LA6 E;  3PE0 A;  3AE4 A;  1OED A;  5FP3 A;  2MAW A;  3RQU A;  3IHR A;  2E9X B;  2M67 A;  4X1I E;  4DV2 T;  2XM1 A;  4QWN B;  5F8P A;  3KV9 A;  5ABF B;  4L0R A;  3ZMT B;  2LSG A;  3O1I A;  4HFC A;  1Z0P A;  5LG3 A;  3UUN A;  2A9U A;  4GK5 E;  3GN5 B;  3EHZ A;  4DID B;  4GYS A;  4LF6 T;  2UXN B;  5EK4 A;  1OXZ A;  4IE6 A;  4HWD A;  1MIV A;  3PUS A;  2VKH A;  3BQL A;  4CN4 A;  2JMK A;  3RC8 A;  5JTG A;  3G06 A;  3NVO A;  2CEA A;  2XM2 A;  4AQG A;  4X62 T;  5LJN A;  2W63 A;  1MND A;  5IYZ E;  5JRC B;  1YD8 G;  2WU2 A;  4U2Z A;  4IDP A;  2YOE A;  4BA9 A;  2DCF A;  4JBW F;  4ILC A;  3ETV A;  3QC9 A;  4LFC T;  3A7M A;  1S94 A;  2LLY A;  2LT3 A;  2NR4 A;  5JDG A;  2XSA A;  3AA1 B;  2MBG A;  3ZJ2 A;  1G73 A;  3FZF B;  4AQF A;  2YIN A;  2VVS A;  3KVB A;  3EVY A;  4EZ4 A;  1LRZ A;  3CX7 B;  4A56 A;  3NZP A;  4I0U A;  2N9D A;  1WCR A;  2XSB A;  2NW9 A;  2XUE A;  4EB6 E;  4CI1 B;  4ZI2 D;  3K3N A;  1XWM A;  5AQJ B;  2BG9 E;  3TLT A;  1HCI A;  4LF5 T;  2LKH A;  4ZZC A;  3AE5 A;  2VQF T;  2HHH T;  4HWI B;  3N9O A;  4UVA B;  1N34 T;  4UIG A;  1FEW A;  4ZS3 A;  1W0A A;  5AQI B;  3LK2 B;  2QYW A;  2KWH A;  3RGL A;  3AXJ B;  3P4S A;  1SE7 A;  5C2T A;  2WWU A;  3LBX A;  2P9B A;  1ZEE A;  4E7Z A;  5BR8 T;  4CN6 A;  3Q5E A;  1V9D A;  2KT9 A;  3HI2 A;  4J2C A;  4L5G A;  3I9Y A;  3FBZ A;  3RPU A;  4U3C A;  3JAE A;  3ZMS B;  3AEB A;  2LSI A;  4IE5 A;  2LSY A;  5JR9 B;  1I6Z A;  4H9S E;  1XNR T;  1OED B;  2IW5 B;  3FB2 A;  2GK9 A;  4CI3 B;  5CJ5 A;  2CWO A;  5JRE A;  3ZT5 A;  4EGW A;  2LRK A;  3Q5D A;  1SUM B;  2IDO B;  3VR8 A;  3RYC E;  1ZV4 X;  5L3D B;  3HA4 A;  5ABE A;  2X68 A;  1SA0 E;  2BS4 A;  3C64 A;  1MMN A;  5AQQ B;  4I55 E;  4IE7 A;  3P4Q A;  2CRB A;  2W4X A;  5AQM B;  1IBK T;  3PUX F;  3EDV A;  1UGO A;  3RIA A;  4HWC A;  3N9Q A;  1Y64 B;  4CQI A;  4UF0 A;  5AQG B;  3CML A;  3KFW X;  4NUV A;  5L2L A;  2XQ8 A;  2XQY A;  4CN1 A;  2M6I A;  4TNW A;  2Y48 B;  1I94 T;  4N78 D;  3RRW A;  2LSK A;  1T98 A;  3OKQ A;  3GA8 A;  1MMA A;  3AE1 A;  4EZH A;  3DJB A;  2C0S A;  3C51 A;  2WBL A;  2RA1 A;  4AKG A;  3W15 B;  2ZM8 A;  3P50 A;  5KDM C;  4JI8 T;  3O1H A;  4QH5 A;  4LF4 T;  2A2F X;  2V7L A;  2N1G A;  2WSS V;  3NRX A;  2XZE A;  1CHU A;  1GQE A;  4F8H A;  3MKD A;  4X64 T;  3L8R A;  3VRA A;  3TLS A;  2IC9 A;  3JC6 C;  2E2A A;  4TX5 A;  2JIW A;  5L4H A;  