2JQQA

Solution structure of saccharomyces cerevisiae conserved oligomeric golgi subunit 2 protein (cog2p)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
154
Chain Sequence
KTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQLTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSIIKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of conserved oligomeric Golgi complex subunit 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
molecule keywords Conserved oligomeric Golgi complex subunit 2
total genus 58
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1240 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jqqA00
2JQQA
chains in the Genus database with same CATH superfamily
3VR8A 3E22E 4EEBA 3EVYA 2W62A 3NKZA 5LG4A 5L2LA 4X66T 2J4GA 4IGUA 2X9HA 2JRKA 5L3FB 2DI4A 2H89A 2KINB 2M67A 4CI2B 1KNPA 2XQ9A 5HEGA 5LNKA 2WY2A 2BG9C 3AA7B 3N9QA 4GKKT 2YDQA 1I6ZA 3I0OA 2DHRA 3VU7H 4IDPA 3ZC1A 4ILAA 2YDRA 3ZYLA 2XY8B 2H7VC 3ZYKA 3P4SA 4B3TT 2XAQB 3CVRA 1VCTA 4PK6A 3EI0A 4PFPA 2H88A 2LSIA 4TNWA 3ZMVB 3ZMSB 2WU2A 4AKHA 5L4EA 1XDOA 3TLVA 2BS3A 4UVBB 4V1Av 1IAPA 3ZT7A 2DNXA 4JI7T 5L3BB 3EABA 4CN1A 2LM2A 3CMLA 3HKDE 3PUAA 4YXDA 4A56A 2UXDT 3RX6A 4UF0A 2Y6XA 4H63V 5AQHB 5HYAA 2UUAT 1S94A 2VL0A 4YLHA 5CB4E 4X62T 4LF6T 3OKQA 1KK7A 2I0MA 4ZI3D 3AEGA 3AECA 3RYCE 4DV6T 3PUYF 4H9RC 3O1JA 3AB3B 2AE9A 3CKDA 4B3ST 3UULA 2IAKA 5LHHB 3PUXF 4G63A 1NEKA 2ACZA 1OXZA 5CA1E 4JI6T 4QHOA 4H9OC 4U3CA 5LA6E 2J47A 3O1HA 3H3MA 1JNZA 4HFEA 5LMUT 3RLFF 5JTGA 1KF6A 3SRZA 5ABFB 3KINB 4BAYB 3ETVA 5HXSA 4DUYT 3RH3A 3LDQB 4I0UA 3QB5K 4HE8A 1D1AA 1J5ET 2A9UA 2BS2A 2BG9A 3PUZF 3RI5A 3ZMZB 5LGUB 5LP6E 4O4LE 2X9WA 3UU3A 1XMQT 4NXMT 3L39A 3N2KE 4PW8A 3CX8B 4OYKA 4WNKA 1UX4A 1WR6A 2CHOA 5E0OA 5ABEA 5AQQB 3IF8B 5EZYE 5LYJE 3D0TA 3P7IA 4UELA 2N2NA 2VURA 2NW9A 2UUCT 4LMLA 1FIOA 2Q9QA 2DCFA 3AEEA 3FXDB 4U72A 2XSAA 5H6QB 1KEYA 4IL9A 5JH7E 4ZHQE 2ODUA 2QYWA 5FNVE 2PJQA 5JDMA 5LGNB 4QKNA 5AQSB 4DR4T 2W4XA 3F31A 5JDHA 3CX6B 3I9WA 4IE5A 4YJ2E 3T1YT 4LF5T 1MNDA 3N5LA 4MHCA 5DQVA 5LBQB 3SOLA 4TX5A 1H7CA 3JADA 3N9NA 2D0UA 2M6IA 3RIFA 4O4HE 2MYSA 3UU4A 4O2AE 4YFSA 4AKLA 1QSDA 2W00A 5AQGB 3GWHA 4YT0A 2ZLYA 4NUVA 4ZI2C 3FBZA 2CMRA 2WDQA 5FL0A 4KUMB 1SHZC 4ILBA 3ZCJA 2MPKA 5FXXA 2VQET 4Z91A 3ETUA 4ZZCA 2QGSA 1MNEA 3RKOA 4EGWA 1UGOA 3VKHA 3VHLA 1AJ3A 1HX1B 3HKCE 4IE0A 2XAJB 3NVOA 3KV6A 4TN7B 3VR9A 4ZI7E 1E2AA 5C3JA 4JI3T 3P8CD 4H9PC 4ZS2A 5EK3A 5C8YE 2CPTA 5LJMA 5LJNA 3OYXA 4C91A 3ONXA 3KDSE 1N32T 1G73A 3MA9A 2LHRA 2BKNA 3ESLA 2XQ4A 3LBXB 5AQNB 4X1YE 5A1LA 4DIDB 5LB7B 1ZOYA 4K0UA 3DJBA 2WWVA 5CFBA 3ZYMA 3RYFE 4ZZBA 2VKOA 1FMWA 2W63A 2UXCT 4EB6E 2D9DA 2JJ9A 3HL6A 5KMGP 2NW8A 3BQIA 1E7PA 5M4YA 2W0GA 3L8RA 3TLWA 4DR3T 4WBNE 4X1KE 5F5WA 3SFEA 3RC8A 2C5KT 3Q2MA 3FZLB 2EHOD 2VKJA 2D0TA 2BS4A 3N2GE 4MALA 5FY1A 5KXJA 4JYAT 2BKPA 4J2CA 3NBXX 3H37A 5FY0A 3LK2B 2E9XD 2E9XB 3MKDA 4UEMA 3UUMA 2XASB 4UXNB 2YKSA 3RKGA 2YOEA 4C90A 3K3QC 2VASA 2IIUA 2WQYA 2XAGB 4YTMA 1D0ZA 2JQQA 2IC9A 3AE2A 4UF0B 2VQFT 5LHIB 4A98A 2X66A 1MMAA 2E5VA 1M7KA 3ANWB 4JBWF 2CCQA 1LKXA 3MJXA 4GIWA 4IDNA 4HFIA 5LOVE 2UXBT 4M1PA 4WW0A 1KNZA 2UXXB 1FJGT 4ZS3A 3OBVE 4PK5A 4DMWA 3BQLA 4CI1B 1UX5A 1HTJF 2QA7A 2A72A 3WAJA 3KVAA 3EDVA 3FB2A 1W0AA 5LBMA 3RGLA 2V7MA 3ZJ2A 4NIQA 4DVDA 3VKGA 4F8HA 1ZEEA 3PUVF 5FYMA 2D5UA 4IT4A 4U2ZA 2OLTA 4YSZA 2CEAA 2BBJA 2FJAA 5JDFA 5ABFA 1LRZA 2BBHA 3HKBE 1ZV4X 1WLXA 4HFDA 4AIUA 3N9LA 4DO0A 2LSJA 2E9XC 3ONJA 3P4QA 4U31A 3AVSA 3PE0A 4BJNA 2FJBA 1HCIA 3PTRB 2C0SA 4UVCB 2CXDA 5C2TA 2X67A 3RRCA 4EZHA 3LK3B 3RF1A 5LXTE 4DR5T 4HN9A 2DWKA 2JQKA 3KV5A 4LF4T 3AE9A 2IMLA 2X9YA 2IHR1 5AQRB 4DV5T 1KNRA 4U7YA 2YU1A 1QLBA 2W66A 2XM2A 4IE4A 4I4TE 3P50A 4Z8XA 2C5JA 2LKGA 4HEAA 4KHZF 2MAWA 4YJ3E 3ZN0B 5BR8T 3JC6C 2X68A 5LG3A 4DV4T 3ZMUB 4KI0F 1MMDA 2WDRA 3MK7C 1HNZT 2G0UA 2YEVC 3PUGA 2LKHA 3ABVA 5FVKA 2IW5B 4AXPA 3AE1A 3CQGB 3TLSA 3N9PA 3PJAA 4LF8T 4NXNT 3B13A 4JLEA 3UU6A 2K48A 4LFCT 1HG2A 1EZ3A 1J1JA 2H7OA 4ILUA 4KX6A 3UT5E 2KLQA 1I94T 5AQLB 3IHRA 5KDMC 3DTOA 3ZN1B 2UXNB 2MBGA 1R8IA 3T1HT 2LRKA 3BQKA 5FXVA 3FZFB 5F8PA 3ZT6A 2IDOB 3UFGA 4EV6A 5BMVE 3HA4A 3C98B 2LE8A 4Z90A 1N33T 4DR7T 4DBRA 2I6HA 4HFBA 2X0HA 3NZQA 2MTQA 4HWCA 2VVSA 1XMOT 3LK42 4PFOA 3W15B 1V9DA 5EK4A 