4DV0T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv0T00
4DR5T 4LFAT 2UUCT 5LMUT 1FJGT 4X65T 4NXNT 4LF8T 4JI3T 2UXBT 4YHHT 4JI8T 2F4VT 4NXMT 4DR7T 4X64T 1XMOT 1HR0T 4JI0T 4JI5T 4JI7T 4X66T 4DV4T 4LFCT 4GKJT 4LF4T 2UU9T 1XNRT 4DR3T 4KHPT 4DUZT 4LF9T 5IWAT 5LMNT 4DUYT 4JI1T 4DR6T 1XNQT 4DR1T 1HNWT 1HNZT 1IBLT 1XMQT 1IBMT 4GKKT 4DV7T 3T1HT 1N32T 2UXDT 4YY3T 4DV5T 4DR2T 2UUBT 4DV0T 4B3ST 1IBKT 2VQFT 1N34T 4OX9T 4B3RT 4JV5T 4LF5T 4JI6T 2HHHT 4JI4T 4DV3T 4B3TT 2E5LT 4B3MT 4JI2T 4JYAT 4DR4T 2VQET 3T1YT 4LF6T 1I94T 2ZM6T 5BR8T 4DV1T 4X62T 3OTOT 1J5ET 4K0KT 4LFBT 1HNXT 1N33T 2UUAT 4DV6T 2UXCT 4AQYT 1N36T 4DV2T 4LF7T
chains in the Genus database with same CATH superfamily
4IE6A 2CWYA 2D9DA 4UEMA 2IHR1 4U7IA 1L0VA 4AQFA 1LVFA 1O3XA 2HPLA 3Q5EA 5AQPB 1S94A 4PK4A 1E7PA 2OLTA 2KXPB 4YTNA 3QB5A 2XTLA 2ZMAA 2CHNA 1OEDB 4DV7T 1Z0PA 4TWDA 3UQ4A 2ZM0A 3N9LA 1YKHB 3UTKA 1IZNB 2X9WA 3NWIA 5TAOA 2JQKA 3AECA 3RGLA 2VK9A 4DV0T 5JVDE 5JDNA 4ZZCA 3ZSTA 4N78D 3EI0A 3HKDE 2HPJA 3I0QA 3P8CD 3TLTA 3IEEA 2ES0A 2CRBA 2VKJA 3RQWA 4WZXA 4ZOLE 2H7OA 3RRWA 2LSYA 2JRKA 3O1JA 3X1DA 4WBOA 4GK0E 5HCJA 2C0SA 2A72A 3EDVA 2XQYA 3RH3A 4CN1A 4DBQA 2EHOC 2V6YA 3C98B 5CB4E 2X9XA 5JDMA 1N33T 3CK6A 1OEDC 4MHCA 2YDQA 2X0LB 1KNPA 2D0UA 3J7Yq 4HFEA 4HFBA 2VB6A 1W0AA 2PG8A 2HN2A 3BQKA 2WAUA 2NTXA 1T7SA 3N9OA 4YHHT 4JI8T 1MIWA 4ADZA 2BG9E 4LMLA 4O4HE 2V5DA 4UELA 2PFVA 4DUZT 3NBXX 3U78A 5LMNT 3VHLA 5ETWA 3RC3A 5IYZE 2IUBA 2ODUA 5HEJA 2DLRA 4XBFB 2KWIB 2W2UA 2XAQB 4TNWA 1ZHCA 3HA4A 2Y8DA 2XM1A 4P09A 4TWFA 3ZT7A 3QUJA 2QA7A 2P9BA 2FJAA 3AE4A 2LSGA 2EHOD 2N2NA 5LXTE 1MMDA 2WSSV 2N9DA 3AAAB 2W00A 3AE3A 3ETUA 4LF6T 4HFDA 2ZM6T 5LG4A 4J2CA 5BR8T 3RI5A 2XPKA 1FEWA 4NUUA 1FMWA 3QK6A 5JR9B 2XQ4A 3PV0F 1MNEA 4I4TE 2X68A 3N2KE 3F31A 4H63V 4UVCB 4HWDA 2X0YA 3ZJ1A 3N9QA 2E9XA 3RX6A 4LF8T 4PK6A 3AA1B 2FBWA 4U31A 3F2EA 3KFWX 5AQKB 4O4JE 1AJ3A 4EV6A 3ZCIA 1WYBA 3KV9A 3I9WA 3KINB 2LM9A 2XZEA 3RPUA 3ZMZB 3IHRA 4ILCA 1XWMA 4GKKT 2BVMA 4X20E 2Q9QB 5HXCA 3FZMB 5JH7E 3RKGA 3PUZF 5DQVA 1SA0E 4KUMB 4EYUA 3L39A 4LMJA 3M3ZB 4ILAA 3ONLC 3FBZA 4AKLA 3AXJA 3HR0A 3C4XA 4JI4T 4DV3T 3FZFB 3UFEA 1CHUA 2YINA 2K3WA 2LKHA 4H9QC 3ZN0B 5FMNA 2R6GF 4BJNA 2JMHA 4CZZB 3DTOA 4LFBT 1HNXT 2X0HA 3UQ7A 1HG5A 4DR5T 1SUMB 3OPCA 4FJOA 2DNXA 2CBIA 3MJXA 4H9RC 4QKNA 2F4VT 5FY0A 4QH4A 4JI0T 3N2GE 3H3MA 5HCMA 3SRZA 4B6XA 4H9NC 4GKJT 4LF4T 4FI5A 1I6ZA 2CXDA 3AE1A 3L8RA 2YEVC 2ACXA 2IIUA 3P7IA 1EZ3A 3RIAA 1D1CA 5EK3A 5FXWA 2BG9B 5M4YA 3S4UA 5HEOA 2UXDT 1OEDE 1HX8A 4ISSA 1KK7A 4HKAA 1YKEB 3K3OA 1M62A 2XAGB 2LLYA 3C4WA 5GONE 2XASB 1N34T 5FKYA 1NENA 4PAGA 1ZV4X 2WS3A 2XAJB 3JAFA 3PUWF 2HHHT 3LK2B 4TUYE 4GK5E 4B3MT 4WYVA 2KSRA 4PJMA 1KEYA 4A56A 1MMAA 5IHYA 4HFHA 3RIUA 5J0ZA 4X62T 2V8SV 3ZMSB 4E7ZA 1NWMX 3O1HA 4YXDA 3O9XA 3A5XA 2JPFA 4YFSA 2CXLA 1HG2A 3HKCE 5AQIB 2XSBA 4AXPA 4H9SE 3PJAJ 3TLWA 5AQTB 3Q5XA 2AE9A 4GIWA 5L2LA 1W09A 2LKGA 2IW5B 5AQFB 1SE7A 3PUYF 3RYCE 4HN9A 5C8YE 2XY8B 3BQLA 1UURA 2X9YA 1BR4A 