2WY2A

Nmr structure of the iiachitobiose-iibchitobiose phosphoryl transition state complex of the n,n'-diacetylchitoboise brance of the e. coli phosphotransferase system.
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
103
structure length
103
Chain Sequence
AEELEEVVMGLIINSGQARSLAYAALKQAKQGDFAAAKAMMDQSRMALNEAHLVQTKLIEGDAGEGKMKVSLVLVHAQLHLMTSMLARELITELIELHEKLKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Iiachitobose-Iibchitobiose Complex of the N,N'-Diacetylchitobiose Branch of the Escherichia Coli Phosphotransfer System
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords N\,N'-DIACETYLCHITOBIOSE-SPECIFIC PHOSPHOTRANSFERASE ENZYME
total genus 41
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02255 PTS_IIA PTS system, Lactose/Cellobiose specific IIA subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Hypothetical protein 1500032h18. 2wy2A00
4U2ZA 2WWVA 4ZEYA 3ZSSA 5CJ5A 2DL1A 2CRBA 2WY2A 2CPTA 2K3WA 4IT4A 4A5XA 3ZSTA 3ZT5A 3ZT7A 2JQHA 2V6XA 2LRLA 3K1SA 4U3CA 2LRKA 5CGMA 4CN6A 1WCRA 4CN1A 4P1NA 1WFDA 4NIQA 2V6YA 4U7YA 4U2YA 1YXRA 3EABA 4U7IA 4WZXA 2MPKA 2A9UA 4CN4A 2W2UA 1WR0A 2V6YB 2JQKA 4U33A 2RPAA 2JQ9A 3ZT6A 5LB7B 2XZEA 5FVKA 5FVLA 4U31A
chains in the Genus database with same CATH superfamily
2HN1A 4HWFA 3P4RA 3TKLB 4AKIA 2W00A 3ZMZB 4I55E 4PJLA 5AQNB 5L3BB 3E22E 4YSYA 3KBUA 1QLBA 1YKEB 4IL9A 4IT4A 4IIJE 4L9IA 4MBQA 3ZSTA 2E9XB 2JQHA 4JEUB 4HFVA 4PJJA 3IEEA 3CQGB 1HF8A 1HNZT 4DR4T 1BR0A 2KWIB 4G2AA 4CN6A 1WYCA 3ONJA 2XHEB 2B1EA 2NW9A 1R8IA 1Z0PA 2IIUA 4FJOA 3UQ4A 2BBHA 1XZYA 3P4QA 4KP3C 2WWUA 2W4XA 3ZCJA 1YXRA 2LSIA 2XAFB 3NZQA 4EYUA 3ABVA 2PJQA 3PE0A 3VR8A 4DBQA 4EZHA 3UU5A 2BVMA 2WDVA 2XAGB 4OK0A 3BQLA 4HE8A 4V1Av 4TNWA 3OTOT 3UUBA 2J4GA 3AE7A 1MMDA 1HTJF 4IDOA 4ZXLA 4HGAA 5LJNA 1KNRA 1QUUA 2CBJA 3K3OA 3F2EA 5IYZE 3ZMVB 1BR2A 4LMJA 4C91A 4QXCB 2DWKA 3KVAA 2PG8A 3MKDA 4NUUA 2UXNB 3RYCE 3D0TA 2E9XA 5AQLB 2K3WA 3JAFA 2UU9T 1SHZC 3RIUA 3Q9DA 2W61A 4LFBT 3ANWB 4AQFC 5J2TE 3KVBA 2SPCA 2IAKA 2H7OA 2QVAA 4U3CA 3VRAA 4EB6E 1IBMT 4B6XA 4DR7T 3L39A 3QK6A 2PFVA 4MLKA 3P7IA 4P09A 3NVOA 4AXPA 3I9YA 4I50E 4Z91A 5LCYA 4JI1T 4YJ2E 1WYBA 3UUNA 2EHOB 2MPKA 2CA5A 2X68A 3KV9A 4PFPA 4AQYT 5L2LA 5C3JA 3VU7H 3AEBA 5AQGB 1UURA 2XQ9A 3ETVA 4DMWA 3PJAA 2LHRA 4CXXA 3O9XA 4IDPA 4JUYA 3SS1A 3RKOA 2AXDS 3MK7C 4Z90A 2EHOA 3N9QA 3WAKA 3UFEA 5AQHB 4X1IE 2VWAA 4CQIA 2CCQA 2HHHT 5HWXA 3O1IA 3LBXB 3AVSA 1U4QA 2DWGA 2HN2A 1IAPA 2LSYA 4OYJA 3ZT5A 4HFBA 5HXSA 3L3PA 5CB4E 3RI5A 3RYHE 2X9WA 5HCMA 1X9BA 1SA0E 4YTMA 4ILAA 5F8PA 2NP9A 4YTPA 3C51A 3PUQA 2XQ3A 4QXHB 4HFDA 4PAGA 1KEYA 5C2TA 4ISSA 3O4XE 3SRZA 3J7Yq 5AQPB 2KWHA 3KBTA 2WB5A 3PUWF 4IDNA 4ISTA 4PK4A 4X65T 3CX6B 4C90A 2W62A 4GKKT 4TWFA 5LGUB 1D0ZA 3AB3B 4IHJE 2XQ4A 2Y48B 3JC6C 3N2OA 4O2BE 3C4ZA 4ZHQE 2KXPB 2XQ8A 5LBMA 1MIWA 4UVAB 5L4HA 2XQAA 3HKCE 4IE4A 1N34T 2CEAA 3JCFA 2KMFA 1L0VA 3QB5K 2BDEA 