4DV0T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv0T00
4X62T 1J5ET 2ZM6T 2VQET 1HNXT 1XMQT 4JV5T 4GKJT 4LF9T 4LFCT 4LF4T 4B3ST 1HR0T 1IBMT 3T1HT 2UUAT 5LMUT 2E5LT 4AQYT 4JI1T 4DR7T 4B3MT 4DV3T 4DV2T 4DV6T 1XNRT 1IBLT 4JI4T 4DR5T 1N36T 4KHPT 4DV4T 5LMNT 4GKKT 4B3TT 4X65T 4X66T 4DR2T 4LF7T 2UUBT 4NXMT 4DUYT 4LFBT 4NXNT 4DR4T 4JI6T 4K0KT 5IWAT 4JI8T 2UXBT 1HNWT 2UXCT 1XNQT 4DUZT 4DV0T 2UXDT 2UUCT 4LFAT 2VQFT 4LF6T 4DR1T 3OTOT 1I94T 1FJGT 4YY3T 2HHHT 4LF8T 4DR6T 1IBKT 4OX9T 5BR8T 3T1YT 4JI3T 4DR3T 4JYAT 4X64T 4JI5T 4DV7T 4JI0T 4DV1T 4JI7T 4LF5T 1HNZT 4YHHT 1N32T 4DV5T 1XMOT 4JI2T 2F4VT 1N34T 1N33T 2UU9T 4B3RT
chains in the Genus database with same CATH superfamily
4EZHA 2X9WA 2Z6EA 2PBIA 2KWIB 4TUYE 2V26A 4GK5E 3RQUA 4TX5A 1MIYA 3UFEA 5HWXA 4JV5T 4DNDA 4KUMB 2LRLA 4X66T 4KX6A 3L3PA 2NW9A 3VR8A 4ADZA 4AQFC 2J47A 4B3ST 3UU4A 2Q9QC 3Q5XA 3Q9DA 4A5XA 1HR0T 1M7KA 5M4YA 2OA5A 2ZM2A 3SRZA 3ZMUB 4P0AA 2E5LT 2UUAT 3Q2MA 4AQYT 1YQ3A 3PUZF 2X0LB 3L09A 4X1KE 4G2AA 5FXWA 3AAIA 4IDNA 2MTQA 4PNIA 4EOZB 4JLEA 3TLWA 4HTEA 4DBQA 4OK0A 5IYZE 4BA9A 2QA7A 3V5SA 3UTKA 3ETVA 1WFDA 2BS3A 2YN6A 2WZHA 5JDHA 4CXXA 2W00A 1XNRT 2IW5B 1GQEA 4EYUA 5KXJA 4F6RC 2XUEA 4YJ2E 2WWUA 3C4WA 4IL4A 3QOFA 2KWHA 3HKBE 2FJEA 4ILAA 5HEOA 1W9RA 2XM1A 1D0XA 1WLXA 2JMHA 3A8YC 2J4GA 2W4XA 3AA0B 4WZXA 3N2GE 4TNVA 4AQGA 2DI4A 4YSYA 2ODUA 2LT3A 4ZI2C 2VVSA 1D0ZA 1X9BA 2RP4A 3EDVA 4B3TT 3RGLA 4X20E 4EZ4A 5L3FB 5LJMA 2YEVC 2WMOA 3FZHB 3LFMA 1HTJF 1SE7A 3MKDA 3P7IA 3IEEA 4IE7A 4ISTA 4MFRA 4PJJA 3ZN1B 1D1BA 2V6YA 4P0BA 4DMVA 2X9XA 1LRZA 4DUYT 5FL1A 3OPCA 4X5TA 3NRYA 5AQHB 4ZOLE 4YSXA 1HFAA 3C4ZA 3D0TA 4I0UA 2DWGA 2KMFA 1FEWA 2E9XB 2V7JA 4NUVA 2WZIA 3ZEFB 4P09A 2BG9E 2W61A 1LVKA 1HNWT 3VKGA 5C2TA 4WNKA 3ZT7A 3LDQB 4HGAA 3I1AA 5AQTB 2QGSA 3CWZB 3B57A 5JRCA 3AE3A 3O1IA 2BBJA 4H9PC 4YHJA 2JQ9A 3S4UA 2PTFA 2D5UA 4JI1T 2XQ5A 1UUSA 4U2ZA 3PUVF 4AQFA 4EIWA 1EZ3A 1YW0A 2CWYA 3DJBA 3FB2A 4TNWA 5LOVE 4DBRA 