3CKDA 3K1SA 2WDQA 5C3JA 1H7CA 1IBLT 2WY2A 3EAMA 1W0BA 2NOXA 3LBXA 5J2TE 3D0TA 3WAJA 5L3EB 4IGUA 2W62A 3A8YC 5L4HA 4OX9T 3AEFA 4LF5T 4H63H 5J1GA 2D2SA 2MOZA 4B3TT 2V7MA 4CI1B 2BZBA 4JI2T 3CPZA 4MFRA 1FIOA 4HFIA 2XAFB 2WCAA 3P4WA 3SFDA 3E22E 4DIDB 4EAHA 2FJEA 2M67A 4ZS3A 4EB6E 3GA8A 3A7MA 2D5UA 3VKHA 4U33A 2W0GA 4YHJA 1QUUA 1U5PA 2YOEA 1D1BA 4NXNT 1BR0A 4XZCA 3QC9A 5JDLA 1S35A 1NEKA 4DR7T 4EIWA 4WNKA 2J47A 3EUHA 4IDQA 4DR1T 5KX5E 5FXXA 3VRBA 2K5BB 4HWHA 3KV5A 3CX8B 1XMQT 2NWBA 4CQIA 2KMFA 4IDNA 4JEHB 1T72A 2W63A 3MA9A 3H3AA 4CXYA 4TWHA 5H6QB 5ABEA 3C4ZA 2BKPA 2LHNA 1OWAA 3VRAA 3PUQA 4ZI3C 4B3ST 5HXRA 3E0ZA 3NZQA 4BAYB 5JDQA 2EHOB 4LMKA 4O4LE 3FZHB 5JQGE 4Z91A 4QHOA 4ASKA 3QB5K 4AKGA 3FXEB 5LNKA 3OKQA 3LJCA 2LT3A 2KLQA 4F6RC 2V5CA 4L9IA 4IT4A 3B5MA 1G73A 3OJAA 2QVAA 1OEDA 4IE7A 4IL9A 5JTGA 1Y64B 4DMVA 4IDPA 4DMWA 2J62A 4AQFC 4DV6T 2BKNA 2DL1A 3JAEA 2ODVA 3DP7A 1KNZA 5AQNB 2QRXA 1G8XA 2E2AA 4EXTA 1D0XA 1YW0A 3ZKRA 1FJGT 5CA1E 4HGAA 2SPCA 3C51A 4U72A 2UXBT 2VL8A 5KDMC 2KNDA 4X66T 2IDOB 3RYFE 3MXZA 1GQEA 2C5IT 1V9DA 3O1IA 2ZM2A 2XQ3A 4U74A 2H88A 2NP9A 4ZI3D 2WB5A 4HFVA 4OYJA 5LP6E 3UU3A 1D0ZA 2W67A 4UV8B 2MAWA 2ZLYA 4DV5T 2WDVA 1VOMA 5DABA 3ZCJA 1QSDA 2JQHA 4IDOA 2VWAA 3AEGA 4QXCB 2RP4A 4PFPA 3VR9A 3WI3A 2MPKA 4UF0B 4CN4A 2JJ9A 2L9QA 3EVYA 4I55E 2NW7A 2BBHA 4QXBB 5AQLB 2E5LT 3N5LA 1HX1B 5LBQB 3RC8A 1E2AA 4JYAT 5HEHA 3ZPOA 4TX5A 2KT9A 5AQMB 1KFYA 2HN1A 4EEDA 5L47A 3ZMVB 4QX7B 4CXWA 4EGWA 1LKXA 4TZ4C 5AQHB 3J9X1 4WW0A 3ONXA 4PJJA 3PE0A 2LM2A 2VVNA 3ABVA 5LCYA 4X65T 3BK9A 4JI3T 5JDFA 4ZHQE 5HYAA 2LRKA 2XSAA 5KMGP 5LB7B 5FVKA 2L3LA 3OBVE 4C90A 4DR3T 2XQ9A 5LBMA 5IWAT 3VKGA 2LSKA 2B76A 1HF8A 3LFMA 4O2AE 2CHOA 1IJ6A 1N32T 3KVAA 3FZKB 3FB2A 4X1YE 5JR9A 4I50E 5HWYA 3T8OA 2RPAA 5L4EA 4BA9A 2WU2A 5ABFB 5FXZA 4F8HA 2YKSA 4Q25A 5L3FB 4B3RT 3U3IA 1HS7A 1SHZC 4JI6T 4A97A 3N2OA 2VURA 4Z8XA 5EZYE 5C2TA 4AIUA 1WRDA 3HKBE 4HE8A 2M6BA 2E9XC 4IHJE 3ZYKA 3KVBA 2UUAT 2I59A 2Q9QA 5F3JA 5L3GB 4ILBA 3P4RA 2E5VA 2CBJA 3PUXF 3CQXC 5HWXA 1VCTA 5LA6E 2XQ6A 4NXMT 3EHZA 3OYZA 5DJQC 3ZC0A 3VU7H 2JQ9A 3F57A 1XNRT 2Y48B 5CFBA 2LEHA 4DR6T 2WQYA 4I0UA 1HNWT 1HNZT 2FUPA 3Q9DA 2LRLA 4H9PC 4YY3T 2CM0A 2LOSA 3GWHA 1YXRA 4IE5A 5E0OA 5FP3A 3UULA 1UK5A 1WFDA 4K0UA 2MTQA 2DCFA 2WDRA 3UUNA 2E9XD 2XQ8A 3ZN1B 2LHRA 4KBMB 2V7JA 3O4XE 2PTFA 2DHRA 2C5KT 3ZT6A 1UCUA 4U3CA 4PFOA 4HWFA 2UXNB 5JREA 3ANWB 3KV6A 2LOPA 2BG9A 5LHHB 1R8IA 2VVSA 4DBRA 2IC6A 5H6RB 4LF7T 4LFAT 5LYJE 3V5UA 3RYHE 1UGOA 5AQJB 2BVLA 5LOVE 3RKOA 5LGUB 4EEBA 3AEBA 3ZEFB 3L3PA 1XMOT 1HR0T 4C91A 1UX5A 2YDSA 3KBTA 3AVSA 5JRCB 4JUYA 3CVRA 3B57A 5AQUB 3UU6A 1KNRA 3PU3A 2K9AA 3E08A 3UUMA 4JI1T 4ZEYA 2OV9A 3OYXA 3WAKA 3T1HT 2CPTA 4DR2T 2CLYC 3ONJA 3SFEA 3SOLA 3RHWA 3B13A 3Q2MA 4IE4A 3RIUC 2YK0A 3IA3A 3ZT5A 1JNZA 5AQQB 3KV4A 1E1HB 4HWCA 4X1KE 4IE0A 2WWUA 3N9MA 2IAKA 2VQET 2CMRA 5JDGA 3ZYLA 3CX6B 4ANJA 3ZYMA 4QX8B 4HEAA 2X66A 2CE7A 4X1IE 2LE8A 3R84B 4K0KT 4EOZB 5L3DB 4V1Av 4QH5A 4ERRA 2I0MA 1DU2A 