4ERRA

1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
GQIFTVQELKERAKVFAKPIGASYQGILDQLDLVHQAKGRDQIAASFELNKKINDYIAEHPTSGRNQALTQLKEQVTSALGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Autotransporter adhesin
publication title 1.55 Angstrom Crystal Structure of the Four Helical Bundle Membrane Localization Domain (4HBM) of the Vibrio vulnificus MARTX Effector Domain DUF5.
rcsb
source organism Vibrio vulnificus
total genus 32
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4errA00
4DMWA 3SS1A 4DMVA 2VK9A 2VKHA 4ERRA 2VKDA 2BVMA 2VL8A 2BVLA 3SRZA
chains in the Genus database with same CATH superfamily
2LRLA 5FY1A 3ZPOA 2FJAA 3ZN0B 2LM9A 3ZC0A 4NUVA 3DJBA 3F31A 3PU3A 4IL9A 3B5MA 4H63H 4ZS2A 3VHLA 3RYHE 2LKGA 3QNUA 3ZC1A 5L4HA 2XPKA 2G0UA 4G63A 5CB4E 4DV4T 3L09A 4E7ZA 2LSYA 4ZOLE 5C2TA 2ZM0A 2IIUA 4EAHA 4HWCA 1FJGT 2FUPA 1HS7A 3EUHA 4PAGA 3LBXB 1MIWA 2JMKA 3QC9A 5E0OA 2WQYA 2V26A 4HFVA 4AISA 4ZXLA 2K9AA 2CXFA 2VL8A 3LDQB 3C50A 2DI4A 2IW5B 1LRZA 4ILAA 3I0QA 1LVKA 2IHR1 5FXXA 5KDMC 1MMAA 2MAWA 2KXPB 4QX8B 2PTFA 2Q9QD 2X66A 2ZM8A 4AKGA 2WDVA 3JCFA 1VCSA 2V6XA 3P8CD 3KV9A 5HWYA 1X9BA 2BBHA 5L3DB 1UK5A 2CXLA 4HWFA 3F57A 3ZKRA 3ZYLA 3IBPA 2E9XD 1QLBA 4EB6E 2N1GA 1VOMA 3ZCJA 3P4SA 2D2SA 4DVDA 1G8XA 5ABGA 3C4WA 4HTEA 4UEMA 4YSXA 3AAAB 1US7B 3ZMZB 2KINB 2ZLYA 5DQWA 3UU6A 2M6BA 2X0HA 5HAXA 3LK3B 3OBVE 2K5BB 5J1GA 5JREA 4AKIA 3EDVA 3AE7A 3N9OA 5ABFA 3JAFA 4DR6T 1OEDB 2XUEA 4OX9T 4DR1T 4GIWA 1SA0E 5F5WA 1Y01A 1MMDA 2F4VT 1IBKT 2ZM2A 2WWVA 5HEOA 5ADXL 2QGSA 4U2ZA 2UUBT 5BR8T 3VRBA 2EHOB 5HEGA 3OTOT 1XWMA 4PJNA 5H6QB 2WU5A 1HF8A 2WU2A 4P09A 2LSIA 3AA6B 1E2AA 2XAFB 3I0OA 2XAQB 1U5PA 1MMGA 3SFDA 2H7OA 4LMLA 4IDQA 2H7VC 3TLWA 1LKXA 3HKBE 1NAFA 5KX5E 1HNXT 5HCMA 1BR2A 5AQRB 5FXVA 1D0YA 1HCIA 2L8KA 3AE3A 2WDRA 3AEFA 2NTXA 3O1JA 3AAEB 1OEDC 3IF8B 2BVMA 4HFHA 4U7YA 5LHGB 2UUAT 3B57A 1KK7A 2XAGB 2A3DA 4UF0A 4CXYA 3KV6A 1SHZC 1MIYA 4H9QC 1V9DA 3K3QC 2W66A 5HXHA 5M4YA 2M67A 3BQLA 2I59A 4DV1T 1WRDA 1JNZA 3ZT6A 2XQ3A 1T8BA 4DR2T 4JI7T 2WP9A 1N34T 4NPPA 4O4LE 5FY7A 2VVNA 5AFUL 3ZMSB 4DBRA 2BBJA 1BR1A 4COFA 2VK9A 5FP3A 2CEAA 2XM2A 5C8YE 2QA7A 5IYZE 2XSAA 5EK3A 3FZMB 4IDOA 2W0GA 3I1AA 2BKNA 4QH4A 3EI0A 2V7LA 2H89A 1WYCA 2RPAA 3DP7A 4ZI2D 3H3AA 5JDNA 1XNRT 2V8SV 4DV6T 4MHCA 2W67A 3CK6A 3VU7H 2V7KA 4QWNB 4BA9A 3PU8A 4EEBA 3Q5DA 2Y48B 2OA5A 1EZ3A 1Z0PA 1U4QA 2V5CA 3UTKA 1HTJF 2XASB 3M65A 4WW0A 3PURA 5BMVE 4CI3B 2NW7A 5JRCB 2YINA 3T1YT 5JDLA 4IT4A 3EDUA 3RIFA 4JI8T 5CGMA 2LM2A 3TKLB 4DR5T 5JDGA 2IDOB 3H37A 1I6ZA 2OV9A 3RI5A 1CUNA 2CLYB 2VASA 2W2UA 1YQ3A 3QK6A 4AXPA 5JR9A 2UXXB 1W0AA 3FHNA 5IHYA 2NTYA 3ONJA 2JIWA 4HFBA 3JAEA 2PJQA 4XZCA 4IHJE 4TV9E 4ZS3A 3NRXA 3K8PC 2VQET 2RA1A 2CRBA 3LJCA 3Q9DA 5LGTB 1B7TA 2HH7A 2Q9QB 5LA6E 4LF8T 2J47A 4EXTA 5AQSB 2YDRA 4DNDA 2UXCT 4HFIA 5EZYE 4JI2T 4HKAA 4H9SE 2JMHA 4ISTA 2XAJB 2QVAA 4HWHA 3E08A 1MIVA 2LJLA 4ZHQE 4OK0A 4MALA 3RRWA 4U74A 4WBOA 4KHPT 2UU9T 4OYJA 4QH1A 3N2GE 5LBQB 2CLYC 3KVAA 1XZYA 1W9RA 3B13A 4GKJT 3UUBA 4A56A 2YK0A 4ANJA 2K3WA 4PNIA 2UXBT 2XQ8A 3AA1B 2XQAA 1XNQT 5FNVE 4DV0T 1KF6A 3LK2B 2Q9QC 5TAOA 4IE5A 2JJ9A 3MZKB 5LOVE 4X62T 1KFYA 3RIAA 5AQTB 2V1DB 4DUZT 3CX6B 3RRCA 2XY8B 1D0ZA 2MYSA 2BVLA 2NOXA 2A72A 2H88A 3T8OA 3R6NA 4YT0A 2WZHA 3CQGB 1KNPA 2WS3A 4ILBA 4DR7T 2YU1A 3GA8A 1BR4A 4YJ3E 2BKOA 5HEHA 2MTQA 3UU3A 4IDPA 2DNXA 3LK42 3FBZA 3TLTA 4JV5T 4EOZB 4O4HE 5FKYA 4LFCT 2YEVC 2HN1A 4HE8A 2AE9A 1MNEA 2MOZA 4BJNA 2X0LB 4KX6A 2MPKA 3PUVF 3VKGA 3N9MA 3GN5A 4TWFA 2VKOA 3AXJB 2BS2A 4DO0A 4CI1B 3V5SA 3WAKA 4Z8XA 1JNRA 3U3IA 4HWIB 4B3TT 2LEHA 4O2AE 1Y64B 2CPTA 5HEUA 4QXBB 1D1BA 5ABFB 2CWYA 2LE8A 3OKQA 1WCRA 4CN4A 3OYZA 4O4IE 1NEKA 4GYRA 4H9OC 1ZHCA 3AE1A 5FY0A 2WSSV 4MLKA 4H9PC 3KV5A 4X1IE 3HL6A 5LHHB 2WAUA 1S94A 4L0RA 4LMJA 4U33A 3RC3A 4DUYT 3RKOA 2L3LA 1IZNB 4EIWA 2FJDA 3HKEE 3ZJ1A 1DU2A 4PFPA 1KNZA 3QOFA 4X64T 3DTOA 4DR3T 2JRKA 4NIQA 2V7IA 2XZEA 4H9NC 3Q5XA 4GK0E 5J2UE 4JUYA 3TLUA 3NKZA 3O9XA 4JYAT 1T7SA 2NR4A 4I4TE 1S35A 2CA5A 4QX7B 5EK2A 5KMGP 3BQKA 3T1HT 3P4WA 1N36T 4TWDA 1LVFA 3C51A 2MBGA 4IL4A 3GWHA 4DIDB 2P9BA 4I55E 2BG9E 2ODUA 5L3BB 2JPFA 1ZP0A 3ANWB 2CXDA 3ZN1B 4LF7T 4YSZA 3LBXA 4FJOA 2DHRA 1HR0T 2N9DA 3CWZB 1IAPA 1QSDA 2D5UA 4JI0T 1WLXA 2XHEB 5HCJA 4YTMA 