2XY8B

Paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
QTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III SUBUNIT EPSILON
publication title Protein-Protein Haddocking Using Exclusively Pseudocontact Shifts.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 19
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2xy8B00
2XY8B 2AE9A 1SE7A 2AXDS 2IDOB 1DU2A
chains in the Genus database with same CATH superfamily
4XAXB 3E22E 1WCRA 2V6YB 4ZOLE 2PTFA 5AQQB 2QYWA 4IT4A 4GYRA 3LK3B 5L3FB 3U78A 2IIUA 3PUGA 5EZYE 1U5PA 4IL9A 2CHNA 2BBHA 2A3DA 2V7JA 4A56A 1OXZA 2KZ7B 2XAJB 2CLYC 3N9LA 2RP4A 3IHRA 4NUVA 1HNXT 4CN1A 4TX5A 2FUPA 3JCFA 4HWDA 4QX7B 4GKJT 2WMOA 3OYXA 3FXDB 3PURA 4IE5A 4TZ4C 3M65A 5ABFB 1IAPA 3RQWA 4WBOA 2L8KA 2HHHT 3SOLA 3JAFA 2V8SV 4KBMB 3O4XE 5C8YE 4DO0A 2XJ7A 4UELA 2ES0A 4JI8T 4YHJA 2B1EA 4DR4T 2E2AA 3HI2A 2WDQA 1NENA 4AISA 2CEAA 5FNVE 2V7MA 2YDRA 4O2BE 2YDSA 1HNWT 2C5JA 4HE8A 4YSZA 1MNEA 3L8RA 4ZEYA 3HA4A 3LBXB 2WU2A 3PU3A 4JI4T 2EHOB 3ZT6A 2UXDT 1IBMT 4WW0A 2LSYA 2E5VA 4AQGA 3AVSA 4QH4A 4EOZB 3RYIE 2BS3A 2C5IT 5JDNA 2A9UA 5ABHA 1R8IA 4KUMB 2D9DA 2XPKA 4E7ZA 1S35A 3EDVA 4H63H 5LJMA 4HFVA 2XSBA 5HYAA 1WYBA 3EUHA 1UUSA 3VKGA 4DUYT 4MLKA 4X5TA 2BS4A 4KHZF 3A7MA 2BS2A 4IGUA 4PJMA 4HGAA 2E9XC 2YU2A 3N9OA 3IEEA 4I4TE 4CXYA 4YHHT 3V5UA 1W9RA 5LMNT 2FJAA 4I43B 1CUNA 4V1Av 5JVDE 4O4IE 5HCMA 2WMNA 2MPKA 4I0UA 4PFPA 4ILBA 1UCUA 5BR8T 2M67A 3ANWA 1XMQT 3KBUA 4HFHA 3RX6A 4QH5A 2W62A 2R6GF 5F8PA 1LVFA 1UURA 2XHEB 2UUAT 3UU5A 2CXFA 3FZKB 1ZEEA 2IAKA 4U2ZA 3SFEA 5HEGA 2DWGA 4O8SA 4HWCA 4L5GA 2Q9QC 3CX6B 3AVRA 4I55E 3UUNA 2X68A 2MOZA 2NW9A 3AXJB 1G8XA 5AQUB 3N9NA 3P7IA 4YFSA 4B3ST 2LE8A 3GN5B 4H63V 4ASKA 3LDQB 4EV6A 3B5MA 3RYFE 4DR1T 1MNDA 3TLUA 1VRBA 3NZPA 5F3JA 3ZCIA 2WB5A 3ZYMA 2MAWA 2KMFA 3HR0A 1ZKEA 3ONXA 4IL4A 3C4ZA 4HTEA 5CA0E 4E7SA 3QNUA 4DR7T 4BA9A 4DV7T 1S94A 5L47A 4JEHB 3O1IA 3J7Yq 4AKHA 3C50A 5JDHA 3C4WA 2UXXB 4LFAT 1N32T 3RH3A 2ACZA 4P0BA 3ABVA 3FBZA 4JBWF 2CE7A 1YXRA 2XQAA 3K3OA 2IC9A 2W0GA 3UFGA 3OTOT 1V9DA 2CPTA 3UT5E 3RRWA 3UQ4A 1U4QA 3GA8A 4CI1B 1AJ3A 4GIWA 2Q9QD 3RIFA 2JMKA 4HWFA 2FBWA 2LHNA 2YK0A 5ETWA 4ZZBA 4ZS3A 4YY3T 2MTQA 1KEYA 1KNZA 4UV8B 1Y64B 1E7PA 1MMAA 1UX4A 4X1KE 3UUMA 3ZJ2A 2YKSA 2WM9A 3O1HA 2GK9A 5ABFA 5IWAT 1HCIA 4CQIA 4MBQA 2D0TA 2W66A 3PDYA 4YTPA 4JI3T 4COFA 3QUJA 2YEVC 1UK5A 4JI2T 2NW8A 2BG9E 4FI5A 2OLTA 5CFBA 3CX8B 2CM0A 4UVBB 5AQGB 2V26A 1HFAA 2VL8A 4HN9A 2WWVA 1N33T 3WAJA 3ANWB 1YQ3A 2KSRA 3AE5A 3AB3B 4Z91A 4YSYA 1D0YA 2X0LB 1VCTA 2H88A 3I9WA 3VU7H 2XM1A 4U7IA 1KNRA 2IC6A 4LMKA 3TLWA 3T1YT 3O1JA 2W00A 3G06A 3CPZA 4UVCB 4ZI3C 4G2AA 2VKOA 1HR0T 4UIGA 1D0XA 5IYZE 2WU5A 