2XY8B

Paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
QTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein-Protein Haddocking Using Exclusively Pseudocontact Shifts.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords DNA POLYMERASE III SUBUNIT EPSILON
total genus 19
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2xy8B00
2AE9A 1DU2A 2IDOB 2XY8B 2AXDS 1SE7A
chains in the Genus database with same CATH superfamily
3QB5K 3UFGA 3SRZA 2LM2A 4Q25A 4DV6T 4NPPA 4WBOA 1MMAA 2QA7A 3PUWF 4Z90A 4KHZF 3VKGA 3ONLC 5AQMB 2KT9A 3FXDB 5ABFA 2VB6A 3KINB 4H9NC 2FUPA 2XAHB 2CRBA 4PW8A 4EAHA 4EV6A 4WNKA 3EHZA 2H3RA 4HFVA 3PJAA 2J1DG 1UX4A 1OEDC 1XWMA 1J5ET 3HKEE 2E9XA 2V7IA 2X66A 5M4YA 2X68A 3P4QA 1N36T 1D1BA 2LSGA 3BQIA 3OBVE 1MNDA 3EDUA 3ZT7A 3D0TA 4DBQA 1SE7A 2RA1A 1QSDA 3CX8B 2I6HA 4HTEA 1D1AA 1NAFA 4I0UA 2X0YA 3I9YA 4IDPA 5HXHA 2DWGA 2BVLA 1HTJF 3I0QA 2V5DA 3AE9A 2Y6XA 2E9XB 1XDOA 3DJBA 4PFOA 2PTFA 5AQJB 5AQPB 2V6YA 3A7MA 3AEBA 4H9QC 2WWVA 2CBIA 3WAKA 4LF6T 5L3CB 3OTOT 4ILCA 4P1NA 5FMNA 5HCJA 2E5LT 1UUSA 3IBPA 4PK4A 3R84B 3KVBA 1FMVA 2AXDS 3O1IA 2SPCA 5FNVE 3MA9A 4JI8T 1HNWT 2X9XA 1D0YA 3FZLB 3ANWB 3CK6A 4IE4A 1O3XA 2V6XA 3N9MA 3UU8A 4QX8B 5HEGA 3B57A 4LF7T 4LF4T 4GKJT 4EYUA 2J47A 3F31A 4CI3B 2H7VC 2JQKA 3OKQA 1IBLT 3L39A 4KHPT 4BJMA 3ONXA 2M6IA 5JDLA 3LBXA 3UQ7A 4B3ST 4HN9A 4IREA 3GA8A 4LFBT 4EXTA 3J9X1 2WZIA 3P4WA 4AXPA 4TNVA 3RYIE 3LSVA 2E9XC 3AECA 2HN1A 3AA1B 5FXVA 3W15B 5HXSA 3EAMA 3SFEA 2UXNB 4HFDA 3KV4A 3UU4A 5AQHB 3RYCE 1D1CA 4JEHB 2LRKA 2H89A 3HKCE 1U4QA 2UUAT 4P0AA 1HFAA 3K1SA 4GYRA 1S94A 2LKGA 4LFAT 2V7MA 3NWIA 3AE4A 3UU5A 3ZLIA 3Q5EA 5JRCB 4H63H 1WRDA 1E1HB 3AXJB 4KMCA 3ZSTA 4AKLA 5IHYA 1ZKEA 3RHWA 3O9XA 4AKRB 2JQ9A 4FJOA 5HEUA 5CJ5A 2CHOA 2BBJA 5HXRA 5AQSB 1M62A 2P9BA 4LFCT 4N78D 2XM2A 4P0BA 4YHJA 4DV1T 2EHOA 1G73A 3PUYF 3Q5XA 4TV8E 5LA6E 4OX9T 1WYBA 3RGLA 3OYZA 3ZC1A 4HWHA 5C3JA 1BR1A 3CX7B 4OYJA 4WBNE 5TAOA 1ZV4X 4IL9A 3C4XA 3EUHA 4HFBA 1QUUA 2ACZA 3ZMZB 4K0KT 3JAEA 2XASB 3TLVA 3PDYA 2CXDA 5HWYA 4JI1T 4AQFC 2N2NA 2HPJA 5DQVA 2Y48B 4YJ3E 4TWDA 1KEYA 4CXWA 4WW0A 3C4WA 3CQCB 4UIGA 4JI4T 4CN4A 4ZOLE 4XBFB 2CPTA 3E0ZA 3ONJA 1YKHB 3KV5A 2DWKA 2BS3A 2W62A 2XZEA 3Q5DA 4L9IA 3SWHA 2W00A 3M65A 4PK5A 4ZS3A 4UVAB 4ZI3D 4TNWA 3RYFE 2VL0A 2E9XD 2KWIB 3K8PC 3TKLB 5HEOA 2DLRA 2M6BA 4JI7T 4CN6A 3RH3A 2YKSA 2UUCT 3AEAA 3FZFB 3VHLA 1IAPA 3PU8A 4H63V 2LSYA 3E22E 4I50E 4COFA 4DR6T 4X66T 3G06A 2X67A 4L0RA 3N9NA 4Z91A 2VKHA 3RF1A 4JI3T 2H88A 2JMHA 4GIWA 4O8SA 4ASKA 1KNPA 2XQ8A 3RIUA 4EEDA 2DCFA 4PK6A 2D0TA 3M3ZB 4OFZA 2QVAA 2WAUA 2JQHA 3Q5WA 3L3PA 5LCYA 5CB4E 1HF8A 1KNRA 1XNQT 2XUEA 1OWAA 4DV2T 2WCAA 3RI5A 3UUNA 