4DV0T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv0T00
2UUBT 4B3RT 1IBLT 2UXBT 2UUCT 4YHHT 1XMQT 1XMOT 4DV5T 4JI2T 4LF6T 4GKKT 4JI5T 4LF8T 4K0KT 4JI7T 4JYAT 1N33T 1FJGT 4DR7T 1XNQT 4B3TT 4JI8T 1HNZT 1IBKT 1J5ET 4DUYT 4DR1T 2ZM6T 4DV1T 2F4VT 1N36T 2VQET 4AQYT 5BR8T 4LF9T 3T1YT 4DR4T 4KHPT 4X64T 2UU9T 4DR5T 5LMUT 1HNWT 1HR0T 1I94T 1N34T 4LF7T 4DV7T 4DR6T 4DV2T 2UUAT 4LFBT 4NXMT 4LF5T 1XNRT 2UXDT 4DR2T 4X65T 4JI1T 4JI0T 3T1HT 4LF4T 4JV5T 1IBMT 4NXNT 4LFAT 4DV6T 4DV3T 4JI3T 3OTOT 4DR3T 2HHHT 4DV0T 5LMNT 2VQFT 1N32T 4DUZT 4JI4T 2E5LT 4JI6T 4B3ST 1HNXT 4LFCT 4DV4T 2UXCT 4B3MT 5IWAT 4X66T 4X62T 4OX9T 4GKJT 4YY3T
chains in the Genus database with same CATH superfamily
3KBTA 3WAKA 2KMFA 2UXBT 3VKHA 5L3CB 3CQXC 4O2AE 5LB7B 4JI2T 4H9QC 4GKKT 3BK9A 2VKJA 3LDQB 2VB6A 5L4EA 2CRBA 4U7IA 1YD8G 5ABHA 1EZ3A 5EZYE 4JI8T 3ZEFB 2FJDA 3H3MA 4KP3C 2CPTA 4HWDA 4ZHQE 1S35A 2G0UA 1N36T 3L39A 5JRCA 2L3LA 2UU9T 2H7OA 4DBRA 3SRZA 5BMVE 5FL1A 2LM2A 4MHCA 4LMJA 2BKPA 3Q9DA 4WYVA 2BZBA 2ZMAA 3GN5B 2DWKA 4IE7A 3MKDA 3JAEA 4ILCA 4TNVA 3FXEB 3AEFA 4JI3T 3N2OA 2HHHT 4IREA 2C5IT 3HL6A 3N9OA 5L47A 2LE8A 5HEOA 3O1IA 2NW9A 3AEGA 5AQRB 5KMGP 4ZS3A 2XASB 4KX6A 4CI3B 3IF8B 5IWAT 3RC8A 2UUBT 1VCTA 5FXZA 2VL8A 5KX5E 4UIGA 5JR9B 2X66A 3ETVA 3EHZA 5JVDE 5FL0A 4LMKA 3P4PA 4PJLA 4Q25A 2LLYA 3RYHE 1SA0E 2A2FX 2UXXB 5HCJA 4CN1A 2X51A 3AE6A 1H7CA 4CXYA 5J2UE 2DL1A 4DR5T 3ZCIA 2LSYA 2V1DB 3ONJA 2B76A 1VCSA 4LF5T 2LOSA 2XM2A 5FNVE 3P8CD 2XQYA 5HXEA 2MTQA 4XZCA 5C2TA 2V5DA 3EUHA 2D0UA 2W2UA 3ZN1B 3P4QA 5A1LA 3SFEA 3F31A 5EK3A 1ZP0A 3UQ4A 1J1JA 2ZM2A 1CHUA 1BR2A 3LG7A 4AXPA 1Z0PA 3P4RA 4ZEYA 3ZSTA 5C3JA 4GKJT 3A5XA 4DO0A 4G2AA 3E08A 4HFHA 3F2EA 5LGUB 3GN5A 5IUXA 2PJQA 2IHR1 5F3JA 2VKHA 3AE7A 5HEGA 4QX8B 2YU1A 4O8SA 1V9DA 2WMOA 4WW0A 1X9BA 1T98A 1U4QA 3ETUA 1YQ4A 4AIUA 4JLEA 2WU5A 3P50A 2IUBA 5HEHA 4DV1T 2K48A 4UV8B 4YT0A 2N9DA 3I0OA 3C4ZA 3V5SA 1D1BA 4OYKA 2E2AA 2NR4A 3DP7A 2P9BA 5JREA 4U2YA 2V6XA 5DJQC 2MYSA 1HG2A 2CBJA 2W0GA 2RPAA 5FVLA 2K24A 4EAHA 3FXDB 2V7KA 4PK6A 1WYBA 3PUWF 2QYWA 4ERRA 2XZEA 3H3AA 3C4WA 3SS1A 5HWXA 4ZS2A 2NOXA 3RHWA 5F8PA 1WFDA 5CGMA 2V7LA 4NIQA 4H9RC 4IDZA 4TUYE 5LP6E 2KINB 3RPUA 2AXDS 2WWUA 3OBVE 5AQPB 1Y01A 4QH4A 4YHHT 2RA1A 2IAKA 4JBWF 2QGSA 3IBPA 2Y8DA 4LF8T 3PUVF 3LSVA 4EGWA 4QXCB 2ZM0A 3AXJB 3AE9A 3AEDA 2F4VT 2XQ5A 3L8RA 4LF9T 4UVAB 4KHPT 3TLSA 2H88A 2IC6A 3ZLIA 4WZXA 4H9SE 2UXNB 4O4JE 5LG3A 2WP9A 4Z90A 1HR0T 3TLVA 4ADZA 2DNXA 5FYMA 4WBOA 1D0XA 4LFBT 4NXMT 2BG9B 5L3GB 5AQVB 3S4UA 3C50A 3KVBA 3KV6A 3FBZA 4DIDB 4DV3T 2M6IA 5LJNA 5LMNT 3CQGB 4YJ3E 3AE2A 2B1EA 4UVCB 3Q5XA 3K8PC 1W09A 4G63A 3R6NA 2YN6A 4ZI3D 2XSBA 4L5GA 3OYXA 3GA8A 4O4IE 3PUQA 5CFBA 2BG9E 2DWGA 4TN7B 5GONE 5LJMA 1XMOT 4ZXLA 3UU5A 3ESLA 1T8BA 3N9PA 2LM9A 5LYJE 2CCQA 4DR7T 2CMRA 3AVRA 4HFDA 2NTXA 5J1GA 5CB4E 5L3BB 4TWDA 4PK5A 4DR1T 2OLTA 1E7PA 2VQET 2I6HA 5LGTB 5FY1A 2X9WA 2CWOA 1UX5A 3B57A 3AAEB 1UK5A 1FMWA 2CXDA 2XAFB 2XSAA 3GMIA 4P1NA 2CHNA 1XWMA 1HX8A 