2XY8B

Paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
b'QTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III SUBUNIT EPSILON
publication title Protein-Protein Haddocking Using Exclusively Pseudocontact Shifts.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 19
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2xy8B00
2AXDS 1DU2A 2IDOB 2XY8B 1SE7A 2AE9A
chains in the Genus database with same CATH superfamily
2CHOA 4IIJE 1KNRA 1SUMB 3NZPA 2V8SV 3EUHA 2I6HA 3PJAA 3UFEA 5L3EB 4Q25A 2Y6XA 4G2AA 5JDHA 4L5GA 3TLVA 4BAYB 4NUVA 4UVBB 3CPZA 3OTOT 3ZN0B 4JI6T 2VB6A 2WMOA 2JMKA 3JC6D 5DABA 1ZKEA 4ZEYA 2W61A 4WBOA 3RYHE 2E5VA 2UXNB 3AE7A 3AVSA 4UV8B 5EK3A 3D0TA 2SPCA 2E2AA 3P4WA 3N9OA 3CVRA 4PJLA 2Q9QB 5AQMB 5L47A 4ILUA 2A9UA 2X0HA 2XAQB 2BBHA 2A72A 2CHNA 4TNWA 2ZLYA 4PAGA 3FZKB 5FY1A 3IBPA 4XAXB 1BR4A 1HF8A 1HNZT 2JJ9A 2D5UA 4X1IE 5HEUA 5L2LA 5C3JA 2RA1A 3I0QA 2WU5A 2DWKA 5KXJA 5ABFA 1QLBA 3IHRA 2VQET 2KXPB 3AE3A 3TLTA 3ETVA 2WWVA 4ZI2D 3P4QA 2V6YB 2XSBA 2JQ9A 4MLKA 5IYZE 1M7KA 5F3JA 4YTPA 4JI8T 1AJ3A 1NENA 4QHOA 4H9RC 2VVSA 2D9DA 1UGOA 2CBJA 3O1IA 2FUPA 2UUCT 2V1DB 2IC9A 1WR0A 5AQFB 4BJNA 4JUYA 2VL8A 4IGUA 1HX1B 4YT0A 3K3OA 5FY7A 4X1YE 3CX7B 3SFDA 2VKHA 4YXDA 4U2ZA 1W9RA 2ES0A 3P4SA 3KFWX 1D1BA 2DI4A 1HNWT 4DUZT 2A3DA 2P9BA 2NW9A 3LK2B 4GOUA 3AA1B 4JI3T 2VKDA 5HXHA 4AQFA 4DR5T 3L3PA 2Q9QA 1ZOYA 4MBQA 4IT4A 4LFBT 2XPKA 4ZS2A 2WM9A 5AQHB 5AQRB 1S94A 3OVUA 2X9HA 3NRXA 4ZHQE 2FJDA 3LK42 4QKNA 4UEMA 2XM1A 2UUBT 4PK5A 1Y01A 2LKHA 1N32T 4WZXA 2YDQA 5HXRA 2G0UA 2EHOB 2BG9B 2KSRA 4YHJA 4PNIA 2BG9E 1KNPA 2V6YA 2HHHT 4EAHA 1D1AA 2XQ8A 4LF7T 4UELA 2E9XB 2NOXA 3ABVA 1GQEA 3ZCIA 5ABGA 3ZMUB 5E0OA 4MALA 2WWUA 4YSYA 3AB3B 4DV2T 2W67A 4CXWA 5LYJE 4UVCB 4AXPA 1OXZA 4DV4T 3DP7A 2IW5B 3U78A 4HFBA 4DO0A 2XSAA 2YDSA 2WDQA 4KP3C 3AEEA 2IDOB 4AIUA 3A7MA 3U3IA 4H9PC 3MXZA 2JQHA 4DV5T 2OLTA 4HWDA 3K8PC 4XBFB 4CN6A 5JDQA 2IC6A 4TN7B 4YTMA 3RGLA 2YU2A 3C50A 4EIWA 4O8SA 5JQGE 3VR8A 4P1NA 2UXDT 2X67A 3OKQA 4CI2B 1B7TA 3PUSA 3S4UA 2H3RA 1HR0T 2XQYA 2V7MA 2EHOA 3QOFA 1MMDA 3N9PA 3ZT7A 2D0TA 2KWHA 2BG9A 3UUMA 2AE9A 2X66A 3F31A 4HTEA 4YY3T 5JDMA 2IMLA 2KLQA 4AISA 2XAJB 5FVLA 4AQYT 3I9YA 4ZI7E 3C4ZA 1V9DA 2E9XA 3RH3A 5J0ZA 4ZI3C 2BVLA 1OEDC 3KVAA 5LHGB 4EYYR 2YN6A 3JAEA 2V5CA 3K1SA 4H63V 4A98A 2KINB 2GK9A 2YDRA 4AKGA 2XQ7A 4KMCA 4X65T 4DR7T 4TNVA 1W0AA 2CBIA 5ABEA 5LJNA 4EGWA 3Q2MA 3VR9A 1X79A 4HFIA 2WY2A 5A1LA 4QH1A 3M65A 3VU7H 3E22E 2Y48B 1D0XA 1LKXA 1FEWA 4YHHT 3CK6A 3BQKA 3FB2A 3PUVF 5LA6E 2HN1A 4PK4A 4HWHA 2V5DA 2XUEA 3AVRA 3Q9DA 1J5ET 4WNKA 4Z8XA 2LHRA 4QXHB 4UXNB 3HA4A 4ISTA 4X66T 2WSSV 1E2AA 3RQWA 5BMVE 2Q9QC 4TWHA 2X0YA 4YSZA 