2XY8B

Paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
QTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA POLYMERASE III SUBUNIT EPSILON
publication title Protein-Protein Haddocking Using Exclusively Pseudocontact Shifts.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 19
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2xy8B00
1DU2A 2AXDS 1SE7A 2IDOB 2XY8B 2AE9A
chains in the Genus database with same CATH superfamily
4IT4A 5AQFB 4DV0T 2M67A 4O2AE 4ZI2C 3CIRA 5AQQB 2XAJB 4Z90A 4DR6T 1EZ3A 4DMWA 2Z6EA 3E08A 3ETUA 2HPJA 4PNIA 2CCQA 2WS3A 4IDZA 3ZJ1A 3ZYKA 2XASB 2X0LB 4TV8E 3HKEE 3AE5A 5HEGA 3I9WA 2V7IA 1LKXA 3KV4A 4HTEA 5L3FB 4HWDA 4CI3B 4QX8B 2WDVA 4GYRA 2DCFA 4BAYB 4HWCA 3N2KE 3RIUA 1S94A 1D0ZA 3AAEB 4YTMA 2L8KA 2XQAA 1WFDA 2IMLA 4GIWA 4HFDA 4EYUA 4EEDA 1XMOT 3FBLA 2C5JA 2KXPB 4AXPA 3PUYF 4JUYA 3N9LA 4DR7T 4EEBA 5EK4A 5FKYA 5JREA 3P50A 5JQGE 2KNDA 4DMVA 3ZMTB 3UULA 2N9DA 3ESLA 5LGNB 4ZI3D 2W62A 2YOEA 3KBTA 3MKDA 2HN1A 3B5MA 4DIDB 3M65A 2DWKA 5JRCA 3ZCJA 1HTJF 4QH4A 2D2SA 2LM9A 3AAAB 4E7SA 3D0TA 3TLSA 2LJLA 2UUCT 5AQGB 2OA5A 5HEUA 2WY2A 3HL6A 3HKDE 4DR1T 2JJ9A 4B3MT 4PW8A 1G73A 2XQYA 5JRCB 4F6RC 1OEDC 3KINB 2CLYC 4LF5T 2CPTA 2XHEB 3MZKB 5FNVE 3Q5WA 2N1GA 3Q2MA 4PJJA 5JDMA 5HXSA 5AQHB 4UEMA 3ONLC 4H9SE 4X66T 1J1JA 3F2EA 4IL4A 3FZHB 2CEAA 4MHCA 2X9HA 4PAGA 2BKOA 3ZN1B 4O4HE 3IA3A 3PUWF 3UTKA 3BQIA 3VU7H 3J7Yq 3AE3A 3FHNA 2WAUA 3ZC1A 4CXWA 1N33T 3W15B 1V9DA 2LM2A 3ZT5A 3CX7B 4Z91A 4NUVA 2WDRA 4U31A 1R8IA 5AQPB 3LSVA 3HKBE 2E9XD 1T72A 2BKNA 3DP7A 3ZMSB 3AE2A 1NAFA 4COFA 1SHZC 2PFVA 4AIUA 2X51A 2MOZA 2XAFB 2FBWA 5FYMA 4DV2T 5A1LA 1MIWA 2QGSA 2W63A 4OK0A 5TAOA 3AB3B 2W0GA 3U3IA 3ZC0A 2Y6XA 2VKDA 2UXXB 4ZXLA 2L3LA 1D1AA 3E0ZA 4GYSA 4EXTA 2CXDA 3IBPA 5JDLA 5LMNT 4B3RT 3CX6B 5ABFA 2JQQA 2KINB 2FUPA 4CN4A 2WMOA 3PV0F 1U5PA 3OBVE 5LBMA 3UUNA 5HWYA 3RKGA 2BS3A 4GOUA 3L39A 4QXHB 4TNWA 4A56A 2HH7A 4U7IA 2AE9A 1QSDA 5HXHA 3ZYMA 4UVAB 4TWDA 1M62A 2XAQB 4PFOA 5HXRA 4JBWF 4X65T 3RYCE 1IZNB 4X1KE 4PJLA 2HHHT 4B3TT 4LFAT 2PBIA 3SS1A 3AECA 1WYBA 3RIUC 3N2OA 2VKOA 3RQWA 3P4QA 3O1HA 2LOPA 3G06A 5LOVE 3P4RA 1N32T 1T8BA 5L3GB 4TZ4C 2Q9QA 5AQJB 2CRBA 1MMGA 2CHOA 2ZM0A 1QLBA 4V1Av 4QWNB 3B13A 4IE7A 3CWZB 2WCAA 5AQTB 3CQGB 2Q9QB 1FEWA 2YKSA 4ZHQE 3KV9A 2Y48B 3P4SA 4OX9T 4ZZBA 5FXVA 4O4JE 3C64A 4UXNB 3IF8B 5LXTE 1W9RA 3C50A 4CI1B 2E8IA 3HR0A 4EYYR 4F8HA 4U72A 4IHJE 3V5SA 1YXRA 2UXNB 4HFCA 4L9IA 4GKJT 2BBHA 4BJNA 2WU5A 2V8SV 5AQIB 4UVCB 2UU9T 2D0TA 3UFEA 2QA7A 4DV1T 5CFBA 3RI5A 5EZYE 4A98A 3MA9A 5LHGB 5FXWA 3AA0B 1KF6A 3AE1A 4DR4T 4DV3T 4QH5A 3FBZA 1OEDB 5L47A 4XAXB 3RHWA 5FY7A 4LMKA 2I0MA 1YD8G 3CKDA 3RYFE 4EV6A 2V5CA 