2XY8B

Paramagnetic-based nmr structure of the complex between the n- terminal epsilon domain and the theta domain of the dna polymerase iii
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
61
structure length
61
Chain Sequence
QTEMDKVNVDLAAAGVAFKERYNMPVIAEAVEREQPEHLRSWFRERLIAHRLASVNLSRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA POLYMERASE III SUBUNIT EPSILON
publication title Protein-Protein Haddocking Using Exclusively Pseudocontact Shifts.
pubmed doi rcsb
source organism Escherichia coli
total genus 19
structure length 61
sequence length 61
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2010-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF06440 DNA_pol3_theta DNA polymerase III, theta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.250 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 DNA polymerase III-theta 2xy8B00
2IDOB 2AXDS 1SE7A 2XY8B 1DU2A 2AE9A
chains in the Genus database with same CATH superfamily
2VK9A 4HTEA 2X51A 4DV7T 3LK2B 3Q5DA 2ODVA 4TV9E 3QB5K 3F31A 4IE0A 4PAGA 1R8IA 3UU3A 3EVYA 3E0ZA 1BR0A 2LM9A 5IWAT 3Q2MA 1W0AA 4ANJA 3KVAA 1IAPA 3TLWA 2ZM0A 1X9BA 1ZHCA 3GN5A 4G63A 2KZ7B 4UVCB 1B7TA 3BQKA 1OEDE 4OK0A 3PUQA 3PUZF 2V6XA 2Q9QC 3AVRA 4I43B 1W9RA 2WWUA 3UU5A 1WLXA 2A72A 1D1AA 3PDYA 2LSJA 4HFDA 3NZPA 2JRKA 3P4RA 2YDQA 3CVRA 4HEAA 5LCYA 5A1LA 2WP9A 5LP6E 4EB6E 3N9MA 3ONLC 4ISSA 2H3RA 2XM2A 3AEDA 3VKHA 2DL1A 2W0GA 2W66A 3LSVA 3GMIA 4OX9T 4MLKA 2W63A 1I6ZA 1FEWA 2YINA 3AE3A 3P8CD 3RRCA 4LF8T 4KX6A 4JI2T 5FXXA 2QVAA 3ZJ1A 5ADXL 2BG9B 1XZYA 4X1KE 3A7MA 5AQJB 3I9WA 5L3BB 1VCTA 3AEEA 1V9DA 3RIFA 3VRAA 4O8SA 2XQAA 3ZSSA 4EOZB 4C91A 2HHHT 2Z6EA 4QHOA 3WI3A 2NR4A 4IHJE 3KBUA 5TAOA 4EEDA 5HAXA 2WSSV 2D0UA 2V7JA 4KI0F 2W62A 3CX7B 3RC8A 2AXDS 2LLYA 1LKXA 2W4XA 2Q9QA 1WYBA 3JAEA 4PK6A 2XQ9A 3EDVA 2CMRA 4NXMT 4GKKT 5FL1A 3BK9A 3KDSE 1Y64B 5LHHB 3T1YT 3W15B 3I9YA 2D5UA 4ZS3A 5JDQA 4ASKA 2BG9C 1VRBA 3ZMSB 4UVBB 2L8KA 2UUCT 4YXDA 5F3JA 3UU4A 2L9QA 4Q25A 3H3MA 2RA1A 1WRDA 1KNPA 2M6BA 4AI6A 1WFDA 3FZKB 5L3GB 3AE4A 4ZI2C 4ILBA 2EHOC 3PJAJ 5LHGB 2WMOA 3OVUA 2VL0A 4OYKA 1MIVA 3PUGA 2WU5A 1SA0E 2R6GF 2IIUA 2BKNA 5HXCA 2VKOA 3MKDA 3ZLIA 2X9YA 4YSZA 3ZT6A 4JI8T 4M1PA 1SHZC 1XDPA 2E2AA 3ABVA 2NP9A 2YU1A 4AQYT 3JC6D 3PUSA 2GK9A 2NOXA 2JMKA 4IE7A 1BR1A 1IBKT 2CLYB 4ZHQE 2JQQA 4H63H 4X20E 2H89A 2XSBA 2FJEA 3EHZA 3RI5A 1IBLT 5LGTB 4IL4A 4DUZT 2HN2A 2CA5A 2XQ6A 4AQGA 4A98A 2LKGA 2VB6A 2LHRA 2K48A 2UU9T 3KV9A 3P4WA 3ZC0A 5AQVB 4ISTA 1US7B 2UXBT 5AQPB 1HX8A 4DR4T 3HL6A 3PE0A 3N9LA 5HXRA 4NPPA 3T8OA 1YQ4A 1HNZT 4JYAT 5JRCA 1XDOA 3P4SA 3QUJA 1S94A 3FBLA 2X68A 2W67A 3FZLB 5L4EA 3UUMA 2BG9A 4HFVA 3N9NA 3RIUC 3C50A 3V5UA 3M65A 2KXPB 2VURA 3ZCJA 3ZN1B 2W00A 1W0BA 