4JI3T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji3T00
4KHPT 4K0KT 4X65T 5LMNT 1HNXT 4NXNT 4YY3T 2UUBT 2E5LT 4DR2T 5BR8T 2UXBT 4B3ST 4GKJT 4DV1T 4LF4T 4B3TT 2F4VT 4B3RT 1J5ET 1IBLT 1FJGT 4JI8T 5IWAT 4DR7T 1HR0T 4X62T 4DV4T 2UUCT 1N36T 1I94T 1N32T 4LFBT 4LF7T 4DUYT 1IBKT 4GKKT 4DUZT 4DR5T 4JI5T 3T1HT 2UXDT 4B3MT 4NXMT 1N33T 1XMOT 1IBMT 4DV5T 4JI6T 4JV5T 2UXCT 4OX9T 4LF6T 1XNRT 4YHHT 4DR4T 4AQYT 2HHHT 4LF5T 2UU9T 1XNQT 1XMQT 4DR6T 2ZM6T 4X66T 4LFCT 2VQFT 5LMUT 4LF8T 3T1YT 4JI7T 4JI1T 1HNZT 4JI4T 2UUAT 4DV3T 4X64T 4LF9T 4JI0T 4DR3T 3OTOT 4DV6T 4LFAT 4DR1T 4DV2T 4DV7T 1HNWT 4DV0T 4JI3T 4JI2T 1N34T 2VQET 4JYAT
chains in the Genus database with same CATH superfamily
4A97A 2X68A 4HWFA 1UX5A 2A2FX 5LGTB 3I9WA 2NP9A 3TLTA 3UT5E 5L3GB 4IDOA 2YDQA 1E7PA 3KV6A 3C50A 3N5LA 3L3PA 2UXXB 4EYYR 5FNVE 5EZYE 5FP3A 1W0BA 4O4IE 4H63V 3CWZB 2V26A 1OEDB 4EEBA 4DR5T 4DO0A 3KDSE 2NTXA 4U7IA 2J47A 2WDVA 2M67A 3JADA 1VOMA 4OHFA 3ETVA 3QK6A 5KXJA 2XQ4A 3LK3B 2CBJA 1H7CA 3N9OA 2MAWA 4DR6T 3EI0A 2VQFT 2VB6A 4JI7T 2XQ6A 2XQAA 3ZCJA 4JI4T 4MALA 2H7OA 2CEAA 3ABVA 3I1AA 2A9UA 3F57A 5AQLB 1KF6A 2WP9A 1HX1B 4EXTA 5LJNA 3X1DA 1G73A 2JQKA 5KX5E 4LMJA 4EEDA 1QLBA 3MXZA 2E9XB 3ZMZB 4C91A 2WDQA 5LMNT 4I43B 4ZI2D 3U78A 3HKDE 2XJ7A 3FBLA 4YSZA 5AQGB 3T8OA 3PU8A 1O3XA 5C2TA 4ZS2A 3I9YA 3NVOA 2WSSV 2XAQB 2A72A 3SOLA 3Q9DA 2XM2A 4IE7A 4ZXLA 5LB7B 2XAGB 3KVAA 4X62T 4KMCA 2WS3A 4UVBB 4ILCA 3CPZA 1WYBA 4JI5T 3T1HT 3K1SA 1WCRA 2C5KT 3SRZA 4EIWA 1FIOA 4PJJA 2DWKA 2LSYA 4WBOA 4ZI7E 5AQFB 3RIAA 2IC9A 4PFPA 4Z91A 2RA1A 5LOVE 2VVSA 3VR9A 3K3NA 5CA0E 2Q9QB 4ZS3A 2WM9A 2BKOA 1XNQT 2XSAA 2W63A 2X51A 5FVKA 3UUMA 2ZM6T 4X1IE 4ZOLE 4K0UA 3JC6D 4UR9A 2WB5A 4ADZA 5FY7A 3KV9A 1MIVA 1R8IA 3PJAA 4LF9T 3OTOT 2KXPB 2W62A 3KV4A 3VR8A 4DVDA 3LG7A 4U31A 2E5VA 1D0ZA 4X1YE 3HKBE 3K3QC 3NKZA 4BAYB 4HTEA 5FXWA 2FBWA 3UQ4A 4YJ2E 2KNDA 3DJBA 4DR7T 5JVDE 5AQPB 2XHEB 2CCQA 5LGNB 3I0OA 2D0TA 1WRDA 5FY0A 1KEYA 4GIWA 3WAJA 3AAAB 2CXDA 2LEHA 4B6XA 3O1HA 2B76A 4Z8XA 4QXHB 3NZQA 4HN9A 4IE4A 5BMVE 3RPUA 5EK3A 1V9DA 3ONJA 2VURA 4I55E 1MMDA 1IAPA 3LK42 2ZM0A 5FL0A 3AEAA 1NENA 4IDPA 4IDNA 2A3DA 1KNRA 1S35A 3FB2A 2YINA 4DR1T 1EZ3A 3NWIA 4UF0B 3RC3A 2XTLA 5M4YA 1J1JA 5ABEA 5TAOA 5CB4E 4CN6A 3AEBA 4ILUA 3CQGB 3H37A 4TV9E 3IHRA 1IJ5A 3ONLC 4IGUA 2LHRA 2GK9A 4B3TT 3LFMA 2X67A 3E22E 4F6RC 3V5UA 3HA4A 4HWIB 1I6ZA 4UELA 2JRKA 4X5TA 5HCMA 4YLHA 5ABFB 3M65A 5GONE 2PFVA 2NW8A 1W09A 1T72A 2X9YA 2LSKA 3Q5EA 2JQ9A 2XQ7A 2H89A 4CN4A 2LKHA 4IDZA 2JMHA 1FMWA 5CFBA 4HEAA 5JDFA 4ERRA 3OYXA 2KSRA 4AXPA 4LFCT 4LF8T 1MIYA 3ZMUB 3RLFF 1JNRA 3KBUA 3CMLA 2WZIA 5HWXA 2BG9C 2ACZA 2DHRA 2LJLA 4YXDA 2CLYC 4JEUB 3DTOA 3JAEA 2IMLA 2BVLA 4IE0A 2ZM2A 4I50E 5IYZE 3MACA 2WZHA 3ZC0A 4TWDA 3C51A 2V8SV 3VKGA 2CRBA 5JR9C 3G06A 5HXSA 3JAFA 3V5SA 4I0UA 4PW8A 5HEHA 2UXBT 4GK5E 4GKJT 3P4SA 5JRCB 3A8YC 3PU3A 4JBWF 2E2AA 2UUCT 4CXWA 1UURA 2HPJA 3P4PA 4QKNA 4IREA 4PK6A 5L4HA 2V7JA 3FHNA 3ZN0B 3FXEB 2EHOC 5L3BB 4TNWA 1ZOYA 