4HE8A 2XQ3A 4JEUB 2W62A 4IE5A 4C90A 5CA0E 2BKOA 1JNRA 4PJMA 2CHOA 2KLQA 3CVRA 3PURA 5CA1E 2D0UA 3ETUA 2DNXA 4Z91A 2MOZA 5F3JA 2LM9A 2XQ9A 5FYMA 4EB6E 2NW7A 5LHHB 2CE7A 4KI0F 4IHJE 1NEKA 1E7PA 2VKJA 3AVRA 3CQGB 4GYRA 2K3WA 4HWIB 4H9QC 3GWHA 5AQPB 5AQQB 5H6QB 2V5CA 4AKLA 3IA3A 5LJNA 1IJ5A 5HAXA 3I9WA 5AQSB 3AXJA 3ZYLA 1BR2A 5AQVB 5HWYA 3ZT5A 2NP9A 4IE0A 1DU2A 4ANJA 3RC8A 1YXRA 5EZYE 4MBQA 4QXCB 3JC6C 4O4HE 2DCFA 2LSYA 1UX5A 3LJCA 3P4QA 5LHIB 1IZNB 4COFA 4X64T 1MMAA 1T72A 2R6GF 2VKDA 3O1JA 5LBQB 4JI0T 3ZCJA 4U33A 3ONJA 3RI5A 4TZ4C 5ADXL 4JI7T 2W63A 2RA1A 2MPKA 3EI0A 3E0ZA 2VL8A 1HNZT 3HKDE 5F5WA 4YHHT 5KX5E 2X9YA 2DWKA 2XAHB 1UX4A 5HXRA 1N32T 2ACZA 1Y64B 2H89A 4TV8E 2FJAA 2XQ6A 4L5GA 3PE0A 2WDQA 5LGTB 1XMOT 3GMIA 3NVOA 5HXSA 3RF1A 1N34T 5TAOA 5FVLA 2X66A 2HPJA 5LP6E 2H7VC 4U72A 4X62T 4QX8B 5LG4A 4ZI3C 1MNEA 3ZKRA 3RLFF 3T8OA 3K3NA 5CGMA 1J5WA 2CA5A 2VQET 1J5ET 4QX7B 2EHOC 3CK6A 1ZEEA 3RPUA 1XMQT 2XQYA 2VB6A 1D1AA 1VCTA 2GK9A 2X68A 4UV9B 4IREA 3C64A 3NZQA 2BVMA 2CXFA 3FHNA 3Q5EA 4LF4T 2M6BA 3J9X1 3RHWA 1I6ZA 1T7SA 3BQKA 2X51A 4UF0A 1CHUA 1IJ6A 3HA4A 2Y8DA 2YDSA 5DJQC 1IBMT 3JAFA 5DABA 2B76A 4A98A 2RPAA 4KMCA 4I43B 3ZMSB 4DR7T 5JDLA 2N9DA 3X1DA 4B3MT 1W0BA 2XHEB 4UV8B 2WMNA 4WBNE 4DV2T 1SA0E 3PV0F 4H9RC 4Z90A 1LVFA 3UU5A 3PU8A 2I6HA 2JJ9A 4IL9A 3RYCE 4DV6T 3NZPA 2EHOD 2A3DA 1FMWA 3GA8A 4X1YE 3A7MA 3AAAB 3I0OA 3BQLA 3P50A 1S35A 2CLYB 4JI4T 1HS7A 2WBLA 2YINA 4EEDA 4NIQA 2IHR1 1N36T 1MNDA 2W67A 2LKGA 3N9NA 3ESLA 3IBPA 3AEBA 3PU3A 3PUSA 4HEAA 4YTPA 2VASA 4UXNB 5EK3A 4L9IA 3ANWA 5ETWA 1H7CA 4YJ3E 5CB4E 4YT0A 4ZI7E 1WR0A 4TWFA 4Q25A 2E9XC 3P8CD 3NWIA 5KMGP 5AQGB 2AXDS 3ABVA 5IUXA 5JDNA 4DR2T 4PK5A 4CZZB 2VURA 1MMGA 3B13A 3E22E 1OEDA 3RYHE 3ZCIA 5IHYA 4NXNT 5ABFB 4DR4T 4YTNA 4JI6T 5FY0A 2E9XD 1D1CA 3KV4A 1HX1B 4XZCA 4EGWA 3TLTA 2NOXA 1R8IA 4X65T 4CN4A 3GN5A 3IHRA 2LSGA 4ERRA 2X9HA 4K0KT 4NPPA 3KV6A 1KF6A 3AE9A 2EHOB 4O2AE 5IWAT 5GONE 2JQHA 3AEFA 4NUUA 5HCMA 