2Y48B 4DR2T 4MFRA 2BBHA 3ZN0B 4IDPA 3H37A 1JNRA 3U3IA 4G2AA 2CLYC 3G06A 3AE7A 4I50E 5BMVE 4WZXA 5DQVA 3J9X1 5FXWA 3PJAA 2WZHA 5JDHA 3OTOT 2DCFA 2PJQA 5FL0A 4H9NC 2CPTA 2I0MA 3MA9A 3N5LA 3HKCE 2PG8A 1KNRA 3RPUA 4HFEA 2VL8A 4LF9T 2X0HA 5FYMA 5L2LA 2QYWA 2CWYA 2KWHA 4E7ZA 5JTGA 3ZYLA 4JUYA 3LDQB 2CRBA 3R84B 3FXEB 3C64A 4IGUA 4QX8B 4BJNA 2C0SA 1UX4A 3ANWA 4IDNA 2XAGB 3DJBA 3Q5EA 2CM0A 3FXDB 3PUWF 4UIGA 3CQGB 1MMGA 2VQET 2WU2A 4HWFA 3ZEFB 3UFEA 5AQMB 4U72A 4NXNT 2NW7A 2ZM6T 3UT5E 3PU3A 4CI1B 5HYAA 2Y6XA 2A3DA 4LFCT 1J5ET 3K8PC 4IE6A 5LHIB 4TV8E 5FNVE 2J62A 2AE9A 4LMJA 1HF8A 5IYZE 1QSDA 2V7KA 5AFUL 2K9AA 2CXDA 3TLUA 2Y8DA 5CA0E 4X64T 1KNZA 1LRZA 2Q9QD 3UTKA 2UUAT 5L4HA 2V8SV 1YW0A 5FY1A 3AE9A 3PTRB 1D0YA 5EZYE 4Z90A 2E9XB 3X1DA 2CHOA 5CA1E 5HCMA 1FMWA 5CB4E 4EGWA 3AEBA 3UFGA 4QWNB 5H6RB 5C8YE 1JNZA 1UURA 5LJMA 2CXLA 2X9XA 5AQNB 4LFBT 2KLQA 3NRXA 4JV5T 1FJGT 2UXXB 4YJ3E 2D9DA 4DMVA 4PJMA 5M4YA 4UEMA 3SWHA 2BVLA 4BJMA 3HI2A 4DR7T 1NEKA 4WBNE 5JDGA 3UUNA 3PU8A 5LXTE 4ADZA 1YQ3A 4EYUA 4MHCA 2XZEA 4QXHB 2LEHA 3ZMTB 3I0QA 5DQWA 4KHPT 3SFEA 4U7YA 4H9OC 2VKJA 3ZSTA 2WMNA 4O2AE 3QNUA 5LA6E 2HPJA 1HCIA 2B76A 3ONJA 4L9IA 2YN6A 5CJ5A 2MPKA 3AXJB 1MMNA 2DI4A 2IUBA 1Z8UA 2E9XC 2SPCA 3ZKRA 4KHZF 2JJ9A 1M62A 1NENA 4HWDA 5ABHA 5E0OA 3C4ZA 2BG9E 5LNKA 4F6RC 3SFDA 1S35A 5HXSA 4B3ST 2NW8A 4BAYB 4GIWA 1J5WA 3L39A 3RLFF 4AKHA 3F57A 3LFMA 5HEGA 2MBGA 2IC9A 4YFSA 1XNQT 2J1DG 5LOVE 2MAWA 2M6IA 3P7IA 3VR9A 4P1NA 4L0RA 2XJ7A 5J0ZA 4HKAA 3JCFA 4YTNA 4PW8A 1T72A 3ZCIA 5KX5E 4PFOA 1WR0A 3K3OA 3TLSA 2LE8A 4YY3T 2XHEB 4IIJE 4UF0B 3HA4A 1H7CA 4O4IE 5JDLA 1OXZA 3B13A 4UV8B 3ETVA 3AEGA 3CX8B 2DWGA 3RYIE 4IDOA 4OFZA 1I94T 5JR9B 2MTQA 4DVDA 4HN9A 3C4XA 4ZI2D 4JEUB 4AQFC 4UR9A 5AQLB 5HXEA 1IBMT 3ZT7A 2EHOB 2VQFT 3B5MA 2HPLA 4YHJA 4MALA 1HNWT 4U2YA 5FP3A 2DLRA 2V1DB 2OLTA 2VVNA 2XQ3A 5ABFB 3E08A 2QRXA 2WM9A 4I0UA 1T7SA 2XAQB 3IA3A 2BVMA 2RPAA 3IBPA 4IL9A 2V26A 1M7KA 2JQ9A 2LRKA 4V1Av 5KXJA 1E1HB 2D2SA 1YXRA 4EXTA 1N33T 3CQXC 3MJXA 2YU2A 2PBIA 4EEBA 3ETUA 3PUVF 2IAKA 3K1SA 3AA7B 5JR9C 3AAIA 4QH5A 2LJLA 4E7SA 5KDMC 4JLEA 4QXCB 4DR5T 3T1HT 1G8XA 4CXWA 3RRWA 4P09A 1UCUA 4BA9A 5AQGB 5HEHA 4UV9B 2X9WA 1ZKEA 2LT3A 3LK42 2X0YA 3LK3B 3ONXA 4P0AA 4FI5A 4J2CA 1MMDA 2IW5B 5FKYA 1DU2A 3AXJA 3UUBA 3PUAA 5J2UE 4EAHA 5LYJE 2KT9A 1U5PA 1T98A 3VRBA 4CI2B 2H88A 4DV2T 1XMQT 4PFPA 1XNRT 3UU8A 2XQ8A 4ZI7E 2ZM2A 4HE8A 4B3RT 1QLBA 4WW0A 4CXYA 2FUPA 3N2OA 3CIRA 3WAKA 5LBQB 4DUYT 2DWKA 1D1CA 1FMVA 1WCRA 4X1YE 4CN6A 4OYJA 3O1HA 4X1IE 1UK5A 4ZI3C 2FJAA 4DV5T 5FXZA 3LBXB 1SE7A 1T8BA 2WWVA 4TN7B 5HEOA 2WBLA 2JQKA 4KP3C 1N34T 1D0ZA 4UF0A 3PV0F 4DBRA 1QUUA 4ILAA 1FIOA 2YK0A 5H6QB 3ZYKA 3CPZA 5C3JA 1IJ6A 2WDVA 1OWAA 4GYSA 1D0XA 4U31A 2KNDA 2UXCT 5AQTB 