5IUXA 3RX6A 2W00A 1LVFA 3VRBA 1VOMA 4IDOA 2WQYA 2XQ9A 4IREA 2LSGA 1OEDB 1J1JA 4YTNA 1KEYA 3FZFB 1OEDE 3UFGA 4U7YA 2LT3A 3RIAA 4AKRB 4PJMA 3AE1A 4JI4T 3WI3A 3SOLA 5KDMC 4O4JE 3ZYMA 2W63A 4B3TT 2H88A 5EZYE 2E5LT 5HEHA 4UVAB 3GA8A 4HFHA 5AFUL 3K3QC 3RKGA 4ASKA 4WYVA 3BQLA 3AA6B 4WBNE 1YD8G 4ZZCA 3ZSSA 3CQGB 3EAMA 4IL9A 2M67A 4DUYT 1SE7A 3LG7A 4U2YA 2KMFA 2N9DA 3ONLC 4X5TA 4EEDA 2CXDA 1ZV4X 1HNXT 3UTKA 4X20E 1FJGT 1HFAA 2NTYA 3ZMTB 4E7SA 3UQ7A 3J9X1 1WCRA 3CQCB 4ADZA 4LF8T 1IZNB 1U5PA 3LBXB 4DBRA 2CA5A 4MHCA 2LSKA 2WB5A 2OA5A 4C90A 4COFA 1XZYA 4X62T 4YSXA 3PUGA 3UU3A 5JR9B 2NWBA 2BS4A 1OEDA 5JDFA 2X68A 3ONXA 5JVDE 3AAEB 4JI1T 2EHOC 2UXXB 2BG9C 3N2GE 4HGAA 2DL1A 3KBTA 1ZHCA 1DU2A 3BQIA 3R6NA 3FZHB 5FYMA 4I43B 5HXEA 3NZQA 4KHZF 2E9XC 5FMNA 4OYJA 3RYFE 3RIFA 4L9IA 3C64A 4EXTA 5L3FB 5FNVE 3KDSE 3PUYF 5LXTE 1HG2A 5LMNT 2CXLA 5C2TA 5GONE 3PUAA 2I0MA 4HWFA 3SRZA 5JRCB 2CCQA 2HPLA 5JREA 1YKEB 2WDVA 4PJNA 3NBXX 3RC3A 1E7PA 3JADA 4ZOLE 4GYSA 2QYWA 3C4WA 3W15B 2WZHA 5HCMA 3LBXA 1CUNA 4B3MT 1U4QA 4GK0E 5LHHB 4I4TE 4DV6T 1JNRA 4X64T 2RP4A 1KNZA 2LLYA 5AQVB 4ILBA 1YKHB 4DVDA 3FZMB 4TUYE 5JR9A 4GKJT 3HL6A 5JDGA 5CB4E 5L3CB 5FL1A 3AEDA 3UUNA 1M62A 1H7CA 1W09A 3HKCE 4YLHA 1EZ3A 2CWYA 2XQAA 2WBLA 4DR2T 3LDQB 3ANWB 4B3ST 3FXDB 3PU8A 3QB5A 4DV1T 1IBLT 4OYKA 4JI2T 4JEUB 4IDPA 1NWMX 5LGUB 1S35A 2C5IT 4DIDB 2DHRA 3T1YT 2DLRA 5AQPB 3EHZA 3HR0A 4IE0A 2PFVA 2FBWA 4A56A 5M4YA 3LFMA 4F6RC 4A97A 2XQ4A 3C51A 5AQJB 5JRCA 4CN1A 5EK4A 2YOEA 1MIYA 5L3GB 2FJEA 4NXMT 4Z90A 1KF6A 3PJAJ 3G06A 1MIWA 4ZXLA 1NAFA 2IIUA 4H63H 2ZM2A 4LFCT 2C0SA 5HEGA 3KBUA 3AXJB 4UF0B 4QXBB 4U72A 2F4VT 1T8BA 4OX9T 4P09A 2WZIA 2E9XD 5L4HA 1T7SA 4LF4T 1VCSA 3ZMVB 5DQWA 4LMLA 3H3AA 5F5WA 2RPAA 2X0LB 3GMIA 4PK6A 2W62A 4LMJA 2WDRA 5HXCA 3CMLA 5J2UE 2KT9A 2PJQA 4ILCA 3H3MA 1IAPA 4CXYA 2C5KT 5LBMA 3MJXA 3JCFA 3ANWA 1IJ5A 3VHLA 2KNDA 2PTFA 3PV0F 4HFCA 4IDZA 2LE8A 4IE5A 1MMAA 3ZMZB 3I9WA 2LSIA 1D0YA 4GIWA 3ZCJA 2LRKA 5AQUB 4DR6T 4I0UA 2H7OA 2X9WA 5FY0A 2VVNA 4EOZB 1G8XA 2XAGB 1YXRA 3WAJA 5HWXA 1G73A 5LJMA 4HKAA 1E1HB 1HX8A 1FMVA 2MYSA 2IUBA 1MNEA 3P4RA 1W0BA 3RHWA 3AEGA 4O4IE 3GN5B 3QC9A 3FBZA 4TWDA 5LG4A 3TLSA 4EYUA 4O4HE 3ZYKA 3ETUA 2NTXA 2MOZA 2B76A 2XAHB 5C8YE 2J62A 2WP9A 1T98A 2V6XA 2MTQA 3IA3A 2JIWA 1I94T 4IE7A 5ADXL 4IE6A 3ZYLA 2X51A 4PFOA 4DR3T 2XM2A 3CIRA 4EZ4A 5L3DB 5AQNB 3T1HT 1ZP0A 2WMNA 3AXJA 3ZC0A 4UF0A 2YK0A 3JC6C 4B3RT 5AQLB 5DJQC 5AQTB 4FJOA 3P7IA 1NEKA 2BKPA 2VKJA 3AA7B 5HEJA 3AAIA 4NXNT 5JTGA 4PW8A 3PUQA 2OV9A 5EK2A 4EEBA 4H9OC 3Q5DA 3B13A 3ESLA 4KI0F 2LM9A 2ODUA 3O9XA 2QVAA 4P0BA 2K5BB 3UQ4A 2ACZA 2HH7A 5HXSA 4QWNB 1YQ3A 5FVKA 2CEAA 3GWHA 2CXFA 1O3XA 4JI0T 4QH4A 