1N36 T;  3SS1 A;  3C50 A;  3PUG A;  4QH1 A;  2VL0 A;  4H9R C;  3IEE A;  1D0Z A;  5HCJ A;  5JDQ A;  2XPK A;  4JI3 T;  1HNW T;  5HEO A;  3AEF A;  3UQ4 A;  4QX8 B;  2X51 A;  4LML A;  2YDQ A;  3KVA A;  2BKN A;  3K3Q C;  4XAX B;  3RH3 A;  3OJA A;  2K3W A;  3LBX B;  3GN5 A;  3UFG A;  3UT5 E;  5KX5 E;  5KMG P;  5JDL A;  1HTJ F;  3PUW F;  1U5P A;  1IBM T;  5F3J A;  4HFB A;  3P4W A;  1WR6 A;  1ZOY A;  2IAK A;  4I50 E;  1E1H B;  1XZY A;  4HFI A;  2VK9 A;  3AEA A;  4DV5 T;  4X1K E;  3PTR B;  2ZM0 A;  5HCM A;  3TLW A;  4YSY A;  4OFZ A;  5CA1 E;  4FI5 A;  4HFV A;  5KXJ A;  4PFP A;  1S35 A;  2H88 A;  2HPL A;  3ZSS A;  4DR2 T;  2EHO D;  3N9L A;  3AEG A;  3U78 A;  2LOS A;  1KK7 A;  2VKD A;  5FVL A;  4MHC A;  4BJM A;  2HPJ A;  1D1A A;  3CQC B;  3NKZ A;  4KHP T;  1L0V A;  4K0U A;  3QOF A;  4DV1 T;  5C8Y E;  4WNK A;  2AXD S;  3MK7 C;  4U7I A;  3UFE A;  2E8I A;  2LM2 A;  1HS7 A;  4UF0 B;  4WYV A;  4TV9 E;  1HX8 A;  5HXH A;  2LKG A;  2WQY A;  2I59 A;  4IDQ A;  4UVB B;  3EI0 A;  4HFD A;  1X79 A;  2XQ4 A;  3SFD A;  2WM9 A;  3ZEF B;  2BDE A;  4CZZ B;  3AA0 B;  4QH4 A;  5DQV A;  3CK6 A;  2Q9Q B;  4ILB A;  2JQQ A;  2L3L A;  4HE8 A;  3T1Y T;  2WB5 A;  4HFH A;  4B3T T;  5GON E;  2PG8 A;  3OVU A;  1CUN A;  3N2O A;  2Z6E A;  2UU9 T;  2ZM2 A;  2HN1 A;  3PDY A;  3VRB A;  2X9Y A;  2CHN A;  3RIU C;  2WP9 A;  3ZKR A;  4DUY T;  2K24 A;  2E9X D;  4Q25 A;  4NXM T;  5HEH A;  5J2U E;  2PBI A;  1JNZ A;  4IT4 A;  2D5U A;  5FYM A;  2W00 A;  3RHW A;  1SHZ C;  3CVR A;  3ZYM A;  3AA7 B;  3ZCI A;  4YFS A;  2W2U A;  4HEA A;  4QX7 B;  1WRD A;  5L3F B;  2CWY A;  1WR0 A;  3I0O A;  3AVR A;  4UV9 B;  4DV4 T;  4JYA T;  4H9Q C;  4TWH A;  3QB5 A;  3CKD A;  4XZC A;  2H7O A;  1ZP0 A;  2KMF A;  2HH7 A;  3PUZ F;  4JEU B;  2CCQ A;  2BKO A;  2V8S V;  4PFO A;  3ONL C;  4KBM B;  1WFD A;  5AQN B;  3VKG A;  1IBL T;  3PUY F;  4ZEY A;  2MOZ A;  4EIW A;  4JI7 T;  1HNZ T;  4JEH B;  3H3A A;  4COF A;  4C91 A;  3ONJ A;  3P7I A;  1YKE B;  1X9B A;  2WU5 A;  1JNR A;  3SRZ A;  2BS3 A;  3ANW B;  3KIN B;  2V7M A;  4PJN A;  5F5W A;  2J1D G;  4HWH A;  4MLK A;  3AE8 A;  4JI0 T;  3IA3 A;  4KP3 C;  3IF8 B;  3KV5 A;  4P1N A;  2XAS B;  5ABH A;  4AKL A;  1M62 A;  3N2K E;  1Y01 A;  2FJE A;  2MTQ A;  3ZC0 A;  5ETW A;  2W0G A;  2L9Q A;  1WLX A;  2JQ9 A;  1XMO T;  2V5C A;  4BJN A;  2D0T A;  1YQ3 A;  4DR1 T;  4ANJ A;  