5HCMA 3PUAA 4JI1T 4TWHA 4C91A 1R8IA 3RRWA 1UURA 4LMLA 4WBNE 5IYZE 4YHJA 1UX4A 1HS7A 3I9YA 3ZYKA 1IAPA 3L09A 5LHIB 3RIAA 3AXJA 3ZT6A 4EIWA 4ZI3C 3K3OA 3ZC1A 5AQMB 4U72A 2YU2A 4PFOA 1VOMA 3AAAB 5ADXL 4I55E 4PJNA 4KMCA 2VVNA 4O2BE 3I0QA 2BG9A 4IDQA 3QOFA 1BR1A 2K9AA 4YJ2E 2KSRA 4DV5T 4CZZB 4YLHA 5JH7E 5JQGE 4J2CA 2RP4A 4TV9E 2XAGB 4YTMA 3Q5EA 5CA0E 2YK0A 2WU2A 4IL4A 5LA6E 4B3TT 1HNZT 5C8YE 1WRDA 4KUMB 3OVUA 2LEHA 4HEAA 1D0YA 1ZHCA 3VR9A 2K3WA 2E9XB 1YXRA 4MLKA 2LSIA 1T72A 1FEWA 3FZKB 3ZYLA 2CA5A 3ZPOA 3LK2B 4AISA 1MMAA 2PG8A 2BKOA 4ZI2D 4ASKA 4IT4A 1XNRT 4QKNA 5AQKB 4ZI7E 4HFEA 2CLYC 2YEVC 3AE4A 4QH1A 4GOUA 3FHNA 5FKYA 3PU8A 4NXNT 3ZJ1A 1KNZA 5AQUB 4TNWA 2X9HA 3HKBE 3EI0A 1HCIA 2MAWA 3C4XA 3ZSSA 3ZMSB 4DBQA 2XQ3A 5AQSB 3PUGA 2E9XD 4TWFA 1D0ZA 2H3RA 4KBMB 4E7ZA 3ZN0B 3QK6A 4F8HA 2W66A 2YDSA 2LJLA 1HFAA 3PUSA 5H6RB 2KWHA 2N2NA 5AQQB 3VHLA 3RF1A 3CX8B 2IC9A 3GWHA 3MJXA 2HH7A 3E22E 4ANJA 4EEBA 1W0AA 2AE9A 3VR8A 2LKHA 2X0HA 5FXVA 4U2ZA 1E1HB 3LFMA 4ZI2C 2LRKA 2Q9QB 4E7SA 4HE8A 4LF7T 2XAQB 2BS4A 3CK6A 2IDOB 2W67A 3BQIA 4TZ4C 2ES0A 1MNDA 3PUXF 2JPFA 1HG5A 5AQFB 3NRYA 3UU4A 5H6QB 2LHRA 2XM1A 4GK0E 4DV6T 1YW0A 4DMVA 3KV4A 3NZPA 3LK3B 5AQGB 4GYSA 2E9XA 4PW8A 5HXCA 2K5BB 3QNUA 2NP9A 3VU7H 2BDEA 2CBIA 3AEEA 3FZLB 2Q9QD 1XMQT 2V6YB 2W00A 3FB2A 3MK7C 3TKLB 5JDLA 1D1CA 3M3ZB 4LF6T 1MIYA 2JMHA 5HWYA 4X20E 3RKOA 1FMVA 5HAXA 5CA1E 4JYAT 4KHZF 1NAFA 4K0UA 5LHGB 2A72A 2VL0A 3KDSE 3AA7B 1OEDB 3O4XE 3O9XA 3FBLA 2NW8A 1MIVA 2WY2A 4IDPA 2W63A 2OV9A 2WWVA 4Z91A 2WB5A 3Q2MA 4F6RC 3JCFA 4ZZCA 2XY8B 3CPZA 4YSYA 4NUUA 1OWAA 4JI0T 3SWHA 3RI5A 4UR9A 4EZ4A 2QRXA 4HN9A 5L2LA 4GYRA 4DV0T 4BJMA 2X9YA 3MZKB 3PUYF 4HFVA 2KT9A 4B6XA 2VKOA 5JTGA 5JR9A 2YDQA 5JR9C 4I0UA 2Q9QA 4EYYR 2XAJB 4QWNB 3WAJA 5ABEA 5M4YA 1NEKA 4CXWA 2C5KT 2HN2A 2WCAA 2XTLA 1HF8A 4HFCA 2MOZA 1O3XA 3KFWX 3RKGA 3TLUA 1G73A 2LOPA 4BA9A 3TLTA 3JC6D 5EK4A 2JQHA 4K0KT 1MNEA 4OK0A 5KDMC 2XQAA 4XAXB 3PJAA 4U31A 3BQLA 3RX6A 4AKLA 5LG4A 2WBLA 4PNIA 4JEHB 3T1YT 3LBXB 4X64T 3RIFA 2ODVA 1D1AA 2KXPB 3A8YC 1IJ5A 4U7YA 1NENA 5EK2A 4FI5A 5KXJA 2V6YA 1KFYA 4QX7B 2VVSA 4X65T 5AQTB 4IE5A 4P0AA 5LBMA 4IDNA 5AQOB 3VKGA 3UFEA 4HGAA 4JV5T 5AQJB 4PJJA 5FY7A 3VRBA 2PBIA 5ABFB 1MMGA 4HFBA 3RLFF 1LVKA 5LOVE 2PTFA 2PFVA 4PJMA 1LRZA 1N32T 4JUYA 2JRKA 3UU6A 4ILUA 4JEUB 3FZFB 4B3MT 3HA4A 4OYJA 4X62T 2BVLA 3EDUA 4YY3T 2LSGA 4AQGA 3JC6C 4C90A 3NKZA 4QXHB 5AFUL 4B3RT 2HPJA 2MBGA 2QVAA 5HEJA 1XDPA 1YQ3A 2EHOB 2DCFA 2MPKA 3Q5DA 1ZEEA 1WLXA 1N33T 5L3DB 5FMNA 3EVYA 3QB5A 4H63V 4M1PA 4OHFA 1IBKT 2VKDA 5FP3A 3W15B 3OJAA 3JADA 1KF6A 2ZLYA 2NWBA 4X1IE 2L9QA 4YSXA 1DU2A 3KVAA 4AQFA 4AKGA 4AQFC 2DLRA 5AQNB 2D9DA 2UUAT 2E8IA 2JMKA 2VK9A 2UXDT 4I43B 5HXRA 3B13A 2CXLA 5JRCB 3ZJ2A 3ABVA 4IDOA 5LHHB 1IBMT 2KZ7B 3O1HA 3ZKRA 2J47A 3CKDA 3CX7B 3AE1A 3NWIA 3PUZF 2LHNA 2YKSA 4COFA 2KNDA 3OYZA 2DI4A 2OA5A 3UT5E 3J7Yq 1JNRA 3K3QC 4MFRA 2V26A 2WSSV 4JI6T 4B3ST 3H37A 2V7MA 4ZZBA 2JQQA 3DJBA 3PURA 1QLBA 3HKDE 1AJ3A 4H9OC 5CJ5A 