1GQEA 4WBOA 2CRBA 1VOMA 4AKHA 2L3LA 3RC3A 2YEVC 5AQTB 2JMKA 2CLYC 2ODVA 2IHR1 2WCAA 3RHWA 5HXEA 5LGNB 2LSJA 3ZT7A 5JRCA 3KINB 3FHNA 4AKRB 2LEHA 3N9MA 2CBIA 4PW8A 4QX7B 2UXBT 4PJNA 1T8BA 3DJBA 1WLXA 4WYVA 5JRCB 5AQOB 2PTFA 4QH5A 2LHNA 1NEKA 2KLQA 5LBQB 3EABA 2N9DA 3OKQA 3C98B 4AKLA 2ZM6T 4JV5T 4TUYE 1YW0A 2XSBA 4H9OC 4CN4A 3JC6D 4X66T 2VL8A 2IDOB 3CMLA 3AE6A 4ZI7E 1YQ3A 2ODUA 2WDQA 2FUPA 3FZFB 1LVFA 3FZHB 1VCSA 3P8CD 3QNUA 4IREA 4UV8B 5E0OA 3UUXB 4JI4T 3AEAA 2CHOA 5AQMB 3ZC1A 2QRXA 1T72A 3ZYLA 3N9PA 2W66A 4LF7T 1MIYA 3ZN0B 5JDNA 3CQXC 4LF9T 3RC8A 2VL0A 1IJ5A 4QH4A 3K8PC 4YY3T 4DV6T 1SE7A 2ZM0A 4PFOA 5AQVB 3K1SA 3N9OA 2GK9A 1XMQT 2NOXA 2V5DA 3CWZB 3LFMA 3CPZA 3PU3A 2LE8A 3QUJA 4LMLA 4WW0A 2X9HA 2H3RA 1WR6A 5J0ZA 1HFAA 3N9NA 1G73A 3B57A 5HEUA 3VRBA 5LHHB 4HWHA 2A9UA 3H3MA 4TWDA 3CVRA 5H6QB 1SUMB 2JQKA 3RRWA 3TLVA 3Q5WA 4JI5T 3ZT6A 2HH7A 2XM1A 1D0YA 5HCJA 4BJNA 1HS7A 2A3DA 3UU8A 4ERRA 2VVSA 3H3AA 3ZPOA 1UGOA 2BKNA 2DNXA 3AEEA 4O2AE 2Z6EA 1LRZA 4ILBA 4WBNE 2EHOC 5HEJA 4DV5T 1NENA 2YKSA 3E08A 5FXVA 4LMKA 2K24A 4I0UA 1VRBA 5JH7E 2FBWA 1ZKEA 2BG9E 3I0QA 3UTKA 3H37A 3FZLB 1JNZA 3OYZA 3AE9A 3WI3A 4ADZA 2G0UA 2JMHA 4DMVA 4YSXA 5J2UE 1OEDA 2H7VC 5JREA 4HFHA 4E7ZA 3CQCB 4NIQA 2V6YA 4OHFA 3UUMA 4AQGA 1IZNB 3T8OA 1OEDB 3RRCA 5FL1A 2D0TA 3UU4A 3CKDA 4HN9A 2YDRA 4UR9A 2W0GA 1G8XA 4YXDA 3PU8A 3HKBE 5J1GA 3FXEB 1KFYA 3EDUA 2QA7A 4YJ3E 2ES0A 2ZMAA 1OEDC 2DCFA 4H9QC 4HWDA 2K9AA 4ILUA 2WWVA 3TLUA 3O1HA 1Z8UA 1YD8G 4DR2T 2CM0A 2BG9A 2JIWA 3AAIA 3EDVA 1Y64B 3RF1A 4A5XA 4CI1B 5FP3A 5C8YE 1D1AA 1N36T 1KNZA 5CA0E 4DV4T 4PJMA 1XMOT 2V6XA 2LRLA 4CI3B 1H7CA 4CI2B 5HYAA 3FXDB 2UXDT 2CE7A 2LM9A 4P1NA 5FXWA 5IHYA 3ZYMA 3P4PA 2MYSA 5JR9C 3QC9A 4J2CA 5HXCA 3M3ZB 3NKZA 2N2NA 2RPAA 2XAHB 3T1YT 3PUSA 4HKAA 1FMWA 2VVNA 1ZHCA 2BZBA 2I0MA 2VKHA 3LSVA 2LKHA 3BQKA 4O4HE 4XZCA 4AISA 4DIDB 2D2SA 3OPCA 4P0AA 3ONXA 5EK3A 5BMVE 2RP4A 2C0SA 2C5IT 4L0RA 3ZJ2A 5LMUT 2WY2A 5EZYE 3I1AA 4BAYB 2BG9C 3T1HT 3GWHA 1FMVA 2YK0A 1EZ3A 4LFAT 4Q25A 1HX8A 4H63H 3P50A 2CXDA 4XAXB 3WAJA 4DR6T 2XUEA 4AKGA 4DV2T 1FIOA 1V9DA 2L8KA 2K5BB 5AQJB 3BK9A 3V5UA 5FY0A 3O1JA 4O4JE 4YHJA 2EHOD 4TNVA 4GKJT 5FYMA 2LSGA 2KINB 3UQ7A 4HFIA 1US7B 2W2UA 1WR0A 2XQ6A 1D1CA 3A7MA 4MFRA 5HEGA 3VKGA 4AQFA 5AFUL 3AAAB 2F4VT 3F57A 5FY1A 2D0UA 3IHRA 2NW7A 2ACZA 1HNWT 5DQVA 2D9DA 5FVLA 5F3JA 5FXZA 4JBWF 2X66A 2JRKA 2WQYA 3AA7B 5FMNA 3ETUA 4BJMA 3X1DA 2DL1A 2BKOA 2R6GF 2NW8A 3AXJA 4P0BA 3RH3A 4DV7T 3UU6A 1HR0T 2CPTA 1N33T 2VQET 2HPLA 1VCTA 4YLHA 1YKHB 2UXCT 4DO0A 4UEMA 3L09A 1XNQT 3ZMTB 3I9WA 5LHGB 4AI6A 2LKGA 4B3MT 3EVYA 2CMRA 2XSAA 1WCRA 4H9NC 5L3DB 2DHRA 2CLYB 2YINA 4IE7A 1E1HB 5GONE 1WFDA 2NR4A 2IW5B 4OX9T 2YN6A 3RLFF 4QKNA 2ZM2A 2VK9A 2YDQA 2CWYA 4PK5A 1ZOYA 4X1KE 4U2YA 4AIUA 5ADXL 5HWYA 4TWHA 1BR1A 1MNEA 4F8HA 4NPPA 4TZ4C 3RGLA 5AQRB 2PBIA 3IBPA 5JR9B 4X5TA 3AEDA 2J1DG 2OV9A 2XZEA 3N2KE 4JI2T 1E7PA 5HAXA 1T7SA 4ZI2C 2LT3A 5ABFA 3AAEB 