2JQQA

Solution structure of saccharomyces cerevisiae conserved oligomeric golgi subunit 2 protein (cog2p)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
154
Chain Sequence
b'KTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQLTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSIIKTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved oligomeric Golgi complex subunit 2
molecule tags Protein transport
source organism Saccharomyces cerevisiae
publication title Structural analysis of conserved oligomeric Golgi complex subunit 2
pubmed doi rcsb
total genus 58
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1240 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jqqA00
2JQQA
chains in the Genus database with same CATH superfamily
5CJ5A 3RH3A 1T72A 3ZEFB 1IBMT 5HEOA 2K3WA 5IHYA 2FJAA 5JVDE 3IF8B 2XQ5A 2A9UA 3P4QA 3N9OA 5EK4A 1B7TA 1W0AA 4KP3C 2XUEA 2IMLA 2V7MA 1E2AA 3AE7A 3UTKA 5ABFB 2X67A 1JNZA 3CVRA 3JC6C 3N9MA 4TX5A 2D0UA 1YW0A 4ZS2A 3ESLA 4ZI3D 1L0VA 2XSBA 3R6NA 4WZXA 4YLHA 2LSKA 4GKJT 3HI2A 3T8OA 2V6XA 2WDRA 4TWFA 4P09A 2FJEA 5HCMA 3O4XE 2WQYA 3RIFA 3V5SA 4TWDA 5JDNA 5LJNA 4HFEA 3ZJ1A 3PUZF 2X68A 3O1HA 5L3CB 1WR0A 4TUYE 5LNKA 2XQ8A 3RYFE 2CPTA 2WDQA 3EI0A 2CBJA 4UV9B 2VWAA 3OYXA 2QGSA 4U74A 5AQRB 4H63V 5ABFA 2UXDT 1MIVA 3FHNA 4AQFC 3KV5A 3UUXB 4DMVA 4HFCA 2BKPA 1BR4A 1MNEA 3NRYA 2UUCT 4EYYR 1SA0E 2W63A 1G8XA 1V9DA 5JR9B 4HFBA 4DR5T 4G63A 5FL0A 2AXDS 2CE7A 4TV8E 4JYAT 1E1HB 2YU1A 5AQHB 2CHOA 3VRAA 1IBKT 3GN5B 4CN6A 2DWKA 3E22E 2BG9E 2JPFA 1QLBA 5E0OA 4NUVA 3BK9A 2KLQA 3SOLA 1U4QA 3ZYMA 2UXBT 4H9QC 2E9XD 4JLEA 2Q9QC 2YEVC 4KHZF 3GMIA 3FZFB 5M4YA 1XNRT 1NWMX 2X9WA 3O9XA 3MZKB 1D0YA 4EB6E 4BAYB 4ADZA 5AQUB 2XTLA 3MXZA 3RYIE 3IHRA 3ZT6A 3OVUA 2V8SV 4DV2T 3RKOA 4A56A 3PE0A 2XY8B 2A3DA 1D0ZA 2ACZA 3ONJA 4JEUB 1N36T 3CQGB 5L3GB 3A5XA 1KNPA 3AA1B 4XAXB 2CWOA 3AXJA 3FXDB 2CEAA 1WLXA 5DQWA 3W15B 5CA1E 2UU9T 4YFSA 2W61A 1D1BA 3I0OA 2WSSV 3NWIA 4X20E 5AFUL 4YTPA 2YDSA 1ZKEA 2LLYA 2BG9A 2VL0A 5JDFA 3A7MA 3B13A 1OEDA 2IC6A 3N9QA 1IJ5A 1O3XA 3JAFA 3MKDA 3QUJA 4UXNB 1KF6A 1FEWA 2KSRA 3K3OA 3M3ZB 3R84B 4E7SA 1BR0A 2XAGB 2XAFB 4LF7T 3M65A 4PK4A 2X0HA 5FXWA 4JI1T 2MPKA 3I9YA 4GYRA 4O8SA 4ERRA 3EUHA 4DO0A 1WFDA 4HFHA 5LB7B 2D5UA 3ZCIA 2LSIA 2W67A 4QXHB 4CI1B 2XZEA 4IL9A 2W4XA 2V5DA 3Q5EA 4ZOLE 2J4GA 4YTMA 3J7Yq 5CFBA 2HHHT 1Y01A 4TNVA 3B5MA 5AQTB 3UFEA 1WYCA 2NWBA 2NR4A 2JRKA 1YXRA 2E8IA 2VVNA 4MHCA 3RLFF 4DR3T 4IE4A 1KNZA 5L3EB 2V7LA 3MACA 4K0KT 1WR6A 2HN1A 3ANWB 5IYZE 2LOPA 2YDQA 4H9NC 2NW8A 3E08A 3RYHE 3LG7A 3ZT5A 3NVOA 4AKRB 4EEBA 5H6RB 2LM2A 2N2NA 2V7IA 2W66A 1J5WA 2Y6XA 1W09A 1GQEA 2XSAA 3FXEB 4MLKA 5CB4E 3RHWA 3H3MA 3FZHB 1S94A 2WZHA 3LJCA 3PJAA 3SWHA 4B6XA 4DV6T 3ABVA 4CQIA 2KXPB 3ZSSA 3RC8A 4TNWA 1FMWA 5ETWA 4A97A 2XQYA 3C4WA 1OEDE 3PV0F 2X9HA 5F3JA 1R8IA 1KNRA 3KDSE 3P4WA 5AQIB 3ZMVB 4DBRA 5C3JA 2H3RA 1NEKA 1HG2A 4UEMA 5HXCA 2C0SA 4JI2T 5JH7E 3DJBA 3UU6A 3G06A 3PU3A 3ZMSB 5FP3A 4PNIA 4DR7T 5HEJA 2VURA 1YKHB 3F2EA 3FZKB 5HEHA 3NKZA 4LF6T 3C50A 4DR4T 3AE1A 1HNZT 4IGUA 3FBLA 2DLRA 3N9LA 2WWUA 4NPPA 2N9DA 1HFAA 3IBPA 4J2CA 2CLYC 3VKHA 3KINB 2XASB 3GN5A 3LFMA 4X1IE 4JV5T 4DV7T 5F8PA 3UU5A 2BBJA 1D1AA 3HA4A 4QKNA 4O2BE 4P1NA 1HCIA 2QVAA 2E9XA 3UULA 4DV5T 1D1CA 1UX4A 4KBMB 2JQ9A 5BR8T 3PUWF 2XQ6A 3C98B 2E9XC 3C4XA 3CPZA 4IL4A 4F8HA 3EDVA 3AA6B 1OEDC 5LXTE 4P0AA 2LSJA 2V7KA 5C2TA 2EHOD 2MTQA 3ETVA 2CXLA 3PUVF 5LCYA 5AQFB 1Y64B 2B1EA 4LFCT 4OYJA 5L3DB 3NZQA 3AEAA 4I0UA 5AQNB 4PW8A 3LK2B 3PUGA 5HWYA 3ZKRA 4EEDA 5JDGA 4JI7T 3K3NA 2KINB 3SRZA 5JDMA 3RKGA 1EZ3A 2YOEA 5ABGA 3U78A 3ZC1A 5AQSB 2NW9A 4CI2B 2EHOB 4ZI2C 1CHUA 1LRZA 1YD8G 3WAKA 5EK3A 1ZEEA 1HF8A 4A5XA 2ACXA 2WP9A 1J1JA 3CMLA 3OBVE 4ILUA 5JDHA 2DL1A 3HKCE 3KV9A 2E5LT 3PUQA 4H9SE 2XQAA 5LA6E 3A8YC 2LKGA 4B3ST 3PURA 3ZYKA 3RPUA 4GIWA 4CI3B 3AE4A 4GKKT 2H7OA 4QXCB 3ZMZB 3I9WA 3CX8B 2BKOA 2NTYA 3VR8A 4CXXA 4YSYA 3CX6B 5JDQA 5LGTB 4FI5A 3SFEA 5AQMB 2A2FX 5HAXA 3JC6D 5DABA 4HWIB 2V5CA 2V7JA 5AQQB 2CMRA 2YKSA 3OJAA 4PK6A 4PK5A 5HXEA 1MMGA 2BS3A 4U2YA 5FXXA 3AE2A 2QA7A 4CXYA 3PJAJ 4I55E 3HR0A 1QUUA 3S4UA 3ZN0B 4IDQA 1I94T 4Z91A 5BMVE 1ZOYA 4X5TA 2C5IT 1I6ZA 4U2ZA 4JI4T 4EOZB 4KHPT 2JQQA 4L9IA 2LE8A 2J1DG 3NRXA 3KVAA 3QC9A 4HE8A 1ZV4X 4IDOA 