1IBLT 2UUCT 2A9UA 4QH5A 1US7B 5LBQB 1SE7A 2X0LB 2W62A 1UUSA 1NWMX 4JI5T 1S94A 3UQ7A 4DNDA 2J1DG 5ABFA 1LKXA 3N9MA 3I9WA 4N78D 3UFGA 2ODUA 4AI6A 3KV5A 2QA7A 4WNKA 4H9PC 1J5ET 2BG9C 2GK9A 5JDQA 5DABA 3VRAA 5BR8T 4DR4T 2CE7A 4IE6A 1WR0A 3UTKA 3AECA 4HFIA 3ZMUB 1HNWT 4ILAA 2X9XA 2V7IA 4DMWA 3CQCB 5JDGA 5HEUA 2VURA 4GIWA 1WCRA 3AA1B 2EHOA 4L9IA 3EDVA 3AE5A 3ONLC 3NVOA 5JDMA 3RH3A 2A3DA 3HI2A 5L3EB 4YFSA 4YTNA 1ZKEA 3UUMA 2E5VA 3C64A 4IGUA 5HXHA 1KEYA 3HKCE 2HN1A 4AKHA 4OX9T 2CXFA 4X1KE 2V7JA 3PU3A 2XPKA 3N9NA 2WDVA 3P4SA 3ZT5A 4UELA 4EEDA 5L3FB 1T7SA 3AVSA 1BR0A 4I50E 1W0BA 5LGNB 4EV6A 3JAFA 3ZMTB 2H7VC 1XZYA 3MA9A 2L8KA 5F5WA 3TLWA 3M65A 4AQYT 4O4LE 1QSDA 2LSKA 2C5JA 3L3PA 1E2AA 4UF0B 4YTPA 4AKIA 4DV2T 5AQIB 4A98A 4MALA 4PFPA 3X1DA 4ISTA 1SHZC 4QHOA 2LT3A 3ONXA 2JQ9A 2Y48B 4AKRB 4TV8E 2WMNA 4A97A 3LJCA 1FIOA 2W61A 4EOZB 2W4XA 4V1Av 4ILBA 2D0TA 4CQIA 2XJ7A 2VQFT 1M62A 4JI4T 1M7KA 4BJNA 1JNZA 1HNXT 2VWAA 3QUJA 3CMLA 1KK7A 1U5PA 2Y6XA 3QC9A 1HX1B 2WZHA 5TAOA 4U3CA 3B5MA 2E9XC 3UULA 5LNKA 4JI7T 2WAUA 4IIJE 2J62A 4U74A 3AE3A 2BKNA 3P4WA 2XAHB 2IW5B 1UGOA 3N2KE 3UU8A 1CUNA 4YXDA 2NW7A 5E0OA 3HKEE 3WI3A 5FY0A 2ACXA 2Z6EA 3ZYMA 5HYAA 2FBWA 3PDYA 2X0YA 3RIUA 3SFDA 3RIUC 1N34T 3MACA 2JIWA 2ZM8A 4UV9B 5FXWA 3P7IA 4Z8XA 3HR0A 2WM9A 3Q5WA 2J4GA 4EXTA 3RQWA 1ZOYA 1KNRA 2D5UA 4CI1B 2NTYA 3OTOT 3O1JA 3RC3A 3ANWB 5JDFA 4L0RA 1WYCA 2FJBA 4CXXA 4P09A 1B7TA 2WDQA 3EABA 4UF0A 5FVKA 4ZOLE 3NRXA 2BVMA 1YKEB 3DTOA 3AEAA 3RYFE 3A7MA 2BBJA 4PAGA 4YSZA 1OEDE 3PJAJ 3ZCJA 4HWFA 1WR6A 3CIRA 3AA0B 1QUUA 3KINB 3IA3A 3RQUA 5AQHB 2Q9QC 4IHJE 4DVDA 1FJGT 4X1YE 3KV9A 3C51A 1SUMB 1KNPA 2BBHA 2XQ9A 3U78A 2XQ8A 3PV0F 3N5LA 1OXZA 2BS2A 3KBUA 4EB6E 1I94T 3EAMA 5HXSA 1X79A 4DV7T 3LK42 2VASA 2WZIA 5LXTE 4XBFB 3CWZB 4X5TA 1MIWA 3FZHB 3R84B 1MMNA 3ZT7A 5L4HA 3CX6B 3RYCE 3N2GE 3T8OA 2D2SA 2KLQA 4NUVA 2X67A 4LFAT 4DR3T 2IMLA 4P0BA 2XUEA 3ZMZB 4DUZT 2N1GA 4IL9A 2KWIB 3IEEA 5ABGA 4CN6A 2FUPA 3J9X1 4LFCT 3IHRA 3ZMVB 2H89A 2HPLA 4X66T 3RRCA 1XDOA 3UUNA 3SOLA 4UVBB 2FJAA 4PK4A 5LCYA 1OEDA 1OEDC 2LKGA 4CI2B 5FXXA 3OPCA 3UU3A 2XQ4A 3G06A 2WDRA 2R6GF 3FZMB 4NPPA 2BS3A 3ANWA 2V5CA 2YINA 3AE8A 1Y64B 4H63H 4A5XA 3CVRA 2M6BA 2M67A 4CN4A 3V5UA 2CWYA 4HTEA 4H9NC 3F57A 3AA6B 3N9QA 5IHYA 5LMUT 3OKQA 2I0MA 4HKAA 2SPCA 2I59A 4ISSA 1IZNB 3K3NA 3N9LA 4UXNB 3AB3B 1UCUA 3RYIE 4UEMA 3T1HT 4LF4T 4EYUA 5ETWA 3UUXB 3E0ZA 3I1AA 4O4HE 1YKHB 2XHEB 2ACZA 1J5WA 2CLYB 4U33A 4BAYB 4HWCA 2XQ7A 2UXCT 2CM0A 4HWIB 5JDNA 3NZQA 5DQWA 2EHOD 2V8SV 2LSJA 1VRBA 2YOEA 4IE0A 1MMDA 3RGLA 2JJ9A 4MBQA 4GK5E 1BR4A 3LBXA 4HWHA 2LRLA 5J2TE 2YDRA 2C0SA 4KI0F 2DHRA 1XNQT 1HTJF 4EZHA 2IIUA 1Z8UA 4OFZA 4I4TE 4DUYT 2ZM6T 1I6ZA 4IE4A 3PTRB 1IJ6A 4QXBB 3MXZA 3C98B 2XQ6A 3UUBA 3ZC0A 2FJEA 3BQKA 4DR6T 4TX5A 1G8XA 1LVFA 3K1SA 4FJOA 4DR2T 3D0TA 3PE0A 1GQEA 3QB5K 2CHOA 4A56A 2JQKA 2CEAA 3AAIA 2E5LT 5JDHA 1ZV4X 2EHOC 1L0VA 4DV4T 1W9RA 2WS3A 5J0ZA 3NBXX 3AEBA 5AQLB 5DQVA 2X68A 2WQYA 3U3IA