5EK4A 5A1LA 2LOPA 3PTRB 3ZEFB 2WMOA 4EAHA 2WU2A 3S4UA 3Q5XA 5JTGA 4U72A 3SOLA 4EIWA 2E2AA 4EV6A 5DQWA 4CXYA 3MXZA 5ETWA 4KMCA 3UFGA 4H9PC 3IF8B 2WAUA 5JR9A 4JYAT 3AVRA 3B13A 5LJMA 3NRXA 4BA9A 1IBLT 1UX5A 4JEHB 4HFEA 2NWBA 4NXMT 3AECA 2OA5A 3QB5A 3CK6A 3P4SA 4GIWA 4ILCA 4GK5E 4KBMB 4QX8B 1MMAA 2X51A 4IDQA 4COFA 3NZPA 4NUVA 4U7YA 4YT0A 3LDQB 2XJ7A 4KX6A 5LGTB 3GN5A 4MALA 2XY8B 5JDFA 2V5CA 4JI0T 2XAJB 1NWMX 1D0XA 2XM2A 3K3QC 4UV9B 2BBJA 4LF6T 4A56A 1MNDA 4ZI3C 5ABGA 4HWIB 2VB6A 5L3EB 3GA8A 1J5ET 2WBLA 3KDSE 2BG9B 2W67A 4GYRA 4OYKA 4L5GA 4IL4A 3U78A 3VHLA 2V1DB 3GMIA 5ABHA 3I0OA 5AQQB 4TV8E 4EGWA 3TLSA 4YTNA 2KT9A 3HA4A 3C4WA 4PNIA 3ONLC 4LFCT 2X9YA 2XQ7A 4DV1T 5ABFB 3RQWA 4DV3T 2AE9A 2BS2A 2VKOA 3PURA 1E2AA 2MBGA 4EZ4A 1IBKT 4QHOA 4TN7B 4YHHT 5DJQC 2VASA 4ZI3D 4QH1A 5AQSB 4CN1A 4JI6T 2CXLA 2K48A 4Z8XA 4EOZB 3N2GE 2FJDA 4EYYR 1M7KA 3PUYF 2LLYA 1JNRA 4WZXA 3GN5B 3HR0A 3LJCA 2ACXA 5LXTE 1J5WA 2WM9A 4IE0A 1X79A 3LG7A 4X1YE 2KZ7B 4F6RC 5LMNT 3C50A 2JQ9A 3A5XA 5IUXA 4O4LE 3AEFA 1I6ZA 1J1JA 3DTOA 2V7KA 1OWAA 1D1BA 2MOZA 3A8YC 3NBXX 1B7TA 2E8IA 3PUVF 4HEAA 4JI8T 1BR4A 1XDPA 4EEBA 2UUAT 4MHCA 5JVDE 2L9QA 1QSDA 3UULA 2UUBT 3AE4A 3AA6B 3KV4A 1T98A 4DUZT 2WP9A 1MMGA 5CFBA 1ZV4X 2A72A 2BS4A 4N78D 2I6HA 5JDQA 2UUCT 4DR1T 2P9BA 2XQYA 3ZCIA 1OEDE 1U5PA 1UUSA 2M6BA 3ESLA 3KV6A 1XWMA 2C5KT 2LJLA 1ZP0A 3ZN1B 4ANJA 1DU2A 4EEDA 4NXNT 4PK6A 5LHIB 3ZYKA 3F31A 4H9RC 5DABA 1W0BA 2LOSA 2E9XD 1W9RA 3PUAA 2V6YB 3AE5A 4B3TT 3AE3A 3TLTA 3RYIE 3FBLA 2Y8DA 3PJAJ 4I43B 5LB7B 4LF8T 2WS3A 5LA6E 2B76A 3EI0A 1NAFA 2Q9QA 4LF4T 3UT5E 2D5UA 5L47A 4KI0F 1W0AA 2WSSV 3PUGA 2X9XA 2Q9QB 4M1PA 5AQKB 5L3CB 4DR3T 3ZMUB 2BS3A 2E5VA 4WNKA 3MACA 1AJ3A 2V7MA 1YQ4A 3IA3A 4KHZF 3SFEA 4UVBB 5LNKA 5KDMC 2WMNA 3L8RA 4X64T 4DV0T 2N1GA 4UVCB 2Q9QC 4FI5A 2JPFA 4H9SE 2X0LB 5AQIB 3PUZF 3TLWA 4YSZA 4XBFB 1UK5A 1XDOA 2CWOA 2V8SV 2ZLYA 2ZM8A 3BQIA 3FBZA 4UXNB 2WZHA 4U74A 4QWNB 2HPJA 3PUXF 3ZJ1A 3OVUA 5HEHA 3C4XA 1KK7A 2LM2A 3FZKB 5H6RB 4E7SA 1FJGT 2YOEA 4HTEA 3SFDA 5JQGE 3AE1A 4GK0E 3FB2A 5FKYA 5FVKA 3OJAA 3NWIA 3DP7A 4GOUA 1I94T 2KNDA 1CHUA 4IGUA 3U3IA 3AE8A 4X20E 3AEGA 5HEOA 3ZSSA 5ABEA 2Q9QD 1IJ6A 1CUNA 2DI4A 2I59A 2X0YA 4HFCA 3AA0B 4TV9E 3R84B 2Y6XA 3HI2A 3W15B 5JDHA 1ZEEA 4UIGA 4HWCA 1HNXT 5LOVE 2FJBA 2WU5A 1MMNA 4IDZA 2RA1A 5KXJA 2FJEA 3LK2B 2V7LA 2H88A 2YU1A 3KFWX 3LBXA 5L4EA 3J9X1 4B3ST 3R6NA 3HKDE 1HG5A 5FY7A 5CGMA 5KMGP 1O3XA 4A98A 4G63A 3RYFE 2WDRA 2IUBA 3AA1B 2MAWA 3EAMA 5M4YA 3PV0F 3FZMB 5JDLA 2WZIA 3G06A 3P4WA 4O4IE 4UF0B 4DBRA 3B5MA 4U7IA 1W09A 4B3RT 4QXBB 3OYXA 2DLRA 4LF5T 2XAQB 4DR5T 2NTXA 1M62A 2MTQA 2V7IA 3HL6A 2J47A 3VKHA 2E5LT 4A97A 4DNDA 4OFZA 2IC9A 2V26A 3MA9A 2V7JA 3EHZA 4U2ZA 2XTLA 2YDSA 2YU2A 5IWAT 4ZZBA 2QGSA 3CX7B 1LVKA 3C64A 2E9XC 3N5LA 2XASB 5FXXA 1UX4A 3LK3B 3RIFA 3RIAA 3RQUA 3ZC0A 3Q2MA 2X0HA 5FL0A 4JI7T 4KHPT 5HXRA 2VKJA 2LSKA 4TX5A 2LRKA 4JLEA 4I4TE 3Q5DA 1N32T 2H89A 1KF6A 3OBVE 