4ERRA

1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
b'GQIFTVQELKERAKVFAKPIGASYQGILDQLDLVHQAKGRDQIAASFELNKKINDYIAEHPTSGRNQALTQLKEQVTSALGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Autotransporter adhesin
publication title 1.55 Angstrom Crystal Structure of the Four Helical Bundle Membrane Localization Domain (4HBM) of the Vibrio vulnificus MARTX Effector Domain DUF5.
rcsb
source organism Vibrio vulnificus
molecule tags Protein binding
total genus 32
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4errA00
4DMVA 3SRZA 2BVMA 2VKHA 2VL8A 4DMWA 2VK9A 2BVLA 3SS1A 2VKDA 4ERRA
chains in the Genus database with same CATH superfamily
3CIRA 1ZOYA 2WMNA 2JRKA 2X66A 3ZMTB 1UX5A 2J62A 3ZT5A 2H89A 2ODVA 4BJMA 5A1LA 3M65A 4DV4T 1GQEA 3PUGA 4U2YA 3N9PA 3UU5A 4AISA 3ZYKA 2X9XA 3K3NA 5FYMA 2X51A 3QNUA 2XAQB 4QH1A 4LMKA 3ZMUB 1D1BA 4HFEA 1ZV4X 2J4GA 3FXEB 2QA7A 2PBIA 2BKPA 5AQKB 5JDMA 2HH7A 5L3EB 4YJ2E 3BK9A 4ILAA 5F5WA 3Q5EA 5LMUT 3JAEA 3P4PA 2A9UA 4LMLA 1WCRA 3RKOA 2OV9A 5AQJB 5JDFA 4DBQA 1KNPA 5LJNA 4JLEA 1NEKA 4LF9T 2VKJA 4COFA 4AQFC 2WWUA 3ETVA 5L3BB 3EVYA 3ZMZB 4NUUA 1X79A 2V6XA 4TX5A 4GYSA 4YY3T 4PW8A 4U72A 5JDLA 3VU7H 5L2LA 4KHPT 1HF8A 2V6YB 2WQYA 3C51A 1W0BA 1T72A 3P8CD 1N33T 5DQVA 3L3PA 3RI5A 5FY0A 2YKSA 4KMCA 3ZC0A 5LGUB 1OEDC 3U3IA 4ZOLE 2H88A 3RYIE 1L0VA 1T8BA 1SUMB 3PUWF 4B6XA 4EYUA 1LRZA 1H7CA 4ILUA 4UXNB 5F8PA 4A56A 3N5LA 3C50A 3AAIA 1AJ3A 4BAYB 3Q5WA 1BR1A 4U7IA 3UU8A 2XSBA 2EHOD 2K9AA 2LSKA 5HWXA 5DJQC 3AEDA 3SOLA 3KBUA 4IIJE 4NXMT 3DJBA 4PNIA 1MMAA 4PJLA 3H3MA 3KV9A 5HEJA 3KINB 4ZS2A 3M3ZB 3H37A 5FXVA 2XQ9A 4HN9A 4QKNA 5EK4A 3UFEA 2W67A 5F3JA 3OYXA 5FMNA 4LMJA 3FZFB 3ZSTA 3IBPA 5ABHA 1S94A 4JEHB 4OX9T 4X20E 4A97A 3NZPA 3RYHE 4JI1T 3ONXA 3Q2MA 5LGTB 3RIUA 3VHLA 4EXTA 1HS7A 2XQAA 1UURA 2CWOA 3CX6B 1R8IA 1DU2A 2EHOB 4L0RA 3SFDA 4H9OC 1N32T 1JNRA 5FKYA 5CB4E 4DMVA 2BG9E 1IBKT 5KDMC 2XM2A 4UVCB 4M1PA 2N9DA 4YSYA 5LJMA 3AVSA 5LG4A 3N9OA 4QXHB 2NR4A 1ZP0A 3P4RA 3JC6D 3T1HT 5E0OA 4LF5T 2FBWA 4H9SE 3PU8A 5AFUL 4H9RC 2H3RA 5C3JA 2YK0A 5AQOB 2BG9B 3LBXA 3B57A 4IREA 2LSYA 1J5WA 2WDRA 3VRBA 4H63V 2JIWA 4ZI2D 4AIUA 2V6YA 2W00A 4HGAA 1D0XA 2CCQA 2CXFA 3P4WA 3RHWA 1FMVA 3FB2A 4DR6T 3IHRA 2WDQA 4JI3T 4OHFA 1VOMA 4X1IE 4DVDA 5AQIB 3D0TA 3HKBE 4ILBA 4CXXA 3AE2A 3KVBA 3E22E 1MMDA 4P1NA 5CJ5A 4AKHA 2X68A 5FVKA 2NW9A 3OVUA 4IL4A 3FZHB 2VASA 3V5UA 3TLSA 2J1DG 2XQ6A 3AA6B 5DQWA 3NKZA 5J1GA 1YQ3A 3H3AA 2XAJB 2XHEB 3RC8A 2FJEA 4YT0A 4ASKA 5JREA 4YSZA 2UXDT 2QGSA 5CFBA 1MNEA 4TV8E 3F31A 4DV1T 2WCAA 2RPAA 3PUSA 4O2BE 4AI6A 1S35A 3J9X1 1B7TA 4L9IA 4QWNB 2E9XA 1MNDA 4X66T 1UX4A 3EUHA 3PU3A 1WR6A 3Q5XA 5HXRA 4F8HA 2EHOA 4QX7B 3L39A 3EHZA 4PK6A 2BS2A 1YKHB 4YSXA 4KI0F 3ZCJA 2IHR1 2X67A 4U74A 5CA1E 3WAJA 2JQQA 4IDPA 4ZI7E 3PDYA 3ANWA 3P4SA 4PK5A 3JAFA 2YDSA 2N1GA 1UGOA 3AAAB 3FBLA 5ETWA 4WZXA 3AE4A 3LDQB 3GA8A 1KEYA 3LK2B 3JCFA 2VURA 4H63H 4X5TA 3MACA 5C8YE 1IBMT 2ZLYA 3ZMSB 2ACXA 1LVFA 4UEMA 1KNRA 4HWDA 3FXDB 5FVLA 3C98B 4EB6E 3BQIA 1OWAA 5JR9A 3AEEA 4X64T 3IEEA 2NWBA 4UV9B 5TAOA 4C90A 3OBVE 4DV7T 2D9DA 3ZYLA 2BDEA 4EIWA 2A72A 2LM9A 4IE7A 3EDVA 2LJLA 3NWIA 1XMOT 3OYZA 3MJXA 2C0SA 4PK4A 2CBIA 3KV4A 1KFYA 1HG2A 4TWHA 2DCFA 4JYAT 4ERRA 3P7IA 4IE6A 3AEFA 3ZYMA 1QLBA 3B13A 1MMNA 4U3CA 1I6ZA 1HNZT 3W15B 3WAKA 3ABVA 2CHOA 2WMOA 2P9BA 3CMLA 4H9PC 4DR3T 2UUBT 2W4XA 2XAFB 3CQCB 1XZYA 3RC3A 5FXZA 5JRCA 3UT5E 4EZHA 2VQFT 4C91A 1QUUA 2HN1A 2E2AA 4FI5A 3MXZA 3CX7B 4TWFA 2C5JA 1D1CA 4ISSA 2AE9A 3WI3A 5CA0E 2H7VC 4KHZF 3GN5B 2NTYA 1HR0T 3UU6A 3K1SA 2X9HA 4HE8A 4YJ3E 3AEAA 2UXNB 5AQTB 2CE7A 2CXLA 3K8PC 3UFGA 3J7Yq 5HXHA 5FXXA 3LK42 3AECA 5AQMB 2XM1A 4PJMA 3RIAA 2YDQA 4MLKA 1VRBA 2CPTA 4CQIA 3ZLIA 4YXDA 4KX6A 3LJCA 1J5ET 4HTEA 2VL0A 5FP3A 4H9NC 2FJDA 4JI7T 2WS3A 3JADA 4I55E 4EEBA 2WY2A 1ZKEA 4ZZBA 4UV8B 2KSRA 3CKDA 2FJAA 4YTNA 3ZCIA 2LKGA 3ZN1B 2FJBA 3UUNA 4X1YE 3UU3A 3RIUC 2VQET 3ONLC 5ADXL 4GK5E 5AQFB 1D0YA 4B3ST 4IDOA 1OXZA 4UF0A 4ZS3A 2LRLA 1G8XA 1W0AA 1XDOA 1E7PA 2X0LB 4O4IE 1OEDE 2N2NA 3CPZA 1Z8UA 2LKHA 3I1AA 1SE7A 2WM9A 2PG8A 3Q9DA 2V7LA 5JTGA 4HFHA 2A2FX 4AKGA 2VL8A 2UXCT 1HX1B 2XQ4A 1BR0A 2M6BA 4EGWA 5ABFB 4GKJT 2BKNA 1OEDB 2D5UA 2IW5B 2YU2A 4EV6A 1US7B 5M4YA 4MALA 1IJ6A 5H6QB 3N9QA 1HNWT 4O2AE 3I0QA 3AE8A 