4ERRA

1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
GQIFTVQELKERAKVFAKPIGASYQGILDQLDLVHQAKGRDQIAASFELNKKINDYIAEHPTSGRNQALTQLKEQVTSALGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autotransporter adhesin
publication title 1.55 Angstrom Crystal Structure of the Four Helical Bundle Membrane Localization Domain (4HBM) of the Vibrio vulnificus MARTX Effector Domain DUF5.
rcsb
source organism Vibrio vulnificus
molecule tags Protein binding
total genus 32
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4errA00
4DMVA 3SS1A 2VL8A 2VKDA 3SRZA 2BVLA 4DMWA 4ERRA 2VKHA 2BVMA 2VK9A
chains in the Genus database with same CATH superfamily
4DV0T 3PUSA 1J5ET 5L2LA 4DR6T 5LNKA 3P4SA 2NOXA 4QH1A 3T1HT 2JQHA 2K9AA 4LF4T 5AQTB 2VKHA 4DUZT 3QUJA 3I9WA 3Q5EA 2BG9C 4ISSA 2Y48B 3N2KE 2XAGB 4QXCB 4JBWF 2DLRA 4E7ZA 2JJ9A 4PW8A 2CXDA 4UEMA 3MA9A 2WDRA 4WNKA 3AE1A 4FJOA 4C91A 2PTFA 2XQ8A 3IF8B 4DV6T 1D0YA 2C0SA 2KMFA 2IMLA 4ERRA 5LJMA 2HPJA 1WFDA 2QRXA 3AAIA 4HFCA 3A8YC 5LG4A 4H9RC 4DR2T 2V8SV 3AA7B 5FL0A 3ZC0A 3RC3A 2XQ7A 4IDPA 3EAMA 1MNEA 3KFWX 5AQLB 5HEUA 5L4HA 4KUMB 4EEBA 2LJLA 1NENA 2LSYA 4WBOA 4AKGA 2JQ9A 4I50E 2PG8A 3LBXB 3C4XA 3ZT7A 3ZCIA 2D5UA 4KX6A 2RP4A 2ZM8A 1X79A 3RYIE 4YTMA 3HKBE 4X66T 3HA4A 4U3CA 4IT4A 3V5UA 3JC6D 4EXTA 5L3CB 2E5VA 3MXZA 5HXRA 4FI5A 2LHNA 5ABEA 4EAHA 3AVSA 3CQGB 4Q25A 4ISTA 3F2EA 5J2TE 4AQFC 2H89A 4UVAB 5JDGA 5HEJA 3OYZA 3CX6B 4HFHA 3LK3B 2BG9B 3IEEA 5TAOA 1IBKT 4IGUA 4P1NA 5IHYA 4CZZB 3OPCA 4IL4A 3I0QA 3PUYF 4TZ4C 5AQFB 1UGOA 3I1AA 4JEUB 1D0ZA 4CQIA 2XTLA 3K3NA 2XSBA 4TWDA 3QB5A 5CGMA 5F5WA 2CE7A 3UUBA 1J1JA 1W0BA 4HFEA 3RX6A 2V26A 3OTOT 2LSKA 4HWCA 1S94A 3NRYA 4KP3C 5FXZA 3C64A 2HH7A 2YN6A 1OXZA 4ZI3D 4JI8T 4U72A 3UUXB 3P4WA 2XQ4A 2ZLYA 5JRCB 5HXEA 4A5XA 3RF1A 4DV7T 1E2AA 4F8HA 2WY2A 4L0RA 3FXEB 1O3XA 3N5LA 4TV9E 3SWHA 2LM9A 1DU2A 2KINB 3EI0A 4QHOA 1X9BA 2X67A 2E2AA 3RQUA 2X68A 4A56A 2CXFA 3OVUA 3ZMTB 3UULA 4G2AA 4Z91A 3RGLA 1T7SA 3P4QA 3HI2A 3MZKB 3FB2A 3CWZB 4MHCA 2ACZA 3NZQA 2UXDT 2EHOD 3AE2A 2I0MA 4AI6A 1KNPA 3G06A 5AQGB 2IC9A 2ODVA 2X51A 3T1YT 3I0OA 3QNUA 5LGUB 2NW7A 5BR8T 4O4IE 3WAJA 3SFEA 2HHHT 2WM9A 3AEDA 5FL1A 4OK0A 2E8IA 5HCJA 1KF6A 2V5CA 2AXDS 3VKGA 4BJMA 5FYMA 4IL9A 3MACA 3ZJ2A 3PUAA 4NUVA 5ETWA 2HN2A 1KFYA 3F57A 4QX7B 4U74A 2C5IT 3CVRA 3VRBA 4U7YA 3AEEA 2E9XD 4QX8B 4JI7T 1U5PA 5HXCA 3N2GE 2X9YA 3CK6A 2VL8A 4ZEYA 4NXMT 4AQYT 3GMIA 4EB6E 5HWXA 5JDLA 1N34T 2XZEA 1UX5A 3TLUA 1IAPA 1OEDA 4EYUA 3UT5E 4H63V 4LFBT 2LHRA 2IUBA 1YW0A 3KINB 4X1YE 4U31A 2XUEA 3ESLA 3AEGA 2UXBT 1V9DA 4PK5A 3NVOA 3OYXA 4DMWA 2CHNA 4KMCA 3UU6A 2YU2A 1ZHCA 3AE6A 1T8BA 4LMJA 4WBNE 4HFDA 2LOSA 4TN7B 1MIYA 2V1DB 5EK2A 2J1DG 2W2UA 2ZM0A 2B1EA 3Q5DA 2M6IA 4DV5T 5EK3A 2YOEA 5ADXL 2LOPA 4QXBB 3GWHA 2H3RA 2XQ3A 2IDOB 2YDRA 3N9OA 4CI1B 2XM2A 4C90A 3FXDB 4X64T 1T72A 4EIWA 1ZOYA 5LBMA 5HXHA 4GYSA 2CEAA 5ABFA 4O2AE 3JAFA 1T98A 2NR4A 2FJEA 3K1SA 2N9DA 1SA0E 4WYVA 2CXLA 3BQKA 2CA5A 2W62A 1IBMT 2VB6A 4HTEA 1QSDA 1OWAA 4TWHA 3UUNA 1QUUA 4CXWA 2LRLA 4K0UA 4B3RT 3E08A 4QXHB 4K0KT 1R8IA 5LB7B 3ZN0B 3ANWB 3PJAJ 4COFA 3L3PA 1E1HB 2YDQA 1HG2A 5JR9B 3L09A 5A1LA 4H63H 1Z0PA 2YKSA 3ZMUB 4JI4T 5HXSA 3J9X1 4I55E 3JADA 2WB5A 1MMGA 5AQKB 4O2BE 2NW8A 3AE9A 4MFRA 3RKOA 3ZMVB 4TNVA 2WWVA 2W0GA 5CB4E 4IDZA 3DP7A 2CWOA 2I59A 3FBLA 1KK7A 3AA1B 2KT9A 2LM2A 4DR7T 2LSGA 1YQ3A 3IA3A 3AE4A 4CN1A 4HFIA 5L4EA 2NW9A 3RQWA 3RKGA 2J62A 5F3JA 4ZI3C 5IUXA 2MYSA 3AEAA 2OA5A 4ILBA 3UQ7A 1YQ4A 5FMNA 4HWIB 1N33T 3SFDA 2M6BA 4X5TA 4ANJA 2CBIA 2XPKA 2OLTA 2WAUA 3K3QC 4IDQA 2YK0A 3PE0A 2PJQA 1FJGT 3Q5XA 2LRKA 4PK6A 2X9WA 3NZPA 4HN9A 5HWYA 5FVKA 2K3WA 3DTOA 4DBQA 3N9MA 4Z8XA 2VKDA 2X9HA 2WU2A 1YD8G 2A9UA 2Y6XA 3AA0B 5EK4A 2YINA 4U2ZA 4YFSA 4HWDA 1H7CA 3O9XA 2L8KA 2NTXA 3R84B 1WCRA 1ZKEA 2XAHB 2D2SA 3RC8A 1HX1B 3H3AA 3F31A 2XSAA 3AAEB 2CM0A 5L47A 4ASKA 4M1PA 2IW5B 2WMOA 4EZHA 1BR1A 4B3MT 5CFBA 3CQXC 3P8CD 4JI3T 1XMQT 3OKQA 4JV5T 4DV3T 2UUAT 1Y01A 2VK9A 5FNVE 3KVBA 4NPPA 4ZZBA 4DIDB 4UV8B 4DNDA 5DJQC 2PBIA 3MK7C 4YHJA 5FKYA 2M67A 4H9SE 3K8PC 1OEDE 2DL1A 2DI4A 2SPCA 2CRBA 3LDQB 5FXXA 1W09A 1MMNA 2KZ7B 4YTNA 5HYAA 5CA0E 4YJ3E 4MLKA 4HGAA 1M7KA 3PDYA 5LMUT 3ONXA 2XQYA 2KSRA 2A2FX 4IE6A 1MIVA 4ZHQE 2KWHA 5LOVE 4AKRB 4U7IA 1HNXT 5J1GA 2WS3A 