2JQQA

Solution structure of saccharomyces cerevisiae conserved oligomeric golgi subunit 2 protein (cog2p)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
154
Chain Sequence
KTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQLTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSIIKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Conserved oligomeric Golgi complex subunit 2
publication title Structural analysis of conserved oligomeric Golgi complex subunit 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 58
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1240 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jqqA00
2JQQA
chains in the Genus database with same CATH superfamily
4IL9A 1D0ZA 3QB5A 4ZI3C 1MNEA 2E5LT 2YINA 4CXWA 4KX6A 5LMUT 2WU5A 2VURA 4OFZA 4U2YA 3AA1B 4J2CA 2E9XA 3JC6C 1E1HB 5LCYA 4IIJE 3HKCE 5IWAT 2KWHA 1DU2A 4O4LE 1NEKA 3MA9A 3N9LA 4CQIA 3KVAA 4BAYB 3B57A 4LMJA 1IJ5A 2EHOC 3BQLA 5JDNA 3ZMTB 3IEEA 5HXHA 3UQ4A 3S4UA 3O1HA 2CPTA 4AISA 2PG8A 5J2UE 4JI2T 4LFCT 3QNUA 2I0MA 3UU5A 5AQRB 3F2EA 3LK3B 5HXEA 4P0BA 2LOPA 4AQGA 3C4XA 3GWHA 5L3BB 2BG9A 3L3PA 4QX8B 2J62A 2IUBA 4HWCA 2VQFT 4C91A 2BKPA 2ACZA 4ILBA 4E7SA 3I0OA 3HKEE 5LGNB 1NENA 1AJ3A 4IT4A 5FL0A 1YKEB 2K9AA 3E22E 3PUGA 2K5BB 2MYSA 4HWFA 2LEHA 2Q9QD 2VASA 2CRBA 1L0VA 2CXFA 2KLQA 3NWIA 2JRKA 2XQAA 4G2AA 4UV9B 1IZNB 3IBPA 1OEDB 2HH7A 3EHZA 5F5WA 5DJQC 4I4TE 3ZYLA 2LHRA 2VB6A 3RIUA 1FJGT 2X9WA 2NP9A 3HL6A 2MAWA 2BKNA 5L3GB 2NR4A 2ODUA 2YKSA 4IDPA 4CN4A 2YEVC 5AQVB 1V9DA 2W62A 2W00A 4U7YA 4B3ST 4ASKA 4GK0E 2OA5A 4C90A 4TNWA 4EEDA 2WM9A 4LMLA 2HN2A 1FMWA 5TAOA 1HTJF 1HS7A 2V5CA 3PUSA 5LOVE 4X1KE 2V6XA 2XQ4A 4E7ZA 1M7KA 5ABHA 3N9MA 2JMHA 2V7KA 2FJBA 2LRLA 5LGUB 4PJLA 4P1NA 2H89A 1NWMX 4KUMB 4V1Av 4G63A 1YQ3A 4JLEA 4PNIA 5HXRA 4YSYA 3PE0A 3RYHE 2J1DG 3FZKB 4L0RA 2R6GF 2BS4A 3PUYF 2BVLA 3HI2A 5C3JA 2CXLA 3B13A 2I6HA 2IC6A 3PU3A 3AE8A 3AE1A 3RH3A 4DR1T 3RLFF 4ZHQE 4YSZA 2DWKA 3SWHA 2DNXA 5FY0A 2YDRA 5FXXA 4HGAA 2WP9A 1I94T 4YTPA 1MMGA 1T7SA 4DVDA 3UU8A 4QWNB 1E7PA 5L3EB 4CXYA 2WS3A 4UR9A 1OXZA 3E0ZA 4DV3T 2UXBT 1Z8UA 2FBWA 4AKLA 1U4QA 1H7CA 3ZCJA 2ZM8A 5AQKB 2WQYA 4NPPA 4IE7A 3JADA 3BK9A 4ZI3D 4X64T 2BBJA 4ZOLE 4QH1A 2Z6EA 4LFAT 2CBJA 3P7IA 2XSBA 5LHIB 5AFUL 4WYVA 4QHOA 1MMAA 3KBTA 4HFEA 2XQ5A 4XZCA 3MK7C 4X65T 1W0AA 3EDUA 2K24A 5FY7A 2NW7A 4X62T 2ZMAA 4Z8XA 2UXDT 5JR9B 1SHZC 1J5WA 4KP3C 4X5TA 4LF6T 2M67A 2OLTA 3AAEB 2VVSA 1IJ6A 2V5DA 1XNRT 2UXCT 2D2SA 4BJMA 2QYWA 3ZYMA 5JDLA 3EVYA 4O8SA 4DR2T 2K48A 1HCIA 3O1JA 3RGLA 2KXPB 2VKDA 4A98A 2BG9E 5LP6E 4I43B 2XM2A 3AA7B 2XQ6A 4OX9T 3AVRA 4KHZF 4OK0A 2NW8A 4UELA 4AI6A 3HKDE 1UUSA 2BS2A 5GONE 4N78D 1MMDA 4A5XA 3ZYKA 5AQNB 3JAFA 3EAMA 3F57A 4FI5A 4MHCA 2C0SA 5FXZA 5CA0E 2V7JA 4PK4A 1N36T 4DMWA 3ETVA 4QH5A 3MJXA 3DJBA 1XNQT 4EYYR 3D0TA 5ETWA 2NOXA 3ZSSA 3UU3A 3LDQB 2LSYA 4DV5T 4ZXLA 1VCTA 3KV6A 3CX8B 3LK42 3CK6A 4BJNA 4AQYT 3AE9A 1G73A 3AB3B 2LRKA 2BDEA 5LG4A 3MKDA 4OHFA 1YD8G 5AQUB 4ERRA 1UURA 2XJ7A 1D0XA 5AQPB 2J47A 1I6ZA 3AAIA 2CEAA 2WU2A 3QK6A 4ZZBA 4YHJA 3CIRA 3RF1A 2I59A 3FZFB 1JNRA 5LHGB 3FB2A 1QLBA 3PTRB 1XMQT 4O2AE 4HEAA 4Z90A 4AKHA 2WY2A 5EK4A 2QA7A 2XZEA 1XDPA 5L3DB 3O9XA 5CFBA 3LBXA 3CMLA 2XY8B 2MBGA 3ETUA 4QXHB 3HKBE 3CQCB 1XDOA 3K3NA 4EV6A 3FXEB 4ILUA 1WYBA 4YTNA 4NUUA 2KT9A 2MTQA 3RI5A 1UX4A 2L9QA 3TLTA 4IDNA 2XQYA 4NXNT 2C5JA 1OEDC 4IDZA 2FUPA 3C64A 1KK7A 2QVAA 3H37A 2W2UA 2DCFA 3RIUC 3RIFA 4O2BE 1R8IA 1FMVA 3H3MA 3W15B 3PJAJ 3F31A 3UUBA 3ONJA 4IL4A 3ONLC 2Q9QB 5FMNA 5JDMA 2N1GA 1X79A 1B7TA 2Q9QA 4P0AA 3I9YA 4ILCA 4K0KT 2AE9A 3AXJB 4EXTA 4U3CA 3AXJA 2WWUA 5J2TE 1T98A 1US7B 4JUYA 3C50A 3ZLIA 5FVKA 2LHNA 1J1JA 4DUZT 5FL1A 2V7LA 4B6XA 3P4QA 4LF9T 5LB7B 5LBMA 4PJJA 3V5UA 3H3AA 4GKJT 2SPCA 4XBFB 3G06A 3RRCA 4Z91A 4MALA 3N9QA 4AIUA 1ZHCA 5L47A 5AQLB 5HEUA 3VKHA 3NRXA 5HCJA 4HE8A 4HFCA 5IUXA 1HX8A 4YJ3E 2VKOA 2CWOA 2XPKA 4JI3T 2C5KT 3ZMSB 2X0LB 3P4PA 3AA6B 1UCUA 4TV9E 2LJLA 3P4SA 2LM9A 4IDQA 2YK0A 3NRYA 2WDQA 3I0QA 4ISSA 2DLRA 4U7IA 4LF5T 2MPKA 2CLYB 3ZSTA 3PUQA 2BKOA 3JAEA 2VKHA 1LRZA 4ZI2D 4UVBB 4NUVA 3VR8A 3AE5A 2WWVA 3NZPA 1OEDA 2XQ7A 4QXBB 4LFBT 2ZM2A 2X51A 3K1SA 2L8KA 3ZC0A 3KVBA 4DV1T 2ZLYA 2WMOA 3C51A 4DBQA 4DMVA 2YU2A 3T8OA 1MIYA 5JDQA 1SA0E 3AVSA 