4JI3T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji3T00
5IWAT 4JI8T 4LF8T 4B3ST 4JI5T 4DR6T 3T1HT 1J5ET 2UXCT 1FJGT 4DR2T 4DV3T 2VQFT 4DV6T 1XMOT 4YY3T 4KHPT 4X66T 2F4VT 4JI0T 4LF5T 1HNWT 4DR7T 1N36T 4LFBT 4B3TT 1IBKT 2UUCT 1HNZT 1XMQT 4B3RT 4JV5T 4LFCT 4JYAT 4DR3T 2UXDT 4JI3T 1HR0T 4DR1T 4X64T 1N33T 4JI4T 5LMUT 2UU9T 4LFAT 4AQYT 2UUBT 4JI2T 4JI7T 2E5LT 4GKJT 4YHHT 4B3MT 4DV1T 4JI6T 4LF6T 1XNRT 4K0KT 4DUZT 4X65T 4GKKT 4OX9T 4NXNT 4X62T 1IBMT 4DV4T 2UXBT 3OTOT 4DV7T 2UUAT 2VQET 4NXMT 1I94T 1IBLT 5LMNT 5BR8T 4DV5T 4DV0T 4LF9T 4JI1T 2ZM6T 4DR5T 4DV2T 1N34T 1XNQT 4DUYT 1N32T 4DR4T 4LF4T 4LF7T 3T1YT 2HHHT 1HNXT
chains in the Genus database with same CATH superfamily
4MALA 2FJEA 2WDQA 2NWBA 1YD8G 3RYIE 3UUBA 1SUMB 4CN6A 2CXFA 3ETVA 3FXDB 3MKDA 1L0VA 2AXDS 3CQXC 3RC3A 3LDQB 3KV4A 4E7ZA 4EIWA 3KFWX 3PU3A 5CB4E 1MMAA 4HTEA 4HWCA 2E9XC 3IBPA 1HNZT 3PUQA 5HXHA 4CZZB 3ZSTA 3L8RA 3ZT6A 2I59A 2YDSA 4EXTA 5FVKA 5FXWA 4I50E 3RQWA 2XM2A 3N2GE 4EV6A 5J1GA 5FL0A 2CXLA 2LM9A 3CMLA 5AFUL 3Q9DA 2G0UA 4DMWA 3SRZA 1XDPA 5LGNB 2GK9A 2WMNA 4IREA 5CGMA 4M1PA 3OJAA 5GONE 1IBLT 5LMNT 1D0YA 3LBXB 4I55E 3AE9A 4BAYB 1BR2A 3SFEA 3AE2A 1NEKA 2WCAA 2W0GA 4UR9A 5DABA 3CKDA 2OA5A 4YLHA 3CK6A 4ZI3D 5AQKB 4OFZA 2QRXA 1D1AA 3MACA 1WR6A 5BMVE 2A2FX 5M4YA 1HF8A 5LCYA 3N9PA 1KFYA 3LBXA 2BKPA 1HFAA 4A56A 4LFCT 2W4XA 2UXDT 4YSZA 3RH3A 1S35A 3ZKRA 4JI7T 2LOSA 3KVAA 4UV8B 3JC6D 4PJNA 2PJQA 2X0YA 2CBJA 2MTQA 5HCJA 4X1IE 4CQIA 2D5UA 3HKBE 2XQ8A 2XAGB 4U2ZA 3EUHA 1LVFA 2V1DB 4IDQA 2X0HA 4YXDA 1OEDB 1I94T 3V5SA 1ZV4X 4TV8E 4H9SE 1UX4A 3A5XA 5AQQB 1WR0A 5L3DB 1WLXA 3FZLB 5DQVA 5JRCB 5HEJA 2KLQA 4XAXB 1GQEA 3TLSA 3SS1A 4JI8T 4B3ST 3PUVF 2XAQB 1FJGT 5LXTE 2XUEA 4DV6T 3C50A 1UGOA 3UFGA 2C0SA 1N36T 5C8YE 2RA1A 4YJ3E 1E7PA 5LJNA 3PUGA 3VRAA 2V7KA 2LEHA 3EAMA 2UU9T 4IGUA 4QH1A 3MZKB 3HA4A 3PUSA 1T8BA 2QA7A 2YOEA 3ZSSA 3I9YA 4GYRA 1VRBA 4AKLA 4B3MT 1MNEA 3J7Yq 5HWYA 4A5XA 4GKKT 1KNZA 4X62T 4EZ4A 4GK0E 3M65A 3LK3B 4BJMA 4ZS2A 2CCQA 2XQ3A 2CMRA 2BKOA 1KNPA 5KX5E 2IHR1 2QGSA 2LJLA 2V7MA 5HYAA 1MIVA 2CRBA 3KVBA 3R84B 4L0RA 4LF4T 4LF7T 5LA6E 5IWAT 3SWHA 4CXWA 3VRBA 2E8IA 3R6NA 2XQ6A 4DR6T 3T1HT 4EAHA 5FXZA 1VCSA 3ZMSB 3MJXA 1UCUA 3UU8A 4XBFB 2ZLYA 5KMGP 3B13A 1QUUA 5AQPB 5A1LA 4UVBB 2HPJA 2Y8DA 3UUMA 5JDMA 3UULA 5HAXA 4QH4A 1WYCA 4EEBA 2LHNA 4J2CA 3NZPA 1W0AA 5AQTB 4YT0A 3N9QA 3QC9A 2XM1A 3KINB 1CHUA 1ZHCA 2XQ4A 3AXJA 2LE8A 4MHCA 4TV9E 3AEDA 2M6BA 5LHGB 2E5LT 4YHHT 5E0OA 3VKHA 4JI6T 3J9X1 3TLVA 2HN2A 2LKGA 4YFSA 5AQNB 3HKDE 2WU2A 4UEMA 2I0MA 1XZYA 4HN9A 3FZMB 1NAFA 1U5PA 5L3FB 1LKXA 4X5TA 4DV2T 1YKEB 4WNKA 2HHHT 2OV9A 5FYMA 4QXCB 2WM9A 2YK0A 1SA0E 1D1BA 5HWXA 3RRWA 2Y6XA 3ZC0A 5F5WA 3AA7B 5HEHA 3RGLA 4EZHA 3ZYMA 3I1AA 2YN6A 4YJ2E 1E1HB 2BBHA 2XSBA 5J0ZA 5AQJB 5JTGA 3UT5E 4ILUA 4PJLA 1W0BA 3ESLA 4ZZBA 2CBIA 1DU2A 2XZEA 3ABVA 4HFHA 1N33T 3AA0B 5AQSB 2VURA 4P1NA 2YDRA 2LSKA 4JI2T 3DJBA 4UVAB 3PE0A 3NKZA 4AI6A 4ILBA 5LJMA 1XNRT 4PK5A 4TUYE 4GOUA 2LSJA 2CPTA 