1FEWA 3SOLA 2V7MA 4AQFA 2M6IA 2ZM6T 4UR9A 2HN2A 2FBWA 2NW9A 4V1Av 5LGNB 2LSJA 1G73A 4LF4T 5LMUT 3RHWA 2X9WA 5ABEA 4ZI2C 3RPUA 5C3JA 4ZI3C 3A7MA 4AKLA 3RQUA 1J5ET 4B3ST 3ZEFB 2A2FX 4GK5E 4ERRA 4QKNA 4AIUA 5LXTE 3HA4A 2WMOA 2LKHA 3PUSA 4DMVA 4TUYE 5LMNT 3AEGA 2W62A 4DMWA 4O2BE 4AKRB 5AQPB 4DV3T 3KVBA 3TLSA 3PTRB 4KBMB 5LGUB 3MK7C 2V6YB 5AQMB 2L9QA 3AA0B 4U3CA 1XDOA 5FL0A 2YDSA 5LJNA 5LP6E 5L4EA 4EZHA 3P7IA 2LHRA 5AQNB 5J0ZA 5A1LA 5CA1E 4EGWA 5CJ5A 4YLHA 4YFSA 1J5WA 3RF1A 3AVRA 5FL1A 3FZLB 3MKDA 3LG7A 3O4XE 5L47A 2VVSA 1FMVA 1YW0A 1I94T 1YD8G 2ODVA 2EHOA 3G06A 1IJ6A 4ILUA 5CA0E 2IAKA 4J2CA 4Z91A 3UQ4A 1ZV4X 4PJLA 3AE5A 5JR9B 1FMWA 1H7CA 1YKHB 5LHIB 1UURA 3PE0A 1N33T 2X9HA 3AVSA 3RIUA 1T98A 5GONE 4GYSA 3SFEA 5LBMA 2LOPA 4KUMB 1W09A 4DR4T 4PW8A 1SUMB 2RP4A 4X1YE 4ZI3D 3R84B 2IMLA 4IDNA 1HNZT 3FZKB 4I0UA 2HPLA 4X65T 3C98B 4WZXA 3PUWF 5LJMA 4AQGA 4JI5T 2BG9A 1MMNA 3I9YA 1HX1B 3UUXB 3AECA 3E22E 4E7SA 1D0XA 3W15B 4MBQA 2LOSA 2YKSA 1CHUA 4DV5T 2WZIA 2WWUA 3PJAJ 2KLQA 2JQ9A 5JR9C 3ONXA 4UVAB 2K48A 4KHZF 5AQVB 3UUNA 3RLFF 5JTGA 3AE9A 5HWXA 4WNKA 2BS3A 4L5GA 5L2LA 4BJMA 2WM9A 5L3EB 3C4XA 3NWIA 4IE6A 1YXRA 3N9LA 4QH5A 5LCYA 1OWAA 3PUYF 2XM1A 3RQWA 4UIGA 3CMLA 1AJ3A 2X51A 1NWMX 3N9PA 4LMKA 3AAIA 4NXNT 3M3ZB 2GK9A 3AB3B 2BS4A 3UQ7A 4JEHB 3ZMUB 3CIRA 4ASKA 5DQVA 4CN1A 3O1IA 2D0UA 2VL0A 2C5KT 4X5TA 3IA3A 3RC8A 3NZQA 4LF6T 3RKGA 2Z6EA 3ZCIA 4DV7T 3RH3A 4I50E 5HXCA 1XMOT 4A5XA 5HXSA 4IE4A 3GN5B 4PJMA 2CHOA 3OPCA 5LNKA 4ZEYA 4P0AA 5JDQA 4IE0A 2ZMAA 3LSVA 2J4GA 4Q25A 3FZFB 3PUGA 3RYCE 4YSYA 4TV8E 2E2AA 3U78A 4KP3C 3QUJA 3KINB 3UULA 3IHRA 5AQKB 4TZ4C 3OVUA 3RYFE 3Q5EA 4TWHA 2LRKA 4EYYR 4TN7B 2WCAA 2X0YA 4ZZBA 2WB5A 2X9XA 3OJAA 2ES0A 4H63V 3ZT7A 4YJ2E 3C4ZA 4HWDA 4IGUA 2UUCT 3KV4A 4ZZCA 5AQFB 3RYIE 3H3MA 1M62A 5DABA 4PK6A 4CQIA 5F8PA 2KT9A 2FJBA 2E9XA 3ZSSA 4K0UA 3PUZF 4M1PA 3ESLA 4OYKA 1UX5A 3NRYA 4PFOA 2PBIA 1ZEEA 2CM0A 1YQ4A 3N2KE 4DV2T 2B1EA 1Z8UA 3TLVA 4NUUA 5HEJA 2XQYA 2J1DG 1WR6A 4EZ4A 3AE8A 2XAHB 1OEDE 4JEUB 3KBUA 3PJAA 4KI0F 5LYJE 2X68A 2XQ9A 2IUBA 3UU4A 4JI4T 3SWHA 3ABVA 2BKPA 3UT5E 4PK4A 1HX8A 2WDQA 2HHHT 1J1JA 3EVYA 3QB5A 1VCTA 2NWBA 4KMCA 2CHNA 2VKJA 4EYUA 2IC6A 5DJQC 5AQGB 3EAMA 1MNDA 5L3FB 4HFEA 2CCQA 4N78D 2E5VA 3SRZA 4QXCB 2DWGA 4HEAA 4B3RT 2KZ7B 3AE4A 4TX5A 2VQFT 4HN9A 3F2EA 5LB7B 3Q2MA 2V7JA 1VRBA 4EEDA 5JQGE 3PV0F 2CBIA 3FXEB 3RX6A 4HFCA 3D0TA 4UF0B 3AXJA 1KNRA 5AQIB 4AQFC 3P4QA 4UV8B 2W61A 2W63A 4YTPA 2W4XA 3O1HA 1HG5A 2J62A 3BQIA 3ONLC 3FBLA 4U72A 3N9NA 2WMNA 3ZMVB 1UGOA 2JQQA 4U7IA 3BK9A 2KWIB 4C91A 1OXZA 2JQKA 2WY2A 1KEYA 4AQYT 4IDZA 5CFBA 4CXXA 1E1HB 1HFAA 3VKHA 4QXHB 3KDSE 5AQLB 4XBFB 3N9QA 4CZZB 4YHHT 3JADA 3GMIA 4GOUA 3HKCE 2VKDA 4Z90A 4LF9T 2VURA 2YOEA 3K1SA 3I9WA 4TNVA 4U2YA 3CX7B 3N2OA 1D1AA 2UXNB 4A98A 4O8SA 4CI2B 4ADZA 3MJXA 3A8YC 4X1KE 5LG4A 3UUMA 4P1NA 3VRAA 4PK5A 3LFMA 3AEBA 4U31A 3VR8A 5FXWA 3PUXF 5AQUB 2HPJA 3E0ZA 3Q5WA 2CWOA 2ACZA 2Y8DA 4O4JE 3MXZA 3J7Yq 2BG9B 5AQHB 4CN6A 5KXJA 3ANWA 2NP9A 2DLRA 4YXDA 1BR0A 4IE7A 1NENA 2Y6XA 3X1DA 5ETWA 1GQEA 3UU8A 1OEDA 5AQJB 3A5XA 4G2AA 2DL1A 4OHFA 3VR9A 1UX4A 3AEDA 3ZSTA 2EHOC 1N32T 2V5DA 5JVDE 4XAXB 3FXDB 4FI5A 2QYWA 2XQ6A 4L9IA 2YU2A 2A9UA 3ETUA 2B76A 2LHNA 2QRXA 1R8IA 2E5LT 3L3PA 3RIUC 5JDHA 3K3OA 1UUSA 5J2TE 2JQHA 2H3RA 4JLEA 2D9DA 2DCFA 3C64A 2C0SA 2KMFA 3JC6C 1IBMT 3HI2A 3ETVA 3PDYA 5IWAT 3IEEA 1L0VA 5FVLA 5JH7E 4QHOA 1HNWT 2BDEA 3UU5A 2X9YA 2XSBA 2VKHA 3UFEA 5EK4A 2BG9C 3NBXX 1SE7A 4LFAT 3CVRA 4WBNE 3CQCB 5HXRA 4ISSA 2DWKA 3K3NA 4UV9B 2PG8A 3CKDA 4JI1T 1O3XA 2CBJA 4UVCB 4JI6T 3SS1A 2VWAA 4UELA 4GKKT 2I0MA 3UFGA 2R6GF 2N2NA 2V6YA 2XQ5A 1WFDA 3PUQA 2XQ4A 1X79A 1D1CA 1XDPA 4H9RC 4P0BA 2I6HA 5JDFA 5F3JA 2KWHA 2C5JA 2PFVA 1WR0A 5HYAA 1WYBA 2XQ7A 3ZLIA 2FJEA 3MA9A 4TNWA 4BAYB 3FB2A 4YHJA 1ZKEA 2NW8A 4NXMT 4WYVA 3KFWX 5FYMA 5IUXA 3PUAA 4CXWA 3AA7B 2EHOD 2XJ7A 4X20E 1UCUA 3WAJA 3HKDE 4YY3T 3RGLA 2SPCA 2UXDT 4UXNB 3CQXC 3MACA 4JBWF 5FVKA 3AE2A 4X66T 3WI3A 4ILCA 4AKHA 1YKEB 4B6XA 2YN6A 2KSRA 3JC6D 3NZPA 4A97A 1IBLT 5FMNA 5L3GB 3AEEA 5HXEA 2OLTA 4IIJE 3S4UA 2WBLA 3EHZA 3QB5K 3HR0A 5AQOB 2IC9A 4IREA 3ZYKA 1E7PA 3NVOA 2K24A 4AI6A 1XMQT 5ABHA 2XTLA 4B3MT 2YDQA 4I43B 5JRCA 2CMRA 3ZYMA 2BZBA 2E9XB 2KNDA 2VB6A 2LSGA 3AEAA 3V5UA 3AE6A 2D0TA 4YTNA 2W00A 4DBQA 4LFBT 4UVBB 4HGAA 2ACXA 1IJ5A 1T72A 4K0KT 3J9X1 4F8HA 2AXDS 3L39A 2LLYA 2CE7A 4OFZA 3ZJ2A 3L8RA 4EV6A 2LSKA 3ZMTB 3ZT5A 2LT3A 1HG2A 5L3CB 4LF5T 5FXZA 3KBTA 3EABA 4MFRA 5AQQB 4F6RC 3OYXA 4C90A 3FZHB 3P50A 1M7KA 2X67A 5H6RB 4JI3T 1FIOA 2C5IT 4ZI7E 2E8IA 1QUUA 1ZOYA 3CX8B 3N5LA 3P4PA 3P4RA 4PJJA 2Q9QA 5LG3A 4HFDA 3CPZA 1W0BA 5JDMA 2E9XC
