4JI3T

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4ji3T00
1IBKT 1XMOT 1N32T 1I94T 4DR1T 2E5LT 4LFBT 4X62T 4JI4T 4AQYT 4LF8T 4GKKT 2ZM6T 1IBMT 4JI0T 4DV2T 2VQFT 4LFCT 4DR4T 4DV4T 4B3MT 4JI2T 4DV5T 4OX9T 4DR7T 4DUZT 5BR8T 4JYAT 4X66T 1XMQT 1HR0T 4NXNT 4DR3T 2UUBT 1N36T 4DV3T 1N34T 4B3ST 4DR2T 4NXMT 1HNZT 4JI6T 1XNQT 4LF4T 1FJGT 1IBLT 4JI5T 2UU9T 4LF9T 4X64T 1XNRT 5IWAT 4K0KT 5LMUT 2HHHT 2UUAT 4B3RT 2F4VT 4LFAT 4KHPT 4DUYT 2UXBT 4GKJT 4LF6T 4YY3T 4JI7T 3T1YT 4JV5T 4DR5T 4JI1T 4LF7T 2UXDT 1N33T 4B3TT 3OTOT 1HNXT 3T1HT 5LMNT 2UXCT 2VQET 4DV7T 4JI3T 4LF5T 4JI8T 4DV0T 2UUCT 1J5ET 4DV1T 1HNWT 4DR6T 4X65T 4YHHT 4DV6T
chains in the Genus database with same CATH superfamily
4OK0A 5TAOA 1HG5A 4LMJA 5L47A 4WBNE 1MNEA 4AXPA 1KFYA 4GKKT 3E22E 2V7LA 4G63A 3C98B 2VQFT 2AXDS 2J4GA 5BMVE 2LM2A 4IL4A 2BS2A 1W0BA 1EZ3A 2PTFA 5ABGA 3C51A 1J5WA 5BR8T 2VK9A 5JVDE 4AIUA 2QGSA 3AA0B 4KI0F 3JADA 5AQLB 3J7Yq 2JIWA 2XTLA 5LHGB 5HXHA 2V7KA 4AQGA 3UQ7A 2C5JA 2XQ3A 2OLTA 5LP6E 1UK5A 4U7YA 4HEAA 4YJ3E 3NBXX 4PFPA 2AE9A 2IUBA 4JI7T 2BVLA 5HEOA 3T1YT 3CIRA 4ZS2A 3KV5A 1MMAA 4UEMA 3PUQA 4HWDA 4KHZF 2XZEA 3AAIA 3C4ZA 5LMNT 5AQHB 4OHFA 4ZI3C 3VR9A 1LVFA 1HFAA 4TNWA 4Q25A 2MYSA 1S94A 3LDQB 4HFCA 2WDQA 3PUYF 4PAGA 4U31A 4TZ4C 3IBPA 3KV9A 1MMGA 4O4JE 2XQ4A 5J1GA 4LFCT 2VVNA 2CPTA 2VKDA 3WI3A 1JNRA 3MA9A 4ADZA 4HFDA 4H63H 5CB4E 2LT3A 2X9XA 4HFIA 3M65A 5AQOB 3QNUA 4TWDA 2CHNA 3DTOA 3RGLA 3AAEB 3N5LA 3ABVA 3RIAA 1UX5A 5L3FB 1DU2A 3H3MA 1T8BA 2XQ7A 2XASB 4QX8B 3EDVA 1M7KA 1UUSA 2V6XA 3M3ZB 5IYZE 4JV5T 1QLBA 3RYFE 1MNDA 4MHCA 3AXJB 4ZOLE 2UXCT 1W9RA 3VRBA 1G73A 3ANWB 2DHRA 2ZM2A 4UV9B 5ABFB 4BA9A 3P4QA 3PDYA 3P7IA 4A98A 4ASKA 3NZPA 5DABA 4EXTA 4JI4T 3UUMA 4V1Av 3QOFA 4ZXLA 3S4UA 1MIVA 5HCJA 3PU8A 2MAWA 2H7OA 1LKXA 2CE7A 5L3GB 4LMKA 4NPPA 3E0ZA 1FEWA 2M6BA 3AECA 3KFWX 4L9IA 5KXJA 5FL1A 1KNRA 3KBTA 5ADXL 5J0ZA 3ZJ2A 1N36T 2KZ7B 2K5BB 3ONXA 3AE1A 3SFDA 3P4SA 1IBLT 2BVMA 2XQ6A 2N1GA 2Q9QD 4UXNB 3FBLA 4MLKA 4KX6A 2XQ5A 2W0GA 5LG3A 5EZYE 4LFAT 4IE7A 4ZI2D 4YY3T 1T72A 2X9YA 3GWHA 4CI2B 1G8XA 5CFBA 4DO0A 2NR4A 1H7CA 3UU3A 2CWOA 1W09A 3CK6A 2BKOA 5IHYA 4WBOA 4H9RC 4AQFC 2KNDA 4HFEA 3LBXB 4ILUA 2JQ9A 2YU1A 2BG9B 4O2BE 3KVAA 3UFGA 4A56A 4ILBA 3L8RA 1HTJF 1LRZA 4AQYT 2XY8B 1MIYA 2ZLYA 4LMLA 4I0UA 2YDSA 2ZM0A 4JI0T 2WZHA 1B7TA 3TLSA 2W66A 2ACXA 4JI2T 3HKDE 4XZCA 3VKHA 2LE8A 2W62A 4YXDA 3RC3A 4IHJE 4IDZA 1ZEEA 2PJQA 1V9DA 1YD8G 4WZXA 4YFSA 2W67A 2N2NA 2MPKA 4X1IE 5LOVE 2CMRA 1HF8A 2LSIA 2VL0A 2QA7A 2YEVC 3AA1B 3PUVF 2A2FX 5LHIB 5J2TE 3MZKB 2WU2A 2I6HA 2YN6A 5F5WA 4B3RT 3ZYMA 4BJMA 4IE4A 4ILAA 4A97A 4BJNA 3LK42 4X20E 4GIWA 1D1CA 5GONE 4UELA 2C5IT 3P50A 2BBHA 3VU7H 1MIWA 2CXFA 1J1JA 2L3LA 5CGMA 3KDSE 3GA8A 3N9LA 4TNVA 2JPFA 1XDOA 4QXHB 3UFEA 1T98A 3UUNA 4ZI3D 4DIDB 2WS3A 4CI1B 3O1HA 5HCMA 2ZM6T 4ZEYA 2NW8A 2CEAA 3JC6C 4YTMA 3ZMZB 5JR9C 2EHOA 4O4LE 3V5SA 3ZSTA 2XM2A 4PJMA 3CKDA 4EAHA 5FY7A 4CXYA 2V6YA 5CA1E 1XMQT 2UUBT 2ZM8A 1KNPA 5JR9B 5JRCB 3E08A 