3PV0F 4O4LE 4H9RC 3P4SA 2J62A 2MYSA 3AEFA 1FMVA 1H7CA 5LG4A 4NIQA 4IDPA 2N9DA 3AE6A 2B1EA 4OK0A 4IL4A 2LRKA 1J5WA 2JQKA 3LK2B 3VR9A 3ZC1A 3UTKA 3QNUA 1O3XA 2FJAA 3I0OA 2JIWA 4OYJA 3EDUA 5JVDE 2XTLA 5JDLA 4O4IE 4GIWA 3RYCE 2DHRA 4WBNE 2KWIB 3CX6B 3G06A 4WW0A 3AVSA 3IEEA 3PJAJ 2WQYA 2UXNB 1IJ5A 5IUXA 2JQQA 1MIWA 3EI0A 3UU6A 2YINA 2W00A 2J4GA 1NWMX 4JEHB 3O1HA 4H9NC 4LMJA 2YEVC 5ABGA 1XDOA 2Z6EA 2IW5B 2CHOA 3P8CD 3RKGA 5CFBA 3H3AA 3ZT7A 4H63V 2NTYA 5FY0A 3RC8A 3LFMA 2P9BA 1X79A 4O2BE 4TWFA 2XQ5A 4IT4A 1ZP0A 4KBMB 4ASKA 3PURA 4PJJA 3JAFA 3IHRA 3WI3A 1WRDA 5JDHA 1Z8UA 4WYVA 1G73A 2VKDA 2C5IT 3ONXA 2LM2A 3Q5DA 2CM0A 4O8SA 2VKOA 2C5JA 2WWUA 3K3QC 3Q2MA 4DR4T 4JUYA 1N32T 3LK42 4OHFA 5JR9B 3L09A 4DBRA 4LF8T 3NBXX 3CIRA 3AE4A 5H6QB 2LKHA 5ABHA 2EHOD 3PUZF 3PUWF 2IDOB 4HFVA 3QUJA 1T98A 4X66T 4LF5T 2OLTA 2ZM0A 3FXEB 2KXPB 4I0UA 3C4ZA 2NW9A 2CLYB 1IBKT 2JQ9A 4JEUB 1QLBA 2LSYA 2JJ9A 3CX7B 3DP7A 2E2AA 4JYAT 3EHZA 2NW7A 5C3JA 3T8OA 2BVLA 2MPKA 3RPUA 4UIGA 3N9LA 2X9XA 4DVDA 2WMOA 5F3JA 5EK4A 1Y64B 5JR9A 3ZMUB 1WYBA 3PJAA 4IE5A 4ADZA 5AQGB 3MK7C 1Z0PA 2KWHA 1UK5A 1NENA 5JREA 3VHLA 2VKHA 3P50A 4NUVA 5HXSA 4DNDA 2JQHA 2QVAA 3MA9A 4ZI2D 1ZOYA 1MMDA 3N5LA 4KX6A 4PJMA 3CVRA 1X9BA 3C64A 5KXJA 1OXZA 5LHHB 2BBJA 3VR8A 1MMGA 2XQ9A 3GA8A 4F8HA 3AEAA 3RYHE 5FY7A 4B6XA 3AB3B 2CHNA 4HEAA 3WAJA 4HFIA 2V6XA 3UFEA 4KHPT 2JMHA 4I4TE 3I9WA 1HX1B 2YKSA 2BG9B 3CX8B 4Z90A 5LOVE 2H89A 4U2YA 2VASA 3DTOA 3TLWA 2E9XD 2JRKA 2E5VA 2N1GA 4IE6A 4UV9B 2MAWA 1JNRA 1OEDA 4F6RC 5FXVA 5CJ5A 5IHYA 3AE1A 1FIOA 5HCMA 2VWAA 4G63A 4ILAA 2I6HA 4COFA 5L2LA 4TWDA 3AEEA 5JRCA 2L3LA 3P7IA 2UUAT 4NXMT 2BG9A 3LG7A 2XHEB 2A3DA 4ISSA 5C2TA 3ZJ1A 2V6YB 5L3CB 2LHRA 3P4RA 1OEDE 3ANWB 3O9XA 1XNQT 3F31A 4QWNB 5AQRB 3VU7H 3AE7A 4ZHQE 4GYSA 5LGUB 3L39A 2W2UA 2WY2A 4CN4A 3HL6A 3OKQA 2BZBA 4IDZA 3AE3A 2XQ7A 2BG9E 4E7SA 4AIUA 5AQVB 2BS3A 1IJ6A 3V5UA 4JI0T 3N9MA 5HEUA 2VVSA 2NP9A 5JDFA 1YW0A 5HXRA 2UUCT 2XY8B 4DBQA 2V7LA 4UVCB 4IDOA 2V6YA 3IA3A 1D0ZA 2NR4A 3KV9A 4HKAA 2RP4A 4CI1B 4V1Av 2DNXA 2FBWA 3ANWA 2H7OA 3NRYA 3EVYA 4Q25A 4U7IA 3HKEE 2UUBT 3HKCE 5LP6E 1YKHB 5JDNA 3C51A 2NW8A 4UELA 4LF6T 5FY1A 4PK6A 4O4HE 4DV4T 2CWOA 3RHWA 5L47A 5LHIB 3HR0A 1HCIA 2LT3A 3GN5B 1SE7A 5FNVE 3AAIA 1M62A 2WU5A 5L3EB 4L9IA 4YTPA 4CI3B 4PFPA 1HG2A 2CE7A 3AE5A 1XWMA 2V7IA 4O2AE 1MMNA 1W9RA 1HNXT 2L9QA 1CUNA 3ZN0B 2WZHA 2DCFA 5ADXL 4H9PC 3SFDA 5JR9C 4MLKA 3RIUA 4LMKA 2K3WA 4JLEA 5LBMA 4DV3T 1IZNB 3ZT5A 1BR0A 4QXHB 1MIYA 3PU8A 2V26A 2LOPA 3GN5A 2HH7A 3AAAB 4ZOLE 4P0AA 2BS4A 4ERRA 5CA0E 4XZCA 2CLYC 3PUYF 3N9NA 4B3RT 3GMIA 3RLFF 4CN1A 3KV6A 3RYFE 3IF8B 4UXNB 1VCTA 5ABFB 3ZMTB 3EDVA 5HXCA 4UF0B 1YQ4A 4HFCA 4WBOA 3AVRA 3F2EA 5CA1E 2XQYA 3OTOT 3JCFA 3S4UA 4AISA 4X1KE 2LSIA 2W61A 1B7TA 1V9DA 3LSVA 2WWVA 3ZYLA 2D0TA 3NVOA 4ZI3C 2V7JA 3K3OA 1D1CA 2DWGA 5JQGE 4Z8XA 5ETWA 5ABFA 4QKNA 3T1YT 1BR1A 5HEGA 2H3RA 4KP3C 5HXEA 1OEDC 2NTXA 2D9DA 4EYUA 4HFBA 3QK6A 3KBTA 3RKOA 2X0LB 4IE4A 1QSDA 5JDQA 4ZZCA 2KT9A 4ZS3A 