4ERRA

1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
GQIFTVQELKERAKVFAKPIGASYQGILDQLDLVHQAKGRDQIAASFELNKKINDYIAEHPTSGRNQALTQLKEQVTSALGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.55 Angstrom Crystal Structure of the Four Helical Bundle Membrane Localization Domain (4HBM) of the Vibrio vulnificus MARTX Effector Domain DUF5.
rcsb
source organism Vibrio vulnificus
molecule tags Protein binding
molecule keywords Autotransporter adhesin
total genus 32
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4errA00
2VKDA 4DMWA 2VKHA 2VK9A 2BVMA 2BVLA 2VL8A 3SRZA 3SS1A 4ERRA 4DMVA
chains in the Genus database with same CATH superfamily
3PUGA 3PUXF 1XMOT 2MTQA 2V1DB 2DNXA 2LRKA 3FXDB 4UV9B 5FVLA 4DUYT 3AE4A 3OBVE 2AXDS 1FJGT 3PU8A 5JDHA 2VKJA 3NRXA 2X68A 3UQ4A 3AEBA 3E22E 4YSYA 4NXMT 3CX8B 3UTKA 2E5LT 4J2CA 3RQWA 4B3RT 4TUYE 1MMNA 1BR2A 1WYBA 2J4GA 1AJ3A 4KHZF 2LJLA 3TLSA 1HNXT 4X62T 5F5WA 2UXXB 3ZN1B 3B5MA 4YSZA 1EZ3A 5GONE 5FY0A 5AQFB 4EGWA 2FBWA 4XAXB 2XPKA 5C8YE 4Z90A 3LK42 5CA1E 1MMGA 4PJMA 3A5XA 4XZCA 2UUAT 2LOSA 2D9DA 3DP7A 4TV8E 4TWHA 4PW8A 2CPTA 4DR6T 1I94T 2CBJA 4H63V 5AQMB 3L3PA 2YU1A 4PJLA 3GWHA 1ZV4X 2XJ7A 4X1IE 2A72A 5JDFA 4ZI3D 3N5LA 3I9YA 4EZ4A 4LFAT 3ANWB 3ZCIA 4GKJT 1HNZT 2X0LB 4WW0A 4PK5A 1OXZA 3VHLA 1S35A 2FJEA 4DV6T 1US7B 3AB3B 3KV4A 2UXCT 3WAKA 4AKHA 2NTXA 5LOVE 3RIUC 3D0TA 3UU3A 2XM2A 2C5IT 5JH7E 2NW8A 1SA0E 2J47A 2HN1A 5ETWA 5JR9C 2ES0A 5JR9B 4HFCA 4DV2T 1KFYA 1NENA 2IC6A 4QXCB 4U31A 3AEFA 2VKHA 3EABA 3MZKB 1HX1B 2V6YA 3K3NA 4L0RA 2VQET 3AE7A 3UUXB 2QYWA 1N33T 1IBLT 4LF7T 2XSAA 3N9OA 3RI5A 3N9LA 2XHEB 4JEUB 1YKEB 3PUQA 4DR7T 2M67A 3H3AA 2CXFA 3NWIA 4ILCA 4YT0A 1J1JA 3ZCJA 4ANJA 1D0YA 1W0AA 4EZHA 2BS2A 2VB6A 3K1SA 5ABFB 1YQ4A 1MMAA 2JQKA 5J2TE 1UURA 3Q5DA 4X66T 5J0ZA 2YK0A 4PNIA 3HR0A 5H6QB 2B76A 4O4HE 4ADZA 4DV7T 5LYJE 4FJOA 5LBMA 1J5ET 1FMVA 2CEAA 4JUYA 3N9PA 3PJAA 3JAEA 4H9QC 4LMKA 4U3CA 4BAYB 4DMWA 5IUXA 4LFCT 3I0QA 2BKOA 3AVRA 3VR9A 4ZZCA 4AQYT 3ZC0A 2DWGA 5ABGA 2JQQA 3K3OA 4U33A 4QKNA 2NOXA 3Q2MA 1HR0T 2WB5A 1JNZA 2XQ3A 4UXNB 4A56A 2UUCT 1CHUA 2VK9A 3B57A 3Q5XA 3RLFF 2LHNA 2XAFB 4KI0F 3A8YC 3ZLIA 5LJMA 3MA9A 4IHJE 2X9YA 3PUVF 4DR5T 4DR4T 3IHRA 4JI8T 1UUSA 2W67A 3EI0A 4K0KT 2UXNB 5BMVE 2WCAA 3N2KE 4YSXA 4KBMB 2WAUA 5E0OA 4UVAB 4PFPA 5AQHB 4Z91A 2HPJA 4O2BE 4LF8T 2A2FX 3RKGA 5IYZE 1MMDA 1VRBA 4KX6A 3JADA 1ZP0A 2JQHA 4HFBA 3MK7C 4JI3T 5LP6E 2N2NA 5AQQB 2XQ9A 2NP9A 2P9BA 2C5KT 4QH1A 5LG3A 4ZEYA 3QB5A 2RPAA 5LB7B 3RX6A 4HE8A 4UVBB 3UQ7A 2K48A 5LMNT 1YXRA 2CBIA 3SWHA 2XQ4A 3KV9A 4P1NA 1VOMA 4H9RC 3FZLB 4AKIA 4NUUA 5KDMC 2X67A 1FEWA 4O4JE 5HXRA 1WR6A 4XBFB 4YHJA 3O9XA 5FVKA 4LF5T 1FIOA 2D0TA 3PDYA 2VQFT 1N34T 4C90A 4NXNT 3LBXB 2CM0A 5LJNA 3AE6A 3ZKRA 2ZMAA 1U4QA 4YJ3E 2WY2A 4NUVA 3FZHB 1G73A 4ISSA 5HWXA 5LG4A 4DV1T 2I59A 1NAFA 3L8RA 2HPLA 1WR0A 3ONXA 2LKGA 5EK4A 2FJDA 5HAXA 4MBQA 4CQIA 2LHRA 2L3LA 5ABHA 3ANWA 4JI4T 2IHR1 3KBUA 1QSDA 4B3MT 4CI3B 2UXBT 2XSBA 5JDNA 5L2LA 4DNDA 4AKGA 4DBRA 3BK9A 4KUMB 5LNKA 3C98B 2Y48B 2AE9A 5L3BB 4JV5T 4IREA 5AQGB 3QUJA 3RIFA 2M6BA 5AQNB 2XQ5A 3O1HA 3CWZB 3CIRA 5AQUB 5F3JA 3PU3A 2NWBA 5L4HA 2JIWA 2K24A 2CE7A 3P4RA 3MJXA 5EK3A 2MBGA 5FL1A 2L8KA 4DR2T 3AA1B 4U72A 2F4VT 3BQLA 4B3ST 5L3GB 4DR1T 4JBWF 3PE0A 2LSKA 5LA6E 3PURA 4C91A 5BR8T 2A9UA 3WAJA 1V9DA 4QH4A 5FYMA 2LLYA 3RRCA 1D1CA 3ZT6A 2PG8A 3RGLA 2CWYA 5JDQA 2DWKA 3RC3A 4JI1T 4WNKA 4JI6T 4JI7T 1OEDA 1YW0A 2Q9QD 3KV5A 3LJCA 4X65T 3ONLC 2KSRA 3AA6B 1WYCA 4IE6A 2JMKA 2Y8DA 4HN9A 2WZHA 4AKRB 2LOPA 1Y01A 3CKDA 5FXWA 5FY1A 3ONJA 3ZSSA 2W66A 4DV3T 2UXDT 1VCTA 4PFOA 4Q25A 1M62A 2G0UA 3C4ZA 3OYZA 2WBLA 4UV8B 4EYUA 5L47A 4DR3T 2PTFA 4ZI3C 3OVUA 2NTYA 4UF0A 2WZIA 5ADXL 2E5VA 3QB5K 2XQAA 3JC6C 5JR9A 4OHFA 4YTMA 5HCMA 1HG5A 2ODVA 5AQPB 4JI5T 2VURA 3CX7B 4HTEA 3RYIE 4YTPA 4U2ZA 2NR4A 3AEEA 1IJ5A 5DQVA 2Y6XA 2XQ6A 3ZPOA 5HXEA 4HEAA 1IZNB 2BG9E 1O3XA 2BS3A 4UIGA 2E9XC 2E9XB 2N9DA 3G06A 4YJ2E 3FXEB 3FZMB 4IE7A 3BQIA 5L3DB 4E7ZA 2BVMA 3RIUA 3VRBA 3AA7B 3AE1A 3EDUA 3U78A 5LHGB 1MNDA 3HI2A 3ZMVB 2CWOA 2LM9A 3QC9A 4CN1A 5KX5E 3W15B 2FJAA 1HFAA 3BQKA 2XAHB 2LSJA 1LVFA 3AECA 5F8PA 2XQ8A 4X1YE 2FJBA 1UX4A 2LEHA 3MXZA 1LRZA 4H9PC 5LGUB 5LCYA 3JCFA 2X9HA 3TLUA 5JRCA 4AI6A 2L9QA 1JNRA 4HGAA 3AVSA 4HWDA 