3FZKB 5FVLA 3ZT5A 1QUUA 1YQ3A 4LF4T 3AA7B 3AE4A 1IAPA 1XDPA 3U3IA 5H6RB 2LLYA 1D1AA 3ZCIA 4MFRA 2WSSV 4AKHA 3J9X1 4LF6T 1E1HB 2YDQA 2WAUA 3B57A 2V7MA 4U7IA 4B3TT 3OTOT 2FBWA 3ZCJA 5HEHA 2PFVA 1Z0PA 1XWMA 3O1JA 2PBIA 2MBGA 3QUJA 3AEBA 5DQVA 4H9SE 4X65T 3PUSA 5JH7E 3VRAA 4BAYB 5JDNA 5LXTE 3Q5XA 2IW5B 2NW7A 2JQKA 3AEFA 3IF8B 5A1LA 5C8YE 1MMNA 1FMWA 1SA0E 2KT9A 5AQMB 4L5GA 2Z6EA 1D1BA 3B13A 4U33A 5HEGA 3ZMTB 5J2UE 1YQ4A 4XBFB 2WU5A 1HR0T 4EV6A 5HEUA 2X68A 3P4WA 2VKJA 2FUPA 1D0XA 2YKSA 3G06A 2XSAA 4X1YE 5JQGE 5L2LA 4X64T 3UUXB 3OJAA 4K0KT 3UTKA 3VR8A 1Z8UA 4P1NA 4DNDA 2V7IA 5LJNA 2IMLA 2WMOA 4WNKA 3N9OA 3CQGB 2X0YA 4DUYT 1VRBA 3FXEB 3BK9A 4K0UA 3RC8A 2BS4A 3I9YA 4PFOA 5FVKA 5ABHA 4LF5T 3UU4A 4EEDA 4HGAA 3HL6A 4PNIA 2MTQA 2DL1A 1KF6A 4HWFA 4P0AA 4HWHA 1BR0A 2LSGA 2E5LT 4QH5A 2NWBA 4MALA 3RIUA 4WYVA 4CZZB 3Q5EA 5JDFA 3ONJA 1IBMT 2DWGA 2LRLA 3EVYA 1L0VA 2KINB 4IL9A 3JCFA 3FZMB 3R84B 4A5XA 4H9OC 1IJ5A 3PUAA 2LM9A 3KBUA 5IUXA 5AQIB 5ABEA 3AXJA 3C50A 5AFUL 2VWAA 4JLEA 2Y8DA 2XHEB 2X0LB 3RIUC 3ANWA 2E9XC 5ETWA 4Z90A 5ABFA 4AKRB 5L3DB 1HG2A 2YDRA 3P4PA 4I55E 4MBQA 2UUAT 1SHZC 3I0OA 2VB6A 4GKJT 4CN6A 2A9UA 2E9XB 5EK4A 2LHRA 4TV9E 2FJBA 4GOUA 3FZFB 2W63A 3Q2MA 1I6ZA 4H9QC 4DV7T 4JI3T 2X0HA 4XAXB 3UULA 2B76A 4DV0T 4DV6T 4X5TA 2XJ7A 2FJDA 1D0YA 1E2AA 4X1KE 4IDQA 5FXXA 1GQEA 3ZMVB 1ZKEA 2A3DA 4GK0E 2G0UA 1QSDA 3A5XA 5FXVA 4L0RA 4TWHA 3N9QA 2HPLA 2VL8A 2MOZA 5F8PA 2D5UA 4G2AA 4JI6T 4IT4A 2N9DA 4F6RC 2VKHA 3UQ4A 1XNRT 2YOEA 2IAKA 2RPAA 5L4EA 2BG9A 3EAMA 5JDLA 2D9DA 4PJLA 2HH7A 2RP4A 5LGNB 2WCAA 5AQSB 2UXXB 3HKCE 2LSYA 4AQFA 3ZT7A 3ONLC 2XAQB 4JI1T 2BG9E 3A7MA 3SRZA 2V7JA 5FP3A 4KBMB 4ANJA 2VQET 3ZJ1A 3QK6A 2CRBA 1NEKA 2EHOD 3PUXF 3I1AA 4YHJA 4O4IE 5L3CB 3AE8A 2NW9A 3ZN0B 3RKGA 3ZC0A 3MACA 3VKGA 3GN5B 4IDPA 4LFBT 2BG9C 2NOXA 3UU6A 3QB5A 1SUMB 3OKQA 2JRKA 2KMFA 2WP9A 5LA6E 4B3MT 2WBLA 4QX7B 2P9BA 3JAEA 3C4XA 3FB2A 4DBQA 3RHWA 4C91A 3AEAA 3EDUA 4ZZCA 3K3QC 4FI5A 3MXZA 3AVSA 3BQIA 4GYRA 4ISTA 3CQCB 3ESLA 3O4XE 1OXZA 1XNQT 3PTRB 1FJGT 3ZN1B 2KXPB 2X66A 2YK0A 2LEHA 3WAJA 4OFZA 1UX4A 3QB5K 5LMUT 2BS3A 5FXWA 3EABA 1OEDC 2M6IA 4NUUA 5HAXA 3SFEA 5EK3A 4AKGA 4AISA 2LSKA 1ZP0A 2CBJA 4YTPA 2DCFA 3LG7A 1OEDB 3Q9DA 5AQTB 3AEEA 2VVSA 3X1DA 5KX5E 4I4TE 2CCQA 5HWXA 2WDVA 4UVCB 2A72A 1KNZA 2W61A 2Y48B 5JR9A 4JEUB 3FZLB 5JRCA 3ZYKA 3P4RA 2JQQA 3F31A 4HE8A 4QH4A 5FY0A 3Q5WA 4CQIA 3ZYLA 4DV4T 4HFVA 4FJOA 3RRWA 1UGOA 4QKNA 4EYUA 1HCIA 2XQYA 4DUZT 3MK7C 3RYIE 2J62A 5DJQC 3FXDB 2I59A 3CVRA 3NKZA 2JMKA 4NXMT 2LKGA 2L9QA 2E8IA 2XPKA 5AQNB 3AE7A 4ZI7E 3AE5A 3OBVE 5HXRA 2HHHT 4OYJA 2KLQA 4QHOA 5HXCA 2F4VT 4H9NC 1O3XA 5AQVB 5LBQB 1NAFA 2OV9A 4TN7B 5LNKA 1SE7A 3DP7A 3O1IA 1N33T 2Y6XA 3N2KE 5HWYA 3FZHB 1ZV4X 3JAFA 5HXSA 3PUZF 2X9HA 3PJAA 3P8CD 2YU2A 3W15B 4U3CA 4U74A 1D0ZA 1IJ6A 4DV1T 3NRYA 1FMVA 3AE6A 2HN2A 1NENA 1E7PA 2IIUA 3IEEA 2M67A 1X9BA 3ZMUB 2VURA 4TV8E 5HYAA 4NIQA 4HWCA 3R6NA 2Q9QC 4UF0B 4UIGA 2I0MA 2C5KT 3RH3A 3KV4A 2BKNA 3K1SA 1YKHB 1US7B 