4ZOLE 3K3NA 3ZMSB 3UU3A 4ZZCA 3NRYA 1S94A 3SWHA 3JADA 4CZZB 5L3FB 4O8SA 2J62A 1FEWA 2W63A 3RIUC 1XNRT 3CX8B 4EXTA 1WRDA 3EUHA 3MZKB 4UELA 2VQFT 2BVLA 3LK42 3E0ZA 4K0KT 2M6IA 3V5SA 3RX6A 1HCIA 2IMLA 3ANWA 5JDMA 2XQ5A 4UF0A 2M67A 3N9LA 4U31A 4ZI2D 5TAOA 4JI3T 4ZEYA 5FNVE 2QYWA 5CJ5A 2UXXB 3CIRA 4X62T 3AE2A 3Q5EA 4IE5A 2NTYA 1HX1B 2IC6A 5EK2A 2KSRA 4ASKA 2C5JA 4KUMB 2FJAA 4ZS2A 1HG2A 5AQUB 3JAEA 3ZKRA 5HXHA 3PDYA 3KV5A 2VKDA 1LKXA 4DUYT 5BR8T 1OXZA 3AXJB 4GYSA 1UCUA 5LG4A 2X67A 5LG3A 3RKGA 2CXFA 5LP6E 2BKPA 5CA1E 3ZLIA 2JQQA 4H63V 3M65A 2XPKA 1MIVA 3QOFA 4K0UA 4DVDA 5JDGA 5LYJE 4YFSA 2A2FX 5L3GB 3VR9A 2OLTA 4CXWA 3HKEE 3MJXA 5KX5E 4U33A 2CHNA 4IE6A 1S35A 2VURA 1KNPA 5AQFB 4ZS3A 1Y01A 5F5WA 2JJ9A 3RPUA
chains in the Genus database with same CATH topology
4U2ZA 2WWVA 4ZEYA 3ZSSA 5CJ5A 2DL1A 2CRBA 2WY2A 2CPTA 2K3WA 4IT4A 4A5XA 3ZSTA 3ZT5A 3ZT7A 2JQHA 2V6XA 2LRLA 3K1SA 4U3CA 2LRKA 5CGMA 4CN6A 1WCRA 4CN1A 4P1NA 1WFDA 4NIQA 2V6YA 4U7YA 4U2YA 1YXRA 3EABA 4U7IA 4WZXA 2MPKA 2A9UA 4CN4A 2W2UA 1WR0A 2V6YB 2JQKA 4U33A 2RPAA 2JQ9A 3ZT6A 5LB7B 2XZEA 5FVKA 5FVLA 4U31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U2Z A;  2WWV A;  4ZEY A;  3ZSS A;  5CJ5 A;  2DL1 A;  2CRB A;  2WY2 A;  2CPT A;  2K3W A;  4IT4 A;  4A5X A;  3ZST A;  3ZT5 A;  3ZT7 A;  2JQH A;  2V6X A;  2LRL A;  3K1S A;  4U3C A;  2LRK A;  5CGM A;  4CN6 A;  1WCR A;  4CN1 A;  4P1N A;  1WFD A;  4NIQ A;  2V6Y A;  4U7Y A;  4U2Y A;  1YXR A;  3EAB A;  4U7I A;  4WZX A;  2MPK A;  2A9U A;  4CN4 A;  2W2U A;  1WR0 A;  2V6Y B;  2JQK A;  4U33 A;  2RPA A;  2JQ9 A;  3ZT6 A;  5LB7 B;  2XZE A;  5FVK A;  5FVL A;  4U31 A; 
#chains in the Genus database with same CATH topology
 2HN1 A;  4HWF A;  3P4R A;  3TKL B;  4AKI A;  2W00 A;  3ZMZ B;  4I55 E;  4PJL A;  5AQN B;  5L3B B;  3E22 E;  4YSY A;  3KBU A;  1QLB A;  1YKE B;  4IL9 A;  4IT4 A;  4IIJ E;  4L9I A;  4MBQ A;  3ZST A;  2E9X B;  2JQH A;  4JEU B;  4HFV A;  4PJJ A;  3IEE A;  3CQG B;  1HF8 A;  1HNZ T;  4DR4 T;  1BR0 A;  2KWI B;  4G2A A;  4CN6 A;  1WYC A;  3ONJ A;  2XHE B;  2B1E A;  2NW9 A;  1R8I A;  1Z0P A;  2IIU A;  4FJO A;  3UQ4 A;  2BBH A;  1XZY A;  3P4Q A;  4KP3 C;  2WWU A;  2W4X A;  3ZCJ A;  1YXR A;  2LSI A;  2XAF B;  3NZQ A;  4EYU A;  3ABV A;  2PJQ A;  3PE0 A;  3VR8 A;  4DBQ A;  4EZH A;  3UU5 A;  2BVM A;  2WDV A;  2XAG B;  4OK0 A;  3BQL A;  4HE8 A;  4V1A v;  4TNW A;  3OTO T;  3UUB A;  2J4G A;  3AE7 A;  1MMD A;  1HTJ F;  4IDO A;  4ZXL A;  4HGA A;  5LJN A;  1KNR A;  1QUU A;  2CBJ A;  3K3O A;  3F2E A;  5IYZ E;  3ZMV B;  1BR2 A;  4LMJ A;  4C91 A;  4QXC B;  2DWK A;  3KVA A;  2PG8 A;  3MKD A;  4NUU A;  2UXN B;  3RYC E;  3D0T A;  2E9X A;  5AQL B;  2K3W A;  3JAF A;  2UU9 T;  1SHZ C;  3RIU A;  3Q9D A;  2W61 A;  4LFB T;  3ANW B;  4AQF C;  5J2T E;  3KVB A;  2SPC A;  2IAK A;  2H7O A;  2QVA A;  4U3C A;  3VRA A;  4EB6 E;  1IBM T;  4B6X A;  4DR7 T;  3L39 A;  3QK6 A;  2PFV A;  