4DV0T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv0T00
4JI1T 4LF9T 4DR3T 1HNXT 4DR7T 4GKJT 1N32T 4DV0T 4X64T 5BR8T 1N34T 4DR6T 2UU9T 1IBKT 4B3ST 4LF7T 4DR5T 4DV2T 4JI5T 2HHHT 4DV4T 2UXDT 4LF6T 1XNRT 4DR2T 2F4VT 3T1YT 4KHPT 5LMUT 2UUAT 4OX9T 1I94T 4DV5T 4LFAT 4X62T 4X66T 4DR4T 3OTOT 5IWAT 2E5LT 4JV5T 4YY3T 1HNZT 4JI3T 4JYAT 4B3MT 1XMQT 4DR1T 1N33T 4JI6T 1XMOT 2UUCT 2UXBT 1IBLT 4LFCT 4JI0T 4JI7T 4X65T 1J5ET 4B3TT 2VQFT 2UUBT 1HNWT 4GKKT 4K0KT 4JI2T 4B3RT 4DV6T 1XNQT 4YHHT 2UXCT 1FJGT 4NXNT 4LF5T 4DUYT 4JI4T 4LF4T 1N36T 4DUZT 2ZM6T 4DV3T 4DV1T 4DV7T 1HR0T 4LF8T 2VQET 5LMNT 3T1HT 4JI8T 4LFBT 4AQYT 4NXMT 1IBMT
chains in the Genus database with same CATH superfamily
5BMVE 1UURA 2NWBA 3WAJA 4I0UA 4KX6A 1FIOA 4IDNA 4OK0A 4GOUA 2P9BA 2XSBA 5L4EA 4L5GA 2JMHA 4ERRA 1W0BA 2X9HA 3SWHA 5J2UE 2D0TA 4DV5T 4OX9T 3UQ4A 2I6HA 4A5XA 3JC6C 5IWAT 2XZEA 2PFVA 1HNZT 4JI3T 4EXTA 1WRDA 2LSJA 2UXBT 3RKOA 4CZZB 4TV9E 1Y64B 3ETVA 4PJLA 2VWAA 4O8SA 4U3CA 5CA1E 2N2NA 3P4SA 4OYJA 3N9OA 5FY0A 4DV6T 4QKNA 4CN4A 5AQHB 1ZEEA 5JDHA 4B6XA 3RC3A 1OEDB 1S94A 2LSGA 3AE4A 4TZ4C 3CMLA 5HAXA 4KBMB 3O9XA 3AAEB 2EHOC 4O4HE 3PUYF 4ZHQE 1BR2A 5HEHA 3QC9A 4IE6A 4MHCA 3HKEE 3AXJA 4DR7T 3ZN1B 5JVDE 2XAHB 3NZPA 2NW8A 5JDNA 4ADZA 4EEDA 4ZI2D 5AQIB 5KX5E 3R84B 4IDPA 3MXZA 2F4VT 4J2CA 2CCQA 2M67A 5L4HA 5HXSA 3NWIA 4YXDA 3UU4A 4HFDA 2VKJA 3MKDA 4WZXA 4JEUB 3C50A 1UCUA 4X65T 3V5SA 3ZMZB 2XQ4A 5TAOA 4IHJE 4K0KT 3GA8A 2YU2A 2UXCT 4WNKA 3VRBA 3RYIE 1ZV4X 5JR9A 1LVFA 3AA0B 1JNZA 1HFAA 4HWCA 2V1DB 3UU8A 4LF4T 4KHZF 5F3JA 2Z6EA 3EABA 2YINA 3HKCE 5FY7A 5KDMC 4LF8T 1U5PA 2BS3A 5M4YA 2A2FX 4H9PC 4AQYT 2KSRA 2XUEA 2JJ9A 3LBXB 3FXDB 3PUQA 2N9DA 2WMOA 2LOSA 3K1SA 1W09A 2C0SA 2H89A 5AQOB 2KZ7B 1D1BA 4QXCB 2QYWA 4DR2T 3EI0A 2W66A 3GWHA 2LSKA 4U7YA 2XQ8A 4YT0A 4IGUA 4X1IE 4U72A 3H3MA 2DI4A 1ZKEA 4WW0A 2H88A 4C91A 5JR9C 4EB6E 2QA7A 2J62A 4ILCA 2LKHA 2WQYA 4CXXA 2D0UA 2YDQA 4WYVA 1T8BA 4HFIA 3AAIA 3ZMVB 4UV8B 2MTQA 2C5KT 2WAUA 2ODVA 3CQGB 2V6YB 2CA5A 4BJMA 3KDSE 3RIUA 5FY1A 2E9XB 2DCFA 4UVCB 4FI5A 1FJGT 1D0ZA 5DQWA 1Z0PA 3ZC1A 3EUHA 4AI6A 2KXPB 4DUZT 3N9NA 3ZJ1A 3P7IA 4DV1T 3CQXC 4DMWA 3JAEA 4PK6A 3IF8B 4QX7B 3FZLB 4TX5A 3HR0A 2BG9A 3AE2A 5LB7B 4QH5A 3I0QA 2JPFA 3MA9A 4JI1T 2WDRA 2I0MA 3RI5A 4DR3T 4DIDB 2WZIA 1N34T 1M7KA 3U78A 3TLTA 2VVSA 4U2YA 2UXDT 2D2SA 2LEHA 2C5JA 1OXZA 5AQGB 5LBQB 2X9XA 2MBGA 4UIGA 1T98A 2XTLA 3CX7B 5J0ZA 3RIUC 3OVUA 2BKNA 3UT5E 1XMOT 4LFCT 2IAKA 2IC9A 4TWDA 4PK5A 2G0UA 2QGSA 3NVOA 2UUBT 3OBVE 2FJDA 2YDRA 4NUUA 4U7IA 4HWDA 2JQHA 5AQUB 3KFWX 2BDEA 1NEKA 1DU2A 4PW8A 4NUVA 4EGWA 3J7Yq 5HXRA 3AA6B 1GQEA 4PJMA 5CB4E 2VQET 1T72A 5ABFA 5LG4A 2X9YA 2ZLYA 2VVNA 4OYKA 3ONXA 5L3BB 3AVRA 3P8CD 1UK5A 1MIVA 5KMGP 5LHIB 4B3ST 1X79A 3PUSA 5FXWA 1LVKA 5C8YE 4PK4A 2IDOB 3A5XA 4A56A 5LMUT 4HWHA 3ZMTB 2VK9A 4IL4A 3OTOT 5LGTB 1L0VA 1IJ5A 3ZPOA 2X0YA 3Q2MA 2IUBA 1I6ZA 2V7JA 2HH7A 2V5CA 4LMKA 4YTMA 4LMLA 1HX8A 5JDLA 5CGMA 4IE7A 5HYAA 5LJMA 4PAGA 4GYRA 3SOLA 3ZJ2A 3JC6D 5HCMA 1V9DA 2WMNA 2VB6A 2KT9A 2FJBA 2XQ5A 2KLQA 4F6RC 2LT3A 4YHHT 3FZKB 2J4GA 2XM2A 5AQNB 2XQ7A 1B7TA 3LK2B 4CI2B 2CMRA 3KINB 5FXVA 3NKZA 1CHUA 4HTEA 3AE7A 3MK7C 4O4IE 2YN6A 4COFA 2NTXA 5HEOA 5LNKA 4LFBT 2DL1A 3EAMA 3W15B 3GMIA 3PU8A 3AXJB 3ZN0B 1CUNA 3UTKA 2JMKA 5BR8T 2LLYA 3QOFA 4CN6A 2CHNA 3JAFA 2EHOD 3N9MA 3N2KE 4UR9A 5GONE 3CVRA 5H6QB 1WR0A 4PJNA 4LFAT 4A98A 1UX5A 3JADA 4DR4T 5C2TA 1FMWA 1U4QA 1IAPA 1D1AA 3CQCB 3RHWA 2HN2A 5LGNB 2EHOA 3PJAJ 2UUCT 3Q5EA 5LHHB 1MMGA 4EZHA 5DJQC 4JI7T 2W63A 3RYHE 1EZ3A 5AQSB 2WDVA 4AQFA 5L47A 1YW0A 4YSXA 1SUMB 2XM1A 3VKGA 2LM9A 4HGAA 1HS7A 1UGOA 5HXEA 4DUYT 3E08A 3GN5A 5AQLB 4CXYA 4PJJA 3T8OA 4H9RC 4X1YE 2W67A 3O1IA 3I1AA 3PUXF 2FBWA 4E7ZA 3SRZA 4NIQA 1IZNB 1BR4A 5FYMA 1SA0E 2OA5A 2CHOA 4U31A 3PUZF 2W62A 3C4ZA 4JI5T 2C5IT 5JDGA 4IT4A 2ACXA 2XQ9A 1US7B 1HG2A 5AQQB 2M6IA 3A8YC 5FNVE 3I9WA 1MNDA 3AE5A 1HG5A 3PDYA 2WS3A 4YJ3E 4AQFC 1WLXA 3QK6A 3RRCA 4PFPA 3RF1A 3VKHA 2BKPA 2W0GA 5AFUL 2X66A 3PTRB 2LKGA 3RYCE 2LSYA 2WCAA 1HTJF 2D9DA 4HFVA 4JI2T 4MLKA 3UQ7A 2Q9QC 1O3XA 4JUYA 3TLWA 3N2GE 4WBOA 4I50E 3ZT5A 2X0HA 3ZT6A 5AQFB 5L3CB 3UUBA 4EYUA 2JQQA 4ZS2A 3L3PA 2K48A 1MMNA 4C90A 5LMNT 2WZHA 5HCJA 2BG9B 2D5UA 3SS1A 3I9YA 3ZYKA 2CXLA 4NXMT 4EOZB 1N32T 4DR6T 3AAAB 3CPZA 3IBPA 2H7VC 2LHRA 5AQJB 5ADXL 1HCIA 3J9X1 4AKRB 3R6NA 3VU7H 3OKQA 5CJ5A 3OYXA 3C64A 2V6XA 1NWMX 1XMQT 2BBJA 3BK9A 3F2EA 4HFEA 4O2BE 3DP7A 5CA0E 2PJQA 4JI0T 4DO0A 2XSAA 5L3GB 2CXDA 2XQ6A 3ZSSA 2LRKA 2MOZA 4DNDA 4I4TE 4H9OC 5LGUB 4UVAB 4P0AA 4MBQA 1D1CA 1W0AA 3RQUA 1LKXA 2LSIA 1S35A 4ZXLA 3P4RA 1KNZA 2K5BB 2JQ9A 5FKYA 2ACZA 4UELA 4IDQA 4N78D 4HE8A 2WSSV 1Z8UA 2AE9A 2CWYA 2B1EA 3T1YT 2NOXA 5FP3A 4ILUA 4EV6A 2VKDA 2X67A 4CQIA 4E7SA 2YKSA 3AEGA 4DV0T 4EAHA 3ZMSB 4OHFA 3VR8A 2X51A 4I55E 3CKDA 5ETWA 4EYYR 5J2TE 3G06A 2E8IA 1OEDC 5HWXA 4QXBB 4U33A 2V7MA 3L8RA 2HN1A 4UVBB 5LXTE 3I0OA 4YJ2E 3WI3A 3RGLA 2WU5A 3N2OA 1LRZA 3RIAA 2IMLA 2Y8DA 4OFZA 4HWFA 2OLTA 1MIWA 1QUUA 2LE8A 5L3DB 4QH1A 2ES0A 3VHLA 5ABHA 3Q5WA 5IHYA 3L39A 2A3DA 5DABA 3N9PA 5FVLA 2CBJA 3OJAA 4I43B 4Z8XA 3UU5A 3C51A 2XAGB 3QB5A 1BR1A 4G2AA 5JRCB 3VRAA 4DV7T 2KWIB 4EZ4A 4ZZBA 4BJNA 4JI8T 4HN9A 3C4XA 1H7CA 4H9SE 4YHJA 2A72A 3KV4A 1VRBA 2RA1A 1HNXT 3Q9DA 4KMCA 3AEDA 3FZMB 2KMFA 4LF7T 4CN1A 1XZYA 2CLYC 2CE7A 4XBFB 2VKOA 4H9NC 4UV9B 2CBIA 2XQAA 3KV6A 1D0XA 5FXZA 3C98B 4JV5T 2WDQA 3B5MA 5FL0A 4FJOA 5JTGA 1OEDE 1ZOYA 2EHOB 3OYZA 1IBLT 1R8IA 3ZT7A 3UU3A 4IL9A 2BKOA 2CRBA 3ESLA 4F8HA 2BVLA 2L8KA 2W2UA 1VCSA 4ANJA 5HXCA 3KBUA 3GN5B 3HKDE 4ISTA 5AQVB 3AEBA 5AQMB 2HPLA 3H3AA 4BA9A 3AA7B 1AJ3A 4ISSA 3AB3B 3ZEFB 2FUPA 3BQLA 2IHR1 2XHEB 3C4WA 2K9AA 1J1JA 4AKLA 3BQKA 2VURA 1IBMT 1MMDA 4HKAA 1MMAA 5LP6E 1ZP0A 3ZYLA 4GYSA 4YFSA 5L3EB 2UU9T 3ONJA 4KUMB 3KBTA 3FZHB 2WWUA 4LMJA 2DNXA 5A1LA 4JLEA 4O2AE 3M65A 3CX6B 3UULA 2WWVA 2LJLA 4X62T 3UUMA 2BVMA 5LG3A 3RKGA 4AKIA 2K24A 5FVKA 3KVAA 4YY3T 2KNDA 2BBHA 1YQ3A 1W9RA 5AQRB 3LDQB 4TNVA 3V5UA 4UF0A 5L3FB 1FMVA 2XAFB 2ZMAA 1WYBA 