4JI3T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji3T00
1XNRT 4X65T 4DR2T 5LMUT 2F4VT 4YHHT 4B3ST 5BR8T 2UU9T 1N36T 5IWAT 2UXCT 4KHPT 5LMNT 4JI1T 4AQYT 4B3TT 2UUBT 4LF6T 1XNQT 4DR6T 4DV5T 4DV6T 4JI6T 4LFBT 4JYAT 4JI2T 2E5LT 2HHHT 4NXNT 2UUAT 4X64T 4DR5T 1XMOT 1IBMT 1N33T 3T1YT 4GKJT 4X66T 2UUCT 4JV5T 1I94T 4GKKT 4DUYT 4DV3T 4JI4T 1HNWT 1J5ET 1FJGT 4X62T 4DUZT 1XMQT 2VQET 4K0KT 4LFAT 3OTOT 4JI3T 1HNXT 4DR4T 3T1HT 4LF4T 4DV4T 1IBKT 4DR7T 4DV0T 4LFCT 2UXBT 4NXMT 4YY3T 4LF5T 4LF7T 1N32T 1N34T 2ZM6T 4JI5T 1HNZT 2UXDT 4DR3T 4LF8T 4DV1T 4JI7T 4B3MT 4LF9T 4JI8T 4B3RT 4OX9T 2VQFT 4DR1T 1IBLT 4JI0T 4DV7T 1HR0T 4DV2T
chains in the Genus database with same CATH superfamily
3PUVF 2DWGA 5FXVA 5AQKB 5AQVB 1YW0A 3P7IA 2FJEA 4HFDA 3P8CD 4IDQA 4NUUA 1H7CA 5AQSB 3EVYA 2HH7A 4J2CA 2LKHA 4N78D 5L3BB 2OA5A 5EZYE 5JRCB 4TV9E 1HF8A 2MOZA 5BR8T 2UU9T 2EHOC 3PU8A 1MIVA 3IBPA 4X5TA 5C3JA 2LM9A 3N9MA 5L3DB 4PFOA 3I0OA 3RX6A 3ZT7A 1R8IA 3AEAA 4IE6A 5FXZA 2JPFA 1J1JA 3N9PA 3UU5A 2I59A 5LG4A 3EHZA 4AQYT 1WYCA 4WZXA 4JBWF 2WZIA 3SWHA 4ZI2D 3V5SA 2UUBT 2R6GF 2W4XA 5LJNA 4OK0A 3ZEFB 1XNQT 2QYWA 4U2ZA 3E08A 3JAFA 2V8SV 3GN5B 1W9RA 2PFVA 4HKAA 2X68A 4IHJE 5E0OA 2IC9A 2JIWA 4I43B 1T7SA 2KLQA 2LM2A 2WMNA 1X79A 3RYCE 5HEJA 2D0UA 4AQFA 2CWOA 3PE0A 4H9RC 4HFIA 4AQGA 4P1NA 4YJ2E 3ZYMA 3UT5E 4HFVA 2D2SA 4LMKA 3A5XA 1D0YA 2W62A 2BVMA 4GYSA 4QXHB 4TNVA 4HE8A 4PJMA 4UXNB 3ANWA 3U3IA 3NRYA 3DP7A 2UUAT 3AXJA 3QOFA 3AXJB 4DVDA 5FVLA 2CE7A 3PJAA 3Q9DA 2DL1A 3ZJ2A 2VKDA 4TUYE 4ZOLE 4YSXA 2W67A 2Q9QA 3AE7A 4QKNA 3RYFE 1YQ3A 3BQKA 3HL6A 4AKLA 2CEAA 2BZBA 3T1YT 1UGOA 4ILUA 3ZMTB 1IBMT 2EHOD 2YDSA 2YN6A 4QH1A 2LJLA 3G06A 3K3OA 3P4QA 4HEAA 4QH5A 5FXWA 3UFEA 2YKSA 1XDOA 3RF1A 4TN7B 3ZT5A 3F57A 4BA9A 4U74A 4PNIA 4F6RC 1IJ6A 3PUSA 4IDOA 5H6QB 5CB4E 2WQYA 2CPTA 4ZEYA 2KWHA 3ZMUB 5CGMA 3KV9A 1WR6A 3SFEA 3RYIE 3VR8A 5JDHA 5LYJE 2DI4A 4L9IA 5AQQB 1D0XA 3RI5A 2L3LA 2CXLA 4QXBB 3AAIA 2E9XD 2ZM8A 5LBQB 2VQET 4AI6A 2UXXB 2W66A 1IJ5A 1T98A 2KXPB 4IREA 1HTJF 2V5CA 5L3EB 3T1HT 2Q9QB 1OEDA 4LF4T 5AQHB 5JR9C 3OPCA 3RGLA 2NOXA 4DV4T 3KDSE 2QRXA 2N2NA 4QHOA 4UEMA 1IZNB 2B76A 2VB6A 4OFZA 1IBKT 3Q5XA 4JEUB 2FJAA 1D1BA 1O3XA 5CFBA 2UXBT 2W63A 2XQ4A 2OV9A 5F8PA 4I55E 1U4QA 2ZM0A 5JR9A 5J0ZA 1NAFA 3CWZB 3KBTA 4MHCA 3KINB 4DNDA 4UF0B 4Z91A 5FVKA 5FY1A 1E2AA 4LF5T 5HXEA 3ONLC 3EDVA 3NWIA 3Q5EA 4YLHA 2ZM6T 5L4HA 3AEBA 1LVFA 3N9NA 2WDVA 5JDMA 2LOSA 2I0MA 2J4GA 1FMWA 2K5BB 2DNXA 2ODUA 5DJQC 3R6NA 4BJMA 4DBQA 4DR3T 2VL8A 2QA7A 2CHNA 2KWIB 3IF8B 3LK42 4HWDA 4A97A 1BR0A 3GMIA 2NW9A 2DWKA 2PJQA 5DQWA 4E7SA 3P50A 4JLEA 4DV1T 2MAWA 4LF9T 1SE7A 2V7MA 2CA5A 4B6XA 4ANJA 1VRBA 2K9AA 4EV6A 2H88A 2CRBA 3CK6A 4M1PA 5AQJB 2XQ9A 2WM9A 4ZI7E 2X9YA 4Z90A 4OX9T 2NR4A 2KINB 2VQFT 1S94A 2LSKA 3CQCB 4IDZA 2OLTA 2BBJA 2J62A 4U3CA 2Y6XA 3A8YC 4WBOA 2WU2A 1QSDA 2YINA 3ZMVB 5LP6E 5JDFA 4ZZCA 3ONJA 1G8XA 3ZMZB 3CX6B 3QK6A 3MACA 5JTGA 5LMUT 4MBQA 4YHHT 2IC6A 4IE0A 3PURA 2XAGB 3PUAA 2H7VC 3KV4A 1N36T 