3ZN0B 2YDRA 2PJQA 3X1DA 4DR5T 3IHRA 5LJMA 2BG9A 2K3WA 2W2UA 4H9OC 1KK7A 3EI0A 2LKHA 4U7IA 4WYVA 4EGWA 3HI2A 4IE7A 3TLSA 4DR2T 5EZYE 2VL8A 1KNZA 4CI1B 5L3DB 4B3MT 2HH7A 4UELA 3LK2B 5LB7B 3RQWA 3N2GE 2UXBT 1JNZA 1HS7A 2FJBA 3GN5A 3ZKRA 2CM0A 2WU2A 5JR9B 5L3GB 5AFUL 3T1HT 2M67A 2JMKA 3OPCA 4LMLA 1VCSA 2VKJA 5AQNB 5L2LA 3CIRA 4X65T 4HGAA 3JAFA 2ODVA 4TWHA 3IF8B 3ZCJA 4YT0A 2VWAA 2F4VT 3Q9DA 1FJGT 2V6YB 1BR0A 3I1AA 5ABFB 5LJNA 3N2OA 1L0VA 4JV5T 3N2KE 4CXXA 3ZC0A 2KMFA 1R8IA 2YDSA 3F57A 4LF8T 4ZI2D 5LHGB 3L09A 5CA1E 4YY3T 2VQET 4GK0E 2LLYA 5AQIB 2LRLA 4P09A 2Y8DA 1WR0A 4LF5T 4QXHB 1MMDA 2WDRA 4DNDA 1D0XA 2YK0A 4PJLA 3RIFA 2V26A 1W0BA 4AIUA 1KF6A 2EHOD 2X0HA 5AQKB 4F6RC 4YSZA 4AQYT 5FXXA 2XQ5A 3PUGA 4IIJE 4MLKA 3B13A 2I59A 2KINB 3VR9A 2WSSV 4PJNA 2WDQA 5JQGE 2E5VA 3AXJA 4ISSA 4A98A 3FZHB 4HE8A 5AQGB 2CEAA 4U31A 3OVUA 3C64A 3ESLA 2LT3A 3AE2A 3S4UA 1YW0A 2D5UA 4YTNA 2BS2A 1IJ5A 1ZEEA 3AA0B 4UEMA 2OLTA 2NW9A 3ZT5A 4C90A 3MXZA 1BR2A 1D0ZA 3PU3A 2YU1A 3EVYA 1X9BA 1W0AA 1UURA 3AEEA 3LBXB 3KFWX 2R6GF 1XZYA 3RC3A 3RIAA 3SS1A 4C91A 4EYYR 4LF9T 2HPLA 2UXCT 2IC6A 1HNXT 1YXRA 4IE0A 2D9DA 3P4PA 4K0UA 2NTXA 1HNZT 2I0MA 2XQ3A 3AAAB 5JDFA 3ZSSA 2PBIA 4EIWA 2WBLA 2W66A 1GQEA 5LXTE 2BVMA 2IUBA 2C5JA 4TV9E 4OYKA 3RX6A 5FL0A 1QLBA 2X0LB 1SA0E 3AE1A 3HR0A 2CWOA 2IMLA 2K24A 2L9QA 3K3QC 4M1PA 1Z0PA 4DR1T 5LOVE 3T1YT 3C4ZA 1IBMT 4ZS2A 3N9OA 1H7CA 3ZMSB 2CXLA 3R6NA 1NENA 3FZMB 4HWCA 3U3IA 5DQWA 1J5WA 3JCFA 3UTKA 5LMUT 2ZM0A 3AE7A 5FVLA 3SOLA 4NXNT 1BR4A 4HKAA 2JQQA 2MBGA 2QYWA 4TX5A 4IDZA 2D0UA 4L5GA 5LG4A 2LSJA 2BG9E 4HWDA 1N32T 1XDPA 2UXDT 3F2EA 2XQAA 5JDHA 2YDQA 2ZM8A 4ZZCA 2BDEA 5J1GA 5LBMA 1W9RA 4PAGA 4UVBB 5AQFB 3P50A 4U3CA 3ZMVB 2UU9T 3QK6A 4X1IE 5FY1A 4J2CA 3ZMTB 1UCUA 4BA9A 5EK3A 1FIOA 2MOZA 3ZT6A 2L3LA 2XSBA 1JNRA 4UVCB 4X62T 3O4XE 3QNUA 2C0SA 2IAKA 2LHRA 4KP3C 3AAIA 5H6RB 3ZMUB 4QWNB 4AQFA 5JDGA 5L3FB 3HL6A 2FBWA 2XJ7A 3QUJA 4H9PC 4NXMT 2V7KA 1NWMX 2V7LA 2K5BB 4CXYA 2DHRA 3PUSA 3AEFA 4NUUA 2ACXA 3K3OA 3ETVA 4DR4T 3FZKB 2JRKA 5J0ZA 3HKDE 5L4HA 3UUMA 2VASA 2VKOA 4NIQA 5AQVB 4ERRA 3DTOA 1E2AA 3BK9A 3LJCA 5FKYA 3A8YC 3NZQA 1YD8G 3VR8A 4UV8B 4ISTA 3UULA 3V5SA 3VKHA 1X79A 4AKIA 4EZ4A 2XAFB 3LG7A 2MPKA 5ETWA 2BZBA 2KZ7B 2KWHA 4DV4T 1CUNA 4O2BE 2BKPA 4A56A 2W4XA 3AVRA 4KBMB 4DO0A 4X64T 4JI5T 3GWHA 5LP6E 5AQLB 1HR0T 2BBHA 5LNKA 5LGNB 4O4IE 4B6XA 4UF0B 4DV3T 5CGMA 1MIYA 4O2AE 3RIUC 2FJAA 3RPUA 2VQFT 3ZPOA 2LHNA 4CI2B 2Q9QC 2FJDA 4UV9B 1IBKT 2XQ9A 3RYHE 3CWZB 3H3AA 4QXBB 5FXWA 5GONE 2CLYC 5HCMA 2A2FX 1EZ3A 4V1Av 4UR9A 4XZCA 4DR7T 2NW7A 3H37A 4CZZB 4HWFA 3KV9A 1Z8UA 3AE8A 5IWAT 1SUMB 5EK4A 1MMGA 3OYXA 3UU3A 3CQXC 5L4EA 4DUZT 1XMOT 1YQ3A 5LMNT 