4I4TE 4LF6T 2B76A 3AEBA 3KBTA 3V5SA 3FZLB 1KK7A 3GN5A 1HNXT 2E5VA 5FY7A 4TNVA 2Q9QD 3RQWA 2E8IA 2LE8A 4H9QC 4CI3B 4K0UA 4HFBA 2MAWA 2WZIA 2VB6A 3L8RA 3ZT6A 4U33A 4ADZA 2HHHT 3AEGA 3BQLA 3QB5K 2KXPB 2V5DA 3N9NA 3AE6A 1O3XA 4AQGA 3RQUA 4GK0E 1JNZA 2XPKA 4JBWF 2YOEA 2BBHA 5AQUB 4TV9E 5LMNT 1BR4A 3ESLA 5HXCA 4LFBT 2UUCT 3UQ7A 1M62A 1CUNA 5AQHB 2Q9QC 2Q9QB 2FUPA 3G06A 4IE4A 3N9MA 5IUXA 4JUYA 3FHNA 4BJNA 2Y48B 3RRWA 1I94T 2KWHA 1YXRA 4OYKA 1WYBA 3ZSSA 5LGNB 3O1HA 3RH3A 2K5BB 3MZKB 4AQFA 2CHNA 2H7OA 4DR4T 1VCTA 4PJNA 4PAGA 4LF8T 3PUZF 3TLWA 1W09A 1Y64B 1UUSA 4A98A 4ILCA 1NAFA 2V7KA 3MKDA 3AE1A 5FL0A 4TWDA 3K3QC 2UUAT 2MBGA 4LFAT 1FEWA 4NXNT 5ABFA 5LHHB 2IC9A 1OEDA 3UTKA 4U7YA 5H6RB 3P4QA 3RYFE 2BVMA 3E08A 3QUJA 4DIDB 1YKEB 3NZQA 3RX6A 4OYJA 2CRBA 4DV0T 3PV0F 5LG3A 2CM0A 4AKLA 2X9YA 3HI2A 2JQHA 3R84B 1G73A 4CN1A 3LG7A 4IE0A 5JVDE 3AE3A 4DV2T 3N2GE 2JMHA 3EAMA 3O1JA 2VVNA 3OJAA 3ZJ1A 3UU4A 3U78A 2VKHA 5AQSB 2VVSA 3RRCA 4X1KE 5ABEA 4GKKT 1N34T 2PFVA 1HX8A 3S4UA 1YW0A 4QXCB 1IJ5A 3QC9A 2DL1A 4YTMA 3RKGA 3K3OA 3ONJA 2ODUA 3TKLB 1U5PA 1FIOA 3ZJ2A 1UK5A 2XSAA 2JQ9A 4QHOA 5J2TE 4MHCA 2R6GF 3AA7B 3HKCE 3N9LA 4Z91A 4JI0T 3NBXX 1E2AA 4XZCA 5LHGB 3KV6A 3L09A 2JMKA 4HEAA 2UXBT 2W63A 5JDNA 1BR2A 4F6RC 4CN6A 5JDQA 2WWVA 4HWHA 4MFRA 2LSIA 1HCIA 2MYSA 4B3TT 2V26A 3CWZB 3ZMVB 4O4HE 1EZ3A 2KZ7B 3LSVA 2ZMAA 4YLHA 2Y6XA 2Y8DA 4CN4A 2NOXA 4EZ4A 4DNDA 2BG9A 4PJJA 2NW7A 2K3WA 3AA0B 5GONE 5HXEA 2PTFA 3AAEB 2YEVC 2LOSA 1NWMX 2XQYA 3PTRB 5EZYE 4O4JE 2DHRA 4DV5T 4OK0A 2NTXA 4WNKA 4DUYT 3PUAA 3UUBA 2KNDA 1WRDA 4PFOA 5KX5E 4TNWA 3A8YC 5LOVE 4TUYE 3RYCE 2WB5A 4YHJA 2B1EA 2X0HA 2XAHB 1NENA 4IE5A 4JEUB 2ES0A 2HN2A 5HXSA 3N2KE 3AE9A 4KUMB 5L4HA 5HWYA 1T7SA 4QH4A 4XBFB 2V1DB 2M67A 5KXJA 3C4XA 4CXWA 3HA4A 3DTOA 2XUEA 2K24A 4P0BA 1D0ZA 3HKDE 3UQ4A 1XNQT 2YINA 3ETUA 4UELA 5HEHA 5ABGA 2KWIB 3I9WA 3PUYF 2SPCA 3PUQA 3CVRA 4AKIA 3ZC1A 2PJQA 4E7SA 2W61A 2XTLA 2OLTA 5J2UE 1ZEEA 2IUBA 4IDQA 4P09A 4LF7T 3ZPOA 2I6HA 4EEDA 3ZEFB 4IGUA 2IDOB 3PUVF 4JI4T 4I50E 1LKXA 2L3LA 2QYWA 2L8KA 4HFIA 1Y01A 4ZI3D 3HR0A 1ZHCA 2W66A 2W2UA 2XQ3A 4KBMB 4NIQA 5AQRB 3UUXB 2V7MA 2AXDS 3FBZA 4JI6T 5LA6E 4NPPA 2LT3A 3F57A 4HWCA 3RGLA 5L3DB 2L9QA 3HKEE 2ZM2A 4ANJA 2ZM6T 1MIYA 2HPLA 4DMWA 3AE7A 3CQXC 1MIVA 2W0GA 5HEOA 1N36T 4IL9A 2CLYC 5HEGA 4UIGA 2CLYB 1XNRT 4ZI3C 4ZHQE 4G2AA 2KINB 3I9YA 5L3GB 4O4LE 4DV6T 4NUVA 2IC6A 4WW0A 3PURA 3ZKRA 2BZBA 2WP9A 2J47A 2MTQA 3KV5A 2F4VT 2KT9A 3BQKA 2BKOA 5HCMA 5LBQB 3AA1B 2ACZA 4UVAB 2RP4A 2CXDA 2D0UA 4EAHA 3SRZA 3LBXB 2DNXA 2VWAA 2G0UA 3E0ZA 2XQ5A 2C5IT 3O1IA 2V7IA 3HL6A 1MIWA 4KP3C 3PJAA 1CHUA 2I59A 2WAUA 3NRXA 2LHNA 5LBMA 4ZZCA 2LLYA 3Q5DA 5JQGE 2KLQA 2QRXA 4HKAA 2LHRA 3UUMA 4WYVA 2LOPA 3AE5A 2E5LT 3VKHA 1IAPA 2V5CA 3RPUA 1IBLT 2WBLA 3AVRA 1VCSA 2YU1A 2JQKA 2E9XD 2GK9A 3C4WA 3PJAJ 2A3DA 2HPJA 4XAXB 1QSDA 2DWKA 5HYAA 3OTOT 1WR0A 3TLUA 4IHJE 5FY1A 2YN6A 2XAGB 4EYYR 2BBJA 5IYZE 5HEUA 2IMLA 2JJ9A 3X1DA 5FL1A 4G63A 3LK3B 4JI2T 4EOZB 3SWHA 1X9BA 4DR7T 2MPKA 3T8OA 5AQGB 1HTJF 2E9XC 2E9XB 2LEHA 2ZM0A 5AQQB 2MOZA 4HWFA 4CZZB 3I0OA 2D2SA 2KMFA 1IZNB 3MK7C 5J0ZA 1YQ4A 1WFDA 5LXTE 2EHOC 4OFZA 3MA9A 4ISTA 4AXPA 4ZXLA 3KDSE 2Z6EA 4X62T 1WLXA 3KVAA 1J1JA 2XQ8A 4GYRA 3ANWB 4IDNA 2DWGA 3CX8B 3AB3B 4HFVA 4MBQA 5BMVE 2WZHA 5JDHA 4YHHT 4GIWA 4DR1T 2BG9C 2VKDA 4Z90A 5LHIB 4UR9A 4BA9A 4FJOA 1D1AA 4AKRB 2I0MA 2UU9T 4X65T 4WBNE 5FNVE 2M6IA 3FZMB 3EI0A 3KFWX 1XDPA 5LNKA 3JC6C 5JR9C 4Q25A 4U31A 5JR9B 1V9DA 2XY8B 2WU2A 5CGMA 3VKGA 4DR2T 4HFCA 2OA5A 4JI8T 2LM2A 3ZN0B 5BR8T 2XZEA 3IF8B 1UCUA 5HAXA 4ZI2C 4DUZT 5LP6E 3AXJB 5L4EA 2VKOA 3VRAA 4LF4T 3RIFA 2NP9A 3OPCA 4WBOA 1HFAA 1FJGT 5IHYA 4JV5T 3A5XA 5C2TA 4K0KT 3NRYA 1Z0PA 2WU5A 4E7ZA 4V1Av 2LSJA 4L5GA 5L47A 3RLFF 2IIUA 2DI4A 5JRCB 5AQNB 2Q9QA 1W9RA 2K48A 2BS4A 1SA0E 5LYJE 3GWHA 4AQYT 1MMGA 2DLRA 3PUXF 5L3FB 2CEAA 1WYCA 3N2OA 5LCYA 2V8SV 4JI5T 4YFSA 3C4ZA 5IWAT 2UXXB 4QXBB 2X0YA 4YTPA 3LFMA 5AQPB 4DR5T 1YD8G 4I43B 4DO0A 3C64A 4HWIB 4B3RT 3CQGB 2IAKA 5AQVB 4DBRA 1XWMA 4A5XA 4HFDA 5DABA 3PE0A 3GMIA 5JDGA 2NW8A 1SHZC 4TZ4C 2RA1A 3VR9A 3QB5A 5FXWA 2CBJA 4GOUA 2YDRA 4CXYA 4J2CA 2CA5A 2XJ7A 2WSSV 4O8SA 2BS3A 3QOFA 5HCJA 3TLTA 3P50A 2CMRA 4B3MT 4I0UA 3B5MA 2D0TA 5EK2A 3ZT7A 3RF1A 4QH5A 1U4QA 4LFCT 1KNZA 2VK9A 4TN7B 2WDVA 4DV3T 4UVBB 3EABA 4IDZA 3UULA 4ZEYA 4U2ZA 3QK6A 3O4XE 4UF0B 1LVKA 4CI1B 3FZKB 3O9XA 5L3CB 3AXJA 1E1HB 3TLVA 1FMWA 3OKQA 3R6NA 1XMQT 2V7JA 5JH7E 2C5KT 2ZM8A 2CWYA 3VR8A 1M7KA 3A7MA 3EDUA 3SFEA 2LRKA 2XQ7A 3IA3A 5AQLB 3F2EA 4Z8XA 4IT4A 4QX8B 4CI2B 2W62A 1HG5A 1T98A 2XASB 3SS1A 4P0AA 5LB7B 3NVOA 3T1YT 4PFPA 5KMGP 2QVAA 2X9WA 4N78D 5EK3A 2JPFA 1KF6A 3DP7A 2LSGA 2BVLA 3CK6A