3N2KE 2BBHA 3J7Yq 5F3JA 4OYKA 3KV4A 2E9XD 2W0GA 3ABVA 4H9OC 2B1EA 4GIWA 3VR9A 5EZYE 2XQ8A 5AQTB 1BR4A 4U31A 1FEWA 5JR9C 4ILAA 1ZV4X 3QUJA 4YXDA 4QH4A 4AKIA 1WYCA 3P4WA 4CI1B 3M65A 1N32T 3GN5B 1KNZA 3Q5EA 2HPJA 4O4JE 2LOSA 5CGMA 1BR2A 2VQET 1SUMB 1KFYA 5CA1E 5C2TA 4O4IE 4CI2B 3RIAA 4QX7B 2B76A 2MOZA 4DO0A 4U74A 1KNPA 3ANWB 3RYCE 1S35A 4LF4T 4HFBA 4ZZCA 1QSDA 1FIOA 5AQFB 3RC8A 5HWYA 4MFRA 1ZKEA 2BS3A 4TWHA 1VCSA 3ZMUB 2E8IA 3E08A 3RRWA 1D1AA 5FXVA 3FBLA 3TLSA 2YN6A 5LBQB 3VRBA 4ADZA 2WBLA 3A8YC 1EZ3A 4B3RT 4HFIA 4TN7B 2C5IT 4YT0A 3ZT7A 2WB5A 1D0YA 5FY1A 5FVLA 3N9OA 1OWAA 3SS1A 4QXCB 3VRAA 2NTYA 1IAPA 1CUNA 2N2NA 4FJOA 1U5PA 2WDVA 2UUAT 2WDRA 2CM0A 4IGUA 3LFMA 4ISTA 2V26A 3B5MA 2X9YA 4M1PA 2ES0A 1CHUA 5JRCB 1HNXT 2JMKA 2RPAA 3N9NA 5FP3A 3KV5A 2YDSA 4A97A 2CMRA 2W4XA 3CKDA 2A3DA 2CE7A 3UFGA 3DP7A 5J1GA 3PUXF 4IE6A 3JC6D 4PK6A 2CHOA 2X9HA 3AEEA 3EDVA 3GMIA 2LSGA 3KINB 2KMFA 3L09A 5JR9A 2EHOD 2CA5A 3X1DA 5JTGA 4WZXA 3Q2MA 3NKZA 4PJNA 2UUCT 3N9PA 5DQWA 3RKGA 1BR1A 5HWXA 3ZMZB 4DUYT 3PU8A 4CN1A 2P9BA 4YTMA 2DWGA 1X9BA 3T1YT 1W9RA 4TWFA 5HEOA 4DR7T 2D9DA 3RKOA 5AQQB 2JQHA 2Y48B 4X20E 3IHRA 1Z0PA 3L39A 4F8HA 5ABFB 5AQGB 4JI7T 2FJAA 4I55E 5ABFA 2Q9QC 3PUWF 5CB4E 4IREA 5BMVE 4EB6E 2LSIA 3VHLA 2LSJA 4JEHB 3LG7A 5HEGA 3K3OA 1OEDE 4UF0B 2JQKA 4UF0A 3ZEFB 2H7OA 1KF6A 5HEHA 1HX1B 3QC9A 4DR3T 5IHYA 1YXRA 3Q5XA 3UTKA 1HNWT 1MIWA 3KFWX 4GYSA 2PTFA 4ZI7E 4A56A 4H9PC 4HFDA 5LYJE 4I50E 3K8PC 4HKAA 4HWDA 3RYIE 3WI3A 2M6BA 3Q5DA 4AKRB 2YDQA 3VU7H 4UV8B 3FZHB 3QOFA 3R84B 2V1DB 4L9IA 3BQIA 5HYAA 3VKGA 2CBIA 2W61A 3OPCA 4YLHA 1KNRA 2JPFA 4DV0T 3AAAB 4IE0A 2JIWA 1VOMA 4UEMA 4ZEYA 3AA0B 2D0UA 5JVDE 1LVFA 2DI4A 2D5UA 2F4VT 3KDSE 4GOUA 4HN9A 5LHHB 2LKHA 2CLYC 3BQKA 5C8YE 2JQ9A 2KZ7B 2BVMA 3AEBA 2H7VC 4ZS2A 2XAGB 2IHR1 2KINB 1MIVA 2XAHB 4WW0A 2FJDA 5DQVA 3OTOT 3PV0F 2IW5B 1XWMA 3OYZA 5L3CB 5F8PA 5FXWA 4QKNA 3EI0A 4LMKA 2UXXB 2X0HA 4EOZB 2DHRA 4DV2T 3ZPOA 3UQ7A 4B3MT 2WZHA 3SRZA 4O4HE 5HCMA 5LJMA 3UUMA 1HFAA 4P09A 2X66A 3AE6A 4DBRA 3P50A 2XSAA 3U3IA 3PUAA 1KEYA 2E9XB 2IIUA 5LGTB 2DL1A 4TUYE 2IC9A 2V8SV 4ZS3A 2V6YB 3UULA 2V6YA 3AE3A 4KMCA 5LA6E 4KHPT 2NTXA 4JI0T 3MZKB 3WAKA 2PBIA 3I9WA 4GK5E 1O3XA 3K3QC 4U72A 5KXJA 5FNVE 1HG5A 3IA3A 1WR6A 3CPZA 1W0BA 4Q25A 5HXSA 1XZYA 3ZMVB 4PFOA 2G0UA 4AQFC 1E2AA 3ZKRA 5H6RB 2BG9B 4JI8T 3ZCIA 4JYAT 2V7IA 3TLUA 3C4WA 1MNDA 1IBKT 4I0UA 4JV5T 2IMLA 4YJ2E 3J9X1 1WR0A 3TLVA 1YW0A 1N33T 4COFA 4UVAB 5AQSB 4HFVA 1T8BA 3N2OA 4HFHA 1NAFA 2XAQB 1D1CA 3HR0A 5CJ5A 3KBUA 4H63V 5JDHA 1ZP0A 1WRDA 1QUUA 3P8CD 5LMNT 3MACA 3CVRA 4U2ZA 4JI4T 3FHNA 3ZC1A 1HF8A 3FXDB 1D1BA 1VRBA 2XASB 3AE4A 3A5XA 2XTLA 4H9NC 2X68A 2X9XA 5HAXA 1J5ET 5E0OA 4JEUB 3O1IA 1IBLT 4OYJA 2CXDA 5JDGA 3Q5WA 4YFSA 4ANJA 4L5GA 4EIWA 2N9DA 2X0YA 3GN5A 1WLXA 1Y01A 2BZBA 4DNDA 5LG3A 2ODVA 4EZ4A 4X1YE 3PJAA 4CN6A 3TKLB 2UXNB 5L3FB 1HR0T 4PW8A 2EHOB 3ANWA 2L3LA 2V7MA 2EHOA 5LJNA 5KMGP 4WBOA 3AEGA 3CQGB 2FJEA 2QRXA 1IBMT 2VKJA 3UU4A 2VL8A 3U78A 3ESLA 2VVNA 2IDOB 4UVCB 3RPUA 5AQMB 1YKHB 3ONXA 4UIGA 4PAGA 4X66T 3MXZA 4MLKA 4MBQA 2W67A 4BA9A 1LKXA 5A1LA 3AEFA 4AQFA 4YSXA 1XMOT 1GQEA 4H9SE 5JDFA 2KWIB 3OVUA 5L2LA 4DIDB 3GA8A 1SE7A 2LE8A 2RP4A 4DV6T 1UX5A 3RQUA 4X1IE 2NW9A 2CWYA 4AKGA 3IF8B 4DV4T 1UK5A 5JQGE 2XQ9A 2A9UA 3AEDA 3RX6A 3A7MA 3PDYA 2LM2A 3SFEA 3Q9DA 3O4XE 3AEAA 5AQOB 3AECA 5JRCA 4CZZB 4JI6T 4TX5A 4EAHA 4YY3T 4HWIB 4LF8T 2XM1A 4HTEA 1MMNA 1T72A 2CCQA 1S94A 3RHWA 4JBWF 3ZN0B 1WFDA 3HA4A 3FZMB 3OBVE 1ZEEA 3CQXC 4PK5A 3SOLA 5HXCA 4KI0F 5KDMC 2RA1A 3OYXA 1ZOYA 2AXDS 2H3RA 2W63A 5ADXL 2A2FX 4EYUA 3NZQA 5HEJA 4EZHA 2KSRA 5JH7E 4PFPA 3V5SA 2WZIA 3LJCA 3ZT5A 2OV9A 2QGSA 5M4YA 3RQWA 4DV7T 4WBNE 3AE7A 5EK3A 4XAXB 4IE4A 2WSSV 2UUBT 1HG2A 4IDOA 4IE5A 3C98B 3LK2B 5LXTE 5FYMA 3SFDA 5DABA 2NWBA 4JI5T 5H6QB 4YHHT 3P4RA 2W66A 2LKGA 2Y6XA 1N34T 2YOEA 2YU1A 4DR4T 5FKYA 4CI3B 1W09A 4ZI2C 5AQJB 2JQQA 2D0TA 4EEBA 3EABA 2VL0A 3RYFE 3ZN1B 3WAJA 3UU6A 1HNZT 2A72A 4GYRA 3NVOA 2X67A 3OKQA 2ZM6T 3PUVF 2XAFB 5L4HA 2LLYA 1BR0A 4NXMT 3CX6B 3TLWA 4UXNB 3ZJ2A 3N5LA 3RC3A 4F6RC 2E9XC 5LNKA 2IAKA 3LSVA 2ACXA 4DR6T 2JJ9A 1Y64B 5AQIB 2XUEA 1LVKA 4K0UA 4TZ4C 1WCRA 3AE2A 3KV9A 2HPLA 5L4EA 5BR8T 4WNKA 5AQHB 3R6NA 2Y8DA 2LSKA 3UUXB 3M3ZB 3C4ZA 4IHJE 1UGOA 2M6IA 2E5VA 3N2GE 3T1HT 2GK9A 5J0ZA 2WAUA 2K3WA 4TWDA 2HN1A 4U33A 4TNVA 4TV8E 3EUHA 2XHEB 2H88A 3FBZA 3L8RA 3NBXX 4EGWA 4DR5T 4AXPA 5ABGA 4PJMA 3CWZB 1YQ4A 2BG9C 3I1AA 3ZJ1A 1G8XA 3ZT6A 2VWAA 3OJAA 3LBXB 3DTOA 2E2AA 3JCFA 4H9RC 4GKKT 3CX7B 3UFEA 5KX5E 2KNDA 3UT5E 2J4GA 4H63H 4HWHA 2PJQA 2PFVA 4CXXA 4JI1T 2CHNA 5IYZE 2XQ3A 3PUZF 5EK2A 5ABEA 5JREA 4KBMB 3UUNA 3FZLB 4NIQA 2UU9T 1JNZA 2HHHT 2LT3A 1M62A 2WMNA 2WCAA 4H9QC 4LF7T 2VK9A 2ZM0A 3QB5K 3PURA 2XAJB 4B3TT