4HWFA 3K3QC 2LKGA 2YDQA 5FYMA 5F3JA 3KFWX 4IL9A 2LSGA 3F2EA 5FY0A 2JJ9A 1UK5A 3F31A 5AQLB 3P4PA 4HFCA 4TX5A 2VL0A 4U7YA 4JI1T 2LHNA 2N1GA 3NZQA 4KMCA 5HCMA 5TAOA 4B3TT 3TLUA 3AEFA 3PTRB 5HWXA 4BAYB 3AA6B 3CX8B 3TLVA 3L09A 1MNDA 1OEDE 1ZKEA 5FXXA 2PTFA 2NWBA 3GWHA 3OBVE 4CN4A 4DV5T 4CXWA 2X51A 1VOMA 4DV6T 2VKHA 1Z8UA 1UUSA 3RYHE 1G73A 3KBUA 2V7JA 2HN1A 3QB5A 4P09A 3CQGB 3H3AA 4NIQA 2ZLYA 4YTPA 4X1YE 1YQ4A 5EK4A 3UU8A 4TWDA 3P4SA 5HXRA 3NVOA 3VU7H 5IHYA 3L39A 3ANWB 1E7PA 3DTOA 2XQ7A 2LT3A 3VRBA 4OHFA 5JDGA 2BKNA 4X64T 3ZC0A 4DIDB 3L3PA 4IE4A 5KX5E 4UV8B 2BG9B 1VCSA 1YKEB 1LVKA 1XMOT 1VCTA 3J9X1 4FJOA 3CQXC 3FZLB 1US7B 3O1JA 4O2BE 5FKYA 3OYXA 4GKJT 3RIFA 4AKGA 2X9HA 4AKRB 2HN2A 2LE8A 2W00A 4X66T 2UUCT 3FZMB 4JV5T 2E2AA 3AEEA 5GONE 3N2OA 3LBXA 4E7ZA 4JI4T 1ZEEA 1M62A 2FUPA 5EK3A 5IYZE 3ZN1B 5HXSA 1J5ET 3C4WA 1HX1B 4ILCA 3LSVA 2I6HA 3Q5WA 5AQMB 4PK5A 3ZPOA 5IUXA 1X9BA 2C5IT 2WCAA 5EK2A 3RC8A 3CVRA 3EABA 4U72A 4UVAB 4V1Av 2XZEA 2Q9QC 4NPPA 4PJJA 4KHZF 1HG2A 2XAQB 4U31A 1YD8G 3K1SA 3MK7C 2MBGA 3FHNA 3KVAA 5AFUL 5JH7E 5CA0E 3SS1A 4K0KT 4GK0E 1D0ZA 3FZFB 3KV6A 2JQHA 5LJMA 3VKHA 3OKQA 3ETVA 3RIUC 3N2KE 3RRCA 2YDRA 4CN1A 4UV9B 1E1HB 1D1AA 2W0GA 5LA6E 5LB7B 5ABHA 2XUEA 2VVSA 2W2UA 2V5DA 4CXYA 3AVSA 1T8BA 3QC9A 5CJ5A 4WBNE 2IW5B 2WU5A 3PUQA 2HPJA 4KI0F 3ZKRA 1LRZA 3AA0B 3UU4A 2BG9C 4X1KE 2C0SA 2NW8A 4LFCT 3EUHA 2L8KA 3PUXF 4NXMT 1M7KA 2XAFB 4TWHA 2B1EA 3ZJ1A 4EB6E 1S35A 2YOEA 4WNKA 3RIAA 2UXNB 5ABFB 5ABFA 5LXTE 4OYJA 3SRZA 3UUMA 4I50E 4UF0A 4G2AA 2XM1A 2M6BA 4XAXB 1N34T 1OEDC 1Y64B 3E22E 2IAKA 3RQUA 4H9QC 4JI5T 5LHIB 4MFRA 5ADXL 2XQYA 4OYKA 2VURA 1FEWA 4P0BA 3HA4A 3QUJA 4HN9A 3TKLB 3HKCE 3PUGA 3CIRA 4H9SE 3AECA 1J5WA 2BBHA 1OEDB 4A98A 2GK9A 4LF8T 1KNZA 5BMVE 5L2LA 2CBJA 4KUMB 4TNWA 4PK4A 1ZOYA 4YXDA 2V26A 2E9XC 3JCFA 3N9LA 3T8OA 1BR2A 5FY7A 2XQ8A 2ZM2A 5L3FB 3A7MA 2X9WA 3OYZA 2LSJA 4CI1B 4DV7T 3AE8A 2A72A 5H6RB 1HR0T 3IHRA 2IIUA 1ZHCA 3C50A 3LDQB 3TLSA 2MTQA 4X65T 3NBXX 4DR2T 5F5WA 2V6YB 1OWAA 2V1DB 2F4VT 4ILAA 3I9YA 3ZC1A 3PUZF 2BDEA 1JNZA 4B3ST 4IGUA 4IE5A 3FBZA 2UXCT 4YJ3E 4WYVA 4TV8E 1HG5A 1WRDA 5C2TA 4KHPT 4CN6A 5HEGA 3AE4A 3RC3A 5LMNT 5HYAA 5FP3A 1WR0A 2WP9A 4HTEA 1Z0PA 4ZHQE 4QX8B 4AQFC 4CQIA 2BVLA 2LRLA 2FJBA 3LG7A 2BG9E 2WSSV 2JRKA 5LGNB 1YXRA 2LLYA 3ESLA 4LF6T 2BS4A 4DR6T 2YEVC 2BS3A 2AXDS 1KF6A 2LSIA 2ZMAA 3OVUA 3PJAJ 4H9OC 4PW8A 5J2UE 1UCUA 2XQAA 4EGWA 4JYAT 3MZKB 3U78A 4PAGA 1WLXA 4TZ4C 1UURA 1QUUA 3JADA 5JREA 2HHHT 2KZ7B 4QX7B 1SUMB 1SA0E 3H37A 2MPKA 3O4XE 3OJAA 4HFHA 3QB5K 3S4UA 5JDNA 3IA3A 2DCFA 1ZP0A 1U5PA 4NUVA 5LG3A 1I6ZA 4ZI2C 3HR0A 2V6XA 4F8HA 2E5VA 3BK9A 3ABVA 5LHHB 3SFDA 4DR5T 4GIWA 2Y8DA 1SHZC 3I1AA 2EHOB 2D9DA 2JMKA 2BS2A 2RPAA 2X0LB 3C51A 2XASB 2XQ6A 4I0UA 5ETWA 5AQTB 4YSYA 4ZS2A 4GKKT 2WZHA 2RP4A 3ZLIA 4DV3T 4JUYA 2A9UA 4HFBA 1HNWT 2DLRA 3ZCJA 4ZXLA 3TLTA 2LEHA 3N9OA 1XZYA 1FJGT 3AVRA 1OXZA 2X9XA 4MLKA 2A2FX 3J7Yq 2KT9A 4DMVA 2BKPA 1MMDA 3HKDE 4DUZT 3X1DA 3UUXB 1WCRA 5HEOA 3UQ7A 4HWIB 