chains in the Genus database with same CATH topology
3K3QC 3VKHA 1IAPA 3LK2B 2WMNA 2JRKA 1FEWA 2X66A 2MBGA 3ZMTB 1UX5A 3RPUA 2WBLA 3AVRA 4H63H 5LHHB 3MACA 5C8YE 2IC9A 3UTKA 2YU1A 5H6RB 2ZLYA 3RYFE 2BVMA 2ODVA 3E08A 3QUJA 3ZMSB 2ACXA 2E9XD 1LVFA 4BJMA 1YKEB 2GK9A 3NZQA 3C4WA 4OYJA 4UEMA 3M65A 2A3DA 2HPJA 4XAXB 3RX6A 5A1LA 3PUGA 3N9PA 1QSDA 2DWKA 3FXDB 5HYAA 2CM0A 3ZYKA 2X9XA 3C98B 2X9YA 3K3NA 4AKLA 3HI2A 5FYMA 3R84B 4EB6E 3BQIA 4IHJE 1OWAA 5JR9A 2X51A 1G73A 5FY1A 2XAGB 4EYYR 3IEEA 3LG7A 2NWBA 2XAQB 4IE0A 5IYZE 4UV9B 5JVDE 5TAOA 3N2GE 4C90A 3OBVE 2JMHA 2JJ9A 3O1JA 3ZMUB 1D1BA 4G63A 3ZYLA 2BDEA 4EIWA 1ZV4X 3LK3B 3OJAA 3FXEB 3ZJ1A 2A72A 3U78A 2QA7A 2LM9A 2VKHA 2PBIA 4IE7A 3EDVA 5JDMA 4EOZB 2HH7A 3SWHA 2LJLA 3RRCA 3T8OA 5L3EB 4X1KE 4YJ2E 3OYZA 3MJXA 2C0SA 4PK4A 3BK9A 2PFVA 1HX8A 1HTJF 2E9XC 3S4UA 2E9XB 1YW0A 3KV4A 4QXCB 2LEHA 1HG2A 2ZM0A 1IJ5A 2DCFA 3QC9A 2MOZA 4ERRA 3P7IA 4CZZB 4IE6A 3RKOA 3ZYMA 5JDFA 3I0OA 3K3OA 2D2SA 2KMFA 4DBQA 1IZNB 2ODUA 3TKLB 3MK7C 1U5PA 5LJNA 1FIOA 3B13A 3ZJ2A 1MMNA 5LXTE 2EHOC 4OFZA 4QHOA 3MA9A 3W15B 3WAKA 5J2TE 4JLEA 4MHCA 4ISTA 2VKJA 2WMOA 3AA7B 2P9BA 3HKCE 3CMLA 3N9LA 4AQFC 4H9PC 2WWUA 4AXPA 3ETVA 3KDSE 3NBXX 5L3BB 2Z6EA 2XAFB 3EVYA 3ZMZB 3CQCB 1X79A 4NUUA 4XZCA 3KV6A 5LHGB 4TX5A 4GYSA 3RC3A 3L09A 2JMKA 5FXZA 5JRCA 4PW8A 1WLXA 3KVAA 4U72A 3UT5E 4HEAA 4GYRA 2W63A 5JDLA 5JDNA 4EZHA 3VU7H 1BR2A 4C91A 1QUUA 4F6RC 5L2LA 3ANWB 1HF8A 2DWGA 5JDQA 3CX8B 4FI5A 3MXZA 3C51A 3CX7B 4MFRA 3AB3B 4HFVA 4MBQA 2LSIA 5BMVE 1HCIA 3P8CD 2C5JA 5DQVA 2MYSA 1D1CA 4ISSA 3L3PA 2V26A 5JDHA 4GIWA 3WI3A 5CA0E 3CWZB 2H7VC 3ZMVB 5FY0A 4O4HE 1EZ3A 2KZ7B 4YLHA 2ZMAA 2Y6XA 2VKDA 4KMCA 3GN5B 5LHIB 2NTYA 2Y8DA 3ZC0A 4EZ4A 2NOXA 4DNDA 5LGUB 3U3IA 4ZOLE 2X9HA 4HE8A 4YJ3E 4BA9A 4PJJA 2NW7A 2UXNB 2CE7A 3RYIE 4FJOA 1D1AA 2CXLA 3K8PC 4AKRB 3AA0B 4B6XA 5GONE 4EYUA 3J7Yq 1LRZA 1H7CA 4ILUA 5HXHA 5HXEA 4UXNB 5FXXA 4WBNE 5FNVE 3LK42 5F8PA 4A56A 3N5LA 3KFWX 5LNKA 3AAEB 4PJMA 2YEVC 3JC6C 5JR9C 3C50A 2LOSA 5JR9B 3AAIA 1AJ3A 4MLKA 1NWMX 1VRBA 4BAYB 2XQYA 1V9DA 4CQIA 3Q5WA 1BR1A 3PTRB 5EZYE 4O4JE 3ZLIA 2DHRA 2EHOD 2K9AA 2LSKA 3VKGA 5HWXA 3LJCA 4OK0A 2NTXA 4HTEA 5DJQC 2OA5A 5FP3A 3SOLA 4WNKA 3PUAA 3KBUA 4H9NC 4IIJE 3DJBA 4PNIA 3ZN0B 1MMAA 4PJLA 2KNDA 1WRDA 3KV9A 4PFOA 5KX5E 3IF8B 4I55E 1UCUA 5HAXA 4ZI2C 3KINB 5LOVE 4ZS2A 5LP6E 1ZKEA 4TUYE 4UV8B 3RYCE 2VKOA 3CKDA 3H37A 5FXVA 4HN9A 4YHJA 3ZCIA 4QKNA 2B1EA 2XAHB 3ZN1B 5EK4A 3UFEA 5F3JA 4IE5A 2NP9A 3OYXA 4JEUB 5FMNA 3UUNA 4X1YE 2ES0A 3IBPA 5HXSA 1S94A 3N2KE 4JEHB 4X20E 5ADXL 4GK5E 1HFAA 4KUMB 4WBOA 5HWYA 3NZPA 3RYHE 5IHYA 3A5XA 1D0YA 3ONXA 3Q2MA 5LGTB 4XBFB 2V1DB 2M67A 3VHLA 4EXTA 1HS7A 2CWOA 3NRYA 3C4XA 1OXZA 3CX6B 4UF0A 4CXWA 1Z0PA 2EHOB 3DTOA 3HA4A 4L0RA 4ZS3A 2XUEA 4E7ZA 4H9OC 4V1Av 2K24A 5CB4E 4P0BA 1G8XA 4DMVA 2LSJA 1D0ZA 5KDMC 4L5GA 3HKDE 2YINA 3ETUA 2DI4A 4UVCB 5JRCB 4UELA 4M1PA 2X0LB 2N9DA 4O4IE 2Q9QA 2KWIB 5LJMA 3I9WA 2K48A 3AVSA 2SPCA 3PUQA 3CVRA 2N2NA 5LG4A 4AKIA 3CPZA 3N9OA 3ZC1A 1SA0E 5LYJE 2PJQA 3GWHA 4QXHB 3I1AA 4E7SA 3JC6D 2W61A 2XTLA 1MMGA 2DLRA 2WM9A 5E0OA 5L3FB 2CEAA 2PG8A 4H9SE 1WYCA 5J2UE 3PU8A 5AFUL 3N2OA 4H9RC 3Q9DA 2V7LA 1ZEEA 2H3RA 4P09A 5LCYA 2A2FX 4AKGA 3ZPOA 2VL8A 2YK0A 4YFSA 3C4ZA 3LBXA 3ZEFB 3B57A 4IGUA 2UXXB 1BR0A 4QXBB 2LSYA 3LFMA 4H63V 1YD8G 4I43B 4DO0A 4ZI2D 3C64A 2D5UA 2IW5B 4I50E 2YU2A 1LKXA 1US7B 2W00A 3CQGB 5M4YA 2L3LA 4HGAA 1IJ6A 1D0XA 4MALA 5H6QB 2L8KA 2CCQA 2IAKA 3N9QA 4DBRA 2CXFA 4O2AE 1FMVA 3FB2A 3I0QA 4I4TE 3IHRA 4OHFA 1VOMA 3KBTA 3V5SA 5DABA 3PE0A 4X1IE 3GMIA 3HR0A 4DVDA 4ZI3D 5JDGA 2NW8A 1ZHCA 1KK7A 4KBMB 1SHZC 3D0TA 3HKBE 4TZ4C 3GN5A 2RA1A 4CXXA 3UUXB 2V7MA 5FY7A 5FXWA 3FBZA 4GOUA 3KVBA 5LA6E 4CXYA 2LT3A 4J2CA 3F57A 3E22E 1MMDA 2Q9QD 2CA5A 5L3DB 4AKHA 2E8IA 2L9QA 2X68A 2WSSV 2LE8A 4O8SA 4H9QC 3HKEE 2ZM2A 2NW9A 4ANJA 4CI3B 4K0UA 2VASA 2CMRA 2VB6A 3V5UA 