4CI1B 2LSIA 3TLWA 2YINA 4TNVA 4H9NC 3ZJ1A 2MOZA 2VWAA 2D2SA 3SS1A 2HH7A 5FKYA 3V5UA 4PJNA 2QRXA 4TZ4C 1UGOA 3O4XE 3ZMUB 1HCIA 2DHRA 2H7VC 2IC9A 3O1JA 1N36T 2ZM0A 3DTOA 3L39A 4IDOA 3N9MA 3VU7H 1D0ZA 2CHNA 4DIDB 1XNRT 3ZMTB 3EHZA 3Q5EA 4HKAA 3ZYKA 2D0UA 2HHHT 1HTJF 3ZEFB 3RF1A 2ACZA 1W9RA 4ZHQE 1IAPA 2ZM2A 3K3QC 3P4WA 4LMJA 3VRAA 1KNZA 3ZSTA 3PTRB 5LMUT 1YD8G 2N1GA 1IJ6A 3ZMZB 2V6YB 2MAWA 3MKDA 4QXBB 5CGMA 4UF0B 4IGUA 3GMIA 2WMOA 1OEDE 3I1AA 3N2GE 2LRLA 2PJQA 4HWHA 2LSYA 2KMFA 3GN5B 3PUZF 4GYRA 4AQFA 2ZLYA 4WBNE 1OEDC 1OEDB 2VL0A 3NBXX 1VCSA 1WCRA 5CB4E 4DV5T 5EK2A 4KHPT 3C51A 4QX7B 1HG2A 2EHOD 4WYVA 3GA8A 2PBIA 3T1HT 4M1PA 4EIWA 2J1DG 4YHHT 2K9AA 2LE8A 4NPPA 3ZMSB 2DLRA 2K3WA 5JVDE 4ILBA 4LF4T 2ODUA 3ETUA 1ZKEA 2VKOA 2KT9A 2QA7A 4IDPA 4U7YA 2W63A 5HWYA 4JI2T 1QUUA 5AQRB 5JDLA 4X64T 4F8HA 4GK0E 1T8BA 2VL8A 1XDPA 2WSSV 3RIAA 4X1KE 4ERRA 3VKGA 3CQGB 1E1HB 4L5GA 4IDZA 3VR8A 5CFBA 3EDVA 2XQYA 1BR0A 2A3DA 3X1DA 3PUWF 4DV0T 3NRYA 5JQGE 3T1YT 2K5BB 3OKQA 2IMLA 5HCJA 4CXWA 2H88A 1E2AA 2VVNA 1J5WA 3LK2B 5HEOA 5AQVB 2W62A 1Y64B 4G2AA 5FXXA 4I0UA 4EXTA 5C2TA 3F31A 3RYFE 3HKCE 4EEDA 4BJMA 5JTGA 3ETVA 4AQFC 1ZOYA 4EEBA 2WQYA 3LBXA 1G8XA 3S4UA 3AAIA 4P0AA 2C0SA 2BBJA 3HL6A 3PV0F 2CXDA 4LF9T 4QX8B 2BBHA 4GYSA 4JI0T 4V1Av 1YQ3A 3RYCE 5ABEA 1BR4A 1I6ZA 4MHCA 1LKXA 4IL4A 1QLBA 4L9IA 4UVCB 4O8SA 4WZXA 2IAKA 2V7KA 3AAEB 4Z8XA 5LGTB 2FUPA 3NZQA 2PFVA 4HFDA 1X79A 5J2UE 4ZI7E 4DV4T 2CHOA 3QOFA 2VASA 4MFRA 3ZT7A 3CPZA 2WDRA 3HKEE 2BG9B 2BG9C 2JRKA 3OPCA 4TWDA 4U7IA 2WWUA 5C3JA 4IL9A 1H7CA 4EYYR 3AE5A 3KVAA 2V7JA 1XWMA 4DBQA 3R6NA 2W61A 4UEMA 3AXJA 3HA4A 5KMGP 2KZ7B 4N78D 3PUYF 1KNRA 4BJNA 2LM2A 3AEDA 5AQJB 3UFEA 5L4EA 3ZYLA 3RHWA 3N9QA 5M4YA 3AEAA 3UU5A 4DMVA 1KF6A 2LSGA 1SHZC 2X66A 2UUBT 4IIJE 3OTOT 3CX6B 3J9X1 2KWHA 4X5TA 2WDQA 2WP9A 3FHNA 3P50A 5AQIB 4PK6A 4ZOLE 4AKLA 1OWAA 4U74A 3IEEA 4O4LE 4ZI2C 2RP4A 3M65A 5HEJA 4E7SA 4OYKA 4ZS3A 5AFUL 1MIVA 3UU8A 1U5PA 2CLYC 2CLYB 2CRBA 3SFEA 4HFVA 2EHOB 2EHOC 2Z6EA 4GIWA 3H37A 2XAJB 3C64A 3L09A 3P7IA 3UUMA 3J7Yq 3N9NA 4ASKA 5FMNA 2W2UA 2V6XA 2Q9QA 2JPFA 3KVBA 4EV6A 5L3EB 4OX9T 2YKSA 2BVLA 2UU9T 3V5SA 4HFHA 4ILAA 1WRDA 2HN2A 5AQSB 2XAQB 3AEGA 5LGNB 4QH5A 1KNPA 1XMQT 4IDQA 3FB2A 4KP3C 2I0MA 3EVYA 4CI2B 1WFDA 1FMWA 2W4XA 4P09A 4I43B 2E9XD 2YOEA 2V7MA 4A97A 4LFBT 4ZXLA 4QXHB 4IDNA 3AE3A 4IE5A 3K8PC 5FXVA 2OLTA 2X0HA 5IHYA 4DO0A 5CA0E 2BG9A 3KBTA 4NIQA 3P8CD 5CJ5A 3CVRA 5FL0A 3JC6D 5ABFA 5AQKB 2WDVA 3T8OA 4OFZA 4ZI2D 2H3RA 3VKHA 3WI3A 5AQLB 2IUBA 3GN5A 1WLXA 3DJBA 4MLKA 2CA5A 4TNWA 5DJQC 1HS7A 3QNUA 1MIWA 2WS3A 3I0OA 4CXYA 1D1BA 2BDEA 2WU2A 4X20E 1MNEA 4ZS2A 3KINB 2YDRA 4HWFA 1BR1A 2EHOA 1D0XA 2ACXA 4GKKT 1KEYA 1W0BA 2IW5B 1B7TA 3RPUA 2Q9QB 2I6HA 2JJ9A 2Q9QC 2ZM8A 3SOLA 2BZBA 3RKOA 2DL1A 4DVDA 3ZYMA 1XZYA 2KLQA 2D5UA 3AAAB 3LFMA 1UK5A 4GK5E 3CMLA 2DCFA 5HEHA 1SE7A 2W00A 3RRWA 1X9BA 2WU5A 2XZEA 3FZKB 3U3IA 3A7MA 2ZM6T 2CXLA 2NW9A 4B3TT 2XASB 3SRZA 4COFA 3E0ZA 1E7PA 4H9OC 5AQOB 5L3FB 4EB6E 2BKPA 4PAGA 2YU2A 3KDSE 5EZYE 1NEKA 1D1AA 1XDOA 2V7IA 2QGSA 3Q5WA 3Q9DA 5LBQB 5JRCB 2KNDA 1ZHCA 2CCQA 3F57A 3HKBE 5JDGA 2SPCA 2XQ7A 1HNWT 4JEHB 2KXPB 1UCUA 3R84B 1T72A 4HFEA 3C4XA 1Z8UA 3M3ZB 5A1LA 3RC8A 4ISTA 4IE0A 2B1EA 2KWIB 3CK6A 4I4TE 3AXJB 5KXJA 3AE8A 3LK3B 4FI5A 4TWFA 2V26A 3P4SA 2GK9A 4A5XA 4TV9E 2DI4A 3FZFB 3H3MA 4YFSA 5H6RB 4AXPA 1GQEA 4G63A 4EOZB 2MYSA 3JAFA 3ZT5A 3TLVA 2JMHA 4IE4A 4K0UA 4OK0A 2WWVA 3RQUA 3P4QA 4O2AE 3PUAA 4KMCA 5HXCA 2W0GA 1SUMB 1M7KA 3QK6A 2M6IA 4H9SE 3CQCB 2BKNA 2IDOB 3F2EA 2V5CA 3NVOA 2JQ9A 1KK7A 3ESLA 3IBPA 3LG7A 1Z0PA 4LMLA 2XAGB 3E08A 4TX5A 2E2AA 2XM1A 3KV6A 4H63H 4UELA 5DABA 2YDSA 5FXZA 3UFGA 4AQGA 3AA0B 4CN6A 3AE2A 2OA5A 3O1IA 3NZPA 3UU4A 2J62A 4YTNA 3ZC1A 1IBKT 2C5JA 2MPKA 3C4WA 4HWIB 3KFWX 2YN6A 5AQTB 5J1GA 3UUNA 5FY7A 4F6RC 3LSVA 2CMRA 4JLEA 3RH3A 3HKDE 5HXSA 1YKHB 1CUNA 2OV9A 2R6GF 3OYXA 5TAOA 3PJAJ 3LDQB 3TKLB 4YY3T 4WBOA 1ZEEA 4PJJA 2BS4A 3PUSA 4UR9A 1L0VA 4LF6T 2H7OA 4OYJA 2NW7A 3B13A 5FNVE 1W09A 5JDMA 4TN7B 5HYAA 3RYHE 3EAMA 3NKZA 5HXHA 4I50E 5LXTE 1T7SA 3ABVA 4QHOA 5LHIB 1S94A 4MALA 3AE9A 4EAHA 2QVAA 5IWAT 2WMNA 2IIUA 3UT5E 1IBMT 4YXDA 1T98A 2YEVC 3C50A 3IA3A 3MACA 5HEUA 1LVKA 2XUEA 3UU6A 5LHHB 1N32T 5DQWA 2RA1A 2XY8B 3FBZA 2WM9A 4I55E 3UUBA 2X9XA 3ZJ2A 1XNQT 2V8SV 2KINB 3SFDA 4CN4A 1UX5A 4HFIA 2LKHA 4GOUA 4IT4A 4A98A 2E9XA 4O4IE 3UULA 2E8IA 1HF8A 4HWCA 2VKDA 3TLTA 4CZZB 3EUHA 4AIUA 3IF8B 2V7LA 4ILUA 5HEGA 2VVSA 4U2YA 4CXXA 1R8IA 4DUZT 4JYAT 1DU2A 2YDQA 3I9WA 4B6XA 5L3CB 3P4PA 2X0YA 4AISA 1MIYA 5FP3A 4BA9A 1NWMX 3CQXC 4YLHA 2XTLA 1HX8A 2X51A 5JREA 2V5DA 3N2OA 4QWNB 4ZZBA 2H89A 2LT3A 4PK4A 3OJAA 3FBLA 4P0BA 2X9WA 3ZN0B