4P0BA 4B3RT 2BG9B 2DHRA 1YQ3A 2VK9A 2NW7A 5AQJB 4C90A 2LSGA 4EAHA 4YT0A 4YSZA 1SHZC 4TZ4C 3RIUC 4XBFB 2WB5A 4DR2T 1IBLT 1ZHCA 1Z0PA 4OYKA 4BA9A 4DVDA 5C8YE 2DWGA 3KFWX 4YHHT 4B3MT 3TLUA 4OX9T 2KNDA 1MIYA 2XQ7A 5JR9C 2M67A 5FMNA 4LMKA 4ZZCA 4HFDA 3Q2MA 3QNUA 2JIWA 4N78D 5LYJE 3H37A 3RX6A 3LDQB 4HEAA 5HYAA 3ONXA 3TLSA 4X65T 2QYWA 4EIWA 1E7PA 1M62A 3WAJA 5J0ZA 2XQ9A 3CKDA 1SUMB 4NXNT 4X62T 4ZS3A 1UX5A 1HTJF 3L09A 5FY7A 3RYCE 3GA8A 4DV0T 2X9XA 2K9AA 4IT4A 4O2AE 5L3FB 3AEEA 4AQFA 4A98A 3T1YT 3K8PC 4FJOA 5FKYA 4TN7B 5LGUB 1MMAA 2W0GA 3O1IA 3ZN1B 4NIQA 5JRCB 3P4PA 4I50E 4QHOA 2ES0A 4WBOA 3UQ4A 4DUZT 3ONLC 4NXMT 2WU2A 2WMOA 1UCUA 1LKXA 1BR2A 1FIOA 4KMCA 5HXHA 1T7SA 2KMFA 4U72A 3ZMUB 2XAQB 3OYZA 4KX6A 3HKEE 5FXVA 1G73A 2RPAA 2LKHA 2JQKA 3N2OA 2WS3A 3KBUA 3RF1A 2V1DB 5JQGE 1NAFA 2YK0A 2PFVA 3IA3A 1VRBA 3C51A 4DV1T 4UVAB 3RC3A 3OTOT 4DR1T 2PJQA 5JRCA 2CHNA 2RP4A 4WYVA 4OFZA 5HEUA 5HCJA 4ASKA 2EHOA 4UIGA 2KZ7B 1US7B 2OLTA 1NENA 5HXRA 4LFAT 5LOVE 2XM2A 3AE9A 5HWXA 4Z8XA 3DP7A 3HKDE 1W9RA 3MK7C 2XM1A 4YSXA 2Y48B 3CQXC 3I0QA 3ZJ2A 4DR6T 2WU5A 3X1DA 4EV6A 3Q5WA 3UUBA 1FJGT 4LMJA 2BG9C 4YJ2E 2MOZA 1UGOA 5IWAT 4B3TT 2BKNA 2VASA 5LP6E 2DI4A 2XJ7A 4WNKA 1N34T 1HG5A 3Q5DA 1XMOT 3UU8A 2WZIA 2CA5A 3AA7B 4ILCA 4JBWF 2WBLA 3BQKA 3KBTA 2D9DA 4GYSA 3IEEA 3HKBE 2ZMAA 3V5UA 4BJMA 4CXWA 4KUMB 5LMNT 3P4RA 2VKOA 2CRBA 4M1PA 4PFPA 1SE7A 4QX7B 2BBHA 2WWVA 2VKDA 3B57A 3ZT7A 2VL8A 5ABHA 5CA0E 5LG3A 4EXTA 2W62A 4ISSA 3C4ZA 4AKGA 2H89A 4O4IE 4PJNA 2XPKA 4AQGA 4YHJA 3OPCA 3AA0B 1XZYA 3RIUA 4YXDA 4H9OC 4KI0F 5LG4A 3UT5E 2IDOB 2X0YA 2V26A 3MJXA 5FXZA 5J2TE 3QB5K 5HEGA 2L9QA 4IE5A 4COFA 5FVLA 2XAJB 3AE6A 5ABEA 2VKHA 4ILAA 5CGMA 2ZM6T 3LBXA 2HPLA 4AQYT 5FY1A 1CUNA 1UURA 2YDRA 1N32T 4H63H 4X64T 3AECA 1XDOA 3P50A 2E5VA 3VR9A 2ZLYA 4LF4T 3AAEB 2M6IA 3UUMA 5FNVE 4AXPA 1UUSA 3UFGA 3EHZA 2K5BB 4MBQA 5TAOA 3OKQA 1YQ4A 4YY3T 5AQLB 4DV3T 3BQIA 1J5ET 5AQPB 1MMNA 4I4TE 3T1HT 3C64A 4GK5E 3JAEA 1IZNB 3UUNA 4UF0B 1MNDA 3ZSTA 1HX1B 2VKJA 2VB6A 2Y8DA 2ZM8A 2BS4A 3H3AA 1HS7A 3LBXB 2CWYA 3RI5A 5H6QB 2CXFA 4PJMA 4IIJE 4UR9A 2WMNA 4JUYA 3AVSA 2CBIA 2LHRA 3VKGA 2R6GF 4TWHA 5ADXL 4ZHQE 1Z8UA 1X9BA 3CQCB 4L5GA 3UU4A 2VQET 4UVBB 5LGNB 2NTXA 4DMWA 4AI6A 2D2SA 4CZZB 2ODUA 2I59A 4OK0A 2LRLA 2V6YB 2CM0A 4IDPA 4OHFA 1VOMA 2SPCA 2YINA 4L0RA 4YTNA 3ETUA 2J47A 4ZXLA 1MMDA 2FBWA 1WCRA 4X66T 3N9PA 2DCFA 3SS1A 2FUPA 4HFIA 4DUYT 3PUYF 4PJLA 4O4LE 1XMQT 5AQKB 3L39A 2KT9A 3HL6A 3NZPA 4QX8B 4ZZBA 5AQOB 4ZI2D 2ODVA 2IUBA 4H9PC 1OWAA 1U5PA 1QSDA 1W0BA 3LK42 2JJ9A 3PUAA 3AE3A 4HN9A 1VCTA 4ILBA 4ZI7E 5HXSA 3I1AA 2BVLA 2WM9A 4IDNA 4K0UA 4F6RC 3PUSA 5LBMA 4AKHA 3PTRB 3AB3B 4DBQA 2GK9A 4IE7A 4ANJA 3PU8A 1HNXT 3FBZA 3DTOA 5EZYE 5EK2A 2L8KA 5LBQB 4JI5T 2NOXA 3BQLA 3N2KE 2M6BA 5FVKA 2H88A 2Q9QA 5AQGB 3VHLA 2I6HA 2LM9A 3O1JA 2E2AA 4IE0A 4O4JE 4JI6T 4LMLA 4Q25A 3RRWA 1LVFA 4AKLA 1VCSA 2IIUA 1M7KA 2UXNB 2VVSA 4HWCA 4PJJA 1IJ6A 2LHNA 4U33A 4LF9T 5A1LA 5IUXA 2W2UA 1LVKA 2PG8A 4U3CA 5KXJA 2MYSA 2HPJA 2VQFT 1BR1A 1KK7A 3AVRA 5L2LA 1UK5A 3MA9A 2XQ3A 4WW0A 3QB5A 2C5KT 3P4SA 3AE5A 3L8RA 5AQVB 5JR9A 2BS2A 3AEGA 4ZI3C 4HFVA 2DNXA 3CIRA 1ZP0A 3AEBA 3CWZB 4DNDA 5GONE 2D0TA 3AAIA 3CX7B 4HWHA 4U7IA 3UU3A 2JMHA 2A72A 5F5WA 1HX8A 2IAKA 2L3LA 3TKLB 3WI3A 4HGAA 4TV9E 5LMUT 3E0ZA 3VU7H 4AIUA 2OV9A 1H7CA 2WAUA 2JQHA 3AEFA 4ZEYA 2IHR1 1JNRA 3N9NA 3P8CD 4GOUA 2B76A 4YJ3E 4MFRA 3J9X1 4DIDB 1HR0T 1MIWA 2LT3A 4HKAA 2IW5B 4IDZA 3LK3B 4UVCB 4MALA 1HNWT 3P7IA 3EDUA 2J62A 2XHEB 2PBIA 4H9RC 5JREA 2XAHB 4UF0A 4V1Av 4DV4T 2W00A 5L4EA 1WRDA 2C5JA 3QOFA 4HWFA 2IC9A 1WYBA 5LHIB 1FMVA 1XWMA 2G0UA 4U31A 3SFDA 3ZMTB 2XQ4A 3N5LA 4HTEA 3RQWA 3U3IA 2K48A 5J1GA 2YU2A 3ANWA 4O4HE 5L47A 5FY0A 4JEHB 2UXCT 3RIAA 4CN1A 3EAMA 3K3QC 2X51A 3JADA 4UELA 2LRKA 2WDVA 3KV6A 2JMKA 2X66A 4E7ZA 1AJ3A 3VRBA 1IAPA 5JTGA 5KDMC 2V6YA 2Z6EA 3AAAB 3JCFA 3K1SA 4X1KE 4I43B 4HWDA 3TLVA 2YN6A 4PFOA 4G2AA 4QXBB 4WBNE 5KMGP 2BDEA 2RA1A 3F57A 5DQVA 3UQ7A 1T98A 2FJBA 3F31A 4U7YA 4IREA 3RRCA 2NP9A 4QH1A 3N2GE 4QH4A 3RQUA 3EABA 4JI8T 3CK6A 3Q9DA 4LFBT 2N1GA 5J2UE 4XZCA 3RGLA 2OA5A 3AE8A 2CLYB 3GWHA 4UV8B 2HH7A 3D0TA 2ZM0A 1KFYA 2LOSA 3ZC0A 4QH5A 4ISTA 5L3BB 4Z90A 4BJNA 2UXXB 2WY2A 4LF8T 4EZHA 4LF5T 4GK0E 1KEYA 3TLTA 2PTFA 3EVYA 4IE6A 5L4HA 2KWIB 4AISA 2LJLA 4IHJE 2LEHA 1T8BA 2EHOC 4EYUA 2ZM2A 2Q9QB 3FZMB 2BVMA 3ZLIA 2MBGA 4EZ4A 2H7VC 1YKEB 1D0XA 2BZBA 2I0MA 2MAWA 3AXJB 1OXZA 4QWNB 5FYMA 1XDPA 1DU2A 3NBXX 2HN2A 4C91A 2CXDA 3AEDA 2F4VT 2X9YA 3ZYLA 5LJMA 1N33T 3KVBA 3Q5XA 2E9XB 4JI0T 1XNQT 2Q9QD 3PDYA 1OEDB 3ZCJA 3ZPOA 5FL1A 5LHHB 2UUAT 3LSVA 1S35A 2K24A 2CCQA 3QK6A 4X1YE 5DJQC 2QRXA 2P9BA 1X79A 3PUXF 5JDLA 4NUUA 4EGWA 2X0LB 2AE9A 3TLWA 4CN4A 2KWHA 2FJDA 2UUBT 3FZLB 3FB2A 2LSYA 4AKIA 3L3PA 5LHGB 5KX5E 3KV4A 4JI3T 2WCAA 4PAGA