3NZQA 4ASKA 2ODUA 2MAWA 5FXZA 2WWUA 1MNDA 1XNQT 2X9YA 3NVOA 1Y64B 1XNRT 1HR0T 5AQNB 3CMLA 3PE0A 2CXFA 3C4WA 2F4VT 2LSGA 3JADA 3H3AA 1ZEEA 2JMHA 1WCRA 3K3NA 2W4XA 5LGTB 3LJCA 2I59A 3N2GE 4WBOA 2W61A 4XBFB 3L3PA 3DTOA 5EK3A 2XQ9A 4I50E 3EI0A 1HG5A 3AEGA 3SFDA 2H3RA 1Z0PA 3PUSA 4UELA 2KLQA 4KMCA 3C4XA 5AQOB 2W66A 5CGMA 3SFEA 4HWFA 2YDRA 5HEOA 4DO0A 3ZMVB 4YSZA 2CWOA 4I4TE 3NBXX 2HN2A 1MMDA 1X9BA 4UF0B 4MBQA 2CXLA 4QX7B 3O4XE 3OJAA 4QKNA 3Q5XA 1W09A 2LKHA 1H7CA 4O8SA 1ZOYA 1HNZT 3UUXB 4ERRA 4ZI2D 3PUQA 4TWFA 2UXBT 3U78A 3RIAA 4X64T 3OYXA 1FJGT 5LHIB 4EIWA 4Q25A 2KSRA 1E1HB 4NXMT 2RPAA 1E2AA 1S35A 2W00A 2PTFA 3AE7A 4L5GA 3AVSA 3J9X1 3CK6A 3OVUA 3UQ7A 3VKGA 2DLRA 2CMRA 4NUUA 2FJDA 4P09A 2WP9A 5AQLB 3O9XA 3GN5A 2E2AA 2VKHA 5F8PA 3PURA 4LMJA 5IUXA 5FY0A 2BS4A 4PK6A 3P4WA 3E22E 5JDNA 2Q9QC 4TX5A 1UURA 2FJEA 4EOZB 1ZKEA 4H63V 3MXZA 5FVKA 2WQYA 3ZSTA 5JH7E 5FXXA 3AEFA 2VB6A 3IHRA 2XSBA 1T7SA 3UT5E 4PJMA 2WB5A 4HFEA 5LJMA 2XTLA 5F3JA 4FI5A 2NW7A 3N9PA 2LRKA 1NEKA 5J2UE 2UUBT 2XQ3A 5AQUB 4ISTA 4ZEYA 2IAKA 2LKGA 1ZHCA 3QNUA 4J2CA 2X0YA 5LGUB 1XMQT 1NWMX 3JAFA 2I6HA 3N5LA 3FZMB 5KX5E 4KHZF 2XY8B 2XPKA 4Z8XA 4YJ2E 4JI5T 3KBUA 4G63A 2VK9A 2MPKA 2XM2A 3AA7B 3RX6A 3I0OA 4K0KT 2BS2A 4IE5A 2XQ5A 2XAGB 3LBXA 3FZLB 2MYSA 3AEDA 4IL9A 5J2TE 2BKPA 3EABA 5AFUL 3ZT7A 2LOSA 2YDSA 5LBQB 5L2LA 4A97A 3LBXB 5HCJA 4X1YE 4AQYT 3ZMUB 2VQET 2YN6A 3RH3A 1FIOA 5L4EA 2N2NA 4TN7B 2VL8A 1YQ3A 4HN9A 3RLFF 4I0UA 4DR5T 3FZKB 4KBMB 4DUYT 2OV9A 3ZMZB 5FL0A 4IDNA 3NRXA 2EHOA 2LEHA 3JC6C 3WI3A 3I1AA 1XDPA 2CWYA 4CN6A 3ABVA 4KP3C 2RP4A 3OYZA 4LMLA 2XZEA 3UU6A 3ZCIA 4AQFA 2B76A 3OTOT 1Z8UA 1HF8A 2VVNA 4HFIA 2UXCT 1UX5A 1FMVA 2EHOB 3ZJ2A 4YSXA 1W0BA 4JI3T 4DNDA 5DQVA 5CA1E 3ZSSA 4I43B 4JI0T 3QB5A 3M3ZB 3UUMA 1B7TA 4YHJA 4YJ3E 4IE6A 1XDOA 3A5XA 4TV9E 3UU5A 5JDFA 2C0SA 2BG9E 5L3BB 1HX8A 4OFZA 4LF8T 4H9OC 3KFWX 3N9MA 2X67A 5ABFB 1VRBA 4H9RC 3H3MA 3AEAA 4HGAA 4EB6E 5ADXL 1IBKT 4DBRA 1D1BA 4IE0A 3ONJA 1XZYA 4X5TA 1NENA 2HPLA 1E7PA 4PK4A 3I0QA 2IW5B 5IHYA 2WSSV 4UV9B 3R84B 1N36T 5HAXA 4OYJA 2NW9A 4CXXA 2NWBA 4H9QC 3TLUA 4YHHT 2LE8A 1DU2A 2D0UA 1VCTA 3AEBA 4DV4T 2IC6A 3SOLA 3EVYA 1UGOA 1WR6A 3F31A 2X0HA 5L3EB 2L9QA 5IYZE 3OPCA 3RKOA 2LHRA 4CN1A 5HCMA 3C4ZA 2K3WA 2V7MA 3LDQB 4X1IE 2ACZA 4C91A 4HFBA 3R6NA 3EDUA 4DBQA 2JPFA 4ILBA 4ANJA 3ZEFB 2GK9A 1XWMA 3UFGA 3K8PC 3HA4A 5KXJA 2V6YA 2X66A 2YINA 4QH1A 2K5BB 2LSIA 2E5VA 2R6GF 5FL1A 4H63H 5BMVE 3GA8A 2BG9A 5ABHA 3L8RA 4DUZT 2WMNA 1JNRA 4AISA 3UU8A 1I6ZA 1L0VA 2QYWA 4HWHA 3CX8B 2A3DA 4DVDA 2NR4A 2NP9A 1YW0A 4YY3T 2NW8A 4HFVA 2V26A 1LVKA 2DL1A 1HCIA 2D5UA 1GQEA 1OWAA 5C8YE 3LK3B 4EZHA 2V1DB 4B3ST 2QVAA 3Q5EA 3RGLA 2CA5A 4GK0E 3T1HT 