4MLK A;  3P7I A;  4P09 A;  3NVO A;  4AXP A;  3I9Y A;  4I50 E;  4Z91 A;  5LCY A;  4JI1 T;  4YJ2 E;  1WYB A;  3UUN A;  2EHO B;  2MPK A;  2CA5 A;  2X68 A;  3KV9 A;  4PFP A;  4AQY T;  5L2L A;  5C3J A;  3VU7 H;  3AEB A;  5AQG B;  1UUR A;  2XQ9 A;  3ETV A;  4DMW A;  3PJA A;  2LHR A;  4CXX A;  3O9X A;  4IDP A;  4JUY A;  3SS1 A;  3RKO A;  2AXD S;  3MK7 C;  4Z90 A;  2EHO A;  3N9Q A;  3WAK A;  3UFE A;  5AQH B;  4X1I E;  2VWA A;  4CQI A;  2CCQ A;  2HHH T;  5HWX A;  3O1I A;  3LBX B;  3AVS A;  1U4Q A;  2DWG A;  2HN2 A;  1IAP A;  2LSY A;  4OYJ A;  3ZT5 A;  4HFB A;  5HXS A;  3L3P A;  5CB4 E;  3RI5 A;  3RYH E;  2X9W A;  5HCM A;  1X9B A;  1SA0 E;  4YTM A;  4ILA A;  5F8P A;  2NP9 A;  4YTP A;  3C51 A;  3PUQ A;  2XQ3 A;  4QXH B;  4HFD A;  4PAG A;  1KEY A;  5C2T A;  4ISS A;  3O4X E;  3SRZ A;  3J7Y q;  5AQP B;  2KWH A;  3KBT A;  2WB5 A;  3PUW F;  4IDN A;  4IST A;  4PK4 A;  4X65 T;  3CX6 B;  4C90 A;  2W62 A;  4GKK T;  4TWF A;  5LGU B;  1D0Z A;  3AB3 B;  4IHJ E;  2XQ4 A;  2Y48 B;  3JC6 C;  3N2O A;  4O2B E;  3C4Z A;  4ZHQ E;  2KXP B;  2XQ8 A;  5LBM A;  1MIW A;  4UVA B;  5L4H A;  2XQA A;  3HKC E;  4IE4 A;  1N34 T;  2CEA A;  3JCF A;  2KMF A;  1L0V A;  3QB5 K;  2BDE A;  1GQE A;  4WBO A;  2CRB A;  1VOM A;  4AKH A;  2L3L A;  3RC3 A;  2YEV C;  5AQT B;  2JMK A;  2CLY C;  2ODV A;  2IHR 1;  2WCA A;  3RHW A;  5HXE A;  5LGN B;  2LSJ A;  3ZT7 A;  5JRC A;  3KIN B;  3FHN A;  4AKR B;  2LEH A;  3N9M A;  2CBI A;  4PW8 A;  4QX7 B;  2UXB T;  4PJN A;  1T8B A;  3DJB A;  1WLX A;  4WYV A;  5JRC B;  5AQO B;  2PTF A;  4QH5 A;  2LHN A;  1NEK A;  2KLQ A;  5LBQ B;  3EAB A;  2N9D A;  3OKQ A;  3C98 B;  4AKL A;  2ZM6 T;  4JV5 T;  4TUY E;  1YW0 A;  2XSB A;  4H9O C;  4CN4 A;  3JC6 D;  4X66 T;  2VL8 A;  2IDO B;  3CML A;  3AE6 A;  4ZI7 E;  1YQ3 A;  2ODU A;  2WDQ A;  2FUP A;  3FZF B;  1LVF A;  3FZH B;  1VCS A;  3P8C D;  3QNU A;  4IRE A;  4UV8 B;  5E0O A;  3UUX B;  4JI4 T;  3AEA A;  2CHO A;  5AQM B;  3ZC1 A;  2QRX A;  1T72 A;  3ZYL A;  3N9P A;  2W66 A;  4LF7 T;  1MIY A;  3ZN0 B;  5JDN A;  3CQX C;  4LF9 T;  3RC8 A;  2VL0 A;  1IJ5 A;  4QH4 A;  3K8P C;  4YY3 T;  4DV6 T;  1SE7 A;  2ZM0 A;  4PFO A;  5AQV B;  3K1S A;  3N9O A;  2GK9 A;  1XMQ T;  2NOX A;  2V5D A;  3CWZ B;  3LFM A;  3CPZ A;  3PU3 A;  2LE8 A;  3QUJ A;  4LML A;  4WW0 A;  2X9H A;  2H3R A;  1WR6 A;  5J0Z A;  1HFA A;  3N9N A;  1G73 A;  3B57 A;  5HEU A;  3VRB A;  5LHH B;  4HWH A;  2A9U A;  3H3M A;  4TWD A;  3CVR A;  5H6Q B;  1SUM B;  2JQK A;  3RRW A;  3TLV A;  3Q5W A;  4JI5 T;  3ZT6 A;  2HH7 A;  2XM1 A;  1D0Y A;  5HCJ A;  4BJN A;  1HS7 A;  2A3D A;  3UU8 A;  4ERR A;  2VVS A;  3H3A A;  3ZPO A;  1UGO A;  2BKN A;  2DNX A;  3AEE A;  4O2A E;  2Z6E A;  1LRZ A;  4ILB A;  4WBN E;  2EHO C;  5HEJ A;  4DV5 T;  1NEN A;  2YKS A;  3E08 A;  5FXV A;  4LMK A;  2K24 A;  4I0U A;  1VRB A;  5JH7 E;  2FBW A;  1ZKE A;  2BG9 E;  3I0Q A;  3UTK A;  3H37 A;  3FZL B;  1JNZ A;  3OYZ A;  3AE9 A;  3WI3 A;  4ADZ A;  2G0U A;  2JMH A;  4DMV A;  4YSX A;  5J2U E;  1OED A;  2H7V C;  5JRE A;  4HFH A;  4E7Z A;  3CQC B;  4NIQ A;  2V6Y A;  4OHF A;  3UUM A;  4AQG A;  1IZN B;  3T8O A;  1OED B;  3RRC A;  5FL1 A;  2D0T A;  3UU4 A;  3CKD A;  4HN9 A;  2YDR A;  4UR9 A;  2W0G A;  1G8X A;  4YXD A;  3PU8 A;  3HKB E;  5J1G A;  3FXE B;  1KFY A;  3EDU A;  2QA7 A;  4YJ3 E;  2ES0 A;  2ZMA A;  1OED C;  2DCF A;  4H9Q C;  4HWD A;  2K9A A;  4ILU A;  2WWV A;  3TLU A;  3O1H A;  1Z8U A;  1YD8 G;  4DR2 T;  2CM0 A;  2BG9 A;  2JIW A;  3AAI A;  3EDV A;  1Y64 B;  3RF1 A;  4A5X A;  4CI1 B;  5FP3 A;  5C8Y E;  1D1A A;  1N36 T;  1KNZ A;  5CA0 E;  4DV4 T;  4PJM A;  1XMO T;  2V6X A;  2LRL A;  4CI3 B;  1H7C A;  4CI2 B;  5HYA A;  3FXD B;  2UXD T;  2CE7 A;  2LM9 A;  4P1N A;  5FXW A;  5IHY A;  3ZYM A;  3P4P A;  2MYS A;  5JR9 C;  3QC9 A;  4J2C A;  5HXC A;  3M3Z B;  3NKZ A;  2N2N A;  2RPA A;  2XAH B;  3T1Y T;  3PUS A;  4HKA A;  1FMW A;  2VVN A;  1ZHC A;  2BZB A;  2I0M A;  2VKH A;  3LSV A;  2LKH A;  3BQK A;  4O4H E;  4XZC A;  4AIS A;  4DID B;  2D2S A;  3OPC A;  4P0A A;  3ONX A;  5EK3 A;  5BMV E;  2RP4 A;  2C0S A;  2C5I T;  4L0R A;  3ZJ2 A;  5LMU T;  2WY2 A;  5EZY E;  3I1A A;  4BAY B;  2BG9 C;  3T1H T;  3GWH A;  1FMV A;  2YK0 A;  1EZ3 A;  4LFA T;  4Q25 A;  1HX8 A;  4H63 H;  3P50 A;  2CXD A;  4XAX B;  3WAJ A;  4DR6 T;  2XUE A;  4AKG A;  4DV2 T;  1FIO A;  1V9D A;  2L8K A;  2K5B B;  5AQJ B;  3BK9 A;  3V5U A;  5FY0 A;  3O1J A;  4O4J E;  4YHJ A;  2EHO D;  4TNV A;  4GKJ T;  5FYM A;  2LSG A;  2KIN B;  3UQ7 A;  4HFI A;  1US7 B;  2W2U A;  1WR0 A;  2XQ6 A;  1D1C A;  3A7M A;  4MFR A;  5HEG A;  3VKG A;  4AQF A;  5AFU L;  3AAA B;  2F4V T;  3F57 A;  5FY1 A;  2D0U A;  3IHR A;  2NW7 A;  2ACZ A;  1HNW T;  5DQV A;  2D9D A;  5FVL A;  5F3J A;  5FXZ A;  4JBW F;  2X66 A;  2JRK A;  2WQY A;  3AA7 B;  5FMN A;  3ETU A;  4BJM A;  3X1D A;  2DL1 A;  2BKO A;  2R6G F;  2NW8 A;  3AXJ A;  4P0B A;  3RH3 A;  4DV7 T;  3UU6 A;  1HR0 T;  2CPT A;  1N33 T;  2VQE T;  2HPL A;  1VCT A;  4YLH A;  1YKH B;  2UXC T;  4DO0 A;  4UEM A;  3L09 A;  1XNQ T;  3ZMT B;  3I9W A;  5LHG B;  4AI6 A;  2LKG A;  4B3M T;  3EVY A;  2CMR A;  2XSA A;  1WCR A;  4H9N C;  5L3D B;  2DHR A;  2CLY B;  2YIN A;  4IE7 A;  1E1H B;  5GON E;  1WFD A;  2NR4 A;  2IW5 B;  4OX9 T;  2YN6 A;  3RLF F;  4QKN A;  2ZM2 A;  2VK9 A;  2YDQ A;  2CWY A;  4PK5 A;  1ZOY A;  4X1K E;  4U2Y A;  4AIU A;  5ADX L;  5HWY A;  4TWH A;  1BR1 A;  1MNE A;  4F8H A;  4NPP A;  4TZ4 C;  3RGL A;  5AQR B;  2PBI A;  3IBP A;  5JR9 B;  4X5T A;  3AED A;  2J1D G;  2OV9 A;  2XZE A;  3N2K E;  4JI2 T;  1E7P A;  5HAX A;  1T7S A;  4ZI2 C;  2LT3 A;  5ABF A;  3AAE B;  5EK4 A;  5A1L A;  2LOP A;  3PTR B;  3ZEF B;  2WMO A;  4EAH A;  2WU2 A;  3S4U A;  3Q5X A;  5JTG A;  4U72 A;  3SOL A;  4EIW A;  2E2A A;  4EV6 A;  5DQW A;  4CXY A;  3MXZ A;  5ETW A;  4KMC A;  3UFG A;  4H9P C;  3IF8 B;  2WAU A;  5JR9 A;  