3CX7B 3TLVA 5JDMA 2H7OA 1X79A 4K0UA 3VRBA 2UXCT 4AKIA 4OYKA 2K9AA 4H9NC 4I50E 5HEGA 5C8YE 3WAJA 4H9SE 2WDRA 4CXWA 1WYCA 5LCYA 5JR9B 1QUUA 2B1EA 3OYZA 2JQKA 5DQVA 4ZS3A 2BG9A 2BVLA 3F2EA 2KINB 4XBFB 1IAPA 4MHCA 2A9UA 3KDSE 2K5BB 1S94A 4KHZF 4C91A 4IDQA 2UXXB 1V9DA 2YOEA 4LFAT 2VQFT 3NBXX 3P4SA 5H6RB 2CMRA 2BKPA 2DHRA 2HPLA 4TN7B 4LMLA 4UELA 3ONLC 4MLKA 2WU2A 3AA6B 1NENA 2N2NA 3OTOT 1J1JA 1Z8UA 4ZS2A 1NAFA 3N9MA 3LK3B 5JH7E 1YD8G 1I94T 1FJGT 2WY2A 2QVAA 1MMNA 4CN6A 4PAGA 3H3MA 4GK0E 4AKRB 4LF8T 5LB7B 5FNVE 2FJBA 3I0QA 3AB3B 5JTGA 2I59A 3W15B 2VK9A 4UR9A 4X1IE 4F8HA 3O9XA 4DIDB 3EAMA 4WYVA 3AE6A 2XZEA 2Y6XA 2BS2A 2D0TA 2V7KA 2WM9A 3MK7C 3KVBA 4ZZBA 1YQ4A 4ILUA 4U31A 4JEHB 3NRXA 2CXLA 2E2AA 2YDQA 3LBXB 2X0YA 4DV7T 2IMLA 2V7LA 2WP9A 4N78D 4U7IA 5DQWA 3U3IA 2OV9A 2XJ7A 2L9QA 4JBWF 5HEJA 3FZLB 4U3CA 1HF8A 3UUNA 1FIOA 2C0SA 1T98A 2E5VA 3FXEB 2NTYA 3KINB 3LBXA 4GOUA 2C5KT 3QNUA 4H63H 3UU3A 4PJLA 3PUYF 4QKNA 3P4WA 2F4VT 2I0MA 3N9QA 1D0YA 3SWHA 2NWBA 4TV9E 3DTOA 4GIWA 5AQIB 4B3RT 2D9DA 2ZM6T 1BR4A 2XPKA 3BK9A 5EK4A 3AE8A 3RIUA 5LXTE 2D2SA 4GKJT 2MAWA 3N9OA 2AE9A 3FBZA 4LF9T 2NR4A 4J2CA 2M67A 2NW8A 2LOSA 5L3CB 1CUNA 3T1HT 5JDQA 4O2BE 2WAUA 1ZP0A 3PDYA 2DL1A 4IGUA 3LSVA 1HG5A 3OJAA 2LLYA 3PTRB 2DLRA 4H9OC 2Q9QD 2V6XA 3O4XE 3L8RA 1MIVA 1WRDA 5AQRB 1G73A 5J2UE 4O4IE 5HXHA 3PUQA 3N2KE 3CQCB 5E0OA 5LG3A 1IBLT 1WR6A 2BKNA 2LSKA 5L47A 4EEBA 4M1PA 3FXDB 4ISSA 1HG2A 2WCAA 4PW8A 5BMVE 3RRCA 4LMKA 1QSDA 3QB5A 3FZMB 3QUJA 4L0RA 4E7ZA 3HI2A 1M62A 3QB5K 1YKEB 2Y48B 4U74A 2X0HA 4KHPT 3M3ZB 4QHOA 2H3RA 3OYXA 1ZKEA 3PUWF 2YK0A 5HXCA 3SFDA 5FXVA 2EHOA 3SFEA 4DV4T 2LRKA 5F8PA 2BZBA 4HFVA 1XDOA 2XY8B 4LF7T 2A2FX 3WAKA 5LGNB 3H3AA 2XQ4A 3OBVE 2XAGB 5FXXA 2YDRA 4CN1A 2UUBT 3UUBA 3UQ7A 2FUPA 4PFPA 4NXMT 3RKGA 2ZLYA 4HFIA 5JDFA 2W0GA 3UQ4A 5JDGA 1UCUA 3MJXA 5L3BB 1SHZC 3CQXC 3AE7A 3AE5A 4MALA 3UFGA 4PFOA 3CIRA 3ZMZB 3N2OA 4UIGA 4HWFA 2JPFA 3EUHA 4IT4A 3AE2A 4QWNB 2M6IA 5CJ5A 1HX8A 