4TWDA 2VK9A 5AFUL 2CE7A 3ZKRA 2WMNA 4DR6T 2J62A 2XM1A 1T72A 2MOZA 1MIVA 4COFA 2C5IT 3LBXA 2ACXA 4EYUA 3IBPA 1Y01A 4I55E 2LEHA 3AEBA 3CK6A 4EOZB 5AQFB 2X0YA 2CBIA 4ZXLA 2KWHA 3ONLC 2FUPA 1WYBA 2E8IA 2HN1A 2XQYA 2KNDA 3PDYA 4HWHA 4MLKA 5FXWA 1HX8A 1JNRA 1XZYA 2BG9E 2V7LA 2WAUA 2XPKA 3ZEFB 4YTPA 2ZM6T 4KHPT 2PFVA 4AI6A 4P0BA 5L47A 2LOSA 2E2AA 4IDOA 1WFDA 1CHUA 2XQ3A 1VRBA 3FXEB 1WCRA 5FY7A 4YHHT 1BR0A 2VKHA 2JQHA 2XHEB 3QOFA 5FL1A 4JI1T 2OV9A 2HN2A 3RYIE 3AE5A 4DV3T 3OVUA 4U33A 4ERRA 1S35A 3M65A 2DWGA 4NPPA 5H6RB 4L0RA 5TAOA 5LGTB 3AEAA 3LFMA 4ZEYA 2H3RA 2XZEA 4GK5E 1US7B 2VL8A 4CXXA 2M6BA 3JAEA 3AA6B 1OEDB 1LVFA 1VCSA 4QX7B 2WZHA 4HGAA 3I1AA 4DR2T 4JI4T 4OFZA 5FVLA 3NRYA 2NTXA 2KXPB 3OPCA 5AQKB 4ZOLE 4H9QC 2LRLA 2NTYA 4H9SE 5KX5E 4PJJA 5JR9A 5JDLA 2KSRA 4G2AA 4ANJA 2CWOA 3E08A 2CLYB 3Q5EA 5L3CB 3CQCB 2L9QA 2AXDS 2I59A 3Q5XA 3SFDA 3E0ZA 3PURA 5HXCA 3IEEA 4EYYR 1D0YA 4IREA 1UURA 4CXYA 4GOUA 4DV7T 3AEFA 2B1EA 2WZIA 3DP7A 3EAMA 3GMIA 4NUUA 1BR1A 2KT9A 4TWFA 3O9XA 4B3MT 4I50E 4ASKA 3C4ZA 2WCAA 3UQ4A 2WS3A 4CN6A 2E9XA 5IUXA 4YHJA 5JRCB 4AKIA 3BK9A 2N9DA 4FI5A 4P1NA 3IA3A 4YSXA 2BG9B 5HXRA 5JDQA 4E7ZA 5JREA 3GN5A 4PK4A 2CHNA 3U78A 1SE7A 2NP9A 2JPFA 1VOMA 1ZKEA 2JMHA 2PBIA 4OYJA 3B57A 4X64T 3AE8A 2WBLA 3PUWF 3U3IA 4AQFA 5ETWA 2CLYC 3C64A 2CRBA 3UUXB 4DV1T 3NZPA 4DNDA 5LHGB 2W61A 3ZSSA 4KBMB 4AISA 4HWFA 4LFBT 1YQ4A 3UTKA 2NR4A 3C4XA 4U74A 1WYCA 2IC6A 3PV0F 2LT3A 2BDEA 5IYZE 1OEDC 3V5SA 2V7JA 3R6NA 3RIAA 2BZBA 4TV9E 1L0VA 3UFEA 4JI2T 3C50A 2WM9A 3AE4A 4UIGA 5FKYA 2KWIB 3OYZA 1IBLT 2KZ7B 4O2BE 5DJQC 1HNWT 2W2UA 3PJAJ 1W09A 3ZLIA 4CXWA 4ISSA 1T8BA 2NOXA 1UCUA 5J0ZA 1XNQT 1HFAA 2XAHB 3A5XA 3LJCA 3H3AA 4ILCA 1HS7A 2CA5A 2L3LA 3F2EA 3KFWX 4CN4A 4YTNA 4P0AA 3RQUA 1OEDE 3CWZB 2Y48B 1YKHB 2YN6A 3MXZA 3M3ZB 3PUSA 4OHFA 5JVDE 3UUBA 4EEDA 5CJ5A 4DR1T 3FBLA 2CXLA 5L3DB 4X20E 1IBMT 3LG7A 3RRWA 5HWYA 3K8PC 1HNXT 2A2FX 5AQIB 1X9BA 2YINA 5EK2A 2ES0A 2Z6EA 2OA5A 4GKJT 2V26A 3WI3A 4X5TA 2XQ5A 3RYHE 2XAFB 4JV5T 1IJ5A 3AAIA 1D1BA 1YD8G 4EZ4A 3UQ7A 3RQWA 3VRAA 2ODVA 4JUYA 4U7IA 5AQVB 1ZHCA 2YU2A 5ABGA 4HFHA 5JDNA 2Q9QC 1FMVA 3CPZA 2CWYA 2EHOB 2P9BA 2R6GF 3S4UA 2X0LB 5JR9C 3FHNA 3X1DA 2LSYA 3C4WA 1YXRA 3F57A 3NWIA 3QK6A 5HEUA 2XQAA 5HCJA 2V7KA 2PTFA 4TUYE 2E5LT 3L09A 2ZM2A 2QRXA 2XQ7A 3RHWA 5JDGA 3OTOT 2F4VT 3ZT5A 3AEDA 3R84B 4KMCA 5IWAT 4IIJE 3N9MA 2D2SA 1BR4A 5ABHA 1IJ6A 2GK9A 5HWXA 4PJLA 3UU8A 4H63H 2FJDA 3QUJA 4IL4A 1UK5A 3JAFA 1OWAA 4UV9B 5AQPB 3RIUC 3PUQA 3V5UA 3ZJ1A 3QC9A 2LSGA 2JQ9A 4L9IA 4YSYA 4QXHB 2HPJA 5HCMA 3RC3A 3AE7A 1YW0A 2CXFA 1MIWA 2XJ7A 3CIRA 2PG8A 3AXJB 3B5MA 4TWHA 5HXEA 5J2TE 1D0XA 4H9NC 2V6YA 4CQIA 4LFAT 2YK0A 1MIYA 1NWMX 4WYVA 4BJMA 4PAGA 2ZMAA 3PU3A 5FXZA 2WB5A 1DU2A 2WWUA 2XQ8A 4JEHB 4A97A 1LVKA 5ADXL 5L3EB 2V1DB 5HEHA 1XWMA 4DMVA 1N34T 1T7SA 2LLYA 1YKEB 2ZM8A 5DABA 3TKLB 4E7SA 1SUMB 2J1DG 3ZSTA 4BA9A 3Q9DA 3ZCIA 4LMJA 3AAEB 5JQGE 4UVAB 4I43B 4N78D 4JEUB 4MBQA 4XBFB 3KVBA 2LSKA 3Q5DA 4IDZA 4DBQA 4K0KT 3LSVA 2LJLA 4GYSA 4HWDA 2YDSA 4P09A 3K3OA 4EAHA 4AKGA 1Z8UA 1G8XA 1E1HB 2XQ6A 2RP4A 4CI3B 4XAXB 5IHYA 4AQGA 1N36T 1Y64B 2NWBA 2W67A 4HFVA 3MZKB 2JIWA 2L8KA 4AQFC 4AKRB 5J1GA 1IZNB 1SA0E 2VWAA 3KV4A 2V8SV 3K1SA 2NW7A 1QUUA 4O4JE 1OEDA 4TZ4C 5DQWA 3UU5A 4B6XA 2HPLA 4U2YA 5CGMA 4O8SA 4LF9T 3QB5A 2HHHT 2Y8DA 1ZP0A 1M62A 3JCFA 4UV8B 3AXJA 3A7MA 3TLTA 4ADZA 2VKDA 2VB6A 4QXCB 2V6YB 4PNIA 5LCYA 4QH4A 2FBWA 1WR0A 2KMFA 2LM9A 4JI5T 2LOPA 3FZMB 3KBTA 4PJMA 5FP3A 4CZZB 3JC6D 1BR2A 4YY3T 3CX7B 2UU9T 1YQ3A 2V7IA 1MMNA 1D1CA 1W0BA 2K5BB 3EHZA 2JMKA 3G06A 3WAKA 1T98A 3ZMTB 4ZI3C 2RA1A 5CA0E 1NAFA 2DL1A 4DV0T 1X79A 5JRCA 2XTLA 4HTEA 3GN5B 4X1IE 5J2UE 2K24A 4GYRA 3NRXA 2BVMA 4PJNA 5AQMB 2HH7A 3AAAB 4JI8T 3UUNA 1IBKT 1B7TA 2IUBA 4TNVA 3EUHA 1XNRT 2CBJA 2N1GA 2K3WA 3ANWA 3OJAA 5L3GB 4XZCA 4Q25A 1CUNA 4LF7T 4KP3C 2XUEA 5AQUB 4MFRA 2RPAA 5AQTB 1GQEA 2K9AA 4DUZT 4F6RC 4LMKA 3K3NA 1NENA 1W9RA 4TV8E 4QXBB 5JR9B 3J9X1 2EHOC 2FJEA 3O4XE 3I0QA 2Q9QB 3O1IA 2CM0A 3RPUA 5LMNT 4B3RT 3A8YC 4QX8B 3SS1A 3T8OA 2Q9QD 5L4HA 1WRDA 4QH1A 4IE6A 4L5GA 3J7Yq 2V5DA 3KV9A 2WU5A 3HI2A 4IDQA 2X51A 3P4RA 3P4PA 5HEOA 2LHNA 3EDUA 3FZHB 3QNUA 1MMGA 3RIUA 2UUBT 3KBUA 2WMOA 1XDPA 2V6XA 1FEWA 1Z0PA 1J5WA 2A3DA 2VVNA 3L3PA 4DV2T 4QWNB 3FZKB 5HAXA 4AQYT 3ZC0A 3MACA 3N9OA 2V5CA 2WSSV 3P4WA 2X9XA 1HG5A 3HR0A 4QH5A 4A5XA 4HFCA 4ZI2D 4EIWA 1HR0T 4OX9T 3VRBA 3I9YA 3C51A 3SWHA 5FMNA 1HF8A 4HWIB 2ZM0A 2DLRA 4WBOA 4EXTA 2WP9A 5F3JA 4UR9A 3TLUA 3AVRA 3AA1B 3AA0B 1U5PA 1UUSA 1KFYA 4IHJE 2QVAA 4ISTA 3PU8A 4WZXA 2SPCA 5GONE 3CQXC 4IE7A 2B76A 4FJOA 2WDVA 3AE3A 4JI0T 3Q5WA 3N2OA 4O4IE 4HKAA 4X65T 2BVLA 4GK0E 5HXHA 3GA8A 3AE6A 4OK0A 2EHOA 3ZPOA 5HEJA 2BKOA 5AQJB 1U4QA 5AQOB 1O3XA 2XSBA 3HKEE