4O4LE 2CBJA 5HWXA 3T1YT 2IHR1 1WYCA 4ISSA 2LRLA 3VKHA 5LCYA 2J62A 3NKZA 3ZPOA 4MFRA 4TUYE 5JDQA 1D0XA 5J0ZA 4HWIB 3PUZF 5JR9A 1HG2A 3UUBA 4OHFA 1D1CA 3UQ4A 2MTQA 1ZV4X 4JI4T 2XQ6A 1IBMT 3LK2B 3X1DA 2ES0A 4AKLA 2X68A 2JMKA 4JI2T 2OLTA 2A2FX 2DNXA 2EHOC 3A7MA 3NRYA 3P4PA 4NXNT 3AAIA 3NWIA 3TLVA 1US7B 4PFPA 4H9NC 2A72A 3ZN0B 2K48A 2A9UA 5JVDE 4AQFC 2ZM8A 1KNZA 3N9QA 2UUAT 4P1NA 3H37A 2BVMA 4LFBT 4WBNE 5HXCA 2W2UA 2DI4A 4JI7T 4WYVA 3ZLIA 3F57A 3K1SA 2H7OA 2K9AA 3RC3A 4LF6T 4B6XA 3LFMA 5J1GA 3RYHE 1YKHB 2YK0A 5CA0E 4BJMA 3VR8A 5H6RB 4OYKA 2CHNA 4UR9A 4IIJE 2LT3A 4UVBB 3ZKRA 3ANWA 3JCFA 2J1DG 3PJAA 5LHHB 2P9BA 3RC8A 3CVRA 3KV5A 4JI6T 3JAEA 5EK2A 2X9WA 2XQ8A 4YT0A 2VVSA 1MIVA 4ZOLE 2VWAA 1SUMB 3ANWB 5LA6E 1HNWT 4EGWA 4P0BA 3KDSE 1I94T 5IWAT 1CUNA 3RPUA 3QB5K 1IAPA 2IDOB 3K3QC 1W0AA 2H88A 3BK9A 4IE4A 3AEEA 2XJ7A 5LYJE 4YSYA 5LG3A 2ZM6T 3LG7A 2WWVA 3VRAA 5LB7B 3FXDB 3EDVA 2DWGA 4U33A 5AQRB 2WZHA 4YLHA 2XQ7A 2KWHA 4BA9A 2KT9A 4YTNA 4FJOA 3WAJA 3GN5B 4H9PC 4IDPA 1BR2A 3RYIE 5H6QB 3N9OA 5AQVB 5GONE 4ZI3C 3UU3A 2JRKA 5HXEA 2Q9QD 5DABA 3P8CD 4TNVA 2V7KA 2JIWA 4LF9T 3PJAJ 4YFSA 2KZ7B 4KI0F 3RQUA 4LF4T 5M4YA 4LFCT 5ABGA 4HE8A 2VQFT 3HI2A 3VR9A 1WRDA 2JQ9A 4HEAA 2BG9C 2WU2A 2V5DA 2LLYA 3C51A 4ZZCA 1LVFA 3VHLA 4EAHA 2CM0A 4N78D 2FJBA 3FZFB 2NOXA 2VKJA 2CBIA 4NIQA 3LK42 1Y01A 3FXEB 4JEHB 1UCUA 2YEVC 1JNZA 4ILUA 4O4IE 4L0RA 5HEHA 2ZMAA 4DR3T 4AQGA 2BDEA 2W67A 4G2AA 1KNPA 3PUXF 3ETVA 2ZM2A 3PU8A 4GK5E 1SA0E 4X62T 4LF7T 3S4UA 4IDOA 5FY1A 5L4HA 3NZPA 3P7IA 2VURA 3IEEA 3VRBA 1HS7A 5ABEA 1HNXT 5JR9C 2E9XC 2Y8DA 2G0UA 5KMGP 2H89A 4IREA 2C5IT 2LSYA 2XQ4A 4U7YA 3CQCB 1UK5A 3B57A 4ZI7E 4QXBB 5FMNA 3TKLB 5KDMC 4ZS3A 2RA1A 3I9YA 4CI2B 1MNEA 4K0UA 5JDHA 5L3CB 1D0YA 3JC6D 1HFAA 2AXDS 2XM1A 3CQXC 4U2ZA 4IGUA 2H7VC 4U3CA 5LP6E 3TLWA 4KX6A 4DV5T 2QRXA 2BVLA 4UIGA 4DR2T 3BQLA 3MK7C 5AQSB 2YDQA 1SE7A 2IC9A 4CXYA 3PDYA 1J5ET 2C5KT 4WZXA 2BBJA 1KNRA 1IBLT 3HKCE 2D9DA 3BQKA 1WR0A 2SPCA 2KMFA 4A5XA 2M6BA 2PJQA 5E0OA 1OEDE 1MIYA 5CJ5A 4ILAA 3RRWA 3Q9DA 3MJXA 4JI1T 2XSAA 4TWHA 4JYAT 1IJ5A 4EZ4A 1UX4A 3K3OA 2FJAA 1KEYA 2LSJA 4KUMB 5F5WA 4MLKA 3QC9A 2NTYA 4ADZA 2YU1A 3EUHA 3C98B 4AKIA 5DJQC 4I55E 4AKHA 2J47A 5FP3A 4PK5A 4QHOA 3N9NA 5ETWA 1HX1B 3CPZA 4NPPA 5L3DB 3AA6B 2BZBA 1MMAA 5C2TA 4C90A 2WBLA 5LJNA 3QUJA 2WZIA 3ZYLA 4X20E 2ODVA 3PUVF 2MBGA 5HYAA 1YQ4A 2K24A 4CQIA 3AE8A 5LG4A 2WM9A 3KVAA 4DV6T 4HKAA 4ZS2A 3AVRA 3EAMA 4YTPA 3AE9A 4XZCA 1AJ3A 2J4GA 2X9XA 4UV8B 3GMIA 1MMNA 5C3JA 3AE6A 3TLTA 1FMWA 3QOFA 2NTXA 3O1JA 3AXJA 3KVBA 1M7KA 3O1IA 3T8OA 3WAKA 5DQWA 3OKQA 3Q5DA 4JLEA 4U74A 2V6YB 2WDQA 3KV6A 5JTGA 1WLXA 2BG9B 4E7ZA 1BR0A 4WNKA 3AA1B 3AXJB 2PG8A 1OEDA 