5HYAA 2KNDA 2L8KA 3JADA 4JI8T 3B5MA 3F31A 4EV6A 5LHGB 3ZC0A 3EHZA 3KV5A 2ZM0A 2WWVA 3TLUA 4A56A 4YXDA 5AQNB 1KK7A 2XAQB 3AAEB 2JQQA 2C5JA 2W2UA 4DUZT 2BBHA 2J62A 3P4RA 2WU5A 4ASKA 4DV0T 2UXDT 3VKHA 1XWMA 2C5IT 3CPZA 3O1HA 3DP7A 3ZJ2A 5AQKB 2JMKA 3E08A 3VU7H 4EYYR 5C3JA 1KNPA 1UURA 2KSRA 3WI3A 1XDPA 2K48A 2QRXA 2V7MA 4GYSA 4KBMB 1ZV4X 4LF6T 2XSAA 2MYSA 2E8IA 2OLTA 2NTXA 4AKGA 2LKHA 3K3QC 3K3OA 4OHFA 4UF0B 1OXZA 3MZKB 1B7TA 2CWOA 3MA9A 2IUBA 2KZ7B 2XQ7A 1KFYA 1US7B 3CX6B 3KBUA 5AQOB 2ES0A 4HKAA 4BJMA 3RRWA 3CMLA 3HKCE 4HFDA 1BR1A 3EABA 3TLSA 5J1GA 4EXTA 2IAKA 3J7Yq 2W66A 4IDZA 1NWMX 5L3EB 2L3LA 2IDOB 2ZMAA 3L39A 2P9BA 2CCQA 3AECA 5L3DB 3T1YT 1L0VA 5FKYA 5HEHA 3LK2B 5ABHA 4JYAT 3C4XA 4OFZA 4QXBB 3KVAA 4JI5T 3RC3A 3AE1A 1VOMA 4CXYA 1E1HB 1Z0PA 4HFEA 4WW0A 4DV1T 5AQUB 4V1Av 4IDOA 4HFBA 5AQMB 4I4TE 3PJAA 2WB5A 3ZLIA 1T8BA 2LSJA 4CI2B 2CBJA 2BDEA 4UVAB 4Z8XA 2MBGA 4YFSA 4UVCB 4AKHA 5FVKA 2CBIA 4G63A 4JI2T 1N33T 2FJDA 5L4HA 3RKOA 1UGOA 2CRBA 1G8XA 5A1LA 5LYJE 5J0ZA 5LMNT 4H63V 4PK6A 5LA6E 1OEDE 3R84B 1W0AA 3IF8B 2CM0A 3AA7B 3SS1A 3ZSTA 3ZT6A 4DVDA 3UU8A 1HNXT 2WDVA 4IE6A 1OWAA 2PJQA 3UULA 1JNZA 2CLYC 3LG7A 4LFCT 4HWDA 5LNKA 2KT9A 4OYJA 1KNRA 3HL6A 3ZN0B 4E7SA 3GN5B 5J2TE 4ILBA 4ZXLA 4ILCA 3PUXF 1W09A 1ZHCA 5LMUT 3V5UA 5HXEA 4QH1A 4KP3C 4ZI2D 4YY3T 1O3XA 2V8SV 3MXZA 3UT5E 4ZEYA 4DV3T 1KNZA 2YKSA 3U78A 1UK5A 3TKLB 3VHLA 2V7IA 4ZZCA 2G0UA 5LBMA 3HR0A 4AIUA 2QYWA 3NKZA 3BQIA 3N9PA 3UUXB 2LEHA 5EK2A 3ANWB 2VL0A 5FMNA 1VRBA 5AFUL 1QLBA 2XASB 3JC6D 5JVDE 1HCIA 3RYIE 1KEYA 4U7YA 5FL0A 4HN9A 2V1DB 3UUMA 4DR5T 4TWDA 3F57A 5FXZA 3JAEA 5L4EA 4FI5A 3N5LA 4YTMA 2CEAA 3RQWA 3RIUC 4ZHQE 5KDMC 2XAJB 1XZYA 2E9XA 4HFCA 4O8SA 4B6XA 4GKKT 3AA1B 4PJNA 4QH4A 4YSZA 3A5XA 3K1SA 4QXHB 4UEMA 4YLHA 2XQ8A 3AEDA 3KV9A 4XAXB 1Y01A 3SOLA 3ZSSA 4EAHA 2LJLA 1WYBA 4CI3B 5ABFA 1MIWA 1OEDB 4UVBB 2V6YB 4AISA 2HH7A 2J1DG 2XQAA 4LFBT 3Q5DA 5HEUA 3CKDA 1OEDC 4PK4A 5LGUB 3OKQA 2SPCA 4IE4A 2IC9A 