2LOSA 3AEDA 2NP9A 2Q9QB 3ZKRA 3V5UA 2XQ9A 3SOLA 2W00A 1MMDA 5L3EB 2IHR1 2J1DG 3OYXA 2JJ9A 4DMVA 2V5DA 2UU9T 3H37A 4HFBA 4M1PA 4ISSA 3TKLB 5M4YA 2LKHA 5FMNA 3CX8B 4KMCA 3ZT6A 3ETUA 2UXNB 2K24A 4QH1A 3RYHE 2UXBT 5F3JA 4J2CA 1Y64B 4CN1A 3PU3A 2DWKA 4P09A 1ZHCA 4P0BA 3RRCA 5AQRB 5AQKB 1HX1B 2R6GF 5CA0E 3EUHA 3HR0A 2PG8A 4H9PC 4DVDA 2XM1A 4DBRA 1N32T 1OWAA 1LVKA 4DR1T 1WYCA 2WWUA 4Z91A 4OYKA 3ZC1A 4B6XA 2WMNA 5FYMA 2D2SA 3PUWF 5E0OA 4DV5T 2CBIA 3NVOA 4JEHB 5LYJE 4EOZB 2C0SA 2E9XA 4DR3T 2SPCA 2WM9A 4DV3T 1N34T 4N78D 2CXDA 4GYSA 3AE3A 4F8HA 4JI5T 1WR6A 4GK5E 3KVBA 1BR4A 2E5VA 5AQPB 5HEJA 2WZIA 3CPZA 2X51A 4CI3B 2W4XA 2XSBA 3KINB 1Y01A 2HPJA 4TUYE 3LK3B 1VCTA 4HFHA 5DQWA 4U2YA 1HNXT 2JQHA 3T1HT 2OA5A 2QYWA 4Z8XA 3ZLIA 1KK7A 3MKDA 2WDRA 5JTGA 3OPCA 4IREA 2H88A 3Q5DA 3UU5A 4HTEA 3WAKA 5JDMA 3LK2B 2ODVA 4UVAB 3LSVA 3K3OA 3PURA 4EZHA 4IDNA 5KMGP 4TX5A 2VKOA 2CWYA 4QXCB 4U72A 4PK4A 2LSJA 3U78A 2ODUA 3RQWA 2IDOB 3EI0A 4YT0A 3FHNA 3HKBE 5AQQB 2HN1A 1BR1A 1WLXA 3RF1A 4X66T 1IZNB 3ZPOA 3TLTA 1U4QA 2YINA 5CJ5A 3K8PC 1WCRA 2B1EA 2FJEA 4EYYR 2BDEA 3PV0F 2K9AA 5LJMA 4IE0A 4LF9T 5HXEA 2NTXA 4YSXA 2FJAA 5KDMC 3GN5A 4WW0A 3JC6D 2K3WA 4IIJE 3UUBA 3CX7B 4U2ZA 4KHPT 3NWIA 3F2EA 4LF7T 2UXDT 5H6QB 1WR0A 2GK9A 4CN4A 3L09A 3LBXA 3RI5A 2D0TA 3NRXA 2XAGB 5FNVE 2UUCT 3RIFA 4HN9A 3AEGA 5LGTB 3MJXA 4DR6T 1W0AA 5LHHB 1XMOT 2RA1A 5AQUB 2ES0A 4EGWA 4I50E 2V5CA 1WYBA 4X62T 1YXRA 2IC9A 2DNXA 2J47A 2CHOA 2ZMAA 3AE2A 3RPUA 2E2AA 4PK6A 3ETVA 1NWMX 2LJLA 5JREA 2CM0A 4JYAT 4H63V 4YLHA 4NXNT 2VASA 3N9PA 5LGUB 2XAFB 3UT5E 4EEBA 4O4HE 1UCUA 4B3ST 4DR2T 1OEDA 1VOMA 4YJ2E 1AJ3A 4PK5A 4QWNB 1JNZA 4JBWF 3AB3B 4EZ4A 4UV8B 3K3NA 3HI2A 1OEDE 4QXBB 4O8SA 2D0UA 2WB5A 1M62A 4HKAA 2H7VC 2H3RA 2KWHA 1U5PA 2V26A 3F57A 5LCYA 4CXWA 3AVRA 1WFDA 5FY1A 3VHLA 3C4WA 1UURA 3DJBA 4UR9A 3RYCE 3OVUA 5JDHA 3PE0A 5AQJB 4KP3C 4JI8T 3H3AA 4UVBB 3NZQA 3LJCA 3AAAB 3LFMA 5JDQA 4AKLA 3CWZB 1T7SA 3IA3A 3ZMSB 2ACZA 2V8SV 4IE5A 2DI4A 5LBMA 4HWIB 3FBZA 4IGUA 2KSRA 4DV2T 3RKOA 4TWFA 3N9NA 2LHNA 4ZHQE 4ILCA 4JUYA 4AI6A 3ZSSA 2WY2A 2X9WA 4IDOA 3TLWA 3C64A 2BKPA 3OYZA 3AA6B 1YW0A 2KWIB 4DMWA 4ZZBA 4PJNA 1KEYA 3RX6A 2CXLA 2JMHA 4YSYA 4CXXA 5FL0A 5L4HA 4O2AE 3CX6B 3I0QA 2XUEA 1FIOA 3IHRA 5LB7B 5FXZA 1YKEB 4DR5T 4I43B 2DLRA 4UF0A 1ZOYA 4ZS3A 3RLFF 3CQXC 3I9WA 2QRXA 2WWVA 3O9XA 2Q9QA 1HNWT 3D0TA 2NTYA 3SWHA 4YHHT 4EB6E 1IBKT 2E9XD 1I94T 2IC6A 1HS7A 5C2TA 1CUNA 3BQLA 4NUVA 2XAJB 4YTNA 4LF8T 1X79A 1R8IA 3T8OA 4ERRA 3SS1A 4EIWA 4DR4T 4YSZA 2L8KA 4OX9T 5C3JA 3EHZA 4KUMB 1S35A 1VCSA 4DR7T 3UU8A 2H89A 5JDGA 2X67A 3HKEE 5AQFB 3PUGA 5FKYA 5LG4A 4E7ZA 2EHOC 1HNZT 3BQKA 3L3PA 2CA5A 2XAHB 4ZI2C 5IWAT 3A8YC 3KV6A 4PW8A 3CMLA 1XZYA 2K48A 2XQ8A 3N2GE 2EHOB 2LRKA 4IE6A 2WQYA 2BBJA 4E7SA 1HX8A 3AE9A 2CLYC 2BZBA 3B5MA 3L39A 3PJAJ 2V6YB 3TLVA 4COFA 3QC9A 3N2OA 4AKIA 5AQGB 3ZEFB 3GMIA 2W2UA 2LOPA 4PJJA 3RQUA 1CHUA 2CLYB 2QVAA 2V1DB 5EK2A 3TLUA 3HA4A 4C90A 1WRDA 1J5ET 1BR2A 2XQAA 3N9MA 5L3BB