chains in the Genus database with same CATH topology
5CA1E 5JR9A 3FXEB 5FY1A 2UXXB 4YLHA 3ZPOA 4YFSA 3ZN0B 2LM9A 3RX6A 3FHNA 3ZC0A 4NUVA 3DJBA 5IHYA 3AVRA 2NTYA 3D0TA 3MKDA 3LG7A 3O4XE 3F31A 2PJQA 4XZCA 4UF0B 4IHJE 4TV9E 4ZS3A 3NRXA 3K8PC 3PU3A 2RA1A 4H63H 4ZS2A 3VHLA 4AQFC 3RYHE 4UV8B 1FMVA 3LJCA 3Q9DA 5LGTB 2W61A 1YW0A 1B7TA 2W63A 2HH7A 3ZC1A 2Q9QB 2G0UA 1HG5A 3O1HA 5LA6E 1YD8G 2ODVA 4G63A 5CB4E 4EXTA 2EHOA 3L09A 3BQIA 3FBLA 4U72A 1IJ6A 4ILUA 5CA0E 3N9NA 4DNDA 4E7ZA 2IAKA 5EZYE 2WMNA 4J2CA 1ZV4X 4PJLA 4HKAA 2LSYA 4H9SE 4ZOLE 5JR9B 2JMHA 3ZMVB 4ISTA 2ZM0A 2XAJB 1FMWA 1H7CA 1YKHB 5LHIB 2JQQA 4EAHA 3PE0A 3BK9A 3E08A 2X9HA 3AVSA 2KWIB 1MIVA 2LJLA 1OXZA 4C91A 4ZHQE 1HS7A 1T98A 5GONE 4GYSA 3EUHA 4OK0A 5LBMA 4PAGA 2LOPA 4KUMB 4MALA 4IDZA 3LBXB 1MIWA 2JMKA 3RRWA 4U74A 4WBOA 3QC9A 4CXXA 1E1HB 1HFAA 4PW8A 5E0OA 4OYJA 2RP4A 4X1YE 4ZI3D 3VKHA 3N2GE 3R84B 2V26A 4HFVA 4QXHB 5LBQB 3KDSE 2CLYC 2K9AA 3KVAA 2HPLA 4XBFB 3N9QA 4CZZB 2CXFA 2VL8A 3C98B 3C50A 3B13A 3GMIA 4GOUA 2DI4A 3HKCE 2IW5B 1LRZA 3I0QA 2VKDA 4AQGA 5LJMA 1LVKA 2YK0A 4A56A 1MMNA 3I9YA 3I9WA 4ANJA 5FXXA 5KDMC 4PNIA 3UUXB 1MMAA 3CX7B 3N2OA 1D1AA 3AA1B 2UXNB 3E22E 4O8SA 4E7SA 4CI2B 5FNVE 4ADZA 1D0XA 2KXPB 4QX8B 3MJXA 3W15B 4MBQA 2LOSA 4X1KE 5LG4A 3UUMA 3LK2B 4PK5A 3LFMA 2Q9QD 2Q9QC 5TAOA 2X66A 4IE5A 2ZM8A 2JJ9A 3MZKB 5FXWA 5LOVE 4AKGA 2WWUA 2KLQA 2V1DB 3CX6B 2HPJA 3E0ZA 3Q5WA 3RRCA 3P8CD 5JR9C 2CWOA 3ONXA 3KV9A 5HWYA 4UVAB 2K48A 3UUNA 2Y8DA 5L3DB 1D0ZA 4O4JE 2MYSA 3MXZA 2BVLA 2NOXA 3J7Yq 2A72A 2CXLA 3T8OA 3F57A 3R6NA 3ANWA 3ZYLA 5HWXA 3CQGB 4WNKA 3IBPA 2NP9A 4L5GA 2DLRA 2E9XD 5L2LA 1BR0A 4IE7A 2WM9A 4BJMA 4EB6E 2Y6XA 5L3EB 3C4XA 5ETWA 2YU1A 3GA8A 1BR4A 2N1GA 1VOMA 4YJ3E 4IE6A 3ZCJA 3A5XA 2MTQA 3N9LA 4G2AA 4OHFA 2D2SA 4DVDA 1G8XA 1UX4A 2DNXA 3C4WA 2EHOC 5LCYA 3LK42 4HTEA 4UEMA 5JVDE 3AAAB 1US7B 3ZMZB 1OWAA 2KINB 4XAXB 3FXDB 4FI5A 2ZLYA 3FBZA 5DQWA 4L9IA 5HAXA 2YU2A 3LK3B 3ETUA 3OBVE 2LHNA 4EOZB 2K5BB 5J1GA 5JREA 4O4HE 4UIGA 3L3PA 5JDHA 3CMLA 1AJ3A 3K3OA 5J2TE 4AKIA 3EDVA 2YEVC 2X51A 1NWMX 3N9PA 4HE8A 2H3RA 4JLEA 3N9OA 2DCFA 3AAIA 3C64A 2C0SA 2KMFA 3JC6C 1MNEA 3HI2A 3ETVA 2XUEA 3PDYA 2GK9A 2MOZA 4BJNA 2X0LB 4GIWA 1SA0E 3AB3B 3IEEA 1MMDA 3VKGA 3N9MA 2ZM2A 3GN5A 4JEHB 2VKOA 5JH7E 3ZMUB 4QHOA 5ADXL 2QGSA 4DO0A 4CI1B 3V5SA 3WAKA 4ASKA 4Z8XA 2BDEA 5DQVA 3O1IA 2D0UA 3U3IA 2X9YA 2LEHA 2VKHA 4O2AE 2C5KT 5EK4A 3UFEA 2EHOB 3NBXX 3RC8A 3NZQA 1Y64B 4PJNA 5H6QB 4QXBB 1D1BA 1HF8A 3CVRA 4WBNE 4P09A 3CQCB 2LSIA 2CWYA 2Z6EA 3AA6B 5HXRA 2LE8A 3OKQA 4ISSA 2XAFB 2DWKA 3OYZA 3K3NA 4O4IE 2PG8A 3I0OA 4UV9B 3ZCIA 3CKDA 2XAQB 1O3XA 3RH3A 4UVCB 4I50E 5HXCA 4GYRA 3SS1A 4H9OC 5HXSA 1ZHCA 2VWAA 1U5PA 4IE4A 4UELA 1MMGA 5FY0A 2WSSV 3GN5B 4MLKA 4PJMA 4H9PC 3KV5A 2N2NA 4X1IE 2H7OA 3HL6A 5LNKA 5LHHB 2WAUA 3PUQA 4P0AA 2H7VC 1S94A 4L0RA 3RC3A 5JDQA 1LKXA 1X79A 1D1CA 4IE0A 2ZMAA 3HKBE 4H9RC 3RKOA 1NAFA 4P0BA 2L3LA 5KX5E 1IZNB 5JDFA 5F3JA 1BR2A 5FXVA 4EIWA 1D0YA 3HKEE 3ZJ1A 1HCIA 4PFPA 2L8KA 3PUGA 1KNZA 3RYCE 2KWHA 3DTOA 2NTXA 2JRKA 2C5JA 3O1JA 4TV8E 2PFVA 3AAEB 5HYAA 1WYBA 3IF8B 3U78A 2BVMA 4KP3C 3QUJA 2V7IA 4H9NC 3ZLIA 3Q5XA 3MA9A 3KINB 4GK0E 5J2UE 5LHGB 4BAYB 3UULA 3B57A 3IHRA 4JUYA 1KK7A 2XAGB 3FB2A 4TZ4C 4YHJA 3RYFE 2A3DA 1ZKEA 3O9XA 2NW8A 4UF0A 4CXYA 3KV6A 4EYYR 4TN7B 1SHZC 3KFWX 5FYMA 4I4TE 3PUAA 1MIYA 1S35A 2CA5A 4CXWA 3AA7B 4H9QC 4QX7B 5EK2A 1V9DA 5KMGP 2EHOD 2X9XA 3BQKA 3K3QC 4X20E 1UCUA 3OJAA 5HXHA 5M4YA 3WAJA 2M67A 3BQLA 2I59A 1LVFA 1WRDA 3C51A 2MBGA 2ES0A 3HKDE 4H63V 3GWHA 4YJ2E 5A1LA 3C4ZA 4IGUA 2SPCA 2P9BA 3KV4A 4I55E 2ODUA 5L3BB 3RYIE 4UXNB 3CQXC 3MACA 2JPFA 4O4LE 5FY7A 5DABA 3ANWB 4PK6A 5AFUL 3ZMSB 4CQIA 3WI3A 4DBRA 4AKHA 5F8PA 2KT9A 2CXDA 1YKEB 2E9XA 4B6XA 3JC6D 1BR1A 3NZPA 4K0UA 4M1PA 3ZN1B 3LBXA 4FJOA 2DHRA 2VK9A 5FP3A 3CWZB 2N9DA 2CEAA 1IAPA 1QSDA 5FMNA 5L3GB 5C8YE 2QA7A 3ESLA 1UX5A 2D5UA 4OYKA 1WLXA 2XHEB 5IYZE 