chains in the Genus database with same CATH topology
3ZEFB 5IHYA 5JVDE 3IF8B 5EK4A 3N9OA 1B7TA 4KP3C 2XUEA 2V7MA 3UTKA 2X67A 3CVRA 3JC6C 3N9MA 4TX5A 4ZS2A 2D0UA 1YW0A 4ZI3D 3ESLA 3R6NA 4YLHA 2LSKA 3HI2A 3T8OA 4P09A 3V5SA 3O4XE 5JDNA 5LJNA 3ZJ1A 5LNKA 2X68A 3O1HA 5L3CB 4TUYE 3RYFE 4UV9B 2VWAA 3OYXA 2QGSA 4U74A 4H63V 1MIVA 3FHNA 4AQFC 3KV5A 3UUXB 4DMVA 1BR4A 1MNEA 3NRYA 4EYYR 1SA0E 2W63A 1G8XA 1V9DA 5JR9B 4G63A 4TV8E 2CE7A 1E1HB 2YU1A 3GN5B 2DWKA 3E22E 2JPFA 5E0OA 4NUVA 3BK9A 2KLQA 3SOLA 1U4QA 3ZYMA 4H9QC 2E9XD 4JLEA 2Q9QC 2YEVC 3GMIA 5M4YA 1NWMX 2X9WA 3MZKB 1D0YA 4EB6E 4BAYB 4ADZA 2XTLA 3MXZA 3RYIE 3IHRA 3RKOA 4A56A 3PE0A 2A3DA 1D0ZA 4JEUB 3CQGB 5L3GB 3A5XA 3AA1B 4XAXB 2CWOA 3FXDB 2CEAA 1WLXA 5DQWA 3W15B 5CA1E 4YFSA 2W61A 1D1BA 3I0OA 2WSSV 4X20E 5AFUL 1ZKEA 5JDFA 3B13A 2IC6A 3N9QA 1IJ5A 1O3XA 3MKDA 3QUJA 4UXNB 4E7SA 3K3OA 1FEWA 3R84B 1BR0A 2XAGB 2XAFB 3M65A 4PK4A 5FXWA 3I9YA 4GYRA 4O8SA 3EUHA 4DO0A 2D5UA 3ZCIA 2LSIA 4QXHB 4CI1B 4ZOLE 3J7Yq 3UFEA 1WYCA 2NWBA 2E8IA 2JRKA 4MHCA 4IE4A 5L3EB 2V7LA 3MACA 1WR6A 3ANWB 5IYZE 2LOPA 4H9NC 2NW8A 3E08A 3RYHE 3LG7A 5H6RB 2N2NA 2V7IA 2Y6XA 4MLKA 3FXEB 5CB4E 3SWHA 1S94A 3LJCA 4B6XA 4CQIA 2KXPB 3RC8A 5ETWA 1FMWA 3C4WA 2XQYA 2X9HA 5F3JA 3ZMVB 3KDSE 4DBRA 2H3RA 1HG2A 4UEMA 5HXCA 2C0SA 5JH7E 3DJBA 3PU3A 3ZMSB 5FP3A 4PNIA 3F2EA 1YKHB 3C50A 4IGUA 3FBLA 2DLRA 3N9LA 2WWUA 2N9DA 1HFAA 3IBPA 4J2CA 2CLYC 3VKHA 3KINB 2XASB 3GN5A 3LFMA 4X1IE 5F8PA 3HA4A 1D1AA 4QKNA 4O2BE 1HCIA 2E9XA 3UULA 1UX4A 1D1CA 4KBMB 3C98B 3CPZA 2E9XC 3C4XA 4P0AA 3EDVA 3AA6B 5LXTE 2LSJA 2V7KA 2EHOD 2MTQA 3ETVA 2CXLA 5LCYA 1Y64B 2B1EA 4OYJA 5L3DB 3NZQA 5HWYA 4PW8A 3LK2B 3PUGA 5JDGA 3K3NA 2KINB 3SRZA 5JDMA 1EZ3A 3U78A 3ZC1A 2NW9A 4CI2B 2EHOB 4ZI2C 1LRZA 1YD8G 3WAKA 5EK3A 1ZEEA 1HF8A 2ACXA 3CMLA 3OBVE 4ILUA 5JDHA 3HKCE 3KV9A 3PUQA 4H9SE 5LA6E 3PURA 3ZYKA 3RPUA 4GIWA 4CI3B 2H7OA 4QXCB 3ZMZB 3I9WA 3CX8B 2NTYA 4CXXA 5JDQA 5LGTB 3CX6B 4FI5A 2A2FX 5HAXA 3JC6D 5DABA 2V7JA 2CMRA 3OJAA 4PK6A 4PK5A 5HXEA 1MMGA 5FXXA 4CXYA 2QA7A 4I55E 3ZN0B 3HR0A 1QUUA 3S4UA 5BMVE 2C5IT 4EOZB 2JQQA 4L9IA 2LE8A 2J1DG 3NRXA 3KVAA 3QC9A 4HE8A 1ZV4X 4P0BA 2VK9A 2DHRA 4EAHA 2NW7A 4C90A 2LSGA 1SHZC 4TZ4C 4XBFB 1ZHCA 1Z0PA 4OYKA 4BA9A 4DVDA 2DWGA 3KFWX 2KNDA 1MIYA 5JR9C 2M67A 5FMNA 3Q2MA 5LYJE 4N78D 3H37A 3RX6A 4HEAA 5HYAA 3ONXA 4EIWA 3WAJA 3CKDA 4ZS3A 1UX5A 1HTJF 3L09A 5FY7A 3RYCE 3GA8A 2X9XA 2K9AA 4O2AE 5L3FB 4AQFA 3K8PC 4FJOA 5JRCB 4TN7B 5LGUB 1MMAA 2W0GA 3O1IA 3ZN1B 4I50E 4QHOA 4WBOA 2ES0A 2WMOA 1UCUA 1LKXA 1FIOA 1BR2A 4KMCA 5HXHA 2KMFA 4U72A 3ZMUB 2XAQB 3OYZA 5FXVA 3HKEE 1G73A 3N2OA 3KBUA 2V1DB 5JQGE 1NAFA 2YK0A 2PFVA 1VRBA 3C51A 4UVAB 3RC3A 2PJQA 5JRCA 2RP4A 4ASKA 4OFZA 2EHOA 4UIGA 2KZ7B 1US7B 5HXRA 5LOVE 5HWXA 4Z8XA 3DP7A 3HKDE 3MK7C 2Y48B 3CQXC 3I0QA 3ZJ2A 3Q5WA 4YJ2E 2MOZA 5LP6E 2VASA 2DI4A 4WNKA 1HG5A 2CA5A 3AA7B 2WBLA 3BQKA 3KBTA 4GYSA 4BJMA 3IEEA 3HKBE 2ZMAA 3V5UA 4CXWA 4KUMB 4M1PA 2VKOA 4PFPA 4QX7B 4ERRA 5CA0E 2VKDA 3B57A 2VL8A 4EXTA 2W62A 4ISSA 3C4ZA 4AKGA 4O4IE 4PJNA 4AQGA 4YHJA 3AA0B 4H9OC 5LG4A 3UT5E 2V26A 3MJXA 5FXZA 5J2TE 2L9QA 4IE5A 2XAJB 2VKHA 3LBXA 2HPLA 5FY1A 1CUNA 4H63H 2ZLYA 3AAEB 3UUMA 5FNVE 4AXPA 2K5BB 4MBQA 5TAOA 3OKQA 3BQIA 1MMNA 4I4TE 3C64A 4GK5E 1IZNB 3UUNA 4UF0B 1MNDA 1HS7A 2VKJA 3H3AA 2VB6A 2Y8DA 2ZM8A 3LBXB 2CWYA 5H6QB 2CXFA 4PJMA 4IIJE 2WMNA 4JUYA 3AVSA 2LHRA 3VKGA 5ADXL 4ZHQE 4L5GA 3CQCB 4UVBB 5LGNB 2NTXA 4DMWA 4AI6A 2D2SA 4CZZB 2ODUA 2I59A 4OK0A 4OHFA 3RH3A 2CM0A 1VOMA 2SPCA 2YINA 4L0RA 3ETUA 1MMDA 3N9PA 2DCFA 3SS1A 4PJLA 4O4LE 4QX8B 2KT9A 3HL6A 3NZPA 4ZI2D 2ODVA 4H9PC 1OWAA 1U5PA 1QSDA 3PUAA 3LK42 2JJ9A 4HN9A 5HXSA 4ZI7E 3I1AA 2BVLA 2WM9A 4K0UA 4F6RC 3PUSA 5LBMA 4AKHA 3PTRB 3AB3B 4DBQA 2GK9A 4IE7A 4ANJA 3PU8A 3FBZA 3DTOA 5EZYE 