1QLBA 3NRXA 2V7KA 2CM0A 2IW5B 4V1Av 2NW7A 1XNQT 3PE0A 2A9UA 5JDQA 3PJAA 4H63H 4NPPA 1G8XA 4ZOLE 5JDMA 2BS2A 3K3QC 2NW9A 3MZKB 2ZM6T 4XAXB 3B13A 4QH4A 2MAWA 4CI1B 3ZCIA 2Q9QD 5JQGE 5JDFA 2CEAA 3F31A 2WM9A 2V7IA 5JR9B 1KK7A 4Q25A 1YXRA 2XASB 4P1NA 1T7SA 2BZBA 5LJNA 5E0OA 3CWZB 1XWMA 5IUXA 2VKHA 4TN7B 5DQVA 1KNPA 3RC8A 1VCTA 2LHNA 2V8SV 5EZYE 3NBXX 4LF6T 3DJBA 2Q9QA 2E5VA 1D0YA 4KHPT 2LRLA 1WYCA 3IHRA 4U2ZA 4X66T 5F5WA 3K3OA 2JIWA 3LJCA 2FJEA 2M6BA 2WB5A 3CK6A 3VR9A 3P4PA 2X9WA 3HA4A 2YU1A 2JRKA 4AIUA 3FXEB 4YSZA 2B76A 3PUAA 4HFHA 4AQGA 5LHGB 3AA1B 2VL0A 4B3RT 4EEBA 4TV8E 3SFDA 3MACA 3ANWA 1KNRA 4MALA 3P50A 1E2AA 4NXNT 2YDSA 4ASKA 4KP3C 4ILBA 2QRXA 5AQPB 3UFEA 3ZC0A 3LSVA 2SPCA 4ZZCA 3HI2A 4QX8B 2PBIA 2ZM0A 4LF9T 3ZKRA 5JREA 4X64T 5HEJA 3FBZA 3EVYA 5KXJA 4DR5T 5C3JA 4YLHA 5F8PA 4DV4T 3KV5A 2L9QA 2R6GF 4XZCA 2DHRA 2BS4A 3FZFB 2UXXB 3LK42 1J5WA 3AE3A 1NENA 1MIYA 2CLYB 3N9QA 4L0RA 4DR1T 4G63A 1N33T 2PG8A 4AKHA 4X5TA 3RLFF 4QXHB 2NR4A 1UUSA 3ZYMA 4Z91A 4AISA 2CXFA 1HNWT 3UFGA 4ZEYA 1HX1B 3F57A 2IC6A 2GK9A 2N1GA 4TWHA 4QWNB 1SHZC 3UU6A 3WAKA 1WFDA 1OEDA 2LM2A 5EK3A 4TWFA 1HR0T 5AQKB 5ABGA 2I59A 4ZI2C 3P4WA 4U74A 2H7OA 4GK5E 2DWGA 4MFRA 3PV0F 3HKBE 5HEGA 3E22E 4GKJT 1WCRA 2YK0A 3ZCJA 3PU3A 3RYFE 5ABFB 4DV2T 1KF6A 3ZSTA 3H37A 4UXNB 3EHZA 2J1DG 2KWHA 1G73A 4WBNE 4ZI7E 4UEMA 2WP9A 3N5LA 2J47A 2LOPA 3OPCA 3QUJA 5CFBA 2XQ3A 5LBMA 3TLUA 5HEUA 1VOMA 2V7LA 5LA6E 3ABVA 3MJXA 4PNIA 2CWOA 5LCYA 2VASA 2L3LA 4JI6T 2X0LB 4BAYB 2XJ7A 4X1KE 5EK2A 4B3TT 5AQTB 4IREA 2Y6XA 4HWIB 4AKGA 1SE7A 3A7MA 4A97A 2MPKA 5H6RB 4GKKT 4IE0A 2ZM8A 4IDOA 5L2LA 3K8PC 3RQWA 3EDUA 3Q5DA 1E1HB 2CPTA 3S4UA 2WY2A 4QHOA 3FBLA 4X20E 2WU2A 1N36T 3IEEA 3Q5XA 4H9QC 4AXPA 2XQYA 4DV3T 3AEFA 2FJAA 4ILAA 3DTOA 2AXDS 3AE8A 1Y01A 4CI3B 3AEAA 1YKEB 5J1GA 3NZQA 5FXXA 5IYZE 4DBRA 3ONLC 1ZHCA 3PUGA 1IJ6A 3M3ZB 3RH3A 3LBXA 3O1JA 3N9LA 2HHHT 3RRWA 1KEYA 2ODUA 3TKLB 1XNRT 2RPAA 2DWKA 2UUAT 3P4QA 1I94T 3AVSA 2X68A 2XAJB 4IE5A 3LK3B 4JBWF 3LG7A 3PURA 1FEWA 3RIFA 4JYAT 4B3MT 2E9XD 4PFOA 2BG9C 4UF0B 2YEVC 3JCFA 1XDPA 3AE6A 3FB2A 4ZI3D 3AE9A 4GK0E 2XAQB 3K3NA 3TLVA 5HXHA 2K3WA 3IA3A 3X1DA 1OWAA 2DLRA 1XDOA 2V6YA 4YTNA 2W61A 2E9XA 3D0TA 3CX8B 3B57A 3U3IA 3O4XE 4LF5T 1UX4A 4JI4T 3ZMUB 4YSYA 3E0ZA 4H63V 3RX6A 3ETUA 2E2AA 4DVDA 1NAFA 2OV9A 3QNUA 4KI0F 1YQ4A 5LYJE 3T1HT 4O4LE 4HFCA 3KVBA 3KV9A 2QVAA 4CXWA 3LFMA 3AE1A 3UUXB 3EDVA 4P0BA 4HEAA 3HL6A 4P09A 4YTPA 1IBKT 1BR0A 4IDZA 4TUYE 3TLSA 2Q9QB 2XPKA 4Z90A 1YKHB 3PUWF 2Y48B 4DMVA 4K0UA 1E7PA 3CIRA 2W00A 4M1PA 1KFYA 3NRYA 3AEEA 5ABEA 2UXNB 2JQKA 4EIWA 3SFEA 4DBQA 4JEHB 2E5LT 5HWYA 3FHNA 2NP9A 2HPJA 4L9IA 4IE4A 5FMNA 1WR6A 2E9XC 2KINB 3PUVF 4O4JE 3RPUA 1J5ET 2XY8B 4ZI3C 1HF8A 2BG9E 2VQFT 4ZS3A 2RP4A 5JRCA 2WBLA 3ANWB 1X9BA 2IIUA 2PTFA 1JNRA 4IIJE 5LOVE 2W4XA 1QSDA 4GIWA 2VL8A 1MNEA 2H3RA 4HFBA 3BQIA 2ZM2A 4TNWA 2V5DA 3O1HA 2YOEA 3QB5K 5JH7E 5EK4A 2NTYA 1M62A 3UUNA 3ZLIA 5FL1A 2V26A 1YD8G 2MYSA 3AECA 3L09A