3O1JA 3ZJ1A 2WU2A 4MFRA 1VRBA 2HN2A 3P4RA 4OFZA 1BR4A 3ZPOA 1XNRT 3P50A 4QH1A 5LGUB 1XDOA 4IL4A 4AI6A 5DQWA 5FMNA 3UU6A 5JQGE 4ZI3C 5LYJE 5ABGA 4DR3T 5JDMA 4ANJA 1YXRA 4L0RA 2IDOB 5IHYA 5HXCA 4K0KT 3AVSA 2V6YA 2IW5B 1SUMB 3PUAA 2X9WA 3P7IA 3TLUA 2MTQA 4IT4A 3RIUC 3PE0A 4HWDA 4WW0A 1IBLT 3RRCA 1KNZA 2XY8B 1GQEA 1YQ4A 4ISSA 2BS2A 3VRBA 5L3DB 1SHZC 2X66A 4HGAA 4DUYT 3ZKRA 4GYRA 2DL1A 2KWHA 2YOEA 3H3AA 4H9RC 2XPKA 3PUSA 4U2YA 2BKPA 1HCIA 5DQVA 2WMNA 3AXJB 2DWGA 5LBMA 4G2AA 3OBVE 3LJCA 4HKAA 2XZEA 4NIQA 3CQXC 3UUXB 2MYSA 5L3FB 3N9LA 5L2LA 2BDEA 3BQLA 4YTMA 1OEDC 3BK9A 3AA0B 2BG9A 3AA6B 3KFWX 3IBPA 4JI0T 2PJQA 4PNIA 2I59A 3B57A 1US7B 2KMFA 4DMWA 4X1KE 4COFA 1XWMA 2X9HA 4QH4A 5JR9A 1WR0A 2JMKA 2ZMAA 2H88A 5LJMA 1YKEB 1MNEA 3ESLA 3UQ7A 5JH7E 3NZPA 5AFUL 4C90A 3UFEA 4UV9B 3FZKB 4DR2T 2D0UA 1YW0A 2V5DA 5HXEA 4B3ST 3AA1B 4WNKA 1J5ET 1MMNA 2C5IT 4AQFC 1FJGT 3A5XA 5AQSB 3MKDA 3I0QA 1YD8G 5L47A 3IA3A 2QA7A 5LHGB 2V7IA 3LDQB 4WYVA 2EHOA 3QB5K 2E9XC 3ANWA 4CZZB 3AE3A 1MNDA 5ETWA 3SS1A 2XQ5A 2UXDT 4B3MT 1N33T 1S94A 3GN5A 2KINB 4ILBA 2PTFA 1HF8A 5LP6E 4TNVA 3QB5A 2LE8A 4P1NA 3TLSA 2W00A 4AKLA 2BZBA 3LBXA 3RYIE 4JI1T 1HNZT 4H9PC 4DV3T 3AE1A 1XDPA 4E7SA 2Y8DA 3UTKA 5LA6E 3O4XE 4DV2T 2IHR1 3ZJ2A 1AJ3A 2XAHB 1UGOA 4PJNA 5AQMB 4TUYE 2Q9QC 4Z90A 2IAKA 2LOPA 2N2NA 3AE7A 3MZKB 1HX8A 2VASA 3C4ZA 1HNXT 5LXTE 3OJAA 2WAUA 3RIUA 3ZMVB 2ODVA 5C8YE 1Z8UA 4DV1T 3U3IA 4O4LE 5JDQA 4JI8T 3MK7C 5AQKB 5AQHB 3Q2MA 3C98B 1D1BA 4HWHA 4LFBT 1N32T 2ACXA 4EZHA 5H6RB 2XAFB 3E0ZA 2I0MA 2XSBA 3HI2A 3H3MA 4UXNB 3RC8A 3MA9A 2KZ7B 4LF6T 2MPKA 2W66A 3VHLA 2FJBA 1SA0E 4ISTA 1XMQT 4V1Av 3PV0F 4AKHA 1OEDA 3RYCE 2K9AA 3WAKA 5L4EA 2G0UA 2X9XA 4YTNA 3K3OA 2PG8A 3L8RA 2CE7A 2WWUA 4YJ3E 2BG9E 2BBJA 4DIDB 2M6IA 3VRAA 2VVNA 5F8PA 5HEGA 3PURA 2XQ9A 3R6NA 5KDMC 4AISA 2Y6XA 2BS3A 4EAHA 4HWCA 2XM1A 2B1EA 5JTGA 1UCUA 3N2GE 4L5GA 1W9RA 2N1GA 1NEKA 2V6XA 5IWAT 2LM9A 2YN6A 2DI4A 4U74A 3ETUA 1M7KA 4PJMA 4DV4T 4FI5A 2E9XA 4ZI2C 2M6BA 2YU2A 2VWAA 4QHOA 5HWYA 3AE8A 5FXZA 4MHCA 3RX6A 5HXHA 4CXXA 2NTYA 5IUXA 4JUYA 2LRKA 4DNDA 4A56A 1X9BA 3SFEA 3C4WA 3AEFA 5CJ5A 4AIUA 3AE4A 1QSDA 4YT0A 3JCFA 4LF5T 3RYFE 2UU9T 3PUXF 1Y01A 3PTRB 1ZEEA 4X66T 3UUBA 4H9OC 4QWNB 2LSIA 2NWBA 4O4HE 4QXBB 2C5JA 2CWYA 3ZEFB 4KBMB 2HPLA 3F31A 4DV6T 5AQJB 1VCTA 2RPAA 3UU8A 3ZSTA 2Q9QA 2W61A 1D0XA 3RIFA 3CX6B 4H9SE 2SPCA 4IIJE 4EV6A 3JC6C 2XQ3A 2Z6EA 2E5LT 2JPFA 3NBXX 3KINB 4KUMB 3NRYA 3ZT6A 2V7MA 3K8PC 3RF1A 4EZ4A 3QNUA 3VU7H 3RI5A 5LBQB 1HR0T 3FZHB 3CX7B 3EUHA 3EDVA 1LVKA 1FMVA 3UUNA 3ZYMA 2CPTA 2H3RA 2J62A 5JDHA 1BR1A 4OX9T 2IC6A 4PFOA 2LT3A 4BJNA 2UXNB 3CIRA 1MMAA 2OLTA 1NWMX 4QXCB 3TKLB 2QYWA 3GMIA 3PJAJ 3OKQA 3Q5DA 4P0AA 1OEDE 3ZMSB 4NUUA 4IE5A 4QX8B 1J5WA 1BR2A 4H9NC 3RRWA 5CA1E 4XBFB 2BBHA 4PAGA 3D0TA 5AQQB 1NAFA 2LHNA 3ZN1B 2WQYA 3A7MA 1OWAA 4KP3C 3UULA 3Q5XA 4UF0A 4P0BA 4CI3B 2VL0A 1HG2A 2CXLA 1ZKEA 1I94T 2Y48B 5LG3A 4U33A 3OPCA 1IBKT 4JEHB 2FJEA 2WMOA 4GKKT 4DUZT 3IEEA 3PUVF 5FKYA 3UU5A 1XMOT 