3HL6A 4QWNB 4GYRA 2UXNB 5C8YE 1G8XA 3JAEA 2WBLA 3AXJB 4IREA 3AEBA 2VWAA 3CMLA 5LJNA 5LGTB 2JIWA 5BMVE 5AQRB 2ZMAA 1I94T 3CQCB 4IE5A 1ZEEA 4QKNA 4O4HE 3VRAA 3ZYLA 2L3LA 3AE5A 4P0AA 4P0BA 3E22E 5H6QB 3BK9A 2LSIA 5LHHB 3ZPOA 3LFMA 2XQAA 4IE4A 5AQPB 4NUUA 5AQNB 2JMKA 1YXRA 4PJNA 2MPKA 4HWHA 1HG5A 3CIRA 3EABA 3UU5A 2FUPA 3N9PA 1LKXA 2V7LA 2H7VC 2FJBA 2Q9QD 2YDSA 2ZM2A 3SRZA 2MOZA 3ZC1A 3IBPA 3MKDA 2C5JA 3PUXF 2RPAA 4UXNB 3RYHE 4EEDA 2LKGA 3UQ4A 2KWIB 1HF8A 4TWFA 3FHNA 1SUMB 2DNXA 3UU3A 5FVLA 3UU8A 3FZHB 1B7TA 3RIAA 2IHR1 2Q9QA 5DABA 2V6YB 3PTRB 3FZLB 3ONJA 4IE7A 3WAKA 4LF7T 2BVLA 2V7IA 3JCFA 3AEFA 2CMRA 5LBQB 4V1Av 2H7OA 2D0UA 4LF5T 4F6RC 4I43B 2ACXA 1J5WA 5AQSB 3O1IA 4PJMA 1HX8A 3KV6A 2RA1A 3PUQA 4UV9B 3FZKB 3M65A 3EDUA 2DWKA 4X20E 3UU4A 2P9BA 5ABFB 5AQQB 4EV6A 3TLTA 3HKCE 2XJ7A 5LYJE 3O4XE 2JPFA 1KEYA 3AE8A 4UF0B 2EHOA 5F8PA 3D0TA 3L39A 4I0UA 2K5BB 1LRZA 2LKHA 2PFVA 2BS4A 5LMNT 3RRCA 5L3DB 2DHRA 5LA6E 1NWMX 2VASA 2Z6EA 4PNIA 3X1DA 4O8SA 4YHHT 4UVCB 5AQMB 4A97A 2MBGA 1SE7A 4O4JE 4JI2T 2E5LT 3A5XA 3SOLA 3KVAA 2WWUA 2UXCT 3LSVA 2X9XA 4OHFA 2E9XA 3Q5WA 4ILAA 4JYAT 1IJ5A 4A98A 3RPUA 4HWFA 2KLQA 4G63A 4PJLA 4GK5E 3QC9A 2KXPB 2XM1A 1KNRA 4B3TT 1WLXA 5L3FB 3GN5B 3WI3A 4DV4T 5HEGA 4ZXLA 1IBLT 2A3DA 3ZMZB 4U33A 4CI3B 3C4ZA 4H9QC 1XDPA 2QA7A 4NXNT 1HCIA 4DV1T 4YJ2E 4MBQA 1E7PA 2VKOA 4UR9A 4EYYR 4DR4T 3PJAA 2W66A 4I4TE 5H6RB 3UUMA 1Y64B 3IHRA 4ILCA 4AISA 4OYJA 5JVDE 3H37A 3P4PA 4YSXA 3JC6C 2VVSA 2XHEB 2UUBT 3RRWA 3QB5K 3Q2MA 4WZXA 4XAXB 4EGWA 3N9NA 3KV9A 3B57A 1N32T 1W9RA 4YLHA 1XWMA 3CKDA 2QYWA 4IDNA 5JDNA 2QGSA 4CXYA 2BBHA 2YU1A 3I9YA 2JMHA 5HAXA 3GA8A 4H9OC 3MJXA 2WZIA 3EDVA 3EUHA 4DMVA 3B5MA 1XNQT 1SHZC 3ZYMA 4UIGA 2LLYA 3PU8A 5IWAT 5HEOA 2BVMA 4HFVA 4BA9A 2B76A 5KXJA 3ABVA 1BR4A 3DJBA 2Y8DA 3ZCJA 4ZI2D 4YY3T 5HCMA 2ZM6T 2VQET 4ZS3A 3C50A 5J2UE 3VU7H 4EOZB 2CLYC 3RI5A 5AQUB 3OJAA 4WW0A 1S35A 2XY8B 2Q9QC 1YKHB 4L9IA 2FBWA 4IIJE 2V7JA 3UTKA 2WMNA 4AIUA 5L3GB 1YKEB 2VKJA 4B6XA 4GKJT 5FY7A 5GONE 2XAFB 4ZS2A 3EHZA 3P7IA 3KV5A 3RH3A 2WZHA 2V6XA 4JUYA 1CHUA 3QOFA 5KMGP 3UFEA 2K24A 4B3ST 4HE8A 5M4YA 1ZV4X 3C4WA 1LVFA 2WP9A 2BKPA 2WDVA 3TLVA 3N2OA 4HFBA 2EHOC 4LFCT 2IAKA 3VHLA 2XASB 4OX9T 3B13A 4TNWA 1U4QA 2BG9E 4AKIA 3A7MA 2XAJB 1US7B 3ANWA 1BR0A 4AXPA 3QK6A 4AQGA 2UU9T 2J4GA 5JQGE 1HR0T 3ZSTA 3RHWA 1WYCA 4CN4A 1OEDC 2W67A 1IZNB 5JREA 5FXVA 4UELA 3ZT5A 3FBZA 4IDOA 5JR9A 2F4VT 1HFAA 3NWIA 3TLWA 4DR3T 2G0UA 1VOMA 2BS2A 2E9XC 2CHOA 1N36T 5C3JA 2XAQB 2CLYB 1HNWT 3VKHA 3UFGA 1XDOA 5AQOB 3KV4A 3ZSSA 4EZ4A 5E0OA 1QLBA 2Q9QB 3LK42 4CI2B 4LF9T 2HPLA 3U3IA 5JDHA 1MMDA 2A72A 4U2YA 2FJAA 1D0XA 5L3EB 4OYKA 1MMAA 1FMWA 3SS1A 3PURA 3CX8B 5AQHB 3CX7B 3P4RA 3C98B 5JDMA 2W4XA 4X1IE 2LT3A 5CJ5A 2LEHA 3ONLC 4DUYT 3N9LA 3HKDE 5LG3A 2EHOB 3RYFE 4MALA 2IC6A 4DR1T 4H9PC 2CPTA 2KNDA 4PJJA 3AE3A 3V5SA 2K48A 3ZT6A 2DCFA 3LJCA 3NKZA 1JNZA 2CCQA 2OV9A 2FJDA 3CPZA 3RIUA 5KX5E 1JNRA 1ZP0A 4JEHB 1UCUA 3FZMB 2W63A 2UUCT 1WR6A 3AECA 1OEDB 5DQWA 2V5DA 1UUSA 3PUVF 5AQJB 4LF8T 2UXXB 2R6GF 4N78D 2E9XB 2HN1A 4L5GA 1HNZT 3OBVE 3W15B 1IJ6A 3C51A 3L8RA 5ABGA 5DQVA 3ZN1B 3R6NA 3H3MA 4UVBB 2WQYA 3ZYKA 3LBXA 2J47A 1KNZA 2VQFT 3KDSE 4XBFB 2WSSV 3FZFB 3E0ZA 5JDQA 1XZYA 4LFAT 2JQKA 2VVNA 5FY0A 2MTQA 4JI6T 3M3ZB 2CWYA 3NRXA 1NAFA 3P50A 4ZI2C 1FIOA 4PFOA 4YXDA 4JI1T 3TLSA 1UK5A 4GKKT 5LP6E 4QH5A 3BQIA 5L3BB 5LHGB 1FMVA 1HTJF 2BKNA 4GIWA 2BG9A 2XQ6A 2BKOA 1D1CA 3AXJA 4GK0E 3VR8A 3K3OA 2W00A 1I6ZA 4AKHA 3AE7A 4DVDA 1WRDA 2L9QA 2NWBA 4O4LE 5JTGA 1UURA 2N1GA 1D1BA 4KI0F 2H88A 3AVRA 1VRBA 5J0ZA 2X0LB 3ZLIA 5EZYE 3ZMSB 2XQ9A 2NP9A 4YSYA 4GOUA 4TV8E 4PAGA 3AB3B 2JQQA 3PUGA 1BR2A 4ILUA 1XMOT 1NEKA 3T8OA 2X0HA 2VL0A 3RYCE 1VCTA 1MNDA 3KBUA 1EZ3A 5JRCA 1FEWA 4BAYB 4IHJE 5JR9C 4KBMB 4X62T 3Q9DA 3RIFA 3BQLA 4CXXA 1WR0A 1MIWA 4E7SA 3VR9A 5HEHA 5C2TA 2WCAA 2WU5A 2BS3A 5LGNB 4X65T 5AQVB 4JLEA 4DBRA 1WYBA 2X66A 4CN6A 1AJ3A 4JI5T 3O1HA 2X0YA 2YEVC 1HS7A 5IYZE 2V6YA 4TUYE 1G73A 4LMLA 2LSJA 4AQFA 5FP3A 4Z90A 2BDEA 4YT0A 3ZKRA 4LF6T 3EVYA 2BZBA 4AKLA 4IE0A 1D1AA 3PU3A 1CUNA 4ADZA 5LHIB 1XNRT 3NBXX 3N9QA 2I6HA 5AFUL 3ZEFB 2DWGA 4H9NC 5LCYA 5AQIB 4ZOLE 3U78A 4OFZA 1VCSA 5FXWA 2W61A 1LVKA 4LMKA 4DR5T 4PFPA 3ETUA 2AE9A 4UF0A 5ABHA 3HR0A 2XQ5A 3S4UA 2WDQA 3LK2B 5JH7E 4ZI7E 3ETVA 2NTYA 2ODUA 1M62A 2MAWA 4PK4A 4J2CA 5LXTE 4KHZF 3RIUC 2JRKA 3PUZF 4DV2T 2GK9A 5KDMC 2VURA 2QVAA 1Z8UA 4YTPA 3RLFF 2ES0A 1GQEA 3PV0F 2IIUA 2C5KT 2V7MA 4HKAA 3KBTA 5FY1A 5JDFA 3AA6B 2CBJA 4YSZA 4KHPT 2N2NA 4BJNA 3J7Yq 3LG7A 2V7KA 2D9DA 4JI0T 4TX5A 2BBJA 4QH4A 4NIQA 3O1JA 1UX4A 1L0VA 3ZJ1A 3HKEE 1W0AA 2D0TA 3TKLB 4DO0A 5CA1E 3GN5A 4P09A 4ZZCA 2LE8A 4HEAA 3PUWF 4X1KE 3AAAB 4XZCA