chains in the Genus database with same CATH topology
4JI1T 4LF9T 4DR3T 1HNXT 4DR7T 4GKJT 1N32T 4DV0T 4X64T 5BR8T 1N34T 4DR6T 2UU9T 1IBKT 4B3ST 4LF7T 4DR5T 4DV2T 4JI5T 2HHHT 4DV4T 2UXDT 4LF6T 1XNRT 4DR2T 2F4VT 3T1YT 4KHPT 5LMUT 2UUAT 4OX9T 1I94T 4DV5T 4LFAT 4X62T 4X66T 4DR4T 3OTOT 5IWAT 2E5LT 4JV5T 4YY3T 1HNZT 4JI3T 4JYAT 4B3MT 1XMQT 4DR1T 1N33T 4JI6T 1XMOT 2UUCT 2UXBT 1IBLT 4LFCT 4JI0T 4JI7T 4X65T 1J5ET 4B3TT 2VQFT 2UUBT 1HNWT 4GKKT 4K0KT 4JI2T 4B3RT 4DV6T 1XNQT 4YHHT 2UXCT 1FJGT 4NXNT 4LF5T 4DUYT 4JI4T 4LF4T 1N36T 4DUZT 2ZM6T 4DV3T 4DV1T 4DV7T 1HR0T 4LF8T 2VQET 5LMNT 3T1HT 4JI8T 4LFBT 4AQYT 4NXMT 1IBMT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 T;  4LF9 T;  4DR3 T;  1HNX T;  4DR7 T;  4GKJ T;  1N32 T;  4DV0 T;  4X64 T;  5BR8 T;  1N34 T;  4DR6 T;  2UU9 T;  1IBK T;  4B3S T;  4LF7 T;  4DR5 T;  4DV2 T;  4JI5 T;  2HHH T;  4DV4 T;  2UXD T;  4LF6 T;  1XNR T;  4DR2 T;  2F4V T;  3T1Y T;  4KHP T;  5LMU T;  2UUA T;  4OX9 T;  1I94 T;  4DV5 T;  4LFA T;  4X62 T;  4X66 T;  4DR4 T;  3OTO T;  5IWA T;  2E5L T;  4JV5 T;  4YY3 T;  1HNZ T;  4JI3 T;  4JYA T;  4B3M T;  1XMQ T;  4DR1 T;  1N33 T;  4JI6 T;  1XMO T;  2UUC T;  2UXB T;  1IBL T;  4LFC T;  4JI0 T;  4JI7 T;  4X65 T;  1J5E T;  4B3T T;  2VQF T;  2UUB T;  1HNW T;  4GKK T;  4K0K T;  4JI2 T;  4B3R T;  4DV6 T;  1XNQ T;  4YHH T;  2UXC T;  1FJG T;  4NXN T;  4LF5 T;  4DUY T;  4JI4 T;  4LF4 T;  1N36 T;  4DUZ T;  2ZM6 T;  4DV3 T;  4DV1 T;  4DV7 T;  1HR0 T;  4LF8 T;  2VQE T;  5LMN T;  3T1H T;  4JI8 T;  4LFB T;  4AQY T;  4NXM T;  1IBM T; 
#chains in the Genus database with same CATH topology
 5BMV E;  1UUR A;  2NWB A;  3WAJ A;  4I0U A;  4KX6 A;  1FIO A;  4IDN A;  4OK0 A;  4GOU A;  2P9B A;  2XSB A;  5L4E A;  4L5G A;  2JMH A;  4ERR A;  1W0B A;  2X9H A;  3SWH A;  5J2U E;  2D0T A;  4DV5 T;  4OX9 T;  3UQ4 A;  2I6H A;  4A5X A;  3JC6 C;  5IWA T;  2XZE A;  2PFV A;  1HNZ T;  4JI3 T;  4EXT A;  1WRD A;  2LSJ A;  2UXB T;  3RKO A;  4CZZ B;  4TV9 E;  1Y64 B;  3ETV A;  4PJL A;  2VWA A;  4O8S A;  4U3C A;  5CA1 E;  2N2N A;  3P4S A;  4OYJ A;  3N9O A;  5FY0 A;  4DV6 T;  4QKN A;  4CN4 A;  5AQH B;  1ZEE A;  5JDH A;  4B6X A;  3RC3 A;  1OED B;  1S94 A;  2LSG A;  3AE4 A;  4TZ4 C;  3CML A;  5HAX A;  4KBM B;  3O9X A;  3AAE B;  2EHO C;  4O4H E;  3PUY F;  4ZHQ E;  1BR2 A;  5HEH A;  3QC9 A;  4IE6 A;  4MHC A;  3HKE E;  3AXJ A;  4DR7 T;  3ZN1 B;  5JVD E;  2XAH B;  3NZP A;  2NW8 A;  5JDN A;  4ADZ A;  4EED A;  4ZI2 D;  5AQI B;  5KX5 E;  3R84 B;  4IDP A;  3MXZ A;  2F4V T;  4J2C A;  2CCQ A;  2M67 A;  5L4H A;  5HXS A;  3NWI A;  4YXD A;  3UU4 A;  4HFD A;  2VKJ A;  3MKD A;  4WZX A;  4JEU B;  3C50 A;  1UCU A;  4X65 T;  3V5S A;  3ZMZ B;  2XQ4 A;  5TAO A;  4IHJ E;  4K0K T;  3GA8 A;  2YU2 A;  2UXC T;  4WNK A;  3VRB A;  3RYI E;  1ZV4 X;  5JR9 A;  1LVF A;  3AA0 B;  1JNZ A;  1HFA A;  4HWC A;  2V1D B;  3UU8 A;  4LF4 T;  4KHZ F;  5F3J A;  2Z6E A;  3EAB A;  2YIN A;  3HKC E;  5FY7 A;  5KDM C;  4LF8 T;  1U5P A;  2BS3 A;  5M4Y A;  2A2F