5JREA 4DMVA 1HS7A 5FYMA 3NRXA 3PUWF 4MBQA 2WCAA 2YDRA 1IZNB 2R6GF 1JNZA 3LK2B 5AQUB 3N9MA 4E7ZA 5ABFA 4GOUA 3WI3A 3UU4A 5LG4A 4ZEYA 3KV5A 3ZMTB 4GK0E 4KI0F 3GA8A 4EB6E 4Q25A 2X0HA 1KNPA 1Z0PA 5A1LA 2XQYA 4TWFA 4CXYA 4HFIA 2C0SA 4AQGA 4IHJE 2VL8A 3N9QA 1E2AA 3P4WA 2CHNA 2XUEA 1CHUA 4ZZCA 4TN7B 2W2UA 4KHPT 4P09A 3AE2A 2L8KA 5HAXA 2YEVC 2FUPA 4M1PA 3PUGA 3UFGA 4BA9A 4CN1A 4HFEA 3TLVA 5BR8T 2E8IA 3AVRA 3HL6A 2CBIA 2CM0A 4KHZF 1SE7A 2RP4A 4UVAB 3AE6A 1FEWA 1T98A 2NOXA 2XAJB 3UU3A 4LF7T 3AE5A 1CUNA 1T7SA 3RKOA 5L3CB 5AQVB 4QX7B 1ZP0A 2BKNA 4IDQA 3AB3B 2FJDA 3N2OA 4DBRA 4JV5T 1LRZA 4PK4A 5JRCA 3EABA 4U2ZA 2AE9A 4ILAA 4DR4T 5EK4A 5FXXA 4JLEA 5HYAA 4UIGA 4UVCB 4CI2B 5JDGA 4AKGA 4HFCA 3F2EA 3T1YT 4A98A 2BS4A 4CI1B 2AXDS 3C64A 2CA5A 4HE8A 3ZLIA 2DLRA 1LVFA 5J2TE 3AEEA 5DABA 2MOZA 2ZLYA 3O1IA 5HCJA 3J9X1 2PBIA 3EVYA 2JIWA 1U5PA 4DV0T 2IUBA 4HFHA 1N34T 4O4JE 3FZMB 3AA7B 4NUVA 2VKHA 3EDUA 4HFVA 3MJXA 4AKIA 3VKHA 2OA5A 3N2KE 4U3CA 2WWVA 1BR0A 2LOSA 1B7TA 3CX8B 4XZCA 4TWHA 3RYHE 4IE6A 2LSGA 3DP7A 1UX4A 5AQIB 1W0AA 2ES0A 3ONXA 2W0GA 3SWHA 1YKHB 5FVLA 3RGLA 2W4XA 4G63A 1IBMT 5F5WA 5FY1A 5AQTB 3RKGA 3GWHA 2UXCT 4PK5A 3FXDB 1UK5A 2HHHT 4XAXB 3PUYF 5L3EB 2V5CA 4ZHQE 2HN1A 2IIUA 2W67A 3ZSSA 4H63H 4ASKA 5AQOB 2N9DA 2LLYA 3W15B 5E0OA 2OV9A 5H6QB 3M3ZB 4OYJA 3PUQA 2JQHA 4DBQA 5FL1A 2L3LA 5CGMA 3AXJA 3ZT7A 4JI3T 3FZFB 3QUJA 4JYAT 2K5BB 5AQRB 3RQWA 3OYZA 3B5MA 5J1GA 2KLQA 4MLKA 2J1DG 3RQUA 2EHOD 4B3RT 1XZYA 3R84B 1Y64B 1G8XA 1WYCA 1HFAA 3TLWA 3ZCIA 2JQQA 4O2AE 2LSJA 2XASB 3HR0A 4YFSA 2D2SA 5LNKA 3N9NA 4H9QC 2YKSA 1HG5A 3AAEB 4WZXA 3ZT5A 3RHWA 4AQFA 2LKGA 2V1DB 4L9IA 2YDSA 4JI6T 3LSVA 2LM2A 4X20E 3ZYLA 4ZI3D 4FJOA 4HFDA 4TZ4C 2BVMA 3RH3A 3FBZA 4YHJA 2V7LA 2YK0A 5J2UE 3QC9A 4UEMA 5HEJA 5HEUA 2V6YB 3BQKA 5EK2A 3OVUA 2UUAT 3HKEE 2KT9A 3HKCE 3B13A 1D0YA 4TV8E 4LFAT 2CWOA 2FJAA 1OXZA 2D5UA 1HNWT 2NW9A 1E1HB 2VQET 1LKXA 2X0YA 4AKRB 4BJMA 2V7KA 3BQIA 4X65T 3EHZA 2KWIB 3Q5WA 4NPPA 4YY3T 5DJQC 4I4TE 1ZHCA 2F4VT 4PJLA 2CXFA 3AECA 2X0LB 1DU2A 1KK7A 4CQIA 4EOZB 2VKDA 1HTJF 4LMLA 1N36T 2LRLA 3QOFA 3CK6A 3P8CD 1UUSA 3N9PA 4EGWA 3CQCB 4NXMT 2BG9B 3CVRA 1IJ6A 2L9QA 1MIWA 2CLYB 1L0VA 5LHHB 3E08A 3L09A 3FZLB 4YHHT 5C3JA 1WR6A 4OK0A 4KX6A 2VKJA 3CKDA 5JR9B 3AAIA 5LCYA 4F8HA 2J4GA 4YSYA 2JJ9A 4EYUA 2NR4A 4LMKA 5HEOA 1MMGA 1D1AA 2QRXA 3AE9A 4U72A 4U7YA 2ZM8A 5ADXL 2DNXA 4DV7T 3AEGA 1WFDA 4JI2T 4WBNE 2ODUA 1D1CA 4HFBA 3PUZF 5ABHA 5F3JA 2EHOB 1ZV4X 4OYKA 1M62A 2XQ8A 3ANWB 5FXVA 4NXNT 2UUBT 2HH7A 2E9XD 4N78D 2NW7A 4IL9A 2I6HA 3GN5B 1YQ3A 4LF4T 5JDLA 4YSXA 2WY2A 5J0ZA 2DCFA 3ZC1A 3SFDA 4TX5A 3AEDA 5AQNB 5HXRA 2CMRA 4O2BE 4YTPA 3EAMA 3LBXB 2QGSA 5LHIB 3IF8B 5KMGP 2CHOA 3P4QA 1X79A 4DV5T 2VKOA 4ZZBA 2WU5A 2P9BA 2D9DA 1T8BA 4QH5A 2QVAA 2VK9A 2WBLA 3J7Yq 4AQYT 3L39A 4UV8B 5LMUT 4O8SA 1U4QA 2Q9QD 1KFYA 2WDRA 2K24A 4J2CA 5JDNA 3C4XA 3KBTA 1QUUA 4GYSA 4A5XA 4X64T 2K3WA 2YU1A 3PDYA 3O9XA 1WLXA 3ZYKA 2MBGA 2H7VC 2K48A 3KVBA 1VCSA 3S4UA