5EK2A 2L8KA 5LBQB 2NOXA 3BQLA 3N2KE 2Q9QA 3VHLA 2LM9A 3O1JA 4IE0A 4O4JE 3RRWA 4AKLA 1LVFA 2UXNB 4PJJA 1IJ6A 2LHNA 5A1LA 1LVKA 2PG8A 2MYSA 2HPJA 1BR1A 1KK7A 3AVRA 5L2LA 3MA9A 4WW0A 2C5KT 5JR9A 4ZI3C 4HFVA 2DNXA 3CWZB 4DNDA 5GONE 2D0TA 3AAIA 3CX7B 2JMHA 2A72A 1HX8A 2IAKA 2L3LA 3TKLB 3WI3A 4HGAA 4TV9E 3E0ZA 3VU7H 1H7CA 2WAUA 3P8CD 4GOUA 3N9NA 4YJ3E 3J9X1 4MFRA 1MIWA 2LT3A 4HKAA 2IW5B 4IDZA 3LK3B 4UVCB 4MALA 3P7IA 3EDUA 5JREA 2XHEB 2PBIA 4H9RC 2XAHB 4UF0A 4V1Av 2W00A 1WRDA 2C5JA 2IC9A 1WYBA 5LHIB 1FMVA 2G0UA 3ZMTB 5C8YE 3N5LA 4HTEA 3U3IA 2K48A 5J1GA 2YU2A 3ANWA 4O4HE 5FY0A 4JEHB 3K3QC 2X51A 4UELA 3KV6A 2JMKA 2X66A 4E7ZA 1AJ3A 1IAPA 5KDMC 2Z6EA 3AAAB 3O9XA 4X1KE 4I43B 4PFOA 4G2AA 4QXBB 4WBNE 5KMGP 2BDEA 2RA1A 3F57A 5DQVA 1T98A 3RRCA 3F31A 2NP9A 3N2GE 3Q9DA 2N1GA 5J2UE 4XZCA 2OA5A 2CLYB 3GWHA 4UV8B 2HH7A 3D0TA 2ZM0A 3ZC0A 2LOSA 4ISTA 5L3BB 4BJNA 2UXXB 4EZHA 4GK0E 3EVYA 4IE6A 2KWIB 2LJLA 4IHJE 2LEHA 2EHOC 4EYUA 2ZM2A 2Q9QB 3ZLIA 2BVMA 1KNZA 2MBGA 4EZ4A 2H7VC 1YKEB 1D0XA 2BZBA 4QWNB 4AKRB 1OXZA 5FYMA 3NBXX 4C91A 2CXDA 2X9YA 3ZYLA 5LJMA 3KVBA 3Q5XA 2E9XB 2Q9QD 3PDYA 3ZCJA 3ZPOA 5LHHB 1S35A 2K24A 2CCQA 3QK6A 4X1YE 5DJQC 2P9BA 1X79A 5JDLA 4NUUA 2X0LB 2KWHA 3FB2A 2LSYA 4AKIA 3L3PA 5LHGB 5KX5E 3KV4A 4PAGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQQ A; 
#chains in the Genus database with same CATH topology
 5CJ5 A;  3RH3 A;  1T72 A;  3ZEF B;  1IBM T;  5HEO A;  2K3W A;  5IHY A;  2FJA A;  5JVD E;  3IF8 B;  2XQ5 A;  2A9U A;  3P4Q A;  3N9O A;  5EK4 A;  1B7T A;  1W0A A;  4KP3 C;  2XUE A;  2IML A;  2V7M A;  1E2A A;  3AE7 A;  3UTK A;  5ABF B;  2X67 A;  1JNZ A;  3CVR A;  3JC6 C;  3N9M A;  4TX5 A;  2D0U A;  1YW0 A;  4ZS2 A;  3ESL A;  4ZI3 D;  1L0V A;  2XSB A;  3R6N A;  4WZX A;  4YLH A;  2LSK A;  4GKJ T;  3HI2 A;  3T8O A;  2V6X A;  2WDR A;  4TWF A;  4P09 A;  2FJE A;  5HCM A;  3O4X E;  2WQY A;  3RIF A;  3V5S A;  4TWD A;  5JDN A;  5LJN A;  4HFE A;  3ZJ1 A;  3PUZ F;  2X68 A;  3O1H A;  5L3C B;  1WR0 A;  4TUY E;  5LNK A;  2XQ8 A;  3RYF E;  2CPT A;  2WDQ A;  3EI0 A;  2CBJ A;  4UV9 B;  2VWA A;  3OYX A;  2QGS A;  4U74 A;  5AQR B;  4H63 V;  5ABF A;  2UXD T;  1MIV A;  3FHN A;  4AQF C;  3KV5 A;  3UUX B;  4DMV A;  4HFC A;  2BKP A;  1BR4 A;  1MNE A;  3NRY A;  2UUC T;  4EYY R;  1SA0 E;  2W63 A;  1G8X A;  1V9D A;  5JR9 B;  4HFB A;  4DR5 T;  4G63 A;  5FL0 A;  2AXD S;  2CE7 A;  4TV8 E;  4JYA T;  1E1H B;  2YU1 A;  5AQH B;  2CHO A;  3VRA A;  1IBK T;  3GN5 B;  4CN6 A;  2DWK A;  3E22 E;  2BG9 E;  2JPF A;  1QLB A;  5E0O A;  4NUV A;  3BK9 A;  2KLQ A;  3SOL A;  1U4Q A;  3ZYM A;  2UXB T;  4H9Q C;  2E9X D;  4JLE A;  2Q9Q C;  2YEV C;  4KHZ F;  3GMI A;  3FZF B;  5M4Y A;  1XNR T;  1NWM X;  2X9W A;  3O9X A;  3MZK B;  1D0Y A;  4EB6 E;  4BAY B;  4ADZ A;  5AQU B;  2XTL A;  3MXZ A;  3RYI E;  3IHR A;  3ZT6 A;  3OVU A;  2V8S V;  4DV2 T;  3RKO A;  4A56 A;  3PE0 A;  2XY8 B;  2A3D A;  1D0Z A;  2ACZ A;  3ONJ A;  4JEU B;  1N36 T;  3CQG B;  5L3G B;  3A5X A;  1KNP A;  3AA1 B;  4XAX B;  2CWO A;  3AXJ A;  3FXD B;  2CEA A;  1WLX A;  5DQW A;  3W15 B;  5CA1 E;  2UU9 T;  4YFS A;  2W61 A;  1D1B A;  3I0O A;  2WSS V;  3NWI A;  4X20 E;  5AFU L;  4YTP A;  2YDS A;  1ZKE A;  2LLY A;  2BG9 A;  2VL0 A;  5JDF A;  3A7M A;  3B13 A;  1OED A;  2IC6 A;  3N9Q A;  1IJ5 A;  1O3X A;  3JAF A;  3MKD A;  3QUJ A;  4UXN B;  1KF6 A;  1FEW A;  2KSR A;  3K3O A;  3M3Z B;  3R84 B;  4E7S A;  1BR0 A;  2XAG B;  2XAF B;  4LF7 T;  3M65 A;  4PK4 A;  2X0H A;  5FXW A;  4JI1 T;  2MPK A;  3I9Y A;  4GYR A;  4O8S A;  4ERR A;  3EUH A;  4DO0 A;  1WFD A;  4HFH A;  5LB7 B;  2D5U A;  3ZCI A;  2LSI A;  2W67 A;  4QXH B;  4CI1 B;  2XZE A;  4IL9 A;  2W4X A;  2V5D A;  3Q5E A;  4ZOL E;  2J4G A;  4YTM A;  3J7Y q;  5CFB A;  2HHH T;  1Y01 A;  4TNV A;  3B5M A;  5AQT B;  3UFE A;  1WYC A;  2NWB A;  2NR4 A;  2JRK A;  1YXR A;  2E8I A;  2VVN A;  4MHC A;  3RLF F;  4DR3 T;  4IE4 A;  1KNZ A;  5L3E B;  2V7L A;  3MAC A;  4K0K T;  1WR6 A;  2HN1 A;  3ANW B;  5IYZ E;  2LOP A;  2YDQ A;  4H9N C;  2NW8 A;  3E08 A;  3RYH E;  3LG7 A;  3ZT5 A;  3NVO A;  4AKR B;  4EEB A;  5H6R B;  2LM2 A;  2N2N A;  2V7I A;  2W66 A;  1J5W A;  2Y6X A;  1W09 A;  1GQE A;  2XSA A;  3FXE B;  4MLK A;  5CB4 E;  3RHW A;  3H3M A;  3FZH B;  1S94 A;  2WZH