chains in the Genus database with same CATH topology
1IBKT 1XMOT 1N32T 1I94T 4DR1T 2E5LT 4LFBT 4X62T 4JI4T 4AQYT 4LF8T 4GKKT 2ZM6T 1IBMT 4JI0T 4DV2T 2VQFT 4LFCT 4DR4T 4DV4T 4B3MT 4JI2T 4DV5T 4OX9T 4DR7T 4DUZT 5BR8T 4JYAT 4X66T 1XMQT 1HR0T 4NXNT 4DR3T 2UUBT 1N36T 4DV3T 1N34T 4B3ST 4DR2T 4NXMT 1HNZT 4JI6T 1XNQT 4LF4T 1FJGT 1IBLT 4JI5T 2UU9T 4LF9T 4X64T 1XNRT 5IWAT 4K0KT 5LMUT 2HHHT 2UUAT 4B3RT 2F4VT 4LFAT 4KHPT 4DUYT 2UXBT 4GKJT 4LF6T 4YY3T 4JI7T 3T1YT 4JV5T 4DR5T 4JI1T 4LF7T 2UXDT 1N33T 4B3TT 3OTOT 1HNXT 3T1HT 5LMNT 2UXCT 2VQET 4DV7T 4JI3T 4LF5T 4JI8T 4DV0T 2UUCT 1J5ET 4DV1T 1HNWT 4DR6T 4X65T 4YHHT 4DV6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBK T;  1XMO T;  1N32 T;  1I94 T;  4DR1 T;  2E5L T;  4LFB T;  4X62 T;  4JI4 T;  4AQY T;  4LF8 T;  4GKK T;  2ZM6 T;  1IBM T;  4JI0 T;  4DV2 T;  2VQF T;  4LFC T;  4DR4 T;  4DV4 T;  4B3M T;  4JI2 T;  4DV5 T;  4OX9 T;  4DR7 T;  4DUZ T;  5BR8 T;  4JYA T;  4X66 T;  1XMQ T;  1HR0 T;  4NXN T;  4DR3 T;  2UUB T;  1N36 T;  4DV3 T;  1N34 T;  4B3S T;  4DR2 T;  4NXM T;  1HNZ T;  4JI6 T;  1XNQ T;  4LF4 T;  1FJG T;  1IBL T;  4JI5 T;  2UU9 T;  4LF9 T;  4X64 T;  1XNR T;  5IWA T;  4K0K T;  5LMU T;  2HHH T;  2UUA T;  4B3R T;  2F4V T;  4LFA T;  4KHP T;  4DUY T;  2UXB T;  4GKJ T;  4LF6 T;  4YY3 T;  4JI7 T;  3T1Y T;  4JV5 T;  4DR5 T;  4JI1 T;  4LF7 T;  2UXD T;  1N33 T;  4B3T T;  3OTO T;  1HNX T;  3T1H T;  5LMN T;  2UXC T;  2VQE T;  4DV7 T;  4JI3 T;  4LF5 T;  4JI8 T;  4DV0 T;  2UUC T;  1J5E T;  4DV1 T;  1HNW T;  4DR6 T;  4X65 T;  4YHH T;  4DV6 T; 
#chains in the Genus database with same CATH topology
 4OK0 A;  5TAO A;  1HG5 A;  4LMJ A;  5L47 A;  4WBN E;  1MNE A;  4AXP A;  1KFY A;  4GKK T;  3E22 E;  2V7L A;  4G63 A;  3C98 B;  2VQF T;  2AXD S;  2J4G A;  5BMV E;  2LM2 A;  4IL4 A;  2BS2 A;  1W0B A;  1EZ3 A;  2PTF A;  5ABG A;  3C51 A;  1J5W A;  5BR8 T;  2VK9 A;  5JVD E;  4AIU A;  2QGS A;  3AA0 B;  4KI0 F;  3JAD A;  5AQL B;  3J7Y q;  2JIW A;  2XTL A;  5LHG B;  5HXH A;  2V7K A;  4AQG A;  3UQ7 A;  2C5J A;  2XQ3 A;  2OLT A;  5LP6 E;  1UK5 A;  4U7Y A;  4HEA A;  4YJ3 E;  3NBX X;  4PFP A;  2AE9 A;  2IUB A;  4JI7 T;  2BVL A;  5HEO A;  3T1Y T;  3CIR A;  4ZS2 A;  3KV5 A;  1MMA A;  4UEM A;  3PUQ A;  4HWD A;  4KHZ F;  2XZE A;  3AAI A;  3C4Z A;  5LMN T;  5AQH B;  4OHF A;  4ZI3 C;  3VR9 A;  1LVF A;  1HFA A;  4TNW A;  4Q25 A;  2MYS A;  1S94 A;  3LDQ B;  4HFC A;  2WDQ A;  3PUY F;  4PAG A;  4U31 A;  4TZ4 C;  3IBP A;  3KV9 A;  1MMG A;  4O4J E;  2XQ4 A;  5J1G A;  4LFC T;  2VVN A;  2CPT A;  2VKD A;  3WI3 A;  1JNR A;  3MA9 A;  4ADZ A;  4HFD A;  4H63 H;  5CB4 E;  2LT3 A;  2X9X A;  4HFI A;  3M65 A;  5AQO B;  3QNU A;  4TWD A;  2CHN A;  3DTO A;  3RGL A;  3AAE B;  3N5L A;  3ABV A;  3RIA A;  1UX5 A;  5L3F B;  1DU2 A;  3H3M A;  1T8B A;  2XQ7 A;  2XAS B;  4QX8 B;  3EDV A;  1M7K A;  1UUS A;  2V6X A;  3M3Z B;  5IYZ E;  4JV5 T;  1QLB A;  3RYF E;  1MND A;  4MHC A;  3AXJ B;  4ZOL E;  2UXC T;  1W9R A;  3VRB A;  1G73 A;  3ANW B;  