3IF8B 4YSXA 3NRYA 5AQFB 3L8RA 4O4JE 5C2TA 5JDFA 3RX6A 2EHOA 1XMOT 3AEAA 3UQ7A 3RYHE 4X5TA 3GN5B 3MK7C 4DR1T 3N2KE 4XBFB 3D0TA 4YSYA 1KK7A 2G0UA 2K3WA 2WDQA 4NUUA 2M67A 1Y01A 4IDZA 3AECA 4EIWA 2ZM8A 4AKRB 2QA7A 3RQWA 5BR8T 2N9DA 1WYCA 4DV0T 3OPCA 4WBOA 4DIDB 2YOEA 4L5GA 3O9XA 5JVDE 5AQOB 3O1IA 3JAFA 4DR3T 3N9OA 1IJ5A 2YDSA 4U3CA 3EI0A 3AEFA 3RGLA 3RHWA 1Z0PA 3RC3A 4PK5A 3P4QA 2MOZA 4GK5E 2K24A 4U74A 3CMLA 2V5DA 2V6YB 3ZMZB 2V7IA 3L3PA 4HWHA 5JQGE 5FVKA 5AQUB 4LFAT 5LG3A 5L3CB 4H9PC 1KEYA 3QB5A 4A56A 3VU7H 5ABEA 2C5JA 4GKJT 2YKSA 1MIYA 2W61A 3I0OA 1MNDA 3RIUA 2XPKA 3RKGA 5LMUT 4YJ2E 2UUBT 3BQIA 2FJBA 4PJLA 1CUNA 5LGUB 4HFIA 2FBWA 2XM1A 4I4TE 3UUXB 4X62T 3H3AA 2BBJA 3ZYMA 5LG4A 2IC6A 5CGMA 3GWHA 4TWFA 3CX6B 4WYVA 2DHRA 4C90A 4LF5T 4AKGA 1IZNB 2E9XD 2JPFA 4NUVA 2XQ7A 3AVSA 1HTJF 2UXDT 2WZIA 3N9PA 1VOMA 2X9HA 5FXVA 4DR6T 4JBWF 3CWZB 2WS3A 3HKDE 5L3DB 3ZC1A 3DTOA 4CXXA 4LF4T 1G73A 3IEEA 4MBQA 3NVOA 1UGOA 3I1AA 5IUXA 3SS1A 5LGNB 3AE5A 1MNEA 2V5CA 4OHFA 2NW9A 2BS2A 3K3NA 4ZEYA 3C98B 2NTYA 3VHLA 4KBMB 3MACA 4AIUA 4K0KT 4GOUA 4F8HA 4UXNB 4X65T 3QK6A 4Z91A 3PUXF 3C4WA 1UUSA 3N9QA 2WQYA 2CE7A 4EYYR 3EDUA 4JI4T 2JMHA 4JI7T 4WNKA 4QH1A 4JI0T 2KSRA 3FB2A 3BQLA 3JADA 2WAUA 3LG7A 1E7PA 2PFVA 3VKGA 3MXZA 1E2AA 3DP7A 3UQ4A 5L47A 2F4VT 2XAFB 1ZEEA 3SOLA 4CZZB 4ILCA 4P0BA 1VCSA 3J7Yq 1W09A 1L0VA 4JI5T 3WAJA 3OKQA 2P9BA 3P50A 2XSAA 1EZ3A 5FY7A 2IMLA 4YHHT 5AQKB 2XQ4A 1OEDB 3NWIA 2V6YA 2RP4A 3E22E 3PUYF 3OYXA 1N32T 4LMKA 5AQSB 3ESLA 4LMLA 4DV3T 4NIQA 5JRCB 3AB3B 3HKEE 3EABA 3KV4A 2HH7A 1BR4A 3N2GE 2NWBA 3TLTA 4YTMA 1HG2A 4ZZCA 1LVFA 4K0UA 3ZJ2A 5HEJA 3KFWX 3HR0A 5AQIB 3GA8A 2EHOD 2OA5A 3O4XE 4YLHA 4HWCA 2FJDA 2YDRA 2ODUA 4GK0E 4ZZBA 4H63V 2A2FX 2ACXA 5IHYA 4O4HE 2LSYA 5LMNT 2WB5A 3L09A 2N2NA 3IHRA 2W2UA 1NWMX 2H7VC 2E9XA 2KINB 2BDEA 1UX5A 1MMAA 1XWMA 1U4QA 1OEDC 3AA0B 2DNXA 4ERRA 2WY2A 1AJ3A 3F2EA 2CEAA 3AE8A 1X79A 2XQ5A 2I59A 2ZLYA 4H9QC 2XAJB 2CBIA 5AQRB 2LSKA 3FZMB 1J1JA 2LHNA 3RQUA 3KV6A 4YT0A 4ZI3D 2CXFA 4AKLA 1HNXT 5EK2A 4TNVA 4UVAB 3KINB 2OV9A 3LJCA 4X66T 2WDRA 4HFHA 5DJQC 1ZV4X 3PURA 2VKHA 4KMCA 5JDMA 2LKHA 3A5XA 5LB7B 3AE2A 2JIWA 2VKDA 3ANWB 3R6NA 2CCQA 4IE4A 1CHUA 2H7OA 1HS7A 4DO0A 2KMFA 4I55E 2ES0A 2E5LT 4IT4A 4HWIB 1MIWA 3HKBE 4LF6T 1NAFA 2BS4A 4QX7B 3K3QC 5FVLA 5DABA 2X67A 2E5VA 2D0TA 4AQFA 3UULA 5F5WA 4B6XA 3NKZA 3O1JA 1HR0T 4U7IA 2LM2A 4UELA 3Q9DA 3Q5XA 4TZ4C 4EZHA 3RKOA 3C51A 1N36T 3ZMUB 4HFCA 4XAXB 3M3ZB 3U78A 2VWAA 4H9SE 4TX5A 2CWOA 4CN4A 4HFBA 4DV6T 4GYRA 1YKHB 4KUMB 4N78D 3FZFB 4FJOA 2C5IT 4B3TT 5JDNA 1YD8G 3V5SA 4CN1A 1OEDA 3AE1A 4U2ZA 5FMNA 2XAHB 4H9RC 4AXPA 2WCAA 4ZS2A 3CQCB 1SUMB 2L3LA 3RH3A 5ABGA 3ZT5A 2LOSA 2YEVC 4YTPA 2BKOA 2VASA 3RYFE 2XUEA 5JR9A 1KF6A 1GQEA 3KV5A 2IDOB 5EK3A 