A;  3LJC A;  3PJA A;  3SWH A;  4B6X A;  4DV6 T;  3ABV A;  4CQI A;  2KXP B;  3ZSS A;  3RC8 A;  4TNW A;  1FMW A;  5ETW A;  4A97 A;  2XQY A;  3C4W A;  1OED E;  3PV0 F;  2X9H A;  5F3J A;  1R8I A;  1KNR A;  3KDS E;  3P4W A;  5AQI B;  3ZMV B;  4DBR A;  5C3J A;  2H3R A;  1NEK A;  1HG2 A;  4UEM A;  5HXC A;  2C0S A;  4JI2 T;  5JH7 E;  3DJB A;  3UU6 A;  3G06 A;  3PU3 A;  3ZMS B;  5FP3 A;  4PNI A;  4DR7 T;  5HEJ A;  2VUR A;  1YKH B;  3F2E A;  3FZK B;  5HEH A;  3NKZ A;  4LF6 T;  3C50 A;  4DR4 T;  3AE1 A;  1HNZ T;  4IGU A;  3FBL A;  2DLR A;  3N9L A;  2WWU A;  4NPP A;  2N9D A;  1HFA A;  3IBP A;  4J2C A;  2CLY C;  3VKH A;  3KIN B;  2XAS B;  3GN5 A;  3LFM A;  4X1I E;  4JV5 T;  4DV7 T;  5F8P A;  3UU5 A;  2BBJ A;  1D1A A;  3HA4 A;  4QKN A;  4O2B E;  4P1N A;  1HCI A;  2QVA A;  2E9X A;  3UUL A;  4DV5 T;  1D1C A;  1UX4 A;  4KBM B;  2JQ9 A;  5BR8 T;  3PUW F;  2XQ6 A;  3C98 B;  2E9X C;  3C4X A;  3CPZ A;  4IL4 A;  4F8H A;  3EDV A;  3AA6 B;  1OED C;  5LXT E;  4P0A A;  2LSJ A;  2V7K A;  5C2T A;  2EHO D;  2MTQ A;  3ETV A;  2CXL A;  3PUV F;  5LCY A;  5AQF B;  1Y64 B;  2B1E A;  4LFC T;  4OYJ A;  5L3D B;  3NZQ A;  3AEA A;  4I0U A;  5AQN B;  4PW8 A;  3LK2 B;  3PUG A;  5HWY A;  3ZKR A;  4EED A;  5JDG A;  4JI7 T;  3K3N A;  2KIN B;  3SRZ A;  5JDM A;  3RKG A;  1EZ3 A;  2YOE A;  5ABG A;  3U78 A;  3ZC1 A;  5AQS B;  2NW9 A;  4CI2 B;  2EHO B;  4ZI2 C;  1CHU A;  1LRZ A;  1YD8 G;  3WAK A;  5EK3 A;  1ZEE A;  1HF8 A;  4A5X A;  2ACX A;  2WP9 A;  1J1J A;  3CML A;  3OBV E;  4ILU A;  5JDH A;  2DL1 A;  3HKC E;  3KV9 A;  2E5L T;  3PUQ A;  4H9S E;  2XQA A;  5LA6 E;  3A8Y C;  2LKG A;  4B3S T;  3PUR A;  3ZYK A;  3RPU A;  4GIW A;  4CI3 B;  3AE4 A;  4GKK T;  2H7O A;  4QXC B;  3ZMZ B;  3I9W A;  3CX8 B;  2BKO A;  2NTY A;  3VR8 A;  4CXX A;  4YSY A;  3CX6 B;  5JDQ A;  5LGT B;  4FI5 A;  3SFE A;  5AQM B;  2A2F X;  5HAX A;  3JC6 D;  5DAB A;  4HWI B;  2V5C A;  2V7J A;  5AQQ B;  2CMR A;  2YKS A;  3OJA A;  4PK6 A;  4PK5 A;  5HXE A;  1MMG A;  2BS3 A;  4U2Y A;  5FXX A;  3AE2 A;  2QA7 A;  4CXY A;  3PJA J;  4I55 E;  3HR0 A;  1QUU A;  3S4U A;  3ZN0 B;  4IDQ A;  1I94 T;  4Z91 A;  5BMV E;  1ZOY A;  4X5T A;  2C5I T;  1I6Z A;  4U2Z A;  4JI4 T;  4EOZ B;  4KHP T;  2JQQ A;  4L9I A;  2LE8 A;  2J1D G;  3NRX A;  3KVA A;  3QC9 A;  4HE8 A;  1ZV4 X;  4IDO A;  4P0B A;  4B3R T;  2BG9 B;  2DHR A;  1YQ3 A;  2VK9 A;  2NW7 A;  5AQJ B;  4C90 A;  2LSG A;  4EAH A;  4YT0 A;  4YSZ A;  1SHZ C;  4TZ4 C;  3RIU C;  4XBF B;  2WB5 A;  4DR2 T;  1IBL T;  1ZHC A;  1Z0P A;  4OYK A;  4BA9 A;  4DVD A;  5C8Y E;  2DWG A;  3KFW X;  4YHH T;  4B3M T;  3TLU A;  4OX9 T;  2KND A;  1MIY A;  2XQ7 A;  5JR9 C;  2M67 A;  5FMN A;  4LMK A;  4ZZC A;  4HFD A;  3Q2M A;  3QNU A;  2JIW A;  4N78 D;  5LYJ E;  3H37 A;  3RX6 A;  3LDQ B;  4HEA A;  5HYA A;  3ONX A;  3TLS A;  4X65 T;  2QYW A;  4EIW A;  1E7P A;  1M62 A;  3WAJ A;  5J0Z A;  2XQ9 A;  3CKD A;  1SUM B;  4NXN T;  4X62 T;  4ZS3 A;  1UX5 A;  1HTJ F;  3L09 A;  5FY7 A;  3RYC E;  3GA8 A;  4DV0 T;  2X9X A;  2K9A A;  4IT4 A;  4O2A E;  5L3F B;  3AEE A;  4AQF A;  4A98 A;  3T1Y T;  3K8P C;  4FJO A;  5FKY A;  4TN7 B;  5LGU B;  1MMA A;  2W0G A;  3O1I A;  3ZN1 B;  4NIQ A;  5JRC B;  3P4P A;  4I50 E;  4QHO A;  2ES0 A;  4WBO A;  3UQ4 A;  4DUZ T;  3ONL C;  4NXM T;  2WU2 A;  2WMO A;  1UCU A;  1LKX A;  1BR2 A;  1FIO A;  4KMC A;  5HXH A;  1T7S A;  2KMF A;  4U72 A;  3ZMU B;  2XAQ B;  3OYZ A;  4KX6 A;  3HKE E;  5FXV A;  1G73 A;  2RPA A;  2LKH A;  2JQK A;  3N2O A;  2WS3 A;  3KBU A;  3RF1 A;  2V1D B;  5JQG E;  1NAF A;  2YK0 A;  2PFV A;  3IA3 A;  1VRB A;  3C51 A;  4DV1 T;  4UVA B;  3RC3 A;  3OTO T;  4DR1 T;  2PJQ A;  5JRC A;  2CHN A;  2RP4 A;  4WYV A;  4OFZ A;  5HEU A;  5HCJ A;  4ASK A;  2EHO A;  4UIG A;  2KZ7 B;  1US7 B;  2OLT A;  1NEN A;  5HXR A;  4LFA T;  5LOV E;  2XM2 A;  3AE9 A;  5HWX A;  4Z8X A;  3DP7 A;  3HKD E;  1W9R A;  3MK7 C;  2XM1 A;  4YSX A;  2Y48 B;  3CQX C;  3I0Q A;  3ZJ2 A;  4DR6 T;  2WU5 A;  3X1D A;  4EV6 A;  3Q5W A;  3UUB A;  1FJG T;  4LMJ A;  2BG9 C;  4YJ2 E;  2MOZ A;  1UGO A;  5IWA T;  4B3T T;  2BKN A;  2VAS A;  5LP6 E;  2DI4 A;  2XJ7 A;  4WNK A;  1N34 T;  1HG5 A;  3Q5D A;  1XMO T;  3UU8 A;  2WZI A;  2CA5 A;  3AA7 B;  4ILC A;  4JBW F;  2WBL A;  3BQK A;  3KBT A;  