2DHR A;  2ZM2 A;  4UV9 B;  5ABF B;  4BA9 A;  3P4Q A;  3PDY A;  3P7I A;  4A98 A;  4ASK A;  3NZP A;  5DAB A;  4EXT A;  4JI4 T;  3UUM A;  4V1A v;  3QOF A;  4ZXL A;  3S4U A;  1MIV A;  5HCJ A;  3PU8 A;  2MAW A;  2H7O A;  1LKX A;  2CE7 A;  5L3G B;  4LMK A;  4NPP A;  3E0Z A;  1FEW A;  2M6B A;  3AEC A;  3KFW X;  4L9I A;  5KXJ A;  5FL1 A;  1KNR A;  3KBT A;  5ADX L;  5J0Z A;  3ZJ2 A;  1N36 T;  2KZ7 B;  2K5B B;  3ONX A;  3AE1 A;  3SFD A;  3P4S A;  1IBL T;  2BVM A;  2XQ6 A;  2N1G A;  2Q9Q D;  4UXN B;  3FBL A;  4MLK A;  4KX6 A;  2XQ5 A;  2W0G A;  5LG3 A;  5EZY E;  4LFA T;  4IE7 A;  4ZI2 D;  4YY3 T;  1T72 A;  2X9Y A;  3GWH A;  4CI2 B;  1G8X A;  5CFB A;  4DO0 A;  2NR4 A;  1H7C A;  3UU3 A;  2CWO A;  1W09 A;  3CK6 A;  2BKO A;  5IHY A;  4WBO A;  4H9R C;  4AQF C;  2KND A;  4HFE A;  3LBX B;  4ILU A;  2JQ9 A;  2YU1 A;  2BG9 B;  4O2B E;  3KVA A;  3UFG A;  4A56 A;  4ILB A;  3L8R A;  1HTJ F;  1LRZ A;  4AQY T;  2XY8 B;  1MIY A;  2ZLY A;  4LML A;  4I0U A;  2YDS A;  2ZM0 A;  4JI0 T;  2WZH A;  1B7T A;  3TLS A;  2W66 A;  2ACX A;  4JI2 T;  3HKD E;  4XZC A;  3VKH A;  2LE8 A;  2W62 A;  4YXD A;  3RC3 A;  4IHJ E;  4IDZ A;  1ZEE A;  2PJQ A;  1V9D A;  1YD8 G;  4WZX A;  4YFS A;  2W67 A;  2N2N A;  2MPK A;  4X1I E;  5LOV E;  2CMR A;  1HF8 A;  2LSI A;  2VL0 A;  2QA7 A;  2YEV C;  3AA1 B;  3PUV F;  2A2F X;  5LHI B;  5J2T E;  3MZK B;  2WU2 A;  2I6H A;  2YN6 A;  5F5W A;  4B3R T;  3ZYM A;  4BJM A;  4IE4 A;  4ILA A;  4A97 A;  4BJN A;  3LK4 2;  4X20 E;  4GIW A;  1D1C A;  5GON E;  4UEL A;  2C5I T;  3P50 A;  2BBH A;  3VU7 H;  1MIW A;  2CXF A;  1J1J A;  2L3L A;  5CGM A;  3KDS E;  3GA8 A;  3N9L A;  4TNV A;  2JPF A;  1XDO A;  4QXH B;  3UFE A;  1T98 A;  3UUN A;  4ZI3 D;  4DID B;  2WS3 A;  4CI1 B;  3O1H A;  5HCM A;  2ZM6 T;  4ZEY A;  2NW8 A;  2CEA A;  3JC6 C;  4YTM A;  3ZMZ B;  5JR9 C;  2EHO A;  4O4L E;  3V5S A;  3ZST A;  2XM2 A;  4PJM A;  3CKD A;  4EAH A;  5FY7 A;  4CXY A;  2V6Y A;  5CA1 E;  1XMQ T;  2UUB T;  2ZM8 A;  1KNP A;  5JR9 B;  5JRC B;  3E08 A;  3FZK B;  5FVL A;  3ZT5 A;  1QUU A;  1YQ3 A;  4LF4 T;  3AA7 B;  3AE4 A;  1IAP A;  1XDP A;  3U3I A;  5H6R B;  2LLY A;  1D1A A;  3ZCI A;  4MFR A;  2WSS V;  4AKH A;  3J9X 1;  4LF6 T;  1E1H B;  2YDQ A;  2WAU A;  3B57 A;  2V7M A;  4U7I A;  4B3T T;  3OTO T;  2FBW A;  3ZCJ A;  5HEH A;  2PFV A;  1Z0P A;  1XWM A;  3O1J A;  2PBI A;  2MBG A;  3QUJ A;  3AEB A;  5DQV A;  4H9S E;  4X65 T;  3PUS A;  5JH7 E;  3VRA A;  4BAY B;  5JDN A;  5LXT E;  3Q5X A;  2IW5 B;  2NW7 A;  2JQK A;  3AEF A;  3IF8 B;  5A1L A;  5C8Y E;  1MMN A;  1FMW A;  1SA0 E;  2KT9 A;  5AQM B;  4L5G A;  2Z6E A;  1D1B A;  3B13 A;  4U33 A;  5HEG A;  3ZMT B;  5J2U E;  1YQ4 A;  4XBF B;  2WU5 A;  1HR0 T;  4EV6 A;  5HEU A;  2X68 A;  3P4W A;  2VKJ A;  2FUP A;  1D0X A;  2YKS A;  3G06 A;  2XSA A;  4X1Y E;  5JQG E;  5L2L A;  4X64 T;  3UUX B;  3OJA A;  4K0K T;  3UTK A;  3VR8 A;  1Z8U A;  4P1N A;  4DND A;  2V7I A;  5LJN A;  2IML A;  2WMO A;  4WNK A;  3N9O A;  3CQG B;  