4JYA T;  3AVR A;  3B13 A;  5LJM A;  3NRX A;  4BA9 A;  1IBL T;  1UX5 A;  4JEH B;  4HFE A;  2NWB A;  4NXM T;  3AEC A;  2OA5 A;  3QB5 A;  3CK6 A;  3P4S A;  4GIW A;  4ILC A;  4GK5 E;  4KBM B;  4QX8 B;  1MMA A;  2X51 A;  4IDQ A;  4COF A;  3NZP A;  4NUV A;  4U7Y A;  4YT0 A;  3LDQ B;  2XJ7 A;  4KX6 A;  5LGT B;  3GN5 A;  4MAL A;  2XY8 B;  5JDF A;  2V5C A;  4JI0 T;  2XAJ B;  1NWM X;  1D0X A;  2XM2 A;  3K3Q C;  4UV9 B;  2BBJ A;  4LF6 T;  4A56 A;  1MND A;  4ZI3 C;  5ABG A;  4HWI B;  2VB6 A;  5L3E B;  3GA8 A;  1J5E T;  2WBL A;  3KDS E;  2BG9 B;  2W67 A;  4GYR A;  4OYK A;  4L5G A;  4IL4 A;  3U78 A;  3VHL A;  2V1D B;  3GMI A;  5ABH A;  3I0O A;  5AQQ B;  4TV8 E;  4EGW A;  3TLS A;  4YTN A;  2KT9 A;  3HA4 A;  3C4W A;  4PNI A;  3ONL C;  4LFC T;  2X9Y A;  2XQ7 A;  4DV1 T;  5ABF B;  3RQW A;  4DV3 T;  2AE9 A;  2BS2 A;  2VKO A;  3PUR A;  1E2A A;  2MBG A;  4EZ4 A;  1IBK T;  4QHO A;  4TN7 B;  4YHH T;  5DJQ C;  2VAS A;  4ZI3 D;  4QH1 A;  5AQS B;  4CN1 A;  4JI6 T;  2CXL A;  2K48 A;  4Z8X A;  4EOZ B;  3N2G E;  2FJD A;  4EYY R;  1M7K A;  3PUY F;  2LLY A;  1JNR A;  4WZX A;  3GN5 B;  3HR0 A;  3LJC A;  2ACX A;  5LXT E;  1J5W A;  2WM9 A;  4IE0 A;  1X79 A;  3LG7 A;  4X1Y E;  2KZ7 B;  4F6R C;  5LMN T;  3C50 A;  2JQ9 A;  3A5X A;  5IUX A;  4O4L E;  3AEF A;  1I6Z A;  1J1J A;  3DTO A;  2V7K A;  1OWA A;  1D1B A;  2MOZ A;  3A8Y C;  3NBX X;  1B7T A;  2E8I A;  3PUV F;  4HEA A;  4JI8 T;  1BR4 A;  1XDP A;  4EEB A;  2UUA T;  4MHC A;  5JVD E;  2L9Q A;  1QSD A;  3UUL A;  2UUB T;  3AE4 A;  3AA6 B;  3KV4 A;  1T98 A;  4DUZ T;  2WP9 A;  1MMG A;  5CFB A;  1ZV4 X;  2A72 A;  2BS4 A;  4N78 D;  2I6H A;  5JDQ A;  2UUC T;  4DR1 T;  2P9B A;  2XQY A;  3ZCI A;  1OED E;  1U5P A;  1UUS A;  2M6B A;  3ESL A;  3KV6 A;  1XWM A;  2C5K T;  2LJL A;  1ZP0 A;  3ZN1 B;  4ANJ A;  1DU2 A;  4EED A;  4NXN T;  4PK6 A;  5LHI B;  3ZYK A;  3F31 A;  4H9R C;  5DAB A;  1W0B A;  2LOS A;  2E9X D;  1W9R A;  3PUA A;  2V6Y B;  3AE5 A;  4B3T T;  3AE3 A;  3TLT A;  3RYI E;  3FBL A;  2Y8D A;  3PJA J;  4I43 B;  5LB7 B;  4LF8 T;  2WS3 A;  5LA6 E;  2B76 A;  3EI0 A;  1NAF A;  2Q9Q A;  4LF4 T;  3UT5 E;  2D5U A;  5L47 A;  4KI0 F;  1W0A A;  2WSS V;  3PUG A;  2X9X A;  2Q9Q B;  4M1P A;  5AQK B;  5L3C B;  4DR3 T;  3ZMU B;  2BS3 A;  2E5V A;  4WNK A;  3MAC A;  1AJ3 A;  2V7M A;  1YQ4 A;  3IA3 A;  4KHZ F;  3SFE A;  4UVB B;  5LNK A;  5KDM C;  2WMN A;  3L8R A;  4X64 T;  4DV0 T;  2N1G A;  4UVC B;  2Q9Q C;  4FI5 A;  2JPF A;  4H9S E;  2X0L B;  5AQI B;  3PUZ F;  3TLW A;  4YSZ A;  4XBF B;  1UK5 A;  1XDO A;  2CWO A;  2V8S V;  2ZLY A;  2ZM8 A;  3BQI A;  3FBZ A;  4UXN B;  2WZH A;  4U74 A;  4QWN B;  2HPJ A;  3PUX F;  3ZJ1 A;  3OVU A;  5HEH A;  3C4X A;  1KK7 A;  2LM2 A;  3FZK B;  5H6R B;  4E7S A;  1FJG T;  2YOE A;  4HTE A;  3SFD A;  5JQG E;  3AE1 A;  4GK0 E;  3FB2 A;  5FKY A;  5FVK A;  3OJA A;  3NWI A;  3DP7 A;  4GOU A;  1I94 T;  2KND A;  1CHU A;  4IGU A;  3U3I