2W67A 1ZKEA 3PTRB 2ZM8A 5LB7B 3RI5A 2X9HA 4YSYA 2ACXA 2BG9C 4AXPA 2IC6A 5J2UE 1J1JA 3C4WA 4OYKA 1SHZC 4DR3T 3CQCB 4QXBB 4PAGA 5H6RB 1US7B 3JC6C 4HGAA 3BQLA 2IUBA 3ETUA 4QX8B 4DV1T 2X67A 4X65T 5FKYA 2XASB 2UXBT 3U3IA 4TZ4C 5FXXA 2MOZA 4HWDA 2Q9QD 2CWYA 4CXYA 4N78D 4IL9A 4DIDB 3E0ZA 3K1SA 4U72A 4JI1T 3ZMZB 4MBQA 3UQ4A 3HI2A 4G2AA 2WAUA 3H37A 3BQKA 1MNDA 2WP9A 3ONLC 2LLYA 2WDRA 3AA6B 4YY3T 2F4VT 3F57A 4IE0A 3RIFA 3A7MA 5FP3A 2VB6A 2BKNA 1XMQT 4JV5T 1JNZA 4ZEYA 1HR0T 2L8KA 2Q9QB 4HFEA 3ZCIA 4AQGA 4CXXA 4AQYT 2SPCA 2QYWA 3ZMVB 3N2OA 4NUUA 3O1JA 4AKHA 2H88A 2X9YA 3RIUC 2FJDA 2IIUA 1LVKA 2VL0A 1I6ZA 2IMLA 3EABA 4NXNT 2UXXB 2A9UA 4U7YA 4C91A 1HS7A 4DV7T 1WCRA 2VQET 3TLUA 3ZEFB 5BR8T 5AQHB 2D0UA 4PW8A 2V8SV 3KDSE 4H63H 1UUSA 2Q9QA 3GWHA 2ES0A 2XAFB 2K24A 4U33A 3AEBA 2PFVA 1N34T 1UURA 4DUYT 4IIJE 4IE7A 3PDYA 2RPAA 3OYZA 1HG5A 3X1DA 2EHOB 3Q5EA 3UU4A 2X51A 1M7KA 2HN1A 2VK9A 4JI5T 2PBIA 3E22E 3FB2A 4IHJE 1G8XA 2W66A 4AQFA 3AAEB 3CWZB 2DL1A 2LSGA 3OPCA 1HNWT 2FUPA 2XAJB 5AQIB 4DR7T 2ZM2A 4B3TT 4O4JE 4TX5A 4P09A 2X68A 4CI2B 4DR1T 1YXRA 3SOLA 2JMKA 3PUXF 4BJNA 3ZN1B 2XAHB 2EHOA 3JAEA 5JH7E 2WDVA 2R6GF 4GKJT 3NRXA 5AQUB 4TN7B 2DI4A 1BR4A 4KI0F 3B5MA 1IBMT 1U4QA 2J47A 4ANJA 3ZYKA 3N2KE 2W63A 1VOMA 3ZCJA 4YHJA 5TAOA 4ILCA 2CA5A 3ZPOA 4PK4A 4LF9T 5F8PA 2XQAA 4EYYR 2ODVA 1AJ3A 1KEYA 4KUMB 2VL8A 3CPZA 5L4HA 2DLRA 2W62A 5FL1A 4A97A 2UXCT 5LGTB 1KF6A 4K0UA 4JBWF 4DR2T 4EB6E 2XPKA 4QHOA 1HX8A 4AKGA 1XMOT 3RX6A 5L4EA 4TNWA 4HWIB 2WBLA 3A8YC 2Y48B 2FJBA 3TKLB 3M3ZB 2E9XB 4LMLA 3QB5A 4IDNA 4JI3T 4X64T 4DMVA 2V5CA 2KINB 4KHZF 4I43B 4JI4T 2WSSV 3H3MA 5FVLA 1D0XA 3FBLA 2ODUA 4A98A 3MXZA 4HWFA 5LG3A 3ZLIA 2IC9A 4MFRA 5ABEA 3RF1A 1KNRA 4HFDA 1KK7A 5LNKA 4OX9T 2KZ7B 4WZXA 4BA9A 3AXJB 4FJOA 2E9XA 3JADA 4U31A 5DQWA 2LRLA 2YU1A 3TLTA 2K5BB 2X9WA 4EGWA 2X66A 4DR5T 2A72A 4ZI7E 5LBQB 2MBGA 4X1YE 4ZXLA 1IAPA 5JDGA 3KV5A 3U78A 2PTFA 2XSAA 3RIAA 4KMCA 2ACZA 2K9AA 2KSRA 1J5ET 5AQOB 4EEDA 3B57A 2YU2A 3K3NA 3P4PA 4YTNA 2VQFT 2WZIA 1EZ3A 2J1DG 3Q5XA 2BDEA 4QH5A 3UQ7A 3RRCA 2HPLA 5FMNA 2BVMA 3N9OA 3OYXA 3O1IA 3QOFA 3P4QA 3AEGA 2NOXA 3FHNA 2Q9QC 4FI5A 2JPFA 1S94A 3D0TA 1E2AA 4YTMA 4QX7B 4LFAT 3O4XE 3BK9A 4Z91A 1YQ3A 3CQGB 3FZHB 4L5GA 4C90A 5AQFB 4K0KT 4NPPA 3OBVE 2D2SA 4AQFC 5IYZE 4HE8A 1WFDA 3C4XA 3UUNA 5DJQC 1R8IA 4AKRB 2CXDA 3OVUA 2H7VC 3C98B 3E08A 2YDQA 4DV5T 2DWKA 4DV0T 5AQMB 4TNVA 2ZM6T 1T7SA 3LJCA 2KNDA 3AA1B 4X20E 1FMWA 3UU5A 4P0BA 1OWAA 2EHOC 1ZEEA 4H9OC 1T72A 4TWHA 4DO0A 3NZQA 1HTJF 3AECA 3VKGA 2K48A 3KBUA 2ZMAA 5EZYE 2PG8A 4YSXA 2VKJA 3L3PA 4U74A 4LFBT 3P4WA 5EK2A 1W09A 2WB5A 4UF0A 4EOZB 3WAKA 3I0QA 2M67A 2IAKA 5L3BB 3Q5WA 5LMUT 5EK3A 2C5KT 2VVNA 2M6IA 3ZJ2A 1UX5A 3RQUA 3AE8A 3K8PC 2XJ7A 4U3CA 4DUZT 3ONJA 3FZKB 2N2NA 2WS3A 4PFOA 4PNIA 5HEOA 3W15B 4H9QC 2BS2A 2KMFA 4ISTA 5KDMC 5J2TE 1FEWA 4ZI2C 5LYJE 3QB5K 4AKIA 3NWIA 1LRZA 2B76A 3PUAA 4GK5E 4HWHA 3FBZA 3UU3A 1Y01A 5AQLB 3UUXB 2AE9A 5L3GB 3FZFB 3BQIA 2V5DA 2CEAA