1VRBA 2XQ7A 3R6NA 3GN5B 3P4QA 4ZS2A 1N36T 5HXSA 2WWVA 3AA6B 5ABHA 3AE6A 4KMCA 3MZKB 2IMLA 3ZSSA 4PJNA 1WR6A 4JI7T 5LJMA 3FZLB 4PNIA 5HEUA 5AQVB 2XQ5A 4LF9T 2A2FX 3CMLA 4EZHA 4U2ZA 1FMVA 2V26A 1CUNA 4AKHA 3EABA 2LSIA 3LG7A 3V5SA 3KDSE 2ACZA 5CGMA 4GOUA 3AEAA 4G63A 4IIJE 2WZIA 3LK3B 4KI0F 4AI6A 2WZHA 4TV8E 3AA0B 2BS3A 2YU1A 3AVRA 3I9YA 2BKOA 1UX4A 3PU8A 4EZ4A 2NW9A 4UV9B 4ZI7E 4L5GA 2PJQA 4XAXB 5ABGA 2CWOA 1YD8G 2BDEA 3ZJ2A 3K8PC 3ZC1A 2LJLA 2FJBA 3P50A 1JNRA 2WP9A 2VKOA 3ESLA 1X79A 2YDRA 3NRYA 1ZKEA 4NIQA 5LG3A 3K3QC 3PUSA 2JIWA 4PJLA 4DO0A 2EHOA 3NKZA 2W61A 3MK7C 2XHEB 4DV4T 5IUXA 4UXNB 1D0YA 4CN6A 4KX6A 2V7IA 3RRCA 5FY7A 4KHPT 3N9NA 4CI2B 5CJ5A 1U4QA 1XDPA 4YT0A 2K48A 1IBMT 2V6YB 1MMNA 2WMOA 1OXZA 4PW8A 3AA7B 1IJ5A 4GYRA 2K24A 5BMVE 2UUBT 3AE7A 4IL4A 2H89A 4E7SA 2A9UA 1HCIA 1XZYA 2HH7A 3LSVA 1IBKT 2BS4A 2J4GA 2VQFT 4YTPA 2W66A 5FXVA 2NR4A 4UVBB 3L09A 3SS1A 3ZLIA 3TLUA 3KBUA 3BQIA 4TV9E 4DV1T 1J1JA 3NZPA 4HWIB 3RYIE 1LVKA 5JDHA 2WU5A 4YSZA 5FNVE 3CX7B 5J2UE 4DV2T 4YJ3E 2CCQA 3NRXA 1US7B 2E8IA 1M7KA 5LHIB 3UFGA 1IAPA 4DVDA 4UF0A 1KF6A 1Z8UA 4JI5T 2RA1A 4YSXA 3C64A 3UUBA 2UU9T 4M1PA 3CQGB 4DNDA 3P4PA 3UT5E 2CEAA 2N1GA 3FXDB 4UIGA 3DJBA 2MYSA 2VKDA 4P0AA 3AE8A 4QXHB 1BR1A 3HKEE 5HAXA 1T98A 2E9XB 2KWHA 2BBJA 1HTJF 3Q5DA 4JLEA 2V7KA 4A5XA 2XM2A 3SWHA 4JV5T 3MACA 4AKRB 5L3BB 2D0TA 5A1LA 1J5WA 1LRZA 2YN6A 3C50A 3RQUA 3OVUA 3AEDA 2DI4A 4G2AA 2UXXB 3UU8A 4EYYR 5FL0A 5EK2A 2X51A 2JQQA 4COFA 1QLBA 3M65A 2X67A 5LGTB 1YQ3A 4OHFA 2ZM8A 2KINB 4O4IE 5LMUT 3Q5WA 4H9OC 3ZMUB 3AXJB 3N9PA 5ABFA 3AAIA 1BR2A 1WCRA 5AQGB 4LFCT 3UU4A 5HXHA 2VASA 1MIVA 2QGSA 4NPPA 3W15B 2Y6XA 4ZZBA 3AAEB 5LGNB 5JR9C 2G0UA 4DUYT 4U2YA 4ILUA 2NW8A 4ISTA 2YU2A 4A98A 1YQ4A 3RIFA 3PURA 5F8PA 3PUAA 3JADA 3AB3B 5CA0E 1ZOYA 3LK42 4YJ2E 2XQAA 3PJAA 4QWNB 2VKHA 4OK0A 1UUSA 4GYSA 2DWKA 4AKIA 2IC9A 2NTYA 3CQCB 5HEGA 3HI2A 4X5TA 2Q9QC 3EDUA 3ZMTB 3MKDA 4HTEA 4I43B 4CXXA 3OTOT 4P1NA 5LHGB 4CI3B 2AXDS 1J5ET 4ZXLA 2BS2A 4QH1A 2M6IA 3AE9A 4OFZA 2UXCT 1ZEEA 2XAHB 2H7VC 5ADXL 3FHNA 5L3CB 1WYCA 4IREA 4AISA 4BJMA 2CLYB 1MNDA 2V1DB 3H37A 3PUVF 5AQOB 2VL0A 4KHZF 5AQRB 2CA5A 5FVLA 2FJDA 1WLXA 2LSJA 3HL6A 3ANWA 2WM9A 3QOFA 4KP3C 2Q9QD 3PDYA 1WR0A 4ZI2C 2V6XA 4WBNE 2MBGA 2A3DA 4TN7B 4YTMA 1T8BA 4O2BE 3RLFF 2I6HA 2BG9C 2OA5A 3FBLA 3AE2A 5JRCA 4MLKA 3AE5A 5AQSB 4JEUB 3JC6C 2CXFA 4NUVA 5FL1A 3GMIA 4Z90A 3CWZB 3JCFA 5DQWA 1B7TA 2Z6EA 2PBIA 2QYWA 3PTRB 3LBXB 3G06A 3I1AA 5AFUL 3I0OA 1X9BA 4AQYT 5FY1A 3VR8A 2L8KA 1ZP0A 4U7YA 3NVOA 2UUCT 1MMGA 4OYKA 2WBLA 4MBQA 3K3NA 1W9RA 2V7LA 4UR9A 2WMNA 4L0RA 4JBWF 4X64T 1VCSA 3TKLB 1HFAA 4YLHA 2JMKA 5F5WA 1D1AA 4AQGA 1MIYA 3PUGA 3RF1A 5FYMA 4HFCA 4ZI2D 1XNQT 4PK5A 2C5JA 2XUEA 4UVAB 5KXJA 2XJ7A 4TNVA 2DWGA 5LJNA 5HXEA 5EK4A 3GN5A 3IBPA 3JC6D 2KZ7B 3P4SA 4MALA 2GK9A 2X9HA 3TLSA 4IDZA 4O8SA 3UUXB 3TLVA 2W4XA 4DR4T 2J1DG 3UU5A 3T1YT 4P0BA 1I94T 4YSYA 3ETVA 1XDOA 3IF8B 3AEEA 1NAFA 3LDQB 3QNUA 1Y01A 3CIRA 2B1EA 2H3RA
