4ERRA

1.55 angstrom crystal structure of the four helical bundle membrane localization domain (4hbm) of the vibrio vulnificus martx effector domain duf5
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
82
structure length
82
Chain Sequence
GQIFTVQELKERAKVFAKPIGASYQGILDQLDLVHQAKGRDQIAASFELNKKINDYIAEHPTSGRNQALTQLKEQVTSALGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title 1.55 Angstrom Crystal Structure of the Four Helical Bundle Membrane Localization Domain (4HBM) of the Vibrio vulnificus MARTX Effector Domain DUF5.
rcsb
source organism Vibrio vulnificus
molecule tags Protein binding
molecule keywords Autotransporter adhesin
total genus 32
structure length 82
sequence length 82
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4errA00
4ERRA 2BVMA 4DMWA 2BVLA 2VL8A 4DMVA 2VK9A 3SS1A 2VKDA 3SRZA 2VKHA
chains in the Genus database with same CATH superfamily
2A9UA 3L39A 2DWKA 5LMNT 3PU8A 5JDQA 2CRBA 5ETWA 4DUYT 4YY3T 4CI2B 3PUVF 4ILAA 1WR6A 4L5GA 4CXWA 1W09A 4WYVA 5ABEA 4XBFB 2BS2A 3KBTA 3KV4A 1X9BA 2E2AA 2WB5A 4UVBB 2WS3A 4AQYT 2KWIB 3O1HA 3VU7H 3ZN1B 3M3ZB 1CHUA 2ZM2A 2B76A 3FXEB 4IE0A 4PJNA 4PFOA 2UXDT 4TX5A 4PJLA 4E7SA 2AE9A 2IC6A 1MIVA 3L09A 4LF8T 2MOZA 4UVAB 3I0OA 2HHHT 2K48A 3JCFA 4UF0B 2NW9A 2RA1A 4KP3C 4I43B 4DR3T 3ZEFB 4UV8B 4HTEA 4YTMA 3N2KE 4TUYE 4ZZCA 4NUUA 1YKEB 3TLSA 1BR0A 4TWHA 1X79A 5LG4A 4TV8E 2V7IA 2W61A 4OK0A 4QH4A 5LG3A 1UCUA 4CN4A 5AQVB 5FY1A 2KSRA 2WMOA 3LFMA 4O4JE 4YLHA 4DBQA 5HXSA 3D0TA 3ONXA 3RC3A 2XM2A 3AXJB 5EK3A 5HEGA 2LSGA 2X0YA 5HYAA 1KNRA 3ETVA 4H9RC 5DJQC 2BVLA 2XASB 1N32T 5CB4E 3UUNA 2VASA 2VWAA 1MMDA 5LBMA 4H9NC 1UURA 2H89A 3V5SA 2JQKA 2LEHA 2X9HA 3HKDE 4CN1A 4B3ST 4IT4A 4TN7B 2C5JA 2V6YB 3FXDB 5F3JA 2CLYB 2Y6XA 4UIGA 3KINB 3IA3A 1MIWA 1KF6A 2EHOA 3ZCJA 2IC9A 1NENA 5ABFB 5LCYA 4C90A 4JI8T 4EAHA 1HCIA 3K1SA 5H6QB 4QH1A 4A97A 3AEBA 2W0GA 3IHRA 4LF9T 2YN6A 3QK6A 4HFEA 3VHLA 1FIOA 5FVKA 1N36T 2JPFA 1Y64B 2H7OA 2D9DA 4QHOA 5FXVA 2UXBT 2LE8A 2ODVA 2W66A 2QYWA 4O4LE 5HWYA 5CFBA 4TNWA 1MNDA 5H6RB 4JEUB 1L0VA 4B3RT 1SHZC 3I9WA 5L4HA 2L3LA 2YU1A 2LSIA 1VRBA 2BBJA 5HCMA 4B3MT 3LBXB 3R6NA 2V6YA 1WFDA 2BS4A 2LT3A 2Y8DA 4PK5A 4WBOA 4DV3T 3CIRA 2WDVA 3MACA 3QNUA 4GK0E 5JVDE 1MNEA 2MTQA 3RIFA 5ADXL 3BQLA 3GN5B 2XZEA 5ABFA 3ANWA 4QXHB 4X66T 1G8XA 1S35A 5FL1A 5KMGP 4EGWA 3NVOA 4MFRA 2WBLA 2CM0A 4GOUA 1WYBA 4FJOA 3FZHB 3PTRB 1UK5A 4GK5E 5HEUA 3TLVA 2LRLA 2G0UA 2J47A 2N9DA 2Y48B 2IAKA 4QH5A 5AQHB 3P4PA 1HX8A 5FL0A 4HEAA 3RIUA 3W15B 5JDGA 3EUHA 1AJ3A 1HNWT 3NRYA 3AE2A 3ESLA 4BAYB 4AI6A 3IEEA 2QRXA 3PUWF 4KMCA 4LF4T 1Z0PA 4OYJA 5IWAT 5AFUL 2LHRA 2VL0A 4O2BE 5LGUB 2HH7A 4GYSA 3CQCB 4U72A 2LOSA 4U7YA 1WRDA 4H9QC 5JREA 3O1IA 1UX4A 1YQ4A 1U4QA 5JR9C 5IYZE 1HTJF 5BMVE 1T98A 3I9YA 4IE6A 2LSKA 3ZPOA 1MMAA 4ZI7E 4X64T 2CE7A 1KNZA 4PJJA 2UUBT 3AXJA 2V26A 5HEOA 1VOMA 5LGNB 2C5KT 3OKQA 5A1LA 4J2CA 4YT0A 4JI1T 4JI4T 3ONLC 4DR1T 1E2AA 4C91A 4ZI3C 3LSVA 2CLYC 1T8BA 4I55E 4IL4A 4ISSA 2P9BA 2UXXB 5DQVA 3RF1A 4JBWF 3RQWA 2IHR1 3RYIE 4CZZB 5C8YE 3O9XA 3IBPA 2WDQA 3AE7A 4Z8XA 5LP6E 2Q9QB 2KXPB 1CUNA 2K5BB 2NWBA 3I0QA 2MBGA 4HFHA 3SFDA 4ZEYA 4JI6T 3KBUA 4CI1B 4L9IA 4V1Av 3Q5WA 4LFAT 2XM1A 4MALA 3B5MA 3P4SA 2R6GF 2LHNA 2NTYA 4EYUA 2K3WA 5FKYA 3ONJA 4EYYR 4YSYA 2BDEA 3PE0A 3FB2A 5LBQB 3MA9A 5LHHB 2BKNA 1HNXT 5JTGA 1WCRA 4O4HE 4QWNB 2W2UA 5AQMB 5HXHA 2V1DB 1WYCA 5AQGB 3K3NA 4NUVA 3LDQB 1LVKA 1V9DA 2BKPA 3AECA 3EAMA 2E8IA 4K0UA 2XQ8A 1BR4A 4TWDA 2XSBA 4X1IE 2KMFA 4Z90A 3ZT5A 3UUMA 3K8PC 1FMWA 4KHPT 3OBVE 2XQ5A 5LNKA 3PJAA 1S94A 1U5PA 2ZM0A 3PUYF 1QLBA 3ANWB 3RQUA 4EZ4A 1E7PA 3R84B 2D0UA 2E9XC 1YKHB 2FJEA 3AB3B 3PV0F 3ZMTB 2E5LT 4DR6T 2XAJB 4IDPA 4X20E 4DR2T 2H3RA 4X5TA 1UUSA 3CKDA 5LB7B 2VK9A 2M6IA 1UGOA 2PJQA 2XQ9A 4ISTA 2CXDA 3ZMUB 3RKOA 2CBIA 5FMNA 4OHFA 2FJBA 1T7SA 2JJ9A 3CVRA 3EABA 2VQFT 2IIUA 4LMJA 2BBHA 3RH3A 5LHIB 3PJAJ 4XAXB 2KWHA 4UF0A 2JMHA 3ZYLA 2BS3A 2ZM8A 1US7B 3N9MA 3PUGA 4QXBB 1IBKT 4KHZF 2E5VA 2L9QA 3OYZA 4UEMA 2BZBA 4G63A 5HXCA 3UU5A 2B1EA 2YU2A 4QXCB 5AQJB 3AA0B 5LYJE 4P0AA 3N9NA 2FJDA 4CN6A 3VKGA 1EZ3A 4DV2T 2WU5A 3CX8B 2XQAA 1OEDC 3Q5EA 4U74A 2V5CA 2YEVC 4ILCA 3RLFF 4UR9A 3AEDA 1Z8UA 4XZCA 4LMLA 2WDRA 1W0AA 4KBMB 5CA1E 3RYCE 1BR1A 3P4WA 4HWDA 4JI2T 5EK4A 5FXWA 4WBNE 2ZMAA 2X68A 4JUYA 4HGAA 5AQQB 