1LVKA 5KMGP 5F8PA 4DV7T 2YINA 5JR9C 2H89A 3ZKRA 3ZEFB 5AQOB 3UULA 1MMGA 3AE2A 5FXWA 1I6ZA 2BS2A 5LOVE 3GN5A 2DNXA 2LOSA 4OFZA 4JI7T 4K0UA 2JRKA 1FIOA 3RRCA 3ZJ1A 2CLYB 5AQQB 3L39A 5CA0E 1Y64B 5AQIB 3N9MA 5HYAA 4PJJA 2WS3A 1WRDA 3KV6A 4O2AE 4DV0T 2LEHA 1XMQT 2V7LA 1MMNA 2KWIB 4TV9E 4J2CA 1BR1A 3OJAA 4U7IA 4DR4T 3A8YC 4QX7B 3RIUA 4UV9B 3AE4A 1FMWA 4I50E 1SHZC 2JQQA 4MFRA 3N9QA 2ZM0A 2YEVC 3UU5A 4ZI3D 3X1DA 3P8CD 2M6BA 2JPFA 4B6XA 4GK5E 2ZMAA 4L0RA 2MAWA 3DTOA 2CPTA 4E7ZA 5JDNA 3UU8A 2VASA 1Z0PA 2N1GA 4HEAA 5FXVA 4F8HA 1L0VA 3MK7C 3NRYA 4HWIB 3OBVE 2CM0A 3KV4A 4HN9A 2H7VC 2PG8A 1YW0A 2R6GF 3QUJA 1JNZA 4AI6A 5DQVA 2L9QA 3LJCA 1VRBA 4DMWA 3ZMSB 1XWMA 4U74A 4H9NC 1MNDA 3HKBE 5LBQB 2XZEA 5AQGB 3RF1A 4JLEA 4X1KE 1XNQT 3P50A 2NW7A 2HPJA 4KHPT 2FJAA 4HWCA 3CQXC 3I0OA 3MZKB 3Q5WA 2J1DG 1XNRT 3TKLB 2ACXA 4GYRA 5CFBA 2PBIA 3RC8A 3ONJA 4ANJA 4PFPA 3KV5A 2BZBA 3EVYA 3MA9A 4HFEA 2J4GA 1QSDA 2Z6EA 2V26A 1R8IA 5J2TE 2A2FX 1HTJF 1T72A 3OYZA 3PURA 4IDQA 2Q9QD 4U31A 4DV3T 1WYCA 3OPCA 4AKIA 3O1HA 4EZHA 2L3LA 1N33T 3KV9A 3HKEE 3E0ZA 3RYIE 2XAFB 4KUMB 3UUBA 3PE0A 4JYAT 5BR8T 3N2KE 1N36T 5LB7B 3HI2A 4NPPA 3K3NA 3AEFA 3RLFF 1BR0A 4WW0A 3B57A 4FI5A 4TZ4C 2N2NA 2D2SA 2I59A 2BS3A 2QA7A 5LNKA 3DJBA 3AA0B 3AAAB 4JEHB 3OYXA 2K24A 4JBWF 2K3WA 5ABHA 2XTLA 4LF9T 1VCTA 2W0GA 2W66A 1WYBA 4XZCA 4LMKA 2VURA 4DR1T 3AECA 2LOPA 3O1JA 4G63A 3TLWA 4QX8B 4ERRA 5FP3A 4TWFA 2IHR1 3EDVA 2CRBA 3Q5EA 3MKDA 3L09A 2LKGA 3UU6A 1HCIA 5AQSB 2LHNA 3VKGA 2VWAA 1HG5A 3A5XA 1MIVA 3T8OA 3CX6B 2D0UA 3KINB 3NVOA 4A5XA 2CWOA 3ZT6A 3ZN1B 3H37A 3FXEB 3TLUA 4I55E 2XQ3A 1WLXA 4O2BE 4CI1B 3EABA 4P0AA 5HWYA 3N9LA 3ZLIA 5HCJA 2V7KA 3ZT5A 3CKDA 3EI0A 2XY8B 5FL0A 4V1Av 3QB5K 1IBMT 4IE4A 5CGMA 2NP9A 2EHOD 2KZ7B 3CX8B 2FJBA 3NKZA 3KVBA 3PUWF 3F2EA 4DNDA 2V7IA 4DMVA 4BA9A 2LSJA 4BJMA 4IHJE 3AEAA 2BDEA 2Y8DA 1YQ4A 2HN2A 2W4XA 5J1GA 1SA0E 3EDUA 3RIUC 2ZM6T 3HKDE 3SFEA 3ZSTA 1D1CA 4ZS3A 2BKNA 2BBJA 5LMUT 2M6IA 3FHNA 2DCFA 4DBQA 4LF5T 2QGSA 1KK7A 4TX5A 2IAKA 4CN4A 1US7B 4IDNA 4EV6A 4EB6E 3V5SA 1UCUA 3RQUA 1IJ6A 3N9NA 5FXXA 2LSYA 3VRAA 3R84B 3RRWA 5LHIB 2V7JA 5ETWA 2XQ6A 4AQGA 1UX4A 5H6QB 2DWGA 3ZJ2A 3PDYA 1QUUA 2QRXA 4NUUA 2VQFT 2BKOA 4QXCB 3C4XA 4HE8A 3V5UA 4IL4A 4UIGA 1BR2A 3UT5E 3IF8B 3JAFA 4ZZBA 2CMRA 3AE9A 4YFSA 3P4PA 3PUZF 1XDOA 3AE6A 4CI3B 1N34T 2CLYC 2ODVA 2AXDS 1Z8UA 1ZEEA 3N5LA 3ZPOA 5FKYA 3F57A 1UK5A 5IHYA 3FZLB 3C98B 1X9BA 4H9QC 3CWZB 2X9YA 4LF6T 5AQKB 2BVMA 3SWHA 5L3BB 3M3ZB 3RPUA 2LM2A 3RI5A 2XQ5A 1LRZA 5CA1E 3ZC1A 2UXBT 5JDLA 3IEEA 2VL0A 3NWIA 5LG3A 3QNUA 5H6RB 4KBMB 4U33A 2W2UA 3L8RA 2XASB 3AE8A 3QK6A 2WCAA 2UXCT 5FXZA 2YU1A 3RYCE 5HEOA 2B1EA 2NR4A 2VKOA 4HFDA 1CHUA 1KFYA 