4IREA 4IE5A 4JI6T 5F8PA 2XASB 4PNIA 3NZQA 1O3XA 3Q5WA 4TWDA 3A8YC 4DV1T 3JC6C 5L3FB 4IDQA 5AQHB 4O4LE 2LOPA 5ABFA 4DNDA 2ZMAA 2X66A 2LRLA 1HFAA 3KBTA 3VR8A 3RF1A 5EK4A 2J47A 5HXHA 5FY0A 3OJAA 3RIAA 4EV6A 4COFA 3FBZA 3TKLB 2X0LB 1LVKA 5HCJA 3QOFA 4EZ4A 2LSGA 4A5XA 2LSIA 5GONE 5LJNA 5ETWA 4CQIA 4XZCA 4AISA 3CK6A 3AAEB 4ILUA 5JREA 4LF7T 1WR6A 4TNWA 5HEUA 3UU6A 2V7LA 4ZXLA 4PK4A 5HWXA 4TWHA 2J4GA 2C5KT 4PJNA 4QKNA 4JEHB 2UXNB 3EUHA 2PTFA 3FZHB 1KFYA 3OYZA 4CI3B 4DBQA 3EAMA 2CHNA 2KWIB 3ZMVB 4DMWA 3P4PA 1D1BA 3S4UA 4O2BE 2BKPA 2QGSA 4B3MT 2MYSA 4ZOLE 2IHR1 3QC9A 2BZBA 2HN1A 4PJJA 3RYCE 3AA6B 1ZOYA 3AA1B 2JQHA 2A9UA 5LBMA 2N1GA 2XY8B 4Z8XA 3NBXX 1HX1B 2BS3A 4HGAA 5KMGP 3AAAB 3KVBA 2E8IA 3ZPOA 2NTXA 2B1EA 4U33A 4JI3T 4AKIA 5JH7E 4DV4T 2XQYA 2XTLA 4QXBB 5AQQB 2V7MA 2Q9QB 4JI1T 3CKDA 1HG5A 3SRZA 3MZKB 4TUYE 1ZP0A 4A97A 5J2TE 3LBXA 1YKEB 2VVSA 3OBVE 3B57A 4QH4A 1BR2A 5L3EB 3AE6A 2CBJA 3TLVA 2I6HA 5CFBA 5HWYA 2K5BB 2ACZA 5J1GA 3FHNA
chains in the Genus database with same CATH topology
2IDOB 2AXDS 1SE7A 2XY8B 1DU2A 2AE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IDO B;  2AXD S;  1SE7 A;  2XY8 B;  1DU2 A;  2AE9 A; 
#chains in the Genus database with same CATH topology
 2VK9 A;  4HTE A;  2X51 A;  4DV7 T;  3LK2 B;  3Q5D A;  2ODV A;  4TV9 E;  3QB5 K;  3F31 A;  4IE0 A;  4PAG A;  1R8I A;  3UU3 A;  3EVY A;  3E0Z A;  1BR0 A;  2LM9 A;  5IWA T;  3Q2M A;  1W0A A;  4ANJ A;  3KVA A;  1IAP A;  3TLW A;  2ZM0 A;  1X9B A;  1ZHC A;  3GN5 A;  4G63 A;  2KZ7 B;  4UVC B;  1B7T A;  3BQK A;  1OED E;  4OK0 A;  3PUQ A;  3PUZ F;  2V6X A;  2Q9Q C;  3AVR A;  4I43 B;  1W9R A;  2WWU A;  3UU5 A;  1WLX A;  2A72 A;  1D1A A;  3PDY A;  2LSJ A;  4HFD A;  3NZP A;  2JRK A;  3P4R A;  2YDQ A;  3CVR A;  4HEA A;  5LCY A;  5A1L A;  2WP9 A;  5LP6 E;  4EB6 E;  3N9M A;  3ONL C;  4ISS A;  2H3R A;  2XM2 A;  3AED A;  3VKH A;  2DL1 A;  2W0G A;  2W66 A;  3LSV A;  3GMI A;  4OX9 T;  4MLK A;  2W63 A;  1I6Z A;  1FEW A;  2YIN A;  3AE3 A;  3P8C D;  3RRC A;  4LF8 T;  4KX6 A;  4JI2 T;  5FXX A;  2QVA A;  3ZJ1 A;  5ADX L;  2BG9 B;  1XZY A;  4X1K E;  3A7M A;  5AQJ B;  3I9W A;  5L3B B;  1VCT A;  3AEE A;  1V9D A;  3RIF A;  3VRA A;  4O8S A;  2XQA A;  3ZSS A;  4EOZ B;  4C91 A;  2HHH T;  2Z6E A;  4QHO A;  3WI3 A;  2NR4 A;  4IHJ E;  3KBU A;  5TAO A;  4EED A;  5HAX A;  2WSS V;  2D0U A;  2V7J A;  4KI0 F;  2W62 A;  3CX7 B;  3RC8 A;  2AXD S;  2LLY A;  1LKX A;  2W4X A;  2Q9Q A;  1WYB A;  3JAE A;  4PK6 A;  2XQ9 A;  3EDV A;  2CMR A;  4NXM T;  4GKK T;  5FL1 A;  3BK9 A;  3KDS E;  1Y64 B;  5LHH B;  3T1Y T;  3W15 B;  3I9Y A;  2D5U A;  4ZS3 A;  5JDQ A;  4ASK A;  2BG9 C;  1VRB A;  3ZMS B;  4UVB B;  2L8K A;  2UUC T;  4YXD A;  5F3J A;  3UU4 A;  2L9Q A;  4Q25 