2JQQA

Solution structure of saccharomyces cerevisiae conserved oligomeric golgi subunit 2 protein (cog2p)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
154
structure length
154
Chain Sequence
KTQSDLQKFMTQLDHLIKDDISNTQEIIKDVLEYLKKLDEIYGSLRNHSQLTEALSLGKRLSKSLHEMCGIEPLEEEICSGLIEQLYKLITASRRILESCADSNSPYIHHLRNDYQDLLQEFQISLKILTEKCLENPSSLQNLSLTLVSIIKTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Conserved oligomeric Golgi complex subunit 2
publication title Structural analysis of conserved oligomeric Golgi complex subunit 2
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 58
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2007-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1240 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2jqqA00
2JQQA
chains in the Genus database with same CATH superfamily
4UVBB 4DR4T 1N36T 4JI7T 2V7KA 4LF5T 4G63A 5L3CB 4MFRA 3RIAA 3F31A 3OPCA 4OX9T 4CZZB 4HN9A 4B3TT 2E9XA 2IHR1 1E2AA 3OJAA 2FJEA 4HKAA 3RYCE 3QUJA 2DWKA 3AA1B 2ZM2A 2V6YB 1WR0A 2XPKA 1UUSA 1T98A 4TV8E 2KSRA 1ZOYA 4H9RC 5FKYA 3ZYMA 5IUXA 4AI6A 2XM2A 1T72A 2YDQA 2I0MA 4AIUA 1IBMT 3V5SA 4H63V 1D1AA 1LVKA 1NEKA 3AE5A 1MIWA 5LJMA 2D5UA 3A5XA 4HFEA 2LKHA 1IBLT 3UUXB 1QUUA 2WU5A 3BQKA 2H7OA 5FL1A 2E5LT 3N9LA 3QOFA 5FP3A 5JRCB 1HCIA 5FVKA 2UUBT 2XZEA 4QH5A 1HX1B 4CXXA 1YQ3A 1SHZC 4QHOA 3EAMA 4UF0B 3UTKA 4TN7B 4YSZA 3CMLA 4DV6T 3UUMA 2Z6EA 4UR9A 4TUYE 5L3EB 5JDMA 3K3OA 1W0AA 3CWZB 3VRBA 5HAXA 2WM9A 1KF6A 4JI1T 2YDSA 2BG9A 5FNVE 4X64T 3RRWA 4H9SE 4IE7A 4MBQA 5AQSB 3IF8B 3JC6C 5AQMB 2H7VC 4O4IE 3ZJ2A 4A98A 3VR9A 1MIYA 5LHHB 2QVAA 4MALA 3SFDA 2X9XA 2KZ7B 2Q9QB 4GKKT 4XZCA 5AFUL 3AEGA 3AXJB 5IHYA 4UELA 3SFEA 4LF4T 1J5WA 4WBOA 5M4YA 3ZN1B 4IL4A 3L09A 4LMJA 3L8RA 5JR9B 5JH7E 3H3MA 1VCTA 3D0TA 3HA4A 2V1DB 3VKGA 4PK4A 4Z90A 3U3IA 3SWHA 4QH4A 3ABVA 2HHHT 1D0XA 3GA8A 4F8HA 2W66A 2CRBA 2YN6A 3UT5E 5CA1E 4YHJA 1V9DA 2UUCT 4ZI2C 2J4GA 3ONLC 2C5KT 3RLFF 1OEDC 3P4SA 3UQ4A 3RIUC 2D9DA 4EV6A 2XY8B 3C50A 4X1YE 2K3WA 5HXEA 2CE7A 5ABEA 5HEHA 5GONE 3VKHA 3TLSA 2V6XA 2WDVA 3SOLA 3FZMB 4EIWA 4O4HE 5CB4E 3P4PA 4B3ST 3UQ7A 2W63A 2YKSA 4ZS2A 4YXDA 3KV6A 2CBIA 2NR4A 4PW8A 4IT4A 2BDEA 5L47A 2CHNA 2X9YA 4HFVA 5FMNA 4X66T 4X65T 2UXCT 4H9QC 2W00A 2NTXA 3O1JA 4EZ4A 4JI5T 3KBTA 3PJAJ 4DO0A 2C5IT 2PG8A 5AQOB 4PNIA 3OKQA 3CKDA 3HKCE 2XSAA 2ZM0A 3K8PC 4ILCA 3T1YT 1D1BA 4WBNE 2JQQA 4CI2B 5JDGA 2WDQA 2YK0A 4N78D 4V1Av 3UU8A 1YKHB 5L4HA 2W62A 2LE8A 3JCFA 2N9DA 4C91A 2XHEB 3FZKB 1CUNA 4FI5A 1N33T 2X67A 4NIQA 2XQYA 3AA0B 1MNEA 5ETWA 2K9AA 5E0OA 2XM1A 5AQIB 4I50E 3RQWA 5LGNB 4NPPA 5FY7A 2RA1A 4PFOA 5CJ5A 2CCQA 1VCSA 1HS7A 3K1SA 4OYKA 4JYAT 3PDYA 5CFBA 4LF7T 5CGMA 2HPLA 3RRCA 3P4RA 1OEDA 3RIUA 4ZHQE 3DP7A 3TKLB 3N2KE 2GK9A 4HFCA 1KNPA 2YOEA 3UU6A 2KMFA 1LVFA 4YT0A 2X9HA 5EZYE 3CIRA 2J62A 5AQGB 4IIJE 3C4ZA 5HEOA 4PJLA 3AB3B 1W9RA 1I94T 4CN1A 3ZT6A 3I0QA 2WZHA 4GYSA 1IBKT 1HG5A 2IC9A 2CXDA 3N9NA 3LG7A 5AQTB 1KNZA 1ZP0A 3J7Yq 4HFBA 2A3DA 4ISSA 4IL9A 1I6ZA 2N1GA 4QXHB 5HEUA 4COFA 1D1CA 4EEDA 4JI4T 3L39A 1QSDA 2A72A 4YTPA 2MBGA 2VURA 2LRLA 2W2UA 5JR9C 4ZOLE 2V6YA 3CX6B 3AE8A 4DR2T 5HXHA 4DV5T 4ZZCA 3MA9A 4IDQA 2BKOA 3Q5XA 2XQ7A 3LFMA 4ZI3C 1E1HB 1HFAA 3NKZA 4WNKA 1ZKEA 4DR5T 4AQYT 3U78A 4EZHA 2WY2A 4LF6T 5HCJA 2H3RA 5JRCA 3AA7B 4JEUB 4IE6A 1BR1A 1W09A 3P4QA 1KEYA 2KXPB 5H6RB 4TNWA 4UF0A 1WYBA 3QC9A 4EB6E 4U72A 2JPFA 2KT9A 1G8XA 3QK6A 5A1LA 5JDNA 4DR7T 2B1EA 4ILAA 1HNZT 2XJ7A 3KFWX 4CI1B 3OBVE 4X20E 3R6NA 4AKIA 4TWFA 1XWMA 1E7PA 3NVOA 4X1KE 5JQGE 3W15B 3ZSSA 1FJGT 4DMVA 1KNRA 3WAKA 4U31A 2V7JA 4ASKA 2CXFA 3ZLIA 2Q9QA 4TV9E 4BJMA 2LSJA 1G73A 1BR2A 3AXJA 4CXWA 3NZPA 1ZV4X 2FJAA 5JR9A 3ETUA 3EVYA 4IDOA 5J2TE 2CM0A 3H3AA 4NXMT 3EI0A 5LB7B 4I4TE 2XQ5A 2HH7A 1SE7A 3A7MA 4XAXB 5AQKB 3MKDA 5LNKA 3T8OA 4TX5A 2ACXA 2UXDT 5LA6E 1Y64B 3RI5A 1UK5A 3BK9A 2UXXB 3F2EA 2K48A 4BA9A 4DV3T 4PAGA 2LEHA 2XTLA 4L0RA 1M7KA 2PFVA 3AEBA 3CQGB 1XMQT 4AISA 1OWAA 1O3XA 4ZI3D 4GK5E 2V7MA 3J9X1 2MTQA 4YSXA 3N9QA 2WWUA 4PFPA 4ILBA 4XBFB 2LRKA 5JVDE 1R8IA 5LGUB 3I9YA 1XMOT 2H89A 1XDPA 1FEWA 4EXTA 2M6BA 2Y8DA 2E5VA 5L3DB 2X51A 3E08A 3RC3A 5FY0A 2IIUA 2UXBT 3PE0A 1J1JA 5DQVA 3KVAA 2JQ9A 2B76A 5AQNB 4EAHA 2BVMA 2LM9A 4EGWA 4JV5T 3IEEA 4A56A 1YW0A 4IDNA 4NXNT 2JMKA 4ISTA 4QWNB 