1WR6A 3T8OA 3NRXA 3V5UA 1HX1B 2LEHA 4X1KE 3SFDA 2W0GA 2NR4A 4JBWF 2LSKA 3HA4A 1J1JA 2YU2A 3J7Yq 4GYSA 4QHOA 4QX7B 5C2TA 3UUXB 3FB2A 3NKZA 2LSIA 2KLQA 2ZM2A 2BG9B 1WCRA 2RP4A 5F8PA 4F8HA 5LHIB 2B1EA 5JRCA 1ZP0A 3ETUA 2YN6A 2YINA 1NEKA 3BQLA 5FXZA 4HFEA 2A9UA 4H9RC 2DNXA 3JC6D 4X20E 4XAXB 5LGTB 2CLYB 2WP9A 2CCQA 4FI5A 4UXNB 3H3MA 3VRBA 3MKDA 1T8BA 4ZI7E 1T72A 2LE8A 2JPFA 2NWBA 4O4JE 2N1GA 2CMRA 4JEUB 5L3EB 5FY7A 4DVDA 2K48A 4CQIA 2K9AA 2X9WA 3KDSE 4AI6A 3E08A 4BAYB 2DI4A 1G8XA 2VK9A 2NP9A 2XAGB 1WFDA 2YEVC 3ANWA 1VRBA 2W61A 3C51A 3CMLA 5KDMC 1I6ZA 2BKOA 4ILAA 5FYMA 3PUAA 4YLHA 2Z6EA 3AA7B 2RPAA 3AE5A 3FBLA 4OK0A 5BMVE 5CFBA 5H6QB 2WWUA 4I55E 3RKOA 4QH1A 2LM9A 4ADZA 5FY0A 3MJXA 2EHOC 1OXZA 4U72A 1XMQT 3WAJA 5L47A 1VCTA 1V9DA 3CX6B 3K3NA 1HCIA 2VVSA 3VRAA 1I94T 2X51A 5CA0E 4IDOA 3AEDA 5C8YE 2JJ9A 4KI0F 4JI2T 3AAEB 3PV0F 3ZYMA 5JDMA 1Y64B 3AVSA 4IDQA 4HWIB 2UXXB 3HKBE 3NVOA 2XSAA 2C5KT 2WB5A 2V1DB 4G63A 5AQOB 5AQQB 1XNRT 1N34T 4AQGA 4O4HE 5LBQB 4EZHA 2NTYA 4LMJA 2BKNA 5J2TE 1OEDB 3PUXF 3L8RA 2WS3A 3JC6C 2N9DA 3B5MA 4ILUA 5HEJA 3AEGA 3VU7H 2EHOB 1UX5A 3OJAA 4A5XA 3AE6A 5KMGP 2B76A 5A1LA 5LYJE 4X1YE 5EK2A 4QXCB 4U7YA 4WZXA 2C5IT 3UU6A 2GK9A 3BQKA 1MIVA 2V7JA 2CBJA 4CN1A 3P4RA 4DMWA 5HAXA 1YQ4A 3RC8A 2L8KA 5AQRB 2W63A 1KFYA 2V5CA 4LMKA 3NRYA 2XHEB 3EDVA 3PUZF 4MBQA 1IJ6A 1VOMA 4ZEYA 5HXEA 5KXJA 3CQGB 1HG2A 5LHHB 2KNDA 3CKDA 4DV7T 1B7TA 5JTGA 2HN2A 3PURA 3IA3A 3P8CD 2XQ4A 5L3BB 2PG8A 4QKNA 1T98A 3N9PA 3ZEFB 3ABVA 4EEBA 3U78A 2Q9QD 5FP3A 4U2YA 4QH4A 3P7IA 4DV0T 4E7SA 1UK5A 2CHNA 3UT5E 2CXFA 2IDOB 1MNEA 2A3DA 4JI0T 2QRXA 2BG9C 3AE3A 3C50A 2X9HA 3PJAJ 3QOFA 5ABEA 2WDVA 4HEAA 2WU5A 3QC9A 2OV9A 4IDNA 2CWYA 3C98B 4PNIA 3LK42 2QGSA 5LG3A 2IW5B 3WI3A 4UF0A 4ZI3C 5ABGA 4DUYT 1LRZA 4PJJA 3AA6B 4ZXLA 3ZYKA 2IHR1 4E7ZA 3O1HA 1US7B 4AKHA 4JYAT 3AB3B 2AE9A 2XAJB 4IE6A 1W09A 3MZKB 5JR9A 2LJLA 4IHJE 1IZNB 3MACA 3ZJ1A 5JVDE 2CA5A 2KSRA 1M7KA 2XQYA 2NOXA 3CVRA 3PTRB 5IYZE 3RRWA 2ZM6T 4GKKT 4EB6E 1U5PA 3GMIA 4G2AA 3ZN1B 1UGOA 1S35A 4YSYA 5HEHA 5DABA 4U2ZA 1LVKA 5AQUB 3N5LA 3JADA 2IC9A 4O4LE 2XTLA 3RLFF 3ZJ2A 5F5WA 4B3TT 3TLWA 5JDNA 3NBXX 4U74A 5JR9C 2XPKA 4ANJA 2W67A 2UUBT 4X5TA 1CHUA 5IUXA 4DR3T 1WYCA 3LK3B 5BR8T 4BJNA 4ZZBA 3NZPA 3P4SA 3I9WA 5DJQC 2YOEA 4YFSA 5HWXA 2XQ6A 3QB5A 2V8SV 4AISA 5F3JA 2J62A 2OA5A 4ILBA 3KVAA 2HHHT 1AJ3A 1FEWA 2Q9QB 1OEDA 2MAWA 2ES0A 3MK7C 1ZHCA 4JUYA 1SHZC 4DBRA 4U33A 5E0OA 4QH5A 3EABA 1HG5A 2XM1A 5ABHA 2LOPA 3KV6A 3PUQA 3RQUA 1WLXA 4YJ2E 4IGUA 4TZ4C 2XY8B 3N9QA 3Q2MA 4ZHQE 5JREA 4B3RT 2BS4A 4YXDA 1FMWA 1LKXA 5HYAA 2MTQA 4I4TE 2E2AA 4ZI2C 5JH7E 4MALA 4DIDB 4IE5A 4Z8XA 4TWFA 2FJEA 2WQYA 4YTMA 2D2SA 3N9LA 4TUYE 4YSXA 