chains in the Genus database with same CATH topology
5IWAT 4JI8T 4LF8T 4B3ST 4JI5T 4DR6T 3T1HT 1J5ET 2UXCT 1FJGT 4DR2T 4DV3T 2VQFT 4DV6T 1XMOT 4YY3T 4KHPT 4X66T 2F4VT 4JI0T 4LF5T 1HNWT 4DR7T 1N36T 4LFBT 4B3TT 1IBKT 2UUCT 1HNZT 1XMQT 4B3RT 4JV5T 4LFCT 4JYAT 4DR3T 2UXDT 4JI3T 1HR0T 4DR1T 4X64T 1N33T 4JI4T 5LMUT 2UU9T 4LFAT 4AQYT 2UUBT 4JI2T 4JI7T 2E5LT 4GKJT 4YHHT 4B3MT 4DV1T 4JI6T 4LF6T 1XNRT 4K0KT 4DUZT 4X65T 4GKKT 4OX9T 4NXNT 4X62T 1IBMT 4DV4T 2UXBT 3OTOT 4DV7T 2UUAT 2VQET 4NXMT 1I94T 1IBLT 5LMNT 5BR8T 4DV5T 4DV0T 4LF9T 4JI1T 2ZM6T 4DR5T 4DV2T 1N34T 1XNQT 4DUYT 1N32T 4DR4T 4LF4T 4LF7T 3T1YT 2HHHT 1HNXT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IWA T;  4JI8 T;  4LF8 T;  4B3S T;  4JI5 T;  4DR6 T;  3T1H T;  1J5E T;  2UXC T;  1FJG T;  4DR2 T;  4DV3 T;  2VQF T;  4DV6 T;  1XMO T;  4YY3 T;  4KHP T;  4X66 T;  2F4V T;  4JI0 T;  4LF5 T;  1HNW T;  4DR7 T;  1N36 T;  4LFB T;  4B3T T;  1IBK T;  2UUC T;  1HNZ T;  1XMQ T;  4B3R T;  4JV5 T;  4LFC T;  4JYA T;  4DR3 T;  2UXD T;  4JI3 T;  1HR0 T;  4DR1 T;  4X64 T;  1N33 T;  4JI4 T;  5LMU T;  2UU9 T;  4LFA T;  4AQY T;  2UUB T;  4JI2 T;  4JI7 T;  2E5L T;  4GKJ T;  4YHH T;  4B3M T;  4DV1 T;  4JI6 T;  4LF6 T;  1XNR T;  4K0K T;  4DUZ T;  4X65 T;  4GKK T;  4OX9 T;  4NXN T;  4X62 T;  1IBM T;  4DV4 T;  2UXB T;  3OTO T;  4DV7 T;  2UUA T;  2VQE T;  4NXM T;  1I94 T;  1IBL T;  5LMN T;  5BR8 T;  4DV5 T;  4DV0 T;  4LF9 T;  4JI1 T;  2ZM6 T;  4DR5 T;  4DV2 T;  1N34 T;  1XNQ T;  4DUY T;  1N32 T;  4DR4 T;  4LF4 T;  4LF7 T;  3T1Y T;  2HHH T;  1HNX T; 
#chains in the Genus database with same CATH topology
 4MAL A;  2FJE A;  2WDQ A;  2NWB A;  1YD8 G;  3RYI E;  3UUB A;  1SUM B;  4CN6 A;  2CXF A;  3ETV A;  3FXD B;  3MKD A;  1L0V A;  2AXD S;  3CQX C;  3RC3 A;  3LDQ B;  3KV4 A;  4E7Z A;  4EIW A;  3KFW X;  3PU3 A;  5CB4 E;  1MMA A;  4HTE A;  4HWC A;  2E9X C;  3IBP A;  1HNZ T;  3PUQ A;  5HXH A;  4CZZ B;  3ZST A;  3L8R A;  3ZT6 A;  2I59 A;  2YDS A;  4EXT A;  5FVK A;  5FXW A;  4I50 E;  3RQW A;  2XM2 A;  3N2G E;  4EV6 A;  5J1G A;  5FL0 A;  2CXL A;  2LM9 A;  3CML A;  5AFU L;  3Q9D A;  2G0U A;  4DMW A;  3SRZ A;  1XDP A;  5LGN B;  2GK9 A;  2WMN A;  4IRE A;  5CGM A;  4M1P A;  3OJA A;  5GON E;  1IBL T;  5LMN T;  1D0Y A;  3LBX B;  4I55 E;  3AE9 A;  4BAY B;  1BR2 A;  3SFE A;  3AE2 A;  1NEK A;  2WCA A;  2W0G A;  4UR9 A;  5DAB A;  3CKD A;  2OA5 A;  4YLH A;  3CK6 A;  4ZI3 D;  5AQK B;  4OFZ A;  2QRX A;  1D1A A;  3MAC A;  1WR6 A;  5BMV E;  2A2F X;  5M4Y A;  1HF8 A;  5LCY A;  3N9P A;  1KFY A;  3LBX A;  2BKP A;  1HFA A;  4A56 A;  4LFC T;  2W4X A;  2UXD T;  4YSZ A;  3RH3 A;  1S35 A;  3ZKR A;  4JI7 T;  2LOS A;  3KVA A;  4UV8 B;  3JC6 D;  4PJN A;  2PJQ A;  2X0Y A;  2CBJ A;  2MTQ A;  5HCJ A;  4X1I E;  4CQI A;  2D5U A;  3HKB E;  2XQ8 A;  2XAG B;  4U2Z A;  3EUH A;  1LVF A;  2V1D B;  4IDQ A;  2X0H A;  4YXD A;  1OED B;  1I94 T;  3V5S A;  1ZV4 X;  4TV8 E;  4H9S E;  1UX4 A;  3A5X A;  5AQQ B;  1WR0 A;  5L3D B;  1WLX A;  3FZL B;  5DQV