chains in the Genus database with same CATH topology
4DR5T 4LFAT 2UUCT 5LMUT 1FJGT 4X65T 4NXNT 4LF8T 4JI3T 2UXBT 4YHHT 4JI8T 2F4VT 4NXMT 4DR7T 4X64T 1XMOT 1HR0T 4JI0T 4JI5T 4JI7T 4X66T 4DV4T 4LFCT 4GKJT 4LF4T 2UU9T 1XNRT 4DR3T 4KHPT 4DUZT 4LF9T 5IWAT 5LMNT 4DUYT 4JI1T 4DR6T 1XNQT 4DR1T 1HNWT 1HNZT 1IBLT 1XMQT 1IBMT 4GKKT 4DV7T 3T1HT 1N32T 2UXDT 4YY3T 4DV5T 4DR2T 2UUBT 4DV0T 4B3ST 1IBKT 2VQFT 1N34T 4OX9T 4B3RT 4JV5T 4LF5T 4JI6T 2HHHT 4JI4T 4DV3T 4B3TT 2E5LT 4B3MT 4JI2T 4JYAT 4DR4T 2VQET 3T1YT 4LF6T 1I94T 2ZM6T 5BR8T 4DV1T 4X62T 3OTOT 1J5ET 4K0KT 4LFBT 1HNXT 1N33T 2UUAT 4DV6T 2UXCT 4AQYT 1N36T 4DV2T 4LF7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 T;  4LFA T;  2UUC T;  5LMU T;  1FJG T;  4X65 T;  4NXN T;  4LF8 T;  4JI3 T;  2UXB T;  4YHH T;  4JI8 T;  2F4V T;  4NXM T;  4DR7 T;  4X64 T;  1XMO T;  1HR0 T;  4JI0 T;  4JI5 T;  4JI7 T;  4X66 T;  4DV4 T;  4LFC T;  4GKJ T;  4LF4 T;  2UU9 T;  1XNR T;  4DR3 T;  4KHP T;  4DUZ T;  4LF9 T;  5IWA T;  5LMN T;  4DUY T;  4JI1 T;  4DR6 T;  1XNQ T;  4DR1 T;  1HNW T;  1HNZ T;  1IBL T;  1XMQ T;  1IBM T;  4GKK T;  4DV7 T;  3T1H T;  1N32 T;  2UXD T;  4YY3 T;  4DV5 T;  4DR2 T;  2UUB T;  4DV0 T;  4B3S T;  1IBK T;  2VQF T;  1N34 T;  4OX9 T;  4B3R T;  4JV5 T;  4LF5 T;  4JI6 T;  2HHH T;  4JI4 T;  4DV3 T;  4B3T T;  2E5L T;  4B3M T;  4JI2 T;  4JYA T;  4DR4 T;  2VQE T;  3T1Y T;  4LF6 T;  1I94 T;  2ZM6 T;  5BR8 T;  4DV1 T;  4X62 T;  3OTO T;  1J5E T;  4K0K T;  4LFB T;  1HNX T;  1N33 T;  2UUA T;  4DV6 T;  2UXC T;  4AQY T;  1N36 T;  4DV2 T;  4LF7 T; 
#chains in the Genus database with same CATH topology
 4IE6 A;  2CWY A;  2D9D A;  4UEM A;  2IHR 1;  4U7I A;  1L0V A;  4AQF A;  1LVF A;  1O3X A;  2HPL A;  3Q5E A;  5AQP B;  1S94 A;  4PK4 A;  1E7P A;  2OLT A;  2KXP B;  4YTN A;  3QB5 A;  2XTL A;  2ZMA A;  2CHN A;  1OED B;  4DV7 T;  1Z0P A;  4TWD A;  3UQ4 A;  2ZM0 A;  3N9L A;  1YKH B;  3UTK A;  1IZN B;  2X9W A;  3NWI A;  5TAO A;  2JQK A;  3AEC A;  3RGL A;  2VK9 A;  4DV0 T;  5JVD E;  5JDN A;  4ZZC A;  3ZST A;  4N78 D;  3EI0 A;  3HKD E;  2HPJ A;  3I0Q A;  3P8C D;  3TLT A;  3IEE A;  2ES0 A;  2CRB A;  2VKJ A;  3RQW A;  4WZX A;  4ZOL E;  2H7O A;  3RRW A;  2LSY A;  2JRK A;  3O1J A;  3X1D A;  4WBO A;  4GK0 E;  5HCJ A;  2C0S A;  2A72 A;  3EDV A;  2XQY A;  3RH3 A;  4CN1 A;  4DBQ A;  2EHO C;  2V6Y A;  3C98 B;  5CB4 E;  2X9X A;  5JDM A;  1N33 T;  3CK6 A;  1OED C;  4MHC A;  2YDQ A;  2X0L B;  1KNP A;  2D0U A;  3J7Y q;  4HFE A;  4HFB A;  2VB6 A;  1W0A A;  2PG8 A;  2HN2 A;  3BQK A;  2WAU A;  2NTX A;  1T7S A;  3N9O A;  4YHH T;  4JI8 T;  1MIW A;  4ADZ A;  2BG9 E;  4LML A;  4O4H E;  2V5D A;  4UEL A;  2PFV A;  4DUZ T;  3NBX X;  3U78 A;  5LMN T;  3VHL A;  5ETW A;  3RC3 A;  5IYZ E;  2IUB A;  2ODU A;  5HEJ A;  2DLR A;  4XBF B;  2KWI B;  2W2U A;  2XAQ B;  4TNW A;  1ZHC A;  3HA4 A;  2Y8D A;  2XM1 A;  4P09 A;  4TWF A;  3ZT7 A;  3QUJ A;  2QA7 A;  2P9B A;  2FJA A;  3AE4 A;  2LSG A;  2EHO D;  2N2N A;  5LXT E;  1MMD A;  2WSS V;  2N9D