4A98 A;  4LMK A;  5AQK B;  5FNV E;  2XTL A;  2Q9Q C;  2ZLY A;  5LG4 A;  4MFR A;  1VCS A;  5CA0 E;  2H7V C;  3C98 B;  1NAF A;  2VB6 A;  3UTK A;  2Y6X A;  3L39 A;  2JQH A;  1NEK A;  2ES0 A;  3FHN A;  4CXX A;  2X0H A;  4DMW A;  3WI3 A;  2WY2 A;  4CXY A;  3I9W A;  3SWH A;  3RIU A;  5FVK A;  3PU3 A;  2F4V T;  3PUA A;  2I0M A;  3BQK A;  3H37 A;  3O4X E;  4OK0 A;  5LCY A;  3VKH A;  2B1E A;  2LHN A;  4NUU A;  1FMV A;  3RKO A;  1BR2 A;  1KF6 A;  4YTN A;  3Q5W A;  4DBQ A;  2LSJ A;  3R84 B;  1E2A A;  3DTO A;  2D2S A;  4TWD A;  2YKS A;  2BG9 C;  5FXZ A;  3ZMU B;  4A97 A;  5BMV E;  4IRE A;  2XQ7 A;  2WMO A;  3RYI E;  1IAP A;  3RI5 A;  3KBT A;  1T8B A;  1OWA A;  2YK0 A;  2W67 A;  4DV0 T;  3UUM A;  1WYC A;  4QHO A;  2XHE B;  3O9X A;  5LMN T;  2X66 A;  2WZI A;  4UR9 A;  1FIO A;  5HXE A;  2DHR A;  5LHH B;  2Y8D A;  2WWV A;  4JI2 T;  3HKE E;  3FZK B;  4LFB T;  2JPF A;  4YY3 T;  3KV4 A;  4KUM B;  1XDP A;  2NW7 A;  2OLT A;  2V1D B;  3BQI A;  3RQW A;  3PUR A;  2XAJ B;  4UXN B;  2NTX A;  4PK5 A;  3C4X A;  3D0T A;  5AQV B;  4YHJ A;  2CBJ A;  1U4Q A;  4I43 B;  3ZLI A;  1W0B A;  4C90 A;  4DR3 T;  5LBM A;  1IJ6 A;  2DWK A;  2JQK A;  5JDH A;  2HN2 A;  2WDV A;  3UUL A;  2XQ6 A;  3NRY A;  2PTF A;  2BKP A;  3S4U A;  3N9M A;  2PJQ A;  4UV8 B;  1ZHC A;  3F57 A;  2CBI A;  5JQG E;  4EYU A;  4ERR A;  3AAE B;  2VVN A;  4OYJ A;  2Q9Q A;  4DVD A;  2V7J A;  2CXD A;  4O2B E;  4WZX A;  3F31 A;  2V5D A;  2CMR A;  2X0Y A;  4ZI7 E;  3EAM A;  4KHZ F;  4YTM A;  2XQ5 A;  4AKR B;  3M3Z B;  3ZPO A;  1HG5 A;  4U74 A;  5LGU B;  4TN7 B;  4EYY R;  2AE9 A;  3TLV A;  3X1D A;  1LVK A;  3N5L A;  2V6Y A;  5EK3 A;  3HKC E;  5ADX L;  3RX6 A;  3NZQ A;  3ZN0 B;  3CIR A;  3B13 A;  1XNQ T;  1HNX T;  4PJL A;  4JI5 T;  4ZI3 D;  4JI6 T; 
#chains in the Genus database with same CATH homology
 2CRB A;  2K3W A;  3ZT5 A;  2V6Y B;  2WWV A;  4A5X A;  2JQ9 A;  4U3C A;  5CGM A;  2LRL A;  3K1S A;  5FVK A;  2LRK A;  2V6Y A;  1YXR A;  4U7Y A;  3EAB A;  2JQH A;  4P1N A;  5FVL A;  2JQK A;  2W2U A;  1WFD A;  3ZST A;  2DL1 A;  2V6X A;  2RPA A;  4U33 A;  1WCR A;  1WR0 A;  4CN4 A;  4U31 A;  4ZEY A;  2XZE A;  4NIQ A;  2CPT A;  4U2Y A;  4CN6 A;  3ZT7 A;  2A9U A;  4WZX A;  4CN1 A;  3ZSS A;  2MPK A;  4IT4 A;  5LB7 B;  4U2Z A;  3ZT6 A;  2WY2 A;  5CJ5 A;  4U7I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...