chains in the Genus database with same CATH topology
3PUGA 2MTQA 2V1DB 2DNXA 4UV9B 3FXDB 3OBVE 3PU8A 5JDHA 2VKJA 3NRXA 2X68A 3E22E 3CX8B 3UTKA 4J2CA 4TUYE 1MMNA 1BR2A 1WYBA 2LJLA 3ZN1B 2UXXB 1EZ3A 5GONE 5FY0A 4XAXB 5C8YE 3LK42 5CA1E 1MMGA 4PJMA 3A5XA 4XZCA 2LOSA 3DP7A 4TV8E 4PW8A 4H63V 3L3PA 2YU1A 4PJLA 3GWHA 1ZV4X 4X1IE 4ZI3D 2A72A 5JDFA 3N5LA 3I9YA 4EZ4A 3ANWB 3ZCIA 2X0LB 4WW0A 4PK5A 1OXZA 3VHLA 1S35A 4AKHA 1US7B 3AB3B 3KV4A 3WAKA 2NTXA 5LOVE 3D0TA 5JH7E 2C5IT 2NW8A 1SA0E 5JR9C 5JR9B 5ETWA 2ES0A 2IC6A 4QXCB 2VKHA 3MZKB 3K3NA 4L0RA 3UUXB 3N9OA 3N9LA 2XHEB 4JEUB 1YKEB 3PUQA 2M67A 3H3AA 2CXFA 4EZHA 3ZCJA 4ANJA 1D0YA 2VB6A 1MMAA 5J2TE 2YK0A 4PNIA 3HR0A 5H6QB 4O4HE 4ADZA 5LYJE 4FJOA 5LBMA 1FMVA 2CEAA 4JUYA 3N9PA 4H9QC 4BAYB 4DMWA 3I0QA 3AVRA 3ZC0A 2DWGA 2JQQA 3K3OA 4QKNA 2NOXA 3Q2MA 4UXNB 4A56A 2VK9A 3B57A 3Q5XA 2LHNA 2XAFB 3ZLIA 5LJMA 3MA9A 4IHJE 2X9YA 3IHRA 2UXNB 5BMVE 3N2KE 4KBMB 2WAUA 5E0OA 4UVAB 4PFPA 2HPJA 4O2BE 2A2FX 5IYZE 1MMDA 1VRBA 3MK7C 5LP6E 2N2NA 2NP9A 2P9BA 2C5KT 3RX6A 4HE8A 4UVBB 2K48A 3SWHA 3KV9A 1VOMA 4H9RC 4AKIA 4NUUA 5KDMC 2X67A 1FEWA 4O4JE 5HXRA 1WR6A 4YHJA 3O9XA 1FIOA 2D0TA 3PDYA 4C90A 3LBXB 2CM0A 5LJNA 2ZMAA 1U4QA 4YJ3E 4NUVA 1G73A 4ISSA 5HWXA 5LG4A 2I59A 1NAFA 2HPLA 5EK4A 3ONXA 4CQIA 5HAXA 4WBNE 4XBFB 4MBQA 2LHRA 2L3LA 3ANWA 3KBUA 1QSDA 4CI3B 5L2LA 5JDNA 4DNDA 4AKGA 4DBRA 3BK9A 4KUMB 5LNKA 3C98B 2Y48B 5L3BB 3QUJA 3O1HA 3CWZB 5F3JA 3PU3A 2NWBA 2K24A 2CE7A 2MBGA 3MJXA 5EK3A 2L8KA 3AA1B 4U72A 3BQLA 5L3GB 4C91A 3PE0A 2LSKA 5LA6E 3PURA 3WAJA 1V9DA 5FYMA 3RRCA 1D1CA 2PG8A 2CWYA 5JDQA 2DWKA 3RC3A 4WNKA 1YW0A 2Q9QD 3KV5A 3LJCA 3AA6B 1WYCA 4IE6A 2JMKA 2Y8DA 4HN9A 4AKRB 2LOPA 3CKDA 5FXWA 5FY1A 4PFOA 2G0UA 3C4ZA 3OYZA 2WBLA 4UV8B 4EYUA 4ZI3C 2NTYA 4UF0A 5ADXL 3JC6C 5JR9A 4OHFA 1HG5A 2ODVA 3CX7B 3RYIE 4HTEA 5DQVA 1IJ5A 2Y6XA 5HXEA 3ZPOA 4HEAA 1IZNB 4UIGA 1O3XA 2E9XC 2E9XB 2N9DA 4YJ2E 3FXEB 4IE7A 5L3DB 3BQIA 4E7ZA 2BVMA 5LHGB 3AA7B 3EDUA 3U78A 1MNDA 3HI2A 3ZMVB 2CWOA 2LM9A 3QC9A 5KX5E 3W15B 1HFAA 3BQKA 2XAHB 2LSJA 1LVFA 5F8PA 4X1YE 1UX4A 2LEHA 3MXZA 1LRZA 4H9PC 5LGUB 5LCYA 4AI6A 2X9HA 5JRCA 2L9QA 4HGAA 3AVSA 4CI1B 2LSIA 2YINA 4H9NC 3ZJ1A 2MOZA 2VWAA 2D2SA 3SS1A 2HH7A 3V5UA 4PJNA 4TZ4C 3O4XE 3ZMUB 1HCIA 2DHRA 2H7VC 2IC9A 3O1JA 2ZM0A 3DTOA 3N9MA 3VU7H 1D0ZA 3ZMTB 3ZYKA 4HKAA 2D0UA 1HTJF 3ZEFB 4ZHQE 1IAPA 2ZM2A 3K3QC 1KNZA 3PTRB 1YD8G 2N1GA 1IJ6A 3ZMZB 3MKDA 4QXBB 4UF0B 4IGUA 3GMIA 2WMOA 3I1AA 3N2GE 2PJQA 2LSYA 3GN5B 2KMFA 4AQFA 4GYRA 2ZLYA 3NBXX 5CB4E 5EK2A 3C51A 4QX7B 1HG2A 2EHOD 3GA8A 2PBIA 4M1PA 4EIWA 2J1DG 2K9AA 2LE8A 3ZMSB 2DLRA 5JVDE 2ODUA 3ETUA 1ZKEA 2VKOA 2KT9A 2QA7A 5HWYA 2W63A 1QUUA 5JDLA 4GK0E 2VL8A 2WSSV 4X1KE 4ERRA 3CQGB 1E1HB 4L5GA 4IDZA 3EDVA 2XQYA 1BR0A 2A3DA 3NRYA 5JQGE 2K5BB 3OKQA 4CXWA 3LK2B 2W62A 1Y64B 4G2AA 5FXXA 3F31A 3RYFE 3HKCE 4BJMA 3ETVA 4AQFC 3LBXA 1G8XA 3S4UA 3AAIA 4P0AA 2C0SA 3HL6A 2CXDA 4QX8B 4GYSA 4V1Av 3RYCE 1BR4A 4MHCA 1LKXA 4UVCB 4L9IA 4O8SA 2IAKA 2V7KA 3AAEB 4Z8XA 5LGTB 3NZQA 2PFVA 1X79A 5J2UE 4ZI7E 2VASA 4MFRA 3CPZA 3HKEE 2JRKA 2WWUA 1H7CA 4EYYR 3KVAA 2V7JA 4DBQA 3R6NA 2W61A 4UEMA 3HA4A 5KMGP 2KZ7B 4N78D 4BJNA 3UFEA 3ZYLA 3N9QA 5M4YA 4DMVA 2LSGA 1SHZC 2X66A 4IIJE 3CX6B 3J9X1 2KWHA 4AKLA 3FHNA 4PK6A 4ZOLE 1OWAA 4U74A 3IEEA 4O4LE 4ZI2C 2RP4A 3M65A 4E7SA 4OYKA 4ZS3A 5AFUL 1MIVA 1U5PA 2CLYC 2CLYB 4HFVA 2EHOB 2Z6EA 2EHOC 4GIWA 3H37A 2XAJB 3C64A 3L09A 3P7IA 3UUMA 3J7Yq 3N9NA 4ASKA 5FMNA 2Q9QA 2JPFA 3KVBA 5L3EB 2BVLA 3V5SA 1WRDA 5LGNB 2XAQB 3FB2A 4KP3C 3EVYA 4CI2B 1FMWA 4P09A 4I43B 2E9XD 2V7MA 4QXHB 5FXVA 4IE5A 5IHYA 3K8PC 4DO0A 5CA0E 3KBTA 3P8CD 3CVRA 3JC6D 3T8OA 3VKHA 4OFZA 4ZI2D 2H3RA 3WI3A 3GN5A 1WLXA 3DJBA 4MLKA 2CA5A 5DJQC 1HS7A 1MIWA 3I0OA 4CXYA 1D1BA 2BDEA 4X20E 1MNEA 4ZS2A 3KINB 1BR1A 2EHOA 1D0XA 2ACXA 2IW5B 1B7TA 3RPUA 2Q9QB 2Q9QC 2JJ9A 2ZM8A 3SOLA 2BZBA 3RKOA 4DVDA 3ZYMA 2KLQA 