A;  3AAA B;  2W00 A;  3AE3 A;  3ETU A;  4LF6 T;  4HFD A;  2ZM6 T;  5LG4 A;  4J2C A;  5BR8 T;  3RI5 A;  2XPK A;  1FEW A;  4NUU A;  1FMW A;  3QK6 A;  5JR9 B;  2XQ4 A;  3PV0 F;  1MNE A;  4I4T E;  2X68 A;  3N2K E;  3F31 A;  4H63 V;  4UVC B;  4HWD A;  2X0Y A;  3ZJ1 A;  3N9Q A;  2E9X A;  3RX6 A;  4LF8 T;  4PK6 A;  3AA1 B;  2FBW A;  4U31 A;  3F2E A;  3KFW X;  5AQK B;  4O4J E;  1AJ3 A;  4EV6 A;  3ZCI A;  1WYB A;  3KV9 A;  3I9W A;  3KIN B;  2LM9 A;  2XZE A;  3RPU A;  3ZMZ B;  3IHR A;  4ILC A;  1XWM A;  4GKK T;  2BVM A;  4X20 E;  2Q9Q B;  5HXC A;  3FZM B;  5JH7 E;  3RKG A;  3PUZ F;  5DQV A;  1SA0 E;  4KUM B;  4EYU A;  3L39 A;  4LMJ A;  3M3Z B;  4ILA A;  3ONL C;  3FBZ A;  4AKL A;  3AXJ A;  3HR0 A;  3C4X A;  4JI4 T;  4DV3 T;  3FZF B;  3UFE A;  1CHU A;  2YIN A;  2K3W A;  2LKH A;  4H9Q C;  3ZN0 B;  5FMN A;  2R6G F;  4BJN A;  2JMH A;  4CZZ B;  3DTO A;  4LFB T;  1HNX T;  2X0H A;  3UQ7 A;  1HG5 A;  4DR5 T;  1SUM B;  3OPC A;  4FJO A;  2DNX A;  2CBI A;  3MJX A;  4H9R C;  4QKN A;  2F4V T;  5FY0 A;  4QH4 A;  4JI0 T;  3N2G E;  3H3M A;  5HCM A;  3SRZ A;  4B6X A;  4H9N C;  4GKJ T;  4LF4 T;  4FI5 A;  1I6Z A;  2CXD A;  3AE1 A;  3L8R A;  2YEV C;  2ACX A;  2IIU A;  3P7I A;  1EZ3 A;  3RIA A;  1D1C A;  5EK3 A;  5FXW A;  2BG9 B;  5M4Y A;  3S4U A;  5HEO A;  2UXD T;  1OED E;  1HX8 A;  4ISS A;  1KK7 A;  4HKA A;  1YKE B;  3K3O A;  1M62 A;  2XAG B;  2LLY A;  3C4W A;  5GON E;  2XAS B;  1N34 T;  5FKY A;  1NEN A;  4PAG A;  1ZV4 X;  2WS3 A;  2XAJ B;  3JAF A;  3PUW F;  2HHH T;  3LK2 B;  4TUY E;  4GK5 E;  4B3M T;  4WYV A;  2KSR A;  4PJM A;  1KEY A;  4A56 A;  1MMA A;  5IHY A;  4HFH A;  3RIU A;  5J0Z A;  4X62 T;  2V8S V;  3ZMS B;  4E7Z A;  1NWM X;  3O1H A;  4YXD A;  3O9X A;  3A5X A;  2JPF A;  4YFS A;  2CXL A;  1HG2 A;  3HKC E;  5AQI B;  2XSB A;  4AXP A;  4H9S E;  3PJA J;  3TLW A;  5AQT B;  3Q5X A;  2AE9 A;  4GIW A;  5L2L A;  1W09 A;  2LKG A;  2IW5 B;  5AQF B;  1SE7 A;  3PUY F;  3RYC E;  4HN9 A;  5C8Y E;  2XY8 B;  3BQL A;  1UUR A;  2X9Y A;  1BR4 A;  3CKD A;  3K1S A;  2WDQ A;  5C3J A;  1H7C A;  1IBL T;  2WY2 A;  3EAM A;  1W0B A;  2NOX A;  3LBX A;  5J2T E;  3D0T A;  3WAJ A;  5L3E B;  4IGU A;  2W62 A;  3A8Y C;  5L4H A;  4OX9 T;  3AEF A;  4LF5 T;  4H63 H;  5J1G A;  2D2S A;  2MOZ A;  4B3T T;  2V7M A;  4CI1 B;  2BZB A;  4JI2 T;  3CPZ A;  4MFR A;  1FIO A;  4HFI A;  2XAF B;  2WCA A;  3P4W A;  3SFD A;  3E22 E;  4DID B;  4EAH A;  2FJE A;  2M67 A;  4ZS3 A;  4EB6 E;  3GA8 A;  3A7M A;  2D5U A;  3VKH A;  4U33 A;  2W0G A;  4YHJ A;  1QUU A;  1U5P A;  2YOE A;  1D1B A;  4NXN T;  1BR0 A;  4XZC A;  3QC9 A;  5JDL A;  1S35 A;  1NEK A;  4DR7 T;  4EIW A;  4WNK A;  2J47 A;  3EUH A;  4IDQ A;  4DR1 T;  5KX5 E;  5FXX A;  3VRB A;  2K5B B;  4HWH A;  3KV5 A;  3CX8 B;  1XMQ T;  2NWB A;  4CQI A;  2KMF A;  4IDN A;  4JEH B;  1T72 A;  2W63 A;  3MA9 A;  3H3A A;  4CXY A;  4TWH A;  5H6Q B;  5ABE A;  3C4Z A;  2BKP A;  2LHN A;  1OWA A;  3VRA A;  3PUQ A;  4ZI3 C;  4B3S T;  5HXR A;  