chains in the Genus database with same CATH topology
4KHPT 4K0KT 4X65T 5LMNT 1HNXT 4NXNT 4YY3T 2UUBT 2E5LT 4DR2T 5BR8T 2UXBT 4B3ST 4GKJT 4DV1T 4LF4T 4B3TT 2F4VT 4B3RT 1J5ET 1IBLT 1FJGT 4JI8T 5IWAT 4DR7T 1HR0T 4X62T 4DV4T 2UUCT 1N36T 1I94T 1N32T 4LFBT 4LF7T 4DUYT 1IBKT 4GKKT 4DUZT 4DR5T 4JI5T 3T1HT 2UXDT 4B3MT 4NXMT 1N33T 1XMOT 1IBMT 4DV5T 4JI6T 4JV5T 2UXCT 4OX9T 4LF6T 1XNRT 4YHHT 4DR4T 4AQYT 2HHHT 4LF5T 2UU9T 1XNQT 1XMQT 4DR6T 2ZM6T 4X66T 4LFCT 2VQFT 5LMUT 4LF8T 3T1YT 4JI7T 4JI1T 1HNZT 4JI4T 2UUAT 4DV3T 4X64T 4LF9T 4JI0T 4DR3T 3OTOT 4DV6T 4LFAT 4DR1T 4DV2T 4DV7T 1HNWT 4DV0T 4JI3T 4JI2T 1N34T 2VQET 4JYAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP T;  4K0K T;  4X65 T;  5LMN T;  1HNX T;  4NXN T;  4YY3 T;  2UUB T;  2E5L T;  4DR2 T;  5BR8 T;  2UXB T;  4B3S T;  4GKJ T;  4DV1 T;  4LF4 T;  4B3T T;  2F4V T;  4B3R T;  1J5E T;  1IBL T;  1FJG T;  4JI8 T;  5IWA T;  4DR7 T;  1HR0 T;  4X62 T;  4DV4 T;  2UUC T;  1N36 T;  1I94 T;  1N32 T;  4LFB T;  4LF7 T;  4DUY T;  1IBK T;  4GKK T;  4DUZ T;  4DR5 T;  4JI5 T;  3T1H T;  2UXD T;  4B3M T;  4NXM T;  1N33 T;  1XMO T;  1IBM T;  4DV5 T;  4JI6 T;  4JV5 T;  2UXC T;  4OX9 T;  4LF6 T;  1XNR T;  4YHH T;  4DR4 T;  4AQY T;  2HHH T;  4LF5 T;  2UU9 T;  1XNQ T;  1XMQ T;  4DR6 T;  2ZM6 T;  4X66 T;  4LFC T;  2VQF T;  5LMU T;  4LF8 T;  3T1Y T;  4JI7 T;  4JI1 T;  1HNZ T;  4JI4 T;  2UUA T;  4DV3 T;  4X64 T;  4LF9 T;  4JI0 T;  4DR3 T;  3OTO T;  4DV6 T;  4LFA T;  4DR1 T;  4DV2 T;  4DV7 T;  1HNW T;  4DV0 T;  4JI3 T;  4JI2 T;  1N34 T;  2VQE T;  4JYA T; 
#chains in the Genus database with same CATH topology
 4A97 A;  2X68 A;  4HWF A;  1UX5 A;  2A2F X;  5LGT B;  3I9W A;  2NP9 A;  3TLT A;  3UT5 E;  5L3G B;  4IDO A;  2YDQ A;  1E7P A;  3KV6 A;  3C50 A;  3N5L A;  3L3P A;  2UXX B;  4EYY R;  5FNV E;  5EZY E;  5FP3 A;  1W0B A;  4O4I E;  4H63 V;  3CWZ B;  2V26 A;  1OED B;  4EEB A;  4DR5 T;  4DO0 A;  3KDS E;  2NTX A;  4U7I A;  2J47 A;  2WDV A;  2M67 A;  3JAD A;  1VOM A;  4OHF A;  3ETV A;  3QK6 A;  5KXJ A;  2XQ4 A;  3LK3 B;  2CBJ A;  1H7C A;  3N9O A;  2MAW A;  4DR6 T;  3EI0 A;  2VQF T;  2VB6 A;  4JI7 T;  2XQ6 A;  2XQA A;  3ZCJ A;  4JI4 T;  4MAL A;  2H7O A;  2CEA A;  3ABV A;  3I1A A;  2A9U A;  3F57 A;  5AQL B;  1KF6 A;  2WP9 A;  1HX1 B;  4EXT A;  5LJN A;  3X1D A;  1G73 A;  2JQK A;  5KX5 E;  4LMJ A;  4EED A;  1QLB A;  3MXZ A;  2E9X B;  3ZMZ B;  4C91 A;  2WDQ A;  5LMN T;  4I43 B;  4ZI2 D;  3U78 A;  3HKD E;  2XJ7 A;  3FBL A;  4YSZ A;  5AQG B;  3T8O A;  3PU8 A;  1O3X A;  5C2T A;  4ZS2 A;  3I9Y A;  3NVO A;  2WSS V;  2XAQ B;  2A72 A;  3SOL A;  3Q9D A;  2XM2 A;  4IE7 A;  4ZXL A;  5LB7 B;  2XAG B;  3KVA A;  4X62 T;  4KMC A;  2WS3 A;  4UVB B;  4ILC A;  3CPZ A;  1WYB A;  4JI5 T;  3T1H T;  3K1S A;  1WCR A;  2C5K T;  3SRZ A;  4EIW A;  1FIO A;  4PJJ A;  2DWK A;  2LSY A;  4WBO A;  4ZI7 E;  5AQF B;  3RIA A;  2IC9 A;  4PFP A;  4Z91 A;  2RA1 A;  5LOV E;  2VVS A;  3VR9 A;  3K3N A;  5CA0 E;  2Q9Q B;  4ZS3 A;  2WM9 A;  2BKO A;  1XNQ T;  2XSA A;  2W63 A;  2X51 A;  5FVK A;  3UUM A;  2ZM6 T;  4X1I E;  4ZOL E;  4K0U A;  3JC6 D;  4UR9 A;  2WB5 A;  4ADZ A;  5FY7 A;  3KV9 A;  1MIV A;  1R8I A;  3PJA A;  4LF9 T;  3OTO T;  2KXP B;  2W62 A;  3KV4 A;  3VR8 A;  4DVD A;  3LG7 A;  4U31 A;  2E5V A;  1D0Z A;  4X1Y E;  3HKB E;  3K3Q C;  3NKZ A;  4BAY B;  4HTE A;  5FXW A;  2FBW A;  3UQ4 A;  4YJ2 E;  2KND A;  3DJB A;  4DR7 T;  5JVD E;  5AQP B;  2XHE B;  2CCQ A;  5LGN B;  3I0O A;  2D0T A;  1WRD A;  5FY0 A;  1KEY A;  4GIW A;  3WAJ A;  3AAA B;  2CXD A;  2LEH A;  4B6X A;  3O1H A;  2B76 A;  4Z8X A;  4QXH B;  3NZQ A;  4HN9 A;  4IE4 A;  5BMV E;  3RPU A;  5EK3 A;  1V9D A;  3ONJ A;  2VUR A;  4I55 E;  1MMD A;  1IAP A;  3LK4 2;  2ZM0 A;  5FL0 A;  3AEA A;  1NEN A;  4IDP A;  4IDN A;  2A3D A;  1KNR A;  1S35 A;  3FB2 A;  2YIN A;  4DR1 T;  1EZ3 A;  3NWI A;  4UF0 B;  3RC3 A;  2XTL A;  5M4Y A;  1J1J A;  5ABE A;  5TAO A;  5CB4 E;  4CN6 A;  3AEB A;  4ILU A;  3CQG B;  3H37 A;  4TV9 E;  3IHR A;  1IJ5 A;  3ONL C;  4IGU A;  2LHR A;  2GK9 A;  4B3T T;  3LFM A;  2X67 A;  3E22 E;  4F6R C;  3V5U A;  3HA4 A;  4HWI B;  1I6Z A;  4UEL A;  2JRK A;  4X5T A;  5HCM A;  4YLH A;  5ABF B;  3M65 A;  5GON E;  2PFV A;  2NW8 A;  1W09 A;  1T72 A;  2X9Y A;  2LSK A;  3Q5E A;  2JQ9 A;  2XQ7 A;  2H89 A;  4CN4 A;  2LKH A;  4IDZ A;  2JMH A;  1FMW A;  5CFB A;  4HEA A;  5JDF A;  4ERR A;  3OYX A;  2KSR A;  4AXP A;  4LFC T;  4LF8 T;  1MIY A;  3ZMU B;  3RLF F;  1JNR A;  3KBU A;  3CML A;  2WZI A;  5HWX A;  2BG9 C;  2ACZ A;  2DHR A;  2LJL A;  4YXD A;  2CLY C;  4JEU B;  3DTO A;  3JAE A;  2IML A;  2BVL A;  4IE0 A;  2ZM2 A;  4I50 E;  5IYZ E;  3MAC A;  2WZH A;  3ZC0 A;  4TWD A;  3C51 A;  2V8S V;  3VKG A;  2CRB A;  5JR9 C;  3G06 A;  5HXS A;  3JAF A;  3V5S A;  4I0U A;  4PW8 A;  5HEH A;  2UXB T;  4GK5 E;  4GKJ T;  3P4S A;  5JRC B;  3A8Y C;  3PU3 A;  4JBW F;  2E2A A;  2UUC T;  4CXW A;  1UUR A;  2HPJ A;  3P4P A;  4QKN A;  4IRE A;  4PK6 A;  5L4H A;  2V7J A;  3FHN A;  3ZN0 B;  3FXE B;  2EHO C;  5L3B B;  4TNW A;  1ZOY A;  3O1J A;  3ZJ1 A;  2WU2 A;  4MFR A;  1VRB A;  2HN2 A;  3P4R A;  4OFZ A;  1BR4 A;  3ZPO A;  1XNR T;  3P50 A;  4QH1 A;  5LGU B;  1XDO A;  4IL4 A;  4AI6 A;  5DQW A;  5FMN A;  3UU6 A;  5JQG E;  4ZI3 C;  5LYJ E;  5ABG A;  4DR3 T;  5JDM A;  4ANJ A;  1YXR A;  4L0R A;  2IDO B;  5IHY A;  5HXC A;  4K0K T;  3AVS A;  2V6Y A;  2IW5 B;  1SUM B;  3PUA A;  2X9W A;  3P7I A;  3TLU A;  2MTQ A;  4IT4 A;  3RIU C;  3PE0 A;  4HWD A;  4WW0 A;  1IBL T;  3RRC A;  1KNZ A;  2XY8 B;  1GQE A;  1YQ4 A;  4ISS A;  2BS2 A;  3VRB A;  5L3D B;  1SHZ C;  2X66 A;  4HGA A;  4DUY T;  3ZKR A;  4GYR A;  2DL1 A;  2KWH A;  2YOE A;  3H3A A;  4H9R C;  2XPK A;  3PUS A;  4U2Y A;  2BKP A;  1HCI A;  5DQV A;  2WMN A;  3AXJ B;  2DWG A;  5LBM A;  4G2A A;  3OBV E;  3LJC A;  4HKA A;  2XZE A;  4NIQ A;  3CQX C;  3UUX B;  2MYS A;  5L3F B;  3N9L A;  5L2L A;  2BDE A;  3BQL A;  4YTM A;  1OED C;  3BK9 A;  3AA0 B;  2BG9 A;  3AA6 B;  3KFW X;  3IBP A;  4JI0 T;  