4UF0A 5L3DB 1ZOYA 3O9XA 3ZMSB 2W67A 4U2YA 1IJ6A 2RA1A 4H9QC 3AEFA 3AEBA 2DI4A 4HWIB 2K5BB 1N34T 1T72A 3JADA 2VK9A 1HF8A 3K8PC 4DVDA 1MIVA 4YXDA 2FJDA 2X0YA 1BR0A 4KP3C 5JR9C 4JI1T 3AEAA 3ESLA 1W0AA 3DP7A 4IREA 2JPFA 4AKGA 2ZLYA 3GWHA 2F4VT 4PFOA 2W2UA 4IDZA 2Q9QB 5AQRB 3RHWA 3C98B 3WAKA 2E8IA 3DTOA 3R84B 1OEDA 2JQKA 4DBQA 3RIAA 4X66T 3ZSTA 3JC6C 2BKOA 5IUXA 1WRDA 3QK6A 4O4HE 3B57A 3LJCA 4A97A 4EEBA 5GONE 4KI0F 3PTRB 1B7TA 4UVAB 2NOXA 5L2LA 4DV2T 1VCSA 3AXJA 2JRKA 3CQGB 3LSVA 2UXBT 3EABA 3GN5A 4TWHA 5AQFB 5FKYA 5HWYA 4U31A 4DMWA 4YTNA 2AE9A 1SE7A 4QXBB 3VKHA 4CXXA 2V7KA 5LCYA 2V1DB 5JQGE 5AQOB 2HPLA 1H7CA 4DR3T 3ZMZB 2B76A 2VKDA 4TUYE 2CCQA 3AEDA 4ZHQE 3N9MA 4CXWA 4ZI2C 4TNVA 3UUBA 3B13A 2XQ9A 4WYVA 2DLRA 3FZFB 2V7IA 4JYAT 3KBTA 2C0SA 3P4PA 3MKDA 5L4HA 1E2AA 2WSSV 4ZXLA 1FMWA 5FVLA 5M4YA 2JQ9A 2NP9A 4TV9E 3RGLA 4X1YE 5L3EB 5J2UE 3C51A 5JRCA 1D1CA 2BDEA 2CA5A 2KT9A 3ZEFB 5AQKB 2CWOA 2WAUA 4OK0A 2BG9C 5KX5E 3KVAA 3PV0F 3OJAA 3PJAJ 3CIRA 5AQJB 2JJ9A 3CQXC 3UFEA 1YW0A 2MBGA 2C5KT 3NWIA 3K3NA 3HKEE 4UF0B 4O2AE 1D1AA 4O4LE 1MMDA 3Q5WA 3EAMA 4H9SE 3AE1A 1XNQT 1E1HB 3KDSE 3DJBA 1ZP0A 2AXDS 3HKDE 3OYZA 2HH7A 3OKQA 1NAFA 2OA5A 2A72A 2VWAA 3BK9A 3KVBA 5DQVA 5ADXL 3RC8A 1XNRT 5FXZA 4KHPT 4WBNE 2X67A 4ZI2D 2HN1A 2LJLA 5KDMC 2LEHA 3RIUC 4PW8A 4B6XA 2ZMAA 3SFDA 3MJXA 5JDLA 2WP9A 5LBMA 3BQIA 3CK6A 5FXWA 5J0ZA 3NRYA 1OEDB 5KMGP 4IDNA 5JDQA 5BMVE 5LA6E 3CWZB 4H9NC 2QVAA 3CX7B 4EIWA 3ZN0B 5C2TA 1YD8G 2IMLA 4JEUB 3W15B 2D2SA 2PG8A 1YKHB 4B3MT 1IJ5A 2E9XA 3MK7C 2W4XA 4K0KT 3AAIA 3RLFF 2VQET 5HCJA 3P4RA 3RI5A 5JR9B 3RQUA 4ANJA 3RC3A 4PAGA 2CHOA 3FXEB 3L39A 2X51A 1LRZA 5J1GA 4YJ2E 5CGMA 4EYUA 4OYJA 2E9XD 3FZMB 2IDOB 2DL1A 3BQLA 2N2NA 4UEMA 3E08A 3EDUA 5F5WA 1J5WA 2KNDA 4A98A 2K3WA 3ETUA 3KV5A 2V7LA 2LSGA 2XM2A 1X9BA 2D0UA 4PK4A 4LFBT 2VKJA 4EYYR 4U7YA 1FMVA 5E0OA 5JTGA 2CWYA 4Q25A 1G73A 3U3IA 3N2KE 3KINB 3I9YA 2CRBA 2XAHB 2DWKA 3KV6A 4U72A 2X9HA 2WQYA 3AE6A 4P0AA 4U74A 4YLHA 4CI3B 1T8BA 2NTYA 3Q5DA 2CLYB 4CZZB 2Q9QA 5FL0A 3MA9A 4CI2B 1HNZT 5JRCB 1CHUA 4YJ3E 4HFBA 2MYSA 4PJJA 3PUYF 3ZKRA 3PUWF 2LSIA 4TWFA 3UU3A 2BZBA 5FMNA 5FP3A 4AQFC 2WCAA 2LSKA 1IBLT 1QLBA 3WI3A 4ZI7E 5AQPB 3H3AA 2N9DA 2XUEA 1LVKA 5LMUT 2XQ8A 3HL6A 3Q2MA 3K3QC 3ZPOA 2LOPA 3ZMTB 4ZZCA 5ABGA 4NXMT 1SHZC 4X64T 1WYCA 3VRAA 5HXEA 3HKCE 3LK2B 2EHOC 1M7KA 4Z8XA 2K48A 3S4UA 3FZHB 2XAFB 1MIYA 5KXJA 1SA0E 1HX1B 3TLTA 2KWHA 2WZIA 5EK3A 3I0OA 4PNIA 5LB7B 2JQHA 2BVLA 3ETVA 4X62T 2NW7A 3X1DA 1WR6A 4K0UA 4YTMA 5CA1E 2X66A 5HAXA 1Y01A 3ZMUB 1YQ4A 3UULA 5TAOA 5LGTB 4ISTA 5AFUL 3ZSSA 3MXZA 2UUCT 4LF5T 2W63A 1FJGT 4CN6A 4AQFA 2Y48B 5HWXA 4PK5A 2XQ7A 2XAGB 2XQ4A 3PU8A 4EEDA 2ZM6T 2HN2A 