4WBOA 5ABEA 5JR9C 3ZMTB 4BJNA 1MMDA 4DO0A 4CQIA 3HKEE 3RX6A 3VR9A 2CHNA 1BR0A 2VKOA 3OVUA 2XAFB 2LE8A 2UXBT 2V5DA 3MACA 4I55E 5HCJA 1XNQT 4TWHA 2CXDA 4O4LE 2BG9C 3RH3A 2BS4A 4HWCA 5L2LA 2IIUA 4BAYB 1U5PA 4O4JE 2VWAA 3ZJ1A 3ZYKA 2CPTA 5FP3A 3UU6A 4AXPA 3P4PA 1VCSA 5AQFB 3QK6A 5L3GB 5JREA 3EVYA 5CFBA 3RYFE 1SUMB 2LSIA 3FBLA 2IC6A 2WQYA 3AEAA 3AVSA 3FZFB 4IIJE 5AQJB 5FY7A 4HWHA 2PG8A 2UUCT 2X67A 3C51A 3QC9A 2LHNA 2LOPA 3KFWX 2HN1A 2WSSV 3G06A 2WS3A 2JRKA 4DR1T 4QH5A 3ZC1A 4ZI3D 3PUAA 2A72A 2JIWA 4FJOA 4AI6A 4U2YA 2VKHA 2HN2A 2KXPB 3AE4A 3PUGA 1ZOYA 3CX8B 5ABGA 2HHHT 2H88A 3H37A 2N1GA 2VVNA 1U4QA 2K24A 2ODVA 3N9LA 5AQLB 3R6NA 3ZPOA 4DR6T 1WCRA 2YU1A 4DMWA 3AXJB 1AJ3A 1IBKT 3FZKB 3AEGA 4OX9T 2ZM8A 1E2AA 2LM2A 2PFVA 4HFHA 3RIFA 5BR8T 4DR3T 4JI3T 4IDPA 3AEEA 3I9YA 5FY1A 3ZYMA 2XM2A 2YU2A 3C50A 2Q9QA 3RIAA 3ZMVB 3M65A 4JUYA 3JCFA 2UXNB 3K8PC 3ONXA 3LK42 4LMJA 3Q5WA 3VRAA 2FBWA 4P1NA 4LF5T 1YKHB 3PJAJ 5JQGE 3KBTA 2Q9QB 4DV5T 1LKXA 2LHRA 2XSBA 2BG9B 2ACXA 2XTLA 3C98B 1FMVA 3EDUA 5JR9A 4A97A 4CI1B 5JRCB 2UU9T
chains in the Genus database with same CATH topology
4X62T 1J5ET 2ZM6T 2VQET 1HNXT 1XMQT 4JV5T 4GKJT 4LF9T 4LFCT 4LF4T 4B3ST 1HR0T 1IBMT 3T1HT 2UUAT 5LMUT 2E5LT 4AQYT 4JI1T 4DR7T 4B3MT 4DV3T 4DV2T 4DV6T 1XNRT 1IBLT 4JI4T 4DR5T 1N36T 4KHPT 4DV4T 5LMNT 4GKKT 4B3TT 4X65T 4X66T 4DR2T 4LF7T 2UUBT 4NXMT 4DUYT 4LFBT 4NXNT 4DR4T 4JI6T 4K0KT 5IWAT 4JI8T 2UXBT 1HNWT 2UXCT 1XNQT 4DUZT 4DV0T 2UXDT 2UUCT 4LFAT 2VQFT 4LF6T 4DR1T 3OTOT 1I94T 1FJGT 4YY3T 2HHHT 4LF8T 4DR6T 1IBKT 4OX9T 5BR8T 3T1YT 4JI3T 4DR3T 4JYAT 4X64T 4JI5T 4DV7T 4JI0T 4DV1T 4JI7T 4LF5T 1HNZT 4YHHT 1N32T 4DV5T 1XMOT 4JI2T 2F4VT 1N34T 1N33T 2UU9T 4B3RT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 T;  1J5E T;  2ZM6 T;  2VQE T;  1HNX T;  1XMQ T;  4JV5 T;  4GKJ T;  4LF9 T;  4LFC T;  4LF4 T;  4B3S T;  1HR0 T;  1IBM T;  3T1H T;  2UUA T;  5LMU T;  2E5L T;  4AQY T;  4JI1 T;  4DR7 T;  4B3M T;  4DV3 T;  4DV2 T;  4DV6 T;  1XNR T;  1IBL T;  4JI4 T;  4DR5 T;  1N36 T;  4KHP T;  4DV4 T;  5LMN T;  4GKK T;  4B3T T;  4X65 T;  4X66 T;  4DR2 T;  4LF7 T;  2UUB T;  4NXM T;  4DUY T;  4LFB T;  4NXN T;  4DR4 T;  4JI6 T;  4K0K T;  5IWA T;  4JI8 T;  2UXB T;  1HNW T;  2UXC T;  1XNQ T;  4DUZ T;  4DV0 T;  2UXD T;  2UUC T;  4LFA T;  2VQF T;  4LF6 T;  4DR1 T;  3OTO T;  1I94 T;  1FJG T;  4YY3 T;  2HHH T;  4LF8 T;  4DR6 T;  1IBK T;  4OX9 T;  5BR8 T;  3T1Y T;  4JI3 T;  4DR3 T;  4JYA T;  4X64 T;  4JI5 T;  4DV7 T;  4JI0 T;  4DV1 T;  4JI7 T;  4LF5 T;  1HNZ T;  4YHH T;  1N32 T;  4DV5 T;  1XMO T;  4JI2 T;  2F4V T;  1N34 T;  1N33 T;  2UU9 T;  4B3R T; 
#chains in the Genus database with same CATH topology
 4EZH A;  2X9W A;  2Z6E A;  2PBI A;  2KWI B;  4TUY E;  2V26 A;  4GK5 E;  3RQU A;  4TX5 A;  1MIY A;  3UFE A;  5HWX A;  4JV5 T;  4DND A;  4KUM B;  2LRL A;  4X66 T;  4KX6 A;  3L3P A;  2NW9 A;  3VR8 A;  4ADZ A;  4AQF C;  2J47 A;  4B3S T;  3UU4 A;  2Q9Q C;  3Q5X A;  3Q9D A;  4A5X A;  1HR0 T;  1M7K A;  5M4Y A;  2OA5 A;  2ZM2 A;  3SRZ A;  3ZMU B;  4P0A A;  2E5L T;  2UUA T;  3Q2M A;  4AQY T;  1YQ3 A;  3PUZ F;  2X0L B;  3L09 A;  4X1K E;  4G2A A;  5FXW A;  3AAI A;  4IDN A;  2MTQ A;  4PNI A;  4EOZ B;  4JLE A;  3TLW A;  4HTE A;  4DBQ A;  4OK0 A;  5IYZ E;  4BA9 A;  2QA7 A;  3V5S A;  3UTK A;  3ETV A;  1WFD A;  2BS3 A;  2YN6 A;  2WZH A;  5JDH A;  4CXX A;  2W00 A;  1XNR T;  2IW5 B;  1GQE A;  4EYU A;  5KXJ A;  4F6R C;  2XUE A;  4YJ2 E;  2WWU A;  3C4W A;  4IL4 A;  3QOF A;  2KWH A;  3HKB E;  2FJE A;  4ILA A;  5HEO A;  1W9R A;  2XM1 A;  1D0X A;  1WLX A;  2JMH A;  3A8Y C;  2J4G A;  2W4X A;  3AA0 B;  4WZX A;  3N2G E;  4TNV A;  4AQG A;  2DI4 A;  4YSY A;  2ODU A;  2LT3 A;  4ZI2 C;  2VVS A;  1D0Z A;  1X9B A;  2RP4 A;  3EDV A;  4B3T T;  3RGL A;  4X20 E;  4EZ4 A;  5L3F B;  5LJM A;  2YEV C;  2WMO A;  3FZH B;  3LFM A;  1HTJ F;  1SE7 A;  3MKD A;  3P7I A;  3IEE A;  4IE7 A;  4IST A;  4MFR A;  4PJJ A;  3ZN1 