chains in the Genus database with same CATH topology
3E22E 3EVYA 2W62A 5L2LA 5LG4A 4IGUA 2X9HA 2JRKA 5L3FB 2DI4A 2KINB 2M67A 4CI2B 5LNKA 3AA7B 3N9QA 3I0OA 2DHRA 3VU7H 3ZC1A 3ZYLA 2H7VC 3ZYKA 2XAQB 3CVRA 4PK6A 4PFPA 2LSIA 3ZMVB 3ZMSB 4AKHA 4UVBB 4V1Av 1IAPA 2DNXA 5L3BB 3CMLA 3HKDE 3PUAA 4A56A 3RX6A 4UF0A 2Y6XA 4H63V 5HYAA 1S94A 4YLHA 5CB4E 3OKQA 1KK7A 4ZI3D 3RYCE 4H9RC 3O1JA 3AB3B 3CKDA 3UULA 2IAKA 5LHHB 4G63A 5CA1E 1OXZA 4QHOA 4H9OC 5LA6E 3O1HA 3SRZA 3KINB 4BAYB 3ETVA 5HXSA 3RH3A 4HE8A 1D1AA 3ZMZB 5LGUB 4O4LE 2X9WA 3N2KE 4WNKA 4PW8A 3CX8B 4OYKA 1UX4A 1WR6A 5E0OA 3IF8B 5EZYE 5LYJE 3D0TA 3P7IA 4UELA 2N2NA 2NW9A 1FIOA 2Q9QA 2DCFA 3FXDB 4U72A 5H6QB 5JH7E 4ZHQE 2ODUA 5FNVE 2PJQA 5JDMA 5LGNB 4QKNA 3F31A 5JDHA 3CX6B 3I9WA 4IE5A 4YJ2E 1MNDA 3N5LA 4MHCA 5DQVA 5LBQB 3SOLA 4TX5A 1H7CA 3N9NA 2D0UA 4O4HE 2MYSA 4O2AE 4YFSA 4AKLA 1QSDA 2W00A 3GWHA 2ZLYA 4NUVA 4ZI2C 3FBZA 2CMRA 3ZCJA 4KUMB 1SHZC 5FXXA 3ETUA 2QGSA 1MNEA 3RKOA 3VKHA 3VHLA 1AJ3A 4IE0A 3HKCE 2XAJB 3KV6A 4TN7B 4ZI7E 3P8CD 4H9PC 4ZS2A 5EK3A 5C8YE 5LJMA 5LJNA 3OYXA 4C91A 3ONXA 3KDSE 1G73A 3MA9A 2LHRA 3ESLA 3LBXB 4X1YE 5A1LA 4K0UA 3DJBA 3ZYMA 3RYFE 2VKOA 1FMWA 2W63A 4EB6E 2JJ9A 3HL6A 5KMGP 2NW8A 3BQIA 5M4YA 2W0GA 4WBNE 4X1KE 3RC8A 2C5KT 3Q2MA 2EHOD 2VKJA 2D0TA 3N2GE 4MALA 5FY1A 4J2CA 3NBXX 3H37A 5FY0A 3LK2B 2E9XD 2E9XB 3MKDA 4UEMA 3UUMA 2XASB 4UXNB 4C90A 3K3QC 2VASA 2XAGB 1D0ZA 2JQQA 2IC9A 4UF0B 5LHIB 2X66A 1MMAA 3ANWB 2CCQA 1LKXA 3MJXA 4GIWA 5LOVE 4M1PA 4WW0A 1KNZA 2UXXB 4ZS3A 3OBVE 4PK5A 4DMWA 3BQLA 4CI1B 1UX5A 1HTJF 2QA7A 2A72A 3WAJA 3KVAA 3EDVA 3FB2A 5LBMA 3ZJ2A 4DVDA 2V7MA 3VKGA 1ZEEA 5FYMA 2D5UA 2CEAA 1LRZA 5F3JA 3HKBE 1ZV4X 1WLXA 4DO0A 3N9LA 2LSJA 2E9XC 4BJNA 3AVSA 3PE0A 1HCIA 3PTRB 2C0SA 4UVCB 2CXDA 2X67A 3RRCA 4EZHA 3LK3B 5LXTE 4HN9A 2DWKA 3KV5A 2X9YA 2YU1A 4IE4A 4I4TE 4Z8XA 2C5JA 4HEAA 4YJ3E 3ZN0B 3JC6C 2X68A 3ZMUB 1MMDA 3MK7C 2G0UA 2YEVC 3PUGA 2IW5B 4AXPA 3CQGB 3N9PA 3B13A 4JLEA 2K48A 1HG2A 1EZ3A 2H7OA 4ILUA 3UT5E 2KLQA 5KDMC 3IHRA 3DTOA 3ZN1B 2UXNB 2MBGA 3BQKA 5FXVA 5F8PA 5BMVE 3HA4A 3C98B 2LE8A 4DBRA 3NZQA 2MTQA 3LK42 4PFOA 3W15B 1V9DA 5EK4A 5AFUL 2VK9A 2CE7A 2WMNA 2MOZA 1MIVA 2C5IT 3LBXA 2ACXA 4EYUA 3IBPA 4I55E 2LEHA 4EOZB 2KWHA 3PDYA 5JDFA 1WYBA 2E8IA 2XQYA 3TKLB 2KNDA 4MLKA 5FXWA 1HX8A 2V7LA 2WAUA 3ZEFB 2PFVA 4AI6A 4P0BA 2LOSA 5FY7A 1VRBA 3FXEB 1BR0A 2VKHA 2XHEB 3RYIE 4ERRA 1S35A 3M65A 2DWGA 5H6RB 4L0RA 5TAOA 5LGTB 3LFMA 2H3RA 4GK5E 4CXXA 1US7B 2VL8A 3AA6B 1LVFA 4QX7B 4HGAA 3I1AA 4OFZA 3NRYA 2NTXA 2KXPB 4ZOLE 4H9QC 4H9SE 2NTYA 5KX5E 4PJJA 5JR9A 5JDLA 4G2AA 4ANJA 2CWOA 3E08A 2CLYB 5L3CB 3CQCB 2L9QA 2I59A 3Q5XA 3E0ZA 3PURA 5HXCA 3IEEA 4EYYR 1D0YA 4CXYA 4GOUA 2B1EA 3DP7A 3GMIA 4NUUA 4XBFB 1BR1A 2KT9A 3O9XA 4I50E 4ASKA 3C4ZA 2E9XA 4YHJA 5JRCB 4AKIA 3BK9A 2N9DA 4FI5A 5HXRA 5JDQA 4E7ZA 5JREA 3GN5A 4PK4A 3U78A 2NP9A 1VOMA 1ZKEA 2JMHA 2JPFA 2PBIA 4OYJA 3B57A 2WBLA 3U3IA 4AQFA 2CLYC 3C64A 3UUXB 3NZPA 4DNDA 5LHGB 2W61A 4KBMB 3UTKA 3C4XA 4U74A 1WYCA 2IC6A 2LT3A 2BDEA 5IYZE 3V5SA 2V7JA 3R6NA 2BZBA 4TV9E 3UFEA 3C50A 2WM9A 4UIGA 2KWIB 3OYZA 2KZ7B 4O2BE 5DJQC 3ZLIA 4CXWA 4ISSA 2NOXA 1UCUA 1HFAA 2XAHB 3A5XA 3LJCA 3H3AA 1HS7A 2CA5A 2L3LA 3F2EA 3KFWX 4P0AA 3MXZA 3CWZB 2Y48B 1YKHB 3PUSA 5JVDE 4OHFA 3FBLA 2CXLA 5L3DB 4X20E 3LG7A 3RRWA 5HWYA 3K8PC 2A2FX 2YINA 5EK2A 2ES0A 2Z6EA 2OA5A 2V26A 3WI3A 3RYHE 2XAFB 1IJ5A 3AAIA 1D1BA 1YD8G 4EZ4A 2ODVA 4JUYA 1ZHCA 2YU2A 5JDNA 3CPZA 2Q9QC 1FMVA 2CWYA 2EHOB 2P9BA 3S4UA 2X0LB 5JR9C 3FHNA 2LSYA 3C4WA 3F57A 3QK6A 2V7KA 4TUYE 3L09A 2ZM2A 5JDGA 3R84B 4KMCA 4IIJE 3N9MA 2D2SA 1BR4A 1IJ6A 2GK9A 5HWXA 4PJLA 4H63H 3QUJA 4UV9B 1OWAA 3PUQA 3V5UA 3ZJ1A 3QC9A 2LSGA 4L9IA 4QXHB 2HPJA 3RC3A 1YW0A 2CXFA 1MIWA 2PG8A 5HXEA 5J2TE 1D0XA 4H9NC 4CQIA 2YK0A 1MIYA 1NWMX 4BJMA 4PAGA 2ZMAA 3PU3A 5FXZA 2WWUA 