3N2GE 3O9XA 2QA7A 4IREA 3AE1A 3ZYKA 2CLYB 2QYWA 2LSKA 3RKOA 2VVNA 4DV0T 3OYXA 5LGTB 5L3BB 5LXTE 2XSBA 2OLTA 4HWHA 3EUHA 2IUBA 3UULA 4UVAB 3TLUA 5AQPB 4AKLA 2CEAA 4CQIA 4AKHA 3B13A 3ZYLA 2VASA 1WLXA 2KINB 4U3CA 2W4XA 4U7IA 2CHOA 4YJ2E 4JEHB 2JIWA 1UURA 2EHOD 2VB6A 2XAFB 3RGLA 4ERRA 1HNWT 3C51A 1WR6A 4DR6T 4B6XA 1N32T 2F4VT 4ZZBA 1XDOA 3IHRA 4TNVA 2XAJB 4O4JE 3FHNA 1EZ3A 4M1PA 3NBXX 2OV9A 4KMCA 4PK5A 1UX5A 1UX4A 4UIGA 5L3GB 3P4WA 5J1GA 2HN2A 1XNQT 4JI8T 2W61A 1OEDE 3RC8A 1LKXA 4ZEYA 4I55E 3H37A 4CI3B 3C4XA 2WZIA 5DABA 2X66A 1D0ZA 2UUAT 4PK6A 2NW9A 4K0UA 3ZCIA 1H7CA 4MLKA 4JI6T 4CXYA 4DUZT 4O8SA 4WZXA 4CN6A 1XZYA 2LOPA 3UU5A 2IC6A 5HWXA 3PUQA 3FB2A 3LK2B 2JQKA 3PJAA 3OYZA 3KINB 2LHRA 4BAYB 2R6GF 5LMUT 3Q5WA 3GN5B 1L0VA 2NTYA 2CWOA 2X0YA 1D0YA 2LSYA 2Y48B 2WB5A 3TLWA 2WP9A 2ZM8A 5L2LA 4O2AE 4AXPA 2PJQA 3O4XE 4DR3T 3BQIA 5JREA 4U2YA 3ZKRA 1JNRA 1AJ3A 1HNXT 4WYVA 2EHOB 5HWYA 4DUYT 3ZT5A 3CQXC 5C2TA 1VOMA 2IDOB 2BKPA 5HCMA 3MACA 3ANWB 1QLBA 4IGUA 3A8YC 5JDQA 3WI3A 4O2BE 4NUUA 3E22E 5LJNA 1UGOA 3PUXF 4E7SA 5AQUB 4QKNA 2LT3A 3R84B 1KFYA 3HL6A 3ZCJA 2WAUA 3ZMVB 1MMGA 5AQRB 5KX5E 4LFCT 3N5LA 2CLYC 1SUMB 2ZMAA 4ZI7E 1GQEA 2XUEA 3HKDE 2AE9A 2IW5B 4HFHA 3AE6A 3LDQB 3PV0F 5AQJB 5FXXA 5ABFB 3AE3A 3RPUA 3VHLA 4ADZA 4YHHT 2H88A 3E0ZA 3RF1A 5L3FB 4UXNB 5FXWA 3NZQA 3O1HA 2DWGA 2XQ8A 5JTGA 2XASB 4LF8T 4BJNA 2IAKA 2LJLA 2NW7A 1NWMX 4F6RC 4NUVA 4J2CA 4Z91A 2X9WA 4YTNA 1WFDA 3QB5K 3JADA 3EDUA 3HKBE 4LMLA 4DBRA 2XQ9A 4HFIA 1WCRA 1FMVA 1HF8A 5JDLA 4AQGA 3UFGA 4B3MT 2NWBA 2ODVA 4YY3T 2WDRA 1X79A 3NRYA 3AEEA 3DTOA 1HTJF 3TLVA 2PBIA 2X68A 5HEJA 4X1IE 2KWHA 2WWVA 2LM2A 4OFZA 4IE4A 3X1DA 3PUWF 3P8CD 4P0BA 5AQFB 1DU2A 2CWYA 2RP4A 3I9WA 3HKEE 4GYRA 5LG4A 2V8SV 3GMIA 4GK0E 2DNXA 3AA6B 2BS3A 5DQWA 3RQUA 1UCUA 3SRZA 2LSIA 2E2AA 1OXZA 4KI0F 2BZBA 1SA0E 2JQHA 2XQAA 5HXRA 4EYYR 4DMWA 2BS4A 2D2SA 1IJ5A 3ONJA 4H9NC 2CBJA 3CVRA 5AQLB 2JMHA 3ZEFB 5LHGB 3K3QC 4ZS3A 3LBXB 3MK7C 5HXSA 2W0GA 4L5GA 5LYJE 1XNRT 2LSGA 3PU3A 4PJMA 2DHRA 1WRDA 4UV9B 2M67A 3ZN0B 1IAPA 4EYUA 3P50A 2DI4A 4IE5A 3MJXA 5IWAT 2KNDA 4CN4A 2XQ4A 3F57A 4ILUA 4QX8B 2EHOC 3PURA 5KXJA 2I6HA 2BG9E 3QB5A 1T8BA 2MPKA 5JDHA 3T1HT 2C5JA 5LG3A 3CX8B 1YKEB 3RYFE 5KDMC 1MMAA 3PUYF 2K24A 5EK3A 3Q9DA 3HR0A 2WU2A 3PUAA 2QGSA 3AVSA 5H6QB 4JUYA 2D0UA 3FXDB 3I0OA 1U4QA 4K0KT 3KDSE 2LHNA 4HWIB 3AAAB 5FYMA 4C90A 2VK9A 2G0UA 3QNUA 4DV2T 2WSSV 4YTMA 1KK7A 4U74A 4QXCB 2BVLA 2M6IA 3UUNA 3B5MA 3WAJA 3PUSA 2L8KA 3VR8A 2L9QA 4OYJA 4A97A 3ZC0A 3KVBA 5LOVE 3M65A 3PUGA 2K5BB 3EDVA 3LSVA 2E9XD 3EHZA 4X62T 2UU9T 2BBJA 4FJOA 3GN5A 4U33A 1Y01A 1S35A 2ODUA 5J0ZA 2WS3A 2UXNB 3FZFB 1B7TA 3RX6A 1HR0T 3RYIE 3NWIA 3FBZA 2L3LA 3MXZA 4AQFC 4IDPA 4YFSA 4HEAA 4Q25A 4DNDA 2VQET 2A9UA 4GKJT 5FXVA 3RH3A 2ES0A 5C3JA 2CMRA 3AE2A 2EHOA 1YD8G 5BR8T 4GIWA 3ANWA 4HFDA 2DL1A 1MMDA 5ADXL 3CX7B 2VWAA 2AXDS 2A2FX 1HX8A 3V5UA 4I0UA 3FZLB 5FXZA 1YXRA 4EEBA 2ZM6T 5ABGA 4E7ZA 4TZ4C 2LLYA 2J47A 2OA5A 3KV4A 2X0HA 3ETVA 2BKNA 5F3JA 3OTOT 3ZT7A 4DIDB 4Z8XA 1VRBA 2Y6XA 3EABA 2V7LA 2HN1A 3AE4A 3ZMSB 5ABHA 4A5XA 5ABFA 3ZPOA 3Q5DA 2ACZA 2CA5A 3P7IA 2D0TA 4KP3C 3RIFA 1LRZA 1IJ6A 4WW0A 3IA3A 4PJJA 5LMNT 3ZMTB 2WBLA 3AEFA 5AQQB 2V7IA 2VL0A 2MAWA 3N2OA 4ZXLA 2XQ3A 5C8YE 1WYCA 4TWDA 3CPZA 4EOZB 2E9XB 1MNDA 3CQCB 4AQFA 3KV5A 2YEVC 3OVUA 2RPAA 3FZHB 3DJBA 2MYSA 4HWFA 2NW8A 3LJCA 1CHUA 2P9BA 3LK42 2C0SA 5AQHB 3L3PA 1M62A 4JLEA 4HGAA 4MHCA 1Z0PA 5EK2A 3VRAA 2VQFT 2BBHA 1ZEEA 4G2AA 1T7SA 4P0AA 3JAEA 1FIOA 5LBMA 4UEMA 3ZSTA 5JDFA 3UU3A 1MIVA 2XAQB 3N9OA 2VKDA 1YQ4A 3AE7A 4DR1T 5LCYA 4P1NA 2VL8A 3B57A 4IDZA 3PTRB 1HG2A 3N9MA 2E8IA 4ANJA 3JC6D 4TWHA 5LHIB 2WMNA 3GWHA 4P09A 3UUBA 3AVRA 2BG9B 4H63H 3UFEA 2QRXA 4DV4T 4LMKA 3JAFA 2LOSA 2WCAA 3N9PA 2XAHB 4X5TA 3ESLA 3CK6A 5HYAA 3LBXA 5TAOA 4B3RT 2FJBA 2XAGB 2XQ6A 1J5ET 4LFAT 3PUZF 1NAFA 2JRKA 2CPTA 2HPJA 3AEAA 4L9IA 3FXEB 2VKOA 2YDRA 3K3NA 3O1IA 2FJDA 2MOZA 5IYZE 2KWIB 2PTFA 3ZMUB 2X0LB 3AEDA 5L4EA 1JNZA 1W0BA 2DLRA 4ZI2D 2V5CA 2YU2A 4GOUA 3AAIA 4YLHA 4KX6A 4DBQA 3FBLA 4QH1A 3HI2A 2JJ9A 3VU7H 2V26A 2J1DG 3RKGA 2SPCA 1FMWA 3BQLA 4OHFA 3AAEB 4H9PC 2Q9QC 2KLQA 5EK4A 4IHJE 3SS1A 4DVDA 3RYHE 3AECA 4JI0T 5FY1A 4KBMB 4LFBT 4HWCA 2VKHA 5AQVB 1ZHCA 2VKJA 4O4LE 5CA0E 2W67A 3I1AA 3KBUA 1NENA 2WMOA 4AKGA 1US7B 4U2ZA 3AE9A 1BR4A 2FUPA 2V5DA 3Q2MA 2I59A 3S4UA 2VVSA 4HE8A 3C64A 5BMVE 4PJNA 4OK0A 2CXLA 4HWDA 4KHPT 5F8PA 5HXCA 1MMNA 4H9OC 2E9XC 4AKRB 5LBQB 5DJQC 4IE0A 3ZJ1A 2ZLYA 3UU4A 3ONXA 3G06A 1IZNB 3Q5EA 1Z8UA 4KUMB 5F5WA 3MZKB 4UVCB 2IMLA 3NRXA 5LP6E 2FBWA 1BR0A 3KV9A 4U7YA 3LK3B 4DV7T 4QXBB 2YU1A 1N34T 1X9BA 4JBWF 1S94A 4DV1T 4KHZF 4HTEA 4YJ3E 5KMGP 2NOXA 3ZC1A 2WQYA 5HEGA 4QX7B 3RHWA 2LKGA 4UV8B 4I43B 4JI3T 1OEDB 1U5PA 3C4WA 2BS2A 4LF9T 5FL0A 2N2NA 3IBPA 3ZMZB 3TLTA 3PU8A 2YINA 2DCFA 5J2UE 2BG9C 3M3ZB 3C98B 4YSYA 4JI2T 2Q9QD 2NP9A 5FVLA 3PUVF