X;  4H9P C;  4AQY T;  2KSR A;  2XUE A;  2JJ9 A;  3LBX B;  3FXD B;  3PUQ A;  2N9D A;  2WMO A;  2LOS A;  3K1S A;  1W09 A;  2C0S A;  2H89 A;  5AQO B;  2KZ7 B;  1D1B A;  4QXC B;  2QYW A;  4DR2 T;  3EI0 A;  2W66 A;  3GWH A;  2LSK A;  4U7Y A;  2XQ8 A;  4YT0 A;  4IGU A;  4X1I E;  4U72 A;  3H3M A;  2DI4 A;  1ZKE A;  4WW0 A;  2H88 A;  4C91 A;  5JR9 C;  4EB6 E;  2QA7 A;  2J62 A;  4ILC A;  2LKH A;  2WQY A;  4CXX A;  2D0U A;  2YDQ A;  4WYV A;  1T8B A;  4HFI A;  3AAI A;  3ZMV B;  4UV8 B;  2MTQ A;  2C5K T;  2WAU A;  2ODV A;  3CQG B;  2V6Y B;  2CA5 A;  4BJM A;  3KDS E;  3RIU A;  5FY1 A;  2E9X B;  2DCF A;  4UVC B;  4FI5 A;  1FJG T;  1D0Z A;  5DQW A;  1Z0P A;  3ZC1 A;  3EUH A;  4AI6 A;  2KXP B;  4DUZ T;  3N9N A;  3ZJ1 A;  3P7I A;  4DV1 T;  3CQX C;  4DMW A;  3JAE A;  4PK6 A;  3IF8 B;  4QX7 B;  3FZL B;  4TX5 A;  3HR0 A;  2BG9 A;  3AE2 A;  5LB7 B;  4QH5 A;  3I0Q A;  2JPF A;  3MA9 A;  4JI1 T;  2WDR A;  2I0M A;  3RI5 A;  4DR3 T;  4DID B;  2WZI A;  1N34 T;  1M7K A;  3U78 A;  3TLT A;  2VVS A;  4U2Y A;  2UXD T;  2D2S A;  2LEH A;  2C5J A;  1OXZ A;  5AQG B;  5LBQ B;  2X9X A;  2MBG A;  4UIG A;  1T98 A;  2XTL A;  3CX7 B;  5J0Z A;  3RIU C;  3OVU A;  2BKN A;  3UT5 E;  1XMO T;  4LFC T;  2IAK A;  2IC9 A;  4TWD A;  4PK5 A;  2G0U A;  2QGS A;  3NVO A;  2UUB T;  3OBV E;  2FJD A;  2YDR A;  4NUU A;  4U7I A;  4HWD A;  2JQH A;  5AQU B;  3KFW X;  2BDE A;  1NEK A;  1DU2 A;  4PW8 A;  4NUV A;  4EGW A;  3J7Y q;  5HXR A;  3AA6 B;  1GQE A;  4PJM A;  5CB4 E;  2VQE T;  1T72 A;  5ABF A;  5LG4 A;  2X9Y A;  2ZLY A;  2VVN A;  4OYK A;  3ONX A;  5L3B B;  3AVR A;  3P8C D;  1UK5 A;  1MIV A;  5KMG P;  5LHI B;  4B3S T;  1X79 A;  3PUS A;  5FXW A;  1LVK A;  5C8Y E;  4PK4 A;  2IDO B;  3A5X A;  4A56 A;  5LMU T;  4HWH A;  3ZMT B;  2VK9 A;  4IL4 A;  3OTO T;  5LGT B;  1L0V A;  1IJ5 A;  3ZPO A;  2X0Y A;  3Q2M A;  2IUB A;  1I6Z A;  2V7J A;  2HH7 A;  2V5C A;  4LMK A;  4YTM A;  4LML A;  1HX8 A;  5JDL A;  5CGM A;  4IE7 A;  5HYA A;  5LJM A;  4PAG A;  4GYR A;  3SOL A;  3ZJ2 A;  3JC6 D;  5HCM A;  1V9D A;  2WMN A;  2VB6 A;  2KT9 A;  2FJB A;  2XQ5 A;  2KLQ A;  4F6R C;  2LT3 A;  4YHH T;  3FZK B;  2J4G A;  2XM2 A;  5AQN B;  2XQ7 A;  1B7T A;  3LK2 B;  4CI2 B;  2CMR A;  3KIN B;  5FXV A;  3NKZ A;  1CHU A;  4HTE A;  3AE7 A;  3MK7 C;  4O4I E;  2YN6 A;  4COF A;  2NTX A;  5HEO A;  5LNK A;  4LFB T;  2DL1 A;  3EAM A;  3W15 B;  3GMI A;  3PU8 A;  3AXJ B;  3ZN0 B;  1CUN A;  3UTK A;  2JMK A;  5BR8 T;  2LLY A;  3QOF A;  4CN6 A;  2CHN A;  3JAF A;  2EHO D;  3N9M A;  3N2K E;  4UR9 A;  5GON E;  3CVR A;  5H6Q B;  1WR0 A;  4PJN A;  4LFA T;  4A98 A;  1UX5 A;  3JAD A;  4DR4 T;  5C2T A;  1FMW A;  1U4Q A;  1IAP A;  1D1A A;  3CQC B;  3RHW A;  2HN2 A;  5LGN B;  2EHO A;  3PJA J;  2UUC T;  3Q5E A;  5LHH B;  1MMG A;  4EZH A;  5DJQ C;  4JI7 T;  2W63 A;  3RYH E;  1EZ3 A;  5AQS B;  2WDV A;  4AQF A;  5L47 A;  1YW0 A;  4YSX A;  1SUM B;  2XM1 A;  3VKG A;  2LM9 A;  4HGA A;  1HS7 A;  1UGO A;  5HXE A;  4DUY T;  