2XPKA 1T72A 3N9QA 3EDUA 4TWFA 3OTOT 1HCIA 2H7OA 4MALA 4XBFB 4ZI3C 2KMFA 2E8IA 2CLYB 3NKZA 3HI2A 5AQGB 4O4HE 4CZZB 2V7KA 3MKDA 4GOUA 2DHRA 4U7IA 3Q5DA 1V9DA 3MXZA 1B7TA 5HWYA 3AEDA 3W15B 2FBWA 2WDRA 5LOVE 3GA8A 4EZ4A 3B5MA 3V5UA 4DV0T 4UELA 2LRKA 4L0RA 3RLFF 3NRXA 3PUWF 3C98B 2MYSA 3AE5A 4IDPA 1CHUA 4CI3B 2BG9A 1W0BA 1XDPA 4YY3T 5HAXA 3L8RA 4AKIA 1MMGA 3EI0A 1BR1A 2WMOA 4AXPA 4LF7T 1N32T 2QVAA 1YKHB 5LBMA 5FL1A 2N9DA 1ZV4X 3FZKB 2VK9A 2WBLA 3JAEA 3LK2B 2X0HA 3IEEA 4UR9A 4XZCA 5JRCA 1HNZT 2PG8A 2VVNA 4GYRA 3WAKA 3VKGA 1D1CA 5ABGA 1NWMX 3KVBA 2CWYA 2H89A 4LFBT 1WYBA 4ISSA 2XY8B 4U2YA 2IUBA 4JI7T 5L3GB 4HWHA 5FNVE 4YSZA 4QXCB 1KFYA 2WDQA 3UTKA 3O1HA 4H63V 3B57A 3LK3B 4KBMB 3ZN0B 4CI2B 1WFDA 4B3RT 1QLBA 3VHLA 4EIWA 2XSAA 3E0ZA 2NP9A 4DR1T 1MIWA 4FI5A 2VKOA 2FJDA 2JQKA 3ETUA 4X20E 3K8PC 2IHR1 3AE6A 5AQIB 4LMJA 4DV2T 4PFPA 1KNRA 1LKXA 1KEYA 3AA1B 3PV0F 4ADZA 5KMGP 2JMHA 1XNRT 3K3NA 3PU3A 2A3DA 2HPLA 3KV5A 3RHWA 5L47A 1CUNA 4L5GA 1L0VA 5L3CB 4ASKA 2E9XA 3I0QA 5IWAT 2CBIA 2G0UA 3ONXA 2CMRA 4YTMA 3UULA 3RH3A 1NENA 4YT0A 3NZPA 1HS7A 3MA9A 2CM0A 2ACXA 1W0AA 4C90A 5HCJA 2BKOA 3FBLA 5HEUA 2IDOB 5C8YE 1FMVA 3FZHB 2VKJA 5JDQA 3UU6A 3BQLA 4EYUA 2CHOA 4I4TE 3LBXB 4ISTA 2X0YA 3TLWA 3CX7B 3M3ZB 4O4LE 5DQVA 4Q25A 4COFA 2ACZA 3CPZA 4JI6T 2IMLA 3B13A 5AQFB 3CKDA 4YFSA 5AQRB 4JI2T 4Z8XA 3UUBA 4A56A 2E5LT 5LCYA 3RKOA 2X67A 3RRWA 4NXNT 3N5LA 3UQ4A 4KP3C 4IE7A 2C5JA 2V6YA 4HFEA 1MNEA 2CXFA 4UVBB 4WW0A 3RPUA 2XSBA 3UFGA 5KDMC 2AE9A 2LSYA 2Y48B 5AQOB 1AJ3A 3ZSSA 5A1LA 2V7IA 4A5XA 3FB2A 5JQGE 3DJBA 4PJLA 2QGSA 3P4RA 4KX6A 3RIUA 4DMWA 3ZYLA 3C4XA 2Q9QD 4DBRA 3C64A 4PK6A 2XQ5A 2XQ3A 1N33T 4ILBA 1GQEA 3AEGA 4UIGA 2LHRA 3MJXA 3R84B 4IIJE 3LJCA 1I94T 2LOPA 4DUYT 3D0TA 2JQQA 5AQUB 4QWNB 4P0AA 1HFAA 2W61A 5J2TE 4DO0A 1JNRA 4AKHA 4UVCB 3AE2A 4EXTA 5AQNB 4H9PC 2D0TA 2YU1A 2VASA 2NW7A 2P9BA 2WAUA 4HWCA 3JC6D 2J47A 3ZYKA 3C4ZA 4X62T 2YU2A 3Q2MA 2XTLA 1XMQT 2XAJB 4EEBA 5ABEA 5LGUB 4C91A 2J1DG 3HKEE 3HKBE 3AAAB 2WY2A 4EOZB 3P4WA 4JI3T 4LFAT 1UX5A 2CCQA 3FXEB 1EZ3A 4QH4A 4ERRA 4ZS3A 1HNXT 4DR4T 3RKGA 5J1GA 2Z6EA 4EZHA 1HX8A 3WI3A 2WWUA 4H9NC 5FL0A 4IDNA 5JVDE 5KXJA 3AE3A 3FXDB 3ZCIA 2SPCA 2NTYA 4H63H 4BJNA 4CXXA 4EYYR 5CA1E 4O4IE 1FIOA 3UU3A 5L4EA 1W09A 2H3RA 3LFMA 4DR7T 1KK7A 2ES0A 2KSRA 4GK5E 3ZMSB 2CLYC 2ODVA 1MIYA 2K48A 3AE1A 1MMAA 5HEHA 5HXCA 4AIUA 2C5KT 3CMLA 1KNPA 3PUYF 2V7LA 1BR4A 5M4YA 2M67A 2WS3A 4G63A 3BQIA 4YHJA 3AB3B 3RQWA 1UX4A 3H3MA 2EHOA 4U33A 2D5UA 4EAHA 1NEKA 2M6IA 5AQPB 3JC6C 5HXHA 2E9XB 4YTNA 3ZT6A 1MMNA 2UXDT 5LNKA 4ZI3D 1IAPA 2XJ7A 1Y01A 2JQ9A 3GN5A 3M65A 4HGAA 4PJNA 4X1IE 5DABA 4AISA 3N2GE 3VR9A 3UUNA 2CXDA 2RA1A 3I9WA 3PDYA 5JDLA 3WAJA 3QNUA 3ZSTA 4B3MT 4O2AE 4JI8T 4K0UA 2K3WA 3O9XA 2WB5A 3AE9A 3EAMA 2NTXA 3SOLA 4EEDA 2KNDA 2XAHB 4ZZBA 2XHEB 2XM2A 3AA7B 4IT4A 3O1IA 2WWVA 4O8SA 2PBIA 4O4JE 5LGTB 2L9QA 2VWAA 1XWMA 2X66A 3AAEB 5JR9B 1IBLT 4JI0T 4LMLA 2YK0A 4IL4A 5FMNA 2K24A 3VRAA 5LHGB 4JEHB 1DU2A