chains in the Genus database with same CATH topology
4UVBB 5FXZA 3Q5XA 3LFMA 2V7KA 2ZM8A 4ZI3C 5L2LA 1E1HB 1HFAA 4O2AE 4AXPA 4WNKA 4E7ZA 1ZKEA 4TZ4C 2OA5A 4G63A 2PJQA 3KV4A 5L3CB 4MFRA 3O4XE 3ETVA 3U78A 5F3JA 4EZHA 3BQIA 3F31A 5JREA 4Z8XA 1VRBA 2Y6XA 1AJ3A 4CZZB 4HN9A 2V7LA 2E9XA 2H3RA 5JRCA 2EHOB 3AA7B 3OJAA 5HWYA 4JEUB 4HKAA 4IE6A 1BR1A 3CQXC 3RYCE 3ZMSB 2KXPB 3QUJA 5H6RB 2DWKA 1VOMA 4UF0A 3AA1B 2ZM2A 3MACA 1WYBA 3ANWB 3ZPOA 2CA5A 3QC9A 4IGUA 5JDQA 3P7IA 3WI3A 4O2BE 1T98A 2D0TA 4KP3C 4NUUA 4TV8E 4H9RC 3ZYMA 3E22E 4AI6A 5LJNA 4EB6E 1LRZA 4U72A 1IJ6A 2JPFA 2KT9A 1G8XA 3QK6A 4WW0A 4E7SA 3V5SA 5A1LA 4PJJA 4H63V 5JDNA 1D1AA 1LVKA 4QKNA 2LT3A 2B1EA 3R84B 1MIWA 3ZMTB 5LJMA 3HL6A 2WBLA 3ZCJA 2WAUA 2D5UA 3ZMVB 2V7IA 1MMGA 3KFWX 3A5XA 3OBVE 4CI1B 4X20E 5KX5E 3R6NA 3N2OA 4AKIA 5C8YE 3N5LA 3UUXB 1WYCA 2CLYC 4X1KE 1QUUA 3BQKA 2ZMAA 4ZI7E 2H7OA 3CPZA 4EOZB 5JQGE 3W15B 3N9LA 4DMVA 2E9XB 5FP3A 1MNDA 5JRCB 3CQCB 4AQFA 1HCIA 3KV5A 3WAKA 2XUEA 2YEVC 2V7JA 3HKDE 2IW5B 4ASKA 4CXXA 1SHZC 2CXFA 4QHOA 3ZLIA 4UF0B 3DJBA 2MYSA 2Q9QA 5FXXA 2NW8A 4TV9E 3RPUA 3LJCA 3UTKA 4TN7B 3CMLA 3UUMA 2Z6EA 2LSJA 4BJMA 1G73A 2P9BA 3LK42 1BR2A 3VHLA 4ADZA 4CXWA 3NZPA 4TUYE 5L3EB 3E0ZA 2C0SA 5L3FB 4UXNB 5FXWA 3NZQA 3O1HA 5JDMA 1ZV4X 3L3PA 2DWGA 3K3OA 4JLEA 3CWZB 4HGAA 2XASB 4MHCA 5JR9A 3ETUA 1Z0PA 5HAXA 5EK2A 2WM9A 3EVYA 5J2TE 5FNVE 2CM0A 3H3AA 3RRWA 4H9SE 4IE7A 1ZEEA 4G2AA 4BJNA 2IAKA 4P0AA 4MBQA 2LJLA 4I4TE 2NW7A 1FIOA 1NWMX 5LBMA 4F6RC 3IF8B 4UEMA 3JC6C 2HH7A 5JDFA 4NUVA 4XAXB 2H7VC 4J2CA 3MKDA 5LNKA 3T8OA 1MIVA 2X9WA 4O4IE 4TX5A 3ZJ2A 2ACXA 2XAQB 1MIYA 3EDUA 3N9OA 5LHHB 4MALA 2VKDA 5LA6E 3HKBE 4DBRA 2X9XA 2KZ7B 1Y64B 5LCYA 2Q9QB 3BK9A 2VL8A 3B57A 4IDZA 2UXXB 1FMVA 3PTRB 4XZCA 3F2EA 2K48A 1HF8A 5AFUL 5JDLA 4AQGA 4BA9A 5IHYA 4UELA 1HG2A 4PAGA 3N9MA 2LEHA 2E8IA 2XTLA 4ANJA 4WBOA 4L0RA 5M4YA 3JC6D 2NWBA 3ZN1B 2ODVA 5LHIB 2WMNA 2PFVA 3L09A 3GWHA 3CQGB 5JR9B 5JH7E 4P09A 1OWAA 1X79A 3D0TA 1O3XA 3HA4A 2V1DB 4ZI3D 3VKGA 3AVRA 2V7MA 4GK5E 4PK4A 3NRYA 4H63H 3DTOA 3J9X1 3U3IA 1HTJF 3UFEA 2MTQA 3SWHA 2PBIA 2X68A 4X1IE 3N9QA 2WWUA 4PFPA 2LOSA 3N9PA 2KWHA 1D0XA 2XAHB 3GA8A 4OFZA 4IE4A 4XBFB 3ESLA 5JVDE 5HYAA 3P8CD 5LGUB 3I9YA 4P0BA 3LBXA 5TAOA 2CWYA 2RP4A 3UT5E 3I9WA 5CA1E 4YHJA 1V9DA 3HKEE 4GYRA 4ZI2C 1FEWA 4EXTA 5LG4A 3GMIA 2XAGB 2Y8DA 4GK0E 2DNXA 3AA6B 1NAFA 2C5KT 5L3DB 5DQWA 2JRKA 1UCUA 2HPJA 4L9IA 2X51A 3SRZA 3FXEB 2VKOA 3E08A 2LSIA 3K3NA 3C50A 3O1IA 1OXZA 4X1YE 2CE7A 5FY0A 3RC3A 5HXEA 2BZBA 1SA0E 2MOZA 5HXRA 3PE0A 5IYZE 2KWIB 4EYYR 5DQVA 4DMWA 3ZMUB 2D2SA 3KVAA 1IJ5A 2X0LB 5GONE 3VKHA 4H9NC 3SOLA 3CVRA 4EIWA 4O4HE 2DLRA 5CB4E 4ZI2D 2YU2A 4GOUA 4EAHA 3AAIA 2BVMA 2LM9A 3IEEA 2W63A 4A56A 1YW0A 2JMHA 3ZEFB 5LHGB 4YLHA 3K3QC 4ZS2A 2JMKA 4ISTA 4QWNB 4ZS3A 3KV6A 4PW8A 4DBQA 3FBLA 3N2GE 3LBXB 2BDEA 2QA7A 3MK7C 5HXSA 3O9XA 2W0GA 4L5GA 2X9YA 3HI2A 2JJ9A 4HFVA 5FMNA 3ZYKA 5LYJE 4H9QC 2LSGA 2W00A 3PU3A 4PJMA 2DHRA 2NTXA 3VU7H 2V26A 2J1DG 3O1JA 1WRDA 2CLYB 2SPCA 4EZ4A 1FMWA 4UV9B 3BQLA 2LSKA 4OHFA 3AAEB 4H9PC 2M67A 3RKOA 3KBTA 4DO0A 2C5IT 2Q9QC 2PG8A 2KLQA 3OYXA 5EK4A 5LGTB 4PNIA 3ZN0B 4IHJE 3OKQA 3CKDA 3HKCE 1IAPA 5L3BB 5LXTE 2ZM0A 4EYUA 3K8PC 2DI4A 4IE5A 3SS1A 3MJXA 4DVDA 3RYHE 3EUHA 1D1BA 4WBNE 5FY1A 2JQQA 2KNDA 3UULA 4CI2B 3F57A 5JDGA 2YK0A 4N78D 4UVAB 4ILUA 4KBMB 4QX8B 2EHOC 3PURA 4V1Av 2VKHA 1YKHB 4AKLA 2CEAA 2W62A 4CQIA 2LE8A 4AKHA 1ZHCA 2VKJA 4O4LE 3B13A 5JDHA 5CA0E 2N9DA 3ZYLA 4C91A 2C5JA 2VASA 2XHEB 3I1AA 3KBUA 1CUNA 1WLXA 4FI5A 2KINB 2WMOA 3CX8B 1YKEB 3RYFE 5KDMC 1MMAA 2K24A 5EK3A 2X67A 3Q9DA 3HR0A 4AKGA 1US7B 3PUAA 2XQYA 4YJ2E 4JEHB 3AA0B 1MNEA 2QGSA 3AVSA 5ETWA 1BR4A 2K9AA 5H6QB 2EHOD 3Q2MA 4JUYA 2I59A 5E0OA 2VB6A 3S4UA 