chains in the Genus database with same CATH topology
3C98B 5JDMA 4C90A 3O1IA 3PUSA 4X1IE 4PJMA 3FXDB 2LT3A 1HX8A 3KV6A 4EIWA 5L2LA 2RA1A 2LEHA 3PUQA 5LBMA 4UV9B 3M65A 5LNKA 3EDUA 5HXHA 2DWKA 4GYSA 2NOXA 4X20E 2CEAA 2P9BA 3N9LA 4O2AE 2K9AA 3HKCE 5LYJE 3O4XE 1T98A 3HKDE 2JPFA 2VKHA 3QUJA 4UF0B 2EHOB 3I9WA 2EHOA 2N9DA 4MALA 3RYFE 2IC6A 1SA0E 5F8PA 3D0TA 4ISSA 4H9PC 2CXLA 3BQKA 2K5BB 2CA5A 2W62A 1LRZA 2PFVA 2VB6A 2Y48B 2KNDA 3N2KE 4HTEA 4PJJA 3V5SA 2XAGB 4QXCB 2K48A 1QSDA 1OWAA 3UUNA 3RRCA 1QUUA 2DCFA 2DLRA 3LJCA 5L3DB 4E7ZA 2JJ9A 4PW8A 4CXWA 2CXDA 2DHRA 2CCQA 4UEMA 4K0UA 5LA6E 1NWMX 2VASA 3CPZA 3MA9A 2Z6EA 4WNKA 5KX5E 4PNIA 4FJOA 4C91A 3E08A 4QXHB 4O8SA 3IF8B 3ZN0B 3ANWB 4JEHB 1D0YA 2C0SA 2KMFA 1UCUA 4UVCB 2MBGA 4ERRA 5LJMA 4O4JE 2HPJA 2W63A 3L3PA 1E1HB 1WR6A 5DQWA 3AAIA 3A5XA 3SOLA 3KVAA 5LG4A 2WWUA 4H9RC 1HG2A 5JR9B 3L09A 5A1LA 2X9XA 4H63H 2UXXB 1Z0PA 3AA7B 3ZC0A 4N78D 3ZMUB 4OHFA 2E9XB 2E9XA 3RC3A 5HXSA 4L5GA 3Q5WA 3OBVE 3J9X1 3W15B 1MNEA 3KFWX 4I55E 1IJ5A 1IJ6A 3C51A 3RPUA 5DQVA 1MMGA 4O2BE 3ZN1B 4KUMB 2NW8A 4MFRA 3R6NA 2KLQA 2LJLA 3RKOA 4G63A 4PJLA 2LSYA 3ZMVB 4GK5E 4WBOA 4AKGA 2W0GA 5CB4E 3QC9A 4IDZA 3DP7A 2CWOA 2I59A 3FBLA 4UVBB 1KK7A 3AA1B 2KXPB 4I50E 2KT9A 3ZYKA 2PG8A 3LBXB 2LSGA 3LBXA 3C4XA 1KNZA 3ZCIA 2D5UA 3KDSE 4XBFB 2RP4A 2WSSV 1WLXA 5L3FB 3E0ZA 2ZM8A 1X79A 3GN5B 3RYIE 5JDQA 3HKBE 2NW9A 3WI3A 3HA4A 3V5UA 3JC6D 4EXTA 5L3CB 2A3DA 5F3JA 5FY0A 3MXZA 4ZI3C 3ZMZB 2MTQA 2MYSA 3C4ZA 4CI3B 5HXRA 2CWYA 2OA5A 4H9QC 4FI5A 2LHNA 2QA7A 3NRXA 1HCIA 4EAHA 3AVSA 3CQGB 1NAFA 4YJ2E 4MBQA 4ISTA 4ZI2C 3F2EA 5J2TE 5FMNA 2VKOA 1FIOA 4AQFC 4EYYR 4PFOA 4ANJA 4UVAB 4I4TE 5JDGA 5LP6E 2WAUA 3BQIA 5L3BB 3OYZA 3CX6B 5LHGB 3K3QC 5H6RB 1FMVA 3UUMA 1Y64B 3IHRA 2YK0A 4OYJA 5JVDE 3PE0A 3H37A 2PJQA 3LK3B 1HTJF 4GIWA 3IEEA 5TAOA 1D1CA 3Q5XA 3JC6C 4PK6A 4GK0E 2X9WA 4IGUA 2XHEB 5IHYA 4CZZB 3NZPA 4HN9A 3K3OA 2W00A 5HWYA 4AKHA 3RRWA 3DTOA 4DVDA 3Q2MA 1WRDA 2L9QA 3I0QA 4DBQA 4TZ4C 3N9MA 4Z8XA 2VKDA 2NWBA 4O4LE 4XAXB 3I1AA 2X9HA 1YD8G 3N9NA 2N1GA 4JEUB 3KV9A 1D0ZA 2Y6XA 3AA0B 2YINA 5EK4A 3B57A 1D1BA 4CQIA 2XTLA 3K3NA 4YFSA 4YLHA 1H7CA 3O9XA 2L8KA 3AVRA 3CKDA 1VRBA 2NTXA 3R84B 5JDNA 1ZKEA 2QGSA 2XAHB 2CE7A 2X0LB 2D2SA 4CXYA 3ZLIA 3RC8A 2YU1A 5EZYE 3ZMSB 3H3AA 3F31A 3RX6A 3I9YA 2JMHA 2V26A 3AAEB 5HAXA 2CM0A 2NP9A 2LSKA 4GOUA 4TV8E 1S94A 3GA8A 3NRYA 4H9OC 4ASKA 4PAGA 3AB3B 4M1PA 2JQQA 3MJXA 2IW5B 4KP3C 3PUGA 3EDVA 2WMOA 4EZHA 3EUHA 1BR2A 1BR1A 4DMVA 4ILUA 3CQXC 5FXZA 3C64A 3P8CD 3T8OA 2HH7A 1OXZA 3OKQA 1SHZC 3ZYMA 4UIGA 3RYCE 4ZI3D 4U72A 3UUXB 3PU8A 2BVMA 2VK9A 4HFVA 4BA9A 5FNVE 2ZLYA 1MNDA 3KBUA 1EZ3A 5JRCB 5JRCA 3KVBA 1FEWA 1BR4A 3DJBA 2Y8DA 4IHJE 4BAYB 5JR9C 4KBMB 3ZCJA 5HXEA 4UV8B 4ZI2D 4DNDA 5DJQC 3Q9DA 2PBIA 3MK7C 3BQLA 4YHJA 4CXXA 4L0RA 2M67A 4H9SE 1MIWA 3K8PC 4E7SA 4ZS3A 3FXEB 1O3XA 3N5LA 4TV9E 3SWHA 2DI4A 2LM9A 2SPCA 3C50A 5J2UE 2KINB 4QHOA 3VU7H 5LGNB 4EOZB 5FXXA 1MMNA 2KZ7B 2X67A 4JLEA 4DBRA 5CA0E 5HYAA 4YJ3E 4MLKA 2CLYC 1WYBA 2X66A 4HGAA 3OJAA 1AJ3A 2X68A 3PDYA 3O1HA 4A56A 2CXFA 3ZMTB 3UULA 4G2AA 2YEVC 4WW0A 1S35A 3ONXA 2XQYA 2A2FX 4IE6A 2Q9QC 1YKHB 4L9IA 1MIVA 4IIJE 1HS7A 2V7JA 3HI2A 5IYZE 2WMNA 3UTKA 4TUYE 3MZKB 1G73A 3FB2A 5L3GB 1YKEB 3CWZB 4ZHQE 2VKJA 2KWHA 2LSJA 4B6XA 5LOVE 4AKRB 4MHCA 4AQFA 5FP3A 5FY7A 5GONE 2BDEA 2XAFB 3NZQA 5J1GA 2EHOD 3HL6A 3EVYA 4ZS2A 2BZBA 3KV5A 3P7IA 4QWNB 4IE0A 3RH3A 4AKLA 4GYRA 1D1AA 3PU3A 2UXNB 4AI6A 5C8YE 1CUNA 4JUYA 1G8XA 4ADZA 5LHIB 2IC9A 2WBLA 3NBXX 3N9QA 5KMGP 2ODVA 5AFUL 3UFEA 2K24A 2X51A 3ZEFB 2DWGA 4HE8A 5M4YA 3I0OA 1ZV4X 2VWAA 4H9NC 3CMLA 5LJNA 5LGUB 5LGTB 5LCYA 3U78A 4ZOLE 3C4WA 2NW7A 4OFZA 5BMVE 1LVFA 2ZMAA 4O4IE 5FXWA 3CQCB 3WAJA 4IE5A 2W61A 1ZEEA 4QKNA 4O4HE 2WM9A 1LVKA 3N2OA 4OK0A 2E8IA 4PFPA 3ZYLA 3ETUA 4UF0A 2EHOC 3VKGA 4BJMA 5FYMA 3HR0A 3S4UA 2L3LA 4P0AA 2IAKA 3LK2B 4P0BA 3MACA 3ZJ2A 3PUAA 3VHLA 