5BR8T 3A8YC 2JQHA 3SRZA 4JV5T 4JI8T 2ACXA 2XAHB 1VCSA 4AI6A 2JQKA 1G8XA 3PUGA 1UUSA 3L09A 5CB4E 5LNKA 1YKEB 1ZP0A 2B1EA 1U4QA 2E5LT 4WW0A 5LMUT 4PJNA 1LRZA 3EHZA 4HFHA 2CLYB 1O3XA 2LSKA 3V5UA 5HEJA 2LHNA 3RRCA 3RF1A 4AKGA 2E9XA 3MACA 1VOMA 4CZZB 4YXDA 4M1PA 4QXCB 2VL0A 4O2BE 3FB2A 2IUBA 1OXZA 1KFYA 3PTRB 5AQKB 2XUEA 2V7LA 5JDGA 5AQMB 5JR9B 2E9XB 1KK7A 4KHPT 3GWHA 3ZT6A 2UXDT 2CE7A 3QK6A 3DJBA 2V6XA 3AE4A 1N34T 2KWIB 3UU4A 2EHOD 4DV7T 3RIFA 4ILCA 4P0AA 1T98A 1BR1A 1CHUA 1X79A 4GKKT 2IIUA 2V7JA 1BR4A 3ONXA 4MALA 3SWHA 4AKRB 2DHRA 2M6IA 4UF0A 2YU2A 3PUAA 4IDQA 4JEUB 1J5WA 1QUUA 1IJ6A 3PU3A 5FVLA 2ZLYA 2VASA 4U2YA
chains in the Genus database with same CATH topology
1DU2A 2AXDS 1SE7A 2IDOB 2XY8B 2AE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DU2 A;  2AXD S;  1SE7 A;  2IDO B;  2XY8 B;  2AE9 A; 
#chains in the Genus database with same CATH topology
 4IT4 A;  5AQF B;  4DV0 T;  2M67 A;  4O2A E;  4ZI2 C;  3CIR A;  5AQQ B;  2XAJ B;  4Z90 A;  4DR6 T;  1EZ3 A;  4DMW A;  2Z6E A;  3E08 A;  3ETU A;  2HPJ A;  4PNI A;  2CCQ A;  2WS3 A;  4IDZ A;  3ZJ1 A;  3ZYK A;  2XAS B;  2X0L B;  4TV8 E;  3HKE E;  3AE5 A;  5HEG A;  3I9W A;  2V7I A;  1LKX A;  3KV4 A;  4HTE A;  5L3F B;  4HWD A;  4CI3 B;  4QX8 B;  2WDV A;  4GYR A;  2DCF A;  4BAY B;  4HWC A;  3N2K E;  3RIU A;  1S94 A;  1D0Z A;  3AAE B;  4YTM A;  2L8K A;  2XQA A;  1WFD A;  2IML A;  4GIW A;  4HFD A;  4EYU A;  4EED A;  1XMO T;  3FBL A;  2C5J A;  2KXP B;  4AXP A;  3PUY F;  4JUY A;  3N9L A;  4DR7 T;  4EEB A;  5EK4 A;  5FKY A;  5JRE A;  3P50 A;  5JQG E;  2KND A;  4DMV A;  3ZMT B;  3UUL A;  2N9D A;  3ESL A;  5LGN B;  4ZI3 D;  2W62 A;  2YOE A;  3KBT A;  3MKD A;  2HN1 A;  3B5M A;  4DID B;  3M65 A;  2DWK A;  5JRC A;  3ZCJ A;  1HTJ F;  4QH4 A;  2D2S A;  2LM9 A;  3AAA B;  4E7S A;  3D0T A;  3TLS A;  2LJL A;  2UUC T;  5AQG B;  2OA5 A;  5HEU A;  2WY2 A;  3HL6 A;  3HKD E;  4DR1 T;  2JJ9 A;  4B3M T;  4PW8 A;  1G73 A;  2XQY A;  5JRC B;  4F6R C;  1OED C;  3KIN B;  2CLY C;  4LF5 T;  2CPT A;  2XHE B;  3MZK B;  5FNV E;  3Q5W A;  2N1G A;  3Q2M A;  4PJJ A;  5JDM A;  5HXS A;  5AQH B;  4UEM A;  3ONL C;  4H9S E;  4X66 T;  1J1J A;  3F2E A;  4IL4 A;  3FZH B;  2CEA A;  4MHC A;  2X9H A;  4PAG A;  2BKO A;  3ZN1 B;  4O4H E;  3IA3 A;  3PUW F;  3UTK A;  3BQI A;  3VU7 H;  3J7Y q;  3AE3 A;  3FHN A;  2WAU A;  3ZC1 A;  4CXW A;  1N33 T;  3W15 B;  1V9D A;  2LM2 A;  3ZT5 A;  3CX7 B;  4Z91 A;  4NUV A;  2WDR A;  4U31 A;  1R8I A;  5AQP B;  3LSV A;  3HKB E;  2E9X D;  1T72 A;  2BKN A;  3DP7 A;  3ZMS B;  3AE2 A;  1NAF A;  4COF A;  1SHZ C;  2PFV A;  4AIU A;  2X51 A;  2MOZ A;  2XAF B;  2FBW A;  5FYM A;  4DV2 T;  5A1L A;  1MIW