5HXEA 3NRYA 4PFOA 4IIJE 5EK3A 3S4UA 1FEWA 2WBLA 2PBIA 1ZEEA 3HR0A 2IC9A 3SOLA 2V7MA 2CM0A 3ZYKA 4AQFA 3N2KE 2B1EA 2K24A 4AI6A 4NUUA 2W0GA 2XQYA 2XTLA 2J1DG 4I43B 3I1AA 2NW9A 1WR6A 4V1Av 4EZ4A 5JRCA 2V7LA 5LGNB 2CMRA 3ZYMA 2LSJA 1G73A 2XAHB 4JEUB 2BZBA 2E9XB 2KNDA 3KBUA 1WYCA 2VB6A 2X9WA 5LYJE 3DP7A 4ZI2D 3H3AA 4ZI2C 5JDNA 3RPUA 2LSGA 2X68A 3V5UA 4MHCA 2D0TA 4ZI3C 2W00A 3SWHA 3VU7H 2V7KA 4QWNB 4BA9A 3UT5E 4PK4A 4DBQA 3PU8A 1HX8A 4UVBB 4HGAA 4AKLA 3EVYA 2Y48B 2OA5A 1EZ3A 2ACXA 3ZEFB 1Z0PA 1U4QA 1IJ5A 2A2FX 3UTKA 4GK5E 1HTJF 2XASB 3M65A 3J9X1 4ERRA 4QKNA 4WW0A 2NWBA 4KMCA 3PURA 2CE7A 5LXTE 2VKJA 4EYUA 4OFZA 3ZJ2A 3HA4A 5BMVE 2IC6A 2LSKA 4CI3B 2NW7A 2WMOA 3ZMTB 5JRCB 2LT3A 1HG2A 2YINA 5DJQC 1MNDA 3PUSA 4DMVA 5L3CB 5JDLA 5L3FB 4TUYE 2CCQA 3KBTA 4N78D 3EDUA 5FXZA 3SRZA 4MFRA 2W62A 4DMWA 4QXCB 2DWGA 4O2BE 4F6RC 3OYXA 4C90A 4AKRB 3KVBA 3PTRB 4HEAA 4KBMB 2X67A 5H6RB 5LGUB 3MK7C 1FIOA 2C5IT 2KZ7B 3TKLB 4ZI7E 2E8IA 2L9QA 3AA0B 1QUUA 3CX8B 4TX5A 5JDGA 4HN9A 3F2EA 3N5LA 5LJNA 3Q2MA 5LP6E 2V7JA 3H37A 2Q9QA 4PJJA 1VRBA 4EZHA 3CPZA 3P7IA 2LHRA 5JQGE 5JDMA 1CUNA 2CLYB 2VASA 3QK6A 4AXPA 2E9XC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DMW A;  3SS1 A;  4DMV A;  2VK9 A;  2VKH A;  4ERR A;  2VKD A;  2BVM A;  2VL8 A;  2BVL A;  3SRZ A; 
#chains in the Genus database with same CATH topology
 2LRL A;  5FY1 A;  3ZPO A;  2FJA A;  3ZN0 B;  2LM9 A;  3ZC0 A;  4NUV A;  3DJB A;  3F31 A;  3PU3 A;  4IL9 A;  3B5M A;  4H63 H;  4ZS2 A;  3VHL A;  3RYH E;  2LKG A;  3QNU A;  3ZC1 A;  5L4H A;  2XPK A;  2G0U A;  4G63 A;  5CB4 E;  4DV4 T;  3L09 A;  4E7Z A;  2LSY A;  4ZOL E;  5C2T A;  2ZM0 A;  2IIU A;  4EAH A;  4HWC A;  1FJG T;  2FUP A;  1HS7 A;  3EUH A;  4PAG A;  3LBX B;  1MIW A;  2JMK A;  3QC9 A;  5E0O A;  2WQY A;  2V26 A;  4HFV A;  4AIS A;  4ZXL A;  2K9A A;  2CXF A;  2VL8 A;  3LDQ B;  3C50 A;  2DI4 A;  2IW5 B;  1LRZ A;  4ILA A;  3I0Q A;  1LVK A;  2IHR 1;  5FXX A;  5KDM C;  1MMA A;  2MAW A;  2KXP B;  4QX8 B;  2PTF A;  2Q9Q D;  2X66 A;  2ZM8 A;  4AKG A;  2WDV A;  3JCF A;  1VCS A;  2V6X A;  3P8C D;  3KV9 A;  5HWY A;  1X9B A;  2BBH A;  5L3D B;  1UK5 A;  2CXL A;  4HWF A;  3F57 A;  3ZKR A;  3ZYL A;  3IBP A;  2E9X D;  1QLB A;  4EB6 E;  2N1G A;  1VOM A;  3ZCJ A;  3P4S A;  2D2S A;  4DVD A;  1G8X A;  5ABG A;  3C4W A;  4HTE A;  4UEM A;  4YSX A;  3AAA B;  1US7 B;  3ZMZ B;  2KIN B;  2ZLY A;  5DQW A;  3UU6 A;  2M6B A;  2X0H A;  5HAX A;  3LK3 B;  3OBV E;  2K5B B;  5J1G A;  5JRE A;  4AKI A;  3EDV A;  3AE7 A;  3N9O A;  5ABF A;  3JAF A;  4DR6 T;  1OED B;  2XUE A;  4OX9 T;  4DR1 T;  4GIW A;  1SA0 E;  5F5W A;  1Y01 A;  1MMD A;  2F4V T;  1IBK T;  2ZM2 A;  2WWV A;  5HEO A;  5ADX L;  2QGS A;  4U2Z A;  2UUB T;  5BR8 T;  3VRB A;  2EHO B;  5HEG A;  3OTO T;  1XWM A;  4PJN A;  5H6Q B;  2WU5 A;  1HF8 A;  2WU2 A;  4P09 A;  2LSI A;  3AA6 B;  1E2A A;  2XAF B;  3I0O A;  2XAQ B;  1U5P A;  1MMG A;  3SFD A;  2H7O A;  4LML A;  4IDQ A;  2H7V C;  3TLW A;  1LKX A;  3HKB E;  1NAF A;  5KX5 E;  1HNX T;  5HCM A;  1BR2 A;  5AQR B;  5FXV A;  1D0Y A;  1HCI A;  2L8K A;  3AE3 A;  2WDR A;  3AEF A;  2NTX A;  3O1J A;  3AAE B;  1OED C;  3IF8 B;  2BVM A;  4HFH A;  4U7Y A;  5LHG B;  2UUA T;  3B57 A;  1KK7 A;  2XAG B;  2A3D A;  4UF0 A;  4CXY A;  3KV6 A;  1SHZ C;  1MIY A;  4H9Q C;  1V9D A;  3K3Q C;  2W66 A;  5HXH A;  5M4Y A;  2M67 A;  3BQL A;  2I59 A;  4DV1 T;  1WRD A;  1JNZ A;  3ZT6 A;  2XQ3 A;  1T8B A;  4DR2 T;  4JI7 T;  2WP9 A;  1N34 T;  4NPP A;  4O4L E;  5FY7 A;  2VVN A;  5AFU L;  3ZMS B;  4DBR A;  2BBJ A;  1BR1 A;  4COF A;  2VK9 A;  5FP3 A;  2CEA A;  2XM2 A;  5C8Y E;  2QA7 A;  5IYZ E;  2XSA A;  5EK3 A;  3FZM B;  4IDO A;  2W0G A;  3I1A A;  2BKN A;  4QH4 A;  3EI0 A;  2V7L A;  2H89 A;  1WYC A;  2RPA A;  3DP7 A;  4ZI2 D;  3H3A A;  5JDN A;  1XNR T;  2V8S V;  4DV6 T;  4MHC A;  2W67 A;  3CK6 A;  3VU7 H;  2V7K A;  4QWN B;  4BA9 A;  3PU8 A;  4EEB A;  3Q5D A;  2Y48 B;  2OA5 A;  1EZ3 A;  1Z0P A;  1U4Q A;  2V5C A;  3UTK A;  1HTJ F;  2XAS B;  3M65 A;  4WW0 A;  3PUR A;  5BMV E;  4CI3 B;  2NW7 A;  5JRC B;  2YIN A;  3T1Y T;  5JDL A;  4IT4 A;  3EDU A;  3RIF A;  4JI8 T;  5CGM A;  2LM2 A;  3TKL B;  4DR5 T;  5JDG A;  2IDO B;  3H37 A;  1I6Z A;  2OV9 A;  3RI5 A;  1CUN A;  2CLY B;  2VAS A;  