2XASB 3E22E 5H6QB 3BK9A 3B13A 5JH7E 4NUVA 5ETWA 4ZI7E 3ETVA 2LSIA 2NTYA 3F57A 5LHHB 4QX7B 4U74A 2ODUA 2C5IT 3ZPOA 3LFMA 3CVRA 4IE4A 1U4QA 4NUUA 4PK4A 2JMKA 4J2CA 5LXTE 4AKIA 4PJNA 2E9XD 4QX8B 2JRKA 1U5PA 1HG5A 5HXCA 3N2GE 2XAJB 2GK9A 2X9YA 5KDMC 1US7B 2VL8A 3N9PA 3ANWA 1BR0A 1LKXA 3GMIA 2V7LA 4AXPA 4EB6E 5HWXA 3QK6A 4AQGA 5JDLA 2H7VC 5JQGE 2ES0A 1UX5A 1WYCA 1IAPA 2C5KT 2V7MA 4EYUA 2Q9QD 1IZNB 4HKAA 3UT5E 3KBTA 4H63V 5FY1A 5JDFA 5JREA 5FXVA 2ZM2A 3SRZA 4UELA 2MOZA 3ZC1A 2LHRA 3AA6B 3IBPA 1YW0A 3FBZA 3KINB 3MKDA 5JR9A 4X1YE 1HFAA 2XUEA 3ESLA 2C5JA 4UXNB 1V9DA 3RYHE 2N2NA 2G0UA 4PK5A 1VOMA 2E9XC 2KWIB 3OYXA 4DMWA 1HF8A 4BJNA 2XAQB 3FHNA 4KMCA 3LG7A 3J7Yq 2V7KA 2DNXA 2YU2A 2CLYB 3VKHA 1ZHCA 4TX5A 1B7TA 4WBNE 2LOSA 3KV4A 4TN7B 4EZ4A 3O1JA 5E0OA 1MIYA 2V1DB 2Q9QB 2Q9QA 5EK2A 1UX4A 3LK42 4CI2B 5DABA 2J1DG 3ZJ1A 3HKEE 3PTRB 2HPLA 2D0TA 4IE7A 3TKLB 3U3IA 3WAKA 5JDHA 1MMDA 4DO0A 2A72A 2BVLA 2ZM0A 5CA1E 3GN5A 4P09A 2B1EA 2V7IA 2LE8A 5EK3A 5ADXL 1D0XA 5L3EB 4OYKA 2CMRA 4HEAA 1MMAA 5LBQB 2LOPA 4QXBB 3GWHA 4V1Av 4X1KE 2H3RA 2H7OA 1FMWA 2D0UA 3SS1A 3AAAB 4XZCA 3N9OA 4F6RC 4CI1B 4I43B 3PURA 3CX8B 2ACXA 3CX7B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMV A;  3SS1 A;  2VL8 A;  2VKD A;  3SRZ A;  2BVL A;  4DMW A;  4ERR A;  2VKH A;  2BVM A;  2VK9 A; 
#chains in the Genus database with same CATH topology
 4DV0 T;  3PUS A;  1J5E T;  5L2L A;  4DR6 T;  5LNK A;  3P4S A;  2NOX A;  4QH1 A;  3T1H T;  2JQH A;  2K9A A;  4LF4 T;  5AQT B;  2VKH A;  4DUZ T;  3QUJ A;  3I9W A;  3Q5E A;  2BG9 C;  4ISS A;  2Y48 B;  3N2K E;  2XAG B;  4QXC B;  4JBW F;  2DLR A;  4E7Z A;  2JJ9 A;  4PW8 A;  2CXD A;  4UEM A;  3MA9 A;  2WDR A;  4WNK A;  3AE1 A;  4FJO A;  4C91 A;  2PTF A;  2XQ8 A;  3IF8 B;  4DV6 T;  1D0Y A;  2C0S A;  2KMF A;  2IML A;  4ERR A;  5LJM A;  2HPJ A;  1WFD A;  2QRX A;  3AAI A;  4HFC A;  3A8Y C;  5LG4 A;  4H9R C;  4DR2 T;  2V8S V;  3AA7 B;  5FL0 A;  3ZC0 A;  3RC3 A;  2XQ7 A;  4IDP A;  3EAM A;  1MNE A;  3KFW X;  5AQL B;  5HEU A;  5L4H A;  4KUM B;  4EEB A;  2LJL A;  1NEN A;  2LSY A;  4WBO A;  4AKG A;  2JQ9 A;  4I50 E;  2PG8 A;  3LBX B;  3C4X A;  3ZT7 A;  3ZCI A;  2D5U A;  4KX6 A;  2RP4 A;  2ZM8 A;  1X79 A;  3RYI E;  4YTM A;  3HKB E;  4X66 T;  3HA4 A;  4U3C A;  4IT4 A;  3V5U A;  3JC6 D;  4EXT A;  5L3C B;  2E5V A;  3MXZ A;  5HXR A;  4FI5 A;  2LHN A;  5ABE A;  4EAH A;  3AVS A;  3CQG B;  4Q25 A;  4IST A;  3F2E A;  5J2T E;  4AQF C;  2H89 A;  4UVA B;  5JDG A;  5HEJ A;  3OYZ A;  3CX6 B;  4HFH A;  3LK3 B;  2BG9 B;  3IEE A;  5TAO A;  1IBK T;  4IGU A;  4P1N A;  5IHY A;  4CZZ B;  3OPC A;  4IL4 A;  3I0Q A;  3PUY F;  4TZ4 C;  5AQF B;  1UGO A;  3I1A A;  4JEU B;  1D0Z A;  4CQI A;  2XTL A;  3K3N A;  2XSB A;  4TWD A;  3QB5 A;  5CGM A;  5F5W A;  2CE7 A;  3UUB A;  1J1J A;  1W0B A;  4HFE A;  3RX6 A;  2V26 A;  3OTO T;  2LSK A;  4HWC A;  1S94 A;  3NRY A;  4KP3 C;  5FXZ A;  3C64 A;  2HH7 A;  2YN6 A;  1OXZ A;  4ZI3 D;  4JI8 T;  4U72 A;  3UUX B;  3P4W A;  2XQ4 A;  2ZLY A;  5JRC B;  5HXE A;  4A5X A;  3RF1 A;  4DV7 T;  1E2A A;  4F8H A;  2WY2 A;  4L0R A;  3FXE B;  1O3X A;  3N5L A;  4TV9 E;  3SWH A;  2LM9 A;  1DU2 A;  2KIN B;  3EI0 A;  4QHO A;  1X9B A;  2X67 A;  2E2A A;  3RQU A;  2X68 A;  4A56 A;  2CXF A;  3OVU A;  3ZMT B;  3UUL A;  4G2A A;  4Z91 A;  3RGL A;  1T7S A;  3P4Q A;  3HI2 A;  3MZK B;  3FB2 A;  3CWZ B;  4MHC A;  2ACZ A;  3NZQ A;  2UXD T;  2EHO D;  3AE2 A;  2I0M A;  4AI6 A;  1KNP A;  3G06 A;  5AQG B;  2IC9 A;  2ODV A;  2X51 A;  3T1Y T;  3I0O A;  3QNU A;  5LGU B;  2NW7 A;  5BR8 T;  4O4I E;  3WAJ A;  3SFE A;  2HHH T;  2WM9 A;  3AED A;  5FL1 A;  4OK0 A;  2E8I A;  5HCJ A;  1KF6 A;  2V5C A;  2AXD S;  3VKG A;  4BJM A;  5FYM A;  4IL9 A;  3MAC A;  3ZJ2 A;  3PUA A;  4NUV A;  5ETW A;  2HN2 A;  1KFY A;  3F57 A;  4QX7 B;  4U74 A;  2C5I T;  3CVR A;  3VRB A;  4U7Y A;  3AEE A;  2E9X D;  4QX8 B;  4JI7 T;  1U5P A;  5HXC A;  3N2G E;  2X9Y A;  3CK6 A;  2VL8 A;  4ZEY A;  4NXM T;  4AQY T;  3GMI A;  4EB6 E;  5HWX A;  5JDL A;  1N34 T;  2XZE A;  1UX5 A;  3TLU A;  1IAP A;  1OED A;  4EYU A;  3UT5 E;  4H63 V;  4LFB T;  2LHR A;  2IUB A;  1YW0 A;  3KIN B;  4X1Y E;  4U31 A;  2XUE A;  3ESL A;  3AEG A;  2UXB T;  1V9D A;  4PK5 A;  3NVO A;  3OYX A;  4DMW A;  2CHN A;  