chains in the Genus database with same CATH topology
1XNRT 4X65T 4DR2T 5LMUT 2F4VT 4YHHT 4B3ST 5BR8T 2UU9T 1N36T 5IWAT 2UXCT 4KHPT 5LMNT 4JI1T 4AQYT 4B3TT 2UUBT 4LF6T 1XNQT 4DR6T 4DV5T 4DV6T 4JI6T 4LFBT 4JYAT 4JI2T 2E5LT 2HHHT 4NXNT 2UUAT 4X64T 4DR5T 1XMOT 1IBMT 1N33T 3T1YT 4GKJT 4X66T 2UUCT 4JV5T 1I94T 4GKKT 4DUYT 4DV3T 4JI4T 1HNWT 1J5ET 1FJGT 4X62T 4DUZT 1XMQT 2VQET 4K0KT 4LFAT 3OTOT 4JI3T 1HNXT 4DR4T 3T1HT 4LF4T 4DV4T 1IBKT 4DR7T 4DV0T 4LFCT 2UXBT 4NXMT 4YY3T 4LF5T 4LF7T 1N32T 1N34T 2ZM6T 4JI5T 1HNZT 2UXDT 4DR3T 4LF8T 4DV1T 4JI7T 4B3MT 4LF9T 4JI8T 4B3RT 4OX9T 2VQFT 4DR1T 1IBLT 4JI0T 4DV7T 1HR0T 4DV2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR T;  4X65 T;  4DR2 T;  5LMU T;  2F4V T;  4YHH T;  4B3S T;  5BR8 T;  2UU9 T;  1N36 T;  5IWA T;  2UXC T;  4KHP T;  5LMN T;  4JI1 T;  4AQY T;  4B3T T;  2UUB T;  4LF6 T;  1XNQ T;  4DR6 T;  4DV5 T;  4DV6 T;  4JI6 T;  4LFB T;  4JYA T;  4JI2 T;  2E5L T;  2HHH T;  4NXN T;  2UUA T;  4X64 T;  4DR5 T;  1XMO T;  1IBM T;  1N33 T;  3T1Y T;  4GKJ T;  4X66 T;  2UUC T;  4JV5 T;  1I94 T;  4GKK T;  4DUY T;  4DV3 T;  4JI4 T;  1HNW T;  1J5E T;  1FJG T;  4X62 T;  4DUZ T;  1XMQ T;  2VQE T;  4K0K T;  4LFA T;  3OTO T;  4JI3 T;  1HNX T;  4DR4 T;  3T1H T;  4LF4 T;  4DV4 T;  1IBK T;  4DR7 T;  4DV0 T;  4LFC T;  2UXB T;  4NXM T;  4YY3 T;  4LF5 T;  4LF7 T;  1N32 T;  1N34 T;  2ZM6 T;  4JI5 T;  1HNZ T;  2UXD T;  4DR3 T;  4LF8 T;  4DV1 T;  4JI7 T;  4B3M T;  4LF9 T;  4JI8 T;  4B3R T;  4OX9 T;  2VQF T;  4DR1 T;  1IBL T;  4JI0 T;  4DV7 T;  1HR0 T;  4DV2 T; 
#chains in the Genus database with same CATH topology
 3PUV F;  2DWG A;  5FXV A;  5AQK B;  5AQV B;  1YW0 A;  3P7I A;  2FJE A;  4HFD A;  3P8C D;  4IDQ A;  4NUU A;  1H7C A;  5AQS B;  3EVY A;  2HH7 A;  4J2C A;  2LKH A;  4N78 D;  5L3B B;  2OA5 A;  5EZY E;  5JRC B;  4TV9 E;  1HF8 A;  2MOZ A;  5BR8 T;  2UU9 T;  2EHO C;  3PU8 A;  1MIV A;  3IBP A;  4X5T A;  5C3J A;  2LM9 A;  3N9M A;  5L3D B;  4PFO A;  3I0O A;  3RX6 A;  3ZT7 A;  1R8I A;  3AEA A;  4IE6 A;  5FXZ A;  2JPF A;  1J1J A;  3N9P A;  3UU5 A;  2I59 A;  5LG4 A;  3EHZ A;  4AQY T;  1WYC A;  4WZX A;  4JBW F;  2WZI A;  3SWH A;  4ZI2 D;  3V5S A;  2UUB T;  2R6G F;  2W4X A;  5LJN A;  4OK0 A;  3ZEF B;  1XNQ T;  2QYW A;  4U2Z A;  3E08 A;  3JAF A;  2V8S V;  3GN5 B;  1W9R A;  2PFV A;  4HKA A;  2X68 A;  4IHJ E;  5E0O A;  2IC9 A;  2JIW A;  4I43 B;  1T7S A;  2KLQ A;  2LM2 A;  2WMN A;  1X79 A;  3RYC E;  5HEJ A;  2D0U A;  4AQF A;  2CWO A;  3PE0 A;  4H9R C;  4HFI A;  4AQG A;  4P1N A;  4YJ2 E;  3ZYM A;  3UT5 E;  4HFV A;  2D2S A;  4LMK A;  3A5X A;  1D0Y A;  2W62 A;  2BVM A;  4GYS A;  4QXH B;  4TNV A;  4HE8 A;  4PJM A;  4UXN B;  3ANW A;  3U3I A;  3NRY A;  3DP7 A;  2UUA T;  3AXJ A;  3QOF A;  3AXJ B;  4DVD A;  5FVL A;  2CE7 A;  3PJA A;  3Q9D A;  2DL1 A;  3ZJ2 A;  2VKD A;  4TUY E;  4ZOL E;  4YSX A;  2W67 A;  2Q9Q A;  3AE7 A;  4QKN A;  3RYF E;  1YQ3 A;  3BQK A;  3HL6 A;  4AKL A;  2CEA A;  2BZB A;  3T1Y T;  1UGO A;  4ILU A;  3ZMT