A;  2QGS A;  2W63 A;  4OK0 A;  5TAO A;  3AB3 B;  2W0G A;  3U3I A;  3ZC0 A;  2Y6X A;  2VKD A;  2UXX B;  4ZXL A;  2L3L A;  1D1A A;  3E0Z A;  4GYS A;  4EXT A;  2CXD A;  3IBP A;  5JDL A;  5LMN T;  4B3R T;  3CX6 B;  5ABF A;  2JQQ A;  2KIN B;  2FUP A;  4CN4 A;  2WMO A;  3PV0 F;  1U5P A;  3OBV E;  5LBM A;  3UUN A;  5HWY A;  3RKG A;  2BS3 A;  4GOU A;  3L39 A;  4QXH B;  4TNW A;  4A56 A;  2HH7 A;  4U7I A;  2AE9 A;  1QSD A;  5HXH A;  3ZYM A;  4UVA B;  4TWD A;  1M62 A;  2XAQ B;  4PFO A;  5HXR A;  4JBW F;  4X65 T;  3RYC E;  1IZN B;  4X1K E;  4PJL A;  2HHH T;  4B3T T;  4LFA T;  2PBI A;  3SS1 A;  3AEC A;  1WYB A;  3RIU C;  3N2O A;  2VKO A;  3RQW A;  3P4Q A;  3O1H A;  2LOP A;  3G06 A;  5LOV E;  3P4R A;  1N32 T;  1T8B A;  5L3G B;  4TZ4 C;  2Q9Q A;  5AQJ B;  2CRB A;  1MMG A;  2CHO A;  2ZM0 A;  1QLB A;  4V1A v;  4QWN B;  3B13 A;  4IE7 A;  3CWZ B;  2WCA A;  5AQT B;  3CQG B;  2Q9Q B;  1FEW A;  2YKS A;  4ZHQ E;  3KV9 A;  2Y48 B;  3P4S A;  4OX9 T;  4ZZB A;  5FXV A;  4O4J E;  3C64 A;  4UXN B;  3IF8 B;  5LXT E;  1W9R A;  3C50 A;  4CI1 B;  2E8I A;  3HR0 A;  4EYY R;  4F8H A;  4U72 A;  4IHJ E;  3V5S A;  1YXR A;  2UXN B;  4HFC A;  4L9I A;  4GKJ T;  2BBH A;  4BJN A;  2WU5 A;  2V8S V;  5AQI B;  4UVC B;  2UU9 T;  2D0T A;  3UFE A;  2QA7 A;  4DV1 T;  5CFB A;  3RI5 A;  5EZY E;  4A98 A;  3MA9 A;  5LHG B;  5FXW A;  3AA0 B;  1KF6 A;  3AE1 A;  4DR4 T;  4DV3 T;  4QH5 A;  3FBZ A;  1OED B;  5L47 A;  4XAX B;  3RHW A;  5FY7 A;  4LMK A;  2I0M A;  1YD8 G;  3CKD A;  3RYF E;  4EV6 A;  2V5C A;  3NZQ A;  4ASK A;  2ODU A;  2MAW A;  5FXZ A;  2WWU A;  1MND A;  1XNQ T;  2X9Y A;  3NVO A;  1Y64 B;  1XNR T;  1HR0 T;  5AQN B;  3CML A;  3PE0 A;  2CXF A;  3C4W A;  2F4V T;  2LSG A;  3JAD A;  3H3A A;  1ZEE A;  2JMH A;  1WCR A;  3K3N A;  2W4X A;  5LGT B;  3LJC A;  2I59 A;  3N2G E;  4WBO A;  2W61 A;  4XBF B;  3L3P A;  3DTO A;  5EK3 A;  2XQ9 A;  4I50 E;  3EI0 A;  1HG5 A;  3AEG A;  3SFD A;  2H3R A;  1Z0P A;  3PUS A;  4UEL A;  2KLQ A;  4KMC A;  3C4X A;  5AQO B;  2W66 A;  5CGM A;  3SFE A;  4HWF A;  2YDR A;  5HEO A;  4DO0 A;  3ZMV B;  4YSZ A;  2CWO A;  4I4T E;  3NBX X;  2HN2 A;  1MMD A;  1X9B A;  4UF0 B;  4MBQ A;  2CXL A;  4QX7 B;  3O4X E;  3OJA A;  4QKN A;  3Q5X A;  1W09 A;  2LKH A;  1H7C A;  4O8S A;  1ZOY A;  1HNZ T;  3UUX B;  4ERR A;  4ZI2 D;  3PUQ A;  4TWF A;  2UXB T;  3U78 A;  3RIA A;  4X64 T;  3OYX A;  1FJG T;  5LHI B;  4EIW A;  4Q25 A;  2KSR A;  1E1H B;  4NXM T;  2RPA A;  1E2A A;  1S35 A;  2W00 A;  2PTF A;  3AE7 A;  4L5G A;  3AVS A;  3J9X 1;  3CK6 A;  3OVU A;  3UQ7 A;  3VKG A;  2DLR A;  2CMR A;  4NUU A;  2FJD A;  4P09 A;  2WP9 A;  5AQL B;  3O9X A;  3GN5 A;  2E2A A;  2VKH