2ACXA 3UT5E 2ZM6T 3KVAA 1OEDA 1VCTA 2QGSA 3MJXA 4H63V 1XNRT 1OXZA 2JQHA 3UULA 1FMVA 2XQYA 5LJNA 3HKCE 3HA4A 3ZJ1A 4OFZA 4AISA 4IE7A 5JQGE 2XSAA 3UUXB 3ZT7A 3U78A 1IJ6A 4ZOLE 3VRAA 4JI3T 4WZXA 4AKGA 3OYXA 2HN2A 3N2OA 3N9QA 3PDYA 3QB5A 4EXTA 3DJBA 3AEAA 4MLKA 4DIDB 3GA8A 4YSXA 2V7MA 3F2EA 4MHCA 5F5WA 2LSJA 2VVSA 1XMQT 4H63H 2Z6EA 3QUJA 3ZKRA 2MYSA 3HKEE 2DCFA 5FY0A 2IMLA 3KFWX 4U33A 5AQLB 3U3IA 2M6BA 2UU9T 2IUBA 3P50A 4ZXLA 2WQYA 2E9XD 3EI0A 4GYRA 5AQUB 1MMGA 2YKSA 3N9LA 4G2AA 2A3DA 3PUXF 4IIJE 4QX7B 2W67A 4N78D 5HAXA 3LJCA 3AEFA 3H37A 2UUAT 3ZMZB 5JRCA 4ZHQE 4LMKA 4ZS2A 1J1JA 5L47A 1HF8A 2MPKA 4ZI2D 5L3GB 2WM9A 4OYKA 1XMOT 3B57A 3L8RA 4NPPA 4AXPA 1Y01A 3AVRA 1W0BA 5TAOA 4GKJT 3K3QC 1NEKA 2MAWA 4AKRB 4ASKA 4JI0T 2LOPA 4JI5T 4EIWA 5JH7E 2FBWA 4U2YA 2XTLA 5AQNB 2I59A 4BJMA 1E1HB 3P4RA 2WY2A 3FZFB 4DV6T 3N5LA 2JQQA 2WAUA 2KNDA 4HWIB 4L0RA 2WZIA 4ILBA 2FJAA 4HE8A 3SFEA 1GQEA 3M65A 5KDMC 2YINA 1BR2A 1D0YA 2CXLA 2V7KA 2JRKA 2XJ7A 2IW5B 4AKLA 4H9OC 4Z91A 5L2LA 2WSSV 1I94T 3JADA 3RKGA 3RRWA 2C5IT 1HR0T 4EEBA 5L4EA 3P8CD 3AE3A 1IBMT 1R8IA 4LF6T 3ZSSA 3Q5XA 1O3XA 4IL9A 1XDPA 2BG9A 3AE4A 5C2TA 5KXJA 2DL1A 3JC6C 2VKDA 2XAQB 4GKKT 5AQIB 2LLYA 2CEAA 5AQKB 3ZYMA 3ZYKA 2WZHA 3RI5A 3VRBA 5ABHA 4JV5T 2X9YA 4X1YE 4DR4T 1T72A 4P1NA 1LRZA 3UTKA 3RIAA 3TLUA 4K0KT 1DU2A 4HWCA 1JNRA 1XZYA 2CHNA 3EDUA 4AQFA 2JQ9A 1YXRA 3EVYA 2WCAA 4X62T 2HPJA 1W9RA 2E9XB 2H88A 2JMKA 4ILUA 3AEGA 4TWFA 3RX6A 2VQET 4BJNA 3ZC0A 3N9PA 4YTPA 2IDOB 4YFSA 2V7JA 3AA6B 3HI2A 4JEHB 3AE1A 3RPUA 3AA1B 3RYFE 4B6XA 4F8HA 1J5WA 4YJ2E 2F4VT 1OWAA 1XWMA 3FHNA 3TLTA 3RIUC 4O4IE 5HEJA 1B7TA 2D0TA 4TZ4C 1ZOYA 3KV9A 2BKOA 3F57A 3NZQA 2UXCT 5LXTE 5DABA 3AE8A 5BR8T 2W00A 4ERRA 2C0SA 2YK0A 4HFCA 4U7IA 3VR9A 4DMVA 2X0LB 5JDHA 3QOFA 2GK9A 1FJGT 5EK2A 3H3AA 5J2TE 3AA7B 2YDRA 4U31A 2ZLYA 1SE7A 2WMNA 3AE9A 3LG7A 1LVFA 4I0UA 5FP3A 5HXRA 2WWVA 3ZN0B 4YXDA 2XQ3A 3CX7B 3LK2B 3AAAB 3GMIA 3RRCA 4B3TT 5JDLA 2CBJA 2LKHA 3NZPA 4M1PA 2A72A 1XDOA 4CXXA 4KX6A 3CX6B 2VB6A 3ZSTA 5L3FB 5LA6E 4O2AE 5LMUT 4LFCT 2CA5A 4ADZA 4EOZB 1ZKEA 3MKDA 2PTFA 3PURA 1J5ET 2YDQA 2CCQA 3EDVA 1OEDE 3CQXC 3Q9DA 2YOEA 3C51A 4PFPA 3FBLA 4DV1T 3VKHA 5JR9B 4HN9A 2BVMA 3CWZB 3NRXA 2XAFB 4PJMA 3CMLA 2PFVA 2BG9E 3JAFA 2W62A 2XUEA 3KV5A 3OVUA 3G06A 1HFAA 4IE5A 4UVCB 3ZT6A 1YD8G 4EB6E 4E7ZA 2NOXA 3MK7C 5EZYE 4KUMB 2BG9C 1UX5A 5DQWA 3NWIA 3UQ7A 2X51A 1MMNA 3JC6D 3S4UA 3E0ZA 3O1JA 3ZMVB 3AAIA 2VURA 3A8YC 3AEEA 3E22E 1OEDB 1QUUA 2WP9A 2V5DA 3C50A 4IDZA 4U3CA 5KX5E 1N33T 4WW0A 2L8KA 3A7MA 3PU3A 4UV9B 3RGLA 2ES0A 2ACZA 2NP9A 4X1KE 5AQRB 2XY8B 2E9XA 2VKHA 5M4YA 4F6RC 2HPLA 2J4GA 2DHRA 4HFVA 3Q5DA 4QX8B 2J62A 2PG8A 3TKLB 3KVBA 1ZEEA 2CHOA 4Q25A 5CA0E 4X65T 5JRCB 2QVAA 4IREA 5FVLA 1XNQT 1VCSA 2EHOD 4DR5T 2V8SV 3JAEA 4A56A 4JI7T 4CQIA 1ZHCA 2NW8A 1ZP0A 1ZV4X 3B13A 3MXZA 3O4XE 4QKNA 1WLXA 1H7CA 1JNZA 5IUXA 4UXNB 3FZLB 1SUMB 5HXEA 2ODUA 2LM2A 4I50E 1M7KA 2XQ6A 1SA0E 4HFIA 1HG2A 4IGUA 2DLRA 3HL6A 2WWUA 3SWHA 2X9WA 1D0ZA 3UU8A 3ZJ2A 4DV5T 3BQKA 5FXXA 5JDMA 4AIUA 4FI5A 3J9X1 3PUAA 2D2SA 3FBZA 4TNVA 3UQ4A 4HFBA 2XHEB 1HX1B 3QC9A 3UU4A 1G73A 4YHJA 4P0BA 2DWGA 2OV9A 2KLQA 5AQPB 5AQSB 4DR7T 3DP7A 4DBRA 3T1HT 3NBXX 4HKAA 2KT9A 2VL8A 2X0HA 3RYHE 3HKBE 3AAEB 2CWOA 3AE6A 4PNIA 4ZI2C 3IF8B 1YQ3A 2NW7A 4TV9E 3UFEA 4EEDA 4ZZBA 2I0MA 4P09A 4COFA 3ZLIA 4YHHT 3NKZA 3PUQA 4JLEA 5JDNA 5AQFB 3GWHA 3KV6A 3LK42 3RHWA 2OLTA 5FXZA 3TLWA 3ZC1A 2NTXA 3J7Yq 2V6XA 4LF7T 1HS7A 3C4WA 5JR9A 3FZKB 1YW0A 3WAJA 4DV0T 3QB5K 5LGTB 2H7VC 3N9OA 5J1GA 4NIQA 4HFDA 2W4XA 3OJAA 3ZMSB 2V7LA 3CK6A 4LF5T 4H9SE 3OPCA 2Q9QD 5LHGB 3BK9A 3CQGB 2LKGA 2VKOA 2J1DG 2BG9B 2K9AA 1D1CA 4MBQA 2YDSA 4HWHA 5JDFA 3RC8A 1IZNB 4DV4T 2DNXA 3P7IA 3PUZF 4DVDA 3LBXA 4EV6A 3AE5A 4O8SA 4ANJA 3I1AA 5J2UE 1NAFA 3ETUA 2FUPA 2CWYA 4OX9T 2N2NA 1WR0A 2UXNB 4PAGA 4IDNA 3GN5A 3SRZA 1HNZT 5LJMA 3C64A 5F8PA 4H9PC 5GONE 2QA7A 3WI3A 5L3CB 1M62A 4EZHA 3E08A 3L3PA 4A5XA 1LKXA 3C4XA 4CI3B 2SPCA 5AQOB 1NWMX 4UELA 4WNKA 3UFGA 2I6HA 1MIYA 3KDSE 2LM9A 2XQ7A 4NXNT 5L3DB 2D5UA 1KFYA 4IE4A 1D1AA 3K3OA 2CPTA 2PBIA 5AQTB 2K24A 5FYMA 3VR8A 2X66A 1FEWA 3A5XA 3CPZA 2W63A 3UUBA 1D1BA 3EHZA 3T1YT 2A2FX 4GIWA 4ZS3A 5HEHA 2X67A 2RP4A 4BA9A 2HN1A 1KK7A 2X9XA 1QSDA 2XQ4A 3PUSA 3H3MA 3V5UA 4DMWA 1N34T 1IBLT 4AKHA 3FZMB 2Q9QC 2XAHB 5J0ZA 2EHOC 4HWFA 2UUCT 2KZ7B 1D0XA 1KNPA 2WU2A 3X1DA 4ZI3D 4IHJE 2N1GA 5HCJA 3OTOT 5LOVE 3LK3B 4I4TE 3HR0A 3ZCIA 1KEYA 2DI4A 2JIWA 4KI0F 5IHYA 2AXDS 2RPAA 4LFBT 5ABGA 5C3JA 4CXYA 5HWXA 2M67A 2VKJA 4YTNA 5L3BB 2Q9QA 3SOLA 2KINB 2LRKA 3P4QA 4AQGA 2LJLA 3ABVA 3BQIA 3UU6A 4DNDA 3C98B 4JYAT 4DO0A 3SS1A 4YSZA 1HG5A 4PW8A 1IAPA 5CJ5A 4A98A 5CGMA 4DV7T 5FNVE 2XAGB 4PK6A 2VVNA 2LSYA 3N2GE 4IDQA 3WAKA 3UU3A 4IDOA 3Q2MA 5L3EB 2XPKA 4U2ZA 4YJ3E 4NXMT 1IJ5A 5FY7A 3MZKB 4AKIA 3C4ZA 3AVSA 2NR4A 3F31A 4PK4A 5E0OA 3T8OA 2CMRA 2OA5A 2EHOB 1I6ZA 4DUZT 2CXFA 3DTOA 4AQFC