B;  1IBM T;  2EHO D;  2YDS A;  2YN6 A;  4QH1 A;  2LJL A;  3G06 A;  3K3O A;  3P4Q A;  4HEA A;  4QH5 A;  5FXW A;  3UFE A;  2YKS A;  1XDO A;  3RF1 A;  4TN7 B;  3ZT5 A;  3F57 A;  4BA9 A;  4U74 A;  4PNI A;  4F6R C;  1IJ6 A;  3PUS A;  4IDO A;  5H6Q B;  5CB4 E;  2WQY A;  2CPT A;  4ZEY A;  2KWH A;  3ZMU B;  5CGM A;  3KV9 A;  1WR6 A;  3SFE A;  3RYI E;  3VR8 A;  5JDH A;  5LYJ E;  2DI4 A;  4L9I A;  5AQQ B;  1D0X A;  3RI5 A;  2L3L A;  2CXL A;  4QXB B;  3AAI A;  2E9X D;  2ZM8 A;  5LBQ B;  2VQE T;  4AI6 A;  2UXX B;  2W66 A;  1IJ5 A;  1T98 A;  2KXP B;  4IRE A;  1HTJ F;  2V5C A;  5L3E B;  3T1H T;  2Q9Q B;  1OED A;  4LF4 T;  5AQH B;  5JR9 C;  3OPC A;  3RGL A;  2NOX A;  4DV4 T;  3KDS E;  2QRX A;  2N2N A;  4QHO A;  4UEM A;  1IZN B;  2B76 A;  2VB6 A;  4OFZ A;  1IBK T;  3Q5X A;  4JEU B;  2FJA A;  1D1B A;  1O3X A;  5CFB A;  2UXB T;  2W63 A;  2XQ4 A;  2OV9 A;  5F8P A;  4I55 E;  1U4Q A;  2ZM0 A;  5JR9 A;  5J0Z A;  1NAF A;  3CWZ B;  3KBT A;  4MHC A;  3KIN B;  4DND A;  4UF0 B;  4Z91 A;  5FVK A;  5FY1 A;  1E2A A;  4LF5 T;  5HXE A;  3ONL C;  3EDV A;  3NWI A;  3Q5E A;  4YLH A;  2ZM6 T;  5L4H A;  3AEB A;  1LVF A;  3N9N A;  2WDV A;  5JDM A;  2LOS A;  2I0M A;  2J4G A;  1FMW A;  2K5B B;  2DNX A;  2ODU A;  5DJQ C;  3R6N A;  4BJM A;  4DBQ A;  4DR3 T;  2VL8 A;  2QA7 A;  2CHN A;  2KWI B;  3IF8 B;  3LK4 2;  4HWD A;  4A97 A;  1BR0 A;  3GMI A;  2NW9 A;  2DWK A;  2PJQ A;  5DQW A;  4E7S A;  3P50 A;  4JLE A;  4DV1 T;  2MAW A;  4LF9 T;  1SE7 A;  2V7M A;  2CA5 A;  4B6X A;  4ANJ A;  1VRB A;  2K9A A;  4EV6 A;  2H88 A;  2CRB A;  3CK6 A;  4M1P A;  5AQJ B;  2XQ9 A;  2WM9 A;  4ZI7 E;  2X9Y A;  4Z90 A;  4OX9 T;  2NR4 A;  2KIN B;  2VQF T;  1S94 A;  2LSK A;  3CQC B;  4IDZ A;  2OLT A;  2BBJ A;  2J62 A;  4U3C A;  2Y6X A;  3A8Y C;  4WBO A;  2WU2 A;  1QSD A;  2YIN A;  3ZMV B;  5LP6 E;  5JDF A;  4ZZC A;  3ONJ A;  1G8X A;  3ZMZ B;  3CX6 B;  3QK6 A;  3MAC A;  5JTG A;  5LMU T;  4MBQ A;  4YHH T;  2IC6 A;  4IE0 A;  3PUR A;  2XAG B;  3PUA A;  2H7V C;  3KV4 A;  1N36 T;  4HWF A;  3K3Q C;  2LKG A;  2YDQ A;  5FYM A;  5F3J A;  3KFW X;  4IL9 A;  2LSG A;  3F2E A;  5FY0 A;  2JJ9 A;  1UK5 A;  3F31 A;  5AQL B;  3P4P A;  4HFC A;  4TX5 A;  2VL0 A;  4U7Y A;  4JI1 T;  2LHN A;  2N1G A;  3NZQ A;  4KMC A;  5HCM A;  5TAO A;  4B3T T;  3TLU A;  3AEF A;  3PTR B;  5HWX A;  4BAY B;  3AA6 B;  3CX8 B;  3TLV A;  3L09 A;  1MND A;  1OED E;  1ZKE A;  5FXX A;  2PTF A;  2NWB A;  3GWH A;  3OBV E;  4CN4 A;  4DV5 T;  4CXW A;  2X51 A;  1VOM A;  4DV6 T;  2VKH A;  1Z8U A;  1UUS A;  3RYH E;  1G73 A;  3KBU A;  2V7J A;  2HN1 A;  3QB5 A;  4P09 A;  3CQG B;  3H3A A;  4NIQ A;  2ZLY A;  4YTP A;  4X1Y E;  1YQ4 A;  5EK4 A;  3UU8 A;  4TWD A;  3P4S A;  5HXR A;  3NVO A;  3VU7 H;  5IHY A;  3L39 A;  3ANW B;  1E7P A;  3DTO A;  2XQ7 A;  2LT3 A;  3VRB A;  4OHF A;  5JDG A;  2BKN A;  4X64 T;  3ZC0 A;  4DID B;  3L3P A;  4IE4 A;  5KX5 E;  4UV8 B;  2BG9 B;  1VCS A;  1YKE B;  1LVK A;  1XMO T;  1VCT A;  3J9X 1;  4FJO A;  