4KMC A;  3UU6 A;  2YU2 A;  1ZHC A;  3AE6 A;  1T8B A;  4LMJ A;  4WBN E;  4HFD A;  2LOS A;  4TN7 B;  1MIY A;  2V1D B;  5EK2 A;  2J1D G;  2W2U A;  2ZM0 A;  2B1E A;  3Q5D A;  2M6I A;  4DV5 T;  5EK3 A;  2YOE A;  5ADX L;  2LOP A;  4QXB B;  3GWH A;  2H3R A;  2XQ3 A;  2IDO B;  2YDR A;  3N9O A;  4CI1 B;  2XM2 A;  4C90 A;  3FXD B;  4X64 T;  1T72 A;  4EIW A;  1ZOY A;  5LBM A;  5HXH A;  4GYS A;  2CEA A;  5ABF A;  4O2A E;  3JAF A;  1T98 A;  2NR4 A;  2FJE A;  3K1S A;  2N9D A;  1SA0 E;  4WYV A;  2CXL A;  3BQK A;  2CA5 A;  2W62 A;  1IBM T;  2VB6 A;  4HTE A;  1QSD A;  1OWA A;  4TWH A;  3UUN A;  1QUU A;  4CXW A;  2LRL A;  4K0U A;  4B3R T;  3E08 A;  4QXH B;  4K0K T;  1R8I A;  5LB7 B;  3ZN0 B;  3ANW B;  3PJA J;  4COF A;  3L3P A;  1E1H B;  2YDQ A;  1HG2 A;  5JR9 B;  3L09 A;  5A1L A;  4H63 H;  1Z0P A;  2YKS A;  3ZMU B;  4JI4 T;  5HXS A;  3J9X 1;  4I55 E;  3JAD A;  2WB5 A;  1MMG A;  5AQK B;  4O2B E;  2NW8 A;  3AE9 A;  4MFR A;  3RKO A;  3ZMV B;  4TNV A;  2WWV A;  2W0G A;  5CB4 E;  4IDZ A;  3DP7 A;  2CWO A;  2I59 A;  3FBL A;  1KK7 A;  3AA1 B;  2KT9 A;  2LM2 A;  4DR7 T;  2LSG A;  1YQ3 A;  3IA3 A;  3AE4 A;  4CN1 A;  4HFI A;  5L4E A;  2NW9 A;  3RQW A;  3RKG A;  2J62 A;  5F3J A;  4ZI3 C;  5IUX A;  2MYS A;  3AEA A;  2OA5 A;  4ILB A;  3UQ7 A;  1YQ4 A;  5FMN A;  4HWI B;  1N33 T;  3SFD A;  2M6B A;  4X5T A;  4ANJ A;  2CBI A;  2XPK A;  2OLT A;  2WAU A;  3K3Q C;  4IDQ A;  2YK0 A;  3PE0 A;  2PJQ A;  1FJG T;  3Q5X A;  2LRK A;  4PK6 A;  2X9W A;  3NZP A;  4HN9 A;  5HWY A;  5FVK A;  2K3W A;  3DTO A;  4DBQ A;  3N9M A;  4Z8X A;  2VKD A;  2X9H A;  2WU2 A;  1YD8 G;  2A9U A;  2Y6X A;  3AA0 B;  5EK4 A;  2YIN A;  4U2Z A;  4YFS A;  4HWD A;  1H7C A;  3O9X A;  2L8K A;  2NTX A;  3R84 B;  1WCR A;  1ZKE A;  2XAH B;  2D2S A;  3RC8 A;  1HX1 B;  3H3A A;  3F31 A;  2XSA A;  3AAE B;  2CM0 A;  5L47 A;  4ASK A;  4M1P A;  2IW5 B;  2WMO A;  4EZH A;  1BR1 A;  4B3M T;  5CFB A;  3CQX C;  3P8C D;  4JI3 T;  1XMQ T;  3OKQ A;  4JV5 T;  4DV3 T;  2UUA T;  1Y01 A;  2VK9 A;  5FNV E;  3KVB A;  4NPP A;  4ZZB A;  4DID B;  4UV8 B;  4DND A;  5DJQ C;  2PBI A;  3MK7 C;  4YHJ A;  5FKY A;  2M67 A;  4H9S E;  3K8P C;  1OED E;  2DL1 A;  2DI4 A;  2SPC A;  2CRB A;  3LDQ B;  5FXX A;  1W09 A;  1MMN A;  2KZ7 B;  4YTN A;  5HYA A;  5CA0 E;  4YJ3 E;  4MLK A;  4HGA A;  1M7K A;  3PDY A;  5LMU T;  3ONX A;  2XQY A;  2KSR A;  2A2F X;  4IE6 A;  1MIV A;  4ZHQ E;  2KWH A;  5LOV E;  4AKR B;  4U7I A;  1HNX T;  5J1G A;  2WS3 A;  3HL6 A;  4QWN B;  4GYR A;  2UXN B;  5C8Y E;  1G8X A;  3JAE A;  2WBL A;  3AXJ B;  4IRE A;  3AEB A;  2VWA A;  3CML A;  5LJN A;  5LGT B;  2JIW A;  5BMV E;  5AQR B;  2ZMA A;  1I94 T;  3CQC B;  4IE5 A;  1ZEE A;  4QKN A;  4O4H E;  3VRA A;  3ZYL A;  2L3L A;  3AE5 A;  4P0A A;  4P0B A;  3E22 E;  5H6Q B;  3BK9 A;  2LSI A;  5LHH B;  3ZPO A;  3LFM A;  2XQA A;  4IE4 A;  5AQP B;  4NUU A;  5AQN B;  2JMK A;  1YXR A;  4PJN A;  2MPK A;  4HWH A;  1HG5 A;  3CIR A;  3EAB A;  3UU5 A;  2FUP A;  3N9P A;  1LKX A;  2V7L A;  2H7V C;  2FJB A;  2Q9Q D;  2YDS A;  2ZM2 A;  3SRZ A;  2MOZ A;  3ZC1 A;  3IBP A;  3MKD A;  2C5J A;  3PUX F;  2RPA A;  4UXN B;  3RYH E;  4EED A;  2LKG A;  3UQ4 A;  2KWI B;  1HF8 A;  4TWF A;  3FHN A;  1SUM B;  2DNX A;  3UU3 A;  5FVL A;  3UU8 A;  3FZH B;  1B7T A;  3RIA A;  2IHR 1;  2Q9Q A;  5DAB A;  2V6Y B;  3PTR B;  3FZL B;  3ONJ A;  4IE7 A;  3WAK A;  4LF7 T;  2BVL A;  2V7I A;  3JCF A;  3AEF A;  2CMR A;  5LBQ B;  4V1A v;  2H7O A;  2D0U A;  4LF5 T;  4F6R C;  4I43 B;  2ACX A;  1J5W A;  5AQS B;  3O1I A;  4PJM A;  1HX8 A;  3KV6 A;  2RA1 A;  3PUQ A;  4UV9 B;  3FZK B;  3M65 A;  3EDU A;  2DWK A;  4X20 E;  3UU4 A;  2P9B A;  5ABF B;  5AQQ B;  4EV6 A;  3TLT A;  3HKC E;  2XJ7 A;  5LYJ E;  3O4X E;  2JPF A;  1KEY A;  3AE8 A;  4UF0 B;  2EHO A;  5F8P A;  3D0T A;  3L39 A;  4I0U A;  2K5B B;  1LRZ A;  2LKH A;  2PFV A;  2BS4 A;  5LMN T;  3RRC A;  5L3D B;  2DHR A;  5LA6 E;  1NWM X;  2VAS A;  2Z6E A;  4PNI A;  3X1D A;  4O8S A;  4YHH T;  4UVC B;  5AQM B;  4A97 A;  2MBG A;  1SE7 A;  4O4J E;  4JI2 T;  2E5L T;  3A5X A;  3SOL A;  3KVA A;  2WWU A;  2UXC T;  3LSV A;  2X9X A;  4OHF A;  2E9X A;  3Q5W A;  4ILA A;  4JYA T;  1IJ5 A;  4A98 A;  3RPU A;  4HWF A;  2KLQ A;  4G63 A;  4PJL A;  4GK5 E;  3QC9 A;  2KXP