2BKNA 3C4XA 2I6HA 4QKNA 4U33A 2WZHA 2YDQA 2HPJA 1O3XA 1D0ZA 4IDOA 2WDVA 4F6RC 4OFZA 3C64A 2E9XB 1SUMB 2J4GA 2WS3A 3T8OA 5HEOA 4LMLA 4DMVA 4H9RC 3LG7A 2I59A 5DQWA 2PJQA 2DHRA 1KF6A 3UTKA 4OX9T 3N9PA 3PUZF 4AKLA 4TV8E 5AQHB 5LNKA 5CB4E 1BR4A 5AQNB 4QH1A 3OVUA 4H9OC 4GK5E 5FXVA 4AQYT 2BVMA 2JIWA 2CXLA 3UU6A 2OV9A 2YN6A 3H37A 4HEAA 4MFRA 2KWIB 4NIQA 2LM9A 2RPAA 4ADZA 2XASB 2J47A 4M1PA 1N36T 3SWHA 5LBQB 2N1GA 4ERRA 2G0UA 3A5XA 4Z90A 2KINB 4QXHB 2M6BA 3PUXF 1Z8UA 3NKZA 2QRXA 2VVNA 1FIOA 2ACXA 3RKGA 3J9X1 4ZI3D 2LSJA 5LXTE 2VKHA 3AE2A 2JMHA 4TWDA 3KV4A 1GQEA 2LT3A 1X79A 3MACA 5AQMB 2CXDA 3AAEB 2WY2A 4EXTA 1NWMX 5LHHB 4FJOA 3PUQA 3AE4A 4QX8B 2IW5B 2PBIA 1NEKA 4DR5T 3L09A 2UUBT 3ZT7A 3FHNA 5JR9A 4BJNA 1HX8A 4OHFA 1IBKT 1WR0A 5LHGB 4O4JE 3CKDA 2VB6A 4JI0T 1US7B 2LM2A 4DR6T 2VQFT 4ILAA 4UV9B 3NZQA 5HEJA 5AQSB 3Q9DA 3FBLA 4JI5T 4AIUA 1L0VA 4MALA 3TLVA 2QA7A 4F8HA 2L9QA 3ZMVB 2CBIA 2PFVA 3CQCB 2XTLA 2CMRA 2ZM0A 1W09A 3EVYA 1XDOA 3SS1A 3P50A 5IHYA 4NPPA 5H6RB 2ODVA 4YT0A 2FJBA 1HG5A 4JLEA 3VR9A 4G63A 2LOSA 3KFWX 5JREA 3IBPA 5FYMA 3JC6D 1W0BA 3PJAA 2YOEA 5EK4A 3PUSA 3AEGA 2CBJA 4X65T 2DCFA 5JDFA 1XMOT 4B3TT 2VVSA 3OBVE 5HXHA 2V5DA 4MHCA 1UGOA 3HKBE 5LG4A 2KXPB 4DNDA 5AQTB 5JDGA 1KFYA 4WZXA 4N78D 4NXNT 4JI6T 1OWAA 2FJEA 3JAEA 4L9IA 3AA6B 2H7OA 1HS7A 2BBJA 2P9BA 4LF8T 2VL0A 4DV6T 3RKOA 1MIWA 5HEHA 3VHLA 2J1DG 3AE3A 4DV5T 1MMNA 5C3JA 3AE7A 3RYCE 1J5ET 4IIJE 1XDPA 5LOVE 5J2TE 1M62A 4GK0E 2LKHA 3QOFA 2BG9A 1T7SA 4XZCA 2V6XA 3F57A 3AA1B 3P4QA 4DV1T 4OYKA 5HXCA 4QXCB 5LJNA 4HFIA 4GYSA 1J1JA 1OEDE 2L3LA 4CN4A 3LFMA 2LRKA 3P4SA 3FZLB 5AQLB 3N5LA 3VR8A 1FEWA 1VOMA 2X9YA 3I0QA 3UQ7A 4UXNB 5L3GB 4JV5T 3ZCJA 4LMJA 1HG2A 3D0TA 2LLYA 2WDRA 3V5SA 4LF4T 3QC9A 2A2FX 2VASA 2XQ5A 4HWHA 1ZHCA 2ODUA 3NRXA 2YU1A 1QUUA 2IHR1 3VRBA 4JUYA 2SPCA 3RF1A 5FL1A 4ZS2A 1D1BA 4EGWA 5JDMA 5JH7E 2ZM2A 4IE7A 5DJQC 3RIUA 1UX5A 4AKIA 1WFDA 2KLQA 5FXXA 1DU2A 2BKPA 3ZC1A 5LYJE 3FB2A 3F31A 3E0ZA 2XQYA 4P1NA 2E5LT 4WNKA 3H3MA 3ZYKA 4QWNB 4EAHA 3CMLA 4IE0A 5L4EA 4ISSA 3F2EA 4H9PC 3AEEA 4IHJE 4IDPA 5L3BB 2IUBA 2XAQB 5DABA 5LG3A 2DNXA 3P8CD 2K9AA 4L0RA 3BQKA 3N2OA 1EZ3A 2QGSA 5H6QB 2Z6EA 1MMGA 1JNZA 4A5XA 3P4WA 4EB6E 4TN7B 3ZT5A 3L3PA 2V6YA 4GOUA 1XWMA 2NR4A 3IA3A 3PUAA 2K24A 3AA7B 4DIDB 4EZHA 4ILCA 4DUZT 3ONLC 3N9QA 4JI7T 3AECA 5LP6E 3LK42 4HFEA 4LFCT 4BJMA 2JQQA 2D5UA 4I50E 4LF6T 4C90A 3ZLIA 4AXPA 4X20E 4IE4A 2W61A 4PJLA 3OPCA 3GMIA 1I6ZA 4UR9A 5FVKA 4HFCA 1YKEB 4LF7T 4XBFB 2XSAA 3NVOA 2V5CA 2VURA 2XQ3A 2Y6XA 1Z0PA 3N2GE 4DV4T 3AA0B 4PJNA 5HXSA 5LGNB 4HFDA 2YINA 3QB5K 3Q5XA 2J62A 3CVRA 1BR2A 4PK6A 3TKLB 3RPUA 2H7VC 2NWBA 3NBXX 1KNPA 1LKXA 3TLSA 3EI0A 4QHOA 2BG9B 3EHZA 3PUVF 