2PJQ A;  4PNI A;  2I59 A;  3B57 A;  1US7 B;  2KMF A;  4DMW A;  4X1K E;  4COF A;  1XWM A;  2X9H A;  4QH4 A;  5JR9 A;  1WR0 A;  2JMK A;  2ZMA A;  2H88 A;  5LJM A;  1YKE B;  1MNE A;  3ESL A;  3UQ7 A;  5JH7 E;  3NZP A;  5AFU L;  4C90 A;  3UFE A;  4UV9 B;  3FZK B;  4DR2 T;  2D0U A;  1YW0 A;  2V5D A;  5HXE A;  4B3S T;  3AA1 B;  4WNK A;  1J5E T;  1MMN A;  2C5I T;  4AQF C;  1FJG T;  3A5X A;  5AQS B;  3MKD A;  3I0Q A;  1YD8 G;  5L47 A;  3IA3 A;  2QA7 A;  5LHG B;  2V7I A;  3LDQ B;  4WYV A;  2EHO A;  3QB5 K;  2E9X C;  3ANW A;  4CZZ B;  3AE3 A;  1MND A;  5ETW A;  3SS1 A;  2XQ5 A;  2UXD T;  4B3M T;  1N33 T;  1S94 A;  3GN5 A;  2KIN B;  4ILB A;  2PTF A;  1HF8 A;  5LP6 E;  4TNV A;  3QB5 A;  2LE8 A;  4P1N A;  3TLS A;  2W00 A;  4AKL A;  2BZB A;  3LBX A;  3RYI E;  4JI1 T;  1HNZ T;  4H9P C;  4DV3 T;  3AE1 A;  1XDP A;  4E7S A;  2Y8D A;  3UTK A;  5LA6 E;  3O4X E;  4DV2 T;  2IHR 1;  3ZJ2 A;  1AJ3 A;  2XAH B;  1UGO A;  4PJN A;  5AQM B;  4TUY E;  2Q9Q C;  4Z90 A;  2IAK A;  2LOP A;  2N2N A;  3AE7 A;  3MZK B;  1HX8 A;  2VAS A;  3C4Z A;  1HNX T;  5LXT E;  3OJA A;  2WAU A;  3RIU A;  3ZMV B;  2ODV A;  5C8Y E;  1Z8U A;  4DV1 T;  3U3I A;  4O4L E;  5JDQ A;  4JI8 T;  3MK7 C;  5AQK B;  5AQH B;  3Q2M A;  3C98 B;  1D1B A;  4HWH A;  4LFB T;  1N32 T;  2ACX A;  4EZH A;  5H6R B;  2XAF B;  3E0Z A;  2I0M A;  2XSB A;  3HI2 A;  3H3M A;  4UXN B;  3RC8 A;  3MA9 A;  2KZ7 B;  4LF6 T;  2MPK A;  2W66 A;  3VHL A;  2FJB A;  1SA0 E;  4IST A;  1XMQ T;  4V1A v;  3PV0 F;  4AKH A;  1OED A;  3RYC E;  2K9A A;  3WAK A;  5L4E A;  2G0U A;  2X9X A;  4YTN A;  3K3O A;  2PG8 A;  3L8R A;  2CE7 A;  2WWU A;  4YJ3 E;  2BG9 E;  2BBJ A;  4DID B;  2M6I A;  3VRA A;  2VVN A;  5F8P A;  5HEG A;  3PUR A;  2XQ9 A;  3R6N A;  5KDM C;  4AIS A;  2Y6X A;  2BS3 A;  4EAH A;  4HWC A;  2XM1 A;  2B1E A;  5JTG A;  1UCU A;  3N2G E;  4L5G A;  1W9R A;  2N1G A;  1NEK A;  2V6X A;  5IWA T;  2LM9 A;  2YN6 A;  2DI4 A;  4U74 A;  3ETU A;  1M7K A;  4PJM A;  4DV4 T;  4FI5 A;  2E9X A;  4ZI2 C;  2M6B A;  2YU2 A;  2VWA A;  4QHO A;  5HWY A;  3AE8 A;  5FXZ A;  4MHC A;  3RX6 A;  5HXH A;  4CXX A;  2NTY A;  5IUX A;  4JUY A;  2LRK A;  4DND A;  4A56 A;  1X9B A;  3SFE A;  3C4W A;  3AEF A;  5CJ5 A;  4AIU A;  3AE4 A;  1QSD A;  4YT0 A;  3JCF A;  4LF5 T;  3RYF E;  2UU9 T;  3PUX F;  1Y01 A;  3PTR B;  1ZEE A;  4X66 T;  3UUB A;  4H9O C;  4QWN B;  2LSI A;  2NWB A;  4O4H E;  4QXB B;  2C5J A;  2CWY A;  3ZEF B;  4KBM B;  2HPL A;  3F31 A;  4DV6 T;  5AQJ B;  1VCT A;  2RPA A;  3UU8 A;  3ZST A;  2Q9Q A;  2W61 A;  1D0X A;  3RIF A;  3CX6 B;  4H9S E;  2SPC A;  4IIJ E;  4EV6 A;  3JC6 C;  2XQ3 A;  2Z6E A;  2E5L T;  2JPF A;  3NBX X;  3KIN B;  4KUM B;  3NRY A;  3ZT6 A;  2V7M A;  3K8P C;  3RF1 A;  4EZ4 A;  3QNU A;  3VU7 H;  3RI5 A;  5LBQ B;  1HR0 T;  3FZH B;  3CX7 B;  3EUH A;  3EDV A;  1LVK A;  1FMV A;  3UUN A;  3ZYM A;  2CPT A;  2H3R A;  2J62 A;  5JDH A;  1BR1 A;  4OX9 T;  2IC6 A;  4PFO A;  2LT3 A;  4BJN A;  2UXN B;  3CIR A;  1MMA