2D5UA 3AAAB 3LFMA 4GK5E 3CMLA 2DCFA 2W00A 3RRWA 3U3IA 2CXLA 2NW9A 2XASB 3SRZA 3E0ZA 4H9OC 5L3FB 4EB6E 4PAGA 2YU2A 3KDSE 5EZYE 1D1AA 2V7IA 2QGSA 3Q5WA 3Q9DA 5LBQB 5JRCB 2KNDA 1ZHCA 2CCQA 3F57A 3HKBE 5JDGA 2SPCA 4JEHB 2KXPB 1UCUA 3R84B 5A1LA 3C4XA 1AJ3A 3RC8A 4ISTA 4IE0A 2B1EA 2KWIB 4I4TE 3LK3B 4FI5A 2V26A 2GK9A 4TV9E 2DI4A 4YFSA 5H6RB 4AXPA 4G63A 4EOZB 2MYSA 2JMHA 4IE4A 4K0UA 4OK0A 4O2AE 3PUAA 4KMCA 5HXCA 2W0GA 3QK6A 4H9SE 3CQCB 3F2EA 1KK7A 3ESLA 3IBPA 3LG7A 1Z0PA 4TX5A 2XAGB 3E08A 4UELA 3KV6A 5DABA 5FXZA 4H63H 4EXTA 4AQGA 3AA0B 2OA5A 3O1IA 3NZPA 3ZC1A 2C5JA 3C4WA 5J1GA 3UUNA 3KFWX 5FY7A 4F6RC 2CMRA 4JLEA 3RH3A 3HKDE 5HXSA 1YKHB 1CUNA 5TAOA 3OYXA 3TKLB 4WBOA 1ZEEA 4PJJA 3PUSA 2H7OA 4OYJA 2NW7A 3B13A 5FNVE 5JDMA 4TN7B 5HYAA 3RYHE 5HXHA 4I50E 5LXTE 4QHOA 5LHIB 1S94A 4MALA 4EAHA 2WMNA 3UT5E 1T98A 2YEVC 3C50A 5LHHB 3MACA 2XUEA 1LVKA 5DQWA 2RA1A 3ZJ2A 3FBZA 2WM9A 4I55E 2X9XA 2KINB 1UX5A 4GOUA 2E9XA 4O4IE 3UULA 2E8IA 1HF8A 2VKDA 4CZZB 3EUHA 3IF8B 2V7LA 4ILUA 4CXXA 3VKGA 3I9WA 4B6XA 5L3CB 1MIYA 5FP3A 4BA9A 1NWMX 3CQXC 4YLHA 2XTLA 1HX8A 2X51A 5JREA 3N2OA 4QWNB 2LT3A 4PK4A 3OJAA 3FBLA 4P0BA 2X9WA 3ZN0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VKD A;  4DMW A;  2VKH A;  2VK9 A;  2BVM A;  2BVL A;  2VL8 A;  3SRZ A;  3SS1 A;  4ERR A;  4DMV A; 
#chains in the Genus database with same CATH topology
 3PUG A;  3PUX F;  1XMO T;  2MTQ A;  2V1D B;  2DNX A;  2LRK A;  3FXD B;  4UV9 B;  5FVL A;  4DUY T;  3AE4 A;  3OBV E;  2AXD S;  1FJG T;  3PU8 A;  5JDH A;  2VKJ A;  3NRX A;  2X68 A;  3UQ4 A;  3AEB A;  3E22 E;  4YSY A;  4NXM T;  3CX8 B;  3UTK A;  2E5L T;  4J2C A;  3RQW A;  4B3R T;  4TUY E;  1MMN A;  1BR2 A;  1WYB A;  2J4G A;  1AJ3 A;  4KHZ F;  2LJL A;  3TLS A;  1HNX T;  4X62 T;  5F5W A;  2UXX B;  3ZN1 B;  3B5M A;  4YSZ A;  1EZ3 A;  5GON E;  5FY0 A;  5AQF B;  4EGW A;  2FBW A;  4XAX B;  2XPK A;  5C8Y E;  4Z90 A;  3LK4 2;  5CA1 E;  1MMG A;  4PJM A;  3A5X A;  4XZC A;  2UUA T;  2LOS A;  2D9D A;  3DP7 A;  4TV8 E;  4TWH A;  4PW8 A;  2CPT A;  4DR6 T;  1I94 T;  2CBJ A;  4H63 V;  5AQM B;  3L3P A;  2YU1 A;  4PJL A;  3GWH A;  1ZV4 X;  2XJ7 A;  4X1I E;  2A72 A;  5JDF A;  4ZI3 D;  3N5L A;  3I9Y A;  4EZ4 A;  4LFA T;  3ANW B;  3ZCI A;  4GKJ T;  1HNZ T;  2X0L B;  4WW0 A;  4PK5 A;  1OXZ A;  3VHL A;  1S35 A;  2FJE A;  4DV6 T;  1US7 B;  3AB3 B;  3KV4 A;  2UXC T;  3WAK A;  4AKH A;  2NTX A;  5LOV E;  3RIU C;  3D0T A;  3UU3 A;  2XM2 A;  2C5I T;  5JH7 E;  2NW8 A;  1SA0 E;  2J47 A;  2HN1 A;  5ETW A;  5JR9 C;  2ES0 A;  5JR9 B;  4HFC A;  4DV2 T;  1KFY A;  1NEN A;  2IC6 A;  4QXC B;  4U31 A;  3AEF A;  2VKH A;  3EAB A;  3MZK B;  1HX1 B;  2V6Y A;  3K3N A;  4L0R A;  2VQE T;  3AE7 A;  3UUX B;  2QYW A;  1N33 T;  1IBL T;  4LF7 T;  2XSA A;  3N9O A;  3RI5 A;  3N9L A;  2XHE B;  4JEU B;  1YKE B;  3PUQ A;  4DR7 T;  2M67 A;  3H3A A;  2CXF A;  3NWI A;  4ILC A;  4YT0 A;  1J1J A;  3ZCJ A;  4ANJ A;  1D0Y A;  1W0A A;  4EZH A;  2BS2 A;  2VB6 A;  3K1S A;  5ABF B;  1YQ4 A;  1MMA A;  2JQK A;  5J2T E;  1UUR A;  3Q5D A;  4X66 T;  5J0Z A;  2YK0 A;  4PNI A;  3HR0 A;  5H6Q B;  2B76 A;  4O4H E;  4ADZ A;  4DV7 T;  5LYJ E;  4FJO A;  5LBM A;  1J5E T;  1FMV A;  2CEA A;  4JUY A;  3N9P A;  3PJA A;  3JAE A;  4H9Q C;  4LMK A;  4U3C A;  4BAY B;  4DMW A;  5IUX A;  4LFC T;  3I0Q A;  2BKO A;  3AVR A;  3VR9 A;  4ZZC A;  4AQY T;  3ZC0 A;  2DWG A;  5ABG A;  2JQQ A;  3K3O A;  4U33 A;  4QKN A;  2NOX A;  3Q2M A;  1HR0 T;  2WB5 A;  1JNZ A;  2XQ3 A;  4UXN B;  4A56 A;  2UUC T;  1CHU A;  2VK9 A;  3B57 A;  3Q5X A;  3RLF F;  2LHN A;  2XAF B;  4KI0 F;  3A8Y C;  3ZLI A;  5LJM A;  3MA9 A;  4IHJ E;  2X9Y A;  3PUV F;  4DR5 T;  4DR4 T;  3IHR A;  4JI8 T;  1UUS A;  2W67 A;  3EI0 A;  4K0K T;  2UXN B;  5BMV E;  2WCA A;  3N2K E;  4YSX A;  4KBM B;  2WAU A;  5E0O A;  4UVA B;  4PFP A;  5AQH B;  4Z91 A;  2HPJ A;  4O2B E;  4LF8 T;  2A2F X;  3RKG A;  5IYZ E;  1MMD A;  1VRB A;  4KX6 A;  3JAD A;  1ZP0 A;  2JQH A;  4HFB A;  3MK7 C;  4JI3 T;  5LP6 E;  2N2N A;  5AQQ B;  2XQ9 A;  2NP9 A;  2P9B A;  2C5K T;  4QH1 A;  5LG3 A;  4ZEY A;  3QB5 A;  2RPA A;  5LB7 B;  3RX6 A;  4HE8 A;  4UVB B;  3UQ7 A;  2K48 A;  5LMN T;  1YXR A;  2CBI A;  3SWH A;  2XQ4 A;  3KV9 A;  4P1N A;  1VOM A;  4H9R C;  3FZL B;  4AKI A;  