B;  1D1B A;  2V6Y A;  4P0B A;  4DMV A;  2X9X A;  1LRZ A;  4DUY T;  5FL1 A;  3OPC A;  4X5T A;  3NRY A;  5AQH B;  4ZOL E;  4YSX A;  1HFA A;  3C4Z A;  3D0T A;  4I0U A;  2DWG A;  2KMF A;  1FEW A;  2E9X B;  2V7J A;  4NUV A;  2WZI A;  3ZEF B;  4P09 A;  2BG9 E;  2W61 A;  1LVK A;  1HNW T;  3VKG A;  5C2T A;  4WNK A;  3ZT7 A;  3LDQ B;  4HGA A;  3I1A A;  5AQT B;  2QGS A;  3CWZ B;  3B57 A;  5JRC A;  3AE3 A;  3O1I A;  2BBJ A;  4H9P C;  4YHJ A;  2JQ9 A;  3S4U A;  2PTF A;  2D5U A;  4JI1 T;  2XQ5 A;  1UUS A;  4U2Z A;  3PUV F;  4AQF A;  4EIW A;  1EZ3 A;  1YW0 A;  2CWY A;  3DJB A;  3FB2 A;  4TNW A;  5LOV E;  4DBR A;  4HE8 A;  2XQ3 A;  4JEU B;  2W62 A;  4IE5 A;  4C90 A;  5CA0 E;  2BKO A;  1JNR A;  4PJM A;  2CHO A;  2KLQ A;  3CVR A;  3PUR A;  5CA1 E;  2D0U A;  3ETU A;  2DNX A;  4Z91 A;  2MOZ A;  5F3J A;  2LM9 A;  2XQ9 A;  5FYM A;  4EB6 E;  2NW7 A;  5LHH B;  2CE7 A;  4KI0 F;  4IHJ E;  1NEK A;  1E7P A;  2VKJ A;  3AVR A;  3CQG B;  4GYR A;  2K3W A;  4HWI B;  4H9Q C;  3GWH A;  5AQP B;  5AQQ B;  5H6Q B;  2V5C A;  4AKL A;  3IA3 A;  5LJN A;  1IJ5 A;  5HAX A;  3I9W A;  5AQS B;  3AXJ A;  3ZYL A;  1BR2 A;  5AQV B;  5HWY A;  3ZT5 A;  2NP9 A;  4IE0 A;  1DU2 A;  4ANJ A;  3RC8 A;  1YXR A;  5EZY E;  4MBQ A;  4QXC B;  3JC6 C;  4O4H E;  2DCF A;  2LSY A;  1UX5 A;  3LJC A;  3P4Q A;  5LHI B;  1IZN B;  4COF A;  4X64 T;  1MMA A;  1T72 A;  2R6G F;  2VKD A;  3O1J A;  5LBQ B;  4JI0 T;  3ZCJ A;  4U33 A;  3ONJ A;  3RI5 A;  4TZ4 C;  5ADX L;  4JI7 T;  2W63 A;  2RA1 A;  2MPK A;  3EI0 A;  3E0Z A;  2VL8 A;  1HNZ T;  3HKD E;  5F5W A;  4YHH T;  5KX5 E;  2X9Y A;  2DWK A;  2XAH B;  1UX4 A;  5HXR A;  1N32 T;  2ACZ A;  1Y64 B;  2H89 A;  4TV8 E;  2FJA A;  2XQ6 A;  4L5G A;  3PE0 A;  2WDQ A;  5LGT B;  1XMO T;  3GMI A;  3NVO A;  5HXS A;  3RF1 A;  1N34 T;  5TAO A;  5FVL A;  2X66 A;  2HPJ A;  5LP6 E;  2H7V C;  4U72 A;  4X62 T;  4QX8 B;  5LG4 A;  4ZI3 C;  1MNE A;  3ZKR A;  3RLF F;  3T8O A;  3K3N A;  5CGM A;  1J5W