chains in the Genus database with same CATH topology
2UUBT 4B3RT 1IBLT 2UXBT 2UUCT 4YHHT 1XMQT 1XMOT 4DV5T 4JI2T 4LF6T 4GKKT 4JI5T 4LF8T 4K0KT 4JI7T 4JYAT 1N33T 1FJGT 4DR7T 1XNQT 4B3TT 4JI8T 1HNZT 1IBKT 1J5ET 4DUYT 4DR1T 2ZM6T 4DV1T 2F4VT 1N36T 2VQET 4AQYT 5BR8T 4LF9T 3T1YT 4DR4T 4KHPT 4X64T 2UU9T 4DR5T 5LMUT 1HNWT 1HR0T 1I94T 1N34T 4LF7T 4DV7T 4DR6T 4DV2T 2UUAT 4LFBT 4NXMT 4LF5T 1XNRT 2UXDT 4DR2T 4X65T 4JI1T 4JI0T 3T1HT 4LF4T 4JV5T 1IBMT 4NXNT 4LFAT 4DV6T 4DV3T 4JI3T 3OTOT 4DR3T 2HHHT 4DV0T 5LMNT 2VQFT 1N32T 4DUZT 4JI4T 2E5LT 4JI6T 4B3ST 1HNXT 4LFCT 4DV4T 2UXCT 4B3MT 5IWAT 4X66T 4X62T 4OX9T 4GKJT 4YY3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB T;  4B3R T;  1IBL T;  2UXB T;  2UUC T;  4YHH T;  1XMQ T;  1XMO T;  4DV5 T;  4JI2 T;  4LF6 T;  4GKK T;  4JI5 T;  4LF8 T;  4K0K T;  4JI7 T;  4JYA T;  1N33 T;  1FJG T;  4DR7 T;  1XNQ T;  4B3T T;  4JI8 T;  1HNZ T;  1IBK T;  1J5E T;  4DUY T;  4DR1 T;  2ZM6 T;  4DV1 T;  2F4V T;  1N36 T;  2VQE T;  4AQY T;  5BR8 T;  4LF9 T;  3T1Y T;  4DR4 T;  4KHP T;  4X64 T;  2UU9 T;  4DR5 T;  5LMU T;  1HNW T;  1HR0 T;  1I94 T;  1N34 T;  4LF7 T;  4DV7 T;  4DR6 T;  4DV2 T;  2UUA T;  4LFB T;  4NXM T;  4LF5 T;  1XNR T;  2UXD T;  4DR2 T;  4X65 T;  4JI1 T;  4JI0 T;  3T1H T;  4LF4 T;  4JV5 T;  1IBM T;  4NXN T;  4LFA T;  4DV6 T;  4DV3 T;  4JI3 T;  3OTO T;  4DR3 T;  2HHH T;  4DV0 T;  5LMN T;  2VQF T;  1N32 T;  4DUZ T;  4JI4 T;  2E5L T;  4JI6 T;  4B3S T;  1HNX T;  4LFC T;  4DV4 T;  2UXC T;  4B3M T;  5IWA T;  4X66 T;  4X62 T;  4OX9 T;  4GKJ T;  4YY3 T; 
#chains in the Genus database with same CATH topology
 3KBT A;  3WAK A;  2KMF A;  2UXB T;  3VKH A;  5L3C B;  3CQX C;  4O2A E;  5LB7 B;  4JI2 T;  4H9Q C;  4GKK T;  3BK9 A;  2VKJ A;  3LDQ B;  2VB6 A;  5L4E A;  2CRB A;  4U7I A;  1YD8 G;  5ABH A;  1EZ3 A;  5EZY E;  4JI8 T;  3ZEF B;  2FJD A;  3H3M A;  4KP3 C;  2CPT A;  4HWD A;  4ZHQ E;  1S35 A;  2G0U A;  1N36 T;  3L39 A;  5JRC A;  2L3L A;  2UU9 T;  2H7O A;  4DBR A;  3SRZ A;  5BMV E;  5FL1 A;  2LM2 A;  4MHC A;  4LMJ A;  2BKP A;  3Q9D A;  4WYV A;  2BZB A;  2ZMA A;  3GN5 B;  2DWK A;  4IE7 A;  3MKD A;  3JAE A;  4ILC A;  4TNV A;  3FXE B;  3AEF A;  4JI3 T;  3N2O A;  2HHH T;  4IRE A;  2C5I T;  3HL6 A;  3N9O A;  5L47 A;  2LE8 A;  5HEO A;  3O1I A;  2NW9 A;  3AEG A;  5AQR B;  5KMG P;  4ZS3 A;  2XAS B;  4KX6 A;  4CI3 B;  3IF8 B;  5IWA T;  3RC8 A;  2UUB T;  1VCT A;  5FXZ A;  2VL8 A;  5KX5 E;  4UIG A;  5JR9 B;  2X66 A;  3ETV A;  3EHZ A;  5JVD E;  5FL0 A;  4LMK A;  3P4P A;  4PJL A;  4Q25 A;  2LLY A;  3RYH E;  1SA0 E;  2A2F X;  2UXX B;  5HCJ A;  4CN1 A;  2X51 A;  3AE6 A;  1H7C A;  4CXY A;  5J2U E;  2DL1 A;  4DR5 T;  3ZCI A;  2LSY A;  2V1D B;  3ONJ A;  2B76 A;  1VCS A;  4LF5 T;  2LOS A;  2XM2 A;  5FNV E;  3P8C D;  2XQY A;  5HXE A;  2MTQ A;  4XZC A;  5C2T A;  2V5D A;  3EUH A;  2D0U A;  2W2U A;  3ZN1 B;  3P4Q A;  5A1L A;  3SFE A;  3F31 A;  5EK3 A;  1ZP0 A;  3UQ4 A;  1J1J A;  2ZM2 A;  1CHU A;  1BR2 A;  3LG7 A;  4AXP A;  1Z0P