B;  2XM1 A;  1KNR A;  4B3T T;  1WLX A;  5L3F B;  3GN5 B;  3WI3 A;  4DV4 T;  5HEG A;  4ZXL A;  1IBL T;  2A3D A;  3ZMZ B;  4U33 A;  4CI3 B;  3C4Z A;  4H9Q C;  1XDP A;  2QA7 A;  4NXN T;  1HCI A;  4DV1 T;  4YJ2 E;  4MBQ A;  1E7P A;  2VKO A;  4UR9 A;  4EYY R;  4DR4 T;  3PJA A;  2W66 A;  4I4T E;  5H6R B;  3UUM A;  1Y64 B;  3IHR A;  4ILC A;  4AIS A;  4OYJ A;  5JVD E;  3H37 A;  3P4P A;  4YSX A;  3JC6 C;  2VVS A;  2XHE B;  2UUB T;  3RRW A;  3QB5 K;  3Q2M A;  4WZX A;  4XAX B;  4EGW A;  3N9N A;  3KV9 A;  3B57 A;  1N32 T;  1W9R A;  4YLH A;  1XWM A;  3CKD A;  2QYW A;  4IDN A;  5JDN A;  2QGS A;  4CXY A;  2BBH A;  2YU1 A;  3I9Y A;  2JMH A;  5HAX A;  3GA8 A;  4H9O C;  3MJX A;  2WZI A;  3EDV A;  3EUH A;  4DMV A;  3B5M A;  1XNQ T;  1SHZ C;  3ZYM A;  4UIG A;  2LLY A;  3PU8 A;  5IWA T;  5HEO A;  2BVM A;  4HFV A;  4BA9 A;  2B76 A;  5KXJ A;  3ABV A;  1BR4 A;  3DJB A;  2Y8D A;  3ZCJ A;  4ZI2 D;  4YY3 T;  5HCM A;  2ZM6 T;  2VQE T;  4ZS3 A;  3C50 A;  5J2U E;  3VU7 H;  4EOZ B;  2CLY C;  3RI5 A;  5AQU B;  3OJA A;  4WW0 A;  1S35 A;  2XY8 B;  2Q9Q C;  1YKH B;  4L9I A;  2FBW A;  4IIJ E;  2V7J A;  3UTK A;  2WMN A;  4AIU A;  5L3G B;  1YKE B;  2VKJ A;  4B6X A;  4GKJ T;  5FY7 A;  5GON E;  2XAF B;  4ZS2 A;  3EHZ A;  3P7I A;  3KV5 A;  3RH3 A;  2WZH A;  2V6X A;  4JUY A;  1CHU A;  3QOF A;  5KMG P;  3UFE A;  2K24 A;  4B3S T;  4HE8 A;  5M4Y A;  1ZV4 X;  3C4W A;  1LVF A;  2WP9 A;  2BKP A;  2WDV A;  3TLV A;  3N2O A;  4HFB A;  2EHO C;  4LFC T;  2IAK A;  3VHL A;  2XAS B;  4OX9 T;  3B13 A;  4TNW A;  1U4Q A;  2BG9 E;  4AKI A;  3A7M A;  2XAJ B;  1US7 B;  3ANW A;  1BR0 A;  4AXP A;  3QK6 A;  4AQG A;  2UU9 T;  2J4G A;  5JQG E;  1HR0 T;  3ZST A;  3RHW A;  1WYC A;  4CN4 A;  1OED C;  2W67 A;  1IZN B;  5JRE A;  5FXV A;  4UEL A;  3ZT5 A;  3FBZ A;  4IDO A;  5JR9 A;  2F4V T;  1HFA A;  3NWI A;  3TLW A;  4DR3 T;  2G0U A;  1VOM A;  2BS2 A;  2E9X C;  2CHO A;  1N36 T;  5C3J A;  2XAQ B;  2CLY B;  1HNW T;  3VKH A;  3UFG A;  1XDO A;  5AQO B;  3KV4 A;  3ZSS A;  4EZ4 A;  5E0O A;  1QLB A;  2Q9Q B;  3LK4 2;  4CI2 B;  4LF9 T;  2HPL A;  3U3I A;  5JDH A;  1MMD A;  2A72 A;  4U2Y A;  2FJA A;  1D0X A;  5L3E B;  4OYK A;  1MMA A;  1FMW A;  3SS1 A;  3PUR A;  3CX8 B;  5AQH B;  3CX7 B;  3P4R A;  3C98 B;  5JDM A;  2W4X A;  4X1I E;  2LT3 A;  5CJ5 A;  2LEH A;  3ONL C;  4DUY T;  3N9L A;  3HKD E;  5LG3 A;  2EHO B;  3RYF E;  4MAL A;  2IC6 A;  4DR1 T;  4H9P C;  2CPT A;  2KND A;  4PJJ A;  3AE3 A;  3V5S A;  2K48 A;  3ZT6 A;  2DCF A;  3LJC A;  3NKZ A;  1JNZ A;  2CCQ A;  2OV9 A;  2FJD A;  3CPZ A;  3RIU A;  5KX5 E;  1JNR A;  1ZP0 A;  4JEH B;  1UCU A;  3FZM B;  2W63 A;  2UUC T;  1WR6 A;  3AEC A;  1OED B;  5DQW A;  2V5D A;  1UUS A;  3PUV F;  5AQJ B;  4LF8 T;  2UXX B;  2R6G F;  4N78 D;  2E9X B;  2HN1 A;  4L5G A;  1HNZ T;  3OBV E;  3W15 B;  1IJ6 A;  3C51 A;  3L8R A;  5ABG A;  5DQV A;  3ZN1 B;  3R6N A;  3H3M A;  4UVB B;  2WQY A;  3ZYK A;  3LBX A;  2J47 A;  1KNZ A;  2VQF T;  3KDS E;  4XBF B;  2WSS V;  3FZF B;  3E0Z A;  5JDQ A;  1XZY A;  4LFA T;  2JQK A;  2VVN A;  5FY0 A;  2MTQ A;  4JI6 T;  3M3Z B;  2CWY A;  3NRX A;  1NAF A;  3P50 A;  4ZI2 C;  1FIO A;  4PFO A;  4YXD A;  4JI1 T;  3TLS A;  1UK5 A;  4GKK T;  5LP6 E;  4QH5 A;  3BQI A;  5L3B B;  5LHG B;  1FMV A;  1HTJ F;  2BKN A;  4GIW A;  2BG9 A;  2XQ6 A;  2BKO A;  1D1C A;  3AXJ A;  4GK0 E;  3VR8 A;  3K3O A;  2W00 A;  1I6Z A;  4AKH A;  3AE7 A;  4DVD A;  1WRD A;  2L9Q A;  2NWB A;  4O4L E;  5JTG A;  1UUR A;  2N1G A;  1D1B A;  4KI0 F;  2H88 A;  3AVR A;  1VRB A;  5J0Z A;  2X0L B;  3ZLI A;  5EZY E;  3ZMS B;  2XQ9 A;  2NP9 A;  4YSY A;  4GOU A;  4TV8 E;  4PAG A;  3AB3 B;  2JQQ A;  3PUG A;  1BR2 A;  4ILU A;  1XMO T;  1NEK A;  3T8O A;  2X0H A;  2VL0 A;  3RYC E;  1VCT A;  1MND A;  3KBU A;  1EZ3 A;  5JRC A;  1FEW A;  4BAY B;  4IHJ E;  5JR9 C;  4KBM B;  4X62 T;  3Q9D A;  3RIF A;  3BQL A;  4CXX A;  1WR0 A;  1MIW A;  4E7S A;  3VR9 A;  5HEH A;  5C2T A;  2WCA A;  2WU5 A;  2BS3 A;  5LGN B;  4X65 T;  5AQV B;  4JLE A;  4DBR A;  1WYB A;  2X66 A;  4CN6 A;  1AJ3 A;  4JI5 T;  3O1H A;  2X0Y A;  2YEV C;  1HS7 A;  5IYZ E;  2V6Y A;  4TUY E;  1G73 A;  4LML A;  2LSJ A;  4AQF A;  5FP3 A;  4Z90 A;  2BDE A;  4YT0 A;  3ZKR A;  4LF6 T;  3EVY A;  2BZB A;  4AKL A;  4IE0 A;  