2E8IA 2J4GA 3TLUA 3UQ4A 3ZCIA 3GN5B 4GK5E 2JIWA 5HXCA 4NUVA 2DL1A 4HFCA 2G0UA 2ZLYA 5AQTB 2WMNA 2ZMAA 5FL1A 3UFEA 4H9SE 1YKEB 3UUBA 1MMNA 3FHNA 2PFVA 3PE0A 4YTPA 5LGUB 1Y01A 4OHFA 3TLTA 2MYSA 2WMOA 2XQ7A 2Q9QA 4MFRA 3CPZA 2XAQB 4TN7B 4DMVA 5JDQA 4DV5T 4KX6A 3I0OA 2ODUA 2H7OA 2NW8A 4EOZB 2A72A 4I43B 4AKGA 5ADXL 1ZOYA 2VKDA 4IL4A 4HFHA 1HX8A 2VVNA 3DP7A 3RKGA 3FBZA 4YHHT 2WZHA 1MIWA 4JI6T 1T7SA 3IEEA 3O1JA 1N33T 2LOSA 3RRCA 1OEDE 3A5XA 4JLEA 3LFMA 4IT4A 3ZYLA 3PUVF 2VURA 1DU2A 2WM9A 2KXPB 5FVKA 2WY2A 2X9YA 4KUMB 4PFPA 4GOUA 4A97A 4MHCA 5KX5E 3FXEB 2IIUA 5J2UE 3LDQB 3KBTA 2CE7A 3KBUA 4PJMA 4HFIA 1E7PA 1LVFA
chains in the Genus database with same CATH topology
2AE9A 1DU2A 2IDOB 2XY8B 2AXDS 1SE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AE9 A;  1DU2 A;  2IDO B;  2XY8 B;  2AXD S;  1SE7 A; 
#chains in the Genus database with same CATH topology
 3QB5 K;  3UFG A;  3SRZ A;  2LM2 A;  4Q25 A;  4DV6 T;  4NPP A;  4WBO A;  1MMA A;  2QA7 A;  3PUW F;  4Z90 A;  4KHZ F;  3VKG A;  3ONL C;  5AQM B;  2KT9 A;  3FXD B;  5ABF A;  2VB6 A;  3KIN B;  4H9N C;  2FUP A;  2XAH B;  2CRB A;  4PW8 A;  4EAH A;  4EV6 A;  4WNK A;  3EHZ A;  2H3R A;  4HFV A;  3PJA A;  2J1D G;  1UX4 A;  1OED C;  1XWM A;  1J5E T;  3HKE E;  2E9X A;  2V7I A;  2X66 A;  5M4Y A;  2X68 A;  3P4Q A;  1N36 T;  1D1B A;  2LSG A;  3BQI A;  3OBV E;  1MND A;  3EDU A;  3ZT7 A;  3D0T A;  4DBQ A;  1SE7 A;  2RA1 A;  1QSD A;  3CX8 B;  2I6H A;  4HTE A;  1D1A A;  1NAF A;  4I0U A;  2X0Y A;  3I9Y A;  4IDP A;  5HXH A;  2DWG A;  2BVL A;  1HTJ F;  3I0Q A;  2V5D A;  3AE9 A;  2Y6X A;  2E9X B;  1XDO A;  3DJB A;  4PFO A;  2PTF A;  5AQJ B;  5AQP B;  2V6Y A;  3A7M A;  3AEB A;  4H9Q C;  2WWV A;  2CBI A;  3WAK A;  4LF6 T;  5L3C B;  3OTO T;  4ILC A;  4P1N A;  5FMN A;  5HCJ A;  2E5L T;  1UUS A;  3IBP A;  4PK4 A;  3R84 B;  3KVB A;  1FMV A;  2AXD S;  3O1I A;  2SPC A;  5FNV E;  3MA9 A;  4JI8 T;  1HNW T;  2X9X A;  1D0Y A;  3FZL B;  3ANW B;  3CK6 A;  4IE4 A;  1O3X A;  2V6X A;  3N9M A;  3UU8 A;  4QX8 B;  5HEG A;  3B57 A;  4LF7 T;  4LF4 T;  4GKJ T;  4EYU A;  2J47 A;  3F31 A;  4CI3 B;  2H7V C;  2JQK A;  3OKQ A;  1IBL T;  3L39 A;  4KHP T;  4BJM A;  3ONX A;  2M6I A;  5JDL A;  3LBX A;  3UQ7 A;  4B3S T;  4HN9 A;  4IRE A;  3GA8 A;  4LFB T;  4EXT A;  3J9X 1;  2WZI A;  3P4W A;  4AXP A;  4TNV A;  3RYI E;  3LSV A;  2E9X C;  3AEC A;  2HN1 A;  3AA1 B;  5FXV A;  3W15 B;  5HXS A;  3EAM A;  3SFE A;  2UXN B;  4HFD A;  3KV4 A;  3UU4 A;  5AQH B;  3RYC E;  1D1C A;  4JEH B;  2LRK A;  2H89 A;  3HKC E;  1U4Q A;  2UUA T;  4P0A A;  1HFA A;  3K1S A;  4GYR A;  1S94 A;  2LKG A;  4LFA T;  2V7M A;  3NWI A;  3AE4 A;  3UU5 A;  3ZLI