2D0UA 3FXDB 3I0OA 2XAFB 4HE8A 1U4QA 3KDSE 3C64A 2LHNA 3AAAB 4I50E 5FYMA 4C90A 2VK9A 4ERRA 5BMVE 4PJNA 4OK0A 2G0UA 2CXLA 5LGNB 3C51A 1WR6A 5FY7A 2RA1A 2WSSV 4PFOA 1KK7A 5F8PA 4B6XA 4U74A 2CCQA 1MMNA 5HXCA 4QXCB 2BVLA 1HS7A 4OYKA 3PDYA 4H9OC 2E9XC 4AKRB 5LBQB 2HPLA 3UUNA 3RRCA 5DJQC 4IE0A 3ZJ1A 2ZLYA 3WAJA 3PUSA 4ZHQE 3DP7A 2L8KA 3TKLB 3ONXA 3N2KE 2GK9A 3IHRA 2L9QA 1IZNB 2KMFA 1LVFA 4KUMB 4OYJA 3ZC0A 3KVBA 2XAJB 3MZKB 4O4JE 4UVCB 3NRXA 5LOVE 3M65A 3FHNA 1EZ3A 4M1PA 5LP6E 2X9HA 3NBXX 5EZYE 3PUGA 1BR0A 3KV9A 4KMCA 4PK5A 1UX5A 1UX4A 4UIGA 2K5BB 4IIJE 5L3GB 3EDVA 5J1GA 3LK3B 2E9XD 4QXBB 3C4ZA 2YU1A 4FJOA 3GN5A 2W61A 4PJLA 3AB3B 1S35A 2ODUA 2UXNB 1S94A 1B7TA 3RX6A 4HTEA 3RC8A 1LKXA 3I0QA 4GYSA 4I55E 1HG5A 2IC9A 3H37A 4YJ3E 3RYIE 4CI3B 3C4XA 5KMGP 2NOXA 5DABA 3ZC1A 2X66A 2CXDA 1D0ZA 2L3LA 3FBZA 3MXZA 4QX7B 4PK6A 2NW9A 4K0UA 3ZCIA 4UV8B 4AQFC 1H7CA 4MLKA 3N9NA 4YFSA 3LG7A 4HEAA 4I43B 4DNDA 4CXYA 1KNZA 1U5PA 4O8SA 3J7Yq 3C4WA 2A3DA 4ISSA 2LOPA 5FXVA 2N1GA 2IC6A 5HWXA 3PUQA 4QXHB 3RH3A 3FB2A 2ES0A 2N2NA 3IBPA 2CMRA 3ZMZB 3LK2B 1D1CA 2EHOA 1YD8G 3OYZA 3KINB 3PU8A 2LHRA 1QSDA 2A72A 2MBGA 4BAYB 4GIWA 5JR9C 4ZOLE 2YINA 3ANWA 3Q5WA 3GN5B 2DCFA 5J2UE 3CX6B 1MMDA 2NTYA 3C98B 5ADXL 3CX7B 2CWOA 5HXHA 2VWAA 2A2FX 3MA9A 2Q9QD 1HX8A 3V5UA 1D0YA 2NP9A 2LSYA 2Y48B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JQQ A; 
#chains in the Genus database with same CATH topology
 4UVB B;  4DR4 T;  1N36 T;  4JI7 T;  2V7K A;  4LF5 T;  4G63 A;  5L3C B;  4MFR A;  3RIA A;  3F31 A;  3OPC A;  4OX9 T;  4CZZ B;  4HN9 A;  4B3T T;  2E9X A;  2IHR 1;  1E2A A;  3OJA A;  2FJE A;  4HKA A;  3RYC E;  3QUJ A;  2DWK A;  3AA1 B;  2ZM2 A;  2V6Y B;  1WR0 A;  2XPK A;  1UUS A;  1T98 A;  4TV8 E;  2KSR A;  1ZOY A;  4H9R C;  5FKY A;  3ZYM A;  5IUX A;  4AI6 A;  2XM2 A;  1T72 A;  2YDQ A;  2I0M A;  4AIU A;  1IBM T;  3V5S A;  4H63 V;  1D1A A;  1LVK A;  1NEK A;  3AE5 A;  1MIW A;  5LJM A;  2D5U A;  3A5X A;  4HFE A;  2LKH A;  1IBL T;  3UUX B;  1QUU A;  2WU5 A;  3BQK A;  2H7O A;  5FL1 A;  2E5L T;  3N9L A;  3QOF A;  5FP3 A;  5JRC B;  1HCI A;  5FVK A;  2UUB T;  2XZE A;  4QH5 A;  1HX1 B;  4CXX A;  1YQ3 A;  1SHZ C;  4QHO A;  3EAM A;  4UF0 B;  3UTK A;  4TN7 B;  4YSZ A;  3CML A;  4DV6 T;  3UUM A;  2Z6E A;  4UR9 A;  4TUY E;  5L3E B;  5JDM A;  3K3O A;  1W0A A;  3CWZ B;  3VRB A;  5HAX A;  2WM9 A;  1KF6 A;  4JI1 T;  2YDS A;  2BG9 A;  5FNV E;  4X64 T;  3RRW A;  4H9S E;  4IE7 A;  4MBQ A;  5AQS B;  3IF8 B;  3JC6 C;  5AQM B;  2H7V C;  4O4I E;  3ZJ2 A;  4A98 A;  3VR9 A;  1MIY A;  5LHH B;  2QVA A;  4MAL A;  3SFD A;  2X9X A;  2KZ7 B;  2Q9Q B;  4GKK T;  4XZC A;  5AFU L;  3AEG A;  3AXJ B;  5IHY A;  4UEL A;  3SFE A;  4LF4 T;  1J5W A;  4WBO A;  5M4Y A;  3ZN1 B;  4IL4 A;  3L09 A;  4LMJ A;  3L8R A;  5JR9 B;  5JH7 E;  3H3M A;  1VCT A;  3D0T A;  3HA4 A;  2V1D B;  3VKG A;  4PK4 A;  4Z90 A;  3U3I A;  3SWH A;  4QH4 A;  3ABV A;  2HHH T;  1D0X A;  3GA8 A;  4F8H A;  2W66 A;  2CRB A;  2YN6 A;  3UT5 E;  5CA1 E;  4YHJ A;  1V9D A;  2UUC T;  4ZI2 C;  2J4G A;  3ONL C;  2C5K T;  3RLF F;  1OED C;  3P4S A;  3UQ4 A;  3RIU C;  2D9D A;  4EV6 A;  2XY8 B;  3C50 A;  4X1Y E;  2K3W A;  5HXE A;  2CE7 A;  5ABE A;  5HEH A;  5GON E;  3VKH A;  3TLS A;  2V6X A;  2WDV A;  3SOL A;  3FZM B;  4EIW A;  4O4H E;  5CB4 E;  3P4P A;  4B3S T;  3UQ7 A;  2W63 A;  2YKS A;  4ZS2 A;  4YXD A;  3KV6 A;  2CBI A;  2NR4 A;  4PW8 A;  4IT4 A;  2BDE A;  5L47 A;  2CHN A;  2X9Y A;  4HFV A;  5FMN A;  4X66 T;  4X65 T;  2UXC T;  4H9Q C;  2W00 A;  2NTX A;  3O1J A;  4EZ4 A;  4JI5 T;  3KBT A;  3PJA J;  4DO0 A;  2C5I T;  2PG8 A;  5AQO B;  4PNI A;  3OKQ A;  3CKD A;  3HKC E;  2XSA A;  2ZM0 A;  3K8P C;  4ILC A;  3T1Y T;  1D1B A;  4WBN E;  2JQQ A;  4CI2 B;  5JDG A;  2WDQ A;  2YK0 A;  4N78 D;  4V1A v;  3UU8 A;  1YKH B;  5L4H A;  2W62 A;  2LE8 A;  3JCF A;  2N9D A;  4C91 A;  2XHE B;  3FZK B;  1CUN A;  4FI5 A;  1N33 T;  2X67 A;  4NIQ A;  2XQY A;  3AA0 B;  1MNE A;  5ETW A;  2K9A A;  5E0O A;  2XM1 A;  5AQI B;  4I50 E;  3RQW A;  5LGN B;  4NPP A;  5FY7 A;  2RA1 A;  4PFO A;  5CJ5 A;  2CCQ A;  1VCS A;  1HS7 A;  3K1S A;  4OYK A;  4JYA T;  3PDY A;  5CFB A;  4LF7 T;  5CGM A;  2HPL A;  3RRC A;  3P4R A;  1OED A;  3RIU A;  4ZHQ E;  3DP7 A;  3TKL B;  3N2K E;  2GK9 A;  