1MIYA 2D0TA 2J1DG 5EK2A 2HPLA 4DMWA 4ADZA 1U4QA 3AA6B 3BQLA 3CQXC 1MIVA 2W0GA 5DQWA 2KXPB 5J1GA 1KNZA 2VK9A 4TN7B 3H3AA 2XAJB 3N9NA 2XHEB 4UVBB 1O3XA 3RC8A 4AQGA 2CLYC 4GK0E 2CLYB 4IDZA 4UIGA 4ASKA 3UULA 4ZI3C 5JREA 4ZHQE 4G2AA 2QGSA 3QK6A 3O4XE 2KINB 4UF0B 1LVKA 1MNEA 4CI1B 4TV8E 3I9YA 3F31A 4TV9E 5L3GB 1BR4A 4O4LE 3ESLA 3O9XA 5L3CB 4NUVA 1E1HB 3PUSA 4O2BE 1S35A 3J9X1 4AI6A 5HXCA 1FMWA 3OKQA 3R6NA 2IC6A 1B7TA 2V7JA 1CUNA 4WW0A 2Q9QC 4L9IA 5JH7E 2C5KT 2Q9QB 2ZM8A 3PURA 4QWNB 2BZBA 2E9XA 4IE4A 2CWYA 3N9MA 1MNDA 1UX4A 3EUHA 4JUYA 2MTQA 3PU3A 3FHNA 1WR6A 3KV5A 4BJNA 2KT9A 3BQKA 5LBQB 2Y48B 3RRWA 3EDUA 3Q5XA 5HXRA 2KWHA 3AA1B 4OYKA 4UVAB 1WYBA 2EHOA 2RP4A 2CXDA 2D0UA 5LGNB 3O1HA 4QX7B 4EAHA 3F2EA 3RH3A 4Z8XA 2K5BB 3MZKB 4AQFA 3SRZA 3LBXB 4QX8B 2DNXA 2VWAA 4PK6A 2G0UA 4CI2B 3E0ZA 2W62A 2H7OA 1YKHB 1HG5A 1T98A 2XASB 2C5IT 3ZCJA 2X67A 4U74A 3SS1A 3O1IA 4P0AA 2V7IA 3HL6A 5CA1E 4PJNA 3WAJA 4PAGA 2JQQA 1MIWA 4PFPA 4KP3C 5KMGP 4ZI7E 3PDYA 3ANWA 2X9WA 2I59A 4PK5A 2WAUA 3NRXA 2LHNA 5LBMA 4N78D 5EK3A 2N1GA 1Y64B 3AAAB 3FBLA 5JQGE 2KLQA 5ETWA 2JPFA 3DP7A 4HKAA 2LHRA 1NAFA 2LSGA 3UUMA 2BVLA 2V7KA 2LOPA 3MKDA 3GA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMV A;  3SRZ A;  2BVM A;  2VKH A;  2VL8 A;  4DMW A;  2VK9 A;  2BVL A;  3SS1 A;  2VKD A;  4ERR A; 
#chains in the Genus database with same CATH topology
 3CIR A;  1ZOY A;  2WMN A;  2JRK A;  2X66 A;  3ZMT B;  1UX5 A;  2J62 A;  3ZT5 A;  2H89 A;  2ODV A;  4BJM A;  5A1L A;  3M65 A;  4DV4 T;  1GQE A;  3PUG A;  4U2Y A;  3N9P A;  3UU5 A;  4AIS A;  3ZYK A;  2X9X A;  3K3N A;  5FYM A;  2X51 A;  3QNU A;  2XAQ B;  4QH1 A;  4LMK A;  3ZMU B;  1D1B A;  4HFE A;  1ZV4 X;  2J4G A;  3FXE B;  2QA7 A;  2PBI A;  2BKP A;  5AQK B;  5JDM A;  2HH7 A;  5L3E B;  4YJ2 E;  3BK9 A;  4ILA A;  5F5W A;  3Q5E A;  5LMU T;  3JAE A;  3P4P A;  2A9U A;  4LML A;  1WCR A;  3RKO A;  2OV9 A;  5AQJ B;  5JDF A;  4DBQ A;  1KNP A;  5LJN A;  4JLE A;  1NEK A;  4LF9 T;  2VKJ A;  4COF A;  4AQF C;  2WWU A;  3ETV A;  5L3B B;  3EVY A;  3ZMZ B;  4NUU A;  1X79 A;  2V6X A;  4TX5 A;  4GYS A;  4YY3 T;  4PW8 A;  4U72 A;  5JDL A;  3VU7 H;  5L2L A;  4KHP T;  1HF8 A;  2V6Y B;  2WQY A;  3C51 A;  1W0B A;  1T72 A;  3P8C D;  1N33 T;  5DQV A;  3L3P A;  3RI5 A;  5FY0 A;  2YKS A;  4KMC A;  3ZC0 A;  5LGU B;  1OED C;  3U3I A;  4ZOL E;  2H88 A;  3RYI E;  1L0V A;  1T8B A;  1SUM B;  3PUW F;  4B6X A;  4EYU A;  1LRZ A;  1H7C A;  4ILU A;  4UXN B;  5F8P A;  4A56 A;  3N5L A;  3C50 A;  3AAI A;  1AJ3 A;  4BAY B;  3Q5W A;  1BR1 A;  4U7I A;  3UU8 A;  2XSB A;  2EHO D;  2K9A A;  2LSK A;  5HWX A;  5DJQ C;  3AED A;  3SOL A;  3KBU A;  4IIJ E;  4NXM T;  3DJB A;  4PNI A;  1MMA A;  4PJL A;  3H3M A;  3KV9 A;  5HEJ A;  3KIN B;  4ZS2 A;  3M3Z B;  3H37 A;  5FXV A;  2XQ9 A;  4HN9 A;  4QKN A;  5EK4 A;  3UFE A;  2W67 A;  5F3J A;  3OYX A;  5FMN A;  4LMJ A;  3FZF B;  3ZST A;  3IBP A;  5ABH A;  1S94 A;  4JEH B;  4OX9 T;  4X20 E;  4A97 A;  3NZP A;  3RYH E;  4JI1 T;  3ONX A;  3Q2M A;  5LGT B;  3RIU A;  3VHL A;  4EXT A;  1HS7 A;  2XQA A;  1UUR A;  2CWO A;  3CX6 B;  1R8I A;  1DU2 A;  2EHO B;  4L0R A;  3SFD A;  4H9O C;  1N32 T;  1JNR A;  5FKY A;  5CB4 E;  4DMV A;  2BG9 E;  1IBK T;  5KDM C;  2XM2 A;  4UVC B;  4M1P A;  2N9D A;  4YSY A;  5LJM A;  3AVS A;  5LG4 A;  3N9O A;  4QXH B;  2NR4 A;  1ZP0 A;  3P4R A;  3JC6 D;  3T1H T;  5E0O A;  4LF5 T;  2FBW A;  4H9S E;  3PU8 A;  5AFU L;  4H9R C;  2H3R A;  5C3J A;  2YK0 A;  5AQO B;  2BG9 B;  3LBX A;  3B57 A;  4IRE A;  2LSY A;  1J5W A;  2WDR A;  3VRB A;  4H63 V;  2JIW A;  4ZI2 D;  4AIU A;  2V6Y A;  2W00 A;  4HGA A;  1D0X A;  2CCQ A;  2CXF A;  3P4W A;  3RHW A;  1FMV A;  3FB2 A;  4DR6 T;  3IHR A;  2WDQ A;  4JI3 T;  4OHF A;  1VOM A;  4X1I E;  4DVD A;  5AQI B;  3D0T A;  3HKB E;  4ILB A;  4CXX A;  3AE2 A;  3KVB A;  3E22 E;  1MMD A;  4P1N A;  5CJ5 A;  4AKH A;  2X68 A;  5FVK A;  2NW9 A;  3OVU A;  4IL4 A;  3FZH B;  2VAS A;  3V5U A;  3TLS A;  2J1D G;  2XQ6 A;  3AA6 B;  5DQW A;  3NKZ A;  5J1G A;  1YQ3 A;  3H3A A;  2XAJ B;  2XHE B;  3RC8 A;  2FJE A;  4YT0 A;  4ASK A;  5JRE A;  4YSZ A;  2UXD T;  2QGS A;  5CFB A;  1MNE A;  4TV8 E;  3F31 A;  4DV1 T;  2WCA A;  2RPA A;  3PUS A;  4O2B E;  4AI6 A;  1S35 A;  3J9X 1;  1B7T A;  4L9I A;  