chains in the Genus database with same CATH topology
2DWKA 3PU8A 5JDQA 5ETWA 4CI2B 1WR6A 4L5GA 4CXWA 4XBFB 3KBTA 3KV4A 4UVBB 2KWIB 3O1HA 3VU7H 3ZN1B 2ZM2A 3FXEB 4IE0A 4PJNA 4PFOA 4TX5A 4PJLA 4E7SA 2IC6A 1MIVA 3L09A 2MOZA 4UVAB 3I0OA 2K48A 4UF0B 2NW9A 2RA1A 4KP3C 4I43B 3ZEFB 4UV8B 4HTEA 3N2KE 4TUYE 4NUUA 1YKEB 1BR0A 1X79A 5LG4A 4TV8E 2V7IA 2W61A 4OK0A 1UCUA 5FY1A 2WMOA 3LFMA 4O4JE 4YLHA 4DBQA 5HXSA 3D0TA 3ONXA 3RC3A 5EK3A 2LSGA 5HYAA 3ETVA 4H9RC 5DJQC 2BVLA 2XASB 5CB4E 2VASA 2VWAA 1MMDA 5LBMA 4H9NC 4C91A 3V5SA 2LEHA 2X9HA 3HKDE 4TN7B 2C5JA 3FXDB 5F3JA 2CLYB 2Y6XA 4UIGA 3KINB 1MIWA 2EHOA 3ZCJA 2IC9A 5LCYA 4C90A 4EAHA 1HCIA 5H6QB 2W0GA 3IHRA 3QK6A 3VHLA 1FIOA 2JPFA 1Y64B 2H7OA 4QHOA 5FXVA 2LE8A 2ODVA 4O4LE 5HWYA 1MNDA 5H6RB 4JEUB 1SHZC 3I9WA 2L3LA 2YU1A 2LSIA 1VRBA 3LBXB 3R6NA 2Y8DA 4PK5A 2LT3A 4WBOA 3MACA 4GK0E 5JVDE 1MNEA 2MTQA 5ADXL 3BQLA 3GN5B 3ANWA 4QXHB 1G8XA 1S35A 4MFRA 2WBLA 2CM0A 4GOUA 1WYBA 4FJOA 3PTRB 4GK5E 3ZYLA 2G0UA 2N9DA 5KMGP 2Y48B 2IAKA 5L3DB 5JRCB 1HX8A 4HEAA 3W15B 5JDGA 1AJ3A 3EUHA 3NRYA 3ESLA 4BAYB 4AI6A 3IEEA 4KMCA 1Z0PA 4OYJA 5AFUL 2LHRA 4O2BE 5LGUB 2HH7A 4GYSA 3CQCB 4U72A 2LOSA 1WRDA 4H9QC 5JREA 3O1IA 1UX4A 1U4QA 5JR9C 5IYZE 1HTJF 5BMVE 1T98A 3I9YA 4IE6A 2LSKA 3ZPOA 1MMAA 1KNZA 2CE7A 4PJJA 2V26A 1VOMA 5LGNB 2C5KT 3OKQA 5A1LA 4J2CA 4ZI3C 2CLYC 4ISSA 4I55E 3ZC0A 4CZZB 2P9BA 2UXXB 5DQVA 3O9XA 3RYIE 5C8YE 3IBPA 4Z8XA 5LP6E 2KXPB 2NWBA 1CUNA 2K5BB 2Q9QB 3I0QA 2MBGA 3KBUA 4CI1B 4L9IA 4V1Av 3Q5WA 4MALA 2LHNA 2NTYA 4EYUA 4EYYR 5LHHB 2BDEA 3PE0A 3FB2A 5LBQB 3MA9A 4O4HE 4QWNB 5HXHA 2V1DB 1WYCA 3K3NA 4NUVA 1LVKA 1V9DA 4K0UA 2E8IA 1BR4A 4X1IE 2KMFA 3UUMA 3K8PC 1FMWA 3OBVE 5LNKA 1S94A 1U5PA 2ZM0A 3ANWB 4EZ4A 3R84B 2D0UA 2E9XC 1YKHB 3AB3B 3ZMTB 2XAJB 4X20E 2H3RA 3CKDA 2VK9A 2PJQA 4ISTA 2CXDA 3ZMUB 3RKOA 5FMNA 4OHFA 2JJ9A 3CVRA 3RH3A 5LHIB 4XAXB 2KWHA 4UF0A 2JMHA 2ZM8A 1US7B 3N9MA 3PUGA 4QXBB 2L9QA 3OYZA 4UEMA 2BZBA 4G63A 5HXCA 2B1EA 2YU2A 4QXCB 3AA0B 5LYJE 4P0AA 3N9NA 3VKGA 1EZ3A 3CX8B 4U74A 2YEVC 4XZCA 4KBMB 5CA1E 3RYCE 1BR1A 5EK4A 5FXWA 4WBNE 2ZMAA 2X68A 4JUYA 4HGAA 3UT5E 2ACXA 3KVAA 2QGSA 3MJXA 4H63V 1OXZA 3UULA 1FMVA 2XQYA 5LJNA 3HKCE 3HA4A 3ZJ1A 4OFZA 4IE7A 5JQGE 3UUXB 3U78A 1IJ6A 4ZOLE 4AKGA 3OYXA 3N2OA 3N9QA 3PDYA 4EXTA 3DJBA 4MLKA 3GA8A 2V7MA 3F2EA 4MHCA 2LSJA 4H63H 2Z6EA 3QUJA 2MYSA 3HKEE 2DCFA 5FY0A 3KFWX 3U3IA 4GYRA 2E9XD 1MMGA 3N9LA 4G2AA 2A3DA 4IIJE 4QX7B 4N78D 5HAXA 3LJCA 5JRCA 3H37A 3ZMZB 4ZHQE 4ZS2A 5L3GB 1HF8A 4ZI2D 2WM9A 4OYKA 3B57A 4AXPA 3AVRA 5TAOA 3K3QC 4AKRB 4ASKA 2LOPA 4EIWA 5JH7E 2XTLA 2I59A 4BJMA 1E1HB 3N5LA 2JQQA 2WAUA 2KNDA 4L0RA 4HE8A 5KDMC 3M65A 2YINA 1BR2A 1D0YA 2CXLA 2V7KA 2JRKA 2IW5B 4AKLA 5L2LA 4H9OC 2WSSV 3RRWA 2C5IT 3P8CD 3Q5XA 1O3XA 3JC6C 2VKDA 2XAQB 2CEAA 3ZYMA 3ZYKA 2X9YA 4X1YE 1LRZA 3UTKA 3EDUA 4AQFA 3EVYA 2HPJA 2E9XB 3RX6A 2JMKA 4BJNA 3N9PA 4YFSA 2V7JA 3AA6B 3HI2A 4JEHB 3RPUA 3RYFE 3AA1B 4B6XA 4YJ2E 1OWAA 3FHNA 4O4IE 1B7TA 2D0TA 4TZ4C 3KV9A 3F57A 3NZQA 5LXTE 5DABA 2W00A 4ERRA 2C0SA 2YK0A 4DMVA 5JDHA 2X0LB 2GK9A 5EK2A 3H3AA 5J2TE 3AA7B 2ZLYA 2WMNA 3LG7A 5FP3A 5HXRA 1LVFA 3ZN0B 3CX7B 3LK2B 3AAAB 3GMIA 3RRCA 5JDLA 3NZPA 4M1PA 2A72A 4CXXA 5L3FB 3CX6B 2VB6A 5LA6E 4O2AE 2CA5A 4ADZA 4EOZB 1ZKEA 3MKDA 3PURA 2CCQA 3EDVA 3CQXC 3Q9DA 3C51A 4PFPA 3FBLA 3VKHA 5JR9B 4HN9A 3CWZB 2BVMA 3NRXA 2XAFB 4PJMA 3CMLA 2PFVA 3ZC1A 3KV5A 2W62A 2XUEA 4IE5A 4UVCB 3ZCIA 1HFAA 4EB6E 4E7ZA 4ZI7E 1YD8G 2NOXA 3MK7C 5EZYE 4KUMB 1UX5A 5DQWA 2X51A 1MMNA 3JC6D 3S4UA 3E0ZA 3O1JA 3ZMVB 3AAIA 3E22E 1QUUA 3C50A 4IDZA 5KX5E 4WW0A 2L8KA 3PU3A 4UV9B 2ES0A 5M4YA 2NP9A 4X1KE 2E9XA 2VKHA 4F6RC 2HPLA 2DHRA 4HFVA 4QX8B 2PG8A 3TKLB 3KVBA 1ZEEA 5CA0E 2EHOD 4A56A 4CQIA 1ZHCA 2NW8A 1ZV4X 