chains in the Genus database with same CATH topology
2CM0A 3D0TA 1D1BA 3LFMA 4IGUA 2NOXA 4ISTA 1VRBA 5ETWA 1D0ZA 2V26A 4ZI3C 1MNEA 2XASB 2LSYA 2YINA 3A5XA 2X9YA 2XTLA 4H9NC 4M1PA 2X68A 2ES0A 2X9XA 3KV6A 3CX8B 5HAXA 5JRCB 3LK42 4CXWA 5E0OA 4JEUB 4BJNA 3O1IA 4OYJA 2CXDA 2JMKA 1G73A 3N9NA 3AB3B 4OFZA 5FP3A 3KV5A 3AA1B 5JDGA 3Q5WA 2CMRA 2BDEA 4J2CA 2E9XA 3CKDA 1E1HB 2A3DA 3JC6C 2CE7A 5LG4A 5LCYA 4YFSA 3DP7A 4ANJA 3MKDA 4L5GA 4OHFA 4IIJE 1YD8G 5J1GA 4IE6A 4EIWA 3HKCE 3JC6D 4PK6A 2KWHA 2X9HA 4ERRA 3EDVA 3GMIA 1D0XA 4O4LE 2N9DA 3GN5A 3MA9A 3N9LA 4CQIA 3KVAA 4BAYB 3B57A 1IJ5A 1WLXA 2EHOC 2LSGA 3KINB 3AAIA 2KMFA 3BQLA 2CEAA 3QK6A 2BZBA 3L09A 4DNDA 4YHJA 5JR9A 5JDNA 3ZMTB 2EHOD 2CA5A 2I59A 2ODVA 3IEEA 5HXHA 3S4UA 4EZ4A 5LHGB 4X1YE 3Q2MA 3O1HA 3FB2A 3PTRB 3TKLB 4O2AE 2PG8A 4HEAA 4PJNA 2UXNB 5L3FB 5J2UE 4PW8A 2EHOB 3N9PA 5DQWA 3ANWA 1BR1A 2L3LA 2V7MA 5HWXA 4AKHA 3ZMZB 2EHOA 5LJNA 3PU8A 5EK4A 2QA7A 3F2EA 5KMGP 4WBOA 3CQGB 5L3DB 2VKJA 2P9BA 2VL8A 3ESLA 3LK3B 2DWGA 3U78A 3O9XA 5HXEA 4P0BA 3LBXA 2LOPA 4AQGA 3CMLA 2MBGA 3RPUA 3C4XA 3ETUA 4UVCB 1YKHB 3ONXA 4UIGA 3GWHA 4PAGA 5L3BB 4QXHB 3HKBE 3MXZA 4MLKA 3RKOA 4MBQA 3CQCB 3L3PA 4QX8B 3K3NA 3FXEB 4ILUA 1WYBA 4BA9A 1LKXA 4C91A 4NUUA 2KT9A 2MTQA 4E7SA 3I0OA 3HKEE 1UX4A 2Y48B 4X20E 5A1LA 5LGNB 2L9QA 3IHRA 1AJ3A 1Z0PA 2XQYA 4AQFA 1YKEB 2C5JA 2K9AA 4IDZA 3C64A 4I55E 1KK7A 2Q9QC 3E22E 4H9SE 5JDFA 5CB4E 5BMVE 2KWIB 3H37A 2DCFA 3PUGA 2K5BB 4EB6E 2MYSA 5L2LA 3GA8A 2LSIA 4O2BE 3VHLA 2LE8A 1FMVA 2RP4A 2LEHA 2Q9QD 2VASA 3F31A 3W15B 1UX5A 2LSJA 2CXFA 2KLQA 4JEHB 3LG7A 2JRKA 4X1IE 2NW9A 3K3OA 4G2AA 4UV9B 1IZNB 3IBPA 4UF0B 2HH7A 2CWYA 4AKGA 2Q9QB 5FMNA 4UF0A 5DJQC 4I4TE 5JDMA 3IF8B 3ZEFB 2H7OA 2N1GA 1X79A 3ZYLA 1B7TA 2LHRA 2Q9QA 3I9YA 5JQGE 2VB6A 4P0AA 3QC9A 3RX6A 3PDYA 5IHYA 2X9WA 4EXTA 2NP9A 3Q5XA 3Q9DA 3HL6A 2WWUA 3UTKA 3O4XE 1MIWA 5L3GB 3KFWX 5J2TE 4GYSA 5JRCA 4CZZB 1T98A 4ZI7E 4TX5A 4EAHA 1US7B 2ODUA 4JUYA 4A56A 4H9PC 3C50A 4HTEA 3ZLIA 1MMNA 5LYJE 2CCQA 2LHNA 4I50E 1S94A 2V7LA 4B6XA 2YEVC 3K8PC 4HKAA 1V9DA 3ZN0B 2W62A 5LBMA 3RYIE 3WI3A 3HA4A 4PJJA 3V5UA 3H3AA 2W00A 3OBVE 1ZEEA 3CQXC 4PK5A 2SPCA 3SOLA 4AKRB 3VU7H 4ASKA 4XBFB 4GK0E 4UV8B 3RRCA 2OA5A 4MALA 4C90A 2WM9A 5HXCA 5KDMC 3N9QA 2RA1A 3OYXA 2H3RA 1FMWA 1ZHCA 2W63A 5TAOA 5ADXL 1HTJF 2A2FX 1HS7A 3PUSA 3R84B 4EYUA 3NZQA 2V1DB 4EZHA 5LOVE 4L9IA 4X1KE 3BQIA 5HYAA 3VKGA 4E7ZA 5JH7E 4PFPA 3V5SA 2W61A 3N9MA 3VKHA 2JMHA 4YLHA 3LJCA 3NRXA 2V7KA 2JPFA 2QGSA 5M4YA 4HE8A 5LGUB 4WBNE 4PJLA 3AAAB 5EK3A 4XAXB 1NWMX 4KUMB 4V1Av 4IE0A 4IE4A 4G63A 1VOMA 4JLEA 2WSSV 1HX8A 4PNIA 4UEMA 5HXRA 3AA0B 4YJ3E 2VKOA 2CWOA 2D0UA 3PE0A 5JVDE 1LVFA 1HG2A 3RYHE 4IE5A 3C98B 2J1DG 3LK2B 2DI4A 2C5KT 2D5UA 3ZMSB 5LXTE 4L0RA 2X0LB 3KDSE 4GOUA 4HN9A 5FYMA 3AA6B 5LHHB 2BVLA 1UCUA 3HI2A 2NWBA 4TV9E 2LJLA 5DABA 2CXLA 2CLYC 5H6QB 3B13A 2LM9A 2IC6A 3BQKA 5C8YE 2YK0A 2KZ7B 3PU3A 2BVMA 2H7VC 2Y6XA 4ZS2A 3RH3A 2XAGB 2YU1A 3NRYA 2KINB 4ZHQE 1MIVA 2DWKA 2XAHB 3I0QA 4ISSA 4WW0A 2DLRA 4CI3B 5DQVA 3SWHA 2DNXA 5FY0A 2IW5B 4ZI2C 2JQQA 3OYZA 2D0TA 5FXXA 4HGAA 2CLYB 5F8PA 5L3CB 3PUQA 5FXWA 4QKNA 2VKHA 1LRZA 4ZI2D 4UVBB 4NUVA 3RYFE 3ZN1B 2UXXB 1MMGA 3WAJA 4DVDA 4EOZB 4QWNB 2A72A 4GYRA 5L3EB 2DHRA 4CXYA 3NZPA 3ZPOA 2X67A 3OKQA 4QXBB 1OXZA 2ZM2A 2XAFB 3SRZA 2X51A 3E0ZA 2L8KA 4O4HE 5LJMA 3UUMA 3ZC0A 4AKLA 1HFAA 1BR0A 1U4QA 4P09A 3KVBA 2X66A 2ZLYA 2WMOA 3C51A 3CX6B 4DBQA 4DMVA 2YU2A 4UXNB 3T8OA 1H7CA 3ZCJA 3ZJ2A 1MIYA 5JDQA 3N5LA 3RC3A 2ZM8A 4F6RC 4DBRA 1SA0E 3AVSA 2E9XC 5LNKA 2IAKA 2ACXA 3N2KE 2JJ9A 3J7Yq 5F3JA 1Y64B 4IE7A 4OYKA 2XUEA 1LVKA 4K0UA 3KV4A 2E9XD 2W0GA 3BK9A 4TZ4C 4ZI3D 3U3IA 4H9OC 2B1EA 3KV9A 3PUAA 4GIWA 2HPLA 4ZOLE 5EZYE 2Z6EA 3P7IA 1BR4A 4WNKA 3R6NA 5LHIB 5AFUL 2Y8DA 2E9XB 2LSKA 4QHOA 3UUXB 1MMAA 3C4ZA 1FEWA 4IHJE 5JR9C 