4JEHB 1LVKA 5ADXL 5L3EB 2V1DB 4DMVA 1YKEB 2ZM8A 5DABA 4E7SA 2J1DG 4BA9A 3Q9DA 3ZCIA 3AAEB 5JQGE 4UVAB 4I43B 4N78D 4JEUB 4MBQA 3KVBA 2LSKA 4IDZA 4DBQA 2LJLA 4GYSA 4P09A 4EAHA 4AKGA 3K3OA 1G8XA 1E1HB 2RP4A 4CI3B 4XAXB 5IHYA 4AQGA 1Y64B 2NWBA 4HFVA 3MZKB 2L8KA 4AQFC 4AKRB 5J1GA 1IZNB 1SA0E 2VWAA 3KV4A 4O4JE 5ETWA 2NW7A 1QUUA 4TZ4C 5DQWA 4B6XA 2HPLA 4O8SA 2Y8DA 4UV8B 4ADZA 2VKDA 2VB6A 4QXCB 5LCYA 4PNIA 2LM9A 2KMFA 4CZZB 2LOPA 3KBTA 4PJMA 5FP3A 3JC6D 1BR2A 3CX7B 2V7IA 1MMNA 1D1CA 2K5BB 2JMKA 3WAKA 5CA0E 1T98A 3ZMTB 4ZI3C 2RA1A 5JRCA 1NAFA 1X79A 2XTLA 4HTEA 3GN5B 4X1IE 5J2UE 2K24A 4GYRA 3NRXA 2BVMA 4PJNA 2HH7A 3AAAB 3UUNA 1B7TA 3EUHA 2N1GA 3ANWA 3OJAA 5L3GB 4XZCA 1CUNA 4KP3C 2XUEA 4MFRA 2K9AA 4F6RC 3K3NA 4TV8E 5JR9B 4QXBB 3J9X1 2EHOC 3O4XE 3I0QA 2Q9QB 3O1IA 2CM0A 3RPUA 4QX8B 3T8OA 3SS1A 2Q9QD 1WRDA 4IE6A 4L5GA 3J7Yq 3KV9A 3HI2A 2X51A 2LHNA 3EDUA 1MMGA 3KBUA 2WMOA 1Z0PA 1FEWA 3L3PA 2A3DA 4QWNB 5HAXA 3ZC0A 3MACA 3N9OA 2WSSV 2X9XA 1HG5A 3HR0A 4ZI2D 4EIWA 3I9YA 3C51A 3SWHA 5FMNA 1HF8A 2ZM0A 2DLRA 4WBOA 4EXTA 3AVRA 3AA1B 3AA0B 1U5PA 4IHJE 4ISTA 3PU8A 2SPCA 5GONE 3CQXC 4IE7A 4FJOA 3Q5WA 3N2OA 4O4IE 4HKAA 2BVLA 4GK0E 5HXHA 3GA8A 4OK0A 2EHOA 3ZPOA 1U4QA 5LP6E 1O3XA 3HKEE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQQ A; 
#chains in the Genus database with same CATH topology
 3VR8 A;  3E22 E;  4EEB A;  3EVY A;  2W62 A;  3NKZ A;  5LG4 A;  5L2L A;  4X66 T;  2J4G A;  4IGU A;  2X9H A;  2JRK A;  5L3F B;  2DI4 A;  2H89 A;  2KIN B;  2M67 A;  4CI2 B;  1KNP A;  2XQ9 A;  5HEG A;  5LNK A;  2WY2 A;  2BG9 C;  3AA7 B;  3N9Q A;  4GKK T;  2YDQ A;  1I6Z A;  3I0O A;  2DHR A;  3VU7 H;  4IDP A;  3ZC1 A;  4ILA A;  2YDR A;  3ZYL A;  2XY8 B;  2H7V C;  3ZYK A;  3P4S A;  4B3T T;  2XAQ B;  3CVR A;  1VCT A;  4PK6 A;  3EI0 A;  4PFP A;  2H88 A;  2LSI A;  4TNW A;  3ZMV B;  3ZMS B;  2WU2 A;  4AKH A;  5L4E A;  1XDO A;  3TLV A;  2BS3 A;  4UVB B;  4V1A v;  1IAP A;  3ZT7 A;  2DNX A;  4JI7 T;  5L3B B;  3EAB A;  4CN1 A;  2LM2 A;  3CML A;  3HKD E;  3PUA A;  4YXD A;  4A56 A;  2UXD T;  3RX6 A;  4UF0 A;  2Y6X A;  4H63 V;  5AQH B;  5HYA A;  2UUA T;  1S94 A;  2VL0 A;  4YLH A;  5CB4 E;  4X62 T;  4LF6 T;  3OKQ A;  1KK7 A;  2I0M A;  4ZI3 D;  3AEG A;  3AEC A;  3RYC E;  4DV6 T;  3PUY F;  4H9R C;  3O1J A;  3AB3 B;  2AE9 A;  3CKD A;  4B3S T;  3UUL A;  2IAK A;  5LHH B;  3PUX F;  4G63 A;  1NEK A;  2ACZ A;  1OXZ A;  5CA1 E;  4JI6 T;  4QHO A;  4H9O C;  4U3C A;  5LA6 E;  2J47 A;  3O1H A;  3H3M A;  1JNZ A;  4HFE A;  5LMU T;  3RLF F;  5JTG A;  1KF6 A;  3SRZ A;  5ABF B;  3KIN B;  4BAY B;  3ETV A;  5HXS A;  4DUY T;  3RH3 A;  3LDQ B;  4I0U A;  3QB5 K;  4HE8 A;  1D1A A;  1J5E T;  2A9U A;  2BS2 A;  2BG9 A;  3PUZ F;  3RI5 A;  3ZMZ B;  5LGU B;  5LP6 E;  4O4L E;  2X9W A;  3UU3 A;  1XMQ T;  4NXM T;  3L39 A;  3N2K E;  4PW8 A;  3CX8 B;  4OYK A;  4WNK A;  1UX4 A;  1WR6 A;  2CHO A;  5E0O A;  5ABE A;  5AQQ B;  3IF8 B;  5EZY E;  5LYJ E;  3D0T A;  3P7I A;  4UEL A;  2N2N A;  2VUR A;  2NW9 A;  2UUC T;  4LML A;  1FIO A;  2Q9Q A;  2DCF A;  3AEE A;  3FXD B;  4U72 A;  2XSA A;  5H6Q B;  1KEY A;  4IL9 A;  5JH7 E;  4ZHQ E;  2ODU A;  2QYW A;  5FNV E;  2PJQ A;  5JDM A;  5LGN B;  4QKN A;  5AQS B;  4DR4 T;  2W4X A;  3F31 A;  5JDH A;  3CX6 B;  3I9W A;  4IE5 A;  4YJ2 E;  3T1Y T;  4LF5 T;  1MND A;  3N5L A;  4MHC A;  5DQV A;  5LBQ B;  3SOL A;  4TX5 A;  1H7C A;  3JAD A;  3N9N A;  2D0U A;  2M6I A;  3RIF A;  4O4H E;  2MYS A;  3UU4 A;  4O2A E;  4YFS A;  4AKL A;  1QSD A;  2W00 A;  5AQG B;  3GWH A;  4YT0 A;  2ZLY A;  4NUV A;  4ZI2 C;  3FBZ A;  2CMR A;  2WDQ A;  5FL0 A;  4KUM B;  1SHZ C;  4ILB A;  3ZCJ A;  2MPK A;  5FXX A;  2VQE T;  4Z91 A;  3ETU A;  4ZZC A;  2QGS A;  1MNE A;  3RKO A;  4EGW A;  1UGO A;  3VKH A;  3VHL A;  1AJ3 A;  1HX1 B;  3HKC E;  4IE0 A;  2XAJ B;  3NVO A;  3KV6 A;  4TN7 B;  3VR9 A;  4ZI7 E;  1E2A A;  5C3J A;  4JI3 T;  3P8C D;  4H9P C;  4ZS2 A;  5EK3 A;  5C8Y E;  2CPT A;  5LJM A;  5LJN A;  3OYX A;  4C91 A;  3ONX A;  3KDS E;  1N32 T;  1G73 A;  3MA9 A;  2LHR A;  2BKN A;  3ESL A;  2XQ4 A;  3LBX B;  5AQN B;  4X1Y E;  5A1L A;  4DID B;  5LB7 B;  1ZOY A;  4K0U A;  3DJB A;  2WWV A;  5CFB A;  3ZYM A;  3RYF E;  4ZZB A;  2VKO A;  1FMW A;  2W63 A;  2UXC T;  4EB6 E;  2D9D A;  2JJ9 