3B13A 3MXZA 3O4XE 4QKNA 1WLXA 1H7CA 4UXNB 5HXEA 2ODUA 4I50E 4ILUA 1SA0E 3SWHA 1HG2A 4IGUA 2DLRA 3HL6A 2WWUA 2X9WA 1D0ZA 3ZJ2A 3BQKA 5FXXA 4FI5A 3J9X1 3PUAA 2D2SA 3FBZA 2XHEB 3QC9A 1G73A 4YHJA 4P0BA 2DWGA 2KLQA 3DP7A 4DBRA 3NBXX 4HKAA 2KT9A 2VL8A 3RYHE 5JDMA 3HKBE 3AAEB 2CWOA 4PNIA 4ZI2C 3IF8B 3UFEA 2NW7A 4TV9E 4P09A 3ZLIA 3PUQA 4JLEA 5JDNA 3GWHA 3KV6A 3LK42 5FXZA 3J7Yq 2NTXA 1HS7A 3C4WA 5JR9A 3WAJA 1YW0A 5LGTB 2H7VC 3N9OA 5J1GA 3OJAA 3ZMSB 2V7LA 4H9SE 2Q9QD 5LHGB 3BK9A 3CQGB 2VKOA 3UUNA 2J1DG 2K9AA 4MBQA 1D1CA 5JDFA 3RC8A 1IZNB 2DNXA 3P7IA 4DVDA 3LBXA 4O8SA 4ANJA 3I1AA 5J2UE 1NAFA 3ETUA 2CWYA 2N2NA 2UXNB 4PAGA 3SRZA 3GN5A 5LJMA 3C64A 5F8PA 4H9PC 5GONE 2QA7A 3WI3A 5L3CB 4EZHA 3E08A 3L3PA 1LKXA 3C4XA 4CI3B 2SPCA 1NWMX 4UELA 4WNKA 1MIYA 3KDSE 2LM9A 2D5UA 4IE4A 1D1AA 3K3OA 2PBIA 5FYMA 2K24A 2X66A 1FEWA 3A5XA 3CPZA 2W63A 1D1BA 2A2FX 4GIWA 4ZS3A 4BA9A 2X67A 2RP4A 1KK7A 2X9XA 1QSDA 3PUSA 3V5UA 4DMWA 4AKHA 2Q9QC 2XAHB 2EHOC 2KZ7B 1D0XA 4ZI3D 4IHJE 2N1GA 5LOVE 3LK3B 4I4TE 3HR0A 2DI4A 5IHYA 4CXYA 5HWXA 2M67A 2VKJA 5L3BB 2Q9QA 3SOLA 2KINB 4AQGA 2LJLA 3BQIA 4DNDA 3C98B 4DO0A 3SS1A 1HG5A 4PW8A 1IAPA 5FNVE 2XAGB 4PK6A 2LSYA 3N2GE 3WAKA 5L3EB 3Q2MA 4YJ3E 1IJ5A 5FY7A 3MZKB 4AKIA 3C4ZA 3AVSA 3F31A 4PK4A 5E0OA 3T8OA 2CMRA 2OA5A 2EHOB 2CXFA 3DTOA 4AQFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ERR A;  2BVM A;  4DMW A;  2BVL A;  2VL8 A;  4DMV A;  2VK9 A;  3SS1 A;  2VKD A;  3SRZ A;  2VKH A; 
#chains in the Genus database with same CATH topology
 2A9U A;  3L39 A;  2DWK A;  5LMN T;  3PU8 A;  5JDQ A;  2CRB A;  5ETW A;  4DUY T;  4YY3 T;  4CI2 B;  3PUV F;  4ILA A;  1WR6 A;  4L5G A;  4CXW A;  1W09 A;  4WYV A;  5ABE A;  4XBF B;  2BS2 A;  3KBT A;  3KV4 A;  1X9B A;  2E2A A;  2WB5 A;  4UVB B;  2WS3 A;  4AQY T;  2KWI B;  3O1H A;  3VU7 H;  3ZN1 B;  3M3Z B;  1CHU A;  2ZM2 A;  2B76 A;  3FXE B;  4IE0 A;  4PJN A;  4PFO A;  2UXD T;  4TX5 A;  4PJL A;  4E7S A;  2AE9 A;  2IC6 A;  1MIV A;  3L09 A;  4LF8 T;  2MOZ A;  4UVA B;  3I0O A;  2HHH T;  2K48 A;  3JCF A;  4UF0 B;  2NW9 A;  2RA1 A;  4KP3 C;  4I43 B;  4DR3 T;  3ZEF B;  4UV8 B;  4HTE A;  4YTM A;  3N2K E;  4TUY E;  4ZZC A;  4NUU A;  1YKE B;  3TLS A;  1BR0 A;  4TWH A;  1X79 A;  5LG4 A;  4TV8 E;  2V7I A;  2W61 A;  4OK0 A;  4QH4 A;  5LG3 A;  1UCU A;  4CN4 A;  5AQV B;  5FY1 A;  2KSR A;  2WMO A;  3LFM A;  4O4J E;  4YLH A;  4DBQ A;  5HXS A;  3D0T A;  3ONX A;  3RC3 A;  2XM2 A;  3AXJ B;  5EK3 A;  5HEG A;  2LSG A;  2X0Y A;  5HYA A;  1KNR A;  3ETV A;  4H9R C;  5DJQ C;  2BVL A;  2XAS B;  1N32 T;  5CB4 E;  3UUN A;  2VAS A;  2VWA A;  1MMD A;  5LBM A;  4H9N C;  1UUR A;  2H89 A;  3V5S A;  2JQK A;  2LEH A;  2X9H A;  3HKD E;  4CN1 A;  4B3S T;  4IT4 A;  4TN7 B;  2C5J A;  2V6Y B;  3FXD B;  5F3J A;  2CLY B;  2Y6X A;  4UIG A;  3KIN B;  3IA3 A;  1MIW A;  1KF6 A;  2EHO A;  3ZCJ A;  2IC9 A;  1NEN A;  5ABF B;  5LCY A;  4C90 A;  4JI8 T;  4EAH A;  1HCI A;  3K1S A;  5H6Q B;  4QH1 A;  4A97 A;  3AEB A;  2W0G A;  3IHR A;  4LF9 T;  2YN6 A;  3QK6 A;  4HFE A;  3VHL A;  1FIO A;  5FVK A;  1N36 T;  2JPF A;  1Y64 B;  2H7O A;  2D9D A;  4QHO A;  5FXV A;  2UXB T;  2LE8 A;  2ODV A;  2W66 A;  2QYW A;  4O4L E;  5HWY A;  5CFB A;  4TNW A;  1MND A;  5H6R B;  4JEU B;  1L0V A;  4B3R T;  1SHZ C;  3I9W A;  5L4H A;  2L3L A;  2YU1 A;  2LSI A;  1VRB A;  2BBJ A;  5HCM A;  4B3M T;  3LBX B;  3R6N A;  2V6Y A;  1WFD A;  2BS4 A;  2LT3 A;  2Y8D A;  4PK5 A;  4WBO A;  4DV3 T;  3CIR A;  2WDV A;  3MAC A;  3QNU A;  4GK0 E;  5JVD E;  1MNE A;  2MTQ A;  3RIF A;  5ADX L;  3BQL A;  3GN5 B;  2XZE A;  5ABF A;  3ANW A;  4QXH B;  4X66 T;  1G8X A;  1S35 A;  5FL1 A;  5KMG P;  4EGW A;  3NVO A;  4MFR A;  2WBL A;  2CM0 A;  4GOU A;  1WYB A;  4FJO A;  3FZH B;  3PTR B;  1UK5 A;  4GK5 E;  5HEU A;  3TLV A;  2LRL A;  2G0U A;  2J47 A;  2N9D A;  2Y48 B;  2IAK A;  4QH5 A;  5AQH B;  3P4P A;  1HX8 A;  5FL0 A;  4HEA A;  3RIU A;  3W15 B;  5JDG A;  3EUH A;  1AJ3 A;  1HNW T;  3NRY A;  3AE2 A;  3ESL A;  4BAY B;  4AI6 A;  3IEE A;  2QRX A;  3PUW F;  4KMC A;  4LF4 T;  1Z0P A;  4OYJ A;  5IWA T;  5AFU L;  2LHR A;  2VL0 A;  4O2B E;  5LGU B;  2HH7 A;  4GYS A;  3CQC B;  4U72 A;  2LOS A;  4U7Y A;  1WRD A;  4H9Q C;  5JRE A;  3O1I A;  1UX4 A;  1YQ4 A;  1U4Q A;  5JR9 C;  5IYZ E;  1HTJ F;  5BMV E;  1T98 