3E0Z A;  3NZQ A;  4BAY B;  5JDQ A;  2EHO B;  4LMK A;  4O4L E;  3FZH B;  5JQG E;  4Z91 A;  4QHO A;  4ASK A;  3QB5 K;  4AKG A;  3FXE B;  5LNK A;  3OKQ A;  3LJC A;  2LT3 A;  2KLQ A;  4F6R C;  2V5C A;  4L9I A;  4IT4 A;  3B5M A;  1G73 A;  3OJA A;  2QVA A;  1OED A;  4IE7 A;  4IL9 A;  5JTG A;  1Y64 B;  4DMV A;  4IDP A;  4DMW A;  2J62 A;  4AQF C;  4DV6 T;  2BKN A;  2DL1 A;  3JAE A;  2ODV A;  3DP7 A;  1KNZ A;  5AQN B;  2QRX A;  1G8X A;  2E2A A;  4EXT A;  1D0X A;  1YW0 A;  3ZKR A;  1FJG T;  5CA1 E;  4HGA A;  2SPC A;  3C51 A;  4U72 A;  2UXB T;  2VL8 A;  5KDM C;  2KND A;  4X66 T;  2IDO B;  3RYF E;  3MXZ A;  1GQE A;  2C5I T;  1V9D A;  3O1I A;  2ZM2 A;  2XQ3 A;  4U74 A;  2H88 A;  2NP9 A;  4ZI3 D;  2WB5 A;  4HFV A;  4OYJ A;  5LP6 E;  3UU3 A;  1D0Z A;  2W67 A;  4UV8 B;  2MAW A;  2ZLY A;  4DV5 T;  2WDV A;  1VOM A;  5DAB A;  3ZCJ A;  1QSD A;  2JQH A;  4IDO A;  2VWA A;  3AEG A;  4QXC B;  2RP4 A;  4PFP A;  3VR9 A;  3WI3 A;  2MPK A;  4UF0 B;  4CN4 A;  2JJ9 A;  2L9Q A;  3EVY A;  4I55 E;  2NW7 A;  2BBH A;  4QXB B;  5AQL B;  2E5L T;  3N5L A;  1HX1 B;  5LBQ B;  3RC8 A;  1E2A A;  4JYA T;  5HEH A;  3ZPO A;  4TX5 A;  2KT9 A;  5AQM B;  1KFY A;  2HN1 A;  4EED A;  5L47 A;  3ZMV B;  4QX7 B;  4CXW A;  4EGW A;  1LKX A;  4TZ4 C;  5AQH B;  3J9X 1;  4WW0 A;  3ONX A;  4PJJ A;  3PE0 A;  2LM2 A;  2VVN A;  3ABV A;  5LCY A;  4X65 T;  3BK9 A;  4JI3 T;  5JDF A;  4ZHQ E;  5HYA A;  2LRK A;  2XSA A;  5KMG P;  5LB7 B;  5FVK A;  2L3L A;  3OBV E;  4C90 A;  4DR3 T;  2XQ9 A;  5LBM A;  5IWA T;  3VKG A;  2LSK A;  2B76 A;  1HF8 A;  3LFM A;  4O2A E;  2CHO A;  1IJ6 A;  1N32 T;  3KVA A;  3FZK B;  3FB2 A;  4X1Y E;  5JR9 A;  4I50 E;  5HWY A;  3T8O A;  2RPA A;  5L4E A;  4BA9 A;  2WU2 A;  5ABF B;  5FXZ A;  4F8H A;  2YKS A;  4Q25 A;  5L3F B;  4B3R T;  3U3I A;  1HS7 A;  1SHZ C;  4JI6 T;  4A97 A;  3N2O A;  2VUR A;  4Z8X A;  5EZY E;  5C2T A;  4AIU A;  1WRD A;  3HKB E;  4HE8 A;  2M6B A;  2E9X C;  4IHJ E;  3ZYK A;  3KVB A;  2UUA T;  2I59 A;  2Q9Q A;  5F3J A;  5L3G B;  4ILB A;  3P4R A;  2E5V A;  2CBJ A;  3PUX F;  3CQX C;  5HWX A;  1VCT A;  5LA6 E;  2XQ6 A;  4NXM T;  3EHZ A;  3OYZ A;  5DJQ C;  3ZC0 A;  3VU7 H;  2JQ9 A;  3F57 A;  1XNR T;  2Y48 B;  5CFB A;  2LEH A;  4DR6 T;  2WQY A;  4I0U A;  1HNW T;  1HNZ T;  2FUP A;  3Q9D A;  2LRL A;  4H9P C;  4YY3 T;  2CM0 A;  2LOS A;  3GWH A;  1YXR A;  4IE5 A;  5E0O A;  5FP3 A;  3UUL A;  1UK5 A;  1WFD A;  4K0U A;  2MTQ A;  2DCF A;  2WDR A;  3UUN A;  2E9X D;  2XQ8 A;  3ZN1 B;  2LHR A;  4KBM B;  2V7J A;  3O4X E;  2PTF A;  2DHR A;  2C5K T;  3ZT6 A;  1UCU A;  4U3C A;  4PFO A;  4HWF A;  2UXN B;  5JRE A;  3ANW B;  3KV6 A;  2LOP A;  2BG9 A;  5LHH B;  1R8I A;  2VVS A;  4DBR A;  2IC6 A;  5H6R B;  4LF7 T;  4LFA T;  5LYJ E;  3V5U A;  3RYH E;  1UGO A;  5AQJ B;  2BVL A;  5LOV E;  3RKO A;  5LGU B;  4EEB A;  3AEB A;  3ZEF B;  3L3P A;  1XMO T;  1HR0 T;  4C91 A;  1UX5 A;  2YDS A;  3KBT A;  3AVS A;  5JRC B;  4JUY A;  3CVR A;  3B57 A;  5AQU B;  3UU6 