1D1A A;  3PU3 A;  1CUN A;  4ADZ A;  5LHI B;  1XNR T;  3NBX X;  3N9Q A;  2I6H A;  5AFU L;  3ZEF B;  2DWG A;  4H9N C;  5LCY A;  5AQI B;  4ZOL E;  3U78 A;  4OFZ A;  1VCS A;  5FXW A;  2W61 A;  1LVK A;  4LMK A;  4DR5 T;  4PFP A;  3ETU A;  2AE9 A;  4UF0 A;  5ABH A;  3HR0 A;  2XQ5 A;  3S4U A;  2WDQ A;  3LK2 B;  5JH7 E;  4ZI7 E;  3ETV A;  2NTY A;  2ODU A;  1M62 A;  2MAW A;  4PK4 A;  4J2C A;  5LXT E;  4KHZ F;  3RIU C;  2JRK A;  3PUZ F;  4DV2 T;  2GK9 A;  5KDM C;  2VUR A;  2QVA A;  1Z8U A;  4YTP A;  3RLF F;  2ES0 A;  1GQE A;  3PV0 F;  2IIU A;  2C5K T;  2V7M A;  4HKA A;  3KBT A;  5FY1 A;  5JDF A;  3AA6 B;  2CBJ A;  4YSZ A;  4KHP T;  2N2N A;  4BJN A;  3J7Y q;  3LG7 A;  2V7K A;  2D9D A;  4JI0 T;  4TX5 A;  2BBJ A;  4QH4 A;  4NIQ A;  3O1J A;  1UX4 A;  1L0V A;  3ZJ1 A;  3HKE E;  1W0A A;  2D0T A;  3TKL B;  4DO0 A;  5CA1 E;  3GN5 A;  4P09 A;  4ZZC A;  2LE8 A;  4HEA A;  3PUW F;  4X1K E;  3AAA B;  4XZC A; 
#chains in the Genus database with same CATH homology
 3C98 B;  5JDM A;  4C90 A;  3O1I A;  3PUS A;  4X1I E;  4PJM A;  3FXD B;  2LT3 A;  1HX8 A;  3KV6 A;  4EIW A;  5L2L A;  2RA1 A;  2LEH A;  3PUQ A;  5LBM A;  4UV9 B;  3M65 A;  5LNK A;  3EDU A;  5HXH A;  2DWK A;  4GYS A;  2NOX A;  4X20 E;  2CEA A;  2P9B A;  3N9L A;  4O2A E;  2K9A A;  3HKC E;  5LYJ E;  3O4X E;  1T98 A;  3HKD E;  2JPF A;  2VKH A;  3QUJ A;  4UF0 B;  2EHO B;  3I9W A;  2EHO A;  2N9D A;  4MAL A;  3RYF E;  2IC6 A;  1SA0 E;  5F8P A;  3D0T A;  4ISS A;  4H9P C;  2CXL A;  3BQK A;  2K5B B;  2CA5 A;  2W62 A;  1LRZ A;  2PFV A;  2VB6 A;  2Y48 B;  2KND A;  3N2K E;  4HTE A;  4PJJ A;  3V5S A;  2XAG B;  4QXC B;  2K48 A;  1QSD A;  1OWA A;  3UUN A;  3RRC A;  1QUU A;  2DCF A;  2DLR A;  3LJC A;  5L3D B;  4E7Z A;  2JJ9 A;  4PW8 A;  4CXW A;  2CXD A;  2DHR A;  2CCQ A;  4UEM A;  4K0U A;  5LA6 E;  1NWM X;  2VAS A;  3CPZ A;  3MA9 A;  2Z6E A;  4WNK A;  5KX5 E;  4PNI A;  4FJO A;  4C91 A;  3E08 A;  4QXH B;  4O8S A;  3IF8 B;  3ZN0 B;  3ANW B;  4JEH B;  1D0Y A;  2C0S A;  2KMF A;  1UCU A;  4UVC B;  2MBG A;  4ERR A;  5LJM A;  4O4J E;  2HPJ A;  2W63 A;  3L3P A;  1E1H B;  1WR6 A;  5DQW A;  3AAI A;  3A5X A;  3SOL A;  3KVA A;  5LG4 A;  2WWU A;  4H9R C;  1HG2 A;  5JR9 B;  3L09 A;  5A1L A;  2X9X A;  4H63 H;  2UXX B;  1Z0P A;  3AA7 B;  3ZC0 A;  4N78 D;  3ZMU B;  4OHF A;  2E9X B;  2E9X A;  3RC3 A;  5HXS A;  4L5G A;  3Q5W A;  3OBV E;  3J9X 1;  3W15 B;  1MNE A;  3KFW X;  4I55 E;  1IJ5 A;  1IJ6 A;  3C51 A;  3RPU A;  5DQV A;  1MMG A;  4O2B E;  3ZN1 B;  4KUM B;  2NW8 A;  4MFR A;  3R6N A;  2KLQ A;  2LJL A;  3RKO A;  4G63 A;  4PJL A;  2LSY A;  3ZMV B;  4GK5 E;  4WBO A;  4AKG A;  2W0G A;  5CB4 E;  3QC9 A;  4IDZ A;  3DP7 A;  2CWO A;  2I59 A;  3FBL A;  4UVB B;  1KK7 A;  3AA1 B;  2KXP B;  4I50 E;  2KT9 A;  3ZYK A;  2PG8 A;  3LBX B;  2LSG A;  3LBX A;  3C4X A;  1KNZ A;  3ZCI A;  2D5U A;  3KDS E;  4XBF B;  2RP4 A;  2WSS V;  1WLX A;  5L3F B;  3E0Z A;  2ZM8 A;  1X79 A;  3GN5 B;  3RYI E;  5JDQ A;  3HKB E;  2NW9 A;  3WI3 A;  3HA4 A;  3V5U A;  3JC6 D;  4EXT A;  5L3C B;  2A3D A;  5F3J A;  5FY0 A;  3MXZ A;  4ZI3 C;  3ZMZ B;  2MTQ A;  2MYS A;  3C4Z A;  4CI3 B;  5HXR A;  2CWY A;  2OA5 A;  4H9Q C;  4FI5 A;  2LHN A;  2QA7 A;  3NRX A;  1HCI A;  4EAH A;  3AVS A;  3CQG B;  1NAF A;  4YJ2 E;  4MBQ A;  4IST A;  4ZI2 C;  3F2E A;  5J2T E;  5FMN A;  2VKO A;  1FIO A;  4AQF C;  4EYY R;  4PFO A;  4ANJ A;  4UVA B;  4I4T E;  5JDG A;  5LP6 E;  2WAU A;  3BQI A;  5L3B B;  3OYZ A;  3CX6 B;  5LHG B;  3K3Q C;  5H6R B;  1FMV A;  3UUM A;  1Y64 B;  3IHR A;  2YK0 A;  4OYJ A;  5JVD E;  3PE0 A;  3H37 A;  2PJQ A;  3LK3 B;  1HTJ F;  4GIW A;  3IEE A;  5TAO A;  1D1C A;  3Q5X A;  3JC6 C;  4PK6 A;  4GK0 E;  2X9W A;  4IGU A;  2XHE B;  5IHY A;  4CZZ B;  3NZP A;  4HN9 A;  3K3O A;  2W00 A;  5HWY A;  4AKH A;  3RRW A;  3DTO A;  4DVD A;  3Q2M A;  1WRD A;  2L9Q A;  3I0Q A;  4DBQ A;  4TZ4 C;  3N9M A;  4Z8X A;  2VKD A;  2NWB A;  4O4L E;  4XAX B;  3I1A A;  2X9H A;  1YD8 G;  3N9N A;  2N1G A;  4JEU B;  3KV9 A;  1D0Z A;  2Y6X A;  3AA0 B;  2YIN A;  5EK4 A;  3B57 A;  1D1B A;  4CQI A;  2XTL A;  3K3N A;  4YFS A;  4YLH A;  1H7C A;  3O9X A;  2L8K A;  3AVR A;  3CKD A;  1VRB A;  2NTX A;  3R84 B;  5JDN A;  1ZKE A;  2QGS A;  2XAH B;  2CE7 A;  2X0L B;  2D2S A;  4CXY