4NUU A;  5KDM C;  2X67 A;  1FEW A;  4O4J E;  5HXR A;  1WR6 A;  4XBF B;  4YHJ A;  3O9X A;  5FVK A;  4LF5 T;  1FIO A;  2D0T A;  3PDY A;  2VQF T;  1N34 T;  4C90 A;  4NXN T;  3LBX B;  2CM0 A;  5LJN A;  3AE6 A;  3ZKR A;  2ZMA A;  1U4Q A;  4YJ3 E;  2WY2 A;  4NUV A;  3FZH B;  1G73 A;  4ISS A;  5HWX A;  5LG4 A;  4DV1 T;  2I59 A;  1NAF A;  3L8R A;  2HPL A;  1WR0 A;  3ONX A;  2LKG A;  5EK4 A;  2FJD A;  5HAX A;  4MBQ A;  4CQI A;  2LHR A;  2L3L A;  5ABH A;  3ANW A;  4JI4 T;  2IHR 1;  3KBU A;  1QSD A;  4B3M T;  4CI3 B;  2UXB T;  2XSB A;  5JDN A;  5L2L A;  4DND A;  4AKG A;  4DBR A;  3BK9 A;  4KUM B;  5LNK A;  3C98 B;  2Y48 B;  2AE9 A;  5L3B B;  4JV5 T;  4IRE A;  5AQG B;  3QUJ A;  3RIF A;  2M6B A;  5AQN B;  2XQ5 A;  3O1H A;  3CWZ B;  3CIR A;  5AQU B;  5F3J A;  3PU3 A;  2NWB A;  5L4H A;  2JIW A;  2K24 A;  2CE7 A;  3P4R A;  3MJX A;  5EK3 A;  2MBG A;  5FL1 A;  2L8K A;  4DR2 T;  3AA1 B;  4U72 A;  2F4V T;  3BQL A;  4B3S T;  5L3G B;  4DR1 T;  4JBW F;  3PE0 A;  2LSK A;  5LA6 E;  3PUR A;  4C91 A;  5BR8 T;  2A9U A;  3WAJ A;  1V9D A;  4QH4 A;  5FYM A;  2LLY A;  3RRC A;  1D1C A;  3ZT6 A;  2PG8 A;  3RGL A;  2CWY A;  5JDQ A;  2DWK A;  3RC3 A;  4JI1 T;  4WNK A;  4JI6 T;  4JI7 T;  1OED A;  1YW0 A;  2Q9Q D;  3KV5 A;  3LJC A;  4X65 T;  3ONL C;  2KSR A;  3AA6 B;  1WYC A;  4IE6 A;  2JMK A;  2Y8D A;  4HN9 A;  2WZH A;  4AKR B;  2LOP A;  1Y01 A;  3CKD A;  5FXW A;  5FY1 A;  3ONJ A;  3ZSS A;  2W66 A;  4DV3 T;  2UXD T;  1VCT A;  4PFO A;  4Q25 A;  1M62 A;  2G0U A;  3C4Z A;  3OYZ A;  2WBL A;  4UV8 B;  4EYU A;  5L47 A;  4DR3 T;  2PTF A;  4ZI3 C;  3OVU A;  2NTY A;  4UF0 A;  2WZI A;  5ADX L;  2E5V A;  3QB5 K;  2XQA A;  3JC6 C;  5JR9 A;  4OHF A;  4YTM A;  5HCM A;  1HG5 A;  2ODV A;  5AQP B;  4JI5 T;  2VUR A;  3CX7 B;  4HTE A;  3RYI E;  4YTP A;  4U2Z A;  2NR4 A;  3AEE A;  1IJ5 A;  5DQV A;  2Y6X A;  2XQ6 A;  3ZPO A;  5HXE A;  4HEA A;  1IZN B;  2BG9 E;  1O3X A;  2BS3 A;  4UIG A;  2E9X C;  2E9X B;  2N9D A;  3G06 A;  4YJ2 E;  3FXE B;  3FZM B;  4IE7 A;  3BQI A;  5L3D B;  4E7Z A;  2BVM A;  3RIU A;  3VRB A;  3AA7 B;  3AE1 A;  3EDU A;  3U78 A;  5LHG B;  1MND A;  3HI2 A;  3ZMV B;  2CWO A;  2LM9 A;  3QC9 A;  4CN1 A;  5KX5 E;  3W15 B;  2FJA A;  1HFA A;  3BQK A;  2XAH B;  2LSJ A;  1LVF A;  3AEC A;  5F8P A;  2XQ8 A;  4X1Y E;  2FJB A;  1UX4 A;  2LEH A;  3MXZ A;  1LRZ A;  4H9P C;  5LGU B;  5LCY A;  3JCF A;  2X9H A;  3TLU A;  5JRC A;  4AI6 A;  2L9Q A;  1JNR A;  4HGA A;  3AVS A;  4HWD A;  4CI1 B;  2LSI A;  3TLW A;  2YIN A;  4TNV A;  4H9N C;  3ZJ1 A;  2MOZ A;  2VWA A;  2D2S A;  3SS1 A;  2HH7 A;  5FKY A;  3V5U A;  4PJN A;  2QRX A;  4TZ4 C;  1UGO A;  3O4X E;  3ZMU B;  1HCI A;  2DHR A;  2H7V C;  2IC9 A;  3O1J A;  1N36 T;  2ZM0 A;  3DTO A;  3L39 A;  4IDO A;  3N9M A;  3VU7 H;  1D0Z A;  2CHN A;  4DID B;  1XNR T;  3ZMT B;  3EHZ A;  3Q5E A;  4HKA A;  3ZYK A;  2D0U A;  2HHH T;  1HTJ F;  3ZEF B;  3RF1 A;  2ACZ A;  1W9R A;  4ZHQ E;  1IAP A;  2ZM2 A;  3K3Q C;  3P4W A;  4LMJ A;  3VRA A;  1KNZ A;  3ZST A;  3PTR B;  5LMU T;  1YD8 G;  2N1G A;  1IJ6 A;  3ZMZ B;  2V6Y B;  2MAW A;  3MKD A;  4QXB B;  5CGM A;  4UF0 B;  4IGU A;  3GMI A;  2WMO A;  1OED E;  3I1A A;  3N2G E;  2LRL A;  2PJQ A;  4HWH A;  2LSY A;  2KMF A;  3GN5 B;  3PUZ F;  4GYR A;  4AQF A;  2ZLY A;  4WBN E;  1OED C;  1OED B;  2VL0 A;  3NBX X;  1VCS A;  1WCR A;  5CB4 E;  4DV5 T;  5EK2 A;  4KHP T;  3C51 A;  4QX7 B;  1HG2 A;  2EHO D;  4WYV A;  3GA8 A;  2PBI A;  3T1H T;  4M1P A;  4EIW A;  2J1D G;  4YHH T;  2K9A A;  2LE8 A;  4NPP A;  3ZMS B;  2DLR A;  2K3W A;  5JVD E;  4ILB A;  4LF4 T;  2ODU A;  3ETU A;  1ZKE A;  2VKO A;  2KT9 A;  2QA7 A;  4IDP A;  4U7Y A;  2W63 A;  5HWY A;  4JI2 T;  1QUU A;  5AQR B;  5JDL A;  4X64 T;  4F8H A;  4GK0 E;  1T8B A;  2VL8 A;  1XDP A;  2WSS V;  3RIA A;  4X1K E;  4ERR A;  3VKG A;  3CQG B;  1E1H B;  4L5G A;  4IDZ A;  3VR8 A;  5CFB A;  3EDV A;  2XQY A;  1BR0 A;  2A3D A;  3X1D A;  3PUW F;  4DV0 T;  3NRY A;  5JQG E;  3T1Y T;  2K5B B;  3OKQ A;  2IML A;  5HCJ A;  4CXW A;  2H88 A;  1E2A A;  2VVN A;  1J5W A;  3LK2 B;  5HEO A;  5AQV B;  2W62 A;  1Y64 B;  4G2A A;  5FXX A;  4I0U A;  4EXT A;  5C2T A;  3F31 A;  3RYF E;  3HKC E;  4EED A;  4BJM A;  5JTG A;  3ETV A;  4AQF C;  1ZOY A;  4EEB A;  2WQY A;  3LBX