2D9D A;  4GYS A;  3IEE A;  3HKB E;  2ZMA A;  3V5U A;  4BJM A;  4CXW A;  4KUM B;  5LMN T;  3P4R A;  2VKO A;  2CRB A;  4M1P A;  4PFP A;  1SE7 A;  4QX7 B;  2BBH A;  2WWV A;  2VKD A;  3B57 A;  3ZT7 A;  2VL8 A;  5ABH A;  5CA0 E;  5LG3 A;  4EXT A;  2W62 A;  4ISS A;  3C4Z A;  4AKG A;  2H89 A;  4O4I E;  4PJN A;  2XPK A;  4AQG A;  4YHJ A;  3OPC A;  3AA0 B;  1XZY A;  3RIU A;  4YXD A;  4H9O C;  4KI0 F;  5LG4 A;  3UT5 E;  2IDO B;  2X0Y A;  2V26 A;  3MJX A;  5FXZ A;  5J2T E;  3QB5 K;  5HEG A;  2L9Q A;  4IE5 A;  4COF A;  5FVL A;  2XAJ B;  3AE6 A;  5ABE A;  2VKH A;  4ILA A;  5CGM A;  2ZM6 T;  3LBX A;  2HPL A;  4AQY T;  5FY1 A;  1CUN A;  1UUR A;  2YDR A;  1N32 T;  4H63 H;  4X64 T;  3AEC A;  1XDO A;  3P50 A;  2E5V A;  3VR9 A;  2ZLY A;  4LF4 T;  3AAE B;  2M6I A;  3UUM A;  5FNV E;  4AXP A;  1UUS A;  3UFG A;  3EHZ A;  2K5B B;  4MBQ A;  5TAO A;  3OKQ A;  1YQ4 A;  4YY3 T;  5AQL B;  4DV3 T;  3BQI A;  1J5E T;  5AQP B;  1MMN A;  4I4T E;  3T1H T;  3C64 A;  4GK5 E;  3JAE A;  1IZN B;  3UUN A;  4UF0 B;  1MND A;  3ZST A;  1HX1 B;  2VKJ A;  2VB6 A;  2Y8D A;  2ZM8 A;  2BS4 A;  3H3A A;  1HS7 A;  3LBX B;  2CWY A;  3RI5 A;  5H6Q B;  2CXF A;  4PJM A;  4IIJ E;  4UR9 A;  2WMN A;  4JUY A;  3AVS A;  2CBI A;  2LHR A;  3VKG A;  2R6G F;  4TWH A;  5ADX L;  4ZHQ E;  1Z8U A;  1X9B A;  3CQC B;  4L5G A;  3UU4 A;  2VQE T;  4UVB B;  5LGN B;  2NTX A;  4DMW A;  4AI6 A;  2D2S A;  4CZZ B;  2ODU A;  2I59 A;  4OK0 A;  2LRL A;  2V6Y B;  2CM0 A;  4IDP A;  4OHF A;  1VOM A;  2SPC A;  2YIN A;  4L0R A;  4YTN A;  3ETU A;  2J47 A;  4ZXL A;  1MMD A;  2FBW A;  1WCR A;  4X66 T;  3N9P A;  2DCF A;  3SS1 A;  2FUP A;  4HFI A;  4DUY T;  3PUY F;  4PJL A;  4O4L E;  1XMQ T;  5AQK B;  3L39 A;  2KT9 A;  3HL6 A;  3NZP A;  4QX8 B;  4ZZB A;  5AQO B;  4ZI2 D;  2ODV A;  2IUB A;  4H9P C;  1OWA A;  1U5P A;  1QSD A;  1W0B A;  3LK4 2;  2JJ9 A;  3PUA A;  3AE3 A;  4HN9 A;  1VCT A;  4ILB A;  4ZI7 E;  5HXS A;  3I1A A;  2BVL A;  2WM9 A;  4IDN A;  4K0U A;  4F6R C;  3PUS A;  5LBM A;  4AKH A;  3PTR B;  3AB3 B;  4DBQ A;  2GK9 A;  4IE7 A;  4ANJ A;  3PU8 A;  1HNX T;  3FBZ A;  3DTO A;  5EZY E;  5EK2 A;  2L8K A;  5LBQ B;  4JI5 T;  2NOX A;  3BQL A;  3N2K E;  2M6B A;  5FVK A;  2H88 A;  2Q9Q A;  5AQG B;  3VHL A;  2I6H A;  2LM9 A;  3O1J A;  2E2A A;  4IE0 A;  4O4J E;  4JI6 T;  4LML A;  4Q25 A;  3RRW A;  1LVF A;  4AKL A;  1VCS A;  2IIU A;  1M7K A;  2UXN B;  2VVS A;  4HWC A;  4PJJ A;  1IJ6 A;  2LHN A;  4U33 A;  4LF9 T;  5A1L A;  5IUX A;  2W2U A;  1LVK A;  2PG8 A;  4U3C A;  5KXJ A;  2MYS A;  2HPJ A;  2VQF T;  1BR1 A;  1KK7 A;  3AVR A;  5L2L A;  1UK5 A;  3MA9 A;  2XQ3 A;  4WW0 A;  3QB5 A;  2C5K T;  3P4S A;  3AE5 A;  3L8R A;  5AQV B;  5JR9 A;  2BS2 A;  3AEG A;  4ZI3 C;  4HFV A;  2DNX A;  3CIR A;  1ZP0 A;  3AEB A;  3CWZ B;  4DND A;  5GON E;  2D0T A;  3AAI A;  3CX7 B;  4HWH A;  4U7I A;  3UU3 A;  2JMH A;  2A72 A;  5F5W A;  1HX8 A;  2IAK A;  2L3L A;  3TKL B;  3WI3 A;  4HGA A;  4TV9 E;  5LMU T;  3E0Z A;  3VU7 H;  4AIU A;  2OV9 A;  1H7C A;  2WAU A;  2JQH A;  3AEF A;  4ZEY A;  2IHR 1;  1JNR A;  3N9N A;  3P8C D;  4GOU A;  2B76 A;  4YJ3 E;  4MFR A;  3J9X 1;  4DID B;  1HR0 T;  1MIW A;  2LT3 A;  4HKA A;  2IW5 B;  4IDZ A;  3LK3 B;  4UVC B;  4MAL A;  1HNW T;  3P7I A;  3EDU A;  2J62 A;  2XHE B;  2PBI A;  4H9R C;  5JRE A;  2XAH B;  4UF0 A;  4V1A v;  4DV4 T;  2W00 A;  5L4E A;  1WRD A;  2C5J A;  3QOF A;  4HWF A;  2IC9 A;  1WYB A;  5LHI B;  1FMV A;  1XWM A;  2G0U A;  4U31 A;  3SFD A;  3ZMT B;  2XQ4 A;  3N5L A;  4HTE A;  3RQW A;  3U3I A;  2K48 A;  5J1G A;  2YU2 A;  3ANW A;  4O4H E;  5L47 A;  5FY0 A;  4JEH B;  2UXC T;  3RIA A;  4CN1 A;  3EAM A;  3K3Q C;  2X51 A;  3JAD A;  4UEL A;  2LRK A;  2WDV A;  3KV6 A;  2JMK A;  2X66 A;  4E7Z A;  1AJ3 A;  3VRB A;  1IAP A;  5JTG A;  5KDM C;  2V6Y A;  2Z6E A;  3AAA B;  3JCF A;  3K1S A;  4X1K E;  4I43 B;  4HWD A;  3TLV A;  2YN6 A;  4PFO A;  4G2A A;  4QXB B;  4WBN E;  5KMG P;  2BDE A;  2RA1 A;  3F57 A;  5DQV A;  3UQ7 A;  1T98 A;  2FJB A;  3F31 A;  4U7Y A;  4IRE A;  3RRC A;  2NP9 A;  4QH1 A;  3N2G E;  4QH4 A;  3RQU A;  3EAB A;  4JI8 T;  3CK6 A;  3Q9D A;  4LFB T;  2N1G A;  5J2U E;  4XZC A;  3RGL A;  2OA5 A;  3AE8 A;  2CLY B;  3GWH A;  4UV8 B;  2HH7 A;  3D0T A;  2ZM0 A;  1KFY A;  2LOS