A;  5F8P A;  3PUR A;  4LMJ A;  5IUX A;  5FY0 A;  2BS4 A;  4PK6 A;  3P4W A;  3E22 E;  5JDN A;  2Q9Q C;  4TX5 A;  1UUR A;  2FJE A;  4EOZ B;  1ZKE A;  4H63 V;  3MXZ A;  5FVK A;  2WQY A;  3ZST A;  5JH7 E;  5FXX A;  3AEF A;  2VB6 A;  3IHR A;  2XSB A;  1T7S A;  3UT5 E;  4PJM A;  2WB5 A;  4HFE A;  5LJM A;  2XTL A;  5F3J A;  4FI5 A;  2NW7 A;  3N9P A;  2LRK A;  1NEK A;  5J2U E;  2UUB T;  2XQ3 A;  5AQU B;  4IST A;  4ZEY A;  2IAK A;  2LKG A;  1ZHC A;  3QNU A;  4J2C A;  2X0Y A;  5LGU B;  1XMQ T;  1NWM X;  3JAF A;  2I6H A;  3N5L A;  3FZM B;  5KX5 E;  4KHZ F;  2XY8 B;  2XPK A;  4Z8X A;  4YJ2 E;  4JI5 T;  3KBU A;  4G63 A;  2VK9 A;  2MPK A;  2XM2 A;  3AA7 B;  3RX6 A;  3I0O A;  4K0K T;  2BS2 A;  4IE5 A;  2XQ5 A;  2XAG B;  3LBX A;  3FZL B;  2MYS A;  3AED A;  4IL9 A;  5J2T E;  2BKP A;  3EAB A;  5AFU L;  3ZT7 A;  2LOS A;  2YDS A;  5LBQ B;  5L2L A;  4A97 A;  3LBX B;  5HCJ A;  4X1Y E;  4AQY T;  3ZMU B;  2VQE T;  2YN6 A;  3RH3 A;  1FIO A;  5L4E A;  2N2N A;  4TN7 B;  2VL8 A;  1YQ3 A;  4HN9 A;  3RLF F;  4I0U A;  4DR5 T;  3FZK B;  4KBM B;  4DUY T;  2OV9 A;  3ZMZ B;  5FL0 A;  4IDN A;  3NRX A;  2EHO A;  2LEH A;  3JC6 C;  3WI3 A;  3I1A A;  1XDP A;  2CWY A;  4CN6 A;  3ABV A;  4KP3 C;  2RP4 A;  3OYZ A;  4LML A;  2XZE A;  3UU6 A;  3ZCI A;  4AQF A;  2B76 A;  3OTO T;  1Z8U A;  1HF8 A;  2VVN A;  4HFI A;  2UXC T;  1UX5 A;  1FMV A;  2EHO B;  3ZJ2 A;  4YSX A;  1W0B A;  4JI3 T;  4DND A;  5DQV A;  5CA1 E;  3ZSS A;  4I43 B;  4JI0 T;  3QB5 A;  3M3Z B;  3UUM A;  1B7T A;  4YHJ A;  4YJ3 E;  4IE6 A;  1XDO A;  3A5X A;  4TV9 E;  3UU5 A;  5JDF A;  2C0S A;  2BG9 E;  5L3B B;  1HX8 A;  4OFZ A;  4LF8 T;  4H9O C;  3KFW X;  3N9M A;  2X67 A;  5ABF B;  1VRB A;  4H9R C;  3H3M A;  3AEA A;  4HGA A;  4EB6 E;  5ADX L;  1IBK T;  4DBR A;  1D1B A;  4IE0 A;  3ONJ A;  1XZY A;  4X5T A;  1NEN A;  2HPL A;  1E7P A;  4PK4 A;  3I0Q A;  2IW5 B;  5IHY A;  2WSS V;  4UV9 B;  3R84 B;  1N36 T;  5HAX A;  4OYJ A;  2NW9 A;  4CXX A;  2NWB A;  4H9Q C;  3TLU A;  4YHH T;  2LE8 A;  1DU2 A;  2D0U A;  1VCT A;  3AEB A;  4DV4 T;  2IC6 A;  3SOL A;  3EVY A;  1UGO A;  1WR6 A;  3F31 A;  2X0H A;  5L3E B;  2L9Q A;  5IYZ E;  3OPC A;  3RKO A;  2LHR A;  4CN1 A;  5HCM A;  3C4Z A;  2K3W A;  2V7M A;  3LDQ B;  4X1I E;  2ACZ A;  4C91 A;  4HFB A;  3R6N A;  3EDU A;  4DBQ A;  2JPF A;  4ILB A;  4ANJ A;  3ZEF B;  2GK9 A;  1XWM A;  3UFG A;  3K8P C;  3HA4 A;  5KXJ A;  2V6Y A;  2X66 A;  2YIN A;  4QH1 A;  2K5B B;  2LSI A;  2E5V A;  2R6G F;  5FL1 A;  4H63 H;  5BMV E;  3GA8 A;  2BG9 A;  5ABH A;  3L8R A;  4DUZ T;  2WMN A;  1JNR A;  4AIS A;  3UU8 A;  1I6Z A;  1L0V A;  2QYW A;  4HWH A;  3CX8 B;  2A3D A;  4DVD A;  2NR4 A;  2NP9 A;  