A;  3P4R A;  4ZEY A;  3ZST A;  5C3J A;  4GKJ T;  3A5X A;  4DO0 A;  4G2A A;  3E08 A;  4HFH A;  3F2E A;  5LGU B;  3GN5 A;  5IUX A;  2PJQ A;  2IHR 1;  5F3J A;  2VKH A;  3AE7 A;  5HEG A;  4QX8 B;  2YU1 A;  4O8S A;  1V9D A;  2WMO A;  4WW0 A;  1X9B A;  1T98 A;  1U4Q A;  3ETU A;  1YQ4 A;  4AIU A;  4JLE A;  2WU5 A;  3P50 A;  2IUB A;  5HEH A;  4DV1 T;  2K48 A;  4UV8 B;  4YT0 A;  2N9D A;  3I0O A;  3C4Z A;  3V5S A;  1D1B A;  4OYK A;  2E2A A;  2NR4 A;  3DP7 A;  2P9B A;  5JRE A;  4U2Y A;  2V6X A;  5DJQ C;  2MYS A;  1HG2 A;  2CBJ A;  2W0G A;  2RPA A;  5FVL A;  2K24 A;  4EAH A;  3FXD B;  2V7K A;  4PK6 A;  1WYB A;  3PUW F;  2QYW A;  4ERR A;  2XZE A;  3H3A A;  3C4W A;  3SS1 A;  5HWX A;  4ZS2 A;  2NOX A;  3RHW A;  5F8P A;  1WFD A;  5CGM A;  2V7L A;  4NIQ A;  4H9R C;  4IDZ A;  4TUY E;  5LP6 E;  2KIN B;  3RPU A;  2AXD S;  2WWU A;  3OBV E;  5AQP B;  1Y01 A;  4QH4 A;  4YHH T;  2RA1 A;  2IAK A;  4JBW F;  2QGS A;  3IBP A;  2Y8D A;  4LF8 T;  3PUV F;  3LSV A;  4EGW A;  4QXC B;  2ZM0 A;  3AXJ B;  3AE9 A;  3AED A;  2F4V T;  2XQ5 A;  3L8R A;  4LF9 T;  4UVA B;  4KHP T;  3TLS A;  2H88 A;  2IC6 A;  3ZLI A;  4WZX A;  4H9S E;  2UXN B;  4O4J E;  5LG3 A;  2WP9 A;  4Z90 A;  1HR0 T;  3TLV A;  4ADZ A;  2DNX A;  5FYM A;  4WBO A;  1D0X A;  4LFB T;  4NXM T;  2BG9 B;  5L3G B;  5AQV B;  3S4U A;  3C50 A;  3KVB A;  3KV6 A;  3FBZ A;  4DID B;  4DV3 T;  2M6I A;  5LJN A;  5LMN T;  3CQG B;  4YJ3 E;  3AE2 A;  2B1E A;  4UVC B;  3Q5X A;  3K8P C;  1W09 A;  4G63 A;  3R6N A;  2YN6 A;  4ZI3 D;  2XSB A;  4L5G A;  3OYX A;  3GA8 A;  4O4I E;  3PUQ A;  5CFB A;  2BG9 E;  2DWG A;  4TN7 B;  5GON E;  5LJM A;  1XMO T;  4ZXL A;  3UU5 A;  3ESL A;  1T8B A;  3N9P A;  2LM9 A;  5LYJ E;  2CCQ A;  4DR7 T;  2CMR A;  3AVR A;  4HFD A;  2NTX A;  5J1G A;  5CB4 E;  5L3B B;  4TWD A;  4PK5 A;  4DR1 T;  2OLT A;  1E7P A;  2VQE T;  2I6H A;  5LGT B;  5FY1 A;  2X9W A;  2CWO A;  1UX5 A;  3B57 A;  3AAE B;  1UK5 A;  1FMW A;  2CXD A;  2XAF B;  2XSA A;  3GMI A;  4P1N A;  2CHN A;  1XWM A;  1HX8 A;  5HCM A;  3PUA A;  4JI1 T;  4TWH A;  4C91 A;  1R8I A;  3RRW A;  1UUR A;  4LML A;  4WBN E;  5IYZ E;  4YHJ A;  1UX4 A;  1HS7 A;  3I9Y A;  3ZYK A;  1IAP A;  3L09 A;  5LHI B;  3RIA A;  3AXJ A;  3ZT6 A;  4EIW A;  4ZI3 C;  3K3O A;  3ZC1 A;  5AQM B;  4U72 A;  2YU2 A;  4PFO A;  1VOM A;  3AAA B;  5ADX L;  4I55 E;  4PJN A;  4KMC A;  2VVN A;  4O2B E;  3I0Q A;  2BG9 A;  4IDQ A;  3QOF A;  1BR1 A;  2K9A A;  4YJ2 E;  2KSR A;  4DV5 T;  4CZZ B;  4YLH A;  5JH7 E;  5JQG E;  4J2C A;  2RP4 A;  4TV9 E;  2XAG B;  4YTM A;  3Q5E A;  5CA0 E;  2YK0 A;  2WU2 A;  4IL4 A;  5LA6 E;  4B3T T;  1HNZ T;  5C8Y E;  1WRD A;  4KUM B;  3OVU A;  2LEH A;  4HEA A;  1D0Y A;  1ZHC A;  3VR9 A;  2K3W A;  2E9X B;  1YXR A;  4MLK A;  2LSI A;  1T72 A;  1FEW A;  3FZK B;  3ZYL A;  2CA5 A;  3ZPO A;  3LK2 B;  4AIS A;  1MMA A;  2PG8 A;  2BKO A;  4ZI2 D;  4ASK A;  4IT4 A;  1XNR T;  4QKN A;  5AQK B;  4ZI7 E;  4HFE A;  2CLY C;  2YEV C;  3AE4 A;  4QH1 A;  