A;  3ZC0 A;  4QH5 A;  4IST A;  5L3B B;  4Z90 A;  4BJN A;  2UXX B;  2WY2 A;  4LF8 T;  4EZH A;  4LF5 T;  4GK0 E;  1KEY A;  3TLT A;  2PTF A;  3EVY A;  4IE6 A;  5L4H A;  2KWI B;  4AIS A;  2LJL A;  4IHJ E;  2LEH A;  1T8B A;  2EHO C;  4EYU A;  2ZM2 A;  2Q9Q B;  3FZM B;  2BVM A;  3ZLI A;  2MBG A;  4EZ4 A;  2H7V C;  1YKE B;  1D0X A;  2BZB A;  2I0M A;  2MAW A;  3AXJ B;  1OXZ A;  4QWN B;  5FYM A;  1XDP A;  1DU2 A;  3NBX X;  2HN2 A;  4C91 A;  2CXD A;  3AED A;  2F4V T;  2X9Y A;  3ZYL A;  5LJM A;  1N33 T;  3KVB A;  3Q5X A;  2E9X B;  4JI0 T;  1XNQ T;  2Q9Q D;  3PDY A;  1OED B;  3ZCJ A;  3ZPO A;  5FL1 A;  5LHH B;  2UUA T;  3LSV A;  1S35 A;  2K24 A;  2CCQ A;  3QK6 A;  4X1Y E;  5DJQ C;  2QRX A;  2P9B A;  1X79 A;  3PUX F;  5JDL A;  4NUU A;  4EGW A;  2X0L B;  2AE9 A;  3TLW A;  4CN4 A;  2KWH A;  2FJD A;  2UUB T;  3FZL B;  3FB2 A;  2LSY A;  4AKI A;  3L3P A;  5LHG B;  5KX5 E;  3KV4 A;  4JI3 T;  2WCA A;  4PAG A; 
#chains in the Genus database with same CATH homology
 3ZEF B;  5IHY A;  5JVD E;  3IF8 B;  5EK4 A;  3N9O A;  1B7T A;  4KP3 C;  2XUE A;  2V7M A;  3UTK A;  2X67 A;  3CVR A;  3JC6 C;  3N9M A;  4TX5 A;  4ZS2 A;  2D0U A;  1YW0 A;  4ZI3 D;  3ESL A;  3R6N A;  4YLH A;  2LSK A;  3HI2 A;  3T8O A;  4P09 A;  3V5S A;  3O4X E;  5JDN A;  5LJN A;  3ZJ1 A;  5LNK A;  2X68 A;  3O1H A;  5L3C B;  4TUY E;  3RYF E;  4UV9 B;  2VWA A;  3OYX A;  2QGS A;  4U74 A;  4H63 V;  1MIV A;  3FHN A;  4AQF C;  3KV5 A;  3UUX B;  4DMV A;  1BR4 A;  1MNE A;  3NRY A;  4EYY R;  1SA0 E;  2W63 A;  1G8X A;  1V9D A;  5JR9 B;  4G63 A;  4TV8 E;  2CE7 A;  1E1H B;  2YU1 A;  3GN5 B;  2DWK A;  3E22 E;  2JPF A;  5E0O A;  4NUV A;  3BK9 A;  2KLQ A;  3SOL A;  1U4Q A;  3ZYM A;  4H9Q C;  2E9X D;  4JLE A;  2Q9Q C;  2YEV C;  3GMI A;  5M4Y A;  1NWM X;  2X9W A;  3MZK B;  1D0Y A;  4EB6 E;  4BAY B;  4ADZ A;  2XTL A;  3MXZ A;  3RYI E;  3IHR A;  3RKO A;  4A56 A;  3PE0 A;  2A3D A;  1D0Z A;  4JEU B;  3CQG B;  5L3G B;  3A5X A;  3AA1 B;  4XAX B;  2CWO A;  3FXD B;  2CEA A;  1WLX A;  5DQW A;  3W15 B;  5CA1 E;  4YFS A;  2W61 A;  1D1B A;  3I0O A;  2WSS V;  4X20 E;  5AFU L;  1ZKE A;  5JDF A;  3B13 A;  2IC6 A;  3N9Q A;  1IJ5 A;  1O3X A;  3MKD A;  3QUJ A;  4UXN B;  4E7S A;  3K3O A;  1FEW A;  3R84 B;  1BR0 A;  2XAG B;  2XAF B;  3M65 A;  4PK4 A;  5FXW A;  3I9Y A;  4GYR A;  4O8S A;  3EUH A;  4DO0 A;  2D5U A;  3ZCI A;  2LSI A;  4QXH B;  4CI1 B;  4ZOL E;  3J7Y q;  3UFE A;  1WYC A;  2NWB A;  2E8I A;  2JRK A;  4MHC A;  4IE4 A;  5L3E B;  2V7L A;  3MAC A;  1WR6 A;  3ANW B;  5IYZ E;  2LOP A;  4H9N C;  2NW8 A;  3E08 A;  3RYH E;  3LG7 A;  5H6R B;  2N2N A;  2V7I A;  2Y6X A;  4MLK A;  3FXE B;  5CB4 E;  3SWH A;  1S94 A;  3LJC A;  4B6X A;  4CQI A;  2KXP B;  3RC8 A;  5ETW A;  1FMW A;  3C4W A;  2XQY A;  2X9H A;  5F3J A;  3ZMV B;  3KDS E;  4DBR A;  2H3R A;  1HG2 A;  4UEM A;  5HXC A;  2C0S A;  5JH7 E;  3DJB A;  3PU3 A;  3ZMS B;  5FP3 A;  4PNI A;  3F2E A;  1YKH B;  3C50 A;  4IGU A;  3FBL A;  2DLR A;  3N9L A;  2WWU A;  2N9D A;  1HFA A;  3IBP A;  4J2C A;  2CLY C;  3VKH A;  3KIN B;  2XAS B;  3GN5 A;  3LFM A;  4X1I E;  5F8P A;  3HA4 A;  1D1A A;  4QKN A;  4O2B E;  1HCI A;  2E9X A;  3UUL A;  1UX4 A;  1D1C A;  4KBM B;  3C98 B;  3CPZ A;  2E9X C;  3C4X A;  4P0A A;  3EDV A;  3AA6 B;  5LXT E;  2LSJ A;  2V7K A;  2EHO D;  2MTQ A;  3ETV A;  2CXL A;  5LCY A;  1Y64 B;  2B1E A;  4OYJ A;  5L3D B;  3NZQ A;  5HWY A;  4PW8 A;  3LK2 B;  3PUG A;  5JDG A;  3K3N A;  2KIN B;  3SRZ A;  5JDM A;  1EZ3 A;  3U78 A;  3ZC1 A;  2NW9 A;  4CI2 B;  2EHO B;  4ZI2 C;  1LRZ A;  1YD8 G;  3WAK A;  5EK3 A;  1ZEE A;  1HF8 A;  2ACX A;  3CML A;  3OBV E;  4ILU A;  5JDH A;  3HKC E;  3KV9 A;  3PUQ A;  4H9S E;  5LA6 E;  3PUR A;  3ZYK A;  3RPU A;  4GIW A;  4CI3 B;  2H7O A;  4QXC B;  3ZMZ B;  3I9W A;  3CX8 B;  2NTY A;  4CXX A;  5JDQ A;  5LGT B;  3CX6 B;  4FI5 A;  2A2F X;  5HAX A;  3JC6 D;  5DAB A;  2V7J A;  2CMR A;  3OJA A;  4PK6 A;  4PK5 A;  5HXE A;  1MMG A;  5FXX A;  4CXY A;  2QA7 A;  4I55 E;  3ZN0 B;  3HR0 A;  1QUU A;  3S4U A;  5BMV E;  2C5I T;  4EOZ B;  2JQQ A;  4L9I A;  2LE8 A;  2J1D G;  3NRX A;  3KVA A;  3QC9 A;  4HE8 A;  1ZV4 X;  4P0B A;  2VK9 A;  2DHR A;  4EAH A;  2NW7 A;  4C90 A;  2LSG A;  1SHZ C;  4TZ4 C;  4XBF B;  1ZHC A;  1Z0P A;  4OYK A;  