2W2U A;  1YQ3 A;  3QK6 A;  4AXP A;  5JR9 A;  2UXX B;  1W0A A;  3FHN A;  5IHY A;  2NTY A;  3ONJ A;  2JIW A;  4HFB A;  3JAE A;  2PJQ A;  4XZC A;  4IHJ E;  4TV9 E;  4ZS3 A;  3NRX A;  3K8P C;  2VQE T;  2RA1 A;  2CRB A;  3LJC A;  3Q9D A;  5LGT B;  1B7T A;  2HH7 A;  2Q9Q B;  5LA6 E;  4LF8 T;  2J47 A;  4EXT A;  5AQS B;  2YDR A;  4DND A;  2UXC T;  4HFI A;  5EZY E;  4JI2 T;  4HKA A;  4H9S E;  2JMH A;  4IST A;  2XAJ B;  2QVA A;  4HWH A;  3E08 A;  1MIV A;  2LJL A;  4ZHQ E;  4OK0 A;  4MAL A;  3RRW A;  4U74 A;  4WBO A;  4KHP T;  2UU9 T;  4OYJ A;  4QH1 A;  3N2G E;  5LBQ B;  2CLY C;  3KVA A;  1XZY A;  1W9R A;  3B13 A;  4GKJ T;  3UUB A;  4A56 A;  2YK0 A;  4ANJ A;  2K3W A;  4PNI A;  2UXB T;  2XQ8 A;  3AA1 B;  2XQA A;  1XNQ T;  5FNV E;  4DV0 T;  1KF6 A;  3LK2 B;  2Q9Q C;  5TAO A;  4IE5 A;  2JJ9 A;  3MZK B;  5LOV E;  4X62 T;  1KFY A;  3RIA A;  5AQT B;  2V1D B;  4DUZ T;  3CX6 B;  3RRC A;  2XY8 B;  1D0Z A;  2MYS A;  2BVL A;  2NOX A;  2A72 A;  2H88 A;  3T8O A;  3R6N A;  4YT0 A;  2WZH A;  3CQG B;  1KNP A;  2WS3 A;  4ILB A;  4DR7 T;  2YU1 A;  3GA8 A;  1BR4 A;  4YJ3 E;  2BKO A;  5HEH A;  2MTQ A;  3UU3 A;  4IDP A;  2DNX A;  3LK4 2;  3FBZ A;  3TLT A;  4JV5 T;  4EOZ B;  4O4H E;  5FKY A;  4LFC T;  2YEV C;  2HN1 A;  4HE8 A;  2AE9 A;  1MNE A;  2MOZ A;  4BJN A;  2X0L B;  4KX6 A;  2MPK A;  3PUV F;  3VKG A;  3N9M A;  3GN5 A;  4TWF A;  2VKO A;  3AXJ B;  2BS2 A;  4DO0 A;  4CI1 B;  3V5S A;  3WAK A;  4Z8X A;  1JNR A;  3U3I A;  4HWI B;  4B3T T;  2LEH A;  4O2A E;  1Y64 B;  2CPT A;  5HEU A;  4QXB B;  1D1B A;  5ABF B;  2CWY A;  2LE8 A;  3OKQ A;  1WCR A;  4CN4 A;  3OYZ A;  4O4I E;  1NEK A;  4GYR A;  4H9O C;  1ZHC A;  3AE1 A;  5FY0 A;  2WSS V;  4MLK A;  4H9P C;  3KV5 A;  4X1I E;  3HL6 A;  5LHH B;  2WAU A;  1S94 A;  4L0R A;  4LMJ A;  4U33 A;  3RC3 A;  4DUY T;  3RKO A;  2L3L A;  1IZN B;  4EIW A;  2FJD A;  3HKE E;  3ZJ1 A;  1DU2 A;  4PFP A;  1KNZ A;  3QOF A;  4X64 T;  3DTO A;  4DR3 T;  2JRK A;  4NIQ A;  2V7I A;  2XZE A;  4H9N C;  3Q5X A;  4GK0 E;  5J2U E;  4JUY A;  3TLU A;  3NKZ A;  3O9X A;  4JYA T;  1T7S A;  2NR4 A;  4I4T E;  1S35 A;  2CA5 A;  4QX7 B;  5EK2 A;  5KMG P;  3BQK A;  3T1H T;  3P4W A;  1N36 T;  4TWD A;  1LVF A;  3C51 A;  2MBG A;  4IL4 A;  3GWH A;  4DID B;  2P9B A;  4I55 E;  2BG9 E;  2ODU A;  5L3B B;  2JPF A;  1ZP0 A;  3ANW B;  2CXD A;  3ZN1 B;  4LF7 T;  4YSZ A;  3LBX A;  4FJO A;  2DHR A;  1HR0 T;  2N9D A;  3CWZ B;  1IAP A;  1QSD A;  2D5U A;  4JI0 T;  1WLX A;  2XHE B;  5HCJ A;  4YTM A;  1FEW A;  3SOL A;  2V7M A;  4AQF A;  2M6I A;  2ZM6 T;  4UR9 A;  2HN2 A;  2FBW A;  2NW9 A;  4V1A v;  5LGN B;  2LSJ A;  1G73 A;  4LF4 T;  5LMU T;  3RHW A;  2X9W A;  5ABE A;  4ZI2 C;  3RPU A;  5C3J A;  4ZI3 C;  3A7M A;  4AKL A;  3RQU A;  1J5E T;  4B3S T;  3ZEF B;  2A2F X;  4GK5 E;  4ERR A;  4QKN A;  4AIU A;  5LXT E;  3HA4 A;  2WMO A;  2LKH A;  3PUS A;  4DMV A;  4TUY E;  5LMN T;  3AEG A;  2W62 A;  4DMW A;  4O2B E;  4AKR B;  5AQP B;  4DV3 T;  3KVB A;  3TLS A;  3PTR B;  4KBM B;  5LGU B;  3MK7 C;  2V6Y B;  5AQM B;  2L9Q A;  3AA0 B;  4U3C A;  1XDO A;  5FL0 A;  2YDS A;  5LJN A;  5LP6 E;  5L4E A;  4EZH A;  3P7I A;  2LHR A;  5AQN B;  5J0Z A;  5A1L A;  5CA1 E;  4EGW A;  5CJ5 A;  4YLH A;  4YFS A;  1J5W A;  3RF1 A;  3AVR A;  5FL1 A;  3FZL B;  3MKD A;  3LG7 A;  3O4X E;  5L47 A;  2VVS A;  1FMV A;  1YW0 A;  1I94 T;  1YD8 G;  2ODV A;  2EHO A;  3G06 A;  1IJ6 A;  4ILU A;  5CA0 E;  2IAK A;  4J2C A;  4Z91 A;  3UQ4 A;  1ZV4 X;  4PJL A;  3AE5 A;  5JR9 B;  1FMW A;  1H7C A;  1YKH B;  5LHI B;  1UUR A;  3PE0 A;  1N33 T;  2X9H A;  3AVS A;  3RIU A;  1T98 A;  5GON E;  4GYS A;  3SFE A;  5LBM A;  2LOP A;  4KUM B;  1W09 A;  4DR4 T;  4PW8 A;  1SUM B;  2RP4 A;  4X1Y E;  4ZI3 D;  3R84 B;  2IML A;  4IDN A;  1HNZ T;  3FZK B;  4I0U A;  2HPL A;  4X65 T;  3C98 B;  4WZX A;  3PUW F;  5LJM A;  4AQG A;  4JI5 T;  2BG9 A;  1MMN A;  3I9Y A;  1HX1 B;  3UUX B;  3AEC A;  3E22 E;  4E7S A;  1D0X A;  3W15 B;  4MBQ A;  2LOS A;  2YKS A;  1CHU A;  4DV5 T;  2WZI A;  2WWU A;  3PJA J;  2KLQ A;  2JQ9 A;  5JR9 C;  3ONX A;  4UVA B;  2K48 A;  4KHZ F;  5AQV B;  3UUN A;  3RLF F;  5JTG A;  3AE9 A;  5HWX A;  4WNK A;  2BS3 A;  4L5G A;  5L2L A;  4BJM A;  2WM9 A;  5L3E B;  3C4X A;  3NWI A;  4IE6 A;  1YXR A;  