A;  3H3M A;  2RA1 A;  1WRD A;  1KNP A;  2M6B A;  4AI6 A;  1WFD A;  3FZK B;  5L3G B;  3AE4 A;  4ZI2 C;  4ILB A;  2EHO C;  3PJA J;  5LHG B;  2WMO A;  3OVU A;  2VL0 A;  4OYK A;  1MIV A;  3PUG A;  2WU5 A;  1SA0 E;  2R6G F;  2IIU A;  2BKN A;  5HXC A;  2VKO A;  3MKD A;  3ZLI A;  2X9Y A;  4YSZ A;  3ZT6 A;  4JI8 T;  4M1P A;  1SHZ C;  1XDP A;  2E2A A;  3ABV A;  2NP9 A;  2YU1 A;  4AQY T;  3JC6 D;  3PUS A;  2GK9 A;  2NOX A;  2JMK A;  4IE7 A;  1BR1 A;  1IBK T;  2CLY B;  4ZHQ E;  2JQQ A;  4H63 H;  4X20 E;  2H89 A;  2XSB A;  2FJE A;  3EHZ A;  3RI5 A;  1IBL T;  5LGT B;  4IL4 A;  4DUZ T;  2HN2 A;  2CA5 A;  2XQ6 A;  4AQG A;  4A98 A;  2LKG A;  2VB6 A;  2LHR A;  2K48 A;  2UU9 T;  3KV9 A;  3P4W A;  3ZC0 A;  5AQV B;  4IST A;  1US7 B;  2UXB T;  5AQP B;  1HX8 A;  4DR4 T;  3HL6 A;  3PE0 A;  3N9L A;  5HXR A;  4NPP A;  3T8O A;  1YQ4 A;  1HNZ T;  4JYA T;  5JRC A;  1XDO A;  3P4S A;  3QUJ A;  1S94 A;  3FBL A;  2X68 A;  2W67 A;  3FZL B;  5L4E A;  3UUM A;  2BG9 A;  4HFV A;  3N9N A;  3RIU C;  3C50 A;  3V5U A;  3M65 A;  2KXP B;  2VUR A;  3ZCJ A;  3ZN1 B;  2W00 A;  1W0B A;  2Y48 B;  4DR2 T;  4MFR A;  2BBH A;  3ZN0 B;  4IDP A;  3H37 A;  1JNR A;  3U3I A;  4G2A A;  2CLY C;  3G06 A;  3AE7 A;  4I50 E;  5BMV E;  4WZX A;  5DQV A;  3J9X 1;  5FXW A;  3PJA A;  2WZH A;  5JDH A;  3OTO T;  2DCF A;  2PJQ A;  5FL0 A;  4H9N C;  2CPT A;  2I0M A;  3MA9 A;  3N5L A;  3HKC E;  2PG8 A;  1KNR A;  3RPU A;  4HFE A;  2VL8 A;  4LF9 T;  2X0H A;  5FYM A;  5L2L A;  2QYW A;  2CWY A;  2KWH A;  4E7Z A;  5JTG A;  3ZYL A;  4JUY A;  3LDQ B;  2CRB A;  3R84 B;  3FXE B;  3C64 A;  4IGU A;  4QX8 B;  4BJN A;  2C0S A;  1UX4 A;  3ANW A;  4IDN A;  2XAG B;  3DJB A;  3Q5E A;  2CM0 A;  3FXD B;  3PUW F;  4UIG A;  3CQG B;  1MMG A;  2VQE T;  2WU2 A;  4HWF A;  3ZEF B;  3UFE A;  5AQM B;  4U72 A;  4NXN T;  2NW7 A;  2ZM6 T;  3UT5 E;  3PU3 A;  4CI1 B;  5HYA A;  2Y6X A;  2A3D A;  4LFC T;  1J5E T;  3K8P C;  4IE6 A;  5LHI B;  4TV8 E;  5FNV E;  2J62 A;  2AE9 A;  4LMJ A;  1HF8 A;  5IYZ E;  1QSD A;  2V7K A;  5AFU L;  2K9A A;  2CXD A;  3TLU A;  2Y8D A;  5CA0 E;  4X64 T;  1KNZ A;  1LRZ A;  2Q9Q D;  3UTK A;  2UUA T;  5L4H A;  2V8S V;  1YW0 A;  5FY1 A;  3AE9 A;  3PTR B;  1D0Y A;  5EZY E;  4Z90 A;  2E9X B;  3X1D A;  2CHO A;  5CA1 E;  5HCM A;  1FMW A;  5CB4 E;  4EGW A;  3AEB A;  3UFG A;  4QWN B;  5H6R B;  5C8Y E;  1JNZ A;  1UUR A;  5LJM A;  2CXL A;  2X9X A;  5AQN B;  4LFB T;  2KLQ A;  3NRX A;  4JV5 T;  1FJG T;  2UXX B;  4YJ3 E;  2D9D A;  4DMV A;  4PJM A;  5M4Y A;  4UEM A;  3SWH A;  2BVL A;  4BJM A;  3HI2 A;  4DR7 T;  1NEK A;  4WBN E;  5JDG A;  3UUN A;  3PU8 A;  5LXT E;  4ADZ A;  1YQ3 A;  4EYU A;  4MHC A;  2XZE A;  4QXH B;  2LEH A;  3ZMT B;  3I0Q A;  5DQW A;  4KHP T;  3SFE A;  