A;  3Q5E A;  5JRC B;  4H63 H;  1WRD A;  1E1H B;  3AXJ B;  4KMC A;  3ZST A;  4AKL A;  5IHY A;  1ZKE A;  3RHW A;  3O9X A;  4AKR B;  2JQ9 A;  4FJO A;  5HEU A;  5CJ5 A;  2CHO A;  2BBJ A;  5HXR A;  5AQS B;  1M62 A;  2P9B A;  4LFC T;  4N78 D;  2XM2 A;  4P0B A;  4YHJ A;  4DV1 T;  2EHO A;  1G73 A;  3PUY F;  3Q5X A;  4TV8 E;  5LA6 E;  4OX9 T;  1WYB A;  3RGL A;  3OYZ A;  3ZC1 A;  4HWH A;  5C3J A;  1BR1 A;  3CX7 B;  4OYJ A;  4WBN E;  5TAO A;  1ZV4 X;  4IL9 A;  3C4X A;  3EUH A;  4HFB A;  1QUU A;  2ACZ A;  3ZMZ B;  4K0K T;  3JAE A;  2XAS B;  3TLV A;  3PDY A;  2CXD A;  5HWY A;  4JI1 T;  4AQF C;  2N2N A;  2HPJ A;  5DQV A;  2Y48 B;  4YJ3 E;  4TWD A;  1KEY A;  4CXW A;  4WW0 A;  3C4W A;  3CQC B;  4UIG A;  4JI4 T;  4CN4 A;  4ZOL E;  4XBF B;  2CPT A;  3E0Z A;  3ONJ A;  1YKH B;  3KV5 A;  2DWK A;  2BS3 A;  2W62 A;  2XZE A;  3Q5D A;  4L9I A;  3SWH A;  2W00 A;  3M65 A;  4PK5 A;  4ZS3 A;  4UVA B;  4ZI3 D;  4TNW A;  3RYF E;  2VL0 A;  2E9X D;  2KWI B;  3K8P C;  3TKL B;  5HEO A;  2DLR A;  2M6B A;  4JI7 T;  4CN6 A;  3RH3 A;  2YKS A;  2UUC T;  3AEA A;  3FZF B;  3VHL A;  1IAP A;  3PU8 A;  4H63 V;  2LSY A;  3E22 E;  4I50 E;  4COF A;  4DR6 T;  4X66 T;  3G06 A;  2X67 A;  4L0R A;  3N9N A;  4Z91 A;  2VKH A;  3RF1 A;  4JI3 T;  2H88 A;  2JMH A;  4GIW A;  4O8S A;  4ASK A;  1KNP A;  2XQ8 A;  3RIU A;  4EED A;  2DCF A;  4PK6 A;  2D0T A;  3M3Z B;  4OFZ A;  2QVA A;  2WAU A;  2JQH A;  3Q5W A;  3L3P A;  5LCY A;  5CB4 E;  1HF8 A;  1KNR A;  1XNQ T;  2XUE A;  1OWA A;  4DV2 T;  2WCA A;  3RI5 A;  3UUN A;  3ZN0 B;  2YDR A;  2PJQ A;  3X1D A;  4DR5 T;  3IHR A;  5LJM A;  2BG9 A;  2K3W A;  2W2U A;  4H9O C;  1KK7 A;  3EI0 A;  2LKH A;  4U7I A;  4WYV A;  4EGW A;  3HI2 A;  4IE7 A;  3TLS A;  4DR2 T;  5EZY E;  2VL8 A;  1KNZ A;  4CI1 B;  5L3D B;  4B3M T;  2HH7 A;  4UEL A;  3LK2 B;  5LB7 B;  3RQW A;  3N2G E;  2UXB T;  1JNZ A;  1HS7 A;  2FJB A;  3GN5 A;  3ZKR A;  2CM0 A;  2WU2 A;  5JR9 B;  5L3G B;  5AFU L;  3T1H T;  2M67 A;  2JMK A;  3OPC A;  4LML A;  1VCS A;  2VKJ A;  5AQN B;  5L2L A;  3CIR A;  4X65 T;  4HGA A;  3JAF A;  2ODV A;  4TWH A;  3IF8 B;  3ZCJ A;  4YT0 A;  2VWA A;  2F4V T;  3Q9D A;  1FJG T;  2V6Y B;  1BR0 A;  3I1A A;  5ABF B;  5LJN A;  3N2O A;  1L0V A;  4JV5 T;  3N2K E;  4CXX A;  3ZC0 A;  2KMF A;  1R8I A;  2YDS A;  3F57 A;  4LF8 T;  4ZI2 D;  5LHG B;  3L09 A;  5CA1 E;  4YY3 T;  2VQE T;  4GK0 E;  2LLY A;  5AQI B;  2LRL A;  4P09 A;  2Y8D A;  1WR0 A;  4LF5 T;  4QXH B;  1MMD A;  2WDR A;  4DND A;  1D0X A;  2YK0 A;  4PJL A;  3RIF A;  2V26 A;  1W0B A;  4AIU A;  1KF6 A;  2EHO D;  2X0H A;  5AQK B;  4F6R C;  4YSZ A;  4AQY T;  5FXX A;  2XQ5 A;  3PUG A;  4IIJ E;  4MLK A;  3B13 A;  