3N9L A;  4QH5 A;  5LCY A;  1OWA A;  3PUY F;  2XM1 A;  3RQW A;  4UIG A;  3CML A;  1AJ3 A;  2X51 A;  1NWM X;  3N9P A;  4LMK A;  3AAI A;  4NXN T;  3M3Z B;  2GK9 A;  3AB3 B;  2BS4 A;  3UQ7 A;  4JEH B;  3ZMU B;  3CIR A;  4ASK A;  5DQV A;  4CN1 A;  3O1I A;  2D0U A;  2VL0 A;  2C5K T;  4X5T A;  3IA3 A;  3RC8 A;  3NZQ A;  4LF6 T;  3RKG A;  2Z6E A;  3ZCI A;  4DV7 T;  3RH3 A;  4I50 E;  5HXC A;  1XMO T;  4A5X A;  5HXS A;  4IE4 A;  3GN5 B;  4PJM A;  2CHO A;  3OPC A;  5LNK A;  4ZEY A;  4P0A A;  5JDQ A;  4IE0 A;  2ZMA A;  3LSV A;  2J4G A;  4Q25 A;  3FZF B;  3PUG A;  3RYC E;  4YSY A;  4TV8 E;  2E2A A;  3U78 A;  4KP3 C;  3QUJ A;  3KIN B;  3UUL A;  3IHR A;  5AQK B;  4TZ4 C;  3OVU A;  3RYF E;  3Q5E A;  4TWH A;  2LRK A;  4EYY R;  4TN7 B;  2WCA A;  2X0Y A;  4ZZB A;  2WB5 A;  2X9X A;  3OJA A;  2ES0 A;  4H63 V;  3ZT7 A;  4YJ2 E;  3C4Z A;  4HWD A;  4IGU A;  2UUC T;  3KV4 A;  4ZZC A;  5AQF B;  3RYI E;  3H3M A;  1M62 A;  5DAB A;  4PK6 A;  4CQI A;  5F8P A;  2KT9 A;  2FJB A;  2E9X A;  3ZSS A;  4K0U A;  3PUZ F;  4M1P A;  3ESL A;  4OYK A;  1UX5 A;  3NRY A;  4PFO A;  2PBI A;  1ZEE A;  2CM0 A;  1YQ4 A;  3N2K E;  4DV2 T;  2B1E A;  1Z8U A;  3TLV A;  4NUU A;  5HEJ A;  2XQY A;  2J1D G;  1WR6 A;  4EZ4 A;  3AE8 A;  2XAH B;  1OED E;  4JEU B;  3KBU A;  3PJA A;  4KI0 F;  5LYJ E;  2X68 A;  2XQ9 A;  2IUB A;  3UU4 A;  4JI4 T;  3SWH A;  3ABV A;  2BKP A;  3UT5 E;  4PK4 A;  1HX8 A;  2WDQ A;  2HHH T;  1J1J A;  3EVY A;  3QB5 A;  1VCT A;  2NWB A;  4KMC A;  2CHN A;  2VKJ A;  4EYU A;  2IC6 A;  5DJQ C;  5AQG B;  3EAM A;  1MND A;  5L3F B;  4HFE A;  2CCQ A;  4N78 D;  2E5V A;  3SRZ A;  4QXC B;  2DWG A;  4HEA A;  4B3R T;  2KZ7 B;  3AE4 A;  4TX5 A;  2VQF T;  4HN9 A;  3F2E A;  5LB7 B;  3Q2M A;  2V7J A;  1VRB A;  4EED A;  5JQG E;  3PV0 F;  2CBI A;  3FXE B;  3RX6 A;  4HFC A;  3D0T A;  4UF0 B;  3AXJ A;  1KNR A;  5AQI B;  4AQF C;  3P4Q A;  4UV8 B;  2W61 A;  2W63 A;  4YTP A;  2W4X A;  3O1H A;  1HG5 A;  2J62 A;  3BQI A;  3ONL C;  3FBL A;  4U72 A;  3N9N A;  2WMN A;  3ZMV B;  1UGO A;  2JQQ A;  4U7I A;  3BK9 A;  2KWI B;  4C91 A;  1OXZ A;  2JQK A;  2WY2 A;  1KEY A;  4AQY T;  4IDZ A;  5CFB A;  4CXX A;  1E1H B;  1HFA A;  3VKH A;  4QXH B;  3KDS E;  5AQL B;  4XBF B;  3N9Q A;  4CZZ B;  4YHH T;  3JAD A;  3GMI A;  4GOU A;  3HKC E;  2VKD A;  4Z90 A;  4LF9 T;  2VUR A;  2YOE A;  3K1S A;  3I9W A;  4TNV A;  4U2Y A;  3CX7 B;  3N2O A;  1D1A A;  2UXN B;  4A98 A;  4O8S A;  4CI2 B;  4ADZ A;  3MJX A;  3A8Y C;  4X1K E;  5LG4 A;  3UUM A;  4P1N A;  3VRA A;  4PK5 A;  3LFM A;  3AEB A;  4U31 A;  3VR8 A;  5FXW A;  3PUX F;  5AQU B;  2HPJ A;  3E0Z A;  3Q5W A;  2CWO A;  2ACZ A;  2Y8D A;  4O4J E;  3MXZ A;  3J7Y q;  2BG9 B;  5AQH B;  4CN6 A;  5KXJ A;  3ANW A;  2NP9 A;  2DLR A;  4YXD A;  1BR0 A;  4IE7 A;  1NEN A;  2Y6X A;  3X1D A;  5ETW A;  1GQE A;  3UU8 A;  1OED A;  5AQJ B;  3A5X A;  4G2A A;  2DL1 A;  4OHF A;  3VR9 A;  1UX4 A;  3AED A;  3ZST A;  2EHO C;  1N32 T;  2V5D A;  5JVD E;  4XAX B;  3FXD B;  4FI5 A;  2QYW A;  2XQ6 A;  4L9I A;  2YU2 A;  2A9U A;  3ETU A;  2B76 A;  2LHN A;  2QRX A;  1R8I A;  2E5L T;  3L3P A;  3RIU C;  5JDH A;  3K3O A;  1UUS A;  5J2T E;  2JQH A;  2H3R A;  4JLE A;  2D9D A;  2DCF A;  3C64 A;  2C0S A;  2KMF A;  3JC6 C;  1IBM T;  3HI2 A;  3ETV A;  3PDY A;  5IWA T;  3IEE A;  1L0V A;  5FVL A;  5JH7 E;  4QHO A;  1HNW T;  2BDE A;  3UU5 A;  2X9Y A;  2XSB A;  2VKH A;  3UFE A;  5EK4 A;  2BG9 C;  3NBX X;  1SE7 A;  4LFA T;  3CVR A;  4WBN E;  3CQC B;  5HXR A;  4ISS A;  2DWK A;  3K3N A;  4UV9 B;  2PG8 A;  3CKD A;  4JI1 T;  1O3X A;  2CBJ A;  4UVC B;  4JI6 T;  3SS1 A;  2VWA A;  4UEL A;  4GKK T;  2I0M A;  3UFG A;  2R6G F;  2N2N A;  2V6Y A;  2XQ5 A;  1WFD A;  3PUQ A;  2XQ4 A;  1X79 A;  1D1C A;  1XDP A;  4H9R C;  4P0B A;  2I6H A;  5JDF A;  5F3J A;  2KWH A;  2C5J A;  2PFV A;  1WR0 A;  5HYA A;  1WYB A;  2XQ7 A;  3ZLI A;  2FJE A;  3MA9 A;  4TNW A;  4BAY B;  3FB2 A;  4YHJ A;  1ZKE A;  2NW8 A;  4NXM T;  4WYV A;  3KFW X;  5FYM A;  5IUX A;  3PUA A;  4CXW A;  3AA7 B;  2EHO D;  2XJ7 A;  4X20 E;  1UCU A;  3WAJ A;  3HKD E;  4YY3 T;  3RGL A;  2SPC A;  2UXD T;  4UXN B;  3CQX C;  3MAC A;  4JBW F;  5FVK A;  3AE2 A;  4X66 T;  3WI3 A;  4ILC A;  4AKH A;  1YKE B;  4B6X A;  2YN6 A;  2KSR A;  3JC6 D;  