4U7Y A;  4H9O C;  2VKJ A;  3ZST A;  2WMN A;  4O2A E;  3QNU A;  5LA6 E;  2HPJ A;  1HCI A;  2B76 A;  3ONJ A;  4L9I A;  2YN6 A;  5CJ5 A;  2MPK A;  3AXJ B;  1MMN A;  2DI4 A;  2IUB A;  1Z8U A;  2E9X C;  2SPC A;  3ZKR A;  4KHZ F;  2JJ9 A;  1M62 A;  1NEN A;  4HWD A;  5ABH A;  5E0O A;  3C4Z A;  2BG9 E;  5LNK A;  4F6R C;  3SFD A;  1S35 A;  5HXS A;  4B3S T;  2NW8 A;  4BAY B;  4GIW A;  1J5W A;  3L39 A;  3RLF F;  4AKH A;  3F57 A;  3LFM A;  5HEG A;  2MBG A;  2IC9 A;  4YFS A;  1XNQ T;  2J1D G;  5LOV E;  2MAW A;  2M6I A;  3P7I A;  3VR9 A;  4P1N A;  4L0R A;  2XJ7 A;  5J0Z A;  4HKA A;  3JCF A;  4YTN A;  4PW8 A;  1T72 A;  3ZCI A;  5KX5 E;  4PFO A;  1WR0 A;  3K3O A;  3TLS A;  2LE8 A;  4YY3 T;  2XHE B;  4IIJ E;  4UF0 B;  3HA4 A;  1H7C A;  4O4I E;  5JDL A;  1OXZ A;  3B13 A;  4UV8 B;  3ETV A;  3AEG A;  3CX8 B;  2DWG A;  3RYI E;  4IDO A;  4OFZ A;  1I94 T;  5JR9 B;  2MTQ A;  4DVD A;  4HN9 A;  3C4X A;  4ZI2 D;  4JEU B;  4AQF C;  4UR9 A;  5AQL B;  5HXE A;  1IBM T;  3ZT7 A;  2EHO B;  2VQF T;  3B5M A;  2HPL A;  4YHJ A;  4MAL A;  1HNW T;  4U2Y A;  5FP3 A;  2DLR A;  2V1D B;  2OLT A;  2VVN A;  2XQ3 A;  5ABF B;  3E08 A;  2QRX A;  2WM9 A;  4I0U A;  1T7S A;  2XAQ B;  3IA3 A;  2BVM A;  2RPA A;  3IBP A;  4IL9 A;  2V26 A;  1M7K A;  2JQ9 A;  2LRK A;  4V1A v;  5KXJ A;  1E1H B;  2D2S A;  1YXR A;  4EXT A;  1N33 T;  3CQX C;  3MJX A;  2YU2 A;  2PBI A;  4EEB A;  3ETU A;  3PUV F;  2IAK A;  3K1S A;  3AA7 B;  5JR9 C;  3AAI A;  4QH5 A;  2LJL A;  4E7S A;  5KDM C;  4JLE A;  4QXC B;  4DR5 T;  3T1H T;  1G8X A;  4CXW A;  3RRW A;  4P09 A;  1UCU A;  4BA9 A;  5AQG B;  5HEH A;  4UV9 B;  2X9W A;  1ZKE A;  2LT3 A;  3LK4 2;  2X0Y A;  3LK3 B;  3ONX A;  4P0A A;  4FI5 A;  4J2C A;  1MMD A;  2IW5 B;  5FKY A;  1DU2 A;  3AXJ A;  3UUB A;  3PUA A;  5J2U E;  4EAH A;  5LYJ E;  2KT9 A;  1U5P A;  1T98 A;  3VRB A;  4CI2 B;  2H88 A;  4DV2 T;  1XMQ T;  4PFP A;  1XNR T;  3UU8 A;  2XQ8 A;  4ZI7 E;  2ZM2 A;  4HE8 A;  4B3R T;  1QLB A;  4WW0 A;  4CXY A;  2FUP A;  3N2O A;  3CIR A;  3WAK A;  5LBQ B;  4DUY T;  2DWK A;  1D1C A;  1FMV A;  1WCR A;  4X1Y E;  4CN6 A;  4OYJ A;  3O1H A;  4X1I E;  1UK5 A;  4ZI3 C;  2FJA A;  4DV5 T;  5FXZ A;  3LBX B;  1SE7 A;  1T8B A;  2WWV A;  4TN7 B;  5HEO A;  2WBL A;  2JQK A;  4KP3 C;  1N34 T;  1D0Z A;  4UF0 A;  3PV0 F;  4DBR A;  1QUU A;  4ILA A;  1FIO A;  2YK0 A;  5H6Q B;  3ZYK A;  3CPZ A;  5C3J A;  1IJ6 A;  2WDV A;  1OWA A;  4GYS A;  1D0X A;  4U31 A;  2KND A;  2UXC T;  5AQT B;  3IF8 B;  4YSX A;  3NRY A;  5AQF B;  3L8R A;  4O4J E;  5C2T A;  5JDF A;  3RX6 A;  2EHO A;  1XMO T;  3AEA A;  3UQ7 A;  3RYH E;  4X5T A;  3GN5 B;  3MK7 C;  4DR1 T;  3N2K E;  4XBF B;  3D0T A;  4YSY A;  1KK7 A;  2G0U A;  2K3W A;  2WDQ A;  4NUU A;  2M67 A;  1Y01 