3E08 A;  3GN5 A;  5AQL B;  4CXY A;  4PJJ A;  3T8O A;  4H9R C;  4X1Y E;  2W67 A;  3O1I A;  3I1A A;  3PUX F;  2FBW A;  4E7Z A;  3SRZ A;  4NIQ A;  1IZN B;  1BR4 A;  5FYM A;  1SA0 E;  2OA5 A;  2CHO A;  4U31 A;  3PUZ F;  2W62 A;  3C4Z A;  4JI5 T;  2C5I T;  5JDG A;  4IT4 A;  2ACX A;  2XQ9 A;  1US7 B;  1HG2 A;  5AQQ B;  2M6I A;  3A8Y C;  5FNV E;  3I9W A;  1MND A;  3AE5 A;  1HG5 A;  3PDY A;  2WS3 A;  4YJ3 E;  4AQF C;  1WLX A;  3QK6 A;  3RRC A;  4PFP A;  3RF1 A;  3VKH A;  2BKP A;  2W0G A;  5AFU L;  2X66 A;  3PTR B;  2LKG A;  3RYC E;  2LSY A;  2WCA A;  1HTJ F;  2D9D A;  4HFV A;  4JI2 T;  4MLK A;  3UQ7 A;  2Q9Q C;  1O3X A;  4JUY A;  3TLW A;  3N2G E;  4WBO A;  4I50 E;  3ZT5 A;  2X0H A;  3ZT6 A;  5AQF B;  5L3C B;  3UUB A;  4EYU A;  2JQQ A;  4ZS2 A;  3L3P A;  2K48 A;  1MMN A;  4C90 A;  5LMN T;  2WZH A;  5HCJ A;  2BG9 B;  2D5U A;  3SS1 A;  3I9Y A;  3ZYK A;  2CXL A;  4NXM T;  4EOZ B;  1N32 T;  4DR6 T;  3AAA B;  3CPZ A;  3IBP A;  2H7V C;  2LHR A;  5AQJ B;  5ADX L;  1HCI A;  3J9X 1;  4AKR B;  3R6N A;  3VU7 H;  3OKQ A;  5CJ5 A;  3OYX A;  3C64 A;  2V6X A;  1NWM X;  1XMQ T;  2BBJ A;  3BK9 A;  3F2E A;  4HFE A;  4O2B E;  3DP7 A;  5CA0 E;  2PJQ A;  4JI0 T;  4DO0 A;  2XSA A;  5L3G B;  2CXD A;  2XQ6 A;  3ZSS A;  2LRK A;  2MOZ A;  4DND A;  4I4T E;  4H9O C;  5LGU B;  4UVA B;  4P0A A;  4MBQ A;  1D1C A;  1W0A A;  3RQU A;  1LKX A;  2LSI A;  1S35 A;  4ZXL A;  3P4R A;  1KNZ A;  2K5B B;  2JQ9 A;  5FKY A;  2ACZ A;  4UEL A;  4IDQ A;  4N78 D;  4HE8 A;  2WSS V;  1Z8U A;  2AE9 A;  2CWY A;  2B1E A;  3T1Y T;  2NOX A;  5FP3 A;  4ILU A;  4EV6 A;  2VKD A;  2X67 A;  4CQI A;  4E7S A;  2YKS A;  3AEG A;  4DV0 T;  4EAH A;  3ZMS B;  4OHF A;  3VR8 A;  2X51 A;  4I55 E;  3CKD A;  5ETW A;  4EYY R;  5J2T E;  3G06 A;  2E8I A;  1OED C;  5HWX A;  4QXB B;  4U33 A;  2V7M A;  3L8R A;  2HN1 A;  4UVB B;  5LXT E;  3I0O A;  4YJ2 E;  3WI3 A;  3RGL A;  2WU5 A;  3N2O A;  1LRZ A;  3RIA A;  2IML A;  2Y8D A;  4OFZ A;  4HWF A;  2OLT A;  1MIW A;  1QUU A;  2LE8 A;  5L3D B;  4QH1 A;  2ES0 A;  3VHL A;  5ABH A;  3Q5W A;  5IHY A;  3L39 A;  2A3D A;  5DAB A;  3N9P A;  5FVL A;  2CBJ A;  3OJA A;  4I43 B;  4Z8X A;  3UU5 A;  3C51 A;  2XAG B;  3QB5 A;  1BR1 A;  4G2A A;  5JRC B;  3VRA A;  4DV7 T;  2KWI B;  4EZ4 A;  4ZZB A;  4BJN A;  4JI8 T;  4HN9 A;  3C4X A;  1H7C A;  4H9S E;  4YHJ A;  2A72 A;  3KV4 A;  1VRB A;  2RA1 A;  1HNX T;  3Q9D A;  4KMC A;  3AED A;  3FZM B;  2KMF A;  4LF7 T;  4CN1 A;  1XZY A;  2CLY C;  2CE7 A;  4XBF B;  2VKO A;  4H9N C;  4UV9 B;  2CBI A;  2XQA A;  3KV6 A;  1D0X A;  5FXZ A;  3C98 B;  4JV5 T;  2WDQ A;  3B5M A;  5FL0 A;  4FJO A;  5JTG A;  1OED E;  1ZOY A;  2EHO B;  3OYZ A;  1IBL T;  1R8I A;  3ZT7 A;  3UU3 A;  4IL9 A;  2BKO A;  2CRB A;  3ESL A;  4F8H A;  2BVL A;  2L8K A;  2W2U A;  1VCS A;  4ANJ A;  5HXC A;  3KBU A;  3GN5 B;  3HKD E;  4IST A;  5AQV B;  3AEB A;  5AQM B;  2HPL A;  3H3A A;  4BA9 A;  3AA7 B;  1AJ3 A;  4ISS A;  3AB3 B;  3ZEF B;  2FUP A;  3BQL A;  2IHR 1;  