5LGTB 3KBTA 1ZV4X 3QUJA 4TUYE 4XZCA 4AKIA 3MK7C 1WYCA 2IC9A 3N2GE 4CI1B 3EDUA 2GK9A 3M65A 3GN5B 4ZS3A 1KNZA 2K24A 5FY7A 2NW7A 2WAUA 2HPJA 4O4JE 2LOSA 1BR2A 2ZMAA 4TV8E 4Z8XA 3UULA 5JR9B 1SHZC 5CA1E 4KMCA 3EUHA 5LA6E 2NTXA 4KP3C 4O4IE 2XHEB 4CI2B 2M67A 3AAEB 3FBZA 3MZKB 3WAKA 1IJ6A 2PBIA 4QX7B 3NBXX 3I9WA 4GK5E 4AXPA 1O3XA 3K3QC 2MOZA 4U72A 4PJMA 4DO0A 3CWZB 4U74A 5FNVE 1HG5A 3ANWB 3I1AA 3RYCE 2D2SA 4BJMA 3ZJ1A 1G8XA 3ZYMA 1S35A 1WR6A 5JDLA 3EVYA 3CPZA 4O8SA 5HXSA 2K48A 3ZMVB 2VWAA 1QSDA 3OJAA 1HCIA 3LBXB 3O1JA 1FIOA 3DTOA 4PFOA 2KXPB 3RC8A 2G0UA 2VKDA 5HWYA 4MFRA 1ZKEA 4AQFC 5LP6E 4I43B 5H6RB 3AA7B 4H9RC 2E8IA 3ZCIA 3ZMUB 2V7IA 3CX7B 3E08A 3UFEA 3C4WA 3AVRA 5KX5E 3RRWA 2KNDA 1MNDA 3UT5E 4OK0A 2NW8A 1D1AA 5FXVA 3FBLA 4H63H 2PJQA 2PFVA 4CXXA 4YJ2E 4UELA 4AI6A 3J9X1 3HKDE 5LBQB 1YW0A 5IYZE 5GONE 4N78D 4UVAB 5EK2A 1MMDA 4ADZA 2WBLA 5JREA 3ZYKA 1EZ3A 4HFVA 4TN7B 3N2OA 4KBMB 3UUNA 1NAFA 2XAQB 1D1CA 3F57A 4FI5A 4MHCA 3HR0A 2C0SA 3KBUA 4H63V 5JDHA 2C5IT 5FXZA 2LT3A 1WRDA 1QUUA 3P8CD 1D0YA 5FY1A 5CA0E 2V7JA 4PK4A 3N9OA 1OWAA 4DMWA 3MACA 3SS1A 3ETVA 3CVRA 2WMNA 4H9QC 4QXCB 2NTYA 3MJXA 1IAPA 3FHNA 2VK9A 3ZC1A 1CUNA 2N2NA 3DJBA 2ZM0A 1HF8A 3PURA 4FJOA 1U5PA 2XAJB 4EYYR 3FXDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQQ A; 
#chains in the Genus database with same CATH topology
 4IL9 A;  1D0Z A;  3QB5 A;  4ZI3 C;  1MNE A;  2E5L T;  2YIN A;  4CXW A;  4KX6 A;  5LMU T;  2WU5 A;  2VUR A;  4OFZ A;  4U2Y A;  3AA1 B;  4J2C A;  2E9X A;  3JC6 C;  1E1H B;  5LCY A;  4IIJ E;  3HKC E;  5IWA T;  2KWH A;  1DU2 A;  4O4L E;  1NEK A;  3MA9 A;  3N9L A;  4CQI A;  3KVA A;  4BAY B;  3B57 A;  4LMJ A;  1IJ5 A;  2EHO C;  3BQL A;  5JDN A;  3ZMT B;  3IEE A;  5HXH A;  3UQ4 A;  3S4U A;  3O1H A;  2CPT A;  4AIS A;  2PG8 A;  5J2U E;  4JI2 T;  4LFC T;  3QNU A;  2I0M A;  3UU5 A;  5AQR B;  3F2E A;  3LK3 B;  5HXE A;  4P0B A;  2LOP A;  4AQG A;  3C4X A;  3GWH A;  5L3B B;  2BG9 A;  3L3P A;  4QX8 B;  2J62 A;  2IUB A;  4HWC A;  2VQF T;  4C91 A;  2BKP A;  2ACZ A;  4ILB A;  4E7S A;  3I0O A;  3HKE E;  5LGN B;  1NEN A;  1AJ3 A;  4IT4 A;  5FL0 A;  1YKE B;  2K9A A;  3E22 E;  3PUG A;  2K5B B;  2MYS A;  4HWF A;  2LEH A;  2Q9Q D;  2VAS A;  2CRB A;  1L0V A;  2CXF A;  2KLQ A;  3NWI A;  2JRK A;  2XQA A;  4G2A A;  4UV9 B;  1IZN B;  3IBP A;  1OED B;  2HH7 A;  3EHZ A;  5F5W A;  5DJQ C;  4I4T E;  3ZYL A;  2LHR A;  2VB6 A;  3RIU A;  1FJG T;  2X9W A;  2NP9 A;  3HL6 A;  2MAW A;  2BKN A;  5L3G B;  2NR4 A;  2ODU A;  2YKS A;  4IDP A;  4CN4 A;  2YEV C;  5AQV B;  1V9D A;  2W62 A;  2W00 A;  4U7Y A;  4B3S T;  4ASK A;  4GK0 E;  2OA5 A;  4C90 A;  4TNW A;  4EED A;  2WM9 A;  4LML A;  2HN2 A;  1FMW A;  5TAO A;  1HTJ F;  1HS7 A;  2V5C A;  3PUS A;  5LOV E;  4X1K E;  2V6X A;  2XQ4 A;  4E7Z A;  1M7K A;  5ABH A;  3N9M A;  2JMH A;  2V7K A;  2FJB A;  2LRL A;  5LGU B;  4PJL A;  4P1N A;  2H89 A;  1NWM X;  4KUM B;  4V1A v;  4G63 A;  1YQ3 A;  4JLE A;  4PNI A;  5HXR A;  4YSY A;  3PE0 A;  3RYH E;  2J1D G;  3FZK B;  4L0R A;  2R6G F;  2BS4 A;  3PUY F;  2BVL A;  3HI2 A;  5C3J A;  2CXL A;  3B13 A;  2I6H A;  2IC6 A;  3PU3 A;  3AE8 A;  3AE1 A;  3RH3 A;  4DR1 T;  3RLF F;  4ZHQ E;  4YSZ A;  2DWK A;  3SWH A;  2DNX A;  5FY0 A;  2YDR A;  5FXX A;  4HGA A;  2WP9 A;  1I94 T;  4YTP A;  1MMG A;  1T7S A;  4DVD A;  3UU8 A;  4QWN B;  1E7P A;  5L3E B;  4CXY A;  2WS3 A;  4UR9 A;  1OXZ A;  3E0Z A;  4DV3 T;  2UXB T;  1Z8U A;  2FBW A;  4AKL A;  1U4Q A;  1H7C A;  3ZCJ A;  2ZM8 A;  5AQK B;  2WQY A;  4NPP A;  4IE7 A;  3JAD A;  3BK9 A;  4ZI3 D;  4X64 T;  2BBJ A;  4ZOL E;  4QH1 A;  2Z6E A;  4LFA T;  2CBJ A;  3P7I A;  2XSB A;  5LHI B;  5AFU L;  4WYV A;  4QHO A;  1MMA A;  3KBT A;  4HFE A;  2XQ5 A;  4XZC A;  3MK7 C;  4X65 T;  1W0A A;  3EDU A;  2K24 A;  5FY7 A;  2NW7 A;  4X62 T;  2ZMA A;  4Z8X A;  2UXD T;  5JR9 B;  1SHZ C;  1J5W A;  4KP3 C;  4X5T A;  4LF6 T;  2M67 A;  2OLT A;  3AAE B;  2VVS A;  1IJ6 A;  2V5D A;  1XNR T;  2UXC T;  2D2S A;  4BJM A;  2QYW A;  3ZYM A;  5JDL A;  3EVY A;  4O8S A;  4DR2 T;  2K48 A;  1HCI A;  3O1J A;  3RGL A;  2KXP B;  2VKD A;  4A98 A;  2BG9 E;  5LP6 E;  4I43 B;  2XM2 A;  3AA7 B;  2XQ6 A;  4OX9 T;  3AVR A;  4KHZ F;  4OK0 A;  2NW8 A;  4UEL A;  4AI6 A;  3HKD E;  1UUS A;  2BS2 A;  