4HFC A;  1KNP A;  2YOE A;  3UU6 A;  2KMF A;  1LVF A;  4YT0 A;  2X9H A;  5EZY E;  3CIR A;  2J62 A;  5AQG B;  4IIJ E;  3C4Z A;  5HEO A;  4PJL A;  3AB3 B;  1W9R A;  1I94 T;  4CN1 A;  3ZT6 A;  3I0Q A;  2WZH A;  4GYS A;  1IBK T;  1HG5 A;  2IC9 A;  2CXD A;  3N9N A;  3LG7 A;  5AQT B;  1KNZ A;  1ZP0 A;  3J7Y q;  4HFB A;  2A3D A;  4ISS A;  4IL9 A;  1I6Z A;  2N1G A;  4QXH B;  5HEU A;  4COF A;  1D1C A;  4EED A;  4JI4 T;  3L39 A;  1QSD A;  2A72 A;  4YTP A;  2MBG A;  2VUR A;  2LRL A;  2W2U A;  5JR9 C;  4ZOL E;  2V6Y A;  3CX6 B;  3AE8 A;  4DR2 T;  5HXH A;  4DV5 T;  4ZZC A;  3MA9 A;  4IDQ A;  2BKO A;  3Q5X A;  2XQ7 A;  3LFM A;  4ZI3 C;  1E1H B;  1HFA A;  3NKZ A;  4WNK A;  1ZKE A;  4DR5 T;  4AQY T;  3U78 A;  4EZH A;  2WY2 A;  4LF6 T;  5HCJ A;  2H3R A;  5JRC A;  3AA7 B;  4JEU B;  4IE6 A;  1BR1 A;  1W09 A;  3P4Q A;  1KEY A;  2KXP B;  5H6R B;  4TNW A;  4UF0 A;  1WYB A;  3QC9 A;  4EB6 E;  4U72 A;  2JPF A;  2KT9 A;  1G8X A;  3QK6 A;  5A1L A;  5JDN A;  4DR7 T;  2B1E A;  4ILA A;  1HNZ T;  2XJ7 A;  3KFW X;  4CI1 B;  3OBV E;  4X20 E;  3R6N A;  4AKI A;  4TWF A;  1XWM A;  1E7P A;  3NVO A;  4X1K E;  5JQG E;  3W15 B;  3ZSS A;  1FJG T;  4DMV A;  1KNR A;  3WAK A;  4U31 A;  2V7J A;  4ASK A;  2CXF A;  3ZLI A;  2Q9Q A;  4TV9 E;  4BJM A;  2LSJ A;  1G73 A;  1BR2 A;  3AXJ A;  4CXW A;  3NZP A;  1ZV4 X;  2FJA A;  5JR9 A;  3ETU A;  3EVY A;  4IDO A;  5J2T E;  2CM0 A;  3H3A A;  4NXM T;  3EI0 A;  5LB7 B;  4I4T E;  2XQ5 A;  2HH7 A;  1SE7 A;  3A7M A;  4XAX B;  5AQK B;  3MKD A;  5LNK A;  3T8O A;  4TX5 A;  2ACX A;  2UXD T;  5LA6 E;  1Y64 B;  3RI5 A;  1UK5 A;  3BK9 A;  2UXX B;  3F2E A;  2K48 A;  4BA9 A;  4DV3 T;  4PAG A;  2LEH A;  2XTL A;  4L0R A;  1M7K A;  2PFV A;  3AEB A;  3CQG B;  1XMQ T;  4AIS A;  1OWA A;  1O3X A;  4ZI3 D;  4GK5 E;  2V7M A;  3J9X 1;  2MTQ A;  4YSX A;  3N9Q A;  2WWU A;  4PFP A;  4ILB A;  4XBF B;  2LRK A;  5JVD E;  1R8I A;  5LGU B;  3I9Y A;  1XMO T;  2H89 A;  1XDP A;  1FEW A;  4EXT A;  2M6B A;  2Y8D A;  2E5V A;  5L3D B;  2X51 A;  3E08 A;  3RC3 A;  5FY0 A;  2IIU A;  2UXB T;  3PE0 A;  1J1J A;  5DQV A;  3KVA A;  2JQ9 A;  2B76 A;  5AQN B;  4EAH A;  2BVM A;  2LM9 A;  4EGW A;  4JV5 T;  3IEE A;  4A56 A;  1YW0 A;  4IDN A;  4NXN T;  2JMK A;  4IST A;  4QWN B;  3N2G E;  3O9X A;  2QA7 A;  4IRE A;  3AE1 A;  3ZYK A;  2CLY B;  2QYW A;  2LSK A;  3RKO A;  2VVN A;  4DV0 T;  3OYX A;  5LGT B;  5L3B B;  5LXT E;  2XSB A;  2OLT A;  4HWH A;  3EUH A;  2IUB A;  3UUL A;  4UVA B;  3TLU A;  5AQP B;  4AKL A;  2CEA A;  4CQI A;  4AKH A;  3B13 A;  3ZYL A;  2VAS A;  1WLX A;  2KIN B;  4U3C A;  2W4X A;  4U7I A;  2CHO A;  4YJ2 E;  4JEH B;  2JIW A;  1UUR A;  2EHO D;  2VB6 A;  2XAF B;  3RGL A;  4ERR A;  1HNW T;  3C51 A;  1WR6 A;  4DR6 T;  4B6X A;  1N32 T;  2F4V T;  4ZZB A;  1XDO A;  3IHR A;  4TNV A;  2XAJ B;  4O4J E;  3FHN A;  1EZ3 A;  4M1P A;  3NBX X;  2OV9 A;  4KMC A;  4PK5 A;  1UX5 A;  1UX4 A;  4UIG A;  5L3G B;  3P4W A;  5J1G A;  2HN2 A;  1XNQ T;  4JI8 T;  2W61 A;  1OED E;  3RC8 A;  1LKX A;  4ZEY A;  4I55 E;  3H37 A;  4CI3 B;  3C4X A;  2WZI A;  5DAB A;  2X66 A;  1D0Z A;  2UUA T;  4PK6 A;  2NW9 A;  4K0U A;  3ZCI A;  1H7C A;  4MLK A;  4JI6 T;  4CXY A;  4DUZ T;  4O8S A;  4WZX A;  4CN6 A;  1XZY A;  2LOP A;  3UU5 A;  2IC6 A;  5HWX A;  3PUQ A;  3FB2 A;  3LK2 B;  2JQK A;  3PJA A;  3OYZ A;  3KIN B;  2LHR A;  4BAY B;  2R6G F;  5LMU T;  3Q5W A;  3GN5 B;  1L0V A;  2NTY A;  2CWO A;  2X0Y A;  1D0Y A;  2LSY A;  2Y48 B;  2WB5 A;  3TLW A;  2WP9 A;  2ZM8 A;  5L2L A;  4O2A E;  4AXP A;  2PJQ A;  3O4X E;  4DR3 T;  3BQI A;  5JRE A;  4U2Y A;  3ZKR A;  1JNR A;  1AJ3 A;  1HNX T;  4WYV A;  2EHO B;  5HWY A;  4DUY T;  3ZT5 A;  3CQX C;  5C2T A;  1VOM A;  2IDO B;  2BKP A;  5HCM A;  3MAC A;  3ANW B;  1QLB A;  4IGU A;  3A8Y C;  5JDQ A;  3WI3 A;  4O2B E;  4NUU A;  3E22 E;  5LJN A;  1UGO A;  3PUX F;  4E7S A;  5AQU B;  4QKN A;  2LT3 A;  3R84 B;  1KFY A;  3HL6 A;  3ZCJ A;  2WAU A;  3ZMV B;  1MMG A;  5AQR B;  5KX5 E;  4LFC T;  3N5L A;  2CLY C;  1SUM B;  2ZMA A;  4ZI7 E;  1GQE A;  2XUE A;  3HKD E;  2AE9 A;  2IW5 B;  4HFH A;  3AE6 A;  3LDQ B;  3PV0 F;  5AQJ B;  5FXX A;  5ABF B;  3AE3 A;  3RPU A;  3VHL A;  4ADZ A;  4YHH T;  2H88 A;  3E0Z A;  3RF1 A;  5L3F B;  4UXN B;  5FXW A;  3NZQ A;  3O1H A;  2DWG A;  