A;  3HL6 A;  5KMG P;  2NW8 A;  3BQI A;  1E7P A;  5M4Y A;  2W0G A;  3L8R A;  3TLW A;  4DR3 T;  4WBN E;  4X1K E;  5F5W A;  3SFE A;  3RC8 A;  2C5K T;  3Q2M A;  3FZL B;  2EHO D;  2VKJ A;  2D0T A;  2BS4 A;  3N2G E;  4MAL A;  5FY1 A;  5KXJ A;  4JYA T;  2BKP A;  4J2C A;  3NBX X;  3H37 A;  5FY0 A;  3LK2 B;  2E9X D;  2E9X B;  3MKD A;  4UEM A;  3UUM A;  2XAS B;  4UXN B;  2YKS A;  3RKG A;  2YOE A;  4C90 A;  3K3Q C;  2VAS A;  2IIU A;  2WQY A;  2XAG B;  4YTM A;  1D0Z A;  2JQQ A;  2IC9 A;  3AE2 A;  4UF0 B;  2VQF T;  5LHI B;  4A98 A;  2X66 A;  1MMA A;  2E5V A;  1M7K A;  3ANW B;  4JBW F;  2CCQ A;  1LKX A;  3MJX A;  4GIW A;  4IDN A;  4HFI A;  5LOV E;  2UXB T;  4M1P A;  4WW0 A;  1KNZ A;  2UXX B;  1FJG T;  4ZS3 A;  3OBV E;  4PK5 A;  4DMW A;  3BQL A;  4CI1 B;  1UX5 A;  1HTJ F;  2QA7 A;  2A72 A;  3WAJ A;  3KVA A;  3EDV A;  3FB2 A;  1W0A A;  5LBM A;  3RGL A;  2V7M A;  3ZJ2 A;  4NIQ A;  4DVD A;  3VKG A;  4F8H A;  1ZEE A;  3PUV F;  5FYM A;  2D5U A;  4IT4 A;  4U2Z A;  2OLT A;  4YSZ A;  2CEA A;  2BBJ A;  2FJA A;  5JDF A;  5ABF A;  1LRZ A;  2BBH A;  3HKB E;  1ZV4 X;  1WLX A;  4HFD A;  4AIU A;  3N9L A;  4DO0 A;  2LSJ A;  2E9X C;  3ONJ A;  3P4Q A;  4U31 A;  3AVS A;  3PE0 A;  4BJN A;  2FJB A;  1HCI A;  3PTR B;  2C0S A;  4UVC B;  2CXD A;  5C2T A;  2X67 A;  3RRC A;  4EZH A;  3LK3 B;  3RF1 A;  5LXT E;  4DR5 T;  4HN9 A;  2DWK A;  2JQK A;  3KV5 A;  4LF4 T;  3AE9 A;  2IML A;  2X9Y A;  2IHR 1;  5AQR B;  4DV5 T;  1KNR A;  4U7Y A;  2YU1 A;  1QLB A;  2W66 A;  2XM2 A;  4IE4 A;  4I4T E;  3P50 A;  4Z8X A;  2C5J A;  2LKG A;  4HEA A;  4KHZ F;  2MAW A;  4YJ3 E;  3ZN0 B;  5BR8 T;  3JC6 C;  2X68 A;  5LG3 A;  4DV4 T;  3ZMU B;  4KI0 F;  1MMD A;  2WDR A;  3MK7 C;  1HNZ T;  2G0U A;  2YEV C;  3PUG A;  2LKH A;  3ABV A;  5FVK A;  2IW5 B;  4AXP A;  3AE1 A;  3CQG B;  3TLS A;  3N9P A;  3PJA A;  4LF8 T;  4NXN T;  3B13 A;  4JLE A;  3UU6 A;  2K48 A;  4LFC T;  1HG2 A;  1EZ3 A;  1J1J A;  2H7O A;  4ILU A;  4KX6 A;  3UT5 E;  2KLQ A;  1I94 T;  5AQL B;  3IHR A;  5KDM C;  3DTO A;  3ZN1 B;  2UXN B;  2MBG A;  1R8I A;  3T1H T;  2LRK A;  3BQK A;  5FXV A;  3FZF B;  5F8P A;  3ZT6 A;  2IDO B;  3UFG A;  4EV6 A;  5BMV E;  3HA4 A;  3C98 B;  2LE8 A;  4Z90 A;  1N33 T;  4DR7 T;  4DBR A;  2I6H A;  4HFB A;  2X0H A;  3NZQ A;  2MTQ A;  4HWC A;  2VVS A;  1XMO T;  3LK4 2;  4PFO A;  3W15 B;  1V9D A;  5EK4 A;  4TWD A;  2VK9 A;  5AFU L;  2CE7 A;  3ZKR A;  2WMN A;  4DR6 T;  2J62 A;  2XM1 A;  1T72 A;  2MOZ A;  1MIV A;  4COF A;  2C5I T;  3LBX A;  2ACX A;  4EYU A;  3IBP A;  1Y01 A;  4I55 E;  2LEH A;  3AEB A;  3CK6 A;  4EOZ B;  5AQF B;  2X0Y A;  2CBI A;  4ZXL A;  2KWH A;  3ONL C;  2FUP A;  1WYB A;  2E8I A;  2HN1 A;  2XQY A;  2KND A;  3PDY A;  4HWH A;  4MLK A;  5FXW A;  1HX8 A;  1JNR A;  1XZY A;  2BG9 E;  2V7L A;  2WAU A;  2XPK A;  3ZEF B;  4YTP A;  2ZM6 T;  4KHP T;  2PFV A;  4AI6 A;  4P0B A;  5L47 A;  2LOS A;  2E2A A;  4IDO A;  1WFD A;  1CHU A;  2XQ3 A;  1VRB A;  3FXE B;  1WCR A;  5FY7 A;  4YHH T;  1BR0 A;  2VKH A;  2JQH A;  2XHE B;  3QOF A;  5FL1 A;  4JI1 T;  2OV9 A;  2HN2 A;  3RYI E;  3AE5 A;  4DV3 T;  3OVU A;  4U33 A;  4ERR A;  1S35 A;  3M65 A;  2DWG A;  4NPP A;  5H6R B;  4L0R A;  5TAO A;  5LGT B;  3AEA A;  3LFM A;  4ZEY A;  2H3R A;  2XZE A;  4GK5 E;  1US7 B;  2VL8 A;  4CXX A;  2M6B A;  3JAE A;  3AA6 B;  1OED B;  1LVF A;  1VCS A;  4QX7 B;  2WZH A;  4HGA A;  3I1A A;  4DR2 T;  4JI4 T;  4OFZ A;  5FVL A;  3NRY A;  2NTX A;  2KXP B;  3OPC A;  5AQK B;  4ZOL E;  4H9Q C;  2LRL A;  2NTY A;  4H9S E;  5KX5 E;  4PJJ A;  5JR9 A;  5JDL A;  2KSR A;  4G2A A;  4ANJ A;  2CWO A;  3E08 A;  2CLY B;  3Q5E A;  5L3C B;  3CQC B;  2L9Q A;  2AXD S;  2I59 A;  3Q5X A;  3SFD A;  3E0Z A;  3PUR A;  5HXC A;  3IEE A;  4EYY R;  1D0Y A;  4IRE A;  1UUR A;  4CXY A;  4GOU A;  4DV7 T;  3AEF A;  2B1E A;  2WZI A;  3DP7 A;  3EAM A;  3GMI A;  4NUU A;  1BR1 A;  2KT9 A;  4TWF A;  3O9X A;  4B3M T;  4I50 E;  4ASK A;  3C4Z A;  2WCA A;  3UQ4 A;  2WS3 A;  4CN6 A;  2E9X A;  5IUX A;  4YHJ A;  5JRC B;  4AKI A;  3BK9 A;  2N9D A;  4FI5 A;  4P1N A;  3IA3 A;  4YSX A;  2BG9 B;  5HXR A;  5JDQ A;  4E7Z A;  5JRE A;  3GN5 A;  4PK4 A;  2CHN A;  3U78 A;  1SE7 A;  2NP9 A;  2JPF A;  1VOM A;  1ZKE A;  2JMH A;  2PBI A;  4OYJ A;  3B57 A;  4X64 