2X0Y A;  4DUY T;  1VRB A;  3FXE B;  3BK9 A;  4K0U A;  3RC8 A;  2BS4 A;  3I9Y A;  4PFO A;  5FVK A;  5ABH A;  4LF5 T;  3UU4 A;  4EED A;  4HGA A;  3HL6 A;  4PNI A;  2MTQ A;  2DL1 A;  1KF6 A;  4HWF A;  4P0A A;  4HWH A;  1BR0 A;  2LSG A;  2E5L T;  4QH5 A;  2NWB A;  4MAL A;  3RIU A;  4WYV A;  4CZZ B;  3Q5E A;  5JDF A;  3ONJ A;  1IBM T;  2DWG A;  2LRL A;  3EVY A;  1L0V A;  2KIN B;  4IL9 A;  3JCF A;  3FZM B;  3R84 B;  4A5X A;  4H9O C;  1IJ5 A;  3PUA A;  2LM9 A;  3KBU A;  5IUX A;  5AQI B;  5ABE A;  3AXJ A;  3C50 A;  5AFU L;  2VWA A;  4JLE A;  2Y8D A;  2XHE B;  2X0L B;  3RIU C;  3ANW A;  2E9X C;  5ETW A;  4Z90 A;  5ABF A;  4AKR B;  5L3D B;  1HG2 A;  2YDR A;  3P4P A;  4I55 E;  4MBQ A;  2UUA T;  1SHZ C;  3I0O A;  2VB6 A;  4GKJ T;  4CN6 A;  2A9U A;  2E9X B;  5EK4 A;  2LHR A;  4TV9 E;  2FJB A;  4GOU A;  3FZF B;  2W63 A;  3Q2M A;  1I6Z A;  4H9Q C;  4DV7 T;  4JI3 T;  2X0H A;  4XAX B;  3UUL A;  2B76 A;  4DV0 T;  4DV6 T;  4X5T A;  2XJ7 A;  2FJD A;  1D0Y A;  1E2A A;  4X1K E;  4IDQ A;  5FXX A;  1GQE A;  3ZMV B;  1ZKE A;  2A3D A;  4GK0 E;  2G0U A;  1QSD A;  3A5X A;  5FXV A;  4L0R A;  4TWH A;  3N9Q A;  2HPL A;  2VL8 A;  2MOZ A;  5F8P A;  2D5U A;  4G2A A;  4JI6 T;  4IT4 A;  2N9D A;  4F6R C;  2VKH A;  3UQ4 A;  1XNR T;  2YOE A;  2IAK A;  2RPA A;  5L4E A;  2BG9 A;  3EAM A;  5JDL A;  2D9D A;  4PJL A;  2HH7 A;  2RP4 A;  5LGN B;  2WCA A;  5AQS B;  2UXX B;  3HKC E;  2LSY A;  4AQF A;  3ZT7 A;  3ONL C;  2XAQ B;  4JI1 T;  2BG9 E;  3A7M A;  3SRZ A;  2V7J A;  5FP3 A;  4KBM B;  4ANJ A;  2VQE T;  3ZJ1 A;  3QK6 A;  2CRB A;  1NEK A;  2EHO D;  3PUX F;  3I1A A;  4YHJ A;  4O4I E;  5L3C B;  3AE8 A;  2NW9 A;  3ZN0 B;  3RKG A;  3ZC0 A;  3MAC A;  3VKG A;  3GN5 B;  4IDP A;  4LFB T;  2BG9 C;  2NOX A;  3UU6 A;  3QB5 A;  1SUM B;  3OKQ A;  2JRK A;  2KMF A;  2WP9 A;  5LA6 E;  4B3M T;  2WBL A;  4QX7 B;  2P9B A;  3JAE A;  3C4X A;  3FB2 A;  4DBQ A;  3RHW A;  4C91 A;  3AEA A;  3EDU A;  4ZZC A;  3K3Q C;  4FI5 A;  3MXZ A;  3AVS A;  3BQI A;  4GYR A;  4IST A;  3CQC B;  3ESL A;  3O4X E;  1OXZ A;  1XNQ T;  3PTR B;  1FJG T;  3ZN1 B;  2KXP B;  2X66 A;  2YK0 A;  2LEH A;  3WAJ A;  4OFZ A;  1UX4 A;  3QB5 K;  5LMU T;  2BS3 A;  5FXW A;  3EAB A;  1OED C;  2M6I A;  4NUU A;  5HAX A;  3SFE A;  5EK3 A;  4AKG A;  4AIS A;  2LSK A;  1ZP0 A;  2CBJ A;  4YTP A;  2DCF A;  3LG7 A;  1OED B;  3Q9D A;  5AQT B;  3AEE A;  2VVS A;  3X1D A;  5KX5 E;  4I4T E;  2CCQ A;  5HWX A;  2WDV A;  4UVC B;  2A72 A;  1KNZ A;  2W61 A;  2Y48 B;  5JR9 A;  4JEU B;  3FZL B;  5JRC A;  3ZYK A;  3P4R A;  2JQQ A;  3F31 A;  4HE8 A;  4QH4 A;  5FY0 A;  3Q5W A;  4CQI A;  3ZYL A;  4DV4 T;  4HFV A;  4FJO A;  3RRW A;  1UGO A;  4QKN A;  4EYU A;  1HCI A;  2XQY A;  4DUZ T;  3MK7 C;  3RYI E;  2J62 A;  5DJQ C;  3FXD B;  2I59 A;  3CVR A;  3NKZ A;  2JMK A;  4NXM T;  2LKG A;  2L9Q A;  2E8I A;  2XPK A;  5AQN B;  3AE7 A;  4ZI7 E;  3AE5 A;  3OBV E;  5HXR A;  2HHH T;  4OYJ A;  2KLQ A;  4QHO A;  5HXC A;  2F4V T;  4H9N C;  1O3X