A;  3AE8 A;  4X20 E;  3AEG A;  5HEO A;  3ZSS A;  5ABE A;  2Q9Q D;  1IJ6 A;  1CUN A;  2DI4 A;  2I59 A;  2X0Y A;  4HFC A;  3AA0 B;  4TV9 E;  3R84 B;  2Y6X A;  3HI2 A;  3W15 B;  5JDH A;  1ZEE A;  4UIG A;  4HWC A;  1HNX T;  5LOV E;  2FJB A;  2WU5 A;  1MMN A;  4IDZ A;  2RA1 A;  5KXJ A;  2FJE A;  3LK2 B;  2V7L A;  2H88 A;  2YU1 A;  3KFW X;  3LBX A;  5L4E A;  3J9X 1;  4B3S T;  3R6N A;  3HKD E;  1HG5 A;  5FY7 A;  5CGM A;  5KMG P;  1O3X A;  4A98 A;  4G63 A;  3RYF E;  2WDR A;  2IUB A;  3AA1 B;  2MAW A;  3EAM A;  5M4Y A;  3PV0 F;  3FZM B;  5JDL A;  2WZI A;  3G06 A;  3P4W A;  4O4I E;  4UF0 B;  4DBR A;  3B5M A;  4U7I A;  1W09 A;  4B3R T;  4QXB B;  3OYX A;  2DLR A;  4LF5 T;  2XAQ B;  4DR5 T;  2NTX A;  1M62 A;  2MTQ A;  2V7I A;  3HL6 A;  2J47 A;  3VKH A;  2E5L T;  4A97 A;  4DND A;  4OFZ A;  2IC9 A;  2V26 A;  3MA9 A;  2V7J A;  3EHZ A;  4U2Z A;  2XTL A;  2YDS A;  2YU2 A;  5IWA T;  4ZZB A;  2QGS A;  3CX7 B;  1LVK A;  3C64 A;  2E9X C;  3N5L A;  2XAS B;  5FXX A;  1UX4 A;  3LK3 B;  3RIF A;  3RIA A;  3RQU A;  3ZC0 A;  3Q2M A;  2X0H A;  5FL0 A;  4JI7 T;  4KHP T;  5HXR A;  2VKJ A;  2LSK A;  4TX5 A;  2LRK A;  4JLE A;  4I4T E;  3Q5D A;  1N32 T;  2H89 A;  1KF6 A;  3OBV E;  4ZOL E;  3K3N A;  3ZMS B;  3UU3 A;  4ZZC A;  3NRY A;  1S94 A;  3SWH A;  3JAD A;  4CZZ B;  5L3F B;  4O8S A;  2J62 A;  1FEW A;  2W63 A;  3RIU C;  1XNR T;  3CX8 B;  4EXT A;  1WRD A;  3EUH A;  3MZK B;  4UEL A;  2VQF T;  2BVL A;  3LK4 2;  3E0Z A;  4K0K T;  2M6I A;  3V5S A;  3RX6 A;  1HCI A;  2IML A;  3ANW A;  5JDM A;  2XQ5 A;  4UF0 A;  2M67 A;  3N9L A;  4U31 A;  4ZI2 D;  5TAO A;  4JI3 T;  4ZEY A;  5FNV E;  2QYW A;  5CJ5 A;  2UXX B;  3CIR A;  4X62 T;  3AE2 A;  3Q5E A;  4IE5 A;  2NTY A;  1HX1 B;  2IC6 A;  5EK2 A;  2KSR A;  4ASK A;  2C5J A;  4KUM B;  2FJA A;  4ZS2 A;  1HG2 A;  5AQU B;  3JAE A;  3ZKR A;  5HXH A;  3PDY A;  3KV5 A;  2VKD A;  1LKX A;  4DUY T;  5BR8 T;  1OXZ A;  3AXJ B;  4GYS A;  1UCU A;  5LG4 A;  2X67 A;  5LG3 A;  3RKG A;  2CXF A;  5LP6 E;  2BKP A;  5CA1 E;  3ZLI A;  2JQQ A;  4H63 V;  3M65 A;  2XPK A;  1MIV A;  3QOF A;  4K0U A;  4DVD A;  5JDG A;  5LYJ E;  4YFS A;  2A2F X;  5L3G B;  3VR9 A;  2OLT A;  4CXW A;  3HKE E;  3MJX A;  5KX5 E;  4U33 A;  2CHN A;  4IE6 A;  1S35 A;  2VUR A;  1KNP A;  5AQF B;  4ZS3 A;  1Y01 A;  5F5W A;  2JJ9 A;  3RPU A; 
#chains in the Genus database with same CATH homology
 4U2Z A;  2WWV A;  4ZEY A;  3ZSS A;  5CJ5 A;  2DL1 A;  2CRB A;  2WY2 A;  2CPT A;  2K3W A;  4IT4 A;  4A5X A;  3ZST A;  3ZT5 A;  3ZT7 A;  2JQH A;  2V6X A;  2LRL A;  3K1S A;  4U3C A;  2LRK A;  5CGM A;  4CN6 A;  1WCR A;  4CN1 A;  4P1N A;  1WFD A;  4NIQ A;  2V6Y A;  4U7Y A;  4U2Y A;  1YXR A;  3EAB A;  4U7I A;  4WZX A;  2MPK A;  2A9U A;  4CN4 A;  2W2U A;  1WR0 A;  2V6Y B;  2JQK A;  4U33 A;  2RPA A;  2JQ9 A;  3ZT6 A;  5LB7 B;  2XZE A;  5FVK A;  5FVL A;  4U31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...