2I59 A;  2KIN B;  3VR9 A;  2WSS V;  4PJN A;  2WDQ A;  5JQG E;  2E5V A;  3AXJ A;  4ISS A;  4A98 A;  3FZH B;  4HE8 A;  5AQG B;  2CEA A;  4U31 A;  3OVU A;  3C64 A;  3ESL A;  2LT3 A;  3AE2 A;  3S4U A;  1YW0 A;  2D5U A;  4YTN A;  2BS2 A;  1IJ5 A;  1ZEE A;  3AA0 B;  4UEM A;  2OLT A;  2NW9 A;  3ZT5 A;  4C90 A;  3MXZ A;  1BR2 A;  1D0Z A;  3PU3 A;  2YU1 A;  3EVY A;  1X9B A;  1W0A A;  1UUR A;  3AEE A;  3LBX B;  3KFW X;  2R6G F;  1XZY A;  3RC3 A;  3RIA A;  3SS1 A;  4C91 A;  4EYY R;  4LF9 T;  2HPL A;  2UXC T;  2IC6 A;  1HNX T;  1YXR A;  4IE0 A;  2D9D A;  3P4P A;  4K0U A;  2NTX A;  1HNZ T;  2I0M A;  2XQ3 A;  3AAA B;  5JDF A;  3ZSS A;  2PBI A;  4EIW A;  2WBL A;  2W66 A;  1GQE A;  5LXT E;  2BVM A;  2IUB A;  2C5J A;  4TV9 E;  4OYK A;  3RX6 A;  5FL0 A;  1QLB A;  2X0L B;  1SA0 E;  3AE1 A;  3HR0 A;  2CWO A;  2IML A;  2K24 A;  2L9Q A;  3K3Q C;  4M1P A;  1Z0P A;  4DR1 T;  5LOV E;  3T1Y T;  3C4Z A;  1IBM T;  4ZS2 A;  3N9O A;  1H7C A;  3ZMS B;  2CXL A;  3R6N A;  1NEN A;  3FZM B;  4HWC A;  3U3I A;  5DQW A;  1J5W A;  3JCF A;  3UTK A;  5LMU T;  2ZM0 A;  3AE7 A;  5FVL A;  3SOL A;  4NXN T;  1BR4 A;  4HKA A;  2JQQ A;  2MBG A;  2QYW A;  4TX5 A;  4IDZ A;  2D0U A;  4L5G A;  5LG4 A;  2LSJ A;  2BG9 E;  4HWD A;  1N32 T;  1XDP A;  2UXD T;  3F2E A;  2XQA A;  5JDH A;  2YDQ A;  2ZM8 A;  4ZZC A;  2BDE A;  5J1G A;  5LBM A;  1W9R A;  4PAG A;  4UVB B;  5AQF B;  3P50 A;  4U3C A;  3ZMV B;  2UU9 T;  3QK6 A;  4X1I E;  5FY1 A;  4J2C A;  3ZMT B;  1UCU A;  4BA9 A;  5EK3 A;  1FIO A;  2MOZ A;  3ZT6 A;  2L3L A;  2XSB A;  1JNR A;  4UVC B;  4X62 T;  3O4X E;  3QNU A;  2C0S A;  2IAK A;  2LHR A;  4KP3 C;  3AAI A;  5H6R B;  3ZMU B;  4QWN B;  4AQF A;  5JDG A;  5L3F B;  3HL6 A;  2FBW A;  2XJ7 A;  3QUJ A;  4H9P C;  4NXM T;  2V7K A;  1NWM X;  2V7L A;  2K5B B;  4CXY A;  2DHR A;  3PUS A;  3AEF A;  4NUU A;  2ACX A;  3K3O A;  3ETV A;  4DR4 T;  3FZK B;  2JRK A;  5J0Z A;  3HKD E;  5L4H A;  3UUM A;  2VAS A;  2VKO A;  4NIQ A;  5AQV B;  4ERR A;  3DTO A;  1E2A A;  3BK9 A;  3LJC A;  5FKY A;  3A8Y C;  3NZQ A;  1YD8 G;  3VR8 A;  4UV8 B;  4IST A;  3UUL A;  3V5S A;  3VKH A;  1X79 A;  4AKI A;  4EZ4 A;  2XAF B;  3LG7 A;  2MPK A;  5ETW A;  2BZB A;  2KZ7 B;  2KWH A;  4DV4 T;  1CUN A;  4O2B E;  2BKP A;  4A56 A;  2W4X A;  3AVR A;  4KBM B;  4DO0 A;  4X64 T;  4JI5 T;  3GWH A;  5LP6 E;  5AQL B;  1HR0 T;  2BBH A;  5LNK A;  5LGN B;  4O4I E;  4B6X A;  4UF0 B;  4DV3 T;  5CGM A;  1MIY A;  4O2A E;  3RIU C;  2FJA A;  3RPU A;  2VQF T;  3ZPO A;  2LHN A;  4CI2 B;  2Q9Q C;  2FJD A;  4UV9 B;  1IBK T;  2XQ9 A;  3RYH E;  3CWZ B;  3H3A A;  4QXB B;  5FXW A;  5GON E;  2CLY C;  5HCM A;  2A2F X;  1EZ3 A;  4V1A v;  