4ILUA 3UU8A 4EZ4A 3AE9A 5EK2A 1XZYA 2H3RA 3Q5EA 4TNWA 3UU4A 4P09A 4DV3T 4IE6A 1ZV4X 4AI6A 3I1AA 5FY0A 1QSDA 4IDQA 4U3CA 3ZYLA 3LBXA 5CJ5A 2EHOA 4DR2T 2LHRA 2M6IA 1HTJF 2I0MA 2ZM8A 5LHIB 2XY8B 2UXNB 2XZEA 2UU9T 1I94T 3ZC0A 4DV0T 5HEUA 3K1SA 4AKRB 2WBLA 5LGUB 1OEDC 1BR1A 4KMCA 3PE0A 4NUUA 2EHOD 2WWUA 3RRCA 4B3RT 5FY7A 2LRLA 1KK7A 3A8YC 1T98A 3AE8A 2Y8DA 5L3CB 4BAYB 3UUXB 4HKAA 3QB5A 1WLXA 2NTXA 4J2CA 5A1LA 3M3ZB 2X9WA 4LF9T 4DBRA 1IZNB 2H89A 2X9XA 4KX6A 3ONJA 3RYHE 5FY1A 5AQVB 3ZN1B 5ABEA 3SRZA 2X0HA 4GKKT 4YSXA 1JNRA 3MZKB 3AAAB 3IF8B 4X1IE 4C91A 2UXCT 3ZJ1A 3R6NA 2XQ6A 5HXRA 2LKGA 5AQIB 3KV9A 3T1HT
chains in the Genus database with same CATH topology
2XY8B 2AE9A 1SE7A 2AXDS 2IDOB 1DU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XY8 B;  2AE9 A;  1SE7 A;  2AXD S;  2IDO B;  1DU2 A; 
#chains in the Genus database with same CATH topology
 4XAX B;  3E22 E;  1WCR A;  2V6Y B;  4ZOL E;  2PTF A;  5AQQ B;  2QYW A;  4IT4 A;  4GYR A;  3LK3 B;  5L3F B;  3U78 A;  2IIU A;  3PUG A;  5EZY E;  1U5P A;  4IL9 A;  2CHN A;  2BBH A;  2A3D A;  2V7J A;  4A56 A;  1OXZ A;  2KZ7 B;  2XAJ B;  2CLY C;  3N9L A;  2RP4 A;  3IHR A;  4NUV A;  1HNX T;  4CN1 A;  4TX5 A;  2FUP A;  3JCF A;  4HWD A;  4QX7 B;  4GKJ T;  2WMO A;  3OYX A;  3FXD B;  3PUR A;  4IE5 A;  4TZ4 C;  3M65 A;  5ABF B;  1IAP A;  3RQW A;  4WBO A;  2L8K A;  2HHH T;  3SOL A;  3JAF A;  2V8S V;  4KBM B;  3O4X E;  5C8Y E;  4DO0 A;  2XJ7 A;  4UEL A;  2ES0 A;  4JI8 T;  4YHJ A;  2B1E A;  4DR4 T;  2E2A A;  3HI2 A;  2WDQ A;  1NEN A;  4AIS A;  2CEA A;  5FNV E;  2V7M A;  2YDR A;  4O2B E;  2YDS A;  1HNW T;  2C5J A;  4HE8 A;  4YSZ A;  1MNE A;  3L8R A;  4ZEY A;  3HA4 A;  3LBX B;  2WU2 A;  3PU3 A;  4JI4 T;  2EHO B;  3ZT6 A;  2UXD T;  1IBM T;  4WW0 A;  2LSY A;  2E5V A;  4AQG A;  3AVS A;  4QH4 A;  4EOZ B;  3RYI E;  2BS3 A;  2C5I T;  5JDN A;  2A9U A;  5ABH A;  1R8I A;  4KUM B;  2D9D A;  2XPK A;  4E7Z A;  1S35 A;  3EDV A;  4H63 H;  5LJM A;  4HFV A;  2XSB A;  5HYA A;  1WYB A;  3EUH A;  1UUS A;  3VKG A;  4DUY T;  4MLK A;  4X5T A;  2BS4 A;  4KHZ F;  3A7M A;  2BS2 A;  4IGU A;  4PJM A;  4HGA A;  2E9X C;  2YU2 A;  3N9O A;  3IEE A;  4I4T E;  4CXY A;  4YHH T;  3V5U A;  1W9R A;  5LMN T;  2FJA A;  4I43 B;  1CUN A;  4V1A v;  5JVD E;  4O4I E;  5HCM A;  2WMN A;  2MPK A;  4I0U A;  4PFP A;  4ILB A;  1UCU A;  5BR8 T;  2M67 A;  3ANW A;  1XMQ T;  3KBU A;  4HFH A;  3RX6 A;  4QH5 A;  2W62 A;  2R6G F;  5F8P A;  1LVF A;  1UUR A;  2XHE B;  2UUA T;  3UU5 A;  2CXF A;  3FZK B;  1ZEE A;  2IAK A;  4U2Z A;  3SFE A;  5HEG A;  2DWG A;  4O8S A;  4HWC A;  4L5G A;  2Q9Q C;  3CX6 B;  3AVR A;  4I55 E;  3UUN A;  2X68 A;  2MOZ A;  