4QWN B;  2E9X A;  1MND A;  4X66 T;  1UX4 A;  3EUH A;  3PU3 A;  1WR6 A;  3Q5X A;  5HXR A;  4F8H A;  2EHO A;  4QX7 B;  3L39 A;  3EHZ A;  4PK6 A;  2BS2 A;  1YKH B;  4YSX A;  4KI0 F;  3ZCJ A;  2IHR 1;  2X67 A;  4U74 A;  5CA1 E;  3WAJ A;  2JQQ A;  4IDP A;  4ZI7 E;  3PDY A;  3ANW A;  3P4S A;  4PK5 A;  3JAF A;  2YDS A;  2N1G A;  1UGO A;  3AAA B;  3FBL A;  5ETW A;  4WZX A;  3AE4 A;  3LDQ B;  3GA8 A;  1KEY A;  3LK2 B;  3JCF A;  2VUR A;  4H63 H;  4X5T A;  3MAC A;  5C8Y E;  1IBM T;  2ZLY A;  3ZMS B;  2ACX A;  1LVF A;  4UEM A;  1KNR A;  4HWD A;  3FXD B;  5FVL A;  3C98 B;  4EB6 E;  3BQI A;  1OWA A;  5JR9 A;  3AEE A;  4X64 T;  3IEE A;  2NWB A;  4UV9 B;  5TAO A;  4C90 A;  3OBV E;  4DV7 T;  2D9D A;  3ZYL A;  2BDE A;  4EIW A;  2A72 A;  2LM9 A;  4IE7 A;  3EDV A;  2LJL A;  3NWI A;  1XMO T;  3OYZ A;  3MJX A;  2C0S A;  4PK4 A;  2CBI A;  3KV4 A;  1KFY A;  1HG2 A;  4TWH A;  2DCF A;  4JYA T;  4ERR A;  3P7I A;  4IE6 A;  3AEF A;  3ZYM A;  1QLB A;  3B13 A;  1MMN A;  4U3C A;  1I6Z A;  1HNZ T;  3W15 B;  3WAK A;  3ABV A;  2CHO A;  2WMO A;  2P9B A;  3CML A;  4H9P C;  4DR3 T;  2UUB T;  2W4X A;  2XAF B;  3CQC B;  1XZY A;  3RC3 A;  5FXZ A;  5JRC A;  3UT5 E;  4EZH A;  2VQF T;  4C91 A;  1QUU A;  2HN1 A;  2E2A A;  4FI5 A;  3MXZ A;  3CX7 B;  4TWF A;  2C5J A;  1D1C A;  4ISS A;  2AE9 A;  3WI3 A;  5CA0 E;  2H7V C;  4KHZ F;  3GN5 B;  2NTY A;  1HR0 T;  3UU6 A;  3K1S A;  2X9H A;  4HE8 A;  4YJ3 E;  3AEA A;  2UXN B;  5AQT B;  2CE7 A;  2CXL A;  3K8P C;  3UFG A;  3J7Y q;  5HXH A;  5FXX A;  3LK4 2;  3AEC A;  5AQM B;  2XM1 A;  4PJM A;  3RIA A;  2YDQ A;  4MLK A;  1VRB A;  2CPT A;  4CQI A;  3ZLI A;  4YXD A;  4KX6 A;  3LJC A;  1J5E T;  4HTE A;  2VL0 A;  5FP3 A;  4H9N C;  2FJD A;  4JI7 T;  2WS3 A;  3JAD A;  4I55 E;  4EEB A;  2WY2 A;  1ZKE A;  4ZZB A;  4UV8 B;  2KSR A;  3CKD A;  2FJA A;  4YTN A;  3ZCI A;  2LKG A;  3ZN1 B;  2FJB A;  3UUN A;  4X1Y E;  3UU3 A;  3RIU C;  2VQE T;  3ONL C;  5ADX L;  4GK5 E;  5AQF B;  1D0Y A;  4B3S T;  4IDO A;  1OXZ A;  4UF0 A;  4ZS3 A;  2LRL A;  1G8X A;  1W0A A;  1XDO A;  1E7P A;  2X0L B;  4O4I E;  1OED E;  2N2N A;  3CPZ A;  1Z8U A;  2LKH A;  3I1A A;  1SE7 A;  2WM9 A;  2PG8 A;  3Q9D A;  2V7L A;  5JTG A;  4HFH A;  2A2F X;  4AKG A;  2VL8 A;  2UXC T;  1HX1 B;  2XQ4 A;  1BR0 A;  2M6B A;  4EGW A;  5ABF B;  4GKJ T;  2BKN A;  1OED B;  2D5U A;  2IW5 B;  2YU2 A;  4EV6 A;  1US7 B;  5M4Y A;  4MAL A;  1IJ6 A;  5H6Q B;  3N9Q A;  1HNW T;  4O2A E;  3I0Q A;  3AE8 A;  4I4T E;  4LF6 T;  2B76 A;  3AEB A;  3KBT A;  3V5S A;  3FZL B;  1KK7 A;  3GN5 A;  1HNX T;  2E5V A;  5FY7 A;  4TNV A;  2Q9Q D;  3RQW A;  2E8I A;  2LE8 A;  4H9Q C;  4CI3 B;  4K0U A;  4HFB A;  2MAW A;  2WZI A;  2VB6 A;  3L8R A;  3ZT6 A;  4U33 A;  4ADZ A;  2HHH T;  3AEG A;  3BQL A;  3QB5 K;  2KXP B;  2V5D A;  3N9N A;  3AE6 A;  1O3X A;  4AQG A;  3RQU A;  4GK0 E;  1JNZ A;  2XPK A;  4JBW F;  2YOE A;  2BBH A;  5AQU B;  4TV9 E;  5LMN T;  1BR4 A;  3ESL A;  5HXC A;  4LFB T;  2UUC T;  3UQ7 A;  1M62 A;  1CUN A;  5AQH B;  2Q9Q C;  2Q9Q B;  2FUP A;  3G06 A;  4IE4 A;  3N9M A;  5IUX A;  4JUY A;  3FHN A;  4BJN A;  2Y48 B;  3RRW A;  1I94 T;  2KWH A;  1YXR A;  4OYK A;  1WYB A;  3ZSS A;  5LGN B;  3O1H A;  3RH3 A;  2K5B B;  3MZK B;  4AQF A;  2CHN A;  2H7O A;  4DR4 T;  1VCT A;  4PJN A;  4PAG A;  4LF8 T;  3PUZ F;  3TLW A;  1W09 A;  1Y64 B;  1UUS A;  4A98 A;  4ILC A;  1NAF A;  2V7K A;  3MKD A;  3AE1 A;  5FL0 A;  4TWD A;  3K3Q C;  2UUA T;  2MBG A;  4LFA T;  1FEW A;  4NXN T;  5ABF A;  5LHH B;  2IC9 A;  1OED A;  3UTK A;  4U7Y A;  5H6R B;  3P4Q A;  3RYF E;  2BVM A;  3E08 A;  3QUJ A;  4DID B;  1YKE B;  3NZQ A;  3RX6 A;  4OYJ A;  2CRB A;  4DV0 T;  3PV0 F;  5LG3 A;  2CM0 A;  4AKL A;  2X9Y A;  3HI2 A;  2JQH A;  3R84 B;  1G73 A;  4CN1 A;  3LG7 A;  4IE0 A;  5JVD E;  3AE3 A;  4DV2 T;  3N2G E;  2JMH A;  3EAM A;  3O1J A;  2VVN A;  3OJA A;  3ZJ1 A;  3UU4 A;  3U78 A;  2VKH A;  5AQS B;  2VVS A;  3RRC A;  4X1K E;  5ABE A;  4GKK T;  1N34 T;  2PFV A;  1HX8 A;  3S4U A;  1YW0 A;  4QXC B;  1IJ5 A;  3QC9 A;  2DL1 A;  4YTM A;  3RKG A;  3K3O A;  3ONJ A;  2ODU A;  3TKL B;  1U5P A;  1FIO A;  3ZJ2 A;  1UK5 A;  2XSA A;  2JQ9 A;  4QHO A;  5J2T E;  4MHC A;  2R6G F;  3AA7 B;  3HKC E;  3N9L A;  4Z91 A;  4JI0 T;  3NBX X;  1E2A