4BA9 A;  4DVD A;  2DWG A;  3KFW X;  2KND A;  1MIY A;  5JR9 C;  2M67 A;  5FMN A;  3Q2M A;  5LYJ E;  4N78 D;  3H37 A;  3RX6 A;  4HEA A;  5HYA A;  3ONX A;  4EIW A;  3WAJ A;  3CKD A;  4ZS3 A;  1UX5 A;  1HTJ F;  3L09 A;  5FY7 A;  3RYC E;  3GA8 A;  2X9X A;  2K9A A;  4O2A E;  5L3F B;  4AQF A;  3K8P C;  4FJO A;  5JRC B;  4TN7 B;  5LGU B;  1MMA A;  2W0G A;  3O1I A;  3ZN1 B;  4I50 E;  4QHO A;  4WBO A;  2ES0 A;  2WMO A;  1UCU A;  1LKX A;  1FIO A;  1BR2 A;  4KMC A;  5HXH A;  2KMF A;  4U72 A;  3ZMU B;  2XAQ B;  3OYZ A;  5FXV A;  3HKE E;  1G73 A;  3N2O A;  3KBU A;  2V1D B;  5JQG E;  1NAF A;  2YK0 A;  2PFV A;  1VRB A;  3C51 A;  4UVA B;  3RC3 A;  2PJQ A;  5JRC A;  2RP4 A;  4ASK A;  4OFZ A;  2EHO A;  4UIG A;  2KZ7 B;  1US7 B;  5HXR A;  5LOV E;  5HWX A;  4Z8X A;  3DP7 A;  3HKD E;  3MK7 C;  2Y48 B;  3CQX C;  3I0Q A;  3ZJ2 A;  3Q5W A;  4YJ2 E;  2MOZ A;  5LP6 E;  2VAS A;  2DI4 A;  4WNK A;  1HG5 A;  2CA5 A;  3AA7 B;  2WBL A;  3BQK A;  3KBT A;  4GYS A;  4BJM A;  3IEE A;  3HKB E;  2ZMA A;  3V5U A;  4CXW A;  4KUM B;  4M1P A;  2VKO A;  4PFP A;  4QX7 B;  4ERR A;  5CA0 E;  2VKD A;  3B57 A;  2VL8 A;  4EXT A;  2W62 A;  4ISS A;  3C4Z A;  4AKG A;  4O4I E;  4PJN A;  4AQG A;  4YHJ A;  3AA0 B;  4H9O C;  5LG4 A;  3UT5 E;  2V26 A;  3MJX A;  5FXZ A;  5J2T E;  2L9Q A;  4IE5 A;  2XAJ B;  2VKH A;  3LBX A;  2HPL A;  5FY1 A;  1CUN A;  4H63 H;  2ZLY A;  3AAE B;  3UUM A;  5FNV E;  4AXP A;  2K5B B;  4MBQ A;  5TAO A;  3OKQ A;  3BQI A;  1MMN A;  4I4T E;  3C64 A;  4GK5 E;  1IZN B;  3UUN A;  4UF0 B;  1MND A;  1HS7 A;  2VKJ A;  3H3A A;  2VB6 A;  2Y8D A;  2ZM8 A;  3LBX B;  2CWY A;  5H6Q B;  2CXF A;  4PJM A;  4IIJ E;  2WMN A;  4JUY A;  3AVS A;  2LHR A;  3VKG A;  5ADX L;  4ZHQ E;  4L5G A;  3CQC B;  4UVB B;  5LGN B;  2NTX A;  4DMW A;  4AI6 A;  2D2S A;  4CZZ B;  2ODU A;  2I59 A;  4OK0 A;  4OHF A;  3RH3 A;  2CM0 A;  1VOM A;  2SPC A;  2YIN A;  4L0R A;  3ETU A;  1MMD A;  3N9P A;  2DCF A;  3SS1 A;  4PJL A;  4O4L E;  4QX8 B;  2KT9 A;  3HL6 A;  3NZP A;  4ZI2 D;  2ODV A;  4H9P C;  1OWA A;  1U5P A;  1QSD A;  3PUA A;  3LK4 2;  2JJ9 A;  4HN9 A;  5HXS A;  4ZI7 E;  3I1A A;  2BVL A;  2WM9 A;  4K0U A;  4F6R C;  3PUS A;  5LBM A;  4AKH A;  3PTR B;  3AB3 B;  4DBQ A;  2GK9 A;  4IE7 A;  4ANJ A;  3PU8 A;  3FBZ A;  3DTO A;  5EZY E;  5EK2 A;  2L8K A;  5LBQ B;  2NOX A;  3BQL A;  3N2K E;  2Q9Q A;  3VHL A;  2LM9 A;  3O1J A;  4IE0 A;  4O4J E;  3RRW A;  4AKL A;  1LVF A;  2UXN B;  4PJJ A;  1IJ6 A;  2LHN A;  5A1L A;  1LVK A;  2PG8 A;  2MYS A;  2HPJ A;  1BR1 A;  1KK7 A;  3AVR A;  5L2L A;  3MA9 A;  4WW0 A;  2C5K T;  5JR9 A;  4ZI3 C;  4HFV A;  2DNX A;  3CWZ B;  4DND A;  5GON E;  2D0T A;  3AAI A;  3CX7 B;  2JMH A;  2A72 A;  1HX8 A;  2IAK A;  2L3L A;  3TKL B;  3WI3 A;  4HGA A;  4TV9 E;  3E0Z A;  3VU7 H;  1H7C A;  2WAU A;  3P8C D;  4GOU A;  3N9N A;  4YJ3 E;  3J9X 1;  4MFR A;  1MIW A;  2LT3 A;  4HKA A;  2IW5 B;  4IDZ A;  3LK3 B;  4UVC B;  4MAL A;  3P7I A;  3EDU A;  5JRE A;  2XHE B;  2PBI A;  4H9R C;  2XAH B;  4UF0 A;  4V1A v;  2W00 A;  1WRD A;  2C5J A;  2IC9 A;  1WYB A;  5LHI B;  1FMV A;  2G0U A;  3ZMT B;  5C8Y E;  3N5L A;  4HTE A;  3U3I A;  2K48 A;  5J1G A;  2YU2 A;  3ANW A;  4O4H E;  5FY0 A;  4JEH B;  3K3Q C;  2X51 A;  4UEL A;  3KV6 A;  2JMK A;  2X66 A;  4E7Z A;  1AJ3 A;  1IAP A;  5KDM C;  2Z6E A;  3AAA B;  3O9X A;  4X1K E;  4I43 B;  4PFO A;  4G2A A;  4QXB B;  4WBN E;  5KMG P;  2BDE A;  2RA1 A;  3F57 A;  5DQV A;  1T98 A;  3RRC A;  3F31 A;  2NP9 A;  3N2G E;  3Q9D A;  2N1G A;  5J2U E;  4XZC A;  2OA5 A;  2CLY B;  3GWH A;  4UV8 B;  2HH7 A;  3D0T A;  2ZM0 A;  3ZC0 A;  2LOS A;  4IST A;  5L3B B;  4BJN A;  2UXX B;  4EZH A;  4GK0 E;  3EVY A;  4IE6 A;  2KWI B;  2LJL A;  4IHJ E;  2LEH A;  2EHO C;  4EYU A;  2ZM2 A;  2Q9Q B;  3ZLI A;  2BVM A;  1KNZ A;  2MBG A;  4EZ4 A;  2H7V C;  1YKE B;  1D0X A;  2BZB A;  4QWN B;  4AKR B;  1OXZ A;  5FYM A;  3NBX X;  4C91 A;  2CXD A;  2X9Y A;  3ZYL A;  5LJM A;  3KVB A;  3Q5X A;  2E9X B;  2Q9Q D;  3PDY A;  3ZCJ A;  3ZPO A;  5LHH B;  1S35 A;  2K24 A;  2CCQ A;  3QK6 A;  4X1Y E;  5DJQ C;  2P9B A;  1X79 A;  5JDL A;  4NUU A;  2X0L B;  2KWH A;  3FB2 A;  2LSY A;  4AKI A;  3L3P A;  5LHG B;  5KX5 E;  3KV4 A;  4PAG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...