T;  3AE8 A;  2WBL A;  3PUW F;  3U3I A;  4AQF A;  5ETW A;  2CLY C;  3C64 A;  2CRB A;  3UUX B;  4DV1 T;  3NZP A;  4DND A;  5LHG B;  2W61 A;  3ZSS A;  4KBM B;  4AIS A;  4HWF A;  4LFB T;  1YQ4 A;  3UTK A;  2NR4 A;  3C4X A;  4U74 A;  1WYC A;  2IC6 A;  3PV0 F;  2LT3 A;  2BDE A;  5IYZ E;  1OED C;  3V5S A;  2V7J A;  3R6N A;  3RIA A;  2BZB A;  4TV9 E;  1L0V A;  3UFE A;  4JI2 T;  3C50 A;  2WM9 A;  3AE4 A;  4UIG A;  5FKY A;  2KWI B;  3OYZ A;  1IBL T;  2KZ7 B;  4O2B E;  5DJQ C;  1HNW T;  2W2U A;  3PJA J;  1W09 A;  3ZLI A;  4CXW A;  4ISS A;  1T8B A;  2NOX A;  1UCU A;  5J0Z A;  1XNQ T;  1HFA A;  2XAH B;  3A5X A;  3LJC A;  3H3A A;  4ILC A;  1HS7 A;  2CA5 A;  2L3L A;  3F2E A;  3KFW X;  4CN4 A;  4YTN A;  4P0A A;  3RQU A;  1OED E;  3CWZ B;  2Y48 B;  1YKH B;  2YN6 A;  3MXZ A;  3M3Z B;  3PUS A;  4OHF A;  5JVD E;  3UUB A;  4EED A;  5CJ5 A;  4DR1 T;  3FBL A;  2CXL A;  5L3D B;  4X20 E;  1IBM T;  3LG7 A;  3RRW A;  5HWY A;  3K8P C;  1HNX T;  2A2F X;  5AQI B;  1X9B A;  2YIN A;  5EK2 A;  2ES0 A;  2Z6E A;  2OA5 A;  4GKJ T;  2V26 A;  3WI3 A;  4X5T A;  2XQ5 A;  3RYH E;  2XAF B;  4JV5 T;  1IJ5 A;  3AAI A;  1D1B A;  1YD8 G;  4EZ4 A;  3UQ7 A;  3RQW A;  3VRA A;  2ODV A;  4JUY A;  4U7I A;  5AQV B;  1ZHC A;  2YU2 A;  5ABG A;  4HFH A;  5JDN A;  2Q9Q C;  1FMV A;  3CPZ A;  2CWY A;  2EHO B;  2P9B A;  2R6G F;  3S4U A;  2X0L B;  5JR9 C;  3FHN A;  3X1D A;  2LSY A;  3C4W A;  1YXR A;  3F57 A;  3NWI A;  3QK6 A;  5HEU A;  2XQA A;  5HCJ A;  2V7K A;  2PTF A;  4TUY E;  2E5L T;  3L09 A;  2ZM2 A;  2QRX A;  2XQ7 A;  3RHW A;  5JDG A;  3OTO T;  2F4V T;  3ZT5 A;  3AED A;  3R84 B;  4KMC A;  5IWA T;  4IIJ E;  3N9M A;  2D2S A;  1BR4 A;  5ABH A;  1IJ6 A;  2GK9 A;  5HWX A;  4PJL A;  3UU8 A;  4H63 H;  2FJD A;  3QUJ A;  4IL4 A;  1UK5 A;  3JAF A;  1OWA A;  4UV9 B;  5AQP B;  3RIU C;  3PUQ A;  3V5U A;  3ZJ1 A;  3QC9 A;  2LSG A;  2JQ9 A;  4L9I A;  4YSY A;  4QXH B;  2HPJ A;  5HCM A;  3RC3 A;  3AE7 A;  1YW0 A;  2CXF A;  1MIW A;  2XJ7 A;  3CIR A;  2PG8 A;  3AXJ B;  3B5M A;  4TWH A;  5HXE A;  5J2T E;  1D0X A;  4H9N C;  2V6Y A;  4CQI A;  4LFA T;  2YK0 A;  1MIY A;  1NWM X;  4WYV A;  4BJM A;  4PAG A;  2ZMA A;  3PU3 A;  5FXZ A;  2WB5 A;  1DU2 A;  2WWU A;  2XQ8 A;  4JEH B;  4A97 A;  1LVK A;  5ADX L;  5L3E B;  2V1D B;  5HEH A;  1XWM A;  4DMV A;  1N34 T;  1T7S A;  2LLY A;  1YKE B;  2ZM8 A;  5DAB A;  3TKL B;  4E7S A;  1SUM B;  2J1D G;  3ZST A;  4BA9 A;  3Q9D A;  3ZCI A;  4LMJ A;  3AAE B;  5JQG E;  4UVA B;  4I43 B;  4N78 D;  4JEU B;  4MBQ A;  4XBF B;  3KVB A;  2LSK A;  3Q5D A;  4IDZ A;  4DBQ A;  4K0K T;  3LSV A;  2LJL A;  4GYS A;  4HWD A;  2YDS A;  4P09 A;  3K3O A;  4EAH A;  4AKG A;  1Z8U A;  1G8X A;  1E1H B;  2XQ6 A;  2RP4 A;  4CI3 B;  4XAX B;  5IHY A;  4AQG A;  1N36 T;  1Y64 B;  2NWB A;  2W67 A;  4HFV A;  3MZK B;  2JIW A;  2L8K A;  4AQF C;  4AKR B;  5J1G A;  1IZN B;  1SA0 E;  2VWA A;  3KV4 A;  2V8S V;  3K1S A;  2NW7 A;  1QUU A;  4O4J E;  1OED A;  4TZ4 C;  5DQW A;  3UU5 A;  4B6X A;  2HPL A;  4U2Y A;  5CGM A;  4O8S A;  4LF9 T;  3QB5 A;  2HHH T;  2Y8D A;  1ZP0 A;  1M62 A;  3JCF A;  4UV8 B;  3AXJ A;  3A7M A;  3TLT A;  4ADZ A;  2VKD A;  2VB6 A;  4QXC B;  2V6Y B;  4PNI A;  5LCY A;  4QH4 A;  2FBW A;  1WR0 A;  2KMF A;  2LM9 A;  4JI5 T;  2LOP A;  3FZM B;  3KBT A;  4PJM A;  5FP3 A;  4CZZ B;  3JC6 D;  1BR2 A;  4YY3 T;  3CX7 B;  2UU9 T;  1YQ3 A;  2V7I A;  1MMN A;  1D1C A;  1W0B A;  2K5B B;  3EHZ A;  2JMK A;  3G06 A;  3WAK A;  1T98 A;  3ZMT B;  4ZI3 C;  2RA1 A;  5CA0 E;  1NAF A;  2DL1 A;  4DV0 T;  1X79 A;  5JRC A;  2XTL A;  4HTE A;  3GN5 B;  4X1I E;  5J2U E;  2K24 A;  4GYR A;  3NRX A;  2BVM A;  4PJN A;  5AQM B;  2HH7 A;  3AAA B;  4JI8 T;  3UUN A;  1IBK T;  1B7T A;  2IUB A;  4TNV A;  3EUH A;  1XNR T;  2CBJ A;  2N1G A;  2K3W A;  3ANW A;  3OJA A;  5L3G B;  4XZC A;  4Q25 A;  1CUN A;  4LF7 T;  4KP3 C;  2XUE A;  5AQU B;  4MFR A;  2RPA A;  5AQT B;  1GQE A;  2K9A A;  4DUZ T;  4F6R C;  4LMK A;  3K3N A;  1NEN A;  1W9R A;  4TV8 E;  4QXB B;  5JR9 B;  3J9X 1;  2EHO C;  2FJE A;  3O4X E;  3I0Q A;  2Q9Q B;  3O1I A;  2CM0 A;  3RPU A;  5LMN T;  4B3R T;  3A8Y C;  4QX8 B;  3SS1 A;  3T8O A;  2Q9Q D;  5L4H A;  1WRD A;  4QH1 A;  4IE6 A;  4L5G A;  3J7Y q;  2V5D A;  3KV9 A;  2WU5 A;  3HI2 A;  