4OHFA 4Z91A 3PU3A 4GKKT 2XHEB 4CZZB 4H9SE 5IWAT 4ILAA 5HAXA 5LCYA 3I1AA 3UU4A 4M1PA 4LFAT 4OK0A 5CJ5A 5LGNB 2YKSA 2LRLA 1UURA 3VKHA 3WAKA 4AKLA 3AEBA 4QH5A 2NW8A 3AE5A 4AQFC 4ZI2C 4CXXA 5KX5E 4O4LE 5TAOA 2WAUA 4TV8E 4N78D 2ZM8A 2K9AA 4AKHA 3E08A 3B5MA 2L8KA 5LP6E 2JQKA 1WR6A 1HS7A 2XJ7A 5L4EA 3UUXB 1UX5A 3FBLA 3MACA 2MPKA 3SS1A 2MBGA 2K48A 3RKOA 2UUAT 1OWAA 1D0ZA 4NIQA 4UR9A 2JMHA 4HFVA 4JI5T 2WU2A 3Q5XA 4CQIA 2X9XA 4JV5T 2E8IA 5JH7E 2J47A 5LGTB 4U3CA 3PTRB 1XDPA 1J5WA 2UU9T 4YJ2E 4K0KT 1UUSA 5ABFB 4YJ3E 3O4XE 1WFDA 3LSVA 2LJLA 2C5JA 4ISSA 3LK3B 1XMOT 3N2OA 3PUXF 1IBKT 4C91A 2VK9A 3BK9A 2CE7A 4KX6A 3J7Yq
chains in the Genus database with same CATH topology
2AXDS 1DU2A 2IDOB 2XY8B 1SE7A 2AE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AXD S;  1DU2 A;  2IDO B;  2XY8 B;  1SE7 A;  2AE9 A; 
#chains in the Genus database with same CATH topology
 2CHO A;  4IIJ E;  1KNR A;  1SUM B;  3NZP A;  2V8S V;  3EUH A;  2I6H A;  3PJA A;  3UFE A;  5L3E B;  4Q25 A;  2Y6X A;  4G2A A;  5JDH A;  4L5G A;  3TLV A;  4BAY B;  4NUV A;  4UVB B;  3CPZ A;  3OTO T;  3ZN0 B;  4JI6 T;  2VB6 A;  2WMO A;  2JMK A;  3JC6 D;  5DAB A;  1ZKE A;  4ZEY A;  2W61 A;  4WBO A;  3RYH E;  2E5V A;  2UXN B;  3AE7 A;  3AVS A;  4UV8 B;  5EK3 A;  3D0T A;  2SPC A;  2E2A A;  3P4W A;  3N9O A;  3CVR A;  4PJL A;  2Q9Q B;  5AQM B;  5L47 A;  4ILU A;  2A9U A;  2X0H A;  2XAQ B;  2BBH A;  2A72 A;  2CHN A;  4TNW A;  2ZLY A;  4PAG A;  3FZK B;  5FY1 A;  3IBP A;  4XAX B;  1BR4 A;  1HF8 A;  1HNZ T;  2JJ9 A;  2D5U A;  4X1I E;  5HEU A;  5L2L A;  5C3J A;  2RA1 A;  3I0Q A;  2WU5 A;  2DWK A;  5KXJ A;  5ABF A;  1QLB A;  3IHR A;  2VQE T;  2KXP B;  3AE3 A;  3TLT A;  3ETV A;  2WWV A;  4ZI2 D;  3P4Q A;  2V6Y B;  2XSB A;  2JQ9 A;  4MLK A;  5IYZ E;  1M7K A;  5F3J A;  4YTP A;  4JI8 T;  1AJ3 A;  1NEN A;  4QHO A;  4H9R C;  2VVS A;  2D9D A;  1UGO A;  2CBJ A;  3O1I A;  2FUP A;  2UUC T;  2V1D B;  2IC9 A;  1WR0 A;  5AQF B;  4BJN A;  4JUY A;  2VL8 A;  4IGU A;  1HX1 B;  4YT0 A;  3K3O A;  5FY7 A;  4X1Y E;  3CX7 B;  3SFD A;  2VKH A;  4YXD A;  4U2Z A;  1W9R A;  2ES0 A;  3P4S A;  3KFW X;  1D1B A;  2DI4 A;  1HNW T;  4DUZ T;  2A3D A;  2P9B A;  2NW9 A;  3LK2 B;  4GOU A;  3AA1 B;  4JI3 T;  2VKD A;  5HXH A;  4AQF A;  4DR5 T;  3L3P A;  2Q9Q A;  1ZOY A;  4MBQ A;  4IT4 A;  4LFB T;  2XPK A;  4ZS2 A;  2WM9 A;  5AQH B;  5AQR B;  1S94 A;  3OVU A;  2X9H A;  3NRX A;  4ZHQ E;  2FJD A;  3LK4 2;  4QKN A;  4UEM A;  2XM1 A;  2UUB T;  4PK5 A;  1Y01 A;  2LKH A;  1N32 T;  4WZX A;  2YDQ A;  5HXR A;  2G0U A;  2EHO B;  2BG9 B;  2KSR A;  4YHJ A;  4PNI A;  2BG9 E;  1KNP A;  2V6Y A;  2HHH T;  4EAH A;  1D1A A;  2XQ8 A;  4LF7 T;  