5GON E;  4N78 D;  1MMD A;  4A5X A;  3ZYK A;  5AQN B;  3JAF A;  3EAM A;  3F57 A;  4FI5 A;  4MHC A;  2C0S A;  5FXZ A;  5CA0 E;  2V7J A;  4PK4 A;  1N36 T;  4DMW A;  3ETV A;  4QH5 A;  3MJX A;  3DJB A;  1XNQ T;  4EYY R;  3D0T A;  5ETW A;  2NOX A;  3ZSS A;  3UU3 A;  3LDQ B;  2LSY A;  4DV5 T;  4ZXL A;  1VCT A;  3KV6 A;  3CX8 B;  3LK4 2;  3CK6 A;  4BJN A;  4AQY T;  3AE9 A;  1G73 A;  3AB3 B;  2LRK A;  2BDE A;  5LG4 A;  3MKD A;  4OHF A;  1YD8 G;  5AQU B;  4ERR A;  1UUR A;  2XJ7 A;  1D0X A;  5AQP B;  2J47 A;  1I6Z A;  3AAI A;  2CEA A;  2WU2 A;  3QK6 A;  4ZZB A;  4YHJ A;  3CIR A;  3RF1 A;  2I59 A;  3FZF B;  1JNR A;  5LHG B;  3FB2 A;  1QLB A;  3PTR B;  1XMQ T;  4O2A E;  4HEA A;  4Z90 A;  4AKH A;  2WY2 A;  5EK4 A;  2QA7 A;  2XZE A;  1XDP A;  5L3D B;  3O9X A;  5CFB A;  3LBX A;  3CML A;  2XY8 B;  2MBG A;  3ETU A;  4QXH B;  3HKB E;  3CQC B;  1XDO A;  3K3N A;  4EV6 A;  3FXE B;  4ILU A;  1WYB A;  4YTN A;  4NUU A;  2KT9 A;  2MTQ A;  3RI5 A;  1UX4 A;  2L9Q A;  3TLT A;  4IDN A;  2XQY A;  4NXN T;  2C5J A;  1OED C;  4IDZ A;  2FUP A;  3C64 A;  1KK7 A;  2QVA A;  3H37 A;  2W2U A;  2DCF A;  3RIU C;  3RIF A;  4O2B E;  1R8I A;  1FMV A;  3H3M A;  3W15 B;  3PJA J;  3F31 A;  3UUB A;  3ONJ A;  4IL4 A;  3ONL C;  2Q9Q B;  5FMN A;  5JDM A;  2N1G A;  1X79 A;  1B7T A;  2Q9Q A;  4P0A A;  3I9Y A;  4ILC A;  4K0K T;  2AE9 A;  3AXJ B;  4EXT A;  4U3C A;  3AXJ A;  2WWU A;  5J2T E;  1T98 A;  1US7 B;  4JUY A;  3C50 A;  3ZLI A;  5FVK A;  2LHN A;  1J1J A;  4DUZ T;  5FL1 A;  2V7L A;  4B6X A;  3P4Q A;  4LF9 T;  5LB7 B;  5LBM A;  4PJJ A;  3V5U A;  3H3A A;  4GKJ T;  2SPC A;  4XBF B;  3G06 A;  3RRC A;  4Z91 A;  4MAL A;  3N9Q A;  4AIU A;  1ZHC A;  5L47 A;  5AQL B;  5HEU A;  3VKH A;  3NRX A;  5HCJ A;  4HE8 A;  4HFC A;  5IUX A;  1HX8 A;  4YJ3 E;  2VKO A;  2CWO A;  2XPK A;  4JI3 T;  2C5K T;  3ZMS B;  2X0L B;  3P4P A;  3AA6 B;  1UCU A;  4TV9 E;  2LJL A;  3P4S A;  2LM9 A;  4IDQ A;  2YK0 A;  3NRY A;  2WDQ A;  3I0Q A;  4ISS A;  2DLR A;  4U7I A;  4LF5 T;  2MPK A;  2CLY B;  3ZST A;  3PUQ A;  2BKO A;  3JAE A;  2VKH A;  1LRZ A;  4ZI2 D;  4UVB B;  4NUV A;  3VR8 A;  3AE5 A;  2WWV A;  3NZP A;  1OED A;  2XQ7 A;  4QXB B;  4LFB T;  2ZM2 A;  2X51 A;  3K1S A;  2L8K A;  3ZC0 A;  3KVB A;  4DV1 T;  2ZLY A;  2WMO A;  3C51 A;  4DBQ A;  4DMV A;  2YU2 A;  3T8O A;  1MIY A;  5JDQ A;  1SA0 E;  3AVS A;  3N2K E;  2BBH A;  3J7Y q;  5F3J A;  4OYK A;  3KV4 A;  2E9X D;  2W0G A;  3ABV A;  4H9O C;  2B1E A;  4GIW A;  3VR9 A;  5EZY E;  2XQ8 A;  5AQT B;  1BR4 A;  4U31 A;  1FEW A;  5JR9 C;  4ILA A;  1ZV4 X;  3QUJ A;  4YXD A;  4QH4 A;  4AKI A;  1WYC A;  3P4W A;  4CI1 B;  3M65 A;  1N32 T;  3GN5 B;  1KNZ A;  3Q5E A;  2HPJ A;  4O4J E;  2LOS A;  5CGM A;  1BR2 A;  2VQE T;  1SUM B;  1KFY A;  5CA1 E;  5C2T A;  4O4I E;  4CI2 B;  3RIA A;  4QX7 B;  2B76 A;  2MOZ A;  4DO0 A;  4U74 A;  1KNP A;  3ANW B;  3RYC E;  1S35 A;  4LF4 T;  4HFB A;  4ZZC A;  1QSD A;  1FIO A;  5AQF B;  3RC8 A;  5HWY A;  4MFR A;  1ZKE A;  2BS3 A;  4TWH A;  1VCS A;  3ZMU B;  2E8I A;  3E08 A;  3RRW A;  1D1A A;  5FXV A;  3FBL A;  3TLS A;  2YN6 A;  5LBQ B;  3VRB A;  4ADZ A;  2WBL A;  3A8Y C;  1EZ3 A;  4B3R T;  4HFI A;  4TN7 B;  2C5I T;  4YT0 A;  3ZT7 A;  2WB5 A;  1D0Y A;  5FY1 A;  5FVL A;  3N9O A;  1OWA A;  3SS1 A;  4QXC B;  3VRA A;  2NTY A;  1IAP A;  1CUN A;  2N2N A;  4FJO A;  1U5P A;  2WDV A;  2UUA T;  2WDR A;  2CM0 A;  4IGU A;  3LFM A;  4IST A;  2V26 A;  3B5M A;  2X9Y A;  4M1P A;  2ES0 A;  1CHU A;  5JRC B;  1HNX T;  2JMK A;  2RPA A;  3N9N A;  5FP3 A;  3KV5 A;  2YDS A;  4A97 A;  2CMR A;  2W4X A;  3CKD A;  2A3D A;  2CE7 A;  3UFG A;  3DP7 A;  5J1G A;  3PUX F;  4IE6 A;  3JC6 D;  4PK6 A;  2CHO A;  2X9H A;  3AEE A;  3EDV A;  3GMI A;  2LSG A;  3KIN B;  2KMF A;  3L09 A;  5JR9 A;  2EHO D;  2CA5 A;  3X1D A;  5JTG A;  4WZX A;  3Q2M A;  3NKZ A;  4PJN A;  2UUC T;  3N9P A;  5DQW A;  3RKG A;  1BR1 A;  5HWX A;  3ZMZ B;  4DUY T;  3PU8 A;  4CN1 A;  2P9B A;  4YTM A;  2DWG A;  1X9B A;  3T1Y T;  1W9R A;  4TWF A;  5HEO A;  4DR7 T;  2D9D A;  3RKO A;  5AQQ B;  2JQH A;  2Y48 B;  4X20 E;  3IHR A;  1Z0P A;  3L39 A;  4F8H A;  5ABF B;  5AQG B;  4JI7 T;  2FJA A;  4I55 E;  5ABF A;  2Q9Q C;  3PUW F;  5CB4 E;  4IRE A;  5BMV E;  4EB6 E;  2LSI A;  3VHL A;  