3CQX C;  3FZL B;  1US7 B;  3O1J A;  4O2B E;  5FKY A;  3OYX A;  4GKJ T;  3RIF A;  4AKG A;  2X9H A;  4AKR B;  2HN2 A;  2LE8 A;  2W00 A;  4X66 T;  2UUC T;  3FZM B;  4JV5 T;  2E2A A;  3AEE A;  5GON E;  3N2O A;  3LBX A;  4E7Z A;  4JI4 T;  1ZEE A;  1M62 A;  2FUP A;  5EK3 A;  5IYZ E;  3ZN1 B;  5HXS A;  1J5E T;  3C4W A;  1HX1 B;  4ILC A;  3LSV A;  2I6H A;  3Q5W A;  5AQM B;  4PK5 A;  3ZPO A;  5IUX A;  1X9B A;  2C5I T;  2WCA A;  5EK2 A;  3RC8 A;  3CVR A;  3EAB A;  4U72 A;  4UVA B;  4V1A v;  2XZE A;  2Q9Q C;  4NPP A;  4PJJ A;  4KHZ F;  1HG2 A;  2XAQ B;  4U31 A;  1YD8 G;  3K1S A;  3MK7 C;  2MBG A;  3FHN A;  3KVA A;  5AFU L;  5JH7 E;  5CA0 E;  3SS1 A;  4K0K T;  4GK0 E;  1D0Z A;  3FZF B;  3KV6 A;  2JQH A;  5LJM A;  3VKH A;  3OKQ A;  3ETV A;  3RIU C;  3N2K E;  3RRC A;  2YDR A;  4CN1 A;  4UV9 B;  1E1H B;  1D1A A;  2W0G A;  5LA6 E;  5LB7 B;  5ABH A;  2XUE A;  2VVS A;  2W2U A;  2V5D A;  4CXY A;  3AVS A;  1T8B A;  3QC9 A;  5CJ5 A;  4WBN E;  2IW5 B;  2WU5 A;  3PUQ A;  2HPJ A;  4KI0 F;  3ZKR A;  1LRZ A;  3AA0 B;  3UU4 A;  2BG9 C;  4X1K E;  2C0S A;  2NW8 A;  4LFC T;  3EUH A;  2L8K A;  3PUX F;  4NXM T;  1M7K A;  2XAF B;  4TWH A;  2B1E A;  3ZJ1 A;  4EB6 E;  1S35 A;  2YOE A;  4WNK A;  3RIA A;  2UXN B;  5ABF B;  5ABF A;  5LXT E;  4OYJ A;  3SRZ A;  3UUM A;  4I50 E;  4UF0 A;  4G2A A;  2XM1 A;  2M6B A;  4XAX B;  1N34 T;  1OED C;  1Y64 B;  3E22 E;  2IAK A;  3RQU A;  4H9Q C;  4JI5 T;  5LHI B;  4MFR A;  5ADX L;  2XQY A;  4OYK A;  2VUR A;  1FEW A;  4P0B A;  3HA4 A;  3QUJ A;  4HN9 A;  3TKL B;  3HKC E;  3PUG A;  3CIR A;  4H9S E;  3AEC A;  1J5W A;  2BBH A;  1OED B;  4A98 A;  2GK9 A;  4LF8 T;  1KNZ A;  5BMV E;  5L2L A;  2CBJ A;  4KUM B;  4TNW A;  4PK4 A;  1ZOY A;  4YXD A;  2V26 A;  2E9X C;  3JCF A;  3N9L A;  3T8O A;  1BR2 A;  5FY7 A;  2XQ8 A;  2ZM2 A;  5L3F B;  3A7M A;  2X9W A;  3OYZ A;  2LSJ A;  4CI1 B;  4DV7 T;  3AE8 A;  2A72 A;  5H6R B;  1HR0 T;  3IHR A;  2IIU A;  1ZHC A;  3C50 A;  3LDQ B;  3TLS A;  2MTQ A;  4X65 T;  3NBX X;  4DR2 T;  5F5W A;  2V6Y B;  1OWA A;  2V1D B;  2F4V T;  4ILA A;  3I9Y A;  3ZC1 A;  3PUZ F;  2BDE A;  1JNZ A;  4B3S T;  4IGU A;  4IE5 A;  3FBZ A;  2UXC T;  4YJ3 E;  4WYV A;  4TV8 E;  1HG5 A;  1WRD A;  5C2T A;  4KHP T;  4CN6 A;  5HEG A;  3AE4 A;  3RC3 A;  5LMN T;  5HYA A;  5FP3 A;  1WR0 A;  2WP9 A;  4HTE A;  1Z0P A;  4ZHQ E;  4QX8 B;  4AQF C;  4CQI A;  2BVL A;  2LRL A;  2FJB A;  3LG7 A;  2BG9 E;  2WSS V;  2JRK A;  5LGN B;  1YXR A;  2LLY A;  3ESL A;  4LF6 T;  2BS4 A;  4DR6 T;  2YEV C;  2BS3 A;  2AXD S;  1KF6 A;  2LSI A;  2ZMA A;  3OVU A;  3PJA J;  4H9O C;  4PW8 A;  5J2U E;  1UCU A;  2XQA A;  4EGW A;  4JYA T;  3MZK B;  3U78 A;  4PAG A;  1WLX A;  4TZ4 C;  1UUR A;  1QUU A;  3JAD A;  5JRE A;  2HHH T;  2KZ7 B;  4QX7 B;  1SUM B;  1SA0 E;  3H37 A;  2MPK A;  3O4X E;  3OJA A;  4HFH A;  3QB5 K;  3S4U A;  5JDN A;  3IA3 A;  2DCF A;  1ZP0 A;  1U5P A;  4NUV A;  5LG3 A;  1I6Z A;  4ZI2 C;  3HR0 A;  2V6X A;  4F8H A;  2E5V A;  3BK9 