A;  1G8X A;  3S4U A;  3AAI A;  4P0A A;  2C0S A;  2BBJ A;  3HL6 A;  3PV0 F;  2CXD A;  4LF9 T;  4QX8 B;  2BBH A;  4GYS A;  4JI0 T;  4V1A v;  1YQ3 A;  3RYC E;  5ABE A;  1BR4 A;  1I6Z A;  4MHC A;  1LKX A;  4IL4 A;  1QLB A;  4L9I A;  4UVC B;  4O8S A;  4WZX A;  2IAK A;  2V7K A;  3AAE B;  4Z8X A;  5LGT B;  2FUP A;  3NZQ A;  2PFV A;  4HFD A;  1X79 A;  5J2U E;  4ZI7 E;  4DV4 T;  2CHO A;  3QOF A;  2VAS A;  4MFR A;  3ZT7 A;  3CPZ A;  2WDR A;  3HKE E;  2BG9 B;  2BG9 C;  2JRK A;  3OPC A;  4TWD A;  4U7I A;  2WWU A;  5C3J A;  4IL9 A;  1H7C A;  4EYY R;  3AE5 A;  3KVA A;  2V7J A;  1XWM A;  4DBQ A;  3R6N A;  2W61 A;  4UEM A;  3AXJ A;  3HA4 A;  5KMG P;  2KZ7 B;  4N78 D;  3PUY F;  1KNR A;  4BJN A;  2LM2 A;  3AED A;  5AQJ B;  3UFE A;  5L4E A;  3ZYL A;  3RHW A;  3N9Q A;  5M4Y A;  3AEA A;  3UU5 A;  4DMV A;  1KF6 A;  2LSG A;  1SHZ C;  2X66 A;  2UUB T;  4IIJ E;  3OTO T;  3CX6 B;  3J9X 1;  2KWH A;  4X5T A;  2WDQ A;  2WP9 A;  3FHN A;  3P50 A;  5AQI B;  4PK6 A;  4ZOL E;  4AKL A;  1OWA A;  4U74 A;  3IEE A;  4O4L E;  4ZI2 C;  2RP4 A;  3M65 A;  5HEJ A;  4E7S A;  4OYK A;  4ZS3 A;  5AFU L;  1MIV A;  3UU8 A;  1U5P A;  2CLY C;  2CLY B;  2CRB A;  3SFE A;  4HFV A;  2EHO B;  2EHO C;  2Z6E A;  4GIW A;  3H37 A;  2XAJ B;  3C64 A;  3L09 A;  3P7I A;  3UUM A;  3J7Y q;  3N9N A;  4ASK A;  5FMN A;  2W2U A;  2V6X A;  2Q9Q A;  2JPF A;  3KVB A;  4EV6 A;  5L3E B;  4OX9 T;  2YKS A;  2BVL A;  2UU9 T;  3V5S A;  4HFH A;  4ILA A;  1WRD A;  2HN2 A;  5AQS B;  2XAQ B;  3AEG A;  5LGN B;  4QH5 A;  1KNP A;  1XMQ T;  4IDQ A;  3FB2 A;  4KP3 C;  2I0M A;  3EVY A;  4CI2 B;  1WFD A;  1FMW A;  2W4X A;  4P09 A;  4I43 B;  2E9X D;  2YOE A;  2V7M A;  4A97 A;  4LFB T;  4ZXL A;  4QXH B;  4IDN A;  3AE3 A;  4IE5 A;  3K8P C;  5FXV A;  2OLT A;  2X0H A;  5IHY A;  4DO0 A;  5CA0 E;  2BG9 A;  3KBT A;  4NIQ A;  3P8C D;  5CJ5 A;  3CVR A;  5FL0 A;  3JC6 D;  5ABF A;  5AQK B;  2WDV A;  3T8O A;  4OFZ A;  4ZI2 D;  2H3R A;  3VKH A;  3WI3 A;  5AQL B;  2IUB A;  3GN5 A;  1WLX A;  3DJB A;  4MLK A;  2CA5 A;  4TNW A;  5DJQ C;  1HS7 A;  3QNU A;  1MIW A;  2WS3 A;  3I0O A;  4CXY A;  1D1B A;  2BDE A;  2WU2 A;  4X20 E;  1MNE A;  4ZS2 A;  3KIN B;  2YDR A;  4HWF A;  1BR1 A;  2EHO A;  1D0X A;  2ACX A;  4GKK T;  1KEY A;  1W0B A;  2IW5 B;  1B7T A;  3RPU A;  2Q9Q B;  2I6H A;  2JJ9 A;  2Q9Q C;  2ZM8 A;  3SOL A;  2BZB A;  3RKO A;  2DL1 A;  4DVD A;  3ZYM A;  1XZY A;  2KLQ A;  2D5U A;  3AAA B;  3LFM A;  1UK5 A;  4GK5 E;  3CML A;  2DCF A;  5HEH A;  1SE7 A;  2W00 A;  3RRW A;  1X9B A;  2WU5 A;  2XZE A;  3FZK B;  3U3I A;  3A7M A;  2ZM6 T;  2CXL A;  2NW9 A;  4B3T T;  2XAS B;  3SRZ A;  4COF A;  3E0Z A;  1E7P A;  4H9O C;  5AQO B;  5L3F B;  4EB6 E;  2BKP A;  4PAG A;  2YU2 A;  3KDS E;  5EZY E;  1NEK A;  1D1A A;  1XDO A;  2V7I A;  2QGS A;  3Q5W A;  3Q9D A;  5LBQ B;  5JRC B;  2KND A;  1ZHC A;  2CCQ A;  3F57 A;  3HKB E;  5JDG A;  2SPC A;  2XQ7 A;  1HNW T;  4JEH B;  2KXP B;  1UCU A;  3R84 B;  1T72 A;  4HFE A;  3C4X A;  1Z8U A;  3M3Z B;  5A1L A;  3RC8 A;  4IST A;  4IE0 A;  2B1E A;  2KWI B;  3CK6 A;  4I4T E;  3AXJ B;  5KXJ A;  3AE8 A;  3LK3 B;  4FI5 A;  4TWF A;  2V26 A;  3P4S A;  2GK9 A;  4A5X A;  4TV9 E;  2DI4 A;  3FZF B;  3H3M A;  4YFS A;  5H6R B;  4AXP A;  1GQE A;  4G63 A;  4EOZ B;  2MYS A;  3JAF A;  3ZT5 A;  3TLV A;  2JMH A;  4IE4 A;  4K0U A;  4OK0 A;  2WWV A;  3RQU A;  3P4Q A;  4O2A E;  3PUA A;  4KMC A;  5HXC A;  2W0G A;  1SUM B;  1M7K A;  3QK6 A;  2M6I A;  4H9S E;  3CQC B;  2BKN A;  2IDO B;  3F2E A;  2V5C A;  3NVO A;  2JQ9 A;  1KK7 A;  3ESL A;  3IBP A;  3LG7 A;  1Z0P A;  4LML A;  2XAG B;  3E08 A;  4TX5 A;  2E2A A;  2XM1 A;  3KV6 A;  4H63 H;  4UEL A;  5DAB A;  2YDS A;  5FXZ A;  3UFG A;  4AQG A;  3AA0 B;  4CN6 A;  3AE2 A;  2OA5 A;  3O1I A;  3NZP A;  3UU4 A;  2J62 A;  4YTN A;  3ZC1 A;  1IBK T;  2C5J A;  2MPK A;  3C4W A;  4HWI B;  3KFW X;  2YN6 A;  5AQT B;  5J1G A;  3UUN A;  5FY7 A;  4F6R C;  3LSV A;  2CMR A;  4JLE A;  3RH3 A;  3HKD E;  5HXS A;  1YKH B;  1CUN A;  2OV9 A;  2R6G F;  3OYX A;  5TAO A;  3PJA J;  3LDQ B;  3TKL B;  4YY3 T;  4WBO A;  1ZEE A;  4PJJ A;  2BS4 A;  3PUS A;  4UR9 A;  1L0V A;  4LF6 T;  2H7O A;  4OYJ A;  2NW7 A;  3B13 A;  5FNV E;  1W09 A;  5JDM A;  4TN7 B;  5HYA A;  3RYH E;  3EAM A;  3NKZ A;  