4UEL A;  2E9X B;  2NOX A;  3ABV A;  1GQE A;  3ZCI A;  5ABG A;  3ZMU B;  5E0O A;  4MAL A;  2WWU A;  4YSY A;  3AB3 B;  4DV2 T;  2W67 A;  4CXW A;  5LYJ E;  4UVC B;  4AXP A;  1OXZ A;  4DV4 T;  3DP7 A;  2IW5 B;  3U78 A;  4HFB A;  4DO0 A;  2XSA A;  2YDS A;  2WDQ A;  4KP3 C;  3AEE A;  2IDO B;  4AIU A;  3A7M A;  3U3I A;  4H9P C;  3MXZ A;  2JQH A;  4DV5 T;  2OLT A;  4HWD A;  3K8P C;  4XBF B;  4CN6 A;  5JDQ A;  2IC6 A;  4TN7 B;  4YTM A;  3RGL A;  2YU2 A;  3C50 A;  4EIW A;  4O8S A;  5JQG E;  3VR8 A;  4P1N A;  2UXD T;  2X67 A;  3OKQ A;  4CI2 B;  1B7T A;  3PUS A;  3S4U A;  2H3R A;  1HR0 T;  2XQY A;  2V7M A;  2EHO A;  3QOF A;  1MMD A;  3N9P A;  3ZT7 A;  2D0T A;  2KWH A;  2BG9 A;  3UUM A;  2AE9 A;  2X66 A;  3F31 A;  4HTE A;  4YY3 T;  5JDM A;  2IML A;  2KLQ A;  4AIS A;  2XAJ B;  5FVL A;  4AQY T;  3I9Y A;  4ZI7 E;  3C4Z A;  1V9D A;  2E9X A;  3RH3 A;  5J0Z A;  4ZI3 C;  2BVL A;  1OED C;  3KVA A;  5LHG B;  4EYY R;  2YN6 A;  3JAE A;  2V5C A;  3K1S A;  4H63 V;  4A98 A;  2KIN B;  2GK9 A;  2YDR A;  4AKG A;  2XQ7 A;  4KMC A;  4X65 T;  4DR7 T;  4TNV A;  1W0A A;  2CBI A;  5ABE A;  5LJN A;  4EGW A;  3Q2M A;  3VR9 A;  1X79 A;  4HFI A;  2WY2 A;  5A1L A;  4QH1 A;  3M65 A;  3VU7 H;  3E22 E;  2Y48 B;  1D0X A;  1LKX A;  1FEW A;  4YHH T;  3CK6 A;  3BQK A;  3FB2 A;  3PUV F;  5LA6 E;  2HN1 A;  4PK4 A;  4HWH A;  2V5D A;  2XUE A;  3AVR A;  3Q9D A;  1J5E T;  4WNK A;  4Z8X A;  2LHR A;  4QXH B;  4UXN B;  3HA4 A;  4IST A;  4X66 T;  2WSS V;  1E2A A;  3RQW A;  5BMV E;  2Q9Q C;  4TWH A;  2X0Y A;  4YSZ A;  5IUX A;  3RX6 A;  2W00 A;  1LVF A;  3VRB A;  1VOM A;  4IDO A;  2WQY A;  2XQ9 A;  4IRE A;  2LSG A;  1OED B;  1J1J A;  4YTN A;  1KEY A;  3FZF B;  1OED E;  3UFG A;  4U7Y A;  2LT3 A;  3RIA A;  4AKR B;  4PJM A;  3AE1 A;  4JI4 T;  3WI3 A;  3SOL A;  5KDM C;  4O4J E;  3ZYM A;  2W63 A;  4B3T T;  2H88 A;  5EZY E;  2E5L T;  5HEH A;  4UVA B;  3GA8 A;  4HFH A;  5AFU L;  3K3Q C;  3RKG A;  4ASK A;  4WYV A;  3BQL A;  3AA6 B;  4WBN E;  1YD8 G;  4ZZC A;  3ZSS A;  3CQG B;  3EAM A;  4IL9 A;  2M67 A;  4DUY T;  1SE7 A;  3LG7 A;  4U2Y A;  2KMF A;  2N9D A;  3ONL C;  4X5T A;  4EED A;  2CXD A;  1ZV4 X;  1HNX T;  3UTK A;  4X20 E;  1FJG T;  1HFA A;  2NTY A;  3ZMT B;  4E7S A;  3UQ7 A;  3J9X 1;  1WCR A;  3CQC B;  4ADZ A;  4LF8 T;  1IZN B;  1U5P A;  3LBX B;  4DBR A;  2CA5 A;  4MHC A;  2LSK A;  2WB5 A;  2OA5 A;  4C90 A;  4COF A;  1XZY A;  4X62 T;  4YSX A;  3PUG A;  3UU3 A;  5JR9 B;  2NWB A;  2BS4 A;  1OED A;  5JDF A;  2X68 A;  3ONX A;  5JVD E;  3AAE B;  4JI1 T;  2EHO C;  2UXX B;  2BG9 C;  3N2G E;  4HGA A;  2DL1 A;  3KBT A;  1ZHC A;  1DU2 A;  3BQI A;  3R6N A;  3FZH B;  5FYM A;  4I43 B;  