A;  5AQV B;  5LBQ B;  1NAF A;  2OV9 A;  4TN7 B;  5LNK A;  1SE7 A;  3DP7 A;  3O1I A;  1N33 T;  2Y6X A;  3N2K E;  5HWY A;  3FZH B;  1ZV4 X;  3JAF A;  5HXS A;  3PUZ F;  2X9H A;  3PJA A;  3P8C D;  2YU2 A;  3W15 B;  4U3C A;  4U74 A;  1D0Z A;  1IJ6 A;  4DV1 T;  3NRY A;  1FMV A;  3AE6 A;  2HN2 A;  1NEN A;  1E7P A;  2IIU A;  3IEE A;  2M67 A;  1X9B A;  3ZMU B;  2VUR A;  4TV8 E;  5HYA A;  4NIQ A;  4HWC A;  3R6N A;  2Q9Q C;  4UF0 B;  4UIG A;  2I0M A;  2C5K T;  3RH3 A;  3KV4 A;  2BKN A;  3K1S A;  1YKH B;  1US7 B;  2LOS A;  3AED A;  2NP9 A;  2Q9Q B;  3ZKR A;  3V5U A;  2XQ9 A;  3SOL A;  2W00 A;  1MMD A;  5L3E B;  2IHR 1;  2J1D G;  3OYX A;  2JJ9 A;  4DMV A;  2V5D A;  2UU9 T;  3H37 A;  4HFB A;  4M1P A;  4ISS A;  3TKL B;  5M4Y A;  2LKH A;  5FMN A;  3CX8 B;  4KMC A;  3ZT6 A;  3ETU A;  2UXN B;  2K24 A;  4QH1 A;  3RYH E;  2UXB T;  5F3J A;  4J2C A;  1Y64 B;  4CN1 A;  3PU3 A;  2DWK A;  4P09 A;  1ZHC A;  4P0B A;  3RRC A;  5AQR B;  5AQK B;  1HX1 B;  2R6G F;  5CA0 E;  3EUH A;  3HR0 A;  2PG8 A;  4H9P C;  4DVD A;  2XM1 A;  4DBR A;  1N32 T;  1OWA A;  1LVK A;  4DR1 T;  1WYC A;  2WWU A;  4Z91 A;  4OYK A;  3ZC1 A;  4B6X A;  2WMN A;  5FYM A;  2D2S A;  3PUW F;  5E0O A;  4DV5 T;  2CBI A;  3NVO A;  4JEH B;  5LYJ E;  4EOZ B;  2C0S A;  2E9X A;  4DR3 T;  2SPC A;  2WM9 A;  4DV3 T;  1N34 T;  4N78 D;  2CXD A;  4GYS A;  3AE3 A;  4F8H A;  4JI5 T;  1WR6 A;  4GK5 E;  3KVB A;  1BR4 A;  2E5V A;  5AQP B;  5HEJ A;  2WZI A;  3CPZ A;  2X51 A;  4CI3 B;  2W4X A;  2XSB A;  3KIN B;  1Y01 A;  2HPJ A;  4TUY E;  3LK3 B;  1VCT A;  4HFH A;  5DQW A;  4U2Y A;  1HNX T;  2JQH A;  3T1H T;  2OA5 A;  2QYW A;  4Z8X A;  3ZLI A;  1KK7 A;  3MKD A;  2WDR A;  5JTG A;  3OPC A;  4IRE A;  2H88 A;  3Q5D A;  3UU5 A;  4HTE A;  3WAK A;  5JDM A;  3LK2 B;  2ODV A;  4UVA B;  3LSV A;  3K3O A;  3PUR A;  4EZH A;  4IDN A;  5KMG P;  4TX5 A;  2VKO A;  2CWY A;  4QXC B;  4U72 A;  4PK4 A;  2LSJ A;  3U78 A;  2ODU A;  3RQW A;  2IDO B;  3EI0 A;  4YT0 A;  3FHN A;  3HKB E;  5AQQ B;  2HN1 A;  1BR1 A;  1WLX A;  3RF1 A;  4X66 T;  1IZN B;  3ZPO A;  3TLT A;  1U4Q A;  2YIN A;  5CJ5 A;  3K8P C;  1WCR A;  2B1E A;  2FJE A;  4EYY R;  2BDE A;  3PV0 F;  2K9A A;  5LJM A;  4IE0 A;  4LF9 T;  5HXE A;  2NTX A;  4YSX A;  2FJA A;  5KDM C;  3GN5 A;  4WW0 A;  3JC6 D;  2K3W A;  4IIJ E;  3UUB A;  3CX7 B;  4U2Z A;  4KHP T;  3NWI A;  3F2E A;  4LF7 T;  2UXD T;  5H6Q B;  1WR0 A;  2GK9 A;  4CN4 A;  3L09 A;  3LBX A;  3RI5 A;  2D0T A;  3NRX A;  2XAG B;  5FNV E;  2UUC T;  3RIF A;  4HN9 A;  3AEG A;  5LGT B;  3MJX A;  4DR6 T;  1W0A A;  5LHH B;  1XMO T;  2RA1 A;  5AQU B;  2ES0 A;  4EGW A;  4I50 E;  2V5C A;  1WYB A;  4X62 T;  1YXR A;  2IC9 A;  2DNX A;  2J47 A;  2CHO A;  2ZMA A;  3AE2 A;  3RPU A;  2E2A A;  4PK6 A;  3ETV A;  1NWM X;  2LJL A;  5JRE A;  2CM0 A;  4JYA T;  4H63 V;  4YLH A;  4NXN T;  2VAS A;  3N9P A;  5LGU B;  2XAF B;  3UT5 E;  4EEB A;  4O4H E;  1UCU A;  4B3S T;  4DR2 T;  1OED A;  1VOM A;  4YJ2 E;  1AJ3 A;  4PK5 A;  