2XQ8 A;  5JTG A;  2XAS B;  4LF8 T;  4BJN A;  2IAK A;  2LJL A;  2NW7 A;  1NWM X;  4F6R C;  4NUV A;  4J2C A;  4Z91 A;  2X9W A;  4YTN A;  1WFD A;  3QB5 K;  3JAD A;  3EDU A;  3HKB E;  4LML A;  4DBR A;  2XQ9 A;  4HFI A;  1WCR A;  1FMV A;  1HF8 A;  5JDL A;  4AQG A;  3UFG A;  4B3M T;  2NWB A;  2ODV A;  4YY3 T;  2WDR A;  1X79 A;  3NRY A;  3AEE A;  3DTO A;  1HTJ F;  3TLV A;  2PBI A;  2X68 A;  5HEJ A;  4X1I E;  2KWH A;  2WWV A;  2LM2 A;  4OFZ A;  4IE4 A;  3X1D A;  3PUW F;  3P8C D;  4P0B A;  5AQF B;  1DU2 A;  2CWY A;  2RP4 A;  3I9W A;  3HKE E;  4GYR A;  5LG4 A;  2V8S V;  3GMI A;  4GK0 E;  2DNX A;  3AA6 B;  2BS3 A;  5DQW A;  3RQU A;  1UCU A;  3SRZ A;  2LSI A;  2E2A A;  1OXZ A;  4KI0 F;  2BZB A;  1SA0 E;  2JQH A;  2XQA A;  5HXR A;  4EYY R;  4DMW A;  2BS4 A;  2D2S A;  1IJ5 A;  3ONJ A;  4H9N C;  2CBJ A;  3CVR A;  5AQL B;  2JMH A;  3ZEF B;  5LHG B;  3K3Q C;  4ZS3 A;  3LBX B;  3MK7 C;  5HXS A;  2W0G A;  4L5G A;  5LYJ E;  1XNR T;  2LSG A;  3PU3 A;  4PJM A;  2DHR A;  1WRD A;  4UV9 B;  2M67 A;  3ZN0 B;  1IAP A;  4EYU A;  3P50 A;  2DI4 A;  4IE5 A;  3MJX A;  5IWA T;  2KND A;  4CN4 A;  2XQ4 A;  3F57 A;  4ILU A;  4QX8 B;  2EHO C;  3PUR A;  5KXJ A;  2I6H A;  2BG9 E;  3QB5 A;  1T8B A;  2MPK A;  5JDH A;  3T1H T;  2C5J A;  5LG3 A;  3CX8 B;  1YKE B;  3RYF E;  5KDM C;  1MMA A;  3PUY F;  2K24 A;  5EK3 A;  3Q9D A;  3HR0 A;  2WU2 A;  3PUA A;  2QGS A;  3AVS A;  5H6Q B;  4JUY A;  2D0U A;  3FXD B;  3I0O A;  1U4Q A;  4K0K T;  3KDS E;  2LHN A;  4HWI B;  3AAA B;  5FYM A;  4C90 A;  2VK9 A;  2G0U A;  3QNU A;  4DV2 T;  2WSS V;  4YTM A;  1KK7 A;  4U74 A;  4QXC B;  2BVL A;  2M6I A;  3UUN A;  3B5M A;  3WAJ A;  3PUS A;  2L8K A;  3VR8 A;  2L9Q A;  4OYJ A;  4A97 A;  3ZC0 A;  3KVB A;  5LOV E;  3M65 A;  3PUG A;  2K5B B;  3EDV A;  3LSV A;  2E9X D;  3EHZ A;  4X62 T;  2UU9 T;  2BBJ A;  4FJO A;  3GN5 A;  4U33 A;  1Y01 A;  1S35 A;  2ODU A;  5J0Z A;  2WS3 A;  2UXN B;  3FZF B;  1B7T A;  3RX6 A;  1HR0 T;  3RYI E;  3NWI A;  3FBZ A;  2L3L A;  3MXZ A;  4AQF C;  4IDP A;  4YFS A;  4HEA A;  4Q25 A;  4DND A;  2VQE T;  2A9U A;  4GKJ T;  5FXV A;  3RH3 A;  2ES0 A;  5C3J A;  2CMR A;  3AE2 A;  2EHO A;  1YD8 G;  5BR8 T;  4GIW A;  3ANW A;  4HFD A;  2DL1 A;  1MMD A;  5ADX L;  3CX7 B;  2VWA A;  2AXD S;  2A2F X;  1HX8 A;  3V5U A;  4I0U A;  3FZL B;  5FXZ A;  1YXR A;  4EEB A;  2ZM6 T;  5ABG A;  4E7Z A;  4TZ4 C;  2LLY A;  2J47 A;  2OA5 A;  3KV4 A;  2X0H A;  3ETV A;  2BKN A;  5F3J A;  3OTO T;  3ZT7 A;  4DID B;  4Z8X A;  1VRB A;  2Y6X A;  3EAB A;  2V7L A;  2HN1 A;  3AE4 A;  3ZMS B;  5ABH A;  4A5X A;  5ABF A;  3ZPO A;  3Q5D A;  2ACZ A;  2CA5 A;  3P7I A;  2D0T A;  4KP3 C;  3RIF A;  1LRZ A;  1IJ6 A;  4WW0 A;  3IA3 A;  4PJJ A;  5LMN T;  3ZMT B;  2WBL A;  3AEF A;  5AQQ B;  2V7I A;  2VL0 A;  2MAW A;  3N2O A;  4ZXL A;  2XQ3 A;  5C8Y E;  1WYC A;  4TWD A;  3CPZ A;  4EOZ B;  2E9X B;  1MND A;  3CQC B;  4AQF A;  3KV5 A;  2YEV C;  3OVU A;  2RPA A;  3FZH B;  3DJB A;  2MYS A;  4HWF A;  2NW8 A;  3LJC A;  1CHU A;  2P9B A;  3LK4 2;  2C0S A;  5AQH B;  3L3P A;  1M62 A;  4JLE A;  4HGA A;  4MHC A;  1Z0P A;  5EK2 A;  3VRA A;  2VQF T;  2BBH A;  1ZEE A;  4G2A A;  1T7S A;  4P0A A;  3JAE A;  1FIO A;  5LBM A;  4UEM A;  3ZST A;  5JDF A;  3UU3 A;  1MIV A;  2XAQ B;  3N9O A;  2VKD A;  1YQ4 A;  3AE7 A;  4DR1 T;  5LCY A;  4P1N A;  2VL8 A;  3B57 A;  4IDZ A;  3PTR B;  1HG2 A;  3N9M A;  2E8I A;  4ANJ A;  3JC6 D;  4TWH A;  5LHI B;  2WMN A;  3GWH A;  4P09 A;  3UUB A;  3AVR A;  2BG9 B;  4H63 H;  3UFE A;  2QRX A;  4DV4 T;  4LMK A;  3JAF A;  2LOS A;  2WCA A;  3N9P A;  2XAH B;  4X5T A;  3ESL A;  3CK6 A;  5HYA A;  3LBX A;  5TAO A;  4B3R T;  2FJB A;  2XAG B;  2XQ6 A;  1J5E T;  4LFA T;  3PUZ F;  1NAF A;  2JRK A;  2CPT A;  2HPJ A;  3AEA A;  4L9I A;  3FXE B;  2VKO A;  2YDR A;  3K3N A;  3O1I A;  2FJD A;  2MOZ A;  5IYZ E;  2KWI B;  2PTF A;  3ZMU B;  2X0L B;  3AED A;  5L4E A;  1JNZ A;  1W0B A;  2DLR A;  4ZI2 D;  2V5C A;  2YU2 A;  4GOU A;  3AAI A;  4YLH A;  4KX6 A;  4DBQ A;  3FBL A;  4QH1 A;  3HI2 A;  2JJ9 A;  3VU7 H;  2V26 A;  2J1D G;  3RKG A;  2SPC A;  1FMW A;  3BQL A;  4OHF A;  3AAE B;  4H9P C;  2Q9Q C;  2KLQ A;  5EK4 A;  4IHJ E;  3SS1 A;  4DVD A;  3RYH E;  3AEC A;  4JI0 T;  5FY1 A;  4KBM B;  4LFB T;  4HWC A;  2VKH A;  5AQV