4UR9 A;  4XZC A;  4DR7 T;  2NW7 A;  3H37 A;  4CZZ B;  4HWF A;  3KV9 A;  1Z8U A;  3AE8 A;  5IWA T;  1SUM B;  5EK4 A;  1MMG A;  3OYX A;  3UU3 A;  3CQX C;  5L4E A;  4DUZ T;  1XMO T;  1YQ3 A;  5LMN T;  1WR6 A;  3T8O A;  3NRX A;  3V5U A;  1HX1 B;  2LEH A;  4X1K E;  3SFD A;  2W0G A;  2NR4 A;  4JBW F;  2LSK A;  3HA4 A;  1J1J A;  2YU2 A;  3J7Y q;  4GYS A;  4QHO A;  4QX7 B;  5C2T A;  3UUX B;  3FB2 A;  3NKZ A;  2LSI A;  2KLQ A;  2ZM2 A;  2BG9 B;  1WCR A;  2RP4 A;  5F8P A;  4F8H A;  5LHI B;  2B1E A;  5JRC A;  1ZP0 A;  3ETU A;  2YN6 A;  2YIN A;  1NEK A;  3BQL A;  5FXZ A;  4HFE A;  2A9U A;  4H9R C;  2DNX A;  3JC6 D;  4X20 E;  4XAX B;  5LGT B;  2CLY B;  2WP9 A;  2CCQ A;  4FI5 A;  4UXN B;  3H3M A;  3VRB A;  3MKD A;  1T8B A;  4ZI7 E;  1T72 A;  2LE8 A;  2JPF A;  2NWB A;  4O4J E;  2N1G A;  2CMR A;  4JEU B;  5L3E B;  5FY7 A;  4DVD A;  2K48 A;  4CQI A;  2K9A A;  2X9W A;  3KDS E;  4AI6 A;  3E08 A;  4BAY B;  2DI4 A;  1G8X A;  2VK9 A;  2NP9 A;  2XAG B;  1WFD A;  2YEV C;  3ANW A;  1VRB A;  2W61 A;  3C51 A;  3CML A;  5KDM C;  1I6Z A;  2BKO A;  4ILA A;  5FYM A;  3PUA A;  4YLH A;  2Z6E A;  3AA7 B;  2RPA A;  3AE5 A;  3FBL A;  4OK0 A;  5BMV E;  5CFB A;  5H6Q B;  2WWU A;  4I55 E;  3RKO A;  4QH1 A;  2LM9 A;  4ADZ A;  5FY0 A;  3MJX A;  2EHO C;  1OXZ A;  4U72 A;  1XMQ T;  3WAJ A;  5L47 A;  1VCT A;  1V9D A;  3CX6 B;  3K3N A;  1HCI A;  2VVS A;  3VRA A;  1I94 T;  2X51 A;  5CA0 E;  4IDO A;  3AED A;  5C8Y E;  2JJ9 A;  4KI0 F;  4JI2 T;  3AAE B;  3PV0 F;  3ZYM A;  5JDM A;  1Y64 B;  3AVS A;  4IDQ A;  4HWI B;  2UXX B;  3HKB E;  3NVO A;  2XSA A;  2C5K T;  2WB5 A;  2V1D B;  4G63 A;  5AQO B;  5AQQ B;  1XNR T;  1N34 T;  4AQG A;  4O4H E;  5LBQ B;  4EZH A;  2NTY A;  4LMJ A;  2BKN A;  5J2T E;  1OED B;  3PUX F;  3L8R A;  2WS3 A;  3JC6 C;  2N9D A;  3B5M A;  4ILU A;  5HEJ A;  3AEG A;  3VU7 H;  2EHO B;  1UX5 A;  3OJA A;  4A5X A;  3AE6 A;  5KMG P;  2B76 A;  5A1L A;  5LYJ E;  4X1Y E;  5EK2 A;  4QXC B;  4U7Y A;  4WZX A;  2C5I T;  3UU6 A;  2GK9 A;  3BQK A;  1MIV A;  2V7J A;  2CBJ A;  4CN1 A;  3P4R A;  4DMW A;  5HAX A;  1YQ4 A;  3RC8 A;  2L8K A;  5AQR B;  2W63 A;  1KFY A;  2V5C A;  4LMK A;  3NRY A;  2XHE B;  3EDV A;  3PUZ F;  4MBQ A;  1IJ6 A;  1VOM A;  4ZEY A;  5HXE A;  5KXJ A;  3CQG B;  1HG2 A;  5LHH B;  2KND A;  3CKD A;  4DV7 T;  1B7T A;  5JTG A;  2HN2 A;  3PUR A;  3IA3 A;  3P8C D;  2XQ4 A;  5L3B B;  2PG8 A;  4QKN A;  1T98 A;  3N9P A;  3ZEF B;  3ABV A;  4EEB A;  3U78 A;  2Q9Q D;  5FP3 A;  4U2Y A;  4QH4 A;  3P7I A;  4DV0 T;  4E7S A;  1UK5 A;  2CHN A;  3UT5 E;  2CXF A;  2IDO B;  1MNE A;  2A3D A;  4JI0 T;  2QRX A;  2BG9 C;  3AE3 A;  3C50 A;  2X9H A;  3PJA J;  3QOF A;  5ABE