5HXE A;  3NZQ A;  4KHZ F;  2E9X C;  5FMN A;  4OYJ A;  3RYF E;  3RIF A;  4L9I A;  3C64 A;  4EXT A;  5L3F B;  5FNV E;  3KDS E;  3PUY F;  5LXT E;  1HG2 A;  5LMN T;  2CXL A;  5C2T A;  5GON E;  3PUA A;  2I0M A;  4HWF A;  3SRZ A;  5JRC B;  2CCQ A;  2HPL A;  5JRE A;  1YKE B;  2WDV A;  4PJN A;  3NBX X;  3RC3 A;  1E7P A;  3JAD A;  4ZOL E;  4GYS A;  2QYW A;  3C4W A;  3W15 B;  2WZH A;  5HCM A;  3LBX A;  1CUN A;  4B3M T;  1U4Q A;  4GK0 E;  5LHH B;  4I4T E;  4DV6 T;  1JNR A;  4X64 T;  2RP4 A;  1KNZ A;  2LLY A;  5AQV B;  4ILB A;  1YKH B;  4DVD A;  3FZM B;  4TUY E;  5JR9 A;  4GKJ T;  3HL6 A;  5JDG A;  5CB4 E;  5L3C B;  5FL1 A;  3AED A;  3UUN A;  1M62 A;  1H7C A;  1W09 A;  3HKC E;  4YLH A;  1EZ3 A;  2CWY A;  2XQA A;  2WBL A;  4DR2 T;  3LDQ B;  3ANW B;  4B3S T;  3FXD B;  3PU8 A;  3QB5 A;  4DV1 T;  1IBL T;  4OYK A;  4JI2 T;  4JEU B;  4IDP A;  1NWM X;  5LGU B;  1S35 A;  2C5I T;  4DID B;  2DHR A;  3T1Y T;  2DLR A;  5AQP B;  3EHZ A;  3HR0 A;  4IE0 A;  2PFV A;  2FBW A;  4A56 A;  5M4Y A;  3LFM A;  4F6R C;  4A97 A;  2XQ4 A;  3C51 A;  5AQJ B;  5JRC A;  4CN1 A;  5EK4 A;  2YOE A;  1MIY A;  5L3G B;  2FJE A;  4NXM T;  4Z90 A;  1KF6 A;  3PJA J;  3G06 A;  1MIW A;  4ZXL A;  1NAF A;  2IIU A;  4H63 H;  2ZM2 A;  4LFC T;  2C0S A;  5HEG A;  3KBU A;  3AXJ B;  4UF0 B;  4QXB B;  4U72 A;  2F4V T;  1T8B A;  4OX9 T;  4P09 A;  2WZI A;  2E9X D;  5L4H A;  1T7S A;  4LF4 T;  1VCS A;  3ZMV B;  5DQW A;  4LML A;  3H3A A;  5F5W A;  2RPA A;  2X0L B;  3GMI A;  4PK6 A;  2W62 A;  4LMJ A;  2WDR A;  5HXC A;  3CML A;  5J2U E;  2KT9 A;  2PJQ A;  4ILC A;  3H3M A;  1IAP A;  4CXY A;  2C5K T;  5LBM A;  3MJX A;  3JCF A;  3ANW A;  1IJ5 A;  3VHL A;  2KND A;  2PTF A;  3PV0 F;  4HFC A;  4IDZ A;  2LE8 A;  4IE5 A;  1MMA A;  3ZMZ B;  3I9W A;  2LSI A;  1D0Y A;  4GIW A;  3ZCJ A;  2LRK A;  5AQU B;  4DR6 T;  4I0U A;  2H7O A;  2X9W A;  5FY0 A;  2VVN A;  4EOZ B;  1G8X A;  2XAG B;  1YXR A;  3WAJ A;  5HWX A;  1G73 A;  5LJM A;  4HKA A;  1E1H B;  1HX8 A;  1FMV A;  2MYS A;  2IUB A;  1MNE A;  3P4R A;  1W0B A;  3RHW A;  3AEG A;  4O4I E;  3GN5 B;  3QC9 A;  3FBZ A;  4TWD A;  5LG4 A;  3TLS A;  4EYU A;  4O4H E;  3ZYK A;  3ETU A;  2NTX A;  2MOZ A;  2B76 A;  2XAH B;  5C8Y E;  2J62 A;  2WP9 A;  1T98 A;  2V6X A;  2MTQ A;  3IA3 A;  2JIW A;  1I94 T;  4IE7 A;  5ADX L;  4IE6 A;  3ZYL A;  2X51 A;  4PFO A;  4DR3 T;  2XM2 A;  3CIR A;  4EZ4 A;  5L3D B;  5AQN B;  3T1H T;  1ZP0 A;  2WMN A;  3AXJ A;  3ZC0 A;  4UF0 A;  2YK0 A;  3JC6 C;  4B3R T;  5AQL B;  5DJQ C;  5AQT B;  4FJO A;  3P7I A;  1NEK A;  2BKP A;  2VKJ A;  3AA7 B;  5HEJ A;  3AAI A;  4NXN T;  5JTG A;  4PW8 A;  3PUQ A;  2OV9 A;  5EK2 A;  4EEB A;  4H9O C;  3Q5D