A;  2OLT A;  1NWM X;  4QXC B;  3TKL B;  2QYW A;  3GMI A;  3PJA J;  3OKQ A;  3Q5D A;  4P0A A;  1OED E;  3ZMS B;  4NUU A;  4IE5 A;  4QX8 B;  1J5W A;  1BR2 A;  4H9N C;  3RRW A;  5CA1 E;  4XBF B;  2BBH A;  4PAG A;  3D0T A;  5AQQ B;  1NAF A;  2LHN A;  3ZN1 B;  2WQY A;  3A7M A;  1OWA A;  4KP3 C;  3UUL A;  3Q5X A;  4UF0 A;  4P0B A;  4CI3 B;  2VL0 A;  1HG2 A;  2CXL A;  1ZKE A;  1I94 T;  2Y48 B;  5LG3 A;  4U33 A;  3OPC A;  1IBK T;  4JEH B;  2FJE A;  2WMO A;  4GKK T;  4DUZ T;  3IEE A;  3PUV F;  5FKY A;  3UU5 A;  1XMO T;  5JRE A;  4DMV A;  1HS7 A;  5FYM A;  3NRX A;  3PUW F;  4MBQ A;  2WCA A;  2YDR A;  1IZN B;  2R6G F;  1JNZ A;  3LK2 B;  5AQU B;  3N9M A;  4E7Z A;  5ABF A;  4GOU A;  3WI3 A;  3UU4 A;  5LG4 A;  4ZEY A;  3KV5 A;  3ZMT B;  4GK0 E;  4KI0 F;  3GA8 A;  4EB6 E;  4Q25 A;  2X0H A;  1KNP A;  1Z0P A;  5A1L A;  2XQY A;  4TWF A;  4CXY A;  4HFI A;  2C0S A;  4AQG A;  4IHJ E;  2VL8 A;  3N9Q A;  1E2A A;  3P4W A;  2CHN A;  2XUE A;  1CHU A;  4ZZC A;  4TN7 B;  2W2U A;  4KHP T;  4P09 A;  3AE2 A;  2L8K A;  5HAX A;  2YEV C;  2FUP A;  4M1P A;  3PUG A;  3UFG A;  4BA9 A;  4CN1 A;  4HFE A;  3TLV A;  5BR8 T;  2E8I A;  3AVR A;  3HL6 A;  2CBI A;  2CM0 A;  4KHZ F;  1SE7 A;  2RP4 A;  4UVA B;  3AE6 A;  1FEW A;  1T98 A;  2NOX A;  2XAJ B;  3UU3 A;  4LF7 T;  3AE5 A;  1CUN A;  1T7S A;  3RKO A;  5L3C B;  5AQV B;  4QX7 B;  1ZP0 A;  2BKN A;  4IDQ A;  3AB3 B;  2FJD A;  3N2O A;  4DBR A;  4JV5 T;  1LRZ A;  4PK4 A;  5JRC A;  3EAB A;  4U2Z A;  2AE9 A;  4ILA A;  4DR4 T;  5EK4 A;  5FXX A;  4JLE A;  5HYA A;  4UIG A;  4UVC B;  4CI2 B;  5JDG A;  4AKG A;  4HFC A;  3F2E A;  3T1Y T;  4A98 A;  2BS4 A;  4CI1 B;  2AXD S;  3C64 A;  2CA5 A;  4HE8 A;  3ZLI A;  2DLR A;  1LVF A;  5J2T E;  3AEE A;  5DAB A;  2MOZ A;  2ZLY A;  3O1I A;  5HCJ A;  3J9X 1;  2PBI A;  3EVY A;  2JIW A;  1U5P A;  4DV0 T;  2IUB A;  4HFH A;  1N34 T;  4O4J E;  3FZM B;  3AA7 B;  4NUV A;  2VKH A;  3EDU A;  4HFV A;  3MJX A;  4AKI A;  3VKH A;  2OA5 A;  3N2K E;  4U3C A;  2WWV A;  1BR0 A;  2LOS A;  1B7T A;  3CX8 B;  4XZC A;  4TWH A;  3RYH E;  4IE6 A;  2LSG A;  3DP7 A;  1UX4 A;  5AQI B;  1W0A A;  2ES0 A;  3ONX A;  2W0G A;  3SWH A;  1YKH B;  5FVL A;  3RGL A;  2W4X A;  4G63 A;  1IBM T;  5F5W A;  5FY1 A;  5AQT B;  3RKG A;  3GWH A;  2UXC T;  4PK5 A;  3FXD B;  1UK5 A;  2HHH T;  4XAX B;  3PUY F;  5L3E B;  2V5C A;  4ZHQ E;  2HN1 A;  2IIU A;  2W67 A;  3ZSS A;  4H63 H;  4ASK A;  5AQO B;  2N9D A;  2LLY A;  3W15 B;  5E0O A;  2OV9 A;  5H6Q B;  3M3Z B;  4OYJ A;  3PUQ A;  2JQH A;  4DBQ A;  5FL1 A;  2L3L A;  5CGM A;  3AXJ A;  3ZT7 A;  4JI3 T;  3FZF B;  3QUJ A;  4JYA T;  2K5B B;  5AQR B;  3RQW A;  3OYZ A;  3B5M A;  5J1G A;  2KLQ A;  4MLK A;  2J1D G;  3RQU A;  2EHO D;  4B3R T;  1XZY A;  3R84 B;  1Y64 B;  1G8X A;  1WYC A;  1HFA A;  3TLW A;  3ZCI A;  2JQQ A;  4O2A E;  2LSJ A;  2XAS B;  3HR0 A;  4YFS A;  2D2S A;  5LNK A;  3N9N A;  4H9Q C;  2YKS A;  1HG5 A;  3AAE B;  4WZX A;  3ZT5 A;  3RHW A;  4AQF A;  2LKG A;  