A;  3ZLI A;  3RC8 A;  2YU1 A;  5EZY E;  3ZMS B;  3H3A A;  3F31 A;  3RX6 A;  3I9Y A;  2JMH A;  2V26 A;  3AAE B;  5HAX A;  2CM0 A;  2NP9 A;  2LSK A;  4GOU A;  4TV8 E;  1S94 A;  3GA8 A;  3NRY A;  4H9O C;  4ASK A;  4PAG A;  3AB3 B;  4M1P A;  2JQQ A;  3MJX A;  2IW5 B;  4KP3 C;  3PUG A;  3EDV A;  2WMO A;  4EZH A;  3EUH A;  1BR2 A;  1BR1 A;  4DMV A;  4ILU A;  3CQX C;  5FXZ A;  3C64 A;  3P8C D;  3T8O A;  2HH7 A;  1OXZ A;  3OKQ A;  1SHZ C;  3ZYM A;  4UIG A;  3RYC E;  4ZI3 D;  4U72 A;  3UUX B;  3PU8 A;  2BVM A;  2VK9 A;  4HFV A;  4BA9 A;  5FNV E;  2ZLY A;  1MND A;  3KBU A;  1EZ3 A;  5JRC B;  5JRC A;  3KVB A;  1FEW A;  1BR4 A;  3DJB A;  2Y8D A;  4IHJ E;  4BAY B;  5JR9 C;  4KBM B;  3ZCJ A;  5HXE A;  4UV8 B;  4ZI2 D;  4DND A;  5DJQ C;  3Q9D A;  2PBI A;  3MK7 C;  3BQL A;  4YHJ A;  4CXX A;  4L0R A;  2M67 A;  4H9S E;  1MIW A;  3K8P C;  4E7S A;  4ZS3 A;  3FXE B;  1O3X A;  3N5L A;  4TV9 E;  3SWH A;  2DI4 A;  2LM9 A;  2SPC A;  3C50 A;  5J2U E;  2KIN B;  4QHO A;  3VU7 H;  5LGN B;  4EOZ B;  5FXX A;  1MMN A;  2KZ7 B;  2X67 A;  4JLE A;  4DBR A;  5CA0 E;  5HYA A;  4YJ3 E;  4MLK A;  2CLY C;  1WYB A;  2X66 A;  4HGA A;  3OJA A;  1AJ3 A;  2X68 A;  3PDY A;  3O1H A;  4A56 A;  2CXF A;  3ZMT B;  3UUL A;  4G2A A;  2YEV C;  4WW0 A;  1S35 A;  3ONX A;  2XQY A;  2A2F X;  4IE6 A;  2Q9Q C;  1YKH B;  4L9I A;  1MIV A;  4IIJ E;  1HS7 A;  2V7J A;  3HI2 A;  5IYZ E;  2WMN A;  3UTK A;  4TUY E;  3MZK B;  1G73 A;  3FB2 A;  5L3G B;  1YKE B;  3CWZ B;  4ZHQ E;  2VKJ A;  2KWH A;  2LSJ A;  4B6X A;  5LOV E;  4AKR B;  4MHC A;  4AQF A;  5FP3 A;  5FY7 A;  5GON E;  2BDE A;  2XAF B;  3NZQ A;  5J1G A;  2EHO D;  3HL6 A;  3EVY A;  4ZS2 A;  2BZB A;  3KV5 A;  3P7I A;  4QWN B;  4IE0 A;  3RH3 A;  4AKL A;  4GYR A;  1D1A A;  3PU3 A;  2UXN B;  4AI6 A;  5C8Y E;  1CUN A;  4JUY A;  1G8X A;  4ADZ A;  5LHI B;  2IC9 A;  2WBL A;  3NBX X;  3N9Q A;  5KMG P;  2ODV A;  5AFU L;  3UFE A;  2K24 A;  2X51 A;  3ZEF B;  2DWG A;  4HE8 A;  5M4Y A;  3I0O A;  1ZV4 X;  2VWA A;  4H9N C;  3CML A;  5LJN A;  5LGU B;  5LGT B;  5LCY A;  3U78 A;  4ZOL E;  3C4W A;  2NW7 A;  4OFZ A;  5BMV E;  1LVF A;  2ZMA A;  4O4I E;  5FXW A;  3CQC B;  3WAJ A;  4IE5 A;  2W61 A;  1ZEE A;  4QKN A;  4O4H E;  2WM9 A;  1LVK A;  3N2O A;  4OK0 A;  2E8I A;  4PFP A;  3ZYL A;  3ETU A;  4UF0 A;  2EHO C;  3VKG A;  4BJM A;  5FYM A;  3HR0 A;  3S4U A;  2L3L A;  4P0A A;  2IAK A;  3LK2 B;  4P0B A;  3MAC A;  3ZJ2 A;  3PUA A;  3VHL A;  2XAS B;  3E22 E;  5H6Q B;  3BK9 A;  3B13 A;  5JH7 E;  4NUV A;  5ETW A;  4ZI7 E;  3ETV A;  2LSI A;  2NTY A;  3F57 A;  5LHH B;  4QX7 B;  4U74 A;  2ODU A;  2C5I T;  3ZPO A;  3LFM A;  3CVR A;  4IE4 A;  1U4Q A;  4NUU A;  4PK4 A;  2JMK A;  4J2C A;  5LXT E;  4AKI A;  4PJN A;  2E9X D;  4QX8 B;  2JRK A;  1U5P A;  1HG5 A;  5HXC A;  3N2G E;  2XAJ B;  2GK9 A;  2X9Y A;  5KDM C;  1US7 B;  2VL8 A;  3N9P A;  3ANW A;  1BR0 A;  1LKX A;  3GMI A;  2V7L A;  4AXP A;  4EB6 E;  5HWX A;  3QK6 A;  4AQG A;  5JDL A;  2H7V C;  5JQG E;  2ES0 A;  1UX5 A;  1WYC A;  1IAP A;  2C5K T;  2V7M A;  4EYU A;  2Q9Q D;  1IZN B;  4HKA A;  3UT5 E;  3KBT A;  4H63 V;  5FY1 A;  5JDF A;  5JRE A;  5FXV A;  2ZM2 A;  3SRZ A;  4UEL A;  2MOZ A;  3ZC1 A;  2LHR A;  3AA6 B;  3IBP A;  1YW0 A;  3FBZ A;  3KIN B;  3MKD A;  5JR9 A;  4X1Y E;  1HFA A;  2XUE A;  3ESL A;  2C5J A;  4UXN B;  1V9D A;  3RYH E;  2N2N A;  2G0U A;  4PK5 A;  1VOM A;  2E9X C;  2KWI B;  3OYX A;  4DMW A;  1HF8 A;  4BJN A;  2XAQ B;  3FHN A;  4KMC A;  3LG7 A;  3J7Y q;  2V7K A;  2DNX A;  2YU2 A;  2CLY B;  3VKH A;  1ZHC A;  4TX5 A;  1B7T A;  4WBN E;  2LOS A;  3KV4 A;  4TN7 B;  4EZ4 A;  3O1J A;  5E0O A;  1MIY A;  2V1D B;  2Q9Q B;  2Q9Q A;  5EK2 A;  1UX4 A;  3LK4 2;  4CI2 B;  5DAB A;  2J1D G;  3ZJ1 A;  3HKE E;  3PTR B;  2HPL A;  2D0T A;  4IE7 A;  3TKL B;  3U3I A;  3WAK A;  5JDH A;  1MMD A;  4DO0 A;  2A72 A;  2BVL A;  2ZM0 A;  5CA1 E;  3GN5 A;  4P09 A;  2B1E A;  2V7I A;  2LE8 A;  5EK3 A;  5ADX L;  1D0X A;  5L3E B;  4OYK A;  2CMR A;  4HEA A;  1MMA A;  5LBQ B;  2LOP A;  4QXB B;  3GWH A;  4V1A v;  4X1K E;  2H3R A;  2H7O A;  1FMW A;  2D0U A;  3SS1 A;  3AAA B;  4XZC A;  3N9O A;  4F6R C;  4CI1 B;  4I43 B;  3PUR A;  3CX8 B;  2ACX A;  3CX7 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...