5HXH A;  4I50 E;  5LXT E;  1T7S A;  3ABV A;  4QHO A;  5LHI B;  1S94 A;  4MAL A;  3AE9 A;  4EAH A;  2QVA A;  5IWA T;  2WMN A;  2IIU A;  3UT5 E;  1IBM T;  4YXD A;  1T98 A;  2YEV C;  3C50 A;  3IA3 A;  3MAC A;  5HEU A;  1LVK A;  2XUE A;  3UU6 A;  5LHH B;  1N32 T;  5DQW A;  2RA1 A;  2XY8 B;  3FBZ A;  2WM9 A;  4I55 E;  3UUB A;  2X9X A;  3ZJ2 A;  1XNQ T;  2V8S V;  2KIN B;  3SFD A;  4CN4 A;  1UX5 A;  4HFI A;  2LKH A;  4GOU A;  4IT4 A;  4A98 A;  2E9X A;  4O4I E;  3UUL A;  2E8I A;  1HF8 A;  4HWC A;  2VKD A;  3TLT A;  4CZZ B;  3EUH A;  4AIU A;  3IF8 B;  2V7L A;  4ILU A;  5HEG A;  2VVS A;  4U2Y A;  4CXX A;  1R8I A;  4DUZ T;  4JYA T;  1DU2 A;  2YDQ A;  3I9W A;  4B6X A;  5L3C B;  3P4P A;  2X0Y A;  4AIS A;  1MIY A;  5FP3 A;  4BA9 A;  1NWM X;  3CQX C;  4YLH A;  2XTL A;  1HX8 A;  2X51 A;  5JRE A;  2V5D A;  3N2O A;  4QWN B;  4ZZB A;  2H89 A;  2LT3 A;  4PK4 A;  3OJA A;  3FBL A;  4P0B A;  2X9W A;  3ZN0 B; 
#chains in the Genus database with same CATH homology
 3PUG A;  2MTQ A;  2V1D B;  2DNX A;  4UV9 B;  3FXD B;  3OBV E;  3PU8 A;  5JDH A;  2VKJ A;  3NRX A;  2X68 A;  3E22 E;  3CX8 B;  3UTK A;  4J2C A;  4TUY E;  1MMN A;  1BR2 A;  1WYB A;  2LJL A;  3ZN1 B;  2UXX B;  1EZ3 A;  5GON E;  5FY0 A;  4XAX B;  5C8Y E;  3LK4 2;  5CA1 E;  1MMG A;  4PJM A;  3A5X A;  4XZC A;  2LOS A;  3DP7 A;  4TV8 E;  4PW8 A;  4H63 V;  3L3P A;  2YU1 A;  4PJL A;  3GWH A;  1ZV4 X;  4X1I E;  4ZI3 D;  2A72 A;  5JDF A;  3N5L A;  3I9Y A;  4EZ4 A;  3ANW B;  3ZCI A;  2X0L B;  4WW0 A;  4PK5 A;  1OXZ A;  3VHL A;  1S35 A;  4AKH A;  1US7 B;  3AB3 B;  3KV4 A;  3WAK A;  2NTX A;  5LOV E;  3D0T A;  5JH7 E;  2C5I T;  2NW8 A;  1SA0 E;  5JR9 C;  5JR9 B;  5ETW A;  2ES0 A;  2IC6 A;  4QXC B;  2VKH A;  3MZK B;  3K3N A;  4L0R A;  3UUX B;  3N9O A;  3N9L A;  2XHE B;  4JEU B;  1YKE B;  3PUQ A;  2M67 A;  3H3A A;  2CXF A;  4EZH A;  3ZCJ A;  4ANJ A;  1D0Y A;  2VB6 A;  1MMA A;  5J2T E;  2YK0 A;  4PNI A;  3HR0 A;  5H6Q B;  4O4H E;  4ADZ A;  5LYJ E;  4FJO A;  5LBM A;  1FMV A;  2CEA A;  4JUY A;  3N9P A;  4H9Q C;  4BAY B;  4DMW A;  3I0Q A;  3AVR A;  3ZC0 A;  2DWG A;  2JQQ A;  3K3O A;  4QKN A;  2NOX A;  3Q2M A;  4UXN B;  4A56 A;  2VK9 A;  3B57 A;  3Q5X A;  2LHN A;  2XAF B;  3ZLI A;  5LJM A;  3MA9 A;  4IHJ E;  2X9Y A;  3IHR A;  2UXN B;  5BMV E;  3N2K E;  4KBM B;  2WAU A;  5E0O A;  4UVA B;  4PFP A;  2HPJ A;  4O2B E;  2A2F X;  5IYZ E;  1MMD A;  1VRB A;  3MK7 C;  5LP6 E;  2N2N A;  2NP9 A;  2P9B A;  2C5K T;  3RX6 A;  4HE8 A;  4UVB B;  2K48 A;  3SWH A;  3KV9 A;  1VOM A;  4H9R C;  4AKI A;  4NUU A;  5KDM C;  2X67 A;  1FEW A;  4O4J E;  5HXR A;  1WR6 A;  4YHJ A;  3O9X A;  1FIO A;  2D0T A;  3PDY A;  4C90 A;  3LBX B;  2CM0 A;  5LJN A;  2ZMA A;  1U4Q A;  4YJ3 E;  4NUV A;  1G73 A;  4ISS A;  5HWX A;  5LG4 A;  2I59 A;  1NAF A;  2HPL A;  5EK4 A;  3ONX A;  4CQI A;  5HAX A;  4WBN E;  4XBF B;  4MBQ A;  2LHR A;  2L3L A;  3ANW A;  3KBU A;  1QSD A;  4CI3 B;  5L2L A;  5JDN A;  4DND A;  4AKG A;  4DBR A;  3BK9 A;  4KUM B;  5LNK A;  3C98 B;  2Y48 B;  5L3B B;  3QUJ A;  3O1H A;  3CWZ B;  5F3J A;  3PU3 A;  2NWB A;  2K24 A;  2CE7 A;  2MBG A;  3MJX A;  5EK3 A;  2L8K A;  3AA1 B;  4U72 A;  3BQL A;  5L3G B;  4C91 A;  3PE0 A;  2LSK A;  5LA6 E;  3PUR A;  3WAJ A;  1V9D A;  5FYM A;  3RRC A;  1D1C A;  2PG8 A;  2CWY A;  5JDQ A;  2DWK A;  3RC3 A;  4WNK A;  1YW0 A;  2Q9Q D;  3KV5 A;  3LJC A;  3AA6 B;  1WYC A;  4IE6 A;  2JMK A;  2Y8D A;  4HN9 A;  4AKR B;  2LOP A;  3CKD A;  5FXW A;  5FY1 A;  4PFO A;  2G0U A;  3C4Z A;  3OYZ A;  2WBL A;  4UV8 B;  4EYU A;  4ZI3 C;  2NTY A;  4UF0 A;  5ADX L;  3JC6 C;  5JR9 A;  4OHF A;  1HG5 A;  2ODV A;  3CX7 B;  3RYI E;  4HTE A;  5DQV A;  1IJ5 A;  2Y6X A;  5HXE A;  3ZPO A;  4HEA A;  1IZN B;  4UIG A;  1O3X A;  2E9X C;  2E9X B;  2N9D A;  4YJ2 E;  3FXE B;  4IE7 A;  5L3D B;  3BQI A;  4E7Z A;  2BVM A;  5LHG B;  3AA7 B;  3EDU A;  3U78 A;  1MND A;  3HI2 A;  3ZMV B;  2CWO A;  2LM9 A;  3QC9 A;  5KX5 E;  3W15 B;  1HFA A;  3BQK A;  2XAH B;  2LSJ A;  1LVF A;  5F8P A;  4X1Y E;  1UX4 A;  2LEH A;  3MXZ A;  1LRZ A;  4H9P C;  5LGU B;  5LCY A;  4AI6 A;  2X9H A;  5JRC A;  2L9Q A;  4HGA A;  3AVS A;  4CI1 B;  2LSI A;  2YIN A;  4H9N C;  3ZJ1 A;  2MOZ A;  2VWA A;  2D2S A;  3SS1 A;  2HH7 A;  3V5U A;  4PJN A;  