A;  5JRC B;  5HEJ A;  2KLQ A;  4XAX B;  1GQE A;  3TLS A;  3SS1 A;  4JI8 T;  4B3S T;  3PUV F;  2XAQ B;  1FJG T;  5LXT E;  2XUE A;  4DV6 T;  3C50 A;  1UGO A;  3UFG A;  2C0S A;  1N36 T;  5C8Y E;  2RA1 A;  4YJ3 E;  1E7P A;  5LJN A;  3PUG A;  3VRA A;  2V7K A;  2LEH A;  3EAM A;  2UU9 T;  4IGU A;  4QH1 A;  3MZK B;  3HA4 A;  3PUS A;  1T8B A;  2QA7 A;  2YOE A;  3ZSS A;  3I9Y A;  4GYR A;  1VRB A;  4AKL A;  4B3M T;  1MNE A;  3J7Y q;  5HWY A;  4A5X A;  4GKK T;  1KNZ A;  4X62 T;  4EZ4 A;  4GK0 E;  3M65 A;  3LK3 B;  4BJM A;  4ZS2 A;  2CCQ A;  2XQ3 A;  2CMR A;  2BKO A;  1KNP A;  5KX5 E;  2IHR 1;  2QGS A;  2LJL A;  2V7M A;  5HYA A;  1MIV A;  2CRB A;  3KVB A;  3R84 B;  4L0R A;  4LF4 T;  4LF7 T;  5LA6 E;  5IWA T;  3SWH A;  4CXW A;  3VRB A;  2E8I A;  3R6N A;  2XQ6 A;  4DR6 T;  3T1H T;  4EAH A;  5FXZ A;  1VCS A;  3ZMS B;  3MJX A;  1UCU A;  3UU8 A;  4XBF B;  2ZLY A;  5KMG P;  3B13 A;  1QUU A;  5AQP B;  5A1L A;  4UVB B;  2HPJ A;  2Y8D A;  3UUM A;  5JDM A;  3UUL A;  5HAX A;  4QH4 A;  1WYC A;  4EEB A;  2LHN A;  4J2C A;  3NZP A;  1W0A A;  5AQT B;  4YT0 A;  3N9Q A;  3QC9 A;  2XM1 A;  3KIN B;  1CHU A;  1ZHC A;  2XQ4 A;  3AXJ A;  2LE8 A;  4MHC A;  4TV9 E;  3AED A;  2M6B A;  5LHG B;  2E5L T;  4YHH T;  5E0O A;  3VKH A;  4JI6 T;  3J9X 1;  3TLV A;  2HN2 A;  2LKG A;  4YFS A;  5AQN B;  3HKD E;  2WU2 A;  4UEM A;  2I0M A;  1XZY A;  4HN9 A;  3FZM B;  1NAF A;  1U5P A;  5L3F B;  1LKX A;  4X5T A;  4DV2 T;  1YKE B;  4WNK A;  2HHH T;  2OV9 A;  5FYM A;  4QXC B;  2WM9 A;  2YK0 A;  1SA0 E;  1D1B A;  5HWX A;  3RRW A;  2Y6X A;  3ZC0 A;  5F5W A;  3AA7 B;  5HEH A;  3RGL A;  4EZH A;  3ZYM A;  3I1A A;  2YN6 A;  4YJ2 E;  1E1H B;  2BBH A;  2XSB A;  5J0Z A;  5AQJ B;  5JTG A;  3UT5 E;  4ILU A;  4PJL A;  1W0B A;  3ESL A;  4ZZB A;  2CBI A;  1DU2 A;  2XZE A;  3ABV A;  4HFH A;  1N33 T;  3AA0 B;  5AQS B;  2VUR A;  4P1N A;  2YDR A;  2LSK A;  4JI2 T;  3DJB A;  4UVA B;  3PE0 A;  3NKZ A;  4AI6 A;  4ILB A;  5LJM A;  1XNR T;  4PK5 A;  4TUY E;  4GOU A;  2LSJ A;  2CPT A;  3PV0 F;  4O4L E;  4H9R C;  3P4S A;  2J62 A;  2MYS A;  3AEF A;  1FMV A;  1H7C A;  5LG4 A;  4NIQ A;  4IDP A;  2N9D A;  3AE6 A;  2B1E A;  4OK0 A;  4IL4 A;  2LRK A;  1J5W A;  2JQK A;  3LK2 B;  3VR9 A;  3ZC1 A;  3UTK A;  3QNU A;  1O3X A;  2FJA A;  3I0O A;  2JIW A;  4OYJ A;  3EDU A;  5JVD E;  2XTL A;  5JDL A;  4O4I E;  4GIW A;  3RYC E;  2DHR A;  4WBN E;  2KWI B;  3CX6 B;  3G06 A;  4WW0 A;  3AVS A;  3IEE A;  3PJA J;  2WQY A;  2UXN B;  1IJ5 A;  5IUX A;  2JQQ A;  1MIW A;  3EI0 A;  3UU6 A;  2YIN A;  2W00 A;  2J4G A;  1NWM X;  4JEH B;  3O1H A;  4H9N C;  4LMJ A;  2YEV C;  5ABG A;  1XDO A;  2Z6E A;  2IW5 B;  2CHO A;  3P8C D;  3RKG A;  5CFB A;  3H3A A;  3ZT7 A;  4H63 V;  2NTY A;  5FY0 A;  3RC8 A;  3LFM A;  2P9B A;  1X79 A;  4O2B E;  4TWF A;  2XQ5 A;  4IT4 A;  1ZP0 A;  4KBM B;  4ASK A;  3PUR A;  4PJJ A;  3JAF A;  3IHR A;  3WI3 A;  1WRD A;  5JDH A;  1Z8U A;  4WYV A;  1G73 A;  2VKD A;  2C5I T;  3ONX A;  2LM2 A;  