A;  3ABV A;  5LHH B;  3SFD A;  4DR5 T;  4GIW A;  2Y8D A;  1SHZ C;  3I1A A;  2EHO B;  2D9D A;  2JMK A;  2BS2 A;  2RPA A;  2X0L B;  3C51 A;  2XAS B;  2XQ6 A;  4I0U A;  5ETW A;  5AQT B;  4YSY A;  4ZS2 A;  4GKK T;  2WZH A;  2RP4 A;  3ZLI A;  4DV3 T;  4JUY A;  2A9U A;  4HFB A;  1HNW T;  2DLR A;  3ZCJ A;  4ZXL A;  3TLT A;  2LEH A;  3N9O A;  1XZY A;  1FJG T;  3AVR A;  1OXZ A;  2X9X A;  4MLK A;  2A2F X;  3J7Y q;  2KT9 A;  4DMV A;  2BKP A;  1MMD A;  3HKD E;  4DUZ T;  3X1D A;  3UUX B;  1WCR A;  5HEO A;  3UQ7 A;  4HWI B;  2XPK A;  1T72 A;  3N9Q A;  3EDU A;  4TWF A;  3OTO T;  1HCI A;  2H7O A;  4MAL A;  4XBF B;  4ZI3 C;  2KMF A;  2E8I A;  2CLY B;  3NKZ A;  3HI2 A;  5AQG B;  4O4H E;  4CZZ B;  2V7K A;  3MKD A;  4GOU A;  2DHR A;  4U7I A;  3Q5D A;  1V9D A;  3MXZ A;  1B7T A;  5HWY A;  3AED A;  3W15 B;  2FBW A;  2WDR A;  5LOV E;  3GA8 A;  4EZ4 A;  3B5M A;  3V5U A;  4DV0 T;  4UEL A;  2LRK A;  4L0R A;  3RLF F;  3NRX A;  3PUW F;  3C98 B;  2MYS A;  3AE5 A;  4IDP A;  1CHU A;  4CI3 B;  2BG9 A;  1W0B A;  1XDP A;  4YY3 T;  5HAX A;  3L8R A;  4AKI A;  1MMG A;  3EI0 A;  1BR1 A;  2WMO A;  4AXP A;  4LF7 T;  1N32 T;  2QVA A;  1YKH B;  5LBM A;  5FL1 A;  2N9D A;  1ZV4 X;  3FZK B;  2VK9 A;  2WBL A;  3JAE A;  3LK2 B;  2X0H A;  3IEE A;  4UR9 A;  4XZC A;  5JRC A;  1HNZ T;  2PG8 A;  2VVN A;  4GYR A;  3WAK A;  3VKG A;  1D1C A;  5ABG A;  1NWM X;  3KVB A;  2CWY A;  2H89 A;  4LFB T;  1WYB A;  4ISS A;  2XY8 B;  4U2Y A;  2IUB A;  4JI7 T;  5L3G B;  4HWH A;  5FNV E;  4YSZ A;  4QXC B;  1KFY A;  2WDQ A;  3UTK A;  3O1H A;  4H63 V;  3B57 A;  3LK3 B;  4KBM B;  3ZN0 B;  4CI2 B;  1WFD A;  4B3R T;  1QLB A;  3VHL A;  4EIW A;  2XSA A;  3E0Z A;  2NP9 A;  4DR1 T;  1MIW A;  4FI5 A;  2VKO A;  2FJD A;  2JQK A;  3ETU A;  4X20 E;  3K8P C;  2IHR 1;  3AE6 A;  5AQI B;  4LMJ A;  4DV2 T;  4PFP A;  1KNR A;  1LKX A;  1KEY A;  3AA1 B;  3PV0 F;  4ADZ A;  5KMG P;  2JMH A;  1XNR T;  3K3N A;  3PU3 A;  2A3D A;  2HPL A;  3KV5 A;  3RHW A;  5L47 A;  1CUN A;  4L5G A;  1L0V A;  5L3C B;  4ASK A;  2E9X A;  3I0Q A;  5IWA T;  2CBI A;  2G0U A;  3ONX A;  2CMR A;  4YTM A;  3UUL A;  3RH3 A;  1NEN A;  4YT0 A;  3NZP A;  1HS7 A;  3MA9 A;  2CM0 A;  2ACX A;  1W0A A;  4C90 A;  5HCJ A;  2BKO A;  3FBL A;  5HEU A;  2IDO B;  5C8Y E;  1FMV A;  3FZH B;  2VKJ A;  5JDQ A;  3UU6 A;  3BQL A;  4EYU A;  2CHO A;  4I4T E;  3LBX B;  4IST A;  2X0Y A;  3TLW A;  3CX7 B;  3M3Z B;  4O4L E;  5DQV A;  4Q25 A;  4COF A;  2ACZ A;  3CPZ A;  4JI6 T;  2IML A;  3B13 A;  5AQF B;  3CKD A;  4YFS A;  5AQR B;  4JI2 T;  4Z8X A;  3UUB A;  4A56 A;  2E5L T;  5LCY A;  3RKO A;  2X67 A;  3RRW A;  4NXN T;  3N5L A;  3UQ4 A;  4KP3 C;  4IE7 A;  2C5J A;  2V6Y A;  4HFE A;  1MNE A;  2CXF A;  4UVB B;  4WW0 A;  3RPU A;  2XSB A;  3UFG A;  5KDM C;  2AE9 A;  2LSY A;  2Y48 B;  5AQO B;  1AJ3 A;  3ZSS A;  5A1L A;  2V7I A;  4A5X A;  3FB2 A;  5JQG E;  3DJB A;  4PJL A;  2QGS A;  3P4R A;  4KX6 A;  3RIU A;  4DMW A;  3ZYL A;  3C4X A;  2Q9Q D;  4DBR A;  