1YW0 A;  4YY3 T;  2NW8 A;  4HFV A;  2V26 A;  1LVK A;  2DL1 A;  1HCI A;  2D5U A;  1GQE A;  1OWA A;  5C8Y E;  3LK3 B;  4EZH A;  2V1D B;  4B3S T;  2QVA A;  3Q5E A;  3RGL A;  2CA5 A;  4GK0 E;  3T1H T;  4O4L E;  2CBJ A;  5HWX A;  3T1Y T;  2IHR 1;  1WYC A;  4ISS A;  2LRL A;  3VKH A;  5LCY A;  2J62 A;  3NKZ A;  3ZPO A;  4MFR A;  4TUY E;  5JDQ A;  1D0X A;  5J0Z A;  4HWI B;  3PUZ F;  5JR9 A;  1HG2 A;  3UUB A;  4OHF A;  1D1C A;  3UQ4 A;  2MTQ A;  1ZV4 X;  4JI4 T;  2XQ6 A;  1IBM T;  3LK2 B;  3X1D A;  2ES0 A;  4AKL A;  2X68 A;  2JMK A;  4JI2 T;  2OLT A;  2A2F X;  2DNX A;  2EHO C;  3A7M A;  3NRY A;  3P4P A;  4NXN T;  3AAI A;  3NWI A;  3TLV A;  1US7 B;  4PFP A;  4H9N C;  2A72 A;  3ZN0 B;  2K48 A;  2A9U A;  5JVD E;  4AQF C;  2ZM8 A;  1KNZ A;  3N9Q A;  2UUA T;  4P1N A;  3H37 A;  2BVM A;  4LFB T;  4WBN E;  5HXC A;  2W2U A;  2DI4 A;  4JI7 T;  4WYV A;  3ZLI A;  3F57 A;  3K1S A;  2H7O A;  2K9A A;  3RC3 A;  4LF6 T;  4B6X A;  3LFM A;  5J1G A;  3RYH E;  1YKH B;  2YK0 A;  5CA0 E;  4BJM A;  3VR8 A;  5H6R B;  4OYK A;  2CHN A;  4UR9 A;  4IIJ E;  2LT3 A;  4UVB B;  3ZKR A;  3ANW A;  3JCF A;  2J1D G;  3PJA A;  5LHH B;  2P9B A;  3RC8 A;  3CVR A;  3KV5 A;  4JI6 T;  3JAE A;  5EK2 A;  2X9W A;  2XQ8 A;  4YT0 A;  2VVS A;  1MIV A;  4ZOL E;  2VWA A;  1SUM B;  3ANW B;  5LA6 E;  1HNW T;  4EGW A;  4P0B A;  3KDS E;  1I94 T;  5IWA T;  1CUN A;  3RPU A;  3QB5 K;  1IAP A;  2IDO B;  3K3Q C;  1W0A A;  2H88 A;  3BK9 A;  4IE4 A;  3AEE A;  2XJ7 A;  5LYJ E;  4YSY A;  5LG3 A;  2ZM6 T;  3LG7 A;  2WWV A;  3VRA A;  5LB7 B;  3FXD B;  3EDV A;  2DWG A;  4U33 A;  5AQR B;  2WZH A;  4YLH A;  2XQ7 A;  2KWH A;  4BA9 A;  2KT9 A;  4YTN A;  4FJO A;  3WAJ A;  3GN5 B;  4H9P C;  4IDP A;  1BR2 A;  3RYI E;  5H6Q B;  3N9O A;  5AQV B;  5GON E;  4ZI3 C;  3UU3 A;  2JRK A;  5HXE A;  2Q9Q D;  5DAB A;  3P8C D;  4TNV A;  2V7K A;  2JIW A;  4LF9 T;  3PJA J;  4YFS A;  2KZ7 B;  4KI0 F;  3RQU A;  4LF4 T;  5M4Y A;  4LFC T;  5ABG A;  4HE8 A;  2VQF T;  3HI2 A;  3VR9 A;  1WRD A;  2JQ9 A;  4HEA A;  2BG9 C;  2WU2 A;  2V5D A;  2LLY A;  3C51 A;  4ZZC A;  1LVF A;  3VHL A;  4EAH A;  2CM0 A;  4N78 D;  2FJB A;  3FZF B;  2NOX A;  2VKJ A;  2CBI A;  4NIQ A;  3LK4 2;  1Y01 A;  3FXE B;  4JEH B;  1UCU A;  2YEV C;  1JNZ A;  4ILU A;  4O4I E;  4L0R A;  5HEH A;  2ZMA A;  4DR3 T;  4AQG A;  2BDE A;  2W67 A;  4G2A A;  1KNP A;  3PUX F;  3ETV A;  2ZM2 A;  3PU8 A;  4GK5 E;  1SA0 E;  4X62 T;  4LF7 T;  3S4U A;  4IDO A;  5FY1 A;  5L4H A;  3NZP A;  3P7I A;  2VUR A;  3IEE A;  3VRB A;  1HS7 A;  5ABE A;  1HNX T;  5JR9 C;  2E9X C;  2Y8D A;  2G0U A;  5KMG P;  2H89 A;  4IRE A;  2C5I T;  2LSY A;  2XQ4 A;  4U7Y A;  3CQC B;  1UK5 A;  3B57 