2XHE B;  3C4W A;  2K9A A;  1J1J A;  4AKL A;  3BQK A;  2VUR A;  1IBM T;  1MMD A;  4HKA A;  1MMA A;  5LP6 E;  1ZP0 A;  3ZYL A;  4GYS A;  4YFS A;  5L3E B;  2UU9 T;  3ONJ A;  4KUM B;  3KBT A;  3FZH B;  2WWU A;  4LMJ A;  2DNX A;  5A1L A;  4JLE A;  4O2A E;  3M65 A;  3CX6 B;  3UUL A;  2WWV A;  2LJL A;  4X62 T;  3UUM A;  2BVM A;  5LG3 A;  3RKG A;  4AKI A;  2K24 A;  5FVK A;  3KVA A;  4YY3 T;  2KND A;  2BBH A;  1YQ3 A;  1W9R A;  5AQR B;  3LDQ B;  4TNV A;  3V5U A;  4UF0 A;  5L3F B;  1FMV A;  2XAF B;  2ZMA A;  1WYB A;  1QLB A;  3NRX A;  2V7K A;  2CM0 A;  2IW5 B;  4V1A v;  2NW7 A;  1XNQ T;  3PE0 A;  2A9U A;  5JDQ A;  3PJA A;  4H63 H;  4NPP A;  1G8X A;  4ZOL E;  5JDM A;  2BS2 A;  3K3Q C;  2NW9 A;  3MZK B;  2ZM6 T;  4XAX B;  3B13 A;  4QH4 A;  2MAW A;  4CI1 B;  3ZCI A;  2Q9Q D;  5JQG E;  5JDF A;  2CEA A;  3F31 A;  2WM9 A;  2V7I A;  5JR9 B;  1KK7 A;  4Q25 A;  1YXR A;  2XAS B;  4P1N A;  1T7S A;  2BZB A;  5LJN A;  5E0O A;  3CWZ B;  1XWM A;  5IUX A;  2VKH A;  4TN7 B;  5DQV A;  1KNP A;  3RC8 A;  1VCT A;  2LHN A;  2V8S V;  5EZY E;  3NBX X;  4LF6 T;  3DJB A;  2Q9Q A;  2E5V A;  1D0Y A;  4KHP T;  2LRL A;  1WYC A;  3IHR A;  4U2Z A;  4X66 T;  5F5W A;  3K3O A;  2JIW A;  3LJC A;  2FJE A;  2M6B A;  2WB5 A;  3CK6 A;  3VR9 A;  3P4P A;  2X9W A;  3HA4 A;  2YU1 A;  2JRK A;  4AIU A;  3FXE B;  4YSZ A;  2B76 A;  3PUA A;  4HFH A;  4AQG A;  5LHG B;  3AA1 B;  2VL0 A;  4B3R T;  4EEB A;  4TV8 E;  3SFD A;  3MAC A;  3ANW A;  1KNR A;  4MAL A;  3P50 A;  1E2A A;  4NXN T;  2YDS A;  4ASK A;  4KP3 C;  4ILB A;  2QRX A;  5AQP B;  3UFE A;  3ZC0 A;  3LSV A;  2SPC A;  4ZZC A;  3HI2 A;  4QX8 B;  2PBI A;  2ZM0 A;  4LF9 T;  3ZKR A;  5JRE A;  4X64 T;  5HEJ A;  3FBZ A;  3EVY A;  5KXJ A;  4DR5 T;  5C3J A;  4YLH A;  5F8P A;  4DV4 T;  3KV5 A;  2L9Q A;  2R6G F;  4XZC A;  2DHR A;  2BS4 A;  3FZF B;  2UXX B;  3LK4 2;  1J5W A;  3AE3 A;  1NEN A;  1MIY A;  2CLY B;  3N9Q A;  4L0R A;  4DR1 T;  4G63 A;  1N33 T;  2PG8 A;  4AKH A;  4X5T A;  3RLF F;  4QXH B;  2NR4 A;  1UUS A;  3ZYM A;  4Z91 A;  4AIS A;  2CXF A;  1HNW T;  3UFG A;  4ZEY A;  1HX1 B;  3F57 A;  2IC6 A;  2GK9 A;  2N1G A;  4TWH A;  4QWN B;  1SHZ C;  3UU6 A;  3WAK A;  1WFD A;  1OED A;  2LM2 A;  5EK3 A;  4TWF A;  1HR0 T;  5AQK B;  5ABG A;  2I59 A;  4ZI2 C;  3P4W A;  4U74 A;  2H7O A;  4GK5 E;  2DWG A;  4MFR A;  3PV0 F;  3HKB E;  5HEG A;  3E22 E;  4GKJ T;  1WCR A;  2YK0 A;  3ZCJ A;  3PU3 A;  3RYF E;  5ABF B;  4DV2 T;  1KF6 A;  3ZST A;  3H37 A;  4UXN B;  3EHZ A;  2J1D G;  2KWH A;  1G73 A;  4WBN E;  4ZI7 E;  4UEM A;  2WP9 A;  3N5L A;  2J47 A;  2LOP A;  3OPC A;  3QUJ A;  5CFB A;  2XQ3 A;  5LBM A;  3TLU A;  5HEU A;  1VOM A;  2V7L A;  5LA6 E;  3ABV A;  3MJX A;  4PNI A;  2CWO A;  5LCY A;  2VAS A;  2L3L A;  4JI6 T;  2X0L B;  4BAY B;  2XJ7 A;  4X1K E;  5EK2 A;  4B3T T;  5AQT B;  4IRE A;  2Y6X A;  4HWI B;  4AKG A;  1SE7 A;  3A7M A;  4A97 A;  2MPK A;  5H6R B;  4GKK T;  4IE0 A;  2ZM8 A;  4IDO A;  5L2L A;  3K8P C;  3RQW A;  3EDU