2NW9 A;  3AXJ B;  1G8X A;  5AQU B;  3N9N A;  3P7I A;  4YFS A;  4B3S T;  2LE8 A;  3GN5 B;  4H63 V;  4ASK A;  3LDQ B;  4EV6 A;  3B5M A;  3RYF E;  4DR1 T;  1MND A;  3TLU A;  1VRB A;  3NZP A;  5F3J A;  3ZCI A;  2WB5 A;  3ZYM A;  2MAW A;  2KMF A;  3HR0 A;  1ZKE A;  3ONX A;  4IL4 A;  3C4Z A;  4HTE A;  5CA0 E;  4E7S A;  3QNU A;  4DR7 T;  4BA9 A;  4DV7 T;  1S94 A;  5L47 A;  4JEH B;  3O1I A;  3J7Y q;  4AKH A;  3C50 A;  5JDH A;  3C4W A;  2UXX B;  4LFA T;  1N32 T;  3RH3 A;  2ACZ A;  4P0B A;  3ABV A;  3FBZ A;  4JBW F;  2CE7 A;  1YXR A;  2XQA A;  3K3O A;  2IC9 A;  2W0G A;  3UFG A;  3OTO T;  1V9D A;  2CPT A;  3UT5 E;  3RRW A;  3UQ4 A;  1U4Q A;  3GA8 A;  4CI1 B;  1AJ3 A;  4GIW A;  2Q9Q D;  3RIF A;  2JMK A;  4HWF A;  2FBW A;  2LHN A;  2YK0 A;  5ETW A;  4ZZB A;  4ZS3 A;  4YY3 T;  2MTQ A;  1KEY A;  1KNZ A;  4UV8 B;  1Y64 B;  1E7P A;  1MMA A;  1UX4 A;  4X1K E;  3UUM A;  3ZJ2 A;  2YKS A;  2WM9 A;  3O1H A;  2GK9 A;  5ABF A;  5IWA T;  1HCI A;  4CQI A;  4MBQ A;  2D0T A;  2W66 A;  3PDY A;  4YTP A;  4JI3 T;  4COF A;  3QUJ A;  2YEV C;  1UK5 A;  4JI2 T;  2NW8 A;  2BG9 E;  4FI5 A;  2OLT A;  5CFB A;  3CX8 B;  2CM0 A;  4UVB B;  5AQG B;  2V26 A;  1HFA A;  2VL8 A;  4HN9 A;  2WWV A;  1N33 T;  3WAJ A;  3ANW B;  1YQ3 A;  2KSR A;  3AE5 A;  3AB3 B;  4Z91 A;  4YSY A;  1D0Y A;  2X0L B;  1VCT A;  2H88 A;  3I9W A;  3VU7 H;  2XM1 A;  4U7I A;  1KNR A;  2IC6 A;  4LMK A;  3TLW A;  3T1Y T;  3O1J A;  2W00 A;  3G06 A;  3CPZ A;  4UVC B;  4ZI3 C;  4G2A A;  2VKO A;  1HR0 T;  4UIG A;  1D0X A;  5IYZ E;  2WU5 A;  4UF0 A;  5L3D B;  1ZOY A;  3O9X A;  3ZMS B;  2W67 A;  4U2Y A;  1IJ6 A;  2RA1 A;  4H9Q C;  3AEF A;  3AEB A;  2DI4 A;  4HWI B;  2K5B B;  1N34 T;  1T72 A;  3JAD A;  2VK9 A;  1HF8 A;  3K8P C;  4DVD A;  1MIV A;  4YXD A;  2FJD A;  2X0Y A;  1BR0 A;  4KP3 C;  5JR9 C;  4JI1 T;  3AEA A;  3ESL A;  1W0A A;  3DP7 A;  4IRE A;  2JPF A;  4AKG A;  2ZLY A;  3GWH A;  2F4V T;  4PFO A;  2W2U A;  4IDZ A;  2Q9Q B;  5AQR B;  3RHW A;  3C98 B;  3WAK A;  2E8I A;  3DTO A;  3R84 B;  1OED A;  2JQK A;  4DBQ A;  3RIA A;  4X66 T;  3ZST A;  3JC6 C;  2BKO A;  5IUX A;  1WRD A;  3QK6 A;  4O4H E;  3B57 A;  3LJC A;  4A97 A;  4EEB A;  5GON E;  4KI0 F;  3PTR B;  1B7T A;  4UVA B;  2NOX A;  5L2L A;  4DV2 T;  1VCS A;  3AXJ A;  2JRK A;  3CQG B;  3LSV A;  2UXB T;  3EAB A;  3GN5 A;  4TWH A;  5AQF B;  5FKY A;  5HWY A;  4U31 A;  4DMW A;  4YTN A;  2AE9 A;  1SE7 A;  4QXB B;  3VKH A;  4CXX A;  2V7K A;  5LCY A;  2V1D B;  5JQG E;  5AQO B;  2HPL A;  1H7C A;  4DR3 T;  3ZMZ B;  2B76 A;  2VKD A;  4TUY E;  2CCQ A;  3AED A;  4ZHQ E;  3N9M A;  4CXW A;  4ZI2 C;  4TNV A;  3UUB A;  3B13 A;  2XQ9 A;  4WYV A;  2DLR A;  