4IDQ A;  2X51 A;  3P4R A;  3P4P A;  5HEO A;  2LHN A;  3EDU A;  3FZH B;  3QNU A;  1MMG A;  3RIU A;  2UUB T;  3KBU A;  2WMO A;  1XDP A;  2V6X A;  1FEW A;  1Z0P A;  1J5W A;  2A3D A;  2VVN A;  3L3P A;  4DV2 T;  4QWN B;  3FZK B;  5HAX A;  4AQY T;  3ZC0 A;  3MAC A;  3N9O A;  2V5C A;  2WSS V;  3P4W A;  2X9X A;  1HG5 A;  3HR0 A;  4QH5 A;  4A5X A;  4HFC A;  4ZI2 D;  4EIW A;  1HR0 T;  4OX9 T;  3VRB A;  3I9Y A;  3C51 A;  3SWH A;  5FMN A;  1HF8 A;  4HWI B;  2ZM0 A;  2DLR A;  4WBO A;  4EXT A;  2WP9 A;  5F3J A;  4UR9 A;  3TLU A;  3AVR A;  3AA1 B;  3AA0 B;  1U5P A;  1UUS A;  1KFY A;  4IHJ E;  2QVA A;  4IST A;  3PU8 A;  4WZX A;  2SPC A;  5GON E;  3CQX C;  4IE7 A;  2B76 A;  4FJO A;  2WDV A;  3AE3 A;  4JI0 T;  3Q5W A;  3N2O A;  4O4I E;  4HKA A;  4X65 T;  2BVL A;  4GK0 E;  5HXH A;  3GA8 A;  3AE6 A;  4OK0 A;  2EHO A;  3ZPO A;  5HEJ A;  2BKO A;  5AQJ B;  1U4Q A;  5AQO B;  1O3X A;  2XSB A;  3HKE E; 
#chains in the Genus database with same CATH homology
 3E22 E;  3EVY A;  2W62 A;  5L2L A;  5LG4 A;  4IGU A;  2X9H A;  2JRK A;  5L3F B;  2DI4 A;  2KIN B;  2M67 A;  4CI2 B;  5LNK A;  3AA7 B;  3N9Q A;  3I0O A;  2DHR A;  3VU7 H;  3ZC1 A;  3ZYL A;  2H7V C;  3ZYK A;  2XAQ B;  3CVR A;  4PK6 A;  4PFP A;  2LSI A;  3ZMV B;  3ZMS B;  4AKH A;  4UVB B;  4V1A v;  1IAP A;  2DNX A;  5L3B B;  3CML A;  3HKD E;  3PUA A;  4A56 A;  3RX6 A;  4UF0 A;  2Y6X A;  4H63 V;  5HYA A;  1S94 A;  4YLH A;  5CB4 E;  3OKQ A;  1KK7 A;  4ZI3 D;  3RYC E;  4H9R C;  3O1J A;  3AB3 B;  3CKD A;  3UUL A;  2IAK A;  5LHH B;  4G63 A;  5CA1 E;  1OXZ A;  4QHO A;  4H9O C;  5LA6 E;  3O1H A;  3SRZ A;  3KIN B;  4BAY B;  3ETV A;  5HXS A;  3RH3 A;  4HE8 A;  1D1A A;  3ZMZ B;  5LGU B;  4O4L E;  2X9W A;  3N2K E;  4WNK A;  4PW8 A;  3CX8 B;  4OYK A;  1UX4 A;  1WR6 A;  5E0O A;  3IF8 B;  5EZY E;  5LYJ E;  3D0T A;  3P7I A;  4UEL A;  2N2N A;  2NW9 A;  1FIO A;  2Q9Q A;  2DCF A;  3FXD B;  4U72 A;  5H6Q B;  5JH7 E;  4ZHQ E;  2ODU A;  5FNV E;  2PJQ A;  5JDM A;  5LGN B;  4QKN A;  3F31 A;  5JDH A;  3CX6 B;  3I9W A;  4IE5 A;  4YJ2 E;  1MND A;  3N5L A;  4MHC A;  5DQV A;  5LBQ B;  3SOL A;  4TX5 A;  1H7C A;  3N9N A;  2D0U A;  4O4H E;  2MYS A;  4O2A E;  4YFS A;  4AKL A;  1QSD A;  2W00 A;  3GWH A;  2ZLY A;  4NUV A;  4ZI2 C;  3FBZ A;  2CMR A;  3ZCJ A;  4KUM B;  1SHZ C;  5FXX A;  3ETU A;  2QGS A;  1MNE A;  3RKO A;  3VKH A;  3VHL A;  1AJ3 A;  4IE0 A;  3HKC E;  2XAJ B;  3KV6 A;  4TN7 B;  4ZI7 E;  3P8C D;  4H9P C;  4ZS2 A;  5EK3 A;  5C8Y E;  5LJM A;  5LJN A;  3OYX A;  4C91 A;  3ONX A;  3KDS E;  1G73 A;  3MA9 A;  2LHR A;  3ESL A;  3LBX B;  4X1Y E;  5A1L A;  4K0U A;  3DJB A;  3ZYM A;  3RYF E;  2VKO A;  1FMW A;  2W63 A;  4EB6 E;  2JJ9 A;  3HL6 A;  5KMG P;  2NW8 A;  3BQI A;  5M4Y A;  2W0G A;  4WBN E;  4X1K E;  3RC8 A;  2C5K T;  3Q2M A;  2EHO D;  2VKJ A;  2D0T A;  3N2G E;  4MAL A;  5FY1 A;  4J2C A;  3NBX X;  3H37 A;  5FY0 A;  3LK2 B;  2E9X D;  2E9X B;  3MKD A;  4UEM A;  3UUM A;  2XAS B;  4UXN B;  4C90 A;  3K3Q C;  2VAS A;  2XAG B;  1D0Z A;  2JQQ A;  2IC9 A;  4UF0 B;  5LHI B;  2X66 A;  1MMA A;  3ANW B;  2CCQ A;  1LKX A;  3MJX A;  4GIW A;  5LOV E;  4M1P A;  4WW0 A;  1KNZ A;  2UXX B;  4ZS3 A;  3OBV E;  4PK5 A;  4DMW A;  3BQL A;  4CI1 B;  1UX5 A;  1HTJ F;  2QA7 A;  2A72 A;  3WAJ A;  3KVA A;  3EDV A;  3FB2 A;  5LBM A;  3ZJ2 A;  4DVD A;  2V7M A;  3VKG A;  1ZEE A;  5FYM A;  2D5U A;  2CEA A;  1LRZ A;  5F3J A;  3HKB E;  1ZV4 X;  1WLX A;  4DO0 A;  3N9L A;  2LSJ A;  2E9X C;  4BJN A;  3AVS A;  3PE0 A;  1HCI A;  3PTR B;  2C0S A;  4UVC B;  2CXD A;  2X67 A;  3RRC A;  4EZH A;  3LK3 B;  5LXT E;  4HN9 A;  2DWK A;  3KV5 A;  2X9Y A;  2YU1 A;  4IE4 A;  4I4T E;  4Z8X A;  2C5J A;  4HEA A;  4YJ3 E;  3ZN0 B;  3JC6 C;  2X68 A;  3ZMU B;  1MMD A;  3MK7 C;  2G0U A;  2YEV C;  3PUG A;  2IW5 B;  4AXP A;  3CQG B;  3N9P A;  3B13 A;  4JLE A;  2K48 A;  1HG2 A;  1EZ3 A;  2H7O A;  4ILU A;  3UT5 E;  2KLQ A;  5KDM C;  3IHR A;  3DTO A;  3ZN1 B;  2UXN B;  2MBG A;  3BQK A;  5FXV A;  5F8P A;  5BMV E;  3HA4 A;  3C98 B;  2LE8 A;  4DBR A;  3NZQ A;  2MTQ A;  3LK4 2;  4PFO A;  3W15 B;  1V9D A;  5EK4 A;  5AFU L;  2VK9 A;  2CE7 A;  2WMN A;  2MOZ A;  1MIV A;  2C5I T;  3LBX A;  2ACX A;  4EYU A;  3IBP A;  4I55 E;  2LEH A;  4EOZ B;  2KWH A;  3PDY A;  