4GOU A;  3FHN A;  5FKY A;  3PU8 A;  4NXN T;  3ZJ1 A;  1KNZ A;  5AQU B;  4TNW A;  2X9H A;  3HKB E;  3EI0 A;  1HCI A;  2MAW A;  3C4X A;  3ZSS A;  3ZMS B;  4DBQ A;  2XQ3 A;  5AQS B;  3PUG A;  2E9X D;  4TWF A;  1D0Z A;  2H3R A;  4KBM B;  4E7Z A;  3ZN0 B;  3QK6 A;  4F8H A;  2W66 A;  2YDS A;  2LJL A;  1HFA A;  3PUS A;  5H6R B;  2KWH A;  2N2N A;  5AQQ B;  3VHL A;  3RF1 A;  3CX8 B;  2IC9 A;  3GWH A;  3MJX A;  2HH7 A;  3E22 E;  4ANJ A;  4EEB A;  1W0A A;  2AE9 A;  3VR8 A;  2LKH A;  2X0H A;  5FXV A;  4U2Z A;  1E1H B;  3LFM A;  4ZI2 C;  2LRK A;  2Q9Q B;  4E7S A;  4HE8 A;  4LF7 T;  2XAQ B;  2BS4 A;  3CK6 A;  2IDO B;  2W67 A;  3BQI A;  4TZ4 C;  2ES0 A;  1MND A;  3PUX F;  2JPF A;  1HG5 A;  5AQF B;  3NRY A;  3UU4 A;  5H6Q B;  2LHR A;  2XM1 A;  4GK0 E;  4DV6 T;  1YW0 A;  4DMV A;  3KV4 A;  3NZP A;  3LK3 B;  5AQG B;  4GYS A;  2E9X A;  4PW8 A;  5HXC A;  2K5B B;  3QNU A;  2NP9 A;  3VU7 H;  2BDE A;  2CBI A;  3AEE A;  3FZL B;  2Q9Q D;  1XMQ T;  2V6Y B;  2W00 A;  3FB2 A;  3MK7 C;  3TKL B;  5JDL A;  1D1C A;  3M3Z B;  4LF6 T;  1MIY A;  2JMH A;  5HWY A;  4X20 E;  3RKO A;  1FMV A;  5HAX A;  5CA1 E;  4JYA T;  4KHZ F;  1NAF A;  4K0U A;  5LHG B;  2A72 A;  2VL0 A;  3KDS E;  3AA7 B;  1OED B;  3O4X E;  3O9X A;  3FBL A;  2NW8 A;  1MIV A;  2WY2 A;  4IDP A;  2W63 A;  2OV9 A;  2WWV A;  4Z91 A;  2WB5 A;  3Q2M A;  4F6R C;  3JCF A;  4ZZC A;  2XY8 B;  3CPZ A;  4YSY A;  4NUU A;  1OWA A;  4JI0 T;  3SWH A;  3RI5 A;  4UR9 A;  4EZ4 A;  2QRX A;  4HN9 A;  5L2L A;  4GYR A;  4DV0 T;  4BJM A;  2X9Y A;  3MZK B;  3PUY F;  4HFV A;  2KT9 A;  4B6X A;  2VKO A;  5JTG A;  5JR9 A;  2YDQ A;  5JR9 C;  4I0U A;  2Q9Q A;  4EYY R;  2XAJ B;  4QWN B;  3WAJ A;  5ABE A;  5M4Y A;  1NEK A;  4CXW A;  2C5K T;  2HN2 A;  2WCA A;  2XTL A;  1HF8 A;  4HFC A;  2MOZ A;  1O3X A;  3KFW X;  3RKG A;  3TLU A;  1G73 A;  2LOP A;  4BA9 A;  3TLT A;  3JC6 D;  5EK4 A;  2JQH A;  4K0K T;  1MNE A;  4OK0 A;  5KDM C;  2XQA A;  4XAX B;  3PJA A;  4U31 A;  3BQL A;  3RX6 A;  4AKL A;  5LG4 A;  2WBL A;  4PNI A;  4JEH B;  3T1Y T;  3LBX B;  4X64 T;  3RIF A;  2ODV A;  1D1A A;  2KXP B;  3A8Y C;  1IJ5 A;  4U7Y A;  1NEN A;  5EK2 A;  4FI5 A;  5KXJ A;  2V6Y A;  1KFY A;  4QX7 B;  2VVS A;  4X65 T;  5AQT B;  4IE5 A;  4P0A A;  5LBM A;  4IDN A;  5AQO B;  3VKG A;  3UFE A;  4HGA A;  4JV5 T;  5AQJ B;  4PJJ A;  5FY7 A;  3VRB A;  2PBI A;  5ABF B;  1MMG A;  4HFB A;  3RLF F;  1LVK A;  5LOV E;  2PTF A;  2PFV A;  4PJM A;  1LRZ A;  1N32 T;  4JUY A;  2JRK A;  3UU6 A;  4ILU A;  4JEU B;  3FZF B;  4B3M T;  3HA4 A;  4OYJ A;  4X62 T;  2BVL A;  3EDU A;  4YY3 T;  2LSG A;  4AQG A;  3JC6 C;  4C90 A;  3NKZ A;  4QXH B;  5AFU L;  4B3R T;  2HPJ A;  2MBG A;  2QVA A;  5HEJ A;  1XDP A;  1YQ3 A;  2EHO B;  2DCF A;  2MPK A;  3Q5D A;  1ZEE A;  1WLX A;  1N33 T;  5L3D B;  5FMN A;  3EVY A;  3QB5 A;  4H63 V;  4M1P A;  4OHF A;  1IBK T;  2VKD A;  5FP3 A;  3W15 B;  3OJA A;  3JAD A;  1KF6 A;  2ZLY A;  2NWB A;  4X1I E;  2L9Q A;  4YSX A;  1DU2 A;  3KVA