A;  1KNR A;  3PU3 A;  2K9A A;  3E08 A;  3UUM A;  4JI1 T;  4ZEY A;  2OV9 A;  3OYX A;  3WAK A;  3T1H T;  2CPT A;  4DR2 T;  2CLY C;  3ONJ A;  3SFE A;  3SOL A;  3RHW A;  3B13 A;  3Q2M A;  4IE4 A;  3RIU C;  2YK0 A;  3IA3 A;  3ZT5 A;  1JNZ A;  5AQQ B;  3KV4 A;  1E1H B;  4HWC A;  4X1K E;  4IE0 A;  2WWU A;  3N9M A;  2IAK A;  2VQE T;  2CMR A;  5JDG A;  3ZYL A;  3CX6 B;  4ANJ A;  3ZYM A;  4QX8 B;  4HEA A;  2X66 A;  2CE7 A;  4X1I E;  2LE8 A;  3R84 B;  4K0K T;  4EOZ B;  5L3D B;  4V1A v;  4QH5 A;  4ERR A;  2I0M A;  1DU2 A;  1VRB A;  2XQ7 A;  3R6N A;  3GN5 B;  3P4Q A;  4ZS2 A;  1N36 T;  5HXS A;  2WWV A;  3AA6 B;  5ABH A;  3AE6 A;  4KMC A;  3MZK B;  2IML A;  3ZSS A;  4PJN A;  1WR6 A;  4JI7 T;  5LJM A;  3FZL B;  4PNI A;  5HEU A;  5AQV B;  2XQ5 A;  4LF9 T;  2A2F X;  3CML A;  4EZH A;  4U2Z A;  1FMV A;  2V26 A;  1CUN A;  4AKH A;  3EAB A;  2LSI A;  3LG7 A;  3V5S A;  3KDS E;  2ACZ A;  5CGM A;  4GOU A;  3AEA A;  4G63 A;  4IIJ E;  2WZI A;  3LK3 B;  4KI0 F;  4AI6 A;  2WZH A;  4TV8 E;  3AA0 B;  2BS3 A;  2YU1 A;  3AVR A;  3I9Y A;  2BKO A;  1UX4 A;  3PU8 A;  4EZ4 A;  2NW9 A;  4UV9 B;  4ZI7 E;  4L5G A;  2PJQ A;  4XAX B;  5ABG A;  2CWO A;  1YD8 G;  2BDE A;  3ZJ2 A;  3K8P C;  3ZC1 A;  2LJL A;  2FJB A;  3P50 A;  1JNR A;  2WP9 A;  2VKO A;  3ESL A;  1X79 A;  2YDR A;  3NRY A;  1ZKE A;  4NIQ A;  5LG3 A;  3K3Q C;  3PUS A;  2JIW A;  4PJL A;  4DO0 A;  2EHO A;  3NKZ A;  2W61 A;  3MK7 C;  2XHE B;  4DV4 T;  5IUX A;  4UXN B;  1D0Y A;  4CN6 A;  4KX6 A;  2V7I A;  3RRC A;  5FY7 A;  4KHP T;  3N9N A;  4CI2 B;  5CJ5 A;  1U4Q A;  1XDP A;  4YT0 A;  2K48 A;  1IBM T;  2V6Y B;  1MMN A;  2WMO A;  1OXZ A;  4PW8 A;  3AA7 B;  1IJ5 A;  4GYR A;  2K24 A;  5BMV E;  2UUB T;  3AE7 A;  4IL4 A;  2H89 A;  4E7S A;  2A9U A;  1HCI A;  1XZY A;  2HH7 A;  3LSV A;  1IBK T;  2BS4 A;  2J4G A;  2VQF T;  4YTP A;  2W66 A;  5FXV A;  2NR4 A;  4UVB B;  3L09 A;  3SS1 A;  3ZLI A;  3TLU A;  3KBU A;  3BQI A;  4TV9 E;  4DV1 T;  1J1J A;  3NZP A;  4HWI B;  3RYI E;  1LVK A;  5JDH A;  2WU5 A;  4YSZ A;  5FNV E;  3CX7 B;  5J2U E;  4DV2 T;  4YJ3 E;  2CCQ A;  3NRX A;  1US7 B;  2E8I A;  1M7K A;  5LHI B;  3UFG A;  1IAP A;  4DVD A;  4UF0 A;  1KF6 A;  1Z8U A;  4JI5 T;  2RA1 A;  4YSX A;  3C64 A;  3UUB A;  2UU9 T;  4M1P A;  3CQG B;  4DND A;  3P4P A;  3UT5 E;  2CEA A;  2N1G A;  3FXD B;  4UIG A;  3DJB A;  2MYS A;  2VKD A;  4P0A A;  3AE8 A;  4QXH B;  1BR1 A;  3HKE E;  5HAX A;  1T98 A;  2E9X B;  2KWH A;  2BBJ A;  1HTJ F;  3Q5D A;  4JLE A;  2V7K A;  4A5X A;  2XM2 A;  3SWH A;  4JV5 T;  3MAC A;  4AKR B;  5L3B B;  2D0T A;  5A1L A;  1J5W A;  1LRZ A;  2YN6 A;  3C50 A;  3RQU A;  3OVU A;  3AED A;  2DI4 A;  4G2A A;  2UXX B;  3UU8 A;  4EYY R;  5FL0 A;  5EK2 A;  2X51 A;  2JQQ A;  4COF A;  1QLB A;  3M65 A;  2X67 A;  5LGT B;  1YQ3 A;  4OHF A;  2ZM8 A;  2KIN B;  4O4I E;  5LMU T;  3Q5W A;  4H9O C;  3ZMU B;  3AXJ B;  3N9P A;  5ABF A;  3AAI A;  1BR2 A;  1WCR A;  5AQG B;  4LFC T;  3UU4 A;  5HXH A;  2VAS A;  1MIV A;  