3Q5D A;  2CM0 A;  4O8S A;  2VKO A;  2C5J A;  2WWU A;  3K3Q C;  3Q2M A;  4DR4 T;  4JUY A;  1N32 T;  3LK4 2;  4OHF A;  5JR9 B;  3L09 A;  4DBR A;  4LF8 T;  3NBX X;  3CIR A;  3AE4 A;  5H6Q B;  2LKH A;  5ABH A;  2EHO D;  3PUZ F;  3PUW F;  2IDO B;  4HFV A;  3QUJ A;  1T98 A;  4X66 T;  4LF5 T;  2OLT A;  2ZM0 A;  3FXE B;  2KXP B;  4I0U A;  3C4Z A;  2NW9 A;  2CLY B;  1IBK T;  2JQ9 A;  4JEU B;  1QLB A;  2LSY A;  2JJ9 A;  3CX7 B;  3DP7 A;  2E2A A;  4JYA T;  3EHZ A;  2NW7 A;  5C3J A;  3T8O A;  2BVL A;  2MPK A;  3RPU A;  4UIG A;  3N9L A;  2X9X A;  4DVD A;  2WMO A;  5F3J A;  5EK4 A;  1Y64 B;  5JR9 A;  3ZMU B;  1WYB A;  3PJA A;  4IE5 A;  4ADZ A;  5AQG B;  3MK7 C;  1Z0P A;  2KWH A;  1UK5 A;  1NEN A;  5JRE A;  3VHL A;  2VKH A;  3P50 A;  4NUV A;  5HXS A;  4DND A;  2JQH A;  2QVA A;  3MA9 A;  4ZI2 D;  1ZOY A;  1MMD A;  3N5L A;  4KX6 A;  4PJM A;  3CVR A;  1X9B A;  3C64 A;  5KXJ A;  1OXZ A;  5LHH B;  2BBJ A;  3VR8 A;  1MMG A;  2XQ9 A;  3GA8 A;  4F8H A;  3AEA A;  3RYH E;  5FY7 A;  4B6X A;  3AB3 B;  2CHN A;  4HEA A;  3WAJ A;  4HFI A;  2V6X A;  3UFE A;  4KHP T;  2JMH A;  4I4T E;  3I9W A;  1HX1 B;  2YKS A;  2BG9 B;  3CX8 B;  4Z90 A;  5LOV E;  2H89 A;  4U2Y A;  2VAS A;  3DTO A;  3TLW A;  2E9X D;  2JRK A;  2E5V A;  2N1G A;  4IE6 A;  4UV9 B;  2MAW A;  1JNR A;  1OED A;  4F6R C;  5FXV A;  5CJ5 A;  5IHY A;  3AE1 A;  1FIO A;  5HCM A;  2VWA A;  4G63 A;  4ILA A;  2I6H A;  4COF A;  5L2L A;  4TWD A;  3AEE A;  5JRC A;  2L3L A;  3P7I A;  2UUA T;  4NXM T;  2BG9 A;  3LG7 A;  2XHE B;  2A3D A;  4ISS A;  5C2T A;  3ZJ1 A;  2V6Y B;  5L3C B;  2LHR A;  3P4R A;  1OED E;  3ANW B;  3O9X A;  1XNQ T;  3F31 A;  4QWN B;  5AQR B;  3VU7 H;  3AE7 A;  4ZHQ E;  4GYS A;  5LGU B;  3L39 A;  2W2U A;  2WY2 A;  4CN4 A;  3HL6 A;  3OKQ A;  2BZB A;  4IDZ A;  3AE3 A;  2XQ7 A;  2BG9 E;  4E7S A;  4AIU A;  5AQV B;  2BS3 A;  1IJ6 A;  3V5U A;  4JI0 T;  3N9M A;  5HEU A;  2VVS A;  2NP9 A;  5JDF A;  1YW0 A;  5HXR A;  2UUC T;  2XY8 B;  4DBQ A;  2V7L A;  4UVC B;  4IDO A;  2V6Y A;  3IA3 A;  1D0Z A;  2NR4 A;  3KV9 A;  4HKA A;  2RP4 A;  4CI1 B;  4V1A v;  2DNX A;  2FBW A;  3ANW A;  2H7O A;  3NRY A;  3EVY A;  4Q25 A;  4U7I A;  3HKE E;  2UUB T;  3HKC E;  5LP6 E;  1YKH B;  5JDN A;  3C51 A;  2NW8 A;  4UEL A;  4LF6 T;  5FY1 A;  4PK6 A;  4O4H E;  4DV4 T;  2CWO A;  3RHW A;  5L47 A;  5LHI B;  3HR0 A;  1HCI A;  2LT3 A;  3GN5 B;  1SE7 A;  5FNV E;  3AAI A;  1M62 A;  2WU5 A;  5L3E B;  4L9I A;  4YTP A;  4CI3 B;  4PFP A;  1HG2 A;  2CE7 A;  3AE5 A;  1XWM A;  2V7I A;  4O2A E;  1MMN A;  1W9R A;  1HNX T;  2L9Q A;  1CUN A;  3ZN0 B;  2WZH A;  2DCF A;  5ADX L;  4H9P C;  3SFD A;  5JR9 C;  4MLK A;  3RIU A;  4LMK A;  2K3W A;  4JLE A;  5LBM A;  4DV3 T;  1IZN B;  3ZT5 A;  1BR0 A;  4QXH B;  1MIY A;  3PU8 A;  2V26 A;  2LOP A;  3GN5 A;  2HH7 A;  3AAA B;  4ZOL E;  4P0A A;  2BS4 A;  4ERR A;  5CA0 E;  4XZC A;  2CLY C;  3PUY F;  3N9N A;  4B3R T;  3GMI A;  3RLF F;  4CN1 A;  3KV6 A;  3RYF E;  3IF8 B;  4UXN B;  1VCT