2LSJ A;  4JEH B;  3LG7 A;  5HEG A;  3K3O A;  1OED E;  4UF0 B;  2JQK A;  4UF0 A;  3ZEF B;  2H7O A;  1KF6 A;  5HEH A;  1HX1 B;  3QC9 A;  4DR3 T;  5IHY A;  1YXR A;  3Q5X A;  3UTK A;  1HNW T;  1MIW A;  3KFW X;  4GYS A;  2PTF A;  4ZI7 E;  4A56 A;  4H9P C;  4HFD A;  5LYJ E;  4I50 E;  3K8P C;  4HKA A;  4HWD A;  3RYI E;  3WI3 A;  2M6B A;  3Q5D A;  4AKR B;  2YDQ A;  3VU7 H;  4UV8 B;  3FZH B;  3QOF A;  3R84 B;  2V1D B;  4L9I A;  3BQI A;  5HYA A;  3VKG A;  2CBI A;  2W61 A;  3OPC A;  4YLH A;  1KNR A;  2JPF A;  4DV0 T;  3AAA B;  4IE0 A;  2JIW A;  1VOM A;  4UEM A;  4ZEY A;  3AA0 B;  2D0U A;  5JVD E;  1LVF A;  2DI4 A;  2D5U A;  2F4V T;  3KDS E;  4GOU A;  4HN9 A;  5LHH B;  2LKH A;  2CLY C;  3BQK A;  5C8Y E;  2JQ9 A;  2KZ7 B;  2BVM A;  3AEB A;  2H7V C;  4ZS2 A;  2XAG B;  2IHR 1;  2KIN B;  1MIV A;  2XAH B;  4WW0 A;  2FJD A;  5DQV A;  3OTO T;  3PV0 F;  2IW5 B;  1XWM A;  3OYZ A;  5L3C B;  5F8P A;  5FXW A;  4QKN A;  3EI0 A;  4LMK A;  2UXX B;  2X0H A;  4EOZ B;  2DHR A;  4DV2 T;  3ZPO A;  3UQ7 A;  4B3M T;  2WZH A;  3SRZ A;  4O4H E;  5HCM A;  5LJM A;  3UUM A;  1HFA A;  4P09 A;  2X66 A;  3AE6 A;  4DBR A;  3P50 A;  2XSA A;  3U3I A;  3PUA A;  1KEY A;  2E9X B;  2IIU A;  5LGT B;  2DL1 A;  4TUY E;  2IC9 A;  2V8S V;  4ZS3 A;  2V6Y B;  3UUL A;  2V6Y A;  3AE3 A;  4KMC A;  5LA6 E;  4KHP T;  2NTX A;  4JI0 T;  3MZK B;  3WAK A;  2PBI A;  3I9W A;  4GK5 E;  1O3X A;  3K3Q C;  4U72 A;  5KXJ A;  5FNV E;  1HG5 A;  3IA3 A;  1WR6 A;  3CPZ A;  1W0B A;  4Q25 A;  5HXS A;  1XZY A;  3ZMV B;  4PFO A;  2G0U A;  4AQF C;  1E2A A;  3ZKR A;  5H6R B;  2BG9 B;  4JI8 T;  3ZCI A;  4JYA T;  2V7I A;  3TLU A;  3C4W A;  1MND A;  1IBK T;  4I0U A;  4JV5 T;  2IML A;  4YJ2 E;  3J9X 1;  1WR0 A;  3TLV A;  1YW0 A;  1N33 T;  4COF A;  4UVA B;  5AQS B;  4HFV A;  1T8B A;  3N2O A;  4HFH A;  1NAF A;  2XAQ B;  1D1C A;  3HR0 A;  5CJ5 A;  3KBU A;  4H63 V;  5JDH A;  1ZP0 A;  1WRD A;  1QUU A;  3P8C D;  5LMN T;  3MAC A;  3CVR A;  4U2Z A;  4JI4 T;  3FHN A;  3ZC1 A;  1HF8 A;  3FXD B;  1D1B A;  1VRB A;  2XAS B;  3AE4 A;  3A5X A;  2XTL A;  4H9N C;  2X68 A;  2X9X A;  5HAX A;  1J5E T;  5E0O A;  4JEU B;  3O1I A;  1IBL T;  4OYJ A;  2CXD A;  5JDG A;  3Q5W A;  4YFS A;  4ANJ A;  4L5G A;  4EIW A;  2N9D A;  2X0Y A;  3GN5 A;  1WLX A;  1Y01 A;  2BZB A;  4DND A;  5LG3 A;  2ODV A;  4EZ4 A;  4X1Y E;  3PJA A;  4CN6 A;  3TKL B;  2UXN B;  5L3F B;  1HR0 T;  4PW8 A;  2EHO B;  3ANW A;  2L3L A;  2V7M A;  2EHO A;  5LJN A;  5KMG P;  4WBO A;  3AEG A;  3CQG B;  2FJE A;  2QRX A;  1IBM T;  2VKJ A;  3UU4 A;  2VL8 A;  3U78 A;  3ESL A;  2VVN A;  2IDO B;  4UVC B;  3RPU A;  5AQM B;  1YKH B;  3ONX A;  4UIG A;  4PAG A;  4X66 T;  3MXZ A;  4MLK A;  4MBQ A;  2W67 A;  4BA9 A;  1LKX A;  5A1L A;  3AEF A;  4AQF A;  4YSX A;  1XMO T;  1GQE A;  4H9S E;  5JDF A;  2KWI B;  3OVU A;  5L2L A;  4DID B;  3GA8 A;  1SE7 A;  2LE8 A;  2RP4 A;  4DV6 T;  1UX5 A;  3RQU A;  4X1I E;  2NW9 A;  2CWY A;  4AKG A;  3IF8 B;  4DV4 T;  1UK5 A;  5JQG E;  2XQ9 A;  2A9U A;  3AED A;  3RX6 A;  3A7M A;  3PDY A;  2LM2 A;  3SFE A;  3Q9D A;  3O4X E;  3AEA A;  5AQO B;  3AEC A;  5JRC A;  4CZZ B;  4JI6 T;  4TX5 A;  4EAH A;  4YY3 T;  4HWI B;  4LF8 T;  2XM1 A;  4HTE A;  1MMN A;  1T72 A;  2CCQ A;  1S94 A;  3RHW A;  4JBW F;  3ZN0 B;  1WFD A;  3HA4 A;  3FZM B;  3OBV E;  1ZEE A;  3CQX C;  4PK5 A;  3SOL A;  5HXC A;  4KI0 F;  5KDM C;  2RA1 A;  3OYX A;  1ZOY A;  2AXD S;  2H3R A;  2W63 A;  5ADX L;  2A2F X;  4EYU A;  3NZQ A;  5HEJ A;  4EZH A;  2KSR A;  5JH7 E;  4PFP A;  3V5S A;  2WZI A;  3LJC A;  3ZT5 A;  2OV9 A;  2QGS A;  5M4Y A;  3RQW A;  4DV7 T;  4WBN E;  3AE7 A;  5EK3 A;  4XAX B;  4IE4 A;  2WSS V;  2UUB T;  1HG2 A;  4IDO A;  4IE5 A;  3C98 B;  3LK2 B;  5LXT E;  5FYM A;  3SFD A;  5DAB A;  2NWB A;  4JI5 T;  5H6Q B;  4YHH T;  3P4R A;  2W66 A;  2LKG A;  2Y6X A;  1N34 T;  2YOE A;  2YU1 A;  4DR4 T;  5FKY A;  4CI3 B;  1W09 A;  4ZI2 C;  5AQJ B;  2JQQ A;  2D0T A;  4EEB A;  3EAB A;  2VL0 A;  3RYF E;  3ZN1 B;  3WAJ A;  3UU6 A;  1HNZ T;  2A72 A;  4GYR A;  3NVO A;  2X67 A;  3OKQ A;  2ZM6 T;  3PUV F;  2XAF B;  5L4H A;  2LLY A;  1BR0 A;  4NXM T;  3CX6 B;  3TLW A;  4UXN B;  3ZJ2 A;  3N5L A;  3RC3 A;  4F6R C;  2E9X C;  5LNK A;  2IAK A;  3LSV A;  2ACX A;  4DR6 T;  2JJ9 A;  