3FZF B;  2V7I A;  4JYA T;  3KBT A;  2C0S A;  3P4P A;  3MKD A;  5L4H A;  1E2A A;  2WSS V;  4ZXL A;  1FMW A;  5FVL A;  5M4Y A;  2JQ9 A;  2NP9 A;  4TV9 E;  3RGL A;  4X1Y E;  5L3E B;  5J2U E;  3C51 A;  5JRC A;  1D1C A;  2BDE A;  2CA5 A;  2KT9 A;  3ZEF B;  5AQK B;  2CWO A;  2WAU A;  4OK0 A;  2BG9 C;  5KX5 E;  3KVA A;  3PV0 F;  3OJA A;  3PJA J;  3CIR A;  5AQJ B;  2JJ9 A;  3CQX C;  3UFE A;  1YW0 A;  2MBG A;  2C5K T;  3NWI A;  3K3N A;  3HKE E;  4UF0 B;  4O2A E;  1D1A A;  4O4L E;  1MMD A;  3Q5W A;  3EAM A;  4H9S E;  3AE1 A;  1XNQ T;  1E1H B;  3KDS E;  3DJB A;  1ZP0 A;  2AXD S;  3HKD E;  3OYZ A;  2HH7 A;  3OKQ A;  1NAF A;  2OA5 A;  2A72 A;  2VWA A;  3BK9 A;  3KVB A;  5DQV A;  5ADX L;  3RC8 A;  1XNR T;  5FXZ A;  4KHP T;  4WBN E;  2X67 A;  4ZI2 D;  2HN1 A;  2LJL A;  5KDM C;  2LEH A;  3RIU C;  4PW8 A;  4B6X A;  2ZMA A;  3SFD A;  3MJX A;  5JDL A;  2WP9 A;  5LBM A;  3BQI A;  3CK6 A;  5FXW A;  5J0Z A;  3NRY A;  1OED B;  5KMG P;  4IDN A;  5JDQ A;  5BMV E;  5LA6 E;  3CWZ B;  4H9N C;  2QVA A;  3CX7 B;  4EIW A;  3ZN0 B;  5C2T A;  1YD8 G;  2IML A;  4JEU B;  3W15 B;  2D2S A;  2PG8 A;  1YKH B;  4B3M T;  1IJ5 A;  2E9X A;  3MK7 C;  2W4X A;  4K0K T;  3AAI A;  3RLF F;  2VQE T;  5HCJ A;  3P4R A;  3RI5 A;  5JR9 B;  3RQU A;  4ANJ A;  3RC3 A;  4PAG A;  2CHO A;  3FXE B;  3L39 A;  2X51 A;  1LRZ A;  5J1G A;  4YJ2 E;  5CGM A;  4EYU A;  4OYJ A;  2E9X D;  3FZM B;  2IDO B;  2DL1 A;  3BQL A;  2N2N A;  4UEM A;  3E08 A;  3EDU A;  5F5W A;  1J5W A;  2KND A;  4A98 A;  2K3W A;  3ETU A;  3KV5 A;  2V7L A;  2LSG A;  2XM2 A;  1X9B A;  2D0U A;  4PK4 A;  4LFB T;  2VKJ A;  4EYY R;  4U7Y A;  1FMV A;  5E0O A;  5JTG A;  2CWY A;  4Q25 A;  1G73 A;  3U3I A;  3N2K E;  3KIN B;  3I9Y A;  2CRB A;  2XAH B;  2DWK A;  3KV6 A;  4U72 A;  2X9H A;  2WQY A;  3AE6 A;  4P0A A;  4U74 A;  4YLH A;  4CI3 B;  1T8B A;  2NTY A;  3Q5D A;  2CLY B;  4CZZ B;  2Q9Q A;  5FL0 A;  3MA9 A;  4CI2 B;  1HNZ T;  5JRC B;  1CHU A;  4YJ3 E;  4HFB A;  2MYS A;  4PJJ A;  3PUY F;  3ZKR A;  3PUW F;  2LSI A;  4TWF A;  3UU3 A;  2BZB A;  5FMN A;  5FP3 A;  4AQF C;  2WCA A;  2LSK A;  1IBL T;  1QLB A;  3WI3 A;  4ZI7 E;  5AQP B;  3H3A A;  2N9D A;  2XUE A;  1LVK A;  5LMU T;  2XQ8 A;  3HL6 A;  3Q2M A;  3K3Q C;  3ZPO A;  2LOP A;  3ZMT B;  4ZZC A;  5ABG A;  4NXM T;  1SHZ C;  4X64 T;  1WYC A;  3VRA A;  5HXE A;  3HKC E;  3LK2 B;  2EHO C;  1M7K A;  4Z8X A;  2K48 A;  3S4U A;  3FZH B;  2XAF B;  1MIY A;  5KXJ A;  1SA0 E;  1HX1 B;  3TLT A;  2KWH A;  2WZI A;  5EK3 A;  3I0O A;  4PNI A;  5LB7 B;  2JQH A;  2BVL A;  3ETV A;  4X62 T;  2NW7 A;  3X1D A;  1WR6 A;  4K0U A;  4YTM A;  5CA1 E;  2X66 A;  5HAX A;  1Y01 A;  3ZMU B;  1YQ4 A;  3UUL