2V1D B;  4L9I A;  2YDS A;  4JI6 T;  3LSV A;  2LM2 A;  4X20 E;  3ZYL A;  4ZI3 D;  4FJO A;  4HFD A;  4TZ4 C;  2BVM A;  3RH3 A;  3FBZ A;  4YHJ A;  2V7L A;  2YK0 A;  5J2U E;  3QC9 A;  4UEM A;  5HEJ A;  5HEU A;  2V6Y B;  3BQK A;  5EK2 A;  3OVU A;  2UUA T;  3HKE E;  2KT9 A;  3HKC E;  3B13 A;  1D0Y A;  4TV8 E;  4LFA T;  2CWO A;  2FJA A;  1OXZ A;  2D5U A;  1HNW T;  2NW9 A;  1E1H B;  2VQE T;  1LKX A;  2X0Y A;  4AKR B;  4BJM A;  2V7K A;  3BQI A;  4X65 T;  3EHZ A;  2KWI B;  3Q5W A;  4NPP A;  4YY3 T;  5DJQ C;  4I4T E;  1ZHC A;  2F4V T;  4PJL A;  2CXF A;  3AEC A;  2X0L B;  1DU2 A;  1KK7 A;  4CQI A;  4EOZ B;  2VKD A;  1HTJ F;  4LML A;  1N36 T;  2LRL A;  3QOF A;  3CK6 A;  3P8C D;  1UUS A;  3N9P A;  4EGW A;  3CQC B;  4NXM T;  2BG9 B;  3CVR A;  1IJ6 A;  2L9Q A;  1MIW A;  2CLY B;  1L0V A;  5LHH B;  3E08 A;  3L09 A;  3FZL B;  4YHH T;  5C3J A;  1WR6 A;  4OK0 A;  4KX6 A;  2VKJ A;  3CKD A;  5JR9 B;  3AAI A;  5LCY A;  4F8H A;  2J4G A;  4YSY A;  2JJ9 A;  4EYU A;  2NR4 A;  4LMK A;  5HEO A;  1MMG A;  1D1A A;  2QRX A;  3AE9 A;  4U72 A;  4U7Y A;  2ZM8 A;  5ADX L;  2DNX A;  4DV7 T;  3AEG A;  1WFD A;  4JI2 T;  4WBN E;  2ODU A;  1D1C A;  4HFB A;  3PUZ F;  5ABH A;  5F3J A;  2EHO B;  1ZV4 X;  4OYK A;  1M62 A;  2XQ8 A;  3ANW B;  5FXV A;  4NXN T;  2UUB T;  2HH7 A;  2E9X D;  4N78 D;  2NW7 A;  4IL9 A;  2I6H A;  3GN5 B;  1YQ3 A;  4LF4 T;  5JDL A;  4YSX A;  2WY2 A;  5J0Z A;  2DCF A;  3ZC1 A;  3SFD A;  4TX5 A;  3AED A;  5AQN B;  5HXR A;  2CMR A;  4O2B E;  4YTP A;  3EAM A;  3LBX B;  2QGS A;  5LHI B;  3IF8 B;  5KMG P;  2CHO A;  3P4Q A;  1X79 A;  4DV5 T;  2VKO A;  4ZZB A;  2WU5 A;  2P9B A;  2D9D A;  1T8B A;  4QH5 A;  2QVA A;  2VK9 A;  2WBL A;  3J7Y q;  4AQY T;  3L39 A;  4UV8 B;  5LMU T;  4O8S A;  1U4Q A;  2Q9Q D;  1KFY A;  2WDR A;  2K24 A;  4J2C A;  5JDN A;  3C4X A;  3KBT A;  1QUU A;  4GYS A;  4A5X A;  4X64 T;  2K3W A;  2YU1 A;  3PDY A;  3O9X A;  1WLX A;  3ZYK A;  2MBG A;  2H7V C;  2K48 A;  3KVB A;  1VCS A;  3S4U A; 
#chains in the Genus database with same CATH homology
 4KHP T;  4K0K T;  4X65 T;  5LMN T;  1HNX T;  4NXN T;  4YY3 T;  2UUB T;  2E5L T;  4DR2 T;  5BR8 T;  2UXB T;  4B3S T;  4GKJ T;  4DV1 T;  4LF4 T;  4B3T T;  2F4V T;  4B3R T;  1J5E T;  1IBL T;  1FJG T;  4JI8 T;  5IWA T;  4DR7 T;  1HR0 T;  4X62 T;  4DV4 T;  2UUC T;  1N36 T;  1I94 T;  1N32 T;  4LFB T;  4LF7 T;  4DUY T;  1IBK T;  4GKK T;  4DUZ T;  4DR5 T;  4JI5 T;  3T1H T;  2UXD T;  4B3M T;  4NXM T;  1N33 T;  1XMO T;  1IBM T;  4DV5 T;  4JI6 T;  4JV5 T;  2UXC T;  4OX9 T;  4LF6 T;  1XNR T;  4YHH T;  4DR4 T;  4AQY T;  2HHH T;  4LF5 T;  2UU9 T;  1XNQ T;  1XMQ T;  4DR6 T;  2ZM6 T;  4X66 T;  4LFC T;  2VQF T;  5LMU T;  4LF8 T;  3T1Y T;  4JI7 T;  4JI1 T;  1HNZ T;  4JI4 T;  2UUA T;  4DV3 T;  4X64 T;  4LF9 T;  4JI0 T;  4DR3 T;  3OTO T;  4DV6 T;  4LFA T;  4DR1 T;  4DV2 T;  4DV7 T;  1HNW T;  4DV0 T;  4JI3 T;  4JI2 T;  1N34 T;  2VQE T;  4JYA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...