A;  4AQF A;  4AKG A;  4AQF C;  2DLR A;  5AQN B;  2D9D A;  2UUA T;  2E8I A;  2JMK A;  2VK9 A;  2UXD T;  4I43 B;  5HXR A;  3B13 A;  2CXL A;  5JRC B;  3ZJ2 A;  3ABV A;  4IDO A;  5LHH B;  1IBM T;  2KZ7 B;  3O1H A;  3ZKR A;  2J47 A;  3CKD A;  3CX7 B;  3AE1 A;  3NWI A;  3PUZ F;  2LHN A;  2YKS A;  4COF A;  2KND A;  3OYZ A;  2DI4 A;  2OA5 A;  3UT5 E;  3J7Y q;  1JNR A;  3K3Q C;  4MFR A;  2V26 A;  2WSS V;  4JI6 T;  4B3S T;  3H37 A;  2V7M A;  4ZZB A;  2JQQ A;  3DJB A;  3PUR A;  1QLB A;  3HKD E;  1AJ3 A;  4H9O C;  5CJ5 A;  1IBL T;  2UUC T;  2A9U A;  4QH5 A;  1US7 B;  5LBQ B;  1SE7 A;  2X0L B;  2W62 A;  1UUS A;  1NWM X;  4JI5 T;  1S94 A;  3UQ7 A;  4DND A;  2J1D G;  5ABF A;  1LKX A;  3N9M A;  3I9W A;  4N78 D;  3UFG A;  2ODU A;  4AI6 A;  3KV5 A;  2QA7 A;  4WNK A;  4H9P C;  1J5E T;  2BG9 C;  2GK9 A;  5JDQ A;  5DAB A;  3VRA A;  5BR8 T;  4DR4 T;  2CE7 A;  4IE6 A;  1WR0 A;  3UTK A;  3AEC A;  4HFI A;  3ZMU B;  1HNW T;  4ILA A;  2X9X A;  2V7I A;  4DMW A;  3CQC B;  5JDG A;  5HEU A;  2VUR A;  4GIW A;  1WCR A;  3AA1 B;  2EHO A;  4L9I A;  3EDV A;  3AE5 A;  3ONL C;  3NVO A;  5JDM A;  3RH3 A;  2A3D A;  3HI2 A;  5L3E B;  4YFS A;  4YTN A;  1ZKE A;  3UUM A;  2E5V A;  3C64 A;  4IGU A;  5HXH A;  1KEY A;  3HKC E;  2HN1 A;  4AKH A;  4OX9 T;  2CXF A;  4X1K E;  2V7J A;  3PU3 A;  2XPK A;  3N9N A;  2WDV A;  3P4S A;  3ZT5 A;  4UEL A;  4EED A;  5L3F B;  1T7S A;  3AVS A;  1BR0 A;  4I50 E;  1W0B A;  5LGN B;  4EV6 A;  3JAF A;  3ZMT B;  2H7V C;  1XZY A;  3MA9 A;  2L8K A;  5F5W A;  3TLW A;  3M65 A;  4AQY T;  4O4L E;  1QSD A;  2LSK A;  2C5J A;  3L3P A;  1E2A A;  4UF0 B;  4YTP A;  4AKI A;  4DV2 T;  5AQI B;  4A98 A;  4MAL A;  4PFP A;  3X1D A;  4IST A;  1SHZ C;  4QHO A;  2LT3 A;  3ONX A;  2JQ9 A;  2Y48 B;  4AKR B;  4TV8 E;  2WMN A;  4A97 A;  3LJC A;  1FIO A;  2W61 A;  4EOZ B;  2W4X A;  4V1A v;  4ILB A;  2D0T A;  4CQI A;  2XJ7 A;  2VQF T;  1M62 A;  4JI4 T;  1M7K A;  4BJN A;  1JNZ A;  1HNX T;  2VWA A;  3QUJ A;  3CML A;  1KK7 A;  1U5P A;  2Y6X A;  3QC9 A;  1HX1 B;  2WZH A;  5TAO A;  4U3C A;  3B5M A;  2E9X C;  3UUL A;  5LNK A;  4JI7 T;  2WAU A;  4IIJ E;  2J62 A;  4U74 A;  3AE3 A;  2BKN A;  3P4W A;  2XAH B;  2IW5 B;  1UGO A;  3N2K E;  3UU8 A;  1CUN A;  4YXD A;  2NW7 A;  5E0O A;  3HKE E;  3WI3 A;  5FY0 A;  2ACX A;  2Z6E A;  3ZYM A;  5HYA A;  2FBW A;  3PDY A;  2X0Y A;  3RIU A;  3SFD A;  3RIU C;  1N34 T;  3MAC A;  2JIW A;  2ZM8 A;  4UV9 B;  5FXW A;  3P7I A;  4Z8X A;  3HR0 A;  2WM9 A;  3Q5W A;  2J4G A;  4EXT A;  3RQW A;  1ZOY A;  1KNR A;  2D5U A;  4CI1 B;  2NTY A;  3OTO T;  3O1J A;  3RC3 A;  3ANW B;  5JDF A;  4L0R A;  1WYC A;  2FJB A;  4CXX A;  4P09 A;  1B7T A;  2WDQ A;  3EAB A;  4UF0 A;  5FVK A;  4ZOL E;  3NRX A;  2BVM A;  1YKE B;  3DTO A;  3AEA A;  3RYF E;  3A7M A;  2BBJ A;  4PAG A;  4YSZ A;  1OED E;  3PJA J;  3ZCJ A;  4HWF A;  1WR6 A;  3CIR A;  3AA0 B;  1QUU A;  3KIN B;  3IA3 A;  3RQU A;  5AQH B;  2Q9Q C;  4IHJ E;  4DVD A;  1FJG T;  4X1Y E;  3KV9 A;  