A;  4XZC A;  5LHG B;  3KV6 A;  3L09 A;  2JMK A;  4HEA A;  2UXB T;  2W63 A;  5JDN A;  1BR2 A;  4F6R C;  4CN6 A;  5JDQ A;  2WWV A;  4HWH A;  4MFR A;  2LSI A;  1HCI A;  2MYS A;  4B3T T;  2V26 A;  3CWZ B;  3ZMV B;  4O4H E;  1EZ3 A;  2KZ7 B;  3LSV A;  2ZMA A;  4YLH A;  2Y6X A;  2Y8D A;  4CN4 A;  2NOX A;  4EZ4 A;  4DND A;  2BG9 A;  4PJJ A;  2NW7 A;  2K3W A;  3AA0 B;  5GON E;  5HXE A;  2PTF A;  3AAE B;  2YEV C;  2LOS A;  1NWM X;  2XQY A;  3PTR B;  5EZY E;  4O4J E;  2DHR A;  4DV5 T;  4OK0 A;  2NTX A;  4WNK A;  4DUY T;  3PUA A;  3UUB A;  2KND A;  1WRD A;  4PFO A;  5KX5 E;  4TNW A;  3A8Y C;  5LOV E;  4TUY E;  3RYC E;  2WB5 A;  4YHJ A;  2B1E A;  2X0H A;  2XAH B;  1NEN A;  4IE5 A;  4JEU B;  2ES0 A;  2HN2 A;  5HXS A;  3N2K E;  3AE9 A;  4KUM B;  5L4H A;  5HWY A;  1T7S A;  4QH4 A;  4XBF B;  2V1D B;  2M67 A;  5KXJ A;  3C4X A;  4CXW A;  3HA4 A;  3DTO A;  2XUE A;  2K24 A;  4P0B A;  1D0Z A;  3HKD E;  3UQ4 A;  1XNQ T;  2YIN A;  3ETU A;  4UEL A;  5HEH A;  5ABG A;  2KWI B;  3I9W A;  3PUY F;  2SPC A;  3PUQ A;  3CVR A;  4AKI A;  3ZC1 A;  2PJQ A;  4E7S A;  2W61 A;  2XTL A;  2OLT A;  5J2U E;  1ZEE A;  2IUB A;  4IDQ A;  4P09 A;  4LF7 T;  3ZPO A;  2I6H A;  4EED A;  3ZEF B;  4IGU A;  2IDO B;  3PUV F;  4JI4 T;  4I50 E;  1LKX A;  2L3L A;  2QYW A;  2L8K A;  4HFI A;  1Y01 A;  4ZI3 D;  3HR0 A;  1ZHC A;  2W66 A;  2W2U A;  2XQ3 A;  4KBM B;  4NIQ A;  5AQR B;  3UUX B;  2V7M A;  2AXD S;  3FBZ A;  4JI6 T;  5LA6 E;  4NPP A;  2LT3 A;  3F57 A;  4HWC A;  3RGL A;  5L3D B;  2L9Q A;  3HKE E;  2ZM2 A;  4ANJ A;  2ZM6 T;  1MIY A;  2HPL A;  4DMW A;  3AE7 A;  3CQX C;  1MIV A;  2W0G A;  5HEO A;  1N36 T;  4IL9 A;  2CLY C;  5HEG A;  4UIG A;  2CLY B;  1XNR T;  4ZI3 C;  4ZHQ E;  4G2A A;  2KIN B;  3I9Y A;  5L3G B;  4O4L E;  4DV6 T;  4NUV A;  2IC6 A;  4WW0 A;  3PUR A;  3ZKR A;  2BZB A;  2WP9 A;  2J47 A;  2MTQ A;  3KV5 A;  2F4V T;  2KT9 A;  3BQK A;  2BKO A;  5HCM A;  5LBQ B;  3AA1 B;  2ACZ A;  4UVA B;  2RP4 A;  2CXD A;  2D0U A;  4EAH A;  3SRZ A;  3LBX B;  2DNX A;  2VWA A;  2G0U A;  3E0Z A;  2XQ5 A;  2C5I T;  3O1I A;  2V7I A;  3HL6 A;  1MIW A;  4KP3 C;  3PJA A;  1CHU A;  2I59 A;  2WAU A;  3NRX A;  2LHN A;  5LBM A;  4ZZC A;  2LLY A;  3Q5D A;  5JQG E;  2KLQ A;  2QRX A;  4HKA A;  2LHR A;  3UUM A;  4WYV A;  2LOP A;  3AE5 A;  2E5L T;  3VKH A;  1IAP A;  2V5C A;  3RPU A;  1IBL T;  2WBL A;  3AVR A;  1VCS A;  2YU1 A;  2JQK A;  2E9X D;  2GK9 A;  3C4W A;  3PJA J;  2A3D A;  2HPJ A;  4XAX B;  1QSD A;  2DWK A;  5HYA A;  3OTO T;  1WR0 A;  3TLU A;  4IHJ E;  5FY1 A;  2YN6 A;  2XAG B;  4EYY R;  2BBJ A;  5IYZ E;  5HEU A;  2IML A;  2JJ9 A;  3X1D A;  5FL1 A;  4G63 A;  3LK3 B;  4JI2 T;  4EOZ B;  3SWH A;  1X9B A;  4DR7 T;  2MPK A;  3T8O A;  5AQG B;  1HTJ F;  2E9X C;  2E9X B;  2LEH A;  2ZM0 A;  5AQQ B;  2MOZ A;  4HWF A;  4CZZ B;  3I0O A;  2D2S A;  2KMF A;  1IZN B;  3MK7 C;  5J0Z A;  1YQ4 A;  1WFD A;  5LXT E;  2EHO C;  4OFZ A;  3MA9 A;  4IST A;  4AXP A;  4ZXL A;  3KDS E;  2Z6E A;  4X62 T;  1WLX A;  3KVA A;  1J1J A;  2XQ8 A;  4GYR A;  3ANW B;  4IDN A;  2DWG A;  3CX8 B;  3AB3 B;  4HFV A;  4MBQ A;  5BMV E;  2WZH A;  5JDH A;  4YHH T;  4GIW A;  4DR1 T;  2BG9 C;  2VKD A;  4Z90 A;  5LHI B;  4UR9 A;  4BA9 A;  4FJO A;  1D1A A;  4AKR B;  2I0M A;  2UU9 T;  4X65 T;  4WBN E;  5FNV E;  2M6I A;  3FZM B;  3EI0 A;  3KFW X;  1XDP A;  5LNK A;  3JC6 C;  5JR9 C;  4Q25 A;  4U31 A;  5JR9 B;  1V9D A;  2XY8 B;  2WU2 A;  5CGM A;  3VKG A;  4DR2 T;  4HFC A;  2OA5 A;  4JI8 T;  2LM2 A;  3ZN0 B;  5BR8 T;  2XZE A;  3IF8 B;  1UCU A;  5HAX A;  4ZI2 C;  4DUZ T;  5LP6 E;  3AXJ B;  5L4E A;  2VKO A;  3VRA A;  4LF4 T;  3RIF A;  2NP9 A;  3OPC A;  4WBO A;  1HFA A;  1FJG T;  5IHY A;  4JV5 T;  3A5X A;  5C2T A;  4K0K T;  3NRY A;  1Z0P A;  2WU5 A;  4E7Z A;  4V1A v;  2LSJ A;  4L5G A;  5L47 A;  3RLF F;  2IIU A;  2DI4 A;  5JRC B;  5AQN B;  2Q9Q A;  1W9R A;  2K48 A;  2BS4 A;  1SA0 E;  5LYJ E;  3GWH A;  4AQY T;  1MMG A;  2DLR A;  3PUX F;  5L3F B;  2CEA A;  1WYC A;  3N2O A;  5LCY A;  2V8S V;  4JI5 T;  4YFS A;  3C4Z A;  5IWA T;  2UXX B;  4QXB B;  2X0Y A;  4YTP A;  3LFM A;  5AQP B;  4DR5 T;  1YD8 G;  4I43 B;  4DO0 A;  3C64 A;  4HWI B;  4B3R T;  3CQG B;  2IAK A;  5AQV B;  4DBR A;  1XWM A;  4A5X A;  4HFD A;  5DAB A;  3PE0 A;  