3C64 A;  4PK6 A;  2XQ5 A;  2XQ3 A;  1N33 T;  4ILB A;  1GQE A;  3AEG A;  4UIG A;  2LHR A;  3MJX A;  3R84 B;  4IIJ E;  3LJC A;  1I94 T;  2LOP A;  4DUY T;  3D0T A;  2JQQ A;  5AQU B;  4QWN B;  4P0A A;  1HFA A;  2W61 A;  5J2T E;  4DO0 A;  1JNR A;  4AKH A;  4UVC B;  3AE2 A;  4EXT A;  5AQN B;  4H9P C;  2D0T A;  2YU1 A;  2VAS A;  2NW7 A;  2P9B A;  2WAU A;  4HWC A;  3JC6 D;  2J47 A;  3ZYK A;  3C4Z A;  4X62 T;  2YU2 A;  3Q2M A;  2XTL A;  1XMQ T;  2XAJ B;  4EEB A;  5ABE A;  5LGU B;  4C91 A;  2J1D G;  3HKE E;  3HKB E;  3AAA B;  2WY2 A;  4EOZ B;  3P4W A;  4JI3 T;  4LFA T;  1UX5 A;  2CCQ A;  3FXE B;  1EZ3 A;  4QH4 A;  4ERR A;  4ZS3 A;  1HNX T;  4DR4 T;  3RKG A;  5J1G A;  2Z6E A;  4EZH A;  1HX8 A;  3WI3 A;  2WWU A;  4H9N C;  5FL0 A;  4IDN A;  5JVD E;  5KXJ A;  3AE3 A;  3FXD B;  3ZCI A;  2SPC A;  2NTY A;  4H63 H;  4BJN A;  4CXX A;  4EYY R;  5CA1 E;  4O4I E;  1FIO A;  3UU3 A;  5L4E A;  1W09 A;  2H3R A;  3LFM A;  4DR7 T;  1KK7 A;  2ES0 A;  2KSR A;  4GK5 E;  3ZMS B;  2CLY C;  2ODV A;  1MIY A;  2K48 A;  3AE1 A;  1MMA A;  5HEH A;  5HXC A;  4AIU A;  2C5K T;  3CML A;  1KNP A;  3PUY F;  2V7L A;  1BR4 A;  5M4Y A;  2M67 A;  2WS3 A;  4G63 A;  3BQI A;  4YHJ A;  3AB3 B;  3RQW A;  1UX4 A;  3H3M A;  2EHO A;  4U33 A;  2D5U A;  4EAH A;  1NEK A;  2M6I A;  5AQP B;  3JC6 C;  5HXH A;  2E9X B;  4YTN A;  3ZT6 A;  1MMN A;  2UXD T;  5LNK A;  4ZI3 D;  1IAP A;  2XJ7 A;  1Y01 A;  2JQ9 A;  3GN5 A;  3M65 A;  4HGA A;  4PJN A;  4X1I E;  5DAB A;  4AIS A;  3N2G E;  3VR9 A;  3UUN A;  2CXD A;  2RA1 A;  3I9W A;  3PDY A;  5JDL A;  3WAJ A;  3QNU A;  3ZST A;  4B3M T;  4O2A E;  4JI8 T;  4K0U A;  2K3W A;  3O9X A;  2WB5 A;  3AE9 A;  3EAM A;  2NTX A;  3SOL A;  4EED A;  2KND A;  2XAH B;  4ZZB A;  2XHE B;  2XM2 A;  3AA7 B;  4IT4 A;  3O1I A;  2WWV A;  4O8S A;  2PBI A;  4O4J E;  5LGT B;  2L9Q A;  2VWA A;  1XWM A;  2X66 A;  3AAE B;  5JR9 B;  1IBL T;  4JI0 T;  4LML A;  2YK0 A;  4IL4 A;  5FMN A;  2K24 A;  3VRA A;  5LHG B;  4JEH B;  1DU2 A; 
#chains in the Genus database with same CATH homology
 1XNR T;  4X65 T;  4DR2 T;  5LMU T;  2F4V T;  4YHH T;  4B3S T;  5BR8 T;  2UU9 T;  1N36 T;  5IWA T;  2UXC T;  4KHP T;  5LMN T;  4JI1 T;  4AQY T;  4B3T T;  2UUB T;  4LF6 T;  1XNQ T;  4DR6 T;  4DV5 T;  4DV6 T;  4JI6 T;  4LFB T;  4JYA T;  4JI2 T;  2E5L T;  2HHH T;  4NXN T;  2UUA T;  4X64 T;  4DR5 T;  1XMO T;  1IBM T;  1N33 T;  3T1Y T;  4GKJ T;  4X66 T;  2UUC T;  4JV5 T;  1I94 T;  4GKK T;  4DUY T;  4DV3 T;  4JI4 T;  1HNW T;  1J5E T;  1FJG T;  4X62 T;  4DUZ T;  1XMQ T;  2VQE T;  4K0K T;  4LFA T;  3OTO T;  4JI3 T;  1HNX T;  4DR4 T;  3T1H T;  4LF4 T;  4DV4 T;  1IBK T;  4DR7 T;  4DV0 T;  4LFC T;  2UXB T;  4NXM T;  4YY3 T;  4LF5 T;  4LF7 T;  1N32 T;  1N34 T;  2ZM6 T;  4JI5 T;  1HNZ T;  2UXD T;  4DR3 T;  4LF8 T;  4DV1 T;  4JI7 T;  4B3M T;  4LF9 T;  4JI8 T;  4B3R T;  4OX9 T;  2VQF T;  4DR1 T;  1IBL T;  4JI0 T;  4DV7 T;  1HR0 T;  4DV2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...