A;  3I9Y A;  4IE6 A;  2LSK A;  3ZPO A;  1MMA A;  4ZI7 E;  4X64 T;  2CE7 A;  1KNZ A;  4PJJ A;  2UUB T;  3AXJ A;  2V26 A;  5HEO A;  1VOM A;  5LGN B;  2C5K T;  3OKQ A;  5A1L A;  4J2C A;  4YT0 A;  4JI1 T;  4JI4 T;  3ONL C;  4DR1 T;  1E2A A;  4C91 A;  4ZI3 C;  3LSV A;  2CLY C;  1T8B A;  4I55 E;  4IL4 A;  4ISS A;  2P9B A;  2UXX B;  5DQV A;  3RF1 A;  4JBW F;  3RQW A;  2IHR 1;  3RYI E;  4CZZ B;  5C8Y E;  3O9X A;  3IBP A;  2WDQ A;  3AE7 A;  4Z8X A;  5LP6 E;  2Q9Q B;  2KXP B;  1CUN A;  2K5B B;  2NWB A;  3I0Q A;  2MBG A;  4HFH A;  3SFD A;  4ZEY A;  4JI6 T;  3KBU A;  4CI1 B;  4L9I A;  4V1A v;  3Q5W A;  4LFA T;  2XM1 A;  4MAL A;  3B5M A;  3P4S A;  2R6G F;  2LHN A;  2NTY A;  4EYU A;  2K3W A;  5FKY A;  3ONJ A;  4EYY R;  4YSY A;  2BDE A;  3PE0 A;  3FB2 A;  5LBQ B;  3MA9 A;  5LHH B;  2BKN A;  1HNX T;  5JTG A;  1WCR A;  4O4H E;  4QWN B;  2W2U A;  5AQM B;  5HXH A;  2V1D B;  1WYC A;  5AQG B;  3K3N A;  4NUV A;  3LDQ B;  1LVK A;  1V9D A;  2BKP A;  3AEC A;  3EAM A;  2E8I A;  4K0U A;  2XQ8 A;  1BR4 A;  4TWD A;  2XSB A;  4X1I E;  2KMF A;  4Z90 A;  3ZT5 A;  3UUM A;  3K8P C;  1FMW A;  4KHP T;  3OBV E;  2XQ5 A;  5LNK A;  3PJA A;  1S94 A;  1U5P A;  2ZM0 A;  3PUY F;  1QLB A;  3ANW B;  3RQU A;  4EZ4 A;  1E7P A;  3R84 B;  2D0U A;  2E9X C;  1YKH B;  2FJE A;  3AB3 B;  3PV0 F;  3ZMT B;  2E5L T;  4DR6 T;  2XAJ B;  4IDP A;  4X20 E;  4DR2 T;  2H3R A;  4X5T A;  1UUS A;  3CKD A;  5LB7 B;  2VK9 A;  2M6I A;  1UGO A;  2PJQ A;  2XQ9 A;  4IST A;  2CXD A;  3ZMU B;  3RKO A;  2CBI A;  5FMN A;  4OHF A;  2FJB A;  1T7S A;  2JJ9 A;  3CVR A;  3EAB A;  2VQF T;  2IIU A;  4LMJ A;  2BBH A;  3RH3 A;  5LHI B;  3PJA J;  4XAX B;  2KWH A;  4UF0 A;  2JMH A;  3ZYL A;  2BS3 A;  2ZM8 A;  1US7 B;  3N9M A;  3PUG A;  4QXB B;  1IBK T;  4KHZ F;  2E5V A;  2L9Q A;  3OYZ A;  4UEM A;  2BZB A;  4G63 A;  5HXC A;  3UU5 A;  2B1E A;  2YU2 A;  4QXC B;  5AQJ B;  3AA0 B;  5LYJ E;  4P0A A;  3N9N A;  2FJD A;  4CN6 A;  3VKG A;  1EZ3 A;  4DV2 T;  2WU5 A;  3CX8 B;  2XQA A;  1OED C;  3Q5E A;  4U74 A;  2V5C A;  2YEV C;  4ILC A;  3RLF F;  4UR9 A;  3AED A;  1Z8U A;  4XZC A;  4LML A;  2WDR A;  1W0A A;  4KBM B;  5CA1 E;  3RYC E;  1BR1 A;  3P4W A;  4HWD A;  4JI2 T;  5EK4 A;  5FXW A;  4WBN E;  2ZMA A;  2X68 A;  4JUY A;  4HGA A;  5AQQ B;  2ACX A;  3UT5 E;  2ZM6 T;  3KVA A;  1OED A;  1VCT A;  2QGS A;  3MJX A;  4H63 V;  1XNR T;  1OXZ A;  2JQH A;  3UUL A;  1FMV A;  2XQY A;  5LJN A;  3HKC E;  3HA4 A;  3ZJ1 A;  4OFZ A;  4AIS A;  4IE7 A;  5JQG E;  2XSA A;  3UUX B;  3ZT7 A;  3U78 A;  1IJ6 A;  4ZOL E;  3VRA A;  4JI3 T;  4WZX A;  4AKG A;  3OYX A;  2HN2 A;  3N2O A;  3N9Q A;  3PDY A;  3QB5 A;  4EXT A;  3DJB A;  3AEA A;  4MLK A;  4DID B;  3GA8 A;  4YSX A;  2V7M A;  3F2E A;  4MHC A;  5F5W A;  2LSJ A;  2VVS A;  1XMQ T;  4H63 H;  2Z6E A;  3QUJ A;  3ZKR A;  2MYS A;  3HKE E;  2DCF A;  5FY0 A;  2IML A;  3KFW X;  4U33 A;  5AQL B;  3U3I A;  2M6B A;  2UU9 T;  2IUB A;  3P50 A;  4ZXL A;  2WQY A;  2E9X D;  3EI0 A;  4GYR A;  5AQU B;  1MMG A;  2YKS A;  3N9L A;  4G2A A;  2A3D A;  3PUX F;  4IIJ E;  4QX7 B;  2W67 A;  4N78 D;  5HAX A;  3LJC A;  3AEF A;  3H37 A;  2UUA T;  3ZMZ B;  5JRC A;  4ZHQ E;  4LMK A;  4ZS2 A;  1J1J A;  5L47 A;  1HF8 A;  2MPK A;  4ZI2 D;  5L3G B;  2WM9 A;  4OYK A;  1XMO T;  3B57 A;  3L8R A;  4NPP A;  4AXP A;  1Y01 A;  3AVR A;  1W0B A;  5TAO A;  4GKJ T;  3K3Q C;  1NEK A;  2MAW A;  4AKR B;  4ASK A;  4JI0 T;  2LOP A;  4JI5 T;  4EIW A;  5JH7 E;  2FBW A;  4U2Y A;  2XTL A;  5AQN B;  2I59 A;  4BJM A;  1E1H B;  3P4R A;  2WY2 A;  3FZF B;  4DV6 T;  3N5L A;  2JQQ A;  2WAU A;  2KND A;  4HWI B;  4L0R A;  2WZI A;  4ILB A;  2FJA A;  4HE8 A;  3SFE A;  1GQE A;  3M65 A;  5KDM C;  2YIN A;  1BR2 A;  1D0Y A;  2CXL A;  2V7K A;  2JRK A;  2XJ7 A;  2IW5 B;  4AKL A;  4H9O C;  4Z91 A;  5L2L A;  2WSS V;  1I94 T;  3JAD A;  3RKG A;  3RRW A;  2C5I T;  1HR0 T;  4EEB A;  5L4E A;  3P8C D;  3AE3 A;  1IBM T;  1R8I A;  4LF6 T;  3ZSS A;  3Q5X A;  1O3X A;  4IL9 A;  1XDP A;  2BG9 A;  3AE4 A;  5C2T A;  5KXJ A;  2DL1 A;  3JC6 C;  2VKD A;  2XAQ B;  4GKK T;  5AQI B;  2LLY A;  2CEA A;  5AQK B;  3ZYM A;  3ZYK A;  2WZH A;  3RI5 A;  3VRB A;  5ABH A;  4JV5 T;  2X9Y A;  4X1Y E;  4DR4 T;  1T72 A;  4P1N A;  1LRZ A;  3UTK A;  3RIA A;  3TLU A;  4K0K T;  1DU2 A;  4HWC A;  