B;  1ZHC A;  2VKJ A;  4O4L E;  5CA0 E;  2W67 A;  3I1A A;  3KBU A;  1NEN A;  2WMO A;  4AKG A;  1US7 B;  4U2Z A;  3AE9 A;  1BR4 A;  2FUP A;  2V5D A;  3Q2M A;  2I59 A;  3S4U A;  2VVS A;  4HE8 A;  3C64 A;  5BMV E;  4PJN A;  4OK0 A;  2CXL A;  4HWD A;  4KHP T;  5F8P A;  5HXC A;  1MMN A;  4H9O C;  2E9X C;  4AKR B;  5LBQ B;  5DJQ C;  4IE0 A;  3ZJ1 A;  2ZLY A;  3UU4 A;  3ONX A;  3G06 A;  1IZN B;  3Q5E A;  1Z8U A;  4KUM B;  5F5W A;  3MZK B;  4UVC B;  2IML A;  3NRX A;  5LP6 E;  2FBW A;  1BR0 A;  3KV9 A;  4U7Y A;  3LK3 B;  4DV7 T;  4QXB B;  2YU1 A;  1N34 T;  1X9B A;  4JBW F;  1S94 A;  4DV1 T;  4KHZ F;  4HTE A;  4YJ3 E;  5KMG P;  2NOX A;  3ZC1 A;  2WQY A;  5HEG A;  4QX7 B;  3RHW A;  2LKG A;  4UV8 B;  4I43 B;  4JI3 T;  1OED B;  1U5P A;  3C4W A;  2BS2 A;  4LF9 T;  5FL0 A;  2N2N A;  3IBP A;  3ZMZ B;  3TLT A;  3PU8 A;  2YIN A;  2DCF A;  5J2U E;  2BG9 C;  3M3Z B;  3C98 B;  4YSY A;  4JI2 T;  2Q9Q D;  2NP9 A;  5FVL A;  3PUV F; 
#chains in the Genus database with same CATH homology
 4UVB B;  5FXZ A;  3Q5X A;  3LFM A;  2V7K A;  2ZM8 A;  4ZI3 C;  5L2L A;  1E1H B;  1HFA A;  4O2A E;  4AXP A;  4WNK A;  4E7Z A;  1ZKE A;  4TZ4 C;  2OA5 A;  4G63 A;  2PJQ A;  3KV4 A;  5L3C B;  4MFR A;  3O4X E;  3ETV A;  3U78 A;  5F3J A;  4EZH A;  3BQI A;  3F31 A;  5JRE A;  4Z8X A;  1VRB A;  2Y6X A;  1AJ3 A;  4CZZ B;  4HN9 A;  2V7L A;  2E9X A;  2H3R A;  5JRC A;  2EHO B;  3AA7 B;  3OJA A;  5HWY A;  4JEU B;  4HKA A;  4IE6 A;  1BR1 A;  3CQX C;  3RYC E;  3ZMS B;  2KXP B;  3QUJ A;  5H6R B;  2DWK A;  1VOM A;  4UF0 A;  3AA1 B;  2ZM2 A;  3MAC A;  1WYB A;  3ANW B;  3ZPO A;  2CA5 A;  3QC9 A;  4IGU A;  5JDQ A;  3P7I A;  3WI3 A;  4O2B E;  1T98 A;  2D0T A;  4KP3 C;  4NUU A;  4TV8 E;  4H9R C;  3ZYM A;  3E22 E;  4AI6 A;  5LJN A;  4EB6 E;  1LRZ A;  4U72 A;  1IJ6 A;  2JPF A;  2KT9 A;  1G8X A;  3QK6 A;  4WW0 A;  4E7S A;  3V5S A;  5A1L A;  4PJJ A;  4H63 V;  5JDN A;  1D1A A;  1LVK A;  4QKN A;  2LT3 A;  2B1E A;  3R84 B;  1MIW A;  3ZMT B;  5LJM A;  3HL6 A;  2WBL A;  3ZCJ A;  2WAU A;  2D5U A;  3ZMV B;  2V7I A;  1MMG A;  3KFW X;  3A5X A;  3OBV E;  4CI1 B;  4X20 E;  5KX5 E;  3R6N A;  3N2O A;  4AKI A;  5C8Y E;  3N5L A;  3UUX B;  1WYC A;  2CLY C;  4X1K E;  1QUU A;  3BQK A;  2ZMA A;  4ZI7 E;  2H7O A;  3CPZ A;  4EOZ B;  5JQG E;  3W15 B;  3N9L A;  4DMV A;  2E9X B;  5FP3 A;  1MND A;  5JRC B;  3CQC B;  4AQF A;  1HCI A;  3KV5 A;  3WAK A;  2XUE A;  2YEV C;  2V7J A;  3HKD E;  2IW5 B;  4ASK A;  4CXX A;  1SHZ C;  2CXF A;  4QHO A;  3ZLI A;  4UF0 B;  3DJB A;  2MYS A;  2Q9Q A;  5FXX A;  2NW8 A;  4TV9 E;  3RPU A;  3LJC A;  3UTK A;  4TN7 B;  3CML A;  3UUM A;  2Z6E A;  2LSJ A;  4BJM A;  1G73 A;  2P9B A;  3LK4 2;  1BR2 A;  3VHL A;  4ADZ A;  4CXW A;  3NZP A;  4TUY E;  5L3E B;  3E0Z A;  2C0S A;  5L3F B;  4UXN B;  5FXW A;  3NZQ A;  3O1H A;  5JDM A;  1ZV4 X;  3L3P A;  2DWG A;  3K3O A;  4JLE A;  3CWZ B;  4HGA A;  2XAS B;  4MHC A;  5JR9 A;  3ETU A;  1Z0P A;  5HAX A;  5EK2 A;  2WM9 A;  3EVY A;  5J2T E;  5FNV E;  2CM0 A;  3H3A A;  3RRW A;  4H9S E;  4IE7 A;  1ZEE A;  4G2A A;  4BJN A;  2IAK A;  4P0A A;  4MBQ A;  2LJL A;  4I4T E;  2NW7 A;  1FIO A;  1NWM X;  5LBM A;  4F6R C;  3IF8 B;  4UEM A;  3JC6 C;  2HH7 A;  5JDF A;  4NUV A;  4XAX B;  2H7V C;  4J2C A;  3MKD A;  5LNK A;  3T8O A;  1MIV A;  2X9W A;  4O4I E;  4TX5 A;  3ZJ2 A;  2ACX A;  2XAQ B;  1MIY A;  3EDU A;  3N9O A;  5LHH B;  4MAL A;  2VKD A;  5LA6 E;  3HKB E;  4DBR A;  2X9X A;  2KZ7 B;  1Y64 B;  5LCY A;  2Q9Q B;  3BK9 A;  2VL8 A;  3B57 A;  4IDZ A;  2UXX B;  1FMV A;  3PTR B;  4XZC A;  3F2E A;  2K48 A;  1HF8 A;  5AFU L;  5JDL A;  4AQG A;  4BA9 A;  5IHY A;  4UEL A;  1HG2 A;  4PAG A;  3N9M A;  2LEH A;  2E8I A;  2XTL A;  4ANJ A;  4WBO A;  4L0R A;  5M4Y A;  3JC6 D;  2NWB A;  3ZN1 B;  2ODV A;  5LHI B;  2WMN A;  2PFV A;  3L09 A;  3GWH A;  3CQG B;  5JR9 B;  5JH7 E;  4P09 A;  1OWA A;  1X79 A;  3D0T A;  1O3X A;  3HA4 A;  2V1D B;  4ZI3 D;  3VKG A;  3AVR A;  2V7M A;  4GK5 E;  4PK4 A;  3NRY A;  4H63 H;  3DTO A;  3J9X 1;  3U3I A;  1HTJ F;  3UFE A;  2MTQ A;  3SWH A;  2PBI A;  2X68 A;  4X1I E;  3N9Q A;  2WWU A;  4PFP A;  2LOS A;  3N9P A;  2KWH A;  1D0X A;  2XAH B;  3GA8 A;  4OFZ A;  4IE4 A;  4XBF B;  3ESL A;  5JVD E;  5HYA A;  3P8C D;  5LGU B;  3I9Y A;  4P0B A;  