1Y64 B;  5AQI B;  2XUE A;  1LVK A;  4K0U A;  4TZ4 C;  1WCR A;  3AE2 A;  3KV9 A;  2HPL A;  5L4E A;  5BR8 T;  4WNK A;  5AQH B;  3R6N A;  2Y8D A;  2LSK A;  3UUX B;  3M3Z B;  3C4Z A;  4IHJ E;  1UGO A;  2M6I A;  2E5V A;  3N2G E;  3T1H T;  2GK9 A;  5J0Z A;  2WAU A;  2K3W A;  4TWD A;  2HN1 A;  4U33 A;  4TNV A;  4TV8 E;  3EUH A;  2XHE B;  2H88 A;  3FBZ A;  3L8R A;  3NBX X;  4EGW A;  4DR5 T;  4AXP A;  5ABG A;  4PJM A;  3CWZ B;  1YQ4 A;  2BG9 C;  3I1A A;  3ZJ1 A;  1G8X A;  3ZT6 A;  2VWA A;  3OJA A;  3LBX B;  3DTO A;  2E2A A;  3JCF A;  4H9R C;  4GKK T;  3CX7 B;  3UFE A;  5KX5 E;  2KND A;  3UT5 E;  2J4G A;  4H63 H;  4HWH A;  2PJQ A;  2PFV A;  4CXX A;  4JI1 T;  2CHN A;  5IYZ E;  2XQ3 A;  3PUZ F;  5EK2 A;  5ABE A;  5JRE A;  4KBM B;  3UUN A;  3FZL B;  4NIQ A;  2UU9 T;  1JNZ A;  2HHH T;  2LT3 A;  1M62 A;  2WMN A;  2WCA A;  4H9Q C;  4LF7 T;  2VK9 A;  2ZM0 A;  3QB5 K;  3PUR A;  2XAJ B;  4B3T T; 
#chains in the Genus database with same CATH homology
 2CM0 A;  3D0T A;  1D1B A;  3LFM A;  4IGU A;  2NOX A;  4IST A;  1VRB A;  5ETW A;  1D0Z A;  2V26 A;  4ZI3 C;  1MNE A;  2XAS B;  2LSY A;  2YIN A;  3A5X A;  2X9Y A;  2XTL A;  4H9N C;  4M1P A;  2X68 A;  2ES0 A;  2X9X A;  3KV6 A;  3CX8 B;  5HAX A;  5JRC B;  3LK4 2;  4CXW A;  5E0O A;  4JEU B;  4BJN A;  3O1I A;  4OYJ A;  2CXD A;  2JMK A;  1G73 A;  3N9N A;  3AB3 B;  4OFZ A;  5FP3 A;  3KV5 A;  3AA1 B;  5JDG A;  3Q5W A;  2CMR A;  2BDE A;  4J2C A;  2E9X A;  3CKD A;  1E1H B;  2A3D A;  3JC6 C;  2CE7 A;  5LG4 A;  5LCY A;  4YFS A;  3DP7 A;  4ANJ A;  3MKD A;  4L5G A;  4OHF A;  4IIJ E;  1YD8 G;  5J1G A;  4IE6 A;  4EIW A;  3HKC E;  3JC6 D;  4PK6 A;  2KWH A;  2X9H A;  4ERR A;  3EDV A;  3GMI A;  1D0X A;  4O4L E;  2N9D A;  3GN5 A;  3MA9 A;  3N9L A;  4CQI A;  3KVA A;  4BAY B;  3B57 A;  1IJ5 A;  1WLX A;  2EHO C;  2LSG A;  3KIN B;  3AAI A;  2KMF A;  3BQL A;  2CEA A;  3QK6 A;  2BZB A;  3L09 A;  4DND A;  4YHJ A;  5JR9 A;  5JDN A;  3ZMT B;  2EHO D;  2CA5 A;  2I59 A;  2ODV A;  3IEE A;  5HXH A;  3S4U A;  4EZ4 A;  5LHG B;  4X1Y E;  3Q2M A;  3O1H A;  3FB2 A;  3PTR B;  3TKL B;  4O2A E;  2PG8 A;  4HEA A;  4PJN A;  2UXN B;  5L3F B;  5J2U E;  4PW8 A;  2EHO B;  3N9P A;  5DQW A;  3ANW A;  1BR1 A;  2L3L A;  2V7M A;  5HWX A;  4AKH A;  3ZMZ B;  2EHO A;  5LJN A;  3PU8 A;  5EK4 A;  2QA7 A;  3F2E A;  5KMG P;  4WBO A;  3CQG B;  5L3D B;  2VKJ A;  2P9B A;  2VL8 A;  3ESL A;  3LK3 B;  2DWG A;  3U78 A;  3O9X A;  5HXE A;  4P0B A;  3LBX A;  2LOP A;  4AQG A;  3CML A;  2MBG A;  3RPU A;  3C4X A;  3ETU A;  4UVC B;  1YKH B;  3ONX A;  4UIG A;  3GWH A;  4PAG A;  5L3B B;  4QXH B;  3HKB E;  3MXZ A;  4MLK A;  3RKO A;  4MBQ A;  3CQC B;  3L3P A;  4QX8 B;  3K3N A;  3FXE B;  4ILU A;  1WYB A;  4BA9 A;  1LKX A;  4C91 A;  4NUU A;  2KT9 A;  2MTQ A;  4E7S A;  3I0O A;  3HKE E;  1UX4 A;  2Y48 B;  4X20 E;  5A1L A;  5LGN B;  2L9Q A;  3IHR A;  1AJ3 A;  1Z0P A;  2XQY A;  4AQF A;  1YKE B;  2C5J A;  2K9A A;  4IDZ A;  3C64 A;  4I55 E;  1KK7 A;  2Q9Q C;  3E22 E;  4H9S E;  5JDF A;  5CB4 E;  5BMV E;  2KWI B;  3H37 A;  2DCF A;  3PUG A;  2K5B B;  4EB6 E;  2MYS A;  5L2L A;  3GA8 A;  2LSI A;  4O2B E;  3VHL A;  2LE8 A;  1FMV A;  2RP4 A;  2LEH A;  2Q9Q D;  2VAS A;  3F31 A;  3W15 B;  1UX5 A;  2LSJ A;  2CXF A;  2KLQ A;  4JEH B;  3LG7 A;  2JRK A;  4X1I E;  2NW9 A;  3K3O A;  4G2A A;  4UV9 B;  1IZN B;  3IBP A;  4UF0 B;  2HH7 A;  2CWY A;  4AKG A;  2Q9Q B;  5FMN A;  4UF0 A;  5DJQ C;  4I4T E;  5JDM A;  3IF8 B;  3ZEF B;  2H7O A;  2N1G A;  1X79 A;  3ZYL A;  1B7T A;  2LHR A;  2Q9Q A;  3I9Y A;  5JQG E;  2VB6 A;  4P0A A;  3QC9 A;  3RX6 A;  3PDY A;  5IHY A;  2X9W A;  4EXT A;  2NP9 A;  3Q5X A;  3Q9D A;  3HL6 A;  2WWU A;  3UTK A;  3O4X E;  1MIW A;  5L3G B;  3KFW X;  5J2T E;  4GYS A;  5JRC A;  4CZZ B;  1T98 A;  4ZI7 E;  4TX5 A;  4EAH A;  1US7 B;  2ODU A;  4JUY A;  4A56 A;  4H9P C;  3C50 A;  4HTE A;  3ZLI A;  1MMN A;  5LYJ E;  2CCQ A;  2LHN A;  4I50 E;  1S94 A;  2V7L A;  4B6X A;  2YEV C;  3K8P C;  4HKA A;  1V9D A;  3ZN0 B;  2W62 A;  5LBM A;  3RYI E;  3WI3 A;  3HA4 A;  4PJJ A;  3V5U A;  3H3A A;  2W00 A;  3OBV E;  1ZEE A;  3CQX C;  4PK5 A;  2SPC A;  3SOL A;  4AKR B;  3VU7 H;  4ASK A;  4XBF B;  4GK0 E;  4UV8 B;  3RRC A;  2OA5 A;  4MAL A;  4C90 A;  2WM9 A;  5HXC A;  