3GMI A;  5JDG A;  2NW8 A;  1SHZ C;  4TZ4 C;  2RA1 A;  3VR9 A;  3QB5 A;  5FXW A;  2CBJ A;  4GOU A;  2YDR A;  4CXY A;  4J2C A;  2CA5 A;  2XJ7 A;  2WSS V;  4O8S A;  2BS3 A;  3QOF A;  5HCJ A;  3TLT A;  3P50 A;  2CMR A;  4B3M T;  4I0U A;  3B5M A;  2D0T A;  5EK2 A;  3ZT7 A;  3RF1 A;  4QH5 A;  1U4Q A;  4LFC T;  1KNZ A;  2VK9 A;  4TN7 B;  2WDV A;  4DV3 T;  4UVB B;  3EAB A;  4IDZ A;  3UUL A;  4ZEY A;  4U2Z A;  3QK6 A;  3O4X E;  4UF0 B;  1LVK A;  4CI1 B;  3FZK B;  3O9X A;  5L3C B;  3AXJ A;  1E1H B;  3TLV A;  1FMW A;  3OKQ A;  3R6N A;  1XMQ T;  2V7J A;  5JH7 E;  2C5K T;  2ZM8 A;  2CWY A;  3VR8 A;  1M7K A;  3A7M A;  3EDU A;  3SFE A;  2LRK A;  2XQ7 A;  3IA3 A;  5AQL B;  3F2E A;  4Z8X A;  4IT4 A;  4QX8 B;  4CI2 B;  2W62 A;  1HG5 A;  1T98 A;  2XAS B;  3SS1 A;  4P0A A;  5LB7 B;  3NVO A;  3T1Y T;  4PFP A;  5KMG P;  2QVA A;  2X9W A;  4N78 D;  5EK3 A;  2JPF A;  1KF6 A;  3DP7 A;  2LSG A;  2BVL A;  3CK6 A; 
#chains in the Genus database with same CATH homology
 3K3Q C;  3VKH A;  1IAP A;  3LK2 B;  2WMN A;  2JRK A;  1FEW A;  2X66 A;  2MBG A;  3ZMT B;  1UX5 A;  3RPU A;  2WBL A;  3AVR A;  4H63 H;  5LHH B;  3MAC A;  5C8Y E;  2IC9 A;  3UTK A;  2YU1 A;  5H6R B;  2ZLY A;  3RYF E;  2BVM A;  2ODV A;  3E08 A;  3QUJ A;  3ZMS B;  2ACX A;  2E9X D;  1LVF A;  4BJM A;  1YKE B;  2GK9 A;  3NZQ A;  3C4W A;  4OYJ A;  4UEM A;  3M65 A;  2A3D A;  2HPJ A;  4XAX B;  3RX6 A;  5A1L A;  3PUG A;  3N9P A;  1QSD A;  2DWK A;  3FXD B;  5HYA A;  2CM0 A;  3ZYK A;  2X9X A;  3C98 B;  2X9Y A;  3K3N A;  4AKL A;  3HI2 A;  5FYM A;  3R84 B;  4EB6 E;  3BQI A;  4IHJ E;  1OWA A;  5JR9 A;  2X51 A;  1G73 A;  5FY1 A;  2XAG B;  4EYY R;  3IEE A;  3LG7 A;  2NWB A;  2XAQ B;  4IE0 A;  5IYZ E;  4UV9 B;  5JVD E;  5TAO A;  3N2G E;  4C90 A;  3OBV E;  2JMH A;  2JJ9 A;  3O1J A;  3ZMU B;  1D1B A;  4G63 A;  3ZYL A;  2BDE A;  4EIW A;  1ZV4 X;  3LK3 B;  3OJA A;  3FXE B;  3ZJ1 A;  2A72 A;  3U78 A;  2QA7 A;  2LM9 A;  2VKH A;  2PBI A;  4IE7 A;  3EDV A;  5JDM A;  4EOZ B;  2HH7 A;  3SWH A;  2LJL A;  3RRC A;  3T8O A;  5L3E B;  4X1K E;  4YJ2 E;  3OYZ A;  3MJX A;  2C0S A;  4PK4 A;  3BK9 A;  2PFV A;  1HX8 A;  1HTJ F;  2E9X C;  3S4U A;  2E9X B;  1YW0 A;  3KV4 A;  4QXC B;  2LEH A;  1HG2 A;  2ZM0 A;  1IJ5 A;  2DCF A;  3QC9 A;  2MOZ A;  4ERR A;  3P7I A;  4CZZ B;  4IE6 A;  3RKO A;  3ZYM A;  5JDF A;  3I0O A;  3K3O A;  2D2S A;  2KMF A;  4DBQ A;  1IZN B;  2ODU A;  3TKL B;  3MK7 C;  1U5P A;  5LJN A;  1FIO A;  3B13 A;  3ZJ2 A;  1MMN A;  5LXT E;  2EHO C;  4OFZ A;  4QHO A;  3MA9 A;  3W15 B;  3WAK A;  5J2T E;  4JLE A;  4MHC A;  4IST A;  2VKJ A;  2WMO A;  3AA7 B;  2P9B A;  3HKC E;  3CML A;  3N9L A;  4AQF C;  4H9P C;  2WWU A;  4AXP A;  3ETV A;  3KDS E;  3NBX X;  5L3B B;  2Z6E A;  2XAF B;  3EVY A;  3ZMZ B;  3CQC B;  1X79 A;  4NUU A;  4XZC A;  3KV6 A;  5LHG B;  4TX5 A;  4GYS A;  3RC3 A;  3L09 A;  2JMK A;  5FXZ A;  5JRC A;  4PW8 A;  1WLX A;  3KVA A;  4U72 A;  3UT5 E;  4HEA A;  4GYR A;  2W63 A;  5JDL A;  5JDN A;  4EZH A;  3VU7 H;  1BR2 A;  4C91 A;  1QUU A;  4F6R C;  5L2L A;  3ANW B;  1HF8 A;  2DWG A;  5JDQ A;  3CX8 B;  4FI5 A;  3MXZ A;  3C51 A;  3CX7 B;  4MFR A;  3AB3 B;  4HFV A;  4MBQ A;  2LSI A;  5BMV E;  1HCI A;  3P8C D;  2C5J A;  5DQV A;  2MYS A;  1D1C A;  4ISS A;  3L3P A;  2V26 A;  5JDH A;  4GIW A;  3WI3 A;  5CA0 E;  3CWZ B;  2H7V C;  3ZMV B;  5FY0 A;  4O4H E;  1EZ3 A;  2KZ7 B;  4YLH A;  2ZMA A;  2Y6X A;  2VKD A;  4KMC A;  3GN5 B;  5LHI B;  2NTY A;  2Y8D A;  3ZC0 A;  4EZ4 A;  2NOX A;  4DND A;  5LGU B;  3U3I A;  4ZOL E;  2X9H A;  4HE8 A;  4YJ3 E;  4BA9 A;  4PJJ A;  2NW7 A;  2UXN B;  2CE7 A;  3RYI E;  4FJO A;  1D1A A;  2CXL A;  3K8P C;  4AKR B;  3AA0 B;  4B6X A;  5GON E;  4EYU A;  3J7Y q;  1LRZ A;  1H7C A;  4ILU A;  5HXH A;  5HXE A;  4UXN B;  5FXX A;  4WBN E;  5FNV E;  3LK4 2;  5F8P A;  4A56 A;  3N5L A;  3KFW X;  5LNK A;  3AAE B;  4PJM A;  2YEV C;  3JC6 C;  5JR9 C;  3C50 A;  2LOS A;  5JR9 B;  3AAI A;  1AJ3 A;  4MLK A;  1NWM X;  1VRB A;  4BAY B;  2XQY A;  1V9D A;  4CQI A;  3Q5W A;  1BR1 A;  3PTR B;  5EZY E;  4O4J E;  3ZLI A;  2DHR A;  2EHO D;  2K9A A;  2LSK A;  3VKG A;  5HWX A;  3LJC A;  4OK0 A;  2NTX A;  4HTE A;  5DJQ C;  2OA5 A;  5FP3 A;  3SOL A;  4WNK A;  3PUA A;  3KBU A;  4H9N C;  4IIJ E;  