3C51 A;  1SUM B;  1KNP A;  2BBH A;  2XQ9 A;  3U78 A;  2XQ8 A;  3PV0 F;  3N5L A;  1OXZ A;  2BS2 A;  3KBU A;  4EB6 E;  1I94 T;  3EAM A;  5HXS A;  1X79 A;  4DV7 T;  3LK4 2;  2VAS A;  2WZI A;  5LXT E;  4XBF B;  3CWZ B;  4X5T A;  1MIW A;  3FZH B;  3R84 B;  1MMN A;  3ZT7 A;  5L4H A;  3CX6 B;  3RYC E;  3N2G E;  3T8O A;  2D2S A;  2KLQ A;  4NUV A;  2X67 A;  4LFA T;  4DR3 T;  2IML A;  4P0B A;  2XUE A;  3ZMZ B;  4DUZ T;  2N1G A;  4IL9 A;  2KWI B;  3IEE A;  5ABG A;  4CN6 A;  2FUP A;  3J9X 1;  4LFC T;  3IHR A;  3ZMV B;  2H89 A;  2HPL A;  4X66 T;  3RRC A;  1XDO A;  3UUN A;  3SOL A;  4UVB B;  2FJA A;  4PK4 A;  5LCY A;  1OED A;  1OED C;  2LKG A;  4CI2 B;  5FXX A;  3OPC A;  3UU3 A;  2XQ4 A;  3G06 A;  2WDR A;  2R6G F;  3FZM B;  4NPP A;  2BS3 A;  3ANW A;  2V5C A;  2YIN A;  3AE8 A;  1Y64 B;  4H63 H;  4A5X A;  3CVR A;  2M6B A;  2M67 A;  4CN4 A;  3V5U A;  2CWY A;  4HTE A;  4H9N C;  3F57 A;  3AA6 B;  3N9Q A;  5IHY A;  5LMU T;  3OKQ A;  2I0M A;  4HKA A;  2SPC A;  2I59 A;  4ISS A;  1IZN B;  3K3N A;  3N9L A;  4UXN B;  3AB3 B;  1UCU A;  3RYI E;  4UEM A;  3T1H T;  4LF4 T;  4EYU A;  5ETW A;  3UUX B;  3E0Z A;  3I1A A;  4O4H E;  1YKH B;  2XHE B;  2ACZ A;  1J5W A;  2CLY B;  4U33 A;  4BAY B;  4HWC A;  2XQ7 A;  2UXC T;  2CM0 A;  4HWI B;  5JDN A;  3NZQ A;  5DQW A;  2EHO D;  2V8S V;  2LSJ A;  1VRB A;  2YOE A;  4IE0 A;  1MMD A;  3RGL A;  2JJ9 A;  4MBQ A;  4GK5 E;  1BR4 A;  3LBX A;  4HWH A;  2LRL A;  5J2T E;  2YDR A;  2C0S A;  4KI0 F;  2DHR A;  1XNQ T;  1HTJ F;  4EZH A;  2IIU A;  1Z8U A;  4OFZ A;  4I4T E;  4DUY T;  2ZM6 T;  1I6Z A;  4IE4 A;  3PTR B;  1IJ6 A;  4QXB B;  3MXZ A;  3C98 B;  2XQ6 A;  3UUB A;  3ZC0 A;  2FJE A;  3BQK A;  4DR6 T;  4TX5 A;  1G8X A;  1LVF A;  3K1S A;  4FJO A;  4DR2 T;  3D0T A;  3PE0 A;  1GQE A;  3QB5 K;  2CHO A;  4A56 A;  2JQK A;  2CEA A;  3AAI A;  2E5L T;  5JDH A;  1ZV4 X;  2EHO C;  1L0V A;  4DV4 T;  1W9R A;  2WS3 A;  5J0Z A;  3NBX X;  3AEB A;  5AQL B;  5DQV A;  2X68 A;  2WQY A;  3U3I A; 
#chains in the Genus database with same CATH homology
 2UUB T;  4B3R T;  1IBL T;  2UXB T;  2UUC T;  4YHH T;  1XMQ T;  1XMO T;  4DV5 T;  4JI2 T;  4LF6 T;  4GKK T;  4JI5 T;  4LF8 T;  4K0K T;  4JI7 T;  4JYA T;  1N33 T;  1FJG T;  4DR7 T;  1XNQ T;  4B3T T;  4JI8 T;  1HNZ T;  1IBK T;  1J5E T;  4DUY T;  4DR1 T;  2ZM6 T;  4DV1 T;  2F4V T;  1N36 T;  2VQE T;  4AQY T;  5BR8 T;  4LF9 T;  3T1Y T;  4DR4 T;  4KHP T;  4X64 T;  2UU9 T;  4DR5 T;  5LMU T;  1HNW T;  1HR0 T;  1I94 T;  1N34 T;  4LF7 T;  4DV7 T;  4DR6 T;  4DV2 T;  2UUA T;  4LFB T;  4NXM T;  4LF5 T;  1XNR T;  2UXD T;  4DR2 T;  4X65 T;  4JI1 T;  4JI0 T;  3T1H T;  4LF4 T;  4JV5 T;  1IBM T;  4NXN T;  4LFA T;  4DV6 T;  4DV3 T;  4JI3 T;  3OTO T;  4DR3 T;  2HHH T;  4DV0 T;  5LMN T;  2VQF T;  1N32 T;  4DUZ T;  4JI4 T;  2E5L T;  4JI6 T;  4B3S T;  1HNX T;  4LFC T;  4DV4 T;  2UXC T;  4B3M T;  5IWA T;  4X66 T;  4X62 T;  4OX9 T;  4GKJ T;  4YY3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...