5JDF A;  1WYB A;  2E8I A;  2XQY A;  3TKL B;  2KND A;  4MLK A;  5FXW A;  1HX8 A;  2V7L A;  2WAU A;  3ZEF B;  2PFV A;  4AI6 A;  4P0B A;  2LOS A;  5FY7 A;  1VRB A;  3FXE B;  1BR0 A;  2VKH A;  2XHE B;  3RYI E;  4ERR A;  1S35 A;  3M65 A;  2DWG A;  5H6R B;  4L0R A;  5TAO A;  5LGT B;  3LFM A;  2H3R A;  4GK5 E;  4CXX A;  1US7 B;  2VL8 A;  3AA6 B;  1LVF A;  4QX7 B;  4HGA A;  3I1A A;  4OFZ A;  3NRY A;  2NTX A;  2KXP B;  4ZOL E;  4H9Q C;  4H9S E;  2NTY A;  5KX5 E;  4PJJ A;  5JR9 A;  5JDL A;  4G2A A;  4ANJ A;  2CWO A;  3E08 A;  2CLY B;  5L3C B;  3CQC B;  2L9Q A;  2I59 A;  3Q5X A;  3E0Z A;  3PUR A;  5HXC A;  3IEE A;  4EYY R;  1D0Y A;  4CXY A;  4GOU A;  2B1E A;  3DP7 A;  3GMI A;  4NUU A;  4XBF B;  1BR1 A;  2KT9 A;  3O9X A;  4I50 E;  4ASK A;  3C4Z A;  2E9X A;  4YHJ A;  5JRC B;  4AKI A;  3BK9 A;  2N9D A;  4FI5 A;  5HXR A;  5JDQ A;  4E7Z A;  5JRE A;  3GN5 A;  4PK4 A;  3U78 A;  2NP9 A;  1VOM A;  1ZKE A;  2JMH A;  2JPF A;  2PBI A;  4OYJ A;  3B57 A;  2WBL A;  3U3I A;  4AQF A;  2CLY C;  3C64 A;  3UUX B;  3NZP A;  4DND A;  5LHG B;  2W61 A;  4KBM B;  3UTK A;  3C4X A;  4U74 A;  1WYC A;  2IC6 A;  2LT3 A;  2BDE A;  5IYZ E;  3V5S A;  2V7J A;  3R6N A;  2BZB A;  4TV9 E;  3UFE A;  3C50 A;  2WM9 A;  4UIG A;  2KWI B;  3OYZ A;  2KZ7 B;  4O2B E;  5DJQ C;  3ZLI A;  4CXW A;  4ISS A;  2NOX A;  1UCU A;  1HFA A;  2XAH B;  3A5X A;  3LJC A;  3H3A A;  1HS7 A;  2CA5 A;  2L3L A;  3F2E A;  3KFW X;  4P0A A;  3MXZ A;  3CWZ B;  2Y48 B;  1YKH B;  3PUS A;  5JVD E;  4OHF A;  3FBL A;  2CXL A;  5L3D B;  4X20 E;  3LG7 A;  3RRW A;  5HWY A;  3K8P C;  2A2F X;  2YIN A;  5EK2 A;  2ES0 A;  2Z6E A;  2OA5 A;  2V26 A;  3WI3 A;  3RYH E;  2XAF B;  1IJ5 A;  3AAI A;  1D1B A;  1YD8 G;  4EZ4 A;  2ODV A;  4JUY A;  1ZHC A;  2YU2 A;  5JDN A;  3CPZ A;  2Q9Q C;  1FMV A;  2CWY A;  2EHO B;  2P9B A;  3S4U A;  2X0L B;  5JR9 C;  3FHN A;  2LSY A;  3C4W A;  3F57 A;  3QK6 A;  2V7K A;  4TUY E;  3L09 A;  2ZM2 A;  5JDG A;  3R84 B;  4KMC A;  4IIJ E;  3N9M A;  2D2S A;  1BR4 A;  1IJ6 A;  2GK9 A;  5HWX A;  4PJL A;  4H63 H;  3QUJ A;  4UV9 B;  1OWA A;  3PUQ A;  3V5U A;  3ZJ1 A;  3QC9 A;  2LSG A;  4L9I A;  4QXH B;  2HPJ A;  3RC3 A;  1YW0 A;  2CXF A;  1MIW A;  2PG8 A;  5HXE A;  5J2T E;  1D0X A;  4H9N C;  4CQI A;  2YK0 A;  1MIY A;  1NWM X;  4BJM A;  4PAG A;  2ZMA A;  3PU3 A;  5FXZ A;  2WWU A;  4JEH B;  1LVK A;  5ADX L;  5L3E B;  2V1D B;  4DMV A;  1YKE B;  2ZM8 A;  5DAB A;  4E7S A;  2J1D G;  4BA9 A;  3Q9D A;  3ZCI A;  3AAE B;  5JQG E;  4UVA B;  4I43 B;  4N78 D;  4JEU B;  4MBQ A;  3KVB A;  2LSK A;  4IDZ A;  4DBQ A;  2LJL A;  4GYS A;  4P09 A;  4EAH A;  4AKG A;  3K3O A;  1G8X A;  1E1H B;  2RP4 A;  4CI3 B;  4XAX B;  5IHY A;  4AQG A;  1Y64 B;  2NWB A;  4HFV A;  3MZK B;  2L8K A;  4AQF C;  4AKR B;  5J1G A;  1IZN B;  1SA0 E;  2VWA A;  3KV4 A;  4O4J E;  5ETW A;  2NW7 A;  1QUU A;  4TZ4 C;  5DQW A;  4B6X A;  2HPL A;  4O8S A;  2Y8D A;  4UV8 B;  4ADZ A;  2VKD A;  2VB6 A;  4QXC B;  5LCY A;  4PNI A;  2LM9 A;  2KMF A;  4CZZ B;  2LOP A;  3KBT A;  4PJM A;  5FP3 A;  3JC6 D;  1BR2 A;  3CX7 B;  2V7I A;  1MMN A;  1D1C A;  2K5B B;  2JMK A;  3WAK A;  5CA0 E;  1T98 A;  3ZMT B;  4ZI3 C;  2RA1 A;  5JRC A;  1NAF A;  1X79 A;  2XTL A;  4HTE A;  3GN5 B;  4X1I E;  5J2U E;  2K24 A;  4GYR A;  3NRX A;  2BVM A;  4PJN A;  2HH7 A;  3AAA B;  3UUN A;  1B7T A;  3EUH A;  2N1G A;  3ANW A;  3OJA A;  5L3G B;  4XZC A;  1CUN A;  4KP3 C;  2XUE A;  4MFR A;  2K9A A;  4F6R C;  3K3N A;  4TV8 E;  5JR9 B;  4QXB B;  3J9X 1;  2EHO C;  3O4X E;  3I0Q A;  2Q9Q B;  3O1I A;  2CM0 A;  3RPU A;  4QX8 B;  3T8O A;  3SS1 A;  2Q9Q D;  1WRD A;  4IE6 A;  4L5G A;  3J7Y q;  3KV9 A;  3HI2 A;  2X51 A;  2LHN A;  3EDU A;  1MMG A;  3KBU A;  2WMO A;  1Z0P A;  1FEW A;  3L3P A;  2A3D A;  4QWN B;  5HAX A;  3ZC0 A;  3MAC A;  3N9O A;  2WSS V;  2X9X A;  1HG5 A;  3HR0 A;  4ZI2 D;  4EIW A;  3I9Y A;  3C51 A;  3SWH A;  5FMN A;  1HF8 A;  2ZM0 A;  2DLR A;  4WBO A;  4EXT A;  3AVR A;  3AA1 B;  3AA0 B;  1U5P A;  4IHJ E;  4IST A;  3PU8 A;  2SPC A;  5GON E;  3CQX C;  4IE7 A;  4FJO A;  3Q5W A;  3N2O A;  4O4I E;  4HKA A;  2BVL A;  4GK0 E;  5HXH A;  3GA8 A;  4OK0 A;  2EHO A;  3ZPO A;  1U4Q A;  5LP6 E;  1O3X A;  3HKE E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...