4TZ4 C;  3O4X E;  3ZMU B;  1HCI A;  2DHR A;  2H7V C;  2IC9 A;  3O1J A;  2ZM0 A;  3DTO A;  3N9M A;  3VU7 H;  1D0Z A;  3ZMT B;  3ZYK A;  4HKA A;  2D0U A;  1HTJ F;  3ZEF B;  4ZHQ E;  1IAP A;  2ZM2 A;  3K3Q C;  1KNZ A;  3PTR B;  1YD8 G;  2N1G A;  1IJ6 A;  3ZMZ B;  3MKD A;  4QXB B;  4UF0 B;  4IGU A;  3GMI A;  2WMO A;  3I1A A;  3N2G E;  2PJQ A;  2LSY A;  3GN5 B;  2KMF A;  4AQF A;  4GYR A;  2ZLY A;  3NBX X;  5CB4 E;  5EK2 A;  3C51 A;  4QX7 B;  1HG2 A;  2EHO D;  3GA8 A;  2PBI A;  4M1P A;  4EIW A;  2J1D G;  2K9A A;  2LE8 A;  3ZMS B;  2DLR A;  5JVD E;  2ODU A;  3ETU A;  1ZKE A;  2VKO A;  2KT9 A;  2QA7 A;  5HWY A;  2W63 A;  1QUU A;  5JDL A;  4GK0 E;  2VL8 A;  2WSS V;  4X1K E;  4ERR A;  3CQG B;  1E1H B;  4L5G A;  4IDZ A;  3EDV A;  2XQY A;  1BR0 A;  2A3D A;  3NRY A;  5JQG E;  2K5B B;  3OKQ A;  4CXW A;  3LK2 B;  2W62 A;  1Y64 B;  4G2A A;  5FXX A;  3F31 A;  3RYF E;  3HKC E;  4BJM A;  3ETV A;  4AQF C;  3LBX A;  1G8X A;  3S4U A;  3AAI A;  4P0A A;  2C0S A;  3HL6 A;  2CXD A;  4QX8 B;  4GYS A;  4V1A v;  3RYC E;  1BR4 A;  4MHC A;  1LKX A;  4UVC B;  4L9I A;  4O8S A;  2IAK A;  2V7K A;  3AAE B;  4Z8X A;  5LGT B;  3NZQ A;  2PFV A;  1X79 A;  5J2U E;  4ZI7 E;  2VAS A;  4MFR A;  3CPZ A;  3HKE E;  2JRK A;  2WWU A;  1H7C A;  4EYY R;  3KVA A;  2V7J A;  4DBQ A;  3R6N A;  2W61 A;  4UEM A;  3HA4 A;  5KMG P;  2KZ7 B;  4N78 D;  4BJN A;  3UFE A;  3ZYL A;  3N9Q A;  5M4Y A;  4DMV A;  2LSG A;  1SHZ C;  2X66 A;  4IIJ E;  3CX6 B;  3J9X 1;  2KWH A;  4AKL A;  3FHN A;  4PK6 A;  4ZOL E;  1OWA A;  4U74 A;  3IEE A;  4O4L E;  4ZI2 C;  2RP4 A;  3M65 A;  4E7S A;  4OYK A;  4ZS3 A;  5AFU L;  1MIV A;  1U5P A;  2CLY C;  2CLY B;  4HFV A;  2EHO B;  2Z6E A;  2EHO C;  4GIW A;  3H37 A;  2XAJ B;  3C64 A;  3L09 A;  3P7I A;  3UUM A;  3J7Y q;  3N9N A;  4ASK A;  5FMN A;  2Q9Q A;  2JPF A;  3KVB A;  5L3E B;  2BVL A;  3V5S A;  1WRD A;  5LGN B;  2XAQ B;  3FB2 A;  4KP3 C;  3EVY A;  4CI2 B;  1FMW A;  4P09 A;  4I43 B;  2E9X D;  2V7M A;  4QXH B;  5FXV A;  4IE5 A;  5IHY A;  3K8P C;  4DO0 A;  5CA0 E;  3KBT A;  3P8C D;  3CVR A;  3JC6 D;  3T8O A;  3VKH A;  4OFZ A;  4ZI2 D;  2H3R A;  3WI3 A;  3GN5 A;  1WLX A;  3DJB A;  4MLK A;  2CA5 A;  5DJQ C;  1HS7 A;  1MIW A;  3I0O A;  4CXY A;  1D1B A;  2BDE A;  4X20 E;  1MNE A;  4ZS2 A;  3KIN B;  1BR1 A;  2EHO A;  1D0X A;  2ACX A;  2IW5 B;  1B7T A;  3RPU A;  2Q9Q B;  2Q9Q C;  2JJ9 A;  2ZM8 A;  3SOL A;  2BZB A;  3RKO A;  4DVD A;  3ZYM A;  2KLQ A;  2D5U A;  3AAA B;  3LFM A;  4GK5 E;  3CML A;  2DCF A;  2W00 A;  3RRW A;  3U3I A;  2CXL A;  2NW9 A;  2XAS B;  3SRZ A;  3E0Z A;  4H9O C;  5L3F B;  4EB6 E;  4PAG A;  2YU2 A;  3KDS E;  5EZY E;  1D1A A;  2V7I A;  2QGS A;  3Q5W A;  3Q9D A;  5LBQ B;  5JRC B;  2KND A;  1ZHC A;  2CCQ A;  3F57 A;  3HKB E;  5JDG A;  2SPC A;  4JEH B;  2KXP B;  1UCU A;  3R84 B;  5A1L A;  3C4X A;  1AJ3 A;  3RC8 A;  4IST A;  4IE0 A;  2B1E A;  2KWI B;  4I4T E;  3LK3 B;  4FI5 A;  2V26 A;  2GK9 A;  4TV9 E;  2DI4 A;  4YFS A;  5H6R B;  4AXP A;  4G63 A;  4EOZ B;  2MYS A;  2JMH A;  4IE4 A;  4K0U A;  4OK0 A;  4O2A E;  3PUA A;  4KMC A;  5HXC A;  2W0G A;  3QK6 A;  4H9S E;  3CQC B;  3F2E A;  1KK7 A;  3ESL A;  3IBP A;  3LG7 A;  1Z0P A;  4TX5 A;  2XAG B;  3E08 A;  4UEL A;  3KV6 A;  5DAB A;  5FXZ A;  4H63 H;  4EXT A;  4AQG A;  3AA0 B;  2OA5 A;  3O1I A;  3NZP A;  3ZC1 A;  2C5J A;  3C4W A;  5J1G A;  3UUN A;  3KFW X;  5FY7 A;  4F6R C;  2CMR A;  4JLE A;  3RH3 A;  3HKD E;  5HXS A;  1YKH B;  1CUN A;  5TAO A;  3OYX A;  3TKL B;  4WBO A;  1ZEE A;  4PJJ A;  3PUS A;  2H7O A;  4OYJ A;  2NW7 A;  3B13 A;  5FNV E;  5JDM A;  4TN7 B;  5HYA A;  3RYH E;  5HXH A;  4I50 E;  5LXT E;  4QHO A;  5LHI B;  1S94 A;  4MAL A;  4EAH A;  2WMN A;  3UT5 E;  1T98 A;  2YEV C;  3C50 A;  5LHH B;  3MAC A;  2XUE A;  1LVK A;  5DQW A;  2RA1 A;  3ZJ2 A;  3FBZ A;  2WM9 A;  4I55 E;  2X9X A;  2KIN B;  1UX5 A;  4GOU A;  2E9X A;  4O4I E;  3UUL A;  2E8I A;  1HF8 A;  2VKD A;  4CZZ B;  3EUH A;  3IF8 B;  2V7L A;  4ILU A;  4CXX A;  3VKG A;  3I9W A;  4B6X A;  5L3C B;  1MIY A;  5FP3 A;  4BA9 A;  1NWM X;  3CQX C;  4YLH A;  2XTL A;  1HX8 A;  2X51 A;  5JRE A;  3N2O A;  4QWN B;  2LT3 A;  4PK4 A;  3OJA A;  3FBL A;  4P0B A;  2X9W A;  3ZN0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...