A;  5TAO A;  5LGT B;  4IST A;  5AFU L;  3ZSS A;  3MXZ A;  2UUC T;  4LF5 T;  2W63 A;  1FJG T;  4CN6 A;  4AQF A;  2Y48 B;  5HWX A;  4PK5 A;  2XQ7 A;  2XAG B;  2XQ4 A;  3PU8 A;  4EED A;  2ZM6 T;  2HN2 A;  2BKN A;  3C4X A;  2I6H A;  4QKN A;  4U33 A;  2WZH A;  2YDQ A;  2HPJ A;  1O3X A;  1D0Z A;  4IDO A;  2WDV A;  4F6R C;  4OFZ A;  3C64 A;  2E9X B;  1SUM B;  2J4G A;  2WS3 A;  3T8O A;  5HEO A;  4LML A;  4DMV A;  4H9R C;  3LG7 A;  2I59 A;  5DQW A;  2PJQ A;  2DHR A;  1KF6 A;  3UTK A;  4OX9 T;  3N9P A;  3PUZ F;  4AKL A;  4TV8 E;  5AQH B;  5LNK A;  5CB4 E;  1BR4 A;  5AQN B;  4QH1 A;  3OVU A;  4H9O C;  4GK5 E;  5FXV A;  4AQY T;  2BVM A;  2JIW A;  2CXL A;  3UU6 A;  2OV9 A;  2YN6 A;  3H37 A;  4HEA A;  4MFR A;  2KWI B;  4NIQ A;  2LM9 A;  2RPA A;  4ADZ A;  2XAS B;  2J47 A;  4M1P A;  1N36 T;  3SWH A;  5LBQ B;  2N1G A;  4ERR A;  2G0U A;  3A5X A;  4Z90 A;  2KIN B;  4QXH B;  2M6B A;  3PUX F;  1Z8U A;  3NKZ A;  2QRX A;  2VVN A;  1FIO A;  2ACX A;  3RKG A;  3J9X 1;  4ZI3 D;  2LSJ A;  5LXT E;  2VKH A;  3AE2 A;  2JMH A;  4TWD A;  3KV4 A;  1GQE A;  2LT3 A;  1X79 A;  3MAC A;  5AQM B;  2CXD A;  3AAE B;  2WY2 A;  4EXT A;  1NWM X;  5LHH B;  4FJO A;  3PUQ A;  3AE4 A;  4QX8 B;  2IW5 B;  2PBI A;  1NEK A;  4DR5 T;  3L09 A;  2UUB T;  3ZT7 A;  3FHN A;  5JR9 A;  4BJN A;  1HX8 A;  4OHF A;  1IBK T;  1WR0 A;  5LHG B;  4O4J E;  3CKD A;  2VB6 A;  4JI0 T;  1US7 B;  2LM2 A;  4DR6 T;  2VQF T;  4ILA A;  4UV9 B;  3NZQ A;  5HEJ A;  5AQS B;  3Q9D A;  3FBL A;  4JI5 T;  4AIU A;  1L0V A;  4MAL A;  3TLV A;  2QA7 A;  4F8H A;  2L9Q A;  3ZMV B;  2CBI A;  2PFV A;  3CQC B;  2XTL A;  2CMR A;  2ZM0 A;  1W09 A;  3EVY A;  1XDO A;  3SS1 A;  3P50 A;  5IHY A;  4NPP A;  5H6R B;  2ODV A;  4YT0 A;  2FJB A;  1HG5 A;  4JLE A;  3VR9 A;  4G63 A;  2LOS A;  3KFW X;  5JRE A;  3IBP A;  5FYM A;  3JC6 D;  1W0B A;  3PJA A;  2YOE A;  5EK4 A;  3PUS A;  3AEG A;  2CBJ A;  4X65 T;  2DCF A;  5JDF A;  1XMO T;  4B3T T;  2VVS A;  3OBV E;  5HXH A;  2V5D A;  4MHC A;  1UGO A;  3HKB E;  5LG4 A;  2KXP B;  4DND A;  5AQT B;  5JDG A;  1KFY A;  4WZX A;  4N78 D;  4NXN T;  4JI6 T;  1OWA A;  2FJE A;  3JAE A;  4L9I A;  3AA6 B;  2H7O A;  1HS7 A;  2BBJ A;  2P9B A;  4LF8 T;  2VL0 A;  4DV6 T;  3RKO A;  1MIW A;  5HEH A;  3VHL A;  2J1D G;  3AE3 A;  4DV5 T;  1MMN A;  5C3J A;  3AE7 A;  3RYC E;  1J5E T;  4IIJ E;  1XDP A;  5LOV E;  5J2T E;  1M62 A;  4GK0 E;  2LKH A;  3QOF A;  2BG9 A;  1T7S A;  4XZC A;  2V6X A;  3F57 A;  3AA1 B;  3P4Q A;  4DV1 T;  4OYK A;  5HXC A;  4QXC B;  5LJN A;  4HFI A;  4GYS A;  1J1J A;  1OED E;  2L3L A;  4CN4 A;  3LFM A;  2LRK A;  3P4S A;  3FZL B;  5AQL B;  3N5L A;  3VR8 A;  1FEW A;  1VOM A;  2X9Y