5KDM C;  3N9Q A;  2RA1 A;  3OYX A;  2H3R A;  1FMW A;  1ZHC A;  2W63 A;  5TAO A;  5ADX L;  1HTJ F;  2A2F X;  1HS7 A;  3PUS A;  3R84 B;  4EYU A;  3NZQ A;  2V1D B;  4EZH A;  5LOV E;  4L9I A;  4X1K E;  3BQI A;  5HYA A;  3VKG A;  4E7Z A;  5JH7 E;  4PFP A;  3V5S A;  2W61 A;  3N9M A;  3VKH A;  2JMH A;  4YLH A;  3LJC A;  3NRX A;  2V7K A;  2JPF A;  2QGS A;  5M4Y A;  4HE8 A;  5LGU B;  4WBN E;  4PJL A;  3AAA B;  5EK3 A;  4XAX B;  1NWM X;  4KUM B;  4V1A v;  4IE0 A;  4IE4 A;  4G63 A;  1VOM A;  4JLE A;  2WSS V;  1HX8 A;  4PNI A;  4UEM A;  5HXR A;  3AA0 B;  4YJ3 E;  2VKO A;  2CWO A;  2D0U A;  3PE0 A;  5JVD E;  1LVF A;  1HG2 A;  3RYH E;  4IE5 A;  3C98 B;  2J1D G;  3LK2 B;  2DI4 A;  2C5K T;  2D5U A;  3ZMS B;  5LXT E;  4L0R A;  2X0L B;  3KDS E;  4GOU A;  4HN9 A;  5FYM A;  3AA6 B;  5LHH B;  2BVL A;  1UCU A;  3HI2 A;  2NWB A;  4TV9 E;  2LJL A;  5DAB A;  2CXL A;  2CLY C;  5H6Q B;  3B13 A;  2LM9 A;  2IC6 A;  3BQK A;  5C8Y E;  2YK0 A;  2KZ7 B;  3PU3 A;  2BVM A;  2H7V C;  2Y6X A;  4ZS2 A;  3RH3 A;  2XAG B;  2YU1 A;  3NRY A;  2KIN B;  4ZHQ E;  1MIV A;  2DWK A;  2XAH B;  3I0Q A;  4ISS A;  4WW0 A;  2DLR A;  4CI3 B;  5DQV A;  3SWH A;  2DNX A;  5FY0 A;  2IW5 B;  4ZI2 C;  2JQQ A;  3OYZ A;  2D0T A;  5FXX A;  4HGA A;  2CLY B;  5F8P A;  5L3C B;  3PUQ A;  5FXW A;  4QKN A;  2VKH A;  1LRZ A;  4ZI2 D;  4UVB B;  4NUV A;  3RYF E;  3ZN1 B;  2UXX B;  1MMG A;  3WAJ A;  4DVD A;  4EOZ B;  4QWN B;  2A72 A;  4GYR A;  5L3E B;  2DHR A;  4CXY A;  3NZP A;  3ZPO A;  2X67 A;  3OKQ A;  4QXB B;  1OXZ A;  2ZM2 A;  2XAF B;  3SRZ A;  2X51 A;  3E0Z A;  2L8K A;  4O4H E;  5LJM A;  3UUM A;  3ZC0 A;  4AKL A;  1HFA A;  1BR0 A;  1U4Q A;  4P09 A;  3KVB A;  2X66 A;  2ZLY A;  2WMO A;  3C51 A;  3CX6 B;  4DBQ A;  4DMV A;  2YU2 A;  4UXN B;  3T8O A;  1H7C A;  3ZCJ A;  3ZJ2 A;  1MIY A;  5JDQ A;  3N5L A;  3RC3 A;  2ZM8 A;  4F6R C;  4DBR A;  1SA0 E;  3AVS A;  2E9X C;  5LNK A;  2IAK A;  2ACX A;  3N2K E;  2JJ9 A;  3J7Y q;  5F3J A;  1Y64 B;  4IE7 A;  4OYK A;  2XUE A;  1LVK A;  4K0U A;  3KV4 A;  2E9X D;  2W0G A;  3BK9 A;  4TZ4 C;  4ZI3 D;  3U3I A;  4H9O C;  2B1E A;  3KV9 A;  3PUA A;  4GIW A;  2HPL A;  4ZOL E;  5EZY E;  2Z6E A;  3P7I A;  1BR4 A;  4WNK A;  3R6N A;  5LHI B;  5AFU L;  2Y8D A;  2E9X B;  2LSK A;  4QHO A;  3UUX B;  1MMA A;  3C4Z A;  1FEW A;  4IHJ E;  5JR9 C;  5LGT B;  3KBT A;  1ZV4 X;  3QUJ A;  4TUY E;  4XZC A;  4AKI A;  3MK7 C;  1WYC A;  2IC9 A;  3N2G E;  4CI1 B;  3EDU A;  2GK9 A;  3M65 A;  3GN5 B;  4ZS3 A;  1KNZ A;  2K24 A;  5FY7 A;  2NW7 A;  2WAU A;  2HPJ A;  4O4J E;  2LOS A;  1BR2 A;  2ZMA A;  4TV8 E;  4Z8X A;  3UUL A;  5JR9 B;  1SHZ C;  5CA1 E;  4KMC A;  3EUH A;  5LA6 E;  2NTX A;  4KP3 C;  4O4I E;  2XHE B;  4CI2 B;  2M67 A;  3AAE B;  3FBZ A;  3MZK B;  3WAK A;  1IJ6 A;  2PBI A;  4QX7 B;  3NBX X;  3I9W A;  4GK5 E;  4AXP A;  1O3X A;  3K3Q C;  2MOZ A;  4U72 A;  4PJM A;  4DO0 A;  3CWZ B;  4U74 A;  5FNV E;  1HG5 A;  3ANW B;  3I1A A;  3RYC E;  2D2S A;  4BJM A;  3ZJ1 A;  1G8X A;  3ZYM A;  1S35 A;  1WR6 A;  5JDL A;  3EVY A;  3CPZ A;  4O8S A;  5HXS A;  2K48 A;  3ZMV B;  2VWA A;  1QSD A;  3OJA A;  1HCI A;  3LBX B;  3O1J A;  1FIO A;  3DTO A;  4PFO A;  2KXP B;  3RC8 A;  2G0U A;  2VKD A;  5HWY A;  4MFR A;  1ZKE A;  4AQF C;  5LP6 E;  4I43 B;  5H6R B;  3AA7 B;  4H9R C;  2E8I A;  3ZCI A;  3ZMU B;  2V7I A;  3CX7 B;  3E08 A;  3UFE A;  3C4W A;  3AVR A;  5KX5 E;  3RRW A;  2KND A;  1MND A;  3UT5 E;  4OK0 A;  2NW8 A;  1D1A A;  5FXV A;  3FBL A;  4H63 H;  2PJQ A;  2PFV A;  4CXX A;  4YJ2 E;  4UEL A;  4AI6 A;  3J9X 1;  3HKD E;  5LBQ B;  1YW0 A;  5IYZ E;  5GON E;  4N78 D;  4UVA B;  5EK2 A;  1MMD A;  4ADZ A;  2WBL A;  5JRE A;  3ZYK A;  1EZ3 A;  4HFV A;  4TN7 B;  3N2O A;  4KBM B;  3UUN A;  1NAF A;  2XAQ B;  1D1C A;  3F57 A;  4FI5 A;  4MHC A;  3HR0 A;  2C0S A;  3KBU A;  4H63 V;  5JDH A;  2C5I T;  5FXZ A;  2LT3 A;  1WRD A;  1QUU A;  3P8C D;  1D0Y A;  5FY1 A;  5CA0 E;  2V7J A;  4PK4 A;  3N9O A;  1OWA A;  4DMW A;  3MAC A;  3SS1 A;  3ETV A;  3CVR A;  2WMN A;  4H9Q C;  4QXC B;  2NTY A;  3MJX A;  1IAP A;  3FHN A;  2VK9 A;  3ZC1 A;  1CUN A;  2N2N A;  3DJB A;  2ZM0 A;  1HF8 A;  3PUR A;  4FJO A;  1U5P A;  2XAJ B;  4EYY R;  3FXD B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...