3NZP A;  4A97 A;  1IBL T;  5FMN A;  5L3G B;  3AEE A;  5HXE A;  2OLT A;  4IIJ E;  3S4U A;  2WBL A;  3EHZ A;  3QB5 K;  3HR0 A;  5AQO B;  2IC9 A;  4IRE A;  3ZYK A;  1E7P A;  3NVO A;  2K24 A;  4AI6 A;  1XMQ T;  5ABH A;  2XTL A;  4B3M T;  2YDQ A;  4I43 B;  5JRC A;  2CMR A;  3ZYM A;  2BZB A;  2E9X B;  2KND A;  2VB6 A;  2LSG A;  3AEA A;  3V5U A;  3AE6 A;  2D0T A;  4YTN A;  2W00 A;  4DBQ A;  4LFB T;  4UVB B;  4HGA A;  2ACX A;  1IJ5 A;  1T72 A;  4K0K T;  3J9X 1;  4F8H A;  2AXD S;  3L39 A;  2LLY A;  2CE7 A;  4OFZ A;  3ZJ2 A;  3L8R A;  4EV6 A;  2LSK A;  3ZMT B;  3ZT5 A;  2LT3 A;  1HG2 A;  5L3C B;  4LF5 T;  5FXZ A;  3KBT A;  3EAB A;  4MFR A;  5AQQ B;  4F6R C;  3OYX A;  4C90 A;  3FZH B;  3P50 A;  1M7K A;  2X67 A;  5H6R B;  4JI3 T;  1FIO A;  2C5I T;  4ZI7 E;  2E8I A;  1QUU A;  1ZOY A;  3CX8 B;  3N5L A;  3P4P A;  3P4R A;  4PJJ A;  2Q9Q A;  5LG3 A;  4HFD A;  3CPZ A;  1W0B A;  5JDM A;  2E9X C; 
#chains in the Genus database with same CATH homology
 5CA1 E;  5JR9 A;  3FXE B;  5FY1 A;  2UXX B;  4YLH A;  3ZPO A;  4YFS A;  3ZN0 B;  2LM9 A;  3RX6 A;  3FHN A;  3ZC0 A;  4NUV A;  3DJB A;  5IHY A;  3AVR A;  2NTY A;  3D0T A;  3MKD A;  3LG7 A;  3O4X E;  3F31 A;  2PJQ A;  4XZC A;  4UF0 B;  4IHJ E;  4TV9 E;  4ZS3 A;  3NRX A;  3K8P C;  3PU3 A;  2RA1 A;  4H63 H;  4ZS2 A;  3VHL A;  4AQF C;  3RYH E;  4UV8 B;  1FMV A;  3LJC A;  3Q9D A;  5LGT B;  2W61 A;  1YW0 A;  1B7T A;  2W63 A;  2HH7 A;  3ZC1 A;  2Q9Q B;  2G0U A;  1HG5 A;  3O1H A;  5LA6 E;  1YD8 G;  2ODV A;  4G63 A;  5CB4 E;  4EXT A;  2EHO A;  3L09 A;  3BQI A;  3FBL A;  4U72 A;  1IJ6 A;  4ILU A;  5CA0 E;  3N9N A;  4DND A;  4E7Z A;  2IAK A;  5EZY E;  2WMN A;  4J2C A;  1ZV4 X;  4PJL A;  4HKA A;  2LSY A;  4H9S E;  4ZOL E;  5JR9 B;  2JMH A;  3ZMV B;  4IST A;  2ZM0 A;  2XAJ B;  1FMW A;  1H7C A;  1YKH B;  5LHI B;  2JQQ A;  4EAH A;  3PE0 A;  3BK9 A;  3E08 A;  2X9H A;  3AVS A;  2KWI B;  1MIV A;  2LJL A;  1OXZ A;  4C91 A;  4ZHQ E;  1HS7 A;  1T98 A;  5GON E;  4GYS A;  3EUH A;  4OK0 A;  5LBM A;  4PAG A;  2LOP A;  4KUM B;  4MAL A;  4IDZ A;  3LBX B;  1MIW A;  2JMK A;  3RRW A;  4U74 A;  4WBO A;  3QC9 A;  4CXX A;  1E1H B;  1HFA A;  4PW8 A;  5E0O A;  4OYJ A;  2RP4 A;  4X1Y E;  4ZI3 D;  3VKH A;  3N2G E;  3R84 B;  2V26 A;  4HFV A;  4QXH B;  5LBQ B;  3KDS E;  2CLY C;  2K9A A;  3KVA A;  2HPL A;  4XBF B;  3N9Q A;  4CZZ B;  2CXF A;  2VL8 A;  3C98 B;  3C50 A;  3B13 A;  3GMI A;  4GOU A;  2DI4 A;  3HKC E;  2IW5 B;  1LRZ A;  3I0Q A;  2VKD A;  4AQG A;  5LJM A;  1LVK A;  2YK0 A;  4A56 A;  1MMN A;  3I9Y A;  3I9W A;  4ANJ A;  5FXX A;  5KDM C;  4PNI A;  3UUX B;  1MMA A;  3CX7 B;  3N2O A;  1D1A A;  3AA1 B;  2UXN B;  3E22 E;  4O8S A;  4E7S A;  4CI2 B;  5FNV E;  4ADZ A;  1D0X A;  2KXP B;  4QX8 B;  3MJX A;  3W15 B;  4MBQ A;  2LOS A;  4X1K E;  5LG4 A;  3UUM A;  3LK2 B;  4PK5 A;  3LFM A;  2Q9Q D;  2Q9Q C;  5TAO A;  2X66 A;  4IE5 A;  2ZM8 A;  2JJ9 A;  3MZK B;  5FXW A;  5LOV E;  4AKG A;  2WWU A;  2KLQ A;  2V1D B;  3CX6 B;  2HPJ A;  3E0Z A;  3Q5W A;  3RRC A;  3P8C D;  5JR9 C;  2CWO A;  3ONX A;  3KV9 A;  5HWY A;  4UVA B;  2K48 A;  3UUN A;  2Y8D A;  5L3D B;  1D0Z A;  4O4J E;  2MYS A;  3MXZ A;  2BVL A;  2NOX A;  3J7Y q;  2A72 A;  2CXL A;  3T8O A;  3F57 A;  3R6N A;  3ANW A;  3ZYL A;  5HWX A;  3CQG B;  4WNK A;  3IBP A;  2NP9 A;  4L5G A;  2DLR A;  2E9X D;  5L2L A;  1BR0 A;  4IE7 A;  2WM9 A;  4BJM A;  4EB6 E;  2Y6X A;  5L3E B;  3C4X A;  5ETW A;  2YU1 A;  3GA8 A;  1BR4 A;  2N1G A;  1VOM A;  4YJ3 E;  4IE6 A;  3ZCJ A;  3A5X A;  2MTQ A;  3N9L A;  4G2A A;  4OHF A;  2D2S A;  4DVD A;  1G8X A;  1UX4 A;  2DNX A;  3C4W A;  2EHO C;  5LCY A;  3LK4 2;  4HTE A;  4UEM A;  5JVD E;  3AAA B;  1US7 B;  3ZMZ B;  1OWA A;  2KIN B;  4XAX B;  3FXD B;  4FI5 A;  2ZLY A;  3FBZ A;  5DQW A;  4L9I A;  5HAX A;  2YU2 A;  3LK3 B;  3ETU A;  3OBV E;  2LHN A;  4EOZ B;  2K5B B;  5J1G A;  5JRE A;  4O4H E;  4UIG A;  3L3P A;  5JDH A;  3CML A;  1AJ3 A;  3K3O A;  5J2T E;  4AKI A;  3EDV A;  2YEV C;  2X51 A;  1NWM X;  3N9P A;  4HE8 A;  2H3R A;  4JLE A;  3N9O A;  2DCF A;  3AAI A;  3C64 A;  2C0S A;  2KMF A;  3JC6 C;  1MNE A;  3HI2 A;  3ETV A;  2XUE A;  3PDY A;  2GK9 A;  2MOZ A;  4BJN A;  2X0L B;  4GIW A;  1SA0 E;  3AB3 B;  3IEE A;  1MMD A;  3VKG A;  3N9M A;  