4QWN B;  1JNZ A;  4JBW F;  3AB3 B;  4EZ4 A;  4UV8 B;  3K3N A;  3HI2 A;  1OED E;  4QXB B;  4O8S A;  2D0U A;  2WB5 A;  1M62 A;  4HKA A;  2H7V C;  2H3R A;  2KWH A;  1U5P A;  2V26 A;  3F57 A;  5LCY A;  4CXW A;  3AVR A;  1WFD A;  5FY1 A;  3VHL A;  3C4W A;  1UUR A;  3DJB A;  4UR9 A;  3RYC E;  3OVU A;  5JDH A;  3PE0 A;  5AQJ B;  4KP3 C;  4JI8 T;  3H3A A;  4UVB B;  3NZQ A;  3LJC A;  3AAA B;  3LFM A;  5JDQ A;  4AKL A;  3CWZ B;  1T7S A;  3IA3 A;  3ZMS B;  2ACZ A;  2V8S V;  4IE5 A;  2DI4 A;  5LBM A;  4HWI B;  3FBZ A;  4IGU A;  2KSR A;  4DV2 T;  3RKO A;  4TWF A;  3N9N A;  2LHN A;  4ZHQ E;  4ILC A;  4JUY A;  4AI6 A;  3ZSS A;  2WY2 A;  2X9W A;  4IDO A;  3TLW A;  3C64 A;  2BKP A;  3OYZ A;  3AA6 B;  1YW0 A;  2KWI B;  4DMW A;  4ZZB A;  4PJN A;  1KEY A;  3RX6 A;  2CXL A;  2JMH A;  4YSY A;  4CXX A;  5FL0 A;  5L4H A;  4O2A E;  3CX6 B;  3I0Q A;  2XUE A;  1FIO A;  3IHR A;  5LB7 B;  5FXZ A;  1YKE B;  4DR5 T;  4I43 B;  2DLR A;  4UF0 A;  1ZOY A;  4ZS3 A;  3RLF F;  3CQX C;  3I9W A;  2QRX A;  2WWV A;  3O9X A;  2Q9Q A;  1HNW T;  3D0T A;  2NTY A;  3SWH A;  4YHH T;  4EB6 E;  1IBK T;  2E9X D;  1I94 T;  2IC6 A;  1HS7 A;  5C2T A;  1CUN A;  3BQL A;  4NUV A;  2XAJ B;  4YTN A;  4LF8 T;  1X79 A;  1R8I A;  3T8O A;  4ERR A;  3SS1 A;  4EIW A;  4DR4 T;  4YSZ A;  2L8K A;  4OX9 T;  5C3J A;  3EHZ A;  4KUM B;  1S35 A;  1VCS A;  4DR7 T;  3UU8 A;  2H89 A;  5JDG A;  2X67 A;  3HKE E;  5AQF B;  3PUG A;  5FKY A;  5LG4 A;  4E7Z A;  2EHO C;  1HNZ T;  3BQK A;  3L3P A;  2CA5 A;  2XAH B;  4ZI2 C;  5IWA T;  3A8Y C;  3KV6 A;  4PW8 A;  3CML A;  1XZY A;  2K48 A;  2XQ8 A;  3N2G E;  2EHO B;  2LRK A;  4IE6 A;  2WQY A;  2BBJ A;  4E7S A;  1HX8 A;  3AE9 A;  2CLY C;  2BZB A;  3B5M A;  3L39 A;  3PJA J;  2V6Y B;  3TLV A;  4COF A;  3QC9 A;  3N2O A;  4AKI A;  5AQG B;  3ZEF B;  3GMI A;  2W2U A;  2LOP A;  4PJJ A;  3RQU A;  1CHU A;  2CLY B;  2QVA A;  2V1D B;  5EK2 A;  3TLU A;  3HA4 A;  4C90 A;  1WRD A;  1J5E T;  1BR2 A;  2XQA A;  3N9M A;  5L3B B; 
#chains in the Genus database with same CATH homology
 1IBK T;  1XMO T;  1N32 T;  1I94 T;  4DR1 T;  2E5L T;  4LFB T;  4X62 T;  4JI4 T;  4AQY T;  4LF8 T;  4GKK T;  2ZM6 T;  1IBM T;  4JI0 T;  4DV2 T;  2VQF T;  4LFC T;  4DR4 T;  4DV4 T;  4B3M T;  4JI2 T;  4DV5 T;  4OX9 T;  4DR7 T;  4DUZ T;  5BR8 T;  4JYA T;  4X66 T;  1XMQ T;  1HR0 T;  4NXN T;  4DR3 T;  2UUB T;  1N36 T;  4DV3 T;  1N34 T;  4B3S T;  4DR2 T;  4NXM T;  1HNZ T;  4JI6 T;  1XNQ T;  4LF4 T;  1FJG T;  1IBL T;  4JI5 T;  2UU9 T;  4LF9 T;  4X64 T;  1XNR T;  5IWA T;  4K0K T;  5LMU T;  2HHH T;  2UUA T;  4B3R T;  2F4V T;  4LFA T;  4KHP T;  4DUY T;  2UXB T;  4GKJ T;  4LF6 T;  4YY3 T;  4JI7 T;  3T1Y T;  4JV5 T;  4DR5 T;  4JI1 T;  4LF7 T;  2UXD T;  1N33 T;  4B3T T;  3OTO T;  1HNX T;  3T1H T;  5LMN T;  2UXC T;  2VQE T;  4DV7 T;  4JI3 T;  4LF5 T;  4JI8 T;  4DV0 T;  2UUC T;  1J5E T;  4DV1 T;  1HNW T;  4DR6 T;  4X65 T;  4YHH T;  4DV6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...