2QGS A;  4NPP A;  3W15 B;  2Y6X A;  4ZZB A;  3AAE B;  5LGN B;  5JR9 C;  2G0U A;  4DUY T;  4U2Y A;  4ILU A;  2NW8 A;  4IST A;  2YU2 A;  4A98 A;  1YQ4 A;  3RIF A;  3PUR A;  5F8P A;  3PUA A;  3JAD A;  3AB3 B;  5CA0 E;  1ZOY A;  3LK4 2;  4YJ2 E;  2XQA A;  3PJA A;  4QWN B;  2VKH A;  4OK0 A;  1UUS A;  4GYS A;  2DWK A;  4AKI A;  2IC9 A;  2NTY A;  3CQC B;  5HEG A;  3HI2 A;  4X5T A;  2Q9Q C;  3EDU A;  3ZMT B;  3MKD A;  4HTE A;  4I43 B;  4CXX A;  3OTO T;  4P1N A;  5LHG B;  4CI3 B;  2AXD S;  1J5E T;  4ZXL A;  2BS2 A;  4QH1 A;  2M6I A;  3AE9 A;  4OFZ A;  2UXC T;  1ZEE A;  2XAH B;  2H7V C;  5ADX L;  3FHN A;  5L3C B;  1WYC A;  4IRE A;  4AIS A;  4BJM A;  2CLY B;  1MND A;  2V1D B;  3H37 A;  3PUV F;  5AQO B;  2VL0 A;  4KHZ F;  5AQR B;  2CA5 A;  5FVL A;  2FJD A;  1WLX A;  2LSJ A;  3HL6 A;  3ANW A;  2WM9 A;  3QOF A;  4KP3 C;  2Q9Q D;  3PDY A;  1WR0 A;  4ZI2 C;  2V6X A;  4WBN E;  2MBG A;  2A3D A;  4TN7 B;  4YTM A;  1T8B A;  4O2B E;  3RLF F;  2I6H A;  2BG9 C;  2OA5 A;  3FBL A;  3AE2 A;  5JRC A;  4MLK A;  3AE5 A;  5AQS B;  4JEU B;  3JC6 C;  2CXF A;  4NUV A;  5FL1 A;  3GMI A;  4Z90 A;  3CWZ B;  3JCF A;  5DQW A;  1B7T A;  2Z6E A;  2PBI A;  2QYW A;  3PTR B;  3LBX B;  3G06 A;  3I1A A;  5AFU L;  3I0O A;  1X9B A;  4AQY T;  5FY1 A;  3VR8 A;  2L8K A;  1ZP0 A;  4U7Y A;  3NVO A;  2UUC T;  1MMG A;  4OYK A;  2WBL A;  4MBQ A;  3K3N A;  1W9R A;  2V7L A;  4UR9 A;  2WMN A;  4L0R A;  4JBW F;  4X64 T;  1VCS A;  3TKL B;  1HFA A;  4YLH A;  2JMK A;  5F5W A;  1D1A A;  4AQG A;  1MIY A;  3PUG A;  3RF1 A;  5FYM A;  4HFC A;  4ZI2 D;  1XNQ T;  4PK5 A;  2C5J A;  2XUE A;  4UVA B;  5KXJ A;  2XJ7 A;  4TNV A;  2DWG A;  5LJN A;  5HXE A;  5EK4 A;  3GN5 A;  3IBP A;  3JC6 D;  2KZ7 B;  3P4S A;  4MAL A;  2GK9 A;  2X9H A;  3TLS A;  4IDZ A;  4O8S A;  3UUX B;  3TLV A;  2W4X A;  4DR4 T;  2J1D G;  3UU5 A;  3T1Y T;  4P0B A;  1I94 T;  4YSY A;  3ETV A;  1XDO A;  3IF8 B;  3AEE A;  1NAF A;  3LDQ B;  3QNU A;  1Y01 A;  3CIR A;  2B1E A;  2H3R A; 
#chains in the Genus database with same CATH homology
 4DR5 T;  4LFA T;  2UUC T;  5LMU T;  1FJG T;  4X65 T;  4NXN T;  4LF8 T;  4JI3 T;  2UXB T;  4YHH T;  4JI8 T;  2F4V T;  4NXM T;  4DR7 T;  4X64 T;  1XMO T;  1HR0 T;  4JI0 T;  4JI5 T;  4JI7 T;  4X66 T;  4DV4 T;  4LFC T;  4GKJ T;  4LF4 T;  2UU9 T;  1XNR T;  4DR3 T;  4KHP T;  4DUZ T;  4LF9 T;  5IWA T;  5LMN T;  4DUY T;  4JI1 T;  4DR6 T;  1XNQ T;  4DR1 T;  1HNW T;  1HNZ T;  1IBL T;  1XMQ T;  1IBM T;  4GKK T;  4DV7 T;  3T1H T;  1N32 T;  2UXD T;  4YY3 T;  4DV5 T;  4DR2 T;  2UUB T;  4DV0 T;  4B3S T;  1IBK T;  2VQF T;  1N34 T;  4OX9 T;  4B3R T;  4JV5 T;  4LF5 T;  4JI6 T;  2HHH T;  4JI4 T;  4DV3 T;  4B3T T;  2E5L T;  4B3M T;  4JI2 T;  4JYA T;  4DR4 T;  2VQE T;  3T1Y T;  4LF6 T;  1I94 T;  2ZM6 T;  5BR8 T;  4DV1 T;  4X62 T;  3OTO T;  1J5E T;  4K0K T;  4LFB T;  1HNX T;  1N33 T;  2UUA T;  4DV6 T;  2UXC T;  4AQY T;  1N36 T;  4DV2 T;  4LF7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...