A;  4IDZ A;  3AEC A;  4EIW A;  2ZM8 A;  4AKR B;  2QA7 A;  3RQW A;  5BR8 T;  2N9D A;  1WYC A;  4DV0 T;  3OPC A;  4WBO A;  4DID B;  2YOE A;  4L5G A;  3O9X A;  5JVD E;  5AQO B;  3O1I A;  3JAF A;  4DR3 T;  3N9O A;  1IJ5 A;  2YDS A;  4U3C A;  3EI0 A;  3AEF A;  3RGL A;  3RHW A;  1Z0P A;  3RC3 A;  4PK5 A;  3P4Q A;  2MOZ A;  4GK5 E;  2K24 A;  4U74 A;  3CML A;  2V5D A;  2V6Y B;  3ZMZ B;  2V7I A;  3L3P A;  4HWH A;  5JQG E;  5FVK A;  5AQU B;  4LFA T;  5LG3 A;  5L3C B;  4H9P C;  1KEY A;  3QB5 A;  4A56 A;  3VU7 H;  5ABE A;  2C5J A;  4GKJ T;  2YKS A;  1MIY A;  2W61 A;  3I0O A;  1MND A;  3RIU A;  2XPK A;  3RKG A;  5LMU T;  4YJ2 E;  2UUB T;  3BQI A;  2FJB A;  4PJL A;  1CUN A;  5LGU B;  4HFI A;  2FBW A;  2XM1 A;  4I4T E;  3UUX B;  4X62 T;  3H3A A;  2BBJ A;  3ZYM A;  5LG4 A;  2IC6 A;  5CGM A;  3GWH A;  4TWF A;  3CX6 B;  4WYV A;  2DHR A;  4C90 A;  4LF5 T;  4AKG A;  1IZN B;  2E9X D;  2JPF A;  4NUV A;  2XQ7 A;  3AVS A;  1HTJ F;  2UXD T;  2WZI A;  3N9P A;  1VOM A;  2X9H A;  5FXV A;  4DR6 T;  4JBW F;  3CWZ B;  2WS3 A;  3HKD E;  5L3D B;  3ZC1 A;  3DTO A;  4CXX A;  4LF4 T;  1G73 A;  3IEE A;  4MBQ A;  3NVO A;  1UGO A;  3I1A A;  5IUX A;  3SS1 A;  5LGN B;  3AE5 A;  1MNE A;  2V5C A;  4OHF A;  2NW9 A;  2BS2 A;  3K3N A;  4ZEY A;  3C98 B;  2NTY A;  3VHL A;  4KBM B;  3MAC A;  4AIU A;  4K0K T;  4GOU A;  4F8H A;  4UXN B;  4X65 T;  3QK6 A;  4Z91 A;  3PUX F;  3C4W A;  1UUS A;  3N9Q A;  2WQY A;  2CE7 A;  4EYY R;  3EDU A;  4JI4 T;  2JMH A;  4JI7 T;  4WNK A;  4QH1 A;  4JI0 T;  2KSR A;  3FB2 A;  3BQL A;  3JAD A;  2WAU A;  3LG7 A;  1E7P A;  2PFV A;  3VKG A;  3MXZ A;  1E2A A;  3DP7 A;  3UQ4 A;  5L47 A;  2F4V T;  2XAF B;  1ZEE A;  3SOL A;  4CZZ B;  4ILC A;  4P0B A;  1VCS A;  3J7Y q;  1W09 A;  1L0V A;  4JI5 T;  3WAJ A;  3OKQ A;  2P9B A;  3P50 A;  2XSA A;  1EZ3 A;  5FY7 A;  2IML A;  4YHH T;  5AQK B;  2XQ4 A;  1OED B;  3NWI A;  2V6Y A;  2RP4 A;  3E22 E;  3PUY F;  3OYX A;  1N32 T;  4LMK A;  5AQS B;  3ESL A;  4LML A;  4DV3 T;  4NIQ A;  5JRC B;  3AB3 B;  3HKE E;  3EAB A;  3KV4 A;  2HH7 A;  1BR4 A;  3N2G E;  2NWB A;  3TLT A;  4YTM A;  1HG2 A;  4ZZC A;  1LVF A;  4K0U A;  3ZJ2 A;  5HEJ A;  3KFW X;  3HR0 A;  5AQI B;  3GA8 A;  2EHO D;  2OA5 A;  3O4X E;  4YLH A;  4HWC A;  2FJD A;  2YDR A;  2ODU A;  4GK0 E;  4ZZB A;  4H63 V;  2A2F X;  2ACX A;  5IHY A;  4O4H E;  2LSY A;  5LMN T;  2WB5 A;  3L09 A;  2N2N A;  3IHR A;  2W2U A;  1NWM X;  2H7V C;  2E9X A;  2KIN B;  2BDE A;  1UX5 A;  1MMA A;  1XWM A;  1U4Q A;  1OED C;  3AA0 B;  2DNX A;  4ERR A;  2WY2 A;  1AJ3 A;  3F2E A;  2CEA A;  3AE8 A;  1X79 A;  2XQ5 A;  2I59 A;  2ZLY A;  4H9Q C;  2XAJ B;  2CBI A;  5AQR B;  2LSK A;  3FZM B;  1J1J A;  2LHN A;  3RQU A;  3KV6 A;  4YT0 A;  4ZI3 D;  2CXF A;  