A;  3Q5D A;  1E1H B;  2CPT A;  3S4U A;  2WY2 A;  4QHO A;  3FBL A;  4X20 E;  2WU2 A;  1N36 T;  3IEE A;  3Q5X A;  4H9Q C;  4AXP A;  2XQY A;  4DV3 T;  3AEF A;  2FJA A;  4ILA A;  3DTO A;  2AXD S;  3AE8 A;  1Y01 A;  4CI3 B;  3AEA A;  1YKE B;  5J1G A;  3NZQ A;  5FXX A;  5IYZ E;  4DBR A;  3ONL C;  1ZHC A;  3PUG A;  1IJ6 A;  3M3Z B;  3RH3 A;  3LBX A;  3O1J A;  3N9L A;  2HHH T;  3RRW A;  1KEY A;  2ODU A;  3TKL B;  1XNR T;  2RPA A;  2DWK A;  2UUA T;  3P4Q A;  1I94 T;  3AVS A;  2X68 A;  2XAJ B;  4IE5 A;  3LK3 B;  4JBW F;  3LG7 A;  3PUR A;  1FEW A;  3RIF A;  4JYA T;  4B3M T;  2E9X D;  4PFO A;  2BG9 C;  4UF0 B;  2YEV C;  3JCF A;  1XDP A;  3AE6 A;  3FB2 A;  4ZI3 D;  3AE9 A;  4GK0 E;  2XAQ B;  3K3N A;  3TLV A;  5HXH A;  2K3W A;  3IA3 A;  3X1D A;  1OWA A;  2DLR A;  1XDO A;  2V6Y A;  4YTN A;  2W61 A;  2E9X A;  3D0T A;  3CX8 B;  3B57 A;  3U3I A;  3O4X E;  4LF5 T;  1UX4 A;  4JI4 T;  3ZMU B;  4YSY A;  3E0Z A;  4H63 V;  3RX6 A;  3ETU A;  2E2A A;  4DVD A;  1NAF A;  2OV9 A;  3QNU A;  4KI0 F;  1YQ4 A;  5LYJ E;  3T1H T;  4O4L E;  4HFC A;  3KVB A;  3KV9 A;  2QVA A;  4CXW A;  3LFM A;  3AE1 A;  3UUX B;  3EDV A;  4P0B A;  4HEA A;  3HL6 A;  4P09 A;  4YTP A;  1IBK T;  1BR0 A;  4IDZ A;  4TUY E;  3TLS A;  2Q9Q B;  2XPK A;  4Z90 A;  1YKH B;  3PUW F;  2Y48 B;  4DMV A;  4K0U A;  1E7P A;  3CIR A;  2W00 A;  4M1P A;  1KFY A;  3NRY A;  3AEE A;  5ABE A;  2UXN B;  2JQK A;  4EIW A;  3SFE A;  4DBQ A;  4JEH B;  2E5L T;  5HWY A;  3FHN A;  2NP9 A;  2HPJ A;  4L9I A;  4IE4 A;  5FMN A;  1WR6 A;  2E9X C;  2KIN B;  3PUV F;  4O4J E;  3RPU A;  1J5E T;  2XY8 B;  4ZI3 C;  1HF8 A;  2BG9 E;  2VQF T;  4ZS3 A;  2RP4 A;  5JRC A;  2WBL A;  3ANW B;  1X9B A;  2IIU A;  2PTF A;  1JNR A;  4IIJ E;  5LOV E;  2W4X A;  1QSD A;  4GIW A;  2VL8 A;  1MNE A;  2H3R A;  4HFB A;  3BQI A;  2ZM2 A;  4TNW A;  2V5D A;  3O1H A;  2YOE A;  3QB5 K;  5JH7 E;  5EK4 A;  2NTY A;  1M62 A;  3UUN A;  3ZLI A;  5FL1 A;  2V26 A;  1YD8 G;  2MYS A;  3AEC A;  3L09 A; 
#chains in the Genus database with same CATH homology
 4JI1 T;  4LF9 T;  4DR3 T;  1HNX T;  4DR7 T;  4GKJ T;  1N32 T;  4DV0 T;  4X64 T;  5BR8 T;  1N34 T;  4DR6 T;  2UU9 T;  1IBK T;  4B3S T;  4LF7 T;  4DR5 T;  4DV2 T;  4JI5 T;  2HHH T;  4DV4 T;  2UXD T;  4LF6 T;  1XNR T;  4DR2 T;  2F4V T;  3T1Y T;  4KHP T;  5LMU T;  2UUA T;  4OX9 T;  1I94 T;  4DV5 T;  4LFA T;  4X62 T;  4X66 T;  4DR4 T;  3OTO T;  5IWA T;  2E5L T;  4JV5 T;  4YY3 T;  1HNZ T;  4JI3 T;  4JYA T;  4B3M T;  1XMQ T;  4DR1 T;  1N33 T;  4JI6 T;  1XMO T;  2UUC T;  2UXB T;  1IBL T;  4LFC T;  4JI0 T;  4JI7 T;  4X65 T;  1J5E T;  4B3T T;  2VQF T;  2UUB T;  1HNW T;  4GKK T;  4K0K T;  4JI2 T;  4B3R T;  4DV6 T;  1XNQ T;  4YHH T;  2UXC T;  1FJG T;  4NXN T;  4LF5 T;  4DUY T;  4JI4 T;  4LF4 T;  1N36 T;  4DUZ T;  2ZM6 T;  4DV3 T;  4DV1 T;  4DV7 T;  1HR0 T;  4LF8 T;  2VQE T;  5LMN T;  3T1H T;  4JI8 T;  4LFB T;  4AQY T;  4NXM T;  1IBM T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...