2ZM2 A;  3GN5 A;  4JEH B;  2VKO A;  5JH7 E;  3ZMU B;  4QHO A;  5ADX L;  2QGS A;  4DO0 A;  4CI1 B;  3V5S A;  3WAK A;  4ASK A;  4Z8X A;  2BDE A;  5DQV A;  3O1I A;  2D0U A;  3U3I A;  2X9Y A;  2LEH A;  2VKH A;  4O2A E;  2C5K T;  5EK4 A;  3UFE A;  2EHO B;  3NBX X;  3RC8 A;  3NZQ A;  1Y64 B;  4PJN A;  5H6Q B;  4QXB B;  1D1B A;  1HF8 A;  3CVR A;  4WBN E;  4P09 A;  3CQC B;  2LSI A;  2CWY A;  2Z6E A;  3AA6 B;  5HXR A;  2LE8 A;  3OKQ A;  4ISS A;  2XAF B;  2DWK A;  3OYZ A;  3K3N A;  4O4I E;  2PG8 A;  3I0O A;  4UV9 B;  3ZCI A;  3CKD A;  2XAQ B;  1O3X A;  3RH3 A;  4UVC B;  4I50 E;  5HXC A;  4GYR A;  3SS1 A;  4H9O C;  5HXS A;  1ZHC A;  2VWA A;  1U5P A;  4IE4 A;  4UEL A;  1MMG A;  5FY0 A;  2WSS V;  3GN5 B;  4MLK A;  4PJM A;  4H9P C;  3KV5 A;  2N2N A;  4X1I E;  2H7O A;  3HL6 A;  5LNK A;  5LHH B;  2WAU A;  3PUQ A;  4P0A A;  2H7V C;  1S94 A;  4L0R A;  3RC3 A;  5JDQ A;  1LKX A;  1X79 A;  1D1C A;  4IE0 A;  2ZMA A;  3HKB E;  4H9R C;  3RKO A;  1NAF A;  4P0B A;  2L3L A;  5KX5 E;  1IZN B;  5JDF A;  5F3J A;  1BR2 A;  5FXV A;  4EIW A;  1D0Y A;  3HKE E;  3ZJ1 A;  1HCI A;  4PFP A;  2L8K A;  3PUG A;  1KNZ A;  3RYC E;  2KWH A;  3DTO A;  2NTX A;  2JRK A;  2C5J A;  3O1J A;  4TV8 E;  2PFV A;  3AAE B;  5HYA A;  1WYB A;  3IF8 B;  3U78 A;  2BVM A;  4KP3 C;  3QUJ A;  2V7I A;  4H9N C;  3ZLI A;  3Q5X A;  3MA9 A;  3KIN B;  4GK0 E;  5J2U E;  5LHG B;  4BAY B;  3UUL A;  3B57 A;  3IHR A;  4JUY A;  1KK7 A;  2XAG B;  3FB2 A;  4TZ4 C;  4YHJ A;  3RYF E;  2A3D A;  1ZKE A;  3O9X A;  2NW8 A;  4UF0 A;  4CXY A;  3KV6 A;  4EYY R;  4TN7 B;  1SHZ C;  3KFW X;  5FYM A;  4I4T E;  3PUA A;  1MIY A;  1S35 A;  2CA5 A;  4CXW A;  3AA7 B;  4H9Q C;  4QX7 B;  5EK2 A;  1V9D A;  5KMG P;  2EHO D;  2X9X A;  3BQK A;  3K3Q C;  4X20 E;  1UCU A;  3OJA A;  5HXH A;  5M4Y A;  3WAJ A;  2M67 A;  3BQL A;  2I59 A;  1LVF A;  1WRD A;  3C51 A;  2MBG A;  2ES0 A;  3HKD E;  4H63 V;  3GWH A;  4YJ2 E;  5A1L A;  3C4Z A;  4IGU A;  2SPC A;  2P9B A;  3KV4 A;  4I55 E;  2ODU A;  5L3B B;  3RYI E;  4UXN B;  3CQX C;  3MAC A;  2JPF A;  4O4L E;  5FY7 A;  5DAB A;  3ANW B;  4PK6 A;  5AFU L;  3ZMS B;  4CQI A;  3WI3 A;  4DBR A;  4AKH A;  5F8P A;  2KT9 A;  2CXD A;  1YKE B;  2E9X A;  4B6X A;  3JC6 D;  1BR1 A;  3NZP A;  4K0U A;  4M1P A;  3ZN1 B;  3LBX A;  4FJO A;  2DHR A;  2VK9 A;  5FP3 A;  3CWZ B;  2N9D A;  2CEA A;  1IAP A;  1QSD A;  5FMN A;  5L3G B;  5C8Y E;  2QA7 A;  3ESL A;  1UX5 A;  2D5U A;  4OYK A;  1WLX A;  2XHE B;  5IYZ E;  5HXE A;  3NRY A;  4PFO A;  4IIJ E;  5EK3 A;  3S4U A;  1FEW A;  2WBL A;  2PBI A;  1ZEE A;  3HR0 A;  2IC9 A;  3SOL A;  2V7M A;  2CM0 A;  3ZYK A;  4AQF A;  3N2K E;  2B1E A;  2K24 A;  4AI6 A;  4NUU A;  2W0G A;  2XQY A;  2XTL A;  2J1D G;  4I43 B;  3I1A A;  2NW9 A;  1WR6 A;  4V1A v;  4EZ4 A;  5JRC A;  2V7L A;  5LGN B;  2CMR A;  3ZYM A;  2LSJ A;  1G73 A;  2XAH B;  4JEU B;  2BZB A;  2E9X B;  2KND A;  3KBU A;  1WYC A;  2VB6 A;  2X9W A;  5LYJ E;  3DP7 A;  4ZI2 D;  3H3A A;  4ZI2 C;  5JDN A;  3RPU A;  2LSG A;  2X68 A;  3V5U A;  4MHC A;  2D0T A;  4ZI3 C;  2W00 A;  3SWH A;  3VU7 H;  2V7K A;  4QWN B;  4BA9 A;  3UT5 E;  4PK4 A;  4DBQ A;  3PU8 A;  1HX8 A;  4UVB B;  4HGA A;  4AKL A;  3EVY A;  2Y48 B;  2OA5 A;  1EZ3 A;  2ACX A;  3ZEF B;  1Z0P A;  1U4Q A;  1IJ5 A;  2A2F X;  3UTK A;  4GK5 E;  1HTJ F;  2XAS B;  3M65 A;  3J9X 1;  4ERR A;  4QKN A;  4WW0 A;  2NWB A;  4KMC A;  3PUR A;  2CE7 A;  5LXT E;  2VKJ A;  4EYU A;  4OFZ A;  3ZJ2 A;  3HA4 A;  5BMV E;  2IC6 A;  2LSK A;  4CI3 B;  2NW7 A;  2WMO A;  3ZMT B;  5JRC B;  2LT3 A;  1HG2 A;  2YIN A;  5DJQ C;  1MND A;  3PUS A;  4DMV A;  5L3C B;  5JDL A;  5L3F B;  4TUY E;  2CCQ A;  3KBT A;  4N78 D;  3EDU A;  5FXZ A;  3SRZ A;  4MFR A;  2W62 A;  4DMW A;  4QXC B;  2DWG A;  4O2B E;  4F6R C;  3OYX A;  4C90 A;  4AKR B;  3KVB A;  3PTR B;  4HEA A;  4KBM B;  2X67 A;  5H6R B;  5LGU B;  3MK7 C;  1FIO A;  2C5I T;  2KZ7 B;  3TKL B;  4ZI7 E;  2E8I A;  2L9Q A;  3AA0 B;  1QUU A;  3CX8 B;  4TX5 A;  5JDG A;  4HN9 A;  3F2E A;  3N5L A;  5LJN A;  3Q2M A;  5LP6 E;  2V7J A;  3H37 A;  2Q9Q A;  4PJJ A;  1VRB A;  4EZH A;  3CPZ A;  3P7I A;  2LHR A;  5JQG E;  5JDM A;  1CUN A;  2CLY B;  2VAS A;  3QK6 A;  4AXP A;  2E9X C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...