1JNR A;  1XZY A;  2CHN A;  3EDU A;  4AQF A;  2JQ9 A;  1YXR A;  3EVY A;  2WCA A;  4X62 T;  2HPJ A;  1W9R A;  2E9X B;  2H88 A;  2JMK A;  4ILU A;  3AEG A;  4TWF A;  3RX6 A;  2VQE T;  4BJN A;  3ZC0 A;  3N9P A;  4YTP A;  2IDO B;  4YFS A;  2V7J A;  3AA6 B;  3HI2 A;  4JEH B;  3AE1 A;  3RPU A;  3AA1 B;  3RYF E;  4B6X A;  4F8H A;  1J5W A;  4YJ2 E;  2F4V T;  1OWA A;  1XWM A;  3FHN A;  3TLT A;  3RIU C;  4O4I E;  5HEJ A;  1B7T A;  2D0T A;  4TZ4 C;  1ZOY A;  3KV9 A;  2BKO A;  3F57 A;  3NZQ A;  2UXC T;  5LXT E;  5DAB A;  3AE8 A;  5BR8 T;  2W00 A;  4ERR A;  2C0S A;  2YK0 A;  4HFC A;  4U7I A;  3VR9 A;  4DMV A;  2X0L B;  5JDH A;  3QOF A;  2GK9 A;  1FJG T;  5EK2 A;  3H3A A;  5J2T E;  3AA7 B;  2YDR A;  4U31 A;  2ZLY A;  1SE7 A;  2WMN A;  3AE9 A;  3LG7 A;  1LVF A;  4I0U A;  5FP3 A;  5HXR A;  2WWV A;  3ZN0 B;  4YXD A;  2XQ3 A;  3CX7 B;  3LK2 B;  3AAA B;  3GMI A;  3RRC A;  4B3T T;  5JDL A;  2CBJ A;  2LKH A;  3NZP A;  4M1P A;  2A72 A;  1XDO A;  4CXX A;  4KX6 A;  3CX6 B;  2VB6 A;  3ZST A;  5L3F B;  5LA6 E;  4O2A E;  5LMU T;  4LFC T;  2CA5 A;  4ADZ A;  4EOZ B;  1ZKE A;  3MKD A;  2PTF A;  3PUR A;  1J5E T;  2YDQ A;  2CCQ A;  3EDV A;  1OED E;  3CQX C;  3Q9D A;  2YOE A;  3C51 A;  4PFP A;  3FBL A;  4DV1 T;  3VKH A;  5JR9 B;  4HN9 A;  2BVM A;  3CWZ B;  3NRX A;  2XAF B;  4PJM A;  3CML A;  2PFV A;  2BG9 E;  3JAF A;  2W62 A;  2XUE A;  3KV5 A;  3OVU A;  3G06 A;  1HFA A;  4IE5 A;  4UVC B;  3ZT6 A;  1YD8 G;  4EB6 E;  4E7Z A;  2NOX A;  3MK7 C;  5EZY E;  4KUM B;  2BG9 C;  1UX5 A;  5DQW A;  3NWI A;  3UQ7 A;  2X51 A;  1MMN A;  3JC6 D;  3S4U A;  3E0Z A;  3O1J A;  3ZMV B;  3AAI A;  2VUR A;  3A8Y C;  3AEE A;  3E22 E;  1OED B;  1QUU A;  2WP9 A;  2V5D A;  3C50 A;  4IDZ A;  4U3C A;  5KX5 E;  1N33 T;  4WW0 A;  2L8K A;  3A7M A;  3PU3 A;  4UV9 B;  3RGL A;  2ES0 A;  2ACZ A;  2NP9 A;  4X1K E;  5AQR B;  2XY8 B;  2E9X A;  2VKH A;  5M4Y A;  4F6R C;  2HPL A;  2J4G A;  2DHR A;  4HFV A;  3Q5D A;  4QX8 B;  2J62 A;  2PG8 A;  3TKL B;  3KVB A;  1ZEE A;  2CHO A;  4Q25 A;  5CA0 E;  4X65 T;  5JRC B;  2QVA A;  4IRE A;  5FVL A;  1XNQ T;  1VCS A;  2EHO D;  4DR5 T;  2V8S V;  3JAE A;  4A56 A;  4JI7 T;  4CQI A;  1ZHC A;  2NW8 A;  1ZP0 A;  1ZV4 X;  3B13 A;  3MXZ A;  3O4X E;  4QKN A;  1WLX A;  1H7C A;  1JNZ A;  5IUX A;  4UXN B;  3FZL B;  1SUM B;  5HXE A;  2ODU A;  2LM2 A;  4I50 E;  1M7K A;  2XQ6 A;  1SA0 E;  4HFI A;  1HG2 A;  4IGU A;  2DLR A;  3HL6 A;  2WWU A;  3SWH A;  2X9W A;  1D0Z A;  3UU8 A;  3ZJ2 A;  4DV5 T;  3BQK A;  5FXX A;  5JDM A;  4AIU A;  4FI5 A;  3J9X 1;  3PUA A;  2D2S A;  3FBZ A;  4TNV A;  3UQ4 A;  4HFB A;  2XHE B;  1HX1 B;  3QC9 A;  3UU4 A;  1G73 A;  4YHJ A;  4P0B A;  2DWG A;  2OV9 A;  2KLQ A;  5AQP B;  5AQS B;  4DR7 T;  3DP7 A;  4DBR A;  3T1H T;  3NBX X;  4HKA A;  2KT9 A;  2VL8 A;  2X0H A;  3RYH E;  3HKB E;  3AAE B;  2CWO A;  3AE6 A;  4PNI A;  4ZI2 C;  3IF8 B;  1YQ3 A;  2NW7 A;  4TV9 E;  3UFE A;  4EED A;  4ZZB A;  2I0M A;  4P09 A;  4COF A;  3ZLI A;  4YHH T;  3NKZ A;  3PUQ A;  4JLE A;  5JDN A;  5AQF B;  3GWH A;  3KV6 A;  3LK4 2;  3RHW A;  2OLT A;  5FXZ A;  3TLW A;  3ZC1 A;  2NTX A;  3J7Y q;  2V6X A;  4LF7 T;  1HS7 A;  3C4W A;  5JR9 A;  3FZK B;  1YW0 A;  3WAJ A;  4DV0 T;  3QB5 K;  5LGT B;  2H7V C;  3N9O A;  5J1G A;  4NIQ A;  4HFD A;  2W4X A;  3OJA A;  3ZMS B;  2V7L A;  3CK6 A;  4LF5 T;  4H9S E;  3OPC A;  2Q9Q D;  5LHG B;  3BK9 A;  3CQG B;  2LKG A;  2VKO A;  2J1D G;  2BG9 B;  2K9A A;  1D1C A;  4MBQ A;  2YDS A;  4HWH A;  5JDF A;  3RC8 A;  1IZN B;  4DV4 T;  2DNX A;  3P7I A;  3PUZ F;  4DVD A;  3LBX A;  4EV6 A;  3AE5 A;  4O8S A;  4ANJ A;  3I1A A;  5J2U E;  1NAF A;  3ETU A;  2FUP A;  2CWY A;  4OX9 T;  2N2N A;  1WR0 A;  2UXN B;  4PAG A;  4IDN A;  3GN5 A;  3SRZ A;  1HNZ T;  5LJM A;  3C64 A;  5F8P A;  4H9P C;  5GON E;  2QA7 A;  3WI3 A;  5L3C B;  1M62 A;  4EZH A;  3E08 A;  3L3P A;  4A5X A;  1LKX A;  3C4X A;  4CI3 B;  2SPC A;  5AQO B;  1NWM X;  4UEL A;  4WNK A;  3UFG A;  2I6H A;  1MIY A;  3KDS E;  2LM9 A;  2XQ7 A;  4NXN T;  5L3D B;  2D5U A;  1KFY A;  4IE4 A;  1D1A A;  3K3O A;  2CPT A;  2PBI A;  5AQT B;  2K24 A;  5FYM A;  3VR8 A;  2X66 A;  1FEW A;  3A5X A;  3CPZ A;  2W63 A;  3UUB A;  1D1B A;  3EHZ A;  3T1Y T;  2A2F X;  4GIW A;  4ZS3 A;  5HEH A;  2X67 A;  2RP4 A;  4BA9 A;  2HN1 A;  1KK7 