3LBX A;  5TAO A;  2CWY A;  2RP4 A;  3UT5 E;  3I9W A;  5CA1 E;  4YHJ A;  1V9D A;  3HKE E;  4GYR A;  4ZI2 C;  1FEW A;  4EXT A;  5LG4 A;  3GMI A;  2XAG B;  2Y8D A;  4GK0 E;  2DNX A;  3AA6 B;  1NAF A;  2C5K T;  5L3D B;  5DQW A;  2JRK A;  1UCU A;  2HPJ A;  4L9I A;  2X51 A;  3SRZ A;  3FXE B;  2VKO A;  3E08 A;  2LSI A;  3K3N A;  3C50 A;  3O1I A;  1OXZ A;  4X1Y E;  2CE7 A;  5FY0 A;  3RC3 A;  5HXE A;  2BZB A;  1SA0 E;  2MOZ A;  5HXR A;  3PE0 A;  5IYZ E;  2KWI B;  4EYY R;  5DQV A;  4DMW A;  3ZMU B;  2D2S A;  3KVA A;  1IJ5 A;  2X0L B;  5GON E;  3VKH A;  4H9N C;  3SOL A;  3CVR A;  4EIW A;  4O4H E;  2DLR A;  5CB4 E;  4ZI2 D;  2YU2 A;  4GOU A;  4EAH A;  3AAI A;  2BVM A;  2LM9 A;  3IEE A;  2W63 A;  4A56 A;  1YW0 A;  2JMH A;  3ZEF B;  5LHG B;  4YLH A;  3K3Q C;  4ZS2 A;  2JMK A;  4IST A;  4QWN B;  4ZS3 A;  3KV6 A;  4PW8 A;  4DBQ A;  3FBL A;  3N2G E;  3LBX B;  2BDE A;  2QA7 A;  3MK7 C;  5HXS A;  3O9X A;  2W0G A;  4L5G A;  2X9Y A;  3HI2 A;  2JJ9 A;  4HFV A;  5FMN A;  3ZYK A;  5LYJ E;  4H9Q C;  2LSG A;  2W00 A;  3PU3 A;  4PJM A;  2DHR A;  2NTX A;  3VU7 H;  2V26 A;  2J1D G;  3O1J A;  1WRD A;  2CLY B;  2SPC A;  4EZ4 A;  1FMW A;  4UV9 B;  3BQL A;  2LSK A;  4OHF A;  3AAE B;  4H9P C;  2M67 A;  3RKO A;  3KBT A;  4DO0 A;  2C5I T;  2Q9Q C;  2PG8 A;  2KLQ A;  3OYX A;  5EK4 A;  5LGT B;  4PNI A;  3ZN0 B;  4IHJ E;  3OKQ A;  3CKD A;  3HKC E;  1IAP A;  5L3B B;  5LXT E;  2ZM0 A;  4EYU A;  3K8P C;  2DI4 A;  4IE5 A;  3SS1 A;  3MJX A;  4DVD A;  3RYH E;  3EUH A;  1D1B A;  4WBN E;  5FY1 A;  2JQQ A;  2KND A;  3UUL A;  4CI2 B;  3F57 A;  5JDG A;  2YK0 A;  4N78 D;  4UVA B;  4ILU A;  4KBM B;  4QX8 B;  2EHO C;  3PUR A;  4V1A v;  2VKH A;  1YKH B;  4AKL A;  2CEA A;  2W62 A;  4CQI A;  2LE8 A;  4AKH A;  1ZHC A;  2VKJ A;  4O4L E;  3B13 A;  5JDH A;  5CA0 E;  2N9D A;  3ZYL A;  4C91 A;  2C5J A;  2VAS A;  2XHE B;  3I1A A;  3KBU A;  1CUN A;  1WLX A;  4FI5 A;  2KIN B;  2WMO A;  3CX8 B;  1YKE B;  3RYF E;  5KDM C;  1MMA A;  2K24 A;  5EK3 A;  2X67 A;  3Q9D A;  3HR0 A;  4AKG A;  1US7 B;  3PUA A;  2XQY A;  4YJ2 E;  4JEH B;  3AA0 B;  1MNE A;  2QGS A;  3AVS A;  5ETW A;  1BR4 A;  2K9A A;  5H6Q B;  2EHO D;  3Q2M A;  4JUY A;  2I59 A;  5E0O A;  2VB6 A;  3S4U A;  2D0U A;  3FXD B;  3I0O A;  2XAF B;  4HE8 A;  1U4Q A;  3KDS E;  3C64 A;  2LHN A;  3AAA B;  4I50 E;  5FYM A;  4C90 A;  2VK9 A;  4ERR A;  5BMV E;  4PJN A;  4OK0 A;  2G0U A;  2CXL A;  5LGN B;  3C51 A;  1WR6 A;  5FY7 A;  2RA1 A;  2WSS V;  4PFO A;  1KK7 A;  5F8P A;  4B6X A;  4U74 A;  2CCQ A;  1MMN A;  5HXC A;  4QXC B;  2BVL A;  1HS7 A;  4OYK A;  3PDY A;  4H9O C;  2E9X C;  4AKR B;  5LBQ B;  2HPL A;  3UUN A;  3RRC A;  5DJQ C;  4IE0 A;  3ZJ1 A;  2ZLY A;  3WAJ A;  3PUS A;  4ZHQ E;  3DP7 A;  2L8K A;  3TKL B;  3ONX A;  3N2K E;  2GK9 A;  3IHR A;  2L9Q A;  1IZN B;  2KMF A;  1LVF A;  4KUM B;  4OYJ A;  3ZC0 A;  3KVB A;  2XAJ B;  3MZK B;  4O4J E;  4UVC B;  3NRX A;  5LOV E;  3M65 A;  3FHN A;  1EZ3 A;  4M1P A;  5LP6 E;  2X9H A;  3NBX X;  5EZY E;  3PUG A;  1BR0 A;  3KV9 A;  4KMC A;  4PK5 A;  1UX5 A;  1UX4 A;  4UIG A;  2K5B B;  4IIJ E;  5L3G B;  3EDV A;  5J1G A;  3LK3 B;  2E9X D;  4QXB B;  3C4Z A;  2YU1 A;  4FJO A;  3GN5 A;  2W61 A;  4PJL A;  3AB3 B;  1S35 A;  2ODU A;  2UXN B;  1S94 A;  1B7T A;  3RX6 A;  4HTE A;  3RC8 A;  1LKX A;  3I0Q A;  4GYS A;  4I55 E;  1HG5 A;  2IC9 A;  3H37 A;  4YJ3 E;  3RYI E;  4CI3 B;  3C4X A;  5KMG P;  2NOX A;  5DAB A;  3ZC1 A;  2X66 A;  2CXD A;  1D0Z A;  2L3L A;  3FBZ A;  3MXZ A;  4QX7 B;  4PK6 A;  2NW9 A;  4K0U A;  3ZCI A;  4UV8 B;  4AQF C;  1H7C A;  4MLK A;  3N9N A;  4YFS A;  3LG7 A;  4HEA A;  4I43 B;  4DND A;  4CXY A;  1KNZ A;  1U5P A;  4O8S A;  3J7Y q;  3C4W A;  2A3D A;  4ISS A;  2LOP A;  5FXV A;  2N1G A;  2IC6 A;  5HWX A;  3PUQ A;  4QXH B;  3RH3 A;  3FB2 A;  2ES0 A;  2N2N A;  3IBP A;  2CMR A;  3ZMZ B;  3LK2 B;  1D1C A;  2EHO A;  1YD8 G;  3OYZ A;  3KIN B;  3PU8 A;  2LHR A;  1QSD A;  2A72 A;  2MBG A;  4BAY B;  4GIW A;  5JR9 C;  4ZOL E;  2YIN A;  3ANW A;  3Q5W A;  3GN5 B;  2DCF A;  5J2U E;  3CX6 B;  1MMD A;  2NTY A;  3C98 B;  5ADX L;  3CX7 B;  2CWO A;  5HXH A;  2VWA A;  2A2F X;  3MA9 A;  2Q9Q D;  1HX8 A;  3V5U A;  1D0Y A;  2NP9 A;  2LSY A;  2Y48 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...