4AKL A;  1HNX T;  5EK2 A;  4TNV A;  4UVA B;  3KIN B;  2OV9 A;  3LJC A;  4X66 T;  2WDR A;  4HFH A;  5DJQ C;  1ZV4 X;  3PUR A;  2VKH A;  4KMC A;  5JDM A;  2LKH A;  3A5X A;  5LB7 B;  3AE2 A;  2JIW A;  2VKD A;  3ANW B;  3R6N A;  2CCQ A;  4IE4 A;  1CHU A;  2H7O A;  1HS7 A;  4DO0 A;  2KMF A;  4I55 E;  2ES0 A;  2E5L T;  4IT4 A;  4HWI B;  1MIW A;  3HKB E;  4LF6 T;  1NAF A;  2BS4 A;  4QX7 B;  3K3Q C;  5FVL A;  5DAB A;  2X67 A;  2E5V A;  2D0T A;  4AQF A;  3UUL A;  5F5W A;  4B6X A;  3NKZ A;  3O1J A;  1HR0 T;  4U7I A;  2LM2 A;  4UEL A;  3Q9D A;  3Q5X A;  4TZ4 C;  4EZH A;  3RKO A;  3C51 A;  1N36 T;  3ZMU B;  4HFC A;  4XAX B;  3M3Z B;  3U78 A;  2VWA A;  4H9S E;  4TX5 A;  2CWO A;  4CN4 A;  4HFB A;  4DV6 T;  4GYR A;  1YKH B;  4KUM B;  4N78 D;  3FZF B;  4FJO A;  2C5I T;  4B3T T;  5JDN A;  1YD8 G;  3V5S A;  4CN1 A;  1OED A;  3AE1 A;  4U2Z A;  5FMN A;  2XAH B;  4H9R C;  4AXP A;  2WCA A;  4ZS2 A;  3CQC B;  1SUM B;  2L3L A;  3RH3 A;  5ABG A;  3ZT5 A;  2LOS A;  2YEV C;  4YTP A;  2BKO A;  2VAS A;  3RYF E;  2XUE A;  5JR9 A;  1KF6 A;  1GQE A;  3KV5 A;  2IDO B;  5EK3 A;  4IRE A;  4IE5 A;  4JI6 T;  5F8P A;  2XAS B;  4PNI A;  3NZQ A;  1O3X A;  3Q5W A;  4TWD A;  3A8Y C;  4DV1 T;  3JC6 C;  5L3F B;  4IDQ A;  5AQH B;  4O4L E;  2LOP A;  5ABF A;  4DND A;  2ZMA A;  2X66 A;  2LRL A;  1HFA A;  3KBT A;  3VR8 A;  3RF1 A;  5EK4 A;  2J47 A;  5HXH A;  5FY0 A;  3OJA A;  3RIA A;  4EV6 A;  4COF A;  3FBZ A;  3TKL B;  2X0L B;  1LVK A;  5HCJ A;  3QOF A;  4EZ4 A;  2LSG A;  4A5X A;  2LSI A;  5GON E;  5LJN A;  5ETW A;  4CQI A;  4XZC A;  4AIS A;  3CK6 A;  3AAE B;  4ILU A;  5JRE A;  4LF7 T;  1WR6 A;  4TNW A;  5HEU A;  3UU6 A;  2V7L A;  4ZXL A;  4PK4 A;  5HWX A;  4TWH A;  2J4G A;  2C5K T;  4PJN A;  4QKN A;  4JEH B;  2UXN B;  3EUH A;  2PTF A;  3FZH B;  1KFY A;  3OYZ A;  4CI3 B;  4DBQ A;  3EAM A;  2CHN A;  2KWI B;  3ZMV B;  4DMW A;  3P4P A;  1D1B A;  3S4U A;  4O2B E;  2BKP A;  2QGS A;  4B3M T;  2MYS A;  4ZOL E;  2IHR 1;  3QC9 A;  2BZB A;  2HN1 A;  4PJJ A;  3RYC E;  3AA6 B;  1ZOY A;  3AA1 B;  2JQH A;  2A9U A;  5LBM A;  2N1G A;  2XY8 B;  4Z8X A;  3NBX X;  1HX1 B;  2BS3 A;  4HGA A;  5KMG P;  3AAA B;  3KVB A;  2E8I A;  3ZPO A;  2NTX A;  2B1E A;  4U33 A;  4JI3 T;  4AKI A;  5JH7 E;  4DV4 T;  2XQY A;  2XTL A;  4QXB B;  5AQQ B;  2V7M A;  2Q9Q B;  4JI1 T;  3CKD A;  1HG5 A;  3SRZ A;  3MZK B;  4TUY E;  1ZP0 A;  4A97 A;  5J2T E;  3LBX A;  1YKE B;  2VVS A;  3OBV E;  3B57 A;  4QH4 A;  1BR2 A;  5L3E B;  3AE6 A;  2CBJ A;  3TLV A;  2I6H A;  5CFB A;  5HWY A;  2K5B B;  2ACZ A;  5J1G A;  3FHN A; 
#chains in the Genus database with same CATH homology
 2IDO B;  2AXD S;  1SE7 A;  2XY8 B;  1DU2 A;  2AE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...