A;  3B13 A;  3ESL A;  4KI0 F;  2LM9 A;  2ODU A;  3O9X A;  2QVA A;  4P0B A;  2K5B B;  3UQ4 A;  2ACZ A;  2HH7 A;  5HXS A;  4QWN B;  1YQ3 A;  5FVK A;  2CEA A;  3GWH A;  2CXF A;  1O3X A;  4JI0 T;  4QH4 A;  1LVK A;  5KMG P;  5F8P A;  4DV7 T;  2YIN A;  5JR9 C;  2H89 A;  3ZKR A;  3ZEF B;  5AQO B;  3UUL A;  1MMG A;  3AE2 A;  5FXW A;  1I6Z A;  2BS2 A;  5LOV E;  3GN5 A;  2DNX A;  2LOS A;  4OFZ A;  4JI7 T;  4K0U A;  2JRK A;  1FIO A;  3RRC A;  3ZJ1 A;  2CLY B;  5AQQ B;  3L39 A;  5CA0 E;  1Y64 B;  5AQI B;  3N9M A;  5HYA A;  4PJJ A;  2WS3 A;  1WRD A;  3KV6 A;  4O2A E;  4DV0 T;  2LEH A;  1XMQ T;  2V7L A;  1MMN A;  2KWI B;  4TV9 E;  4J2C A;  1BR1 A;  3OJA A;  4U7I A;  4DR4 T;  3A8Y C;  4QX7 B;  3RIU A;  4UV9 B;  3AE4 A;  1FMW A;  4I50 E;  1SHZ C;  2JQQ A;  4MFR A;  3N9Q A;  2ZM0 A;  2YEV C;  3UU5 A;  4ZI3 D;  3X1D A;  3P8C D;  2M6B A;  2JPF A;  4B6X A;  4GK5 E;  2ZMA A;  4L0R A;  2MAW A;  3DTO A;  2CPT A;  4E7Z A;  5JDN A;  3UU8 A;  2VAS A;  1Z0P A;  2N1G A;  4HEA A;  5FXV A;  4F8H A;  1L0V A;  3MK7 C;  3NRY A;  4HWI B;  3OBV E;  2CM0 A;  3KV4 A;  4HN9 A;  2H7V C;  2PG8 A;  1YW0 A;  2R6G F;  3QUJ A;  1JNZ A;  4AI6 A;  5DQV A;  2L9Q A;  3LJC A;  1VRB A;  4DMW A;  3ZMS B;  1XWM A;  4U74 A;  4H9N C;  1MND A;  3HKB E;  5LBQ B;  2XZE A;  5AQG B;  3RF1 A;  4JLE A;  4X1K E;  1XNQ T;  3P50 A;  2NW7 A;  2HPJ A;  4KHP T;  2FJA A;  4HWC A;  3CQX C;  3I0O A;  3MZK B;  3Q5W A;  2J1D G;  1XNR T;  3TKL B;  2ACX A;  4GYR A;  5CFB A;  2PBI A;  3RC8 A;  3ONJ A;  4ANJ A;  4PFP A;  3KV5 A;  2BZB A;  3EVY A;  3MA9 A;  4HFE A;  2J4G A;  1QSD A;  2Z6E A;  2V26 A;  1R8I A;  5J2T E;  2A2F X;  1HTJ F;  1T72 A;  3OYZ A;  3PUR A;  4IDQ A;  2Q9Q D;  4U31 A;  4DV3 T;  1WYC A;  3OPC A;  4AKI A;  3O1H A;  4EZH A;  2L3L A;  1N33 T;  3KV9 A;  3HKE E;  3E0Z A;  3RYI E;  2XAF B;  4KUM B;  3UUB A;  3PE0 A;  4JYA T;  5BR8 T;  3N2K E;  1N36 T;  5LB7 B;  3HI2 A;  4NPP A;  3K3N A;  3AEF A;  3RLF F;  1BR0 A;  4WW0 A;  3B57 A;  4FI5 A;  4TZ4 C;  2N2N A;  2D2S A;  2I59 A;  2BS3 A;  2QA7 A;  5LNK A;  3DJB A;  3AA0 B;  3AAA B;  4JEH B;  3OYX A;  2K24 A;  4JBW F;  2K3W A;  5ABH A;  2XTL A;  4LF9 T;  1VCT A;  2W0G A;  2W66 A;  1WYB A;  4XZC A;  4LMK A;  2VUR A;  4DR1 T;  3AEC A;  2LOP A;  3O1J A;  4G63 A;  3TLW A;  4QX8 B;  4ERR A;  5FP3 A;  4TWF A;  2IHR 1;  3EDV A;  2CRB A;  3Q5E A;  3MKD A;  3L09 A;  2LKG A;  3UU6 A;  1HCI A;  5AQS B;  2LHN A;  3VKG A;  2VWA A;  1HG5 A;  3A5X A;  1MIV A;  3T8O A;  3CX6 B;  2D0U A;  3KIN B;  3NVO A;  4A5X A;  2CWO A;  3ZT6 A;  3ZN1 B;  3H37 A;  3FXE B;  3TLU A;  4I55 E;  2XQ3 A;  1WLX A;  4O2B E;  4CI1 B;  3EAB A;  4P0A A;  5HWY A;  3N9L