A;  5ABF B;  3ZMT B;  3EDV A;  5HXC A;  4UF0 B;  1YQ4 A;  4HFC A;  4WBO A;  3AVR A;  3F2E A;  5CA1 E;  2XQY A;  3OTO T;  3JCF A;  3S4U A;  4AIS A;  4X1K E;  2LSI A;  2W61 A;  1B7T A;  1V9D A;  3LSV A;  2WWV A;  3ZYL A;  2D0T A;  3NVO A;  4ZI3 C;  2V7J A;  3K3O A;  1D1C A;  2DWG A;  5JQG E;  4Z8X A;  5ETW A;  5ABF A;  4QKN A;  3T1Y T;  1BR1 A;  5HEG A;  2H3R A;  4KP3 C;  5HXE A;  1OED C;  2NTX A;  2D9D A;  4EYU A;  4HFB A;  3QK6 A;  3KBT A;  3RKO A;  2X0L B;  4IE4 A;  1QSD A;  5JDQ A;  4ZZC A;  2KT9 A;  4ZS3 A;  2W67 A;  1ZKE A;  3PTR B;  2ZM8 A;  5LB7 B;  3RI5 A;  2X9H A;  4YSY A;  2ACX A;  2BG9 C;  4AXP A;  2IC6 A;  5J2U E;  1J1J A;  3C4W A;  4OYK A;  1SHZ C;  4DR3 T;  3CQC B;  4QXB B;  4PAG A;  5H6R B;  1US7 B;  3JC6 C;  4HGA A;  3BQL A;  2IUB A;  3ETU A;  4QX8 B;  4DV1 T;  2X67 A;  4X65 T;  5FKY A;  2XAS B;  2UXB T;  3U3I A;  4TZ4 C;  5FXX A;  2MOZ A;  4HWD A;  2Q9Q D;  2CWY A;  4CXY A;  4N78 D;  4IL9 A;  4DID B;  3E0Z A;  3K1S A;  4U72 A;  4JI1 T;  3ZMZ B;  4MBQ A;  3UQ4 A;  3HI2 A;  4G2A A;  2WAU A;  3H37 A;  3BQK A;  1MND A;  2WP9 A;  3ONL C;  2LLY A;  2WDR A;  3AA6 B;  4YY3 T;  2F4V T;  3F57 A;  4IE0 A;  3RIF A;  3A7M A;  5FP3 A;  2VB6 A;  2BKN A;  1XMQ T;  4JV5 T;  1JNZ A;  4ZEY A;  1HR0 T;  2L8K A;  2Q9Q B;  4HFE A;  3ZCI A;  4AQG A;  4CXX A;  4AQY T;  2SPC A;  2QYW A;  3ZMV B;  3N2O A;  4NUU A;  3O1J A;  4AKH A;  2H88 A;  2X9Y A;  3RIU C;  2FJD A;  2IIU A;  1LVK A;  2VL0 A;  1I6Z A;  2IML A;  3EAB A;  4NXN T;  2UXX B;  2A9U A;  4U7Y A;  4C91 A;  1HS7 A;  4DV7 T;  1WCR A;  2VQE T;  3TLU A;  3ZEF B;  5BR8 T;  5AQH B;  2D0U A;  4PW8 A;  2V8S V;  3KDS E;  4H63 H;  1UUS A;  2Q9Q A;  3GWH A;  2ES0 A;  2XAF B;  2K24 A;  4U33 A;  3AEB A;  2PFV A;  1N34 T;  1UUR A;  4DUY T;  4IIJ E;  4IE7 A;  3PDY A;  2RPA A;  3OYZ A;  1HG5 A;  3X1D A;  2EHO B;  3Q5E A;  3UU4 A;  2X51 A;  1M7K A;  2HN1 A;  2VK9 A;  4JI5 T;  2PBI A;  3E22 E;  3FB2 A;  4IHJ E;  1G8X A;  2W66 A;  4AQF A;  3AAE B;  3CWZ B;  2DL1 A;  2LSG A;  3OPC A;  1HNW T;  2FUP A;  2XAJ B;  5AQI B;  4DR7 T;  2ZM2 A;  4B3T T;  4O4J E;  4TX5 A;  4P09 A;  2X68 A;  4CI2 B;  4DR1 T;  1YXR A;  3SOL A;  2JMK A;  3PUX F;  4BJN A;  3ZN1 B;  2XAH B;  2EHO A;  3JAE A;  5JH7 E;  2WDV A;  2R6G F;  4GKJ T;  3NRX A;  5AQU B;  4TN7 B;  2DI4 A;  1BR4 A;  4KI0 F;  3B5M A;  1IBM T;  1U4Q A;  2J47 A;  4ANJ A;  3ZYK A;  3N2K E;  2W63 A;  1VOM A;  3ZCJ A;  4YHJ A;  5TAO A;  4ILC A;  2CA5 A;  3ZPO A;  4PK4 A;  4LF9 T;  5F8P A;  2XQA A;  4EYY R;  2ODV A;  1AJ3 A;  1KEY A;  4KUM B;  2VL8 A;  3CPZ A;  5L4H A;  2DLR A;  2W62 A;  5FL1 A;  4A97 A;  2UXC T;  5LGT B;  1KF6 A;  4K0U A;  4JBW F;  4DR2 T;  4EB6 E;  2XPK A;  4QHO A;  1HX8 A;  4AKG A;  1XMO T;  3RX6 A;  5L4E A;  4TNW A;  4HWI B;  2WBL A;  3A8Y C;  2Y48 B;  2FJB A;  3TKL B;  3M3Z B;  2E9X B;  4LML A;  3QB5 A;  4IDN A;  4JI3 T;  4X64 T;  4DMV A;  2V5C A;  2KIN B;  4KHZ F;  4I43 B;  4JI4 T;  2WSS V;  3H3M A;  5FVL A;  1D0X