A;  2WDV A;  4HEA A;  2WU5 A;  3QC9 A;  2OV9 A;  4IDN A;  2CWY A;  3C98 B;  4PNI A;  3LK4 2;  2QGS A;  5LG3 A;  2IW5 B;  3WI3 A;  4UF0 A;  4ZI3 C;  5ABG A;  4DUY T;  1LRZ A;  4PJJ A;  3AA6 B;  4ZXL A;  3ZYK A;  2IHR 1;  4E7Z A;  3O1H A;  1US7 B;  4AKH A;  4JYA T;  3AB3 B;  2AE9 A;  2XAJ B;  4IE6 A;  1W09 A;  3MZK B;  5JR9 A;  2LJL A;  4IHJ E;  1IZN B;  3MAC A;  3ZJ1 A;  5JVD E;  2CA5 A;  2KSR A;  1M7K A;  2XQY A;  2NOX A;  3CVR A;  3PTR B;  5IYZ E;  3RRW A;  2ZM6 T;  4GKK T;  4EB6 E;  1U5P A;  3GMI A;  4G2A A;  3ZN1 B;  1UGO A;  1S35 A;  4YSY A;  5HEH A;  5DAB A;  4U2Z A;  1LVK A;  5AQU B;  3N5L A;  3JAD A;  2IC9 A;  4O4L E;  2XTL A;  3RLF F;  3ZJ2 A;  5F5W A;  4B3T T;  3TLW A;  5JDN A;  3NBX X;  4U74 A;  5JR9 C;  2XPK A;  4ANJ A;  2W67 A;  2UUB T;  4X5T A;  1CHU A;  5IUX A;  4DR3 T;  1WYC A;  3LK3 B;  5BR8 T;  4BJN A;  4ZZB A;  3NZP A;  3P4S A;  3I9W A;  5DJQ C;  2YOE A;  4YFS A;  5HWX A;  2XQ6 A;  3QB5 A;  2V8S V;  4AIS A;  5F3J A;  2J62 A;  2OA5 A;  4ILB A;  3KVA A;  2HHH T;  1AJ3 A;  1FEW A;  2Q9Q B;  1OED A;  2MAW A;  2ES0 A;  3MK7 C;  1ZHC A;  4JUY A;  1SHZ C;  4DBR A;  4U33 A;  5E0O A;  4QH5 A;  3EAB A;  1HG5 A;  2XM1 A;  5ABH A;  2LOP A;  3KV6 A;  3PUQ A;  3RQU A;  1WLX A;  4YJ2 E;  4IGU A;  4TZ4 C;  2XY8 B;  3N9Q A;  3Q2M A;  4ZHQ E;  5JRE A;  4B3R T;  2BS4 A;  4YXD A;  1FMW A;  1LKX A;  5HYA A;  2MTQ A;  4I4T E;  2E2A A;  4ZI2 C;  5JH7 E;  4MAL A;  4DID B;  4IE5 A;  4Z8X A;  4TWF A;  2FJE A;  2WQY A;  4YTM A;  2D2S A;  3N9L A;  4TUY E;  4YSX A;  2E8I A;  2J4G A;  3TLU A;  3UQ4 A;  3ZCI A;  3GN5 B;  4GK5 E;  2JIW A;  5HXC A;  4NUV A;  2DL1 A;  4HFC A;  2G0U A;  2ZLY A;  5AQT B;  2WMN A;  2ZMA A;  5FL1 A;  3UFE A;  4H9S E;  1YKE B;  3UUB A;  1MMN A;  3FHN A;  2PFV A;  3PE0 A;  4YTP A;  5LGU B;  1Y01 A;  4OHF A;  3TLT A;  2MYS A;  2WMO A;  2XQ7 A;  2Q9Q A;  4MFR A;  3CPZ A;  2XAQ B;  4TN7 B;  4DMV A;  5JDQ A;  4DV5 T;  4KX6 A;  3I0O A;  2ODU A;  2H7O A;  2NW8 A;  4EOZ B;  2A72 A;  4I43 B;  4AKG A;  5ADX L;  1ZOY A;  2VKD A;  4IL4 A;  4HFH A;  1HX8 A;  2VVN A;  3DP7 A;  3RKG A;  3FBZ A;  4YHH T;  2WZH A;  1MIW A;  4JI6 T;  1T7S A;  3IEE A;  3O1J A;  1N33 T;  2LOS A;  3RRC A;  1OED E;  3A5X A;  4JLE A;  3LFM A;  4IT4 A;  3ZYL A;  3PUV F;  2VUR A;  1DU2 A;  2WM9 A;  2KXP B;  5FVK A;  2WY2 A;  2X9Y A;  4KUM B;  4PFP A;  4GOU A;  4A97 A;  4MHC A;  5KX5 E;  3FXE B;  2IIU A;  5J2U E;  3LDQ B;  3KBT A;  2CE7 A;  3KBU A;  4PJM A;  4HFI A;  1E7P A;  1LVF A; 
#chains in the Genus database with same CATH homology
 2AE9 A;  1DU2 A;  2IDO B;  2XY8 B;  2AXD S;  1SE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...