A;  3ZLI A;  5HCJ A;  2V7K A;  3ZT5 A;  3CKD A;  3EI0 A;  2XY8 B;  5FL0 A;  4V1A v;  3QB5 K;  1IBM T;  4IE4 A;  5CGM A;  2NP9 A;  2EHO D;  2KZ7 B;  3CX8 B;  2FJB A;  3NKZ A;  3KVB A;  3PUW F;  3F2E A;  4DND A;  2V7I A;  4DMV A;  4BA9 A;  2LSJ A;  4BJM A;  4IHJ E;  3AEA A;  2BDE A;  2Y8D A;  1YQ4 A;  2HN2 A;  2W4X A;  5J1G A;  1SA0 E;  3EDU A;  3RIU C;  2ZM6 T;  3HKD E;  3SFE A;  3ZST A;  1D1C A;  4ZS3 A;  2BKN A;  2BBJ A;  5LMU T;  2M6I A;  3FHN A;  2DCF A;  4DBQ A;  4LF5 T;  2QGS A;  1KK7 A;  4TX5 A;  2IAK A;  4CN4 A;  1US7 B;  4IDN A;  4EV6 A;  4EB6 E;  3V5S A;  1UCU A;  3RQU A;  1IJ6 A;  3N9N A;  5FXX A;  2LSY A;  3VRA A;  3R84 B;  3RRW A;  5LHI B;  2V7J A;  5ETW A;  2XQ6 A;  4AQG A;  1UX4 A;  5H6Q B;  2DWG A;  3ZJ2 A;  3PDY A;  1QUU A;  2QRX A;  4NUU A;  2VQF T;  2BKO A;  4QXC B;  3C4X A;  4HE8 A;  3V5U A;  4IL4 A;  4UIG A;  1BR2 A;  3UT5 E;  3IF8 B;  3JAF A;  4ZZB A;  2CMR A;  3AE9 A;  4YFS A;  3P4P A;  3PUZ F;  1XDO A;  3AE6 A;  4CI3 B;  1N34 T;  2CLY C;  2ODV A;  2AXD S;  1Z8U A;  1ZEE A;  3N5L A;  3ZPO A;  5FKY A;  3F57 A;  1UK5 A;  5IHY A;  3FZL B;  3C98 B;  1X9B A;  4H9Q C;  3CWZ B;  2X9Y A;  4LF6 T;  5AQK B;  2BVM A;  3SWH A;  5L3B B;  3M3Z B;  3RPU A;  2LM2 A;  3RI5 A;  2XQ5 A;  1LRZ A;  5CA1 E;  3ZC1 A;  2UXB T;  5JDL A;  3IEE A;  2VL0 A;  3NWI A;  5LG3 A;  3QNU A;  5H6R B;  4KBM B;  4U33 A;  2W2U A;  3L8R A;  2XAS B;  3AE8 A;  3QK6 A;  2WCA A;  2UXC T;  5FXZ A;  2YU1 A;  3RYC E;  5HEO A;  2B1E A;  2NR4 A;  2VKO A;  4HFD A;  1CHU A;  1KFY A;  4OHF A;  4Z91 A;  3PU3 A;  4GKK T;  2XHE B;  4CZZ B;  4H9S E;  5IWA T;  4ILA A;  5HAX A;  5LCY A;  3I1A A;  3UU4 A;  4M1P A;  4LFA T;  4OK0 A;  5CJ5 A;  5LGN B;  2YKS A;  2LRL A;  1UUR A;  3VKH A;  3WAK A;  4AKL A;  3AEB A;  4QH5 A;  2NW8 A;  3AE5 A;  4AQF C;  4ZI2 C;  4CXX A;  5KX5 E;  4O4L E;  5TAO A;  2WAU A;  4TV8 E;  4N78 D;  2ZM8 A;  2K9A A;  4AKH A;  3E08 A;  3B5M A;  2L8K A;  5LP6 E;  2JQK A;  1WR6 A;  1HS7 A;  2XJ7 A;  5L4E A;  3UUX B;  1UX5 A;  3FBL A;  3MAC A;  2MPK A;  3SS1 A;  2MBG A;  2K48 A;  3RKO A;  2UUA T;  1OWA A;  1D0Z A;  4NIQ A;  4UR9 A;  2JMH A;  4HFV A;  4JI5 T;  2WU2 A;  3Q5X A;  4CQI A;  2X9X A;  4JV5 T;  2E8I A;  5JH7 E;  2J47 A;  5LGT B;  4U3C A;  3PTR B;  1XDP A;  1J5W A;  2UU9 T;  4YJ2 E;  4K0K T;  1UUS A;  5ABF B;  4YJ3 E;  3O4X E;  1WFD A;  3LSV A;  2LJL A;  2C5J A;  4ISS A;  3LK3 B;  1XMO T;  3N2O A;  3PUX F;  1IBK T;  4C91 A;  2VK9 A;  3BK9 A;  2CE7 A;  4KX6 A;  3J7Y q; 
#chains in the Genus database with same CATH homology
 2AXD S;  1DU2 A;  2IDO B;  2XY8 B;  1SE7 A;  2AE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...