A;  2X9X A;  1QSD A;  2XQ4 A;  3PUS A;  3H3M A;  3V5U A;  4DMW A;  1N34 T;  1IBL T;  4AKH A;  3FZM B;  2Q9Q C;  2XAH B;  5J0Z A;  2EHO C;  4HWF A;  2UUC T;  2KZ7 B;  1D0X A;  1KNP A;  2WU2 A;  3X1D A;  4ZI3 D;  4IHJ E;  2N1G A;  5HCJ A;  3OTO T;  5LOV E;  3LK3 B;  4I4T E;  3HR0 A;  3ZCI A;  1KEY A;  2DI4 A;  2JIW A;  4KI0 F;  5IHY A;  2AXD S;  2RPA A;  4LFB T;  5ABG A;  5C3J A;  4CXY A;  5HWX A;  2M67 A;  2VKJ A;  4YTN A;  5L3B B;  2Q9Q A;  3SOL A;  2KIN B;  2LRK A;  3P4Q A;  4AQG A;  2LJL A;  3ABV A;  3BQI A;  3UU6 A;  4DND A;  3C98 B;  4JYA T;  4DO0 A;  3SS1 A;  4YSZ A;  1HG5 A;  4PW8 A;  1IAP A;  5CJ5 A;  4A98 A;  5CGM A;  4DV7 T;  5FNV E;  2XAG B;  4PK6 A;  2VVN A;  2LSY A;  3N2G E;  4IDQ A;  3WAK A;  3UU3 A;  4IDO A;  3Q2M A;  5L3E B;  2XPK A;  4U2Z A;  4YJ3 E;  4NXM T;  1IJ5 A;  5FY7 A;  3MZK B;  4AKI A;  3C4Z A;  3AVS A;  2NR4 A;  3F31 A;  4PK4 A;  5E0O A;  3T8O A;  2CMR A;  2OA5 A;  2EHO B;  1I6Z A;  4DUZ T;  2CXF A;  3DTO A;  4AQF C; 
#chains in the Genus database with same CATH homology
 2DWK A;  3PU8 A;  5JDQ A;  5ETW A;  4CI2 B;  1WR6 A;  4L5G A;  4CXW A;  4XBF B;  3KBT A;  3KV4 A;  4UVB B;  2KWI B;  3O1H A;  3VU7 H;  3ZN1 B;  2ZM2 A;  3FXE B;  4IE0 A;  4PJN A;  4PFO A;  4TX5 A;  4PJL A;  4E7S A;  2IC6 A;  1MIV A;  3L09 A;  2MOZ A;  4UVA B;  3I0O A;  2K48 A;  4UF0 B;  2NW9 A;  2RA1 A;  4KP3 C;  4I43 B;  3ZEF B;  4UV8 B;  4HTE A;  3N2K E;  4TUY E;  4NUU A;  1YKE B;  1BR0 A;  1X79 A;  5LG4 A;  4TV8 E;  2V7I A;  2W61 A;  4OK0 A;  1UCU A;  5FY1 A;  2WMO A;  3LFM A;  4O4J E;  4YLH A;  4DBQ A;  5HXS A;  3D0T A;  3ONX A;  3RC3 A;  5EK3 A;  2LSG A;  5HYA A;  3ETV A;  4H9R C;  5DJQ C;  2BVL A;  2XAS B;  5CB4 E;  2VAS A;  2VWA A;  1MMD A;  5LBM A;  4H9N C;  4C91 A;  3V5S A;  2LEH A;  2X9H A;  3HKD E;  4TN7 B;  2C5J A;  3FXD B;  5F3J A;  2CLY B;  2Y6X A;  4UIG A;  3KIN B;  1MIW A;  2EHO A;  3ZCJ A;  2IC9 A;  5LCY A;  4C90 A;  4EAH A;  1HCI A;  5H6Q B;  2W0G A;  3IHR A;  3QK6 A;  3VHL A;  1FIO A;  2JPF A;  1Y64 B;  2H7O A;  4QHO A;  5FXV A;  2LE8 A;  2ODV A;  4O4L E;  5HWY A;  1MND A;  5H6R B;  4JEU B;  1SHZ C;  3I9W A;  2L3L A;  2YU1 A;  2LSI A;  1VRB A;  3LBX B;  3R6N A;  2Y8D A;  4PK5 A;  2LT3 A;  4WBO A;  3MAC A;  4GK0 E;  5JVD E;  1MNE A;  2MTQ A;  5ADX L;  3BQL A;  3GN5 B;  3ANW A;  4QXH B;  1G8X A;  1S35 A;  4MFR A;  2WBL A;  2CM0 A;  4GOU A;  1WYB A;  4FJO A;  3PTR B;  4GK5 E;  3ZYL A;  2G0U A;  2N9D A;  5KMG P;  2Y48 B;  2IAK A;  5L3D B;  5JRC B;  1HX8 A;  4HEA A;  3W15 B;  5JDG A;  1AJ3 A;  3EUH A;  3NRY A;  3ESL A;  4BAY B;  4AI6 A;  3IEE A;  4KMC A;  1Z0P A;  4OYJ A;  5AFU L;  2LHR A;  4O2B E;  5LGU B;  2HH7 A;  4GYS A;  3CQC B;  4U72 A;  2LOS A;  1WRD A;  4H9Q C;  5JRE A;  3O1I A;  1UX4 A;  1U4Q A;  5JR9 C;  5IYZ E;  1HTJ F;  5BMV E;  1T98 A;  3I9Y A;  4IE6 A;  2LSK A;  3ZPO A;  1MMA A;  1KNZ A;  2CE7 A;  4PJJ A;  2V26 A;  1VOM A;  5LGN B;  2C5K T;  3OKQ A;  5A1L A;  4J2C A;  4ZI3 C;  2CLY C;  4ISS A;  4I55 E;  3ZC0 A;  4CZZ B;  2P9B A;  2UXX B;  5DQV A;  3O9X A;  3RYI E;  5C8Y E;  3IBP A;  4Z8X A;  5LP6 E;  2KXP B;  2NWB A;  1CUN A;  2K5B B;  2Q9Q B;  3I0Q A;  2MBG A;  3KBU A;  4CI1 B;  4L9I A;  4V1A v;  3Q5W A;  4MAL A;  2LHN A;  2NTY A;  4EYU A;  4EYY R;  5LHH B;  2BDE A;  3PE0 A;  3FB2 A;  5LBQ B;  3MA9 A;  4O4H E;  4QWN B;  5HXH A;  2V1D B;  1WYC A;  3K3N A;  4NUV A;  1LVK A;  1V9D A;  4K0U A;  2E8I A;  1BR4 A;  4X1I E;  2KMF A;  3UUM A;  3K8P C;  1FMW A;  3OBV E;  5LNK A;  1S94 A;  1U5P A;  2ZM0 A;  3ANW B;  4EZ4 A;  3R84 B;  2D0U A;  2E9X C;  1YKH B;  3AB3 B;  3ZMT B;  2XAJ B;  4X20 E;  2H3R A;  3CKD A;  2VK9 A;  2PJQ A;  4IST A;  2CXD A;  3ZMU B;  3RKO A;  5FMN A;  4OHF A;  2JJ9 A;  3CVR A;  3RH3 A;  5LHI B;  4XAX B;  2KWH A;  4UF0 A;  2JMH A;  2ZM8 A;  1US7 B;  3N9M A;  3PUG A;  4QXB B;  2L9Q A;  3OYZ A;  4UEM A;  2BZB A;  4G63 A;  5HXC A;  2B1E A;  2YU2 A;  4QXC B;  3AA0 B;  5LYJ E;  4P0A A;  3N9N A;  3VKG A;  1EZ3 A;  3CX8 B;  4U74 A;  2YEV C;  4XZC A;  4KBM B;  5CA1 E;  3RYC E;  1BR1 A;  5EK4 A;  5FXW A;  4WBN E;  2ZMA A;  2X68 A;  4JUY A;  4HGA A;  3UT5 E;  2ACX A;  3KVA A;  2QGS A;  3MJX A;  4H63 V;  1OXZ A;  3UUL A;  1FMV A;  2XQY A;  5LJN A;  3HKC E;  3HA4 A;  3ZJ1 A;  4OFZ A;  4IE7 A;  