3DJB A;  4PNI A;  3ZN0 B;  1MMA A;  4PJL A;  2KND A;  1WRD A;  3KV9 A;  4PFO A;  5KX5 E;  3IF8 B;  4I55 E;  1UCU A;  5HAX A;  4ZI2 C;  3KIN B;  5LOV E;  4ZS2 A;  5LP6 E;  1ZKE A;  4TUY E;  4UV8 B;  3RYC E;  2VKO A;  3CKD A;  3H37 A;  5FXV A;  4HN9 A;  4YHJ A;  3ZCI A;  4QKN A;  2B1E A;  2XAH B;  3ZN1 B;  5EK4 A;  3UFE A;  5F3J A;  4IE5 A;  2NP9 A;  3OYX A;  4JEU B;  5FMN A;  3UUN A;  4X1Y E;  2ES0 A;  3IBP A;  5HXS A;  1S94 A;  3N2K E;  4JEH B;  4X20 E;  5ADX L;  4GK5 E;  1HFA A;  4KUM B;  4WBO A;  5HWY A;  3NZP A;  3RYH E;  5IHY A;  3A5X A;  1D0Y A;  3ONX A;  3Q2M A;  5LGT B;  4XBF B;  2V1D B;  2M67 A;  3VHL A;  4EXT A;  1HS7 A;  2CWO A;  3NRY A;  3C4X A;  1OXZ A;  3CX6 B;  4UF0 A;  4CXW A;  1Z0P A;  2EHO B;  3DTO A;  3HA4 A;  4L0R A;  4ZS3 A;  2XUE A;  4E7Z A;  4H9O C;  4V1A v;  2K24 A;  5CB4 E;  4P0B A;  1G8X A;  4DMV A;  2LSJ A;  1D0Z A;  5KDM C;  4L5G A;  3HKD E;  2YIN A;  3ETU A;  2DI4 A;  4UVC B;  5JRC B;  4UEL A;  4M1P A;  2X0L B;  2N9D A;  4O4I E;  2Q9Q A;  2KWI B;  5LJM A;  3I9W A;  2K48 A;  3AVS A;  2SPC A;  3PUQ A;  3CVR A;  2N2N A;  5LG4 A;  4AKI A;  3CPZ A;  3N9O A;  3ZC1 A;  1SA0 E;  5LYJ E;  2PJQ A;  3GWH A;  4QXH B;  3I1A A;  4E7S A;  3JC6 D;  2W61 A;  2XTL A;  1MMG A;  2DLR A;  2WM9 A;  5E0O A;  5L3F B;  2CEA A;  2PG8 A;  4H9S E;  1WYC A;  5J2U E;  3PU8 A;  5AFU L;  3N2O A;  4H9R C;  3Q9D A;  2V7L A;  1ZEE A;  2H3R A;  4P09 A;  5LCY A;  2A2F X;  4AKG A;  3ZPO A;  2VL8 A;  2YK0 A;  4YFS A;  3C4Z A;  3LBX A;  3ZEF B;  3B57 A;  4IGU A;  2UXX B;  1BR0 A;  4QXB B;  2LSY A;  3LFM A;  4H63 V;  1YD8 G;  4I43 B;  4DO0 A;  4ZI2 D;  3C64 A;  2D5U A;  2IW5 B;  4I50 E;  2YU2 A;  1LKX A;  1US7 B;  2W00 A;  3CQG B;  5M4Y A;  2L3L A;  4HGA A;  1IJ6 A;  1D0X A;  4MAL A;  5H6Q B;  2L8K A;  2CCQ A;  2IAK A;  3N9Q A;  4DBR A;  2CXF A;  4O2A E;  1FMV A;  3FB2 A;  3I0Q A;  4I4T E;  3IHR A;  4OHF A;  1VOM A;  3KBT A;  3V5S A;  5DAB A;  3PE0 A;  4X1I E;  3GMI A;  3HR0 A;  4DVD A;  4ZI3 D;  5JDG A;  2NW8 A;  1ZHC A;  1KK7 A;  4KBM B;  1SHZ C;  3D0T A;  3HKB E;  4TZ4 C;  3GN5 A;  2RA1 A;  4CXX A;  3UUX B;  2V7M A;  5FY7 A;  5FXW A;  3FBZ A;  4GOU A;  3KVB A;  5LA6 E;  4CXY A;  2LT3 A;  4J2C A;  3F57 A;  3E22 E;  1MMD A;  2Q9Q D;  2CA5 A;  5L3D B;  4AKH A;  2E8I A;  2L9Q A;  2X68 A;  2WSS V;  2LE8 A;  4O8S A;  4H9Q C;  3HKE E;  2ZM2 A;  2NW9 A;  4ANJ A;  4CI3 B;  4K0U A;  2VAS A;  2CMR A;  2VB6 A;  3V5U A;  1MIY A;  2D0T A;  2J1D G;  5EK2 A;  2HPL A;  4DMW A;  4ADZ A;  1U4Q A;  3AA6 B;  3BQL A;  3CQX C;  1MIV A;  2W0G A;  5DQW A;  2KXP B;  5J1G A;  1KNZ A;  2VK9 A;  4TN7 B;  3H3A A;  2XAJ B;  3N9N A;  2XHE B;  4UVB B;  1O3X A;  3RC8 A;  4AQG A;  2CLY C;  4GK0 E;  2CLY B;  4IDZ A;  4UIG A;  4ASK A;  3UUL A;  4ZI3 C;  5JRE A;  4ZHQ E;  4G2A A;  2QGS A;  3QK6 A;  3O4X E;  2KIN B;  4UF0 B;  1LVK A;  1MNE A;  4CI1 B;  4TV8 E;  3I9Y A;  3F31 A;  4TV9 E;  5L3G B;  1BR4 A;  4O4L E;  3ESL A;  3O9X A;  5L3C B;  4NUV A;  1E1H B;  3PUS A;  4O2B E;  1S35 A;  3J9X 1;  4AI6 A;  5HXC A;  1FMW A;  3OKQ A;  3R6N A;  2IC6 A;  1B7T A;  2V7J A;  1CUN A;  4WW0 A;  2Q9Q C;  4L9I A;  5JH7 E;  2C5K T;  2Q9Q B;  2ZM8 A;  3PUR A;  4QWN B;  2BZB A;  2E9X A;  4IE4 A;  2CWY A;  3N9M A;  1MND A;  1UX4 A;  3EUH A;  4JUY A;  2MTQ A;  3PU3 A;  3FHN A;  1WR6 A;  3KV5 A;  4BJN A;  2KT9 A;  3BQK A;  5LBQ B;  2Y48 B;  3RRW A;  3EDU A;  3Q5X A;  5HXR A;  2KWH A;  3AA1 B;  4OYK A;  4UVA B;  1WYB A;  2EHO A;  2RP4 A;  2CXD A;  2D0U A;  5LGN B;  3O1H A;  4QX7 B;  4EAH A;  3F2E A;  3RH3 A;  4Z8X A;  2K5B B;  3MZK B;  4AQF A;  3SRZ A;  3LBX B;  4QX8 B;  2DNX A;  2VWA A;  4PK6 A;  2G0U A;  4CI2 B;  3E0Z A;  2W62 A;  2H7O A;  1YKH B;  1HG5 A;  1T98 A;  2XAS B;  2C5I T;  3ZCJ A;  2X67 A;  4U74 A;  3SS1 A;  3O1I A;  4P0A A;  2V7I A;  3HL6 A;  5CA1 E;  4PJN A;  3WAJ A;  4PAG A;  2JQQ A;  1MIW A;  4PFP A;  4KP3 C;  5KMG P;  4ZI7 E;  3PDY A;  3ANW A;  2X9W A;  2I59 A;  4PK5 A;  2WAU A;  3NRX A;  2LHN A;  5LBM A;  4N78 D;  5EK3 A;  2N1G A;  1Y64 B;  3AAA B;  3FBL A;  5JQG E;  2KLQ A;  5ETW A;  2JPF A;  3DP7 A;  4HKA A;  2LHR A;  1NAF A;  2LSG A;  3UUM A;  2BVL A;  2V7K A;  2LOP A;  3MKD A;  3GA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...