A;  4ZI7 E;  4QXB B;  5FMN A;  3TKL B;  5KDM C;  4ZS3 A;  2RA1 A;  3I9Y A;  4CI2 B;  1MNE A;  4K0U A;  5JDH A;  5L3C B;  1D0Y A;  3JC6 D;  1HFA A;  2AXD S;  2XM1 A;  3CQX C;  4U2Z A;  4IGU A;  2H7V C;  4U3C A;  5LP6 E;  3TLW A;  4KX6 A;  4DV5 T;  2QRX A;  2BVL A;  4UIG A;  4DR2 T;  3BQL A;  3MK7 C;  5AQS B;  2YDQ A;  1SE7 A;  2IC9 A;  4CXY A;  3PDY A;  1J5E T;  2C5K T;  4WZX A;  2BBJ A;  1KNR A;  1IBL T;  3HKC E;  2D9D A;  3BQK A;  1WR0 A;  2SPC A;  2KMF A;  4A5X A;  2M6B A;  2PJQ A;  5E0O A;  1OED E;  1MIY A;  5CJ5 A;  4ILA A;  3RRW A;  3Q9D A;  3MJX A;  4JI1 T;  2XSA A;  4TWH A;  4JYA T;  1IJ5 A;  4EZ4 A;  1UX4 A;  3K3O A;  2FJA A;  1KEY A;  2LSJ A;  4KUM B;  5F5W A;  4MLK A;  3QC9 A;  2NTY A;  4ADZ A;  2YU1 A;  3EUH A;  3C98 B;  4AKI A;  5DJQ C;  4I55 E;  4AKH A;  2J47 A;  5FP3 A;  4PK5 A;  4QHO A;  3N9N A;  5ETW A;  1HX1 B;  3CPZ A;  4NPP A;  5L3D B;  3AA6 B;  2BZB A;  1MMA A;  5C2T A;  4C90 A;  2WBL A;  5LJN A;  3QUJ A;  2WZI A;  3ZYL A;  4X20 E;  2ODV A;  3PUV F;  2MBG A;  5HYA A;  1YQ4 A;  2K24 A;  4CQI A;  3AE8 A;  5LG4 A;  2WM9 A;  3KVA A;  4DV6 T;  4HKA A;  4ZS2 A;  3AVR A;  3EAM A;  4YTP A;  3AE9 A;  4XZC A;  1AJ3 A;  2J4G A;  2X9X A;  4UV8 B;  3GMI A;  1MMN A;  5C3J A;  3AE6 A;  3TLT A;  1FMW A;  3QOF A;  2NTX A;  3O1J A;  3AXJ A;  3KVB A;  1M7K A;  3O1I A;  3T8O A;  3WAK A;  5DQW A;  3OKQ A;  3Q5D A;  4JLE A;  4U74 A;  2V6Y B;  2WDQ A;  3KV6 A;  5JTG A;  1WLX A;  2BG9 B;  4E7Z A;  1BR0 A;  4WNK A;  3AA1 B;  3AXJ B;  2PG8 A;  1OED A;  5BR8 T;  3A8Y C;  2JQH A;  3SRZ A;  4JV5 T;  4JI8 T;  2ACX A;  2XAH B;  1VCS A;  4AI6 A;  2JQK A;  1G8X A;  3PUG A;  1UUS A;  3L09 A;  5CB4 E;  5LNK A;  1YKE B;  1ZP0 A;  2B1E A;  1U4Q A;  2E5L T;  4WW0 A;  5LMU T;  4PJN A;  1LRZ A;  3EHZ A;  4HFH A;  2CLY B;  1O3X A;  2LSK A;  3V5U A;  5HEJ A;  2LHN A;  3RRC A;  3RF1 A;  4AKG A;  2E9X A;  3MAC A;  1VOM A;  4CZZ B;  4YXD A;  4M1P A;  4QXC B;  2VL0 A;  4O2B E;  3FB2 A;  2IUB A;  1OXZ A;  1KFY A;  3PTR B;  5AQK B;  2XUE A;  2V7L A;  5JDG A;  5AQM B;  5JR9 B;  2E9X B;  1KK7 A;  4KHP T;  3GWH A;  3ZT6 A;  2UXD T;  2CE7 A;  3QK6 A;  3DJB A;  2V6X A;  3AE4 A;  1N34 T;  2KWI B;  3UU4 A;  2EHO D;  4DV7 T;  3RIF A;  4ILC A;  4P0A A;  1T98 A;  1BR1 A;  1CHU A;  1X79 A;  4GKK T;  2IIU A;  2V7J A;  1BR4 A;  3ONX A;  4MAL A;  3SWH A;  4AKR B;  2DHR A;  2M6I A;  4UF0 A;  2YU2 A;  3PUA A;  4IDQ A;  4JEU B;  1J5W A;  1QUU A;  1IJ6 A;  3PU3 A;  5FVL A;  2ZLY A;  2VAS A;  4U2Y A; 
#chains in the Genus database with same CATH homology
 1DU2 A;  2AXD S;  1SE7 A;  2IDO B;  2XY8 B;  2AE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...