5JQG E;  3UUX B;  3U78 A;  1IJ6 A;  4ZOL E;  4AKG A;  3OYX A;  3N2O A;  3N9Q A;  3PDY A;  4EXT A;  3DJB A;  4MLK A;  3GA8 A;  2V7M A;  3F2E A;  4MHC A;  2LSJ A;  4H63 H;  2Z6E A;  3QUJ A;  2MYS A;  3HKE E;  2DCF A;  5FY0 A;  3KFW X;  3U3I A;  4GYR A;  2E9X D;  1MMG A;  3N9L A;  4G2A A;  2A3D A;  4IIJ E;  4QX7 B;  4N78 D;  5HAX A;  3LJC A;  5JRC A;  3H37 A;  3ZMZ B;  4ZHQ E;  4ZS2 A;  5L3G B;  1HF8 A;  4ZI2 D;  2WM9 A;  4OYK A;  3B57 A;  4AXP A;  3AVR A;  5TAO A;  3K3Q C;  4AKR B;  4ASK A;  2LOP A;  4EIW A;  5JH7 E;  2XTL A;  2I59 A;  4BJM A;  1E1H B;  3N5L A;  2JQQ A;  2WAU A;  2KND A;  4L0R A;  4HE8 A;  5KDM C;  3M65 A;  2YIN A;  1BR2 A;  1D0Y A;  2CXL A;  2V7K A;  2JRK A;  2IW5 B;  4AKL A;  5L2L A;  4H9O C;  2WSS V;  3RRW A;  2C5I T;  3P8C D;  3Q5X A;  1O3X A;  3JC6 C;  2VKD A;  2XAQ B;  2CEA A;  3ZYM A;  3ZYK A;  2X9Y A;  4X1Y E;  1LRZ A;  3UTK A;  3EDU A;  4AQF A;  3EVY A;  2HPJ A;  2E9X B;  3RX6 A;  2JMK A;  4BJN A;  3N9P A;  4YFS A;  2V7J A;  3AA6 B;  3HI2 A;  4JEH B;  3RPU A;  3RYF E;  3AA1 B;  4B6X A;  4YJ2 E;  1OWA A;  3FHN A;  4O4I E;  1B7T A;  2D0T A;  4TZ4 C;  3KV9 A;  3F57 A;  3NZQ A;  5LXT E;  5DAB A;  2W00 A;  4ERR A;  2C0S A;  2YK0 A;  4DMV A;  5JDH A;  2X0L B;  2GK9 A;  5EK2 A;  3H3A A;  5J2T E;  3AA7 B;  2ZLY A;  2WMN A;  3LG7 A;  5FP3 A;  5HXR A;  1LVF A;  3ZN0 B;  3CX7 B;  3LK2 B;  3AAA B;  3GMI A;  3RRC A;  5JDL A;  3NZP A;  4M1P A;  2A72 A;  4CXX A;  5L3F B;  3CX6 B;  2VB6 A;  5LA6 E;  4O2A E;  2CA5 A;  4ADZ A;  4EOZ B;  1ZKE A;  3MKD A;  3PUR A;  2CCQ A;  3EDV A;  3CQX C;  3Q9D A;  3C51 A;  4PFP A;  3FBL A;  3VKH A;  5JR9 B;  4HN9 A;  3CWZ B;  2BVM A;  3NRX A;  2XAF B;  4PJM A;  3CML A;  2PFV A;  3ZC1 A;  3KV5 A;  2W62 A;  2XUE A;  4IE5 A;  4UVC B;  3ZCI A;  1HFA A;  4EB6 E;  4E7Z A;  4ZI7 E;  1YD8 G;  2NOX A;  3MK7 C;  5EZY E;  4KUM B;  1UX5 A;  5DQW A;  2X51 A;  1MMN A;  3JC6 D;  3S4U A;  3E0Z A;  3O1J A;  3ZMV B;  3AAI A;  3E22 E;  1QUU A;  3C50 A;  4IDZ A;  5KX5 E;  4WW0 A;  2L8K A;  3PU3 A;  4UV9 B;  2ES0 A;  5M4Y A;  2NP9 A;  4X1K E;  2E9X A;  2VKH A;  4F6R C;  2HPL A;  2DHR A;  4HFV A;  4QX8 B;  2PG8 A;  3TKL B;  3KVB A;  1ZEE A;  5CA0 E;  2EHO D;  4A56 A;  4CQI A;  1ZHC A;  2NW8 A;  1ZV4 X;  3B13 A;  3MXZ A;  3O4X E;  4QKN A;  1WLX A;  1H7C A;  4UXN B;  5HXE A;  2ODU A;  4I50 E;  4ILU A;  1SA0 E;  3SWH A;  1HG2 A;  4IGU A;  2DLR A;  3HL6 A;  2WWU A;  2X9W A;  1D0Z A;  3ZJ2 A;  3BQK A;  5FXX A;  4FI5 A;  3J9X 1;  3PUA A;  2D2S A;  3FBZ A;  2XHE B;  3QC9 A;  1G73 A;  4YHJ A;  4P0B A;  2DWG A;  2KLQ A;  3DP7 A;  4DBR A;  3NBX X;  4HKA A;  2KT9 A;  2VL8 A;  3RYH E;  5JDM A;  3HKB E;  3AAE B;  2CWO A;  4PNI A;  4ZI2 C;  3IF8 B;  3UFE A;  2NW7 A;  4TV9 E;  4P09 A;  3ZLI A;  3PUQ A;  4JLE A;  5JDN A;  3GWH A;  3KV6 A;  3LK4 2;  5FXZ A;  3J7Y q;  2NTX A;  1HS7 A;  3C4W A;  5JR9 A;  3WAJ A;  1YW0 A;  5LGT B;  2H7V C;  3N9O A;  5J1G A;  3OJA A;  3ZMS B;  2V7L A;  4H9S E;  2Q9Q D;  5LHG B;  3BK9 A;  3CQG B;  2VKO A;  3UUN A;  2J1D G;  2K9A A;  4MBQ A;  1D1C A;  5JDF A;  3RC8 A;  1IZN B;  2DNX A;  3P7I A;  4DVD A;  3LBX A;  4O8S A;  4ANJ A;  3I1A A;  5J2U E;  1NAF A;  3ETU A;  2CWY A;  2N2N A;  2UXN B;  4PAG A;  3SRZ A;  3GN5 A;  5LJM A;  3C64 A;  5F8P A;  4H9P C;  5GON E;  2QA7 A;  3WI3 A;  5L3C B;  4EZH A;  3E08 A;  3L3P A;  1LKX A;  3C4X A;  4CI3 B;  2SPC A;  1NWM X;  4UEL A;  4WNK A;  1MIY A;  3KDS E;  2LM9 A;  2D5U A;  4IE4 A;  1D1A A;  3K3O A;  2PBI A;  5FYM A;  2K24 A;  2X66 A;  1FEW A;  3A5X A;  3CPZ A;  2W63 A;  1D1B A;  2A2F X;  4GIW A;  4ZS3 A;  4BA9 A;  2X67 A;  2RP4 A;  1KK7 A;  2X9X A;  1QSD A;  3PUS A;  3V5U A;  4DMW A;  4AKH A;  2Q9Q C;  2XAH B;  2EHO C;  2KZ7 B;  1D0X A;  4ZI3 D;  4IHJ E;  2N1G A;  5LOV E;  3LK3 B;  4I4T E;  3HR0 A;  2DI4 A;  5IHY A;  4CXY A;  5HWX A;  2M67 A;  2VKJ A;  5L3B B;  2Q9Q A;  3SOL A;  2KIN B;  4AQG A;  2LJL A;  3BQI A;  4DND A;  3C98 B;  4DO0 A;  3SS1 A;  1HG5 A;  4PW8 A;  1IAP A;  5FNV E;  2XAG B;  4PK6 A;  2LSY A;  3N2G E;  3WAK A;  5L3E B;  3Q2M A;  4YJ3 E;  1IJ5 A;  5FY7 A;  3MZK B;  4AKI A;  3C4Z A;  3AVS A;  3F31 A;  4PK4 A;  5E0O A;  3T8O A;  2CMR A;  2OA5 A;  2EHO B;  2CXF A;  3DTO A;  4AQF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...