A;  3FBL A;  2ODU A;  4A98 A;  3MXZ A;  4HWF A;  5LG3 A;  3ZLI A;  2IC9 A;  4MFR A;  5ABE A;  3RF1 A;  1KNR A;  4HFD A;  1KK7 A;  5LNK A;  4OX9 T;  2KZ7 B;  4WZX A;  4BA9 A;  3AXJ B;  4FJO A;  2E9X A;  3JAD A;  4U31 A;  5DQW A;  2LRL A;  2YU1 A;  3TLT A;  2K5B B;  2X9W A;  4EGW A;  2X66 A;  4DR5 T;  2A72 A;  4ZI7 E;  5LBQ B;  2MBG A;  4X1Y E;  4ZXL A;  1IAP A;  5JDG A;  3KV5 A;  3U78 A;  2PTF A;  2XSA A;  3RIA A;  4KMC A;  2ACZ A;  2K9A A;  2KSR A;  1J5E T;  5AQO B;  4EED A;  3B57 A;  2YU2 A;  3K3N A;  3P4P A;  4YTN A;  2VQF T;  2WZI A;  1EZ3 A;  2J1D G;  3Q5X A;  2BDE A;  4QH5 A;  3UQ7 A;  3RRC A;  2HPL A;  5FMN A;  2BVM A;  3N9O A;  3OYX A;  3O1I A;  3QOF A;  3P4Q A;  3AEG A;  2NOX A;  3FHN A;  2Q9Q C;  4FI5 A;  2JPF A;  1S94 A;  3D0T A;  1E2A A;  4YTM A;  4QX7 B;  4LFA T;  3O4X E;  3BK9 A;  4Z91 A;  1YQ3 A;  3CQG B;  3FZH B;  4L5G A;  4C90 A;  5AQF B;  4K0K T;  4NPP A;  3OBV E;  2D2S A;  4AQF C;  5IYZ E;  4HE8 A;  1WFD A;  3C4X A;  3UUN A;  5DJQ C;  1R8I A;  4AKR B;  2CXD A;  3OVU A;  2H7V C;  3C98 B;  3E08 A;  2YDQ A;  4DV5 T;  2DWK A;  4DV0 T;  5AQM B;  4TNV A;  2ZM6 T;  1T7S A;  3LJC A;  2KND A;  3AA1 B;  4X20 E;  1FMW A;  3UU5 A;  4P0B A;  1OWA A;  2EHO C;  1ZEE A;  4H9O C;  1T72 A;  4TWH A;  4DO0 A;  3NZQ A;  1HTJ F;  3AEC A;  3VKG A;  2K48 A;  3KBU A;  2ZMA A;  5EZY E;  2PG8 A;  4YSX A;  2VKJ A;  3L3P A;  4U74 A;  4LFB T;  3P4W A;  5EK2 A;  1W09 A;  2WB5 A;  4UF0 A;  4EOZ B;  3WAK A;  3I0Q A;  2M67 A;  2IAK A;  5L3B B;  3Q5W A;  5LMU T;  5EK3 A;  2C5K T;  2VVN A;  2M6I A;  3ZJ2 A;  1UX5 A;  3RQU A;  3AE8 A;  3K8P C;  2XJ7 A;  4U3C A;  4DUZ T;  3ONJ A;  3FZK B;  2N2N A;  2WS3 A;  4PFO A;  4PNI A;  5HEO A;  3W15 B;  4H9Q C;  2BS2 A;  2KMF A;  4IST A;  5KDM C;  5J2T E;  1FEW A;  4ZI2 C;  5LYJ E;  3QB5 K;  4AKI A;  3NWI A;  1LRZ A;  2B76 A;  3PUA A;  4GK5 E;  4HWH A;  3FBZ A;  3UU3 A;  1Y01 A;  5AQL B;  3UUX B;  2AE9 A;  5L3G B;  3FZF B;  3BQI A;  2V5D A;  2CEA A; 
#chains in the Genus database with same CATH homology
 5IWA T;  4JI8 T;  4LF8 T;  4B3S T;  4JI5 T;  4DR6 T;  3T1H T;  1J5E T;  2UXC T;  1FJG T;  4DR2 T;  4DV3 T;  2VQF T;  4DV6 T;  1XMO T;  4YY3 T;  4KHP T;  4X66 T;  2F4V T;  4JI0 T;  4LF5 T;  1HNW T;  4DR7 T;  1N36 T;  4LFB T;  4B3T T;  1IBK T;  2UUC T;  1HNZ T;  1XMQ T;  4B3R T;  4JV5 T;  4LFC T;  4JYA T;  4DR3 T;  2UXD T;  4JI3 T;  1HR0 T;  4DR1 T;  4X64 T;  1N33 T;  4JI4 T;  5LMU T;  2UU9 T;  4LFA T;  4AQY T;  2UUB T;  4JI2 T;  4JI7 T;  2E5L T;  4GKJ T;  4YHH T;  4B3M T;  4DV1 T;  4JI6 T;  4LF6 T;  1XNR T;  4K0K T;  4DUZ T;  4X65 T;  4GKK T;  4OX9 T;  4NXN T;  4X62 T;  1IBM T;  4DV4 T;  2UXB T;  3OTO T;  4DV7 T;  2UUA T;  2VQE T;  4NXM T;  1I94 T;  1IBL T;  5LMN T;  5BR8 T;  4DV5 T;  4DV0 T;  4LF9 T;  4JI1 T;  2ZM6 T;  4DR5 T;  4DV2 T;  1N34 T;  1XNQ T;  4DUY T;  1N32 T;  4DR4 T;  4LF4 T;  4LF7 T;  3T1Y T;  2HHH T;  1HNX T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...