A;  3I0Q A;  3UQ7 A;  4UXN B;  5L3G B;  4JV5 T;  3ZCJ A;  4LMJ A;  1HG2 A;  3D0T A;  2LLY A;  2WDR A;  3V5S A;  4LF4 T;  3QC9 A;  2A2F X;  2VAS A;  2XQ5 A;  4HWH A;  1ZHC A;  2ODU A;  3NRX A;  2YU1 A;  1QUU A;  2IHR 1;  3VRB A;  4JUY A;  2SPC A;  3RF1 A;  5FL1 A;  4ZS2 A;  1D1B A;  4EGW A;  5JDM A;  5JH7 E;  2ZM2 A;  4IE7 A;  5DJQ C;  3RIU A;  1UX5 A;  4AKI A;  1WFD A;  2KLQ A;  5FXX A;  1DU2 A;  2BKP A;  3ZC1 A;  5LYJ E;  3FB2 A;  3F31 A;  3E0Z A;  2XQY A;  4P1N A;  2E5L T;  4WNK A;  3H3M A;  3ZYK A;  4QWN B;  4EAH A;  3CML A;  4IE0 A;  5L4E A;  4ISS A;  3F2E A;  4H9P C;  3AEE A;  4IHJ E;  4IDP A;  5L3B B;  2IUB A;  2XAQ B;  5DAB A;  5LG3 A;  2DNX A;  3P8C D;  2K9A A;  4L0R A;  3BQK A;  3N2O A;  1EZ3 A;  2QGS A;  5H6Q B;  2Z6E A;  1MMG A;  1JNZ A;  4A5X A;  3P4W A;  4EB6 E;  4TN7 B;  3ZT5 A;  3L3P A;  2V6Y A;  4GOU A;  1XWM A;  2NR4 A;  3IA3 A;  3PUA A;  2K24 A;  3AA7 B;  4DID B;  4EZH A;  4ILC A;  4DUZ T;  3ONL C;  3N9Q A;  4JI7 T;  3AEC A;  5LP6 E;  3LK4 2;  4HFE A;  4LFC T;  4BJM A;  2JQQ A;  2D5U A;  4I50 E;  4LF6 T;  4C90 A;  3ZLI A;  4AXP A;  4X20 E;  4IE4 A;  2W61 A;  4PJL A;  3OPC A;  3GMI A;  1I6Z A;  4UR9 A;  5FVK A;  4HFC A;  1YKE B;  4LF7 T;  4XBF B;  2XSA A;  3NVO A;  2V5C A;  2VUR A;  2XQ3 A;  2Y6X A;  1Z0P A;  3N2G E;  4DV4 T;  3AA0 B;  4PJN A;  5HXS A;  5LGN B;  4HFD A;  2YIN A;  3QB5 K;  3Q5X A;  2J62 A;  3CVR A;  1BR2 A;  4PK6 A;  3TKL B;  3RPU A;  2H7V C;  2NWB A;  3NBX X;  1KNP A;  1LKX A;  3TLS A;  3EI0 A;  4QHO A;  2BG9 B;  3EHZ A;  3PUV F;  4ILU A;  3UU8 A;  4EZ4 A;  3AE9 A;  5EK2 A;  1XZY A;  2H3R A;  3Q5E A;  4TNW A;  3UU4 A;  4P09 A;  4DV3 T;  4IE6 A;  1ZV4 X;  4AI6 A;  3I1A A;  5FY0 A;  1QSD A;  4IDQ A;  4U3C A;  3ZYL A;  3LBX A;  5CJ5 A;  2EHO A;  4DR2 T;  2LHR A;  2M6I A;  1HTJ F;  2I0M A;  2ZM8 A;  5LHI B;  2XY8 B;  2UXN B;  2XZE A;  2UU9 T;  1I94 T;  3ZC0 A;  4DV0 T;  5HEU A;  3K1S A;  4AKR B;  2WBL A;  5LGU B;  1OED C;  1BR1 A;  4KMC A;  3PE0 A;  4NUU A;  2EHO D;  2WWU A;  3RRC A;  4B3R T;  5FY7 A;  2LRL A;  1KK7 A;  3A8Y C;  1T98 A;  3AE8 A;  2Y8D A;  5L3C B;  4BAY B;  3UUX B;  4HKA A;  3QB5 A;  1WLX A;  2NTX A;  4J2C A;  5A1L A;  3M3Z B;  2X9W A;  4LF9 T;  4DBR A;  1IZN B;  2H89 A;  2X9X A;  4KX6 A;  3ONJ A;  3RYH E;  5FY1 A;  5AQV B;  3ZN1 B;  5ABE A;  3SRZ A;  2X0H A;  4GKK T;  4YSX A;  1JNR A;  3MZK B;  3AAA B;  3IF8 B;  4X1I E;  4C91 A;  2UXC T;  3ZJ1 A;  3R6N A;  2XQ6 A;  5HXR A;  2LKG A;  5AQI B;  3KV9 A;  3T1H T; 
#chains in the Genus database with same CATH homology
 2XY8 B;  2AE9 A;  1SE7 A;  2AXD S;  2IDO B;  1DU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...