A;  2CA5 A;  2VQE T;  1J5E T;  4QX7 B;  2EHO C;  3CK6 A;  1ZEE A;  3RPU A;  1XMQ T;  2XQY A;  2VB6 A;  1D1A A;  1VCT A;  2GK9 A;  2X68 A;  4UV9 B;  4IRE A;  3C64 A;  3NZQ A;  2BVM A;  2CXF A;  3FHN A;  3Q5E A;  4LF4 T;  2M6B A;  3J9X 1;  3RHW A;  1I6Z A;  1T7S A;  3BQK A;  2X51 A;  4UF0 A;  1CHU A;  1IJ6 A;  3HA4 A;  2Y8D A;  2YDS A;  5DJQ C;  1IBM T;  3JAF A;  5DAB A;  2B76 A;  4A98 A;  2RPA A;  4KMC A;  4I43 B;  3ZMS B;  4DR7 T;  5JDL A;  2N9D A;  3X1D A;  4B3M T;  1W0B A;  2XHE B;  4UV8 B;  2WMN A;  4WBN E;  4DV2 T;  1SA0 E;  3PV0 F;  4H9R C;  4Z90 A;  1LVF A;  3UU5 A;  3PU8 A;  2I6H A;  2JJ9 A;  4IL9 A;  3RYC E;  4DV6 T;  3NZP A;  2EHO D;  2A3D A;  1FMW A;  3GA8 A;  4X1Y E;  3A7M A;  3AAA B;  3I0O A;  3BQL A;  3P50 A;  1S35 A;  2CLY B;  4JI4 T;  1HS7 A;  2WBL A;  2YIN A;  4EED A;  4NIQ A;  2IHR 1;  1N36 T;  1MND A;  2W67 A;  2LKG A;  3N9N A;  3ESL A;  3IBP A;  3AEB A;  3PU3 A;  3PUS A;  4HEA A;  4YTP A;  2VAS A;  4UXN B;  5EK3 A;  4L9I A;  3ANW A;  5ETW A;  1H7C A;  4YJ3 E;  5CB4 E;  4YT0 A;  4ZI7 E;  1WR0 A;  4TWF A;  4Q25 A;  2E9X C;  3P8C D;  3NWI A;  5KMG P;  5AQG B;  2AXD S;  3ABV A;  5IUX A;  5JDN A;  4DR2 T;  4PK5 A;  4CZZ B;  2VUR A;  1MMG A;  3B13 A;  3E22 E;  1OED A;  3RYH E;  3ZCI A;  5IHY A;  4NXN T;  5ABF B;  4DR4 T;  4YTN A;  4JI6 T;  5FY0 A;  2E9X D;  1D1C A;  3KV4 A;  1HX1 B;  4XZC A;  4EGW A;  3TLT A;  2NOX A;  1R8I A;  4X65 T;  4CN4 A;  3GN5 A;  3IHR A;  2LSG A;  4ERR A;  2X9H A;  4K0K T;  4NPP A;  3KV6 A;  1KF6 A;  3AE9 A;  2EHO B;  4O2A E;  5IWA T;  5GON E;  2JQH A;  3AEF A;  4NUU A;  5HCM A;  3CX7 B;  3TLV A;  5JDM A;  2H7O A;  1X79 A;  4K0U A;  3VRB A;  2UXC T;  4AKI A;  4OYK A;  2K9A A;  4H9N C;  4I50 E;  5HEG A;  5C8Y E;  3WAJ A;  4H9S E;  2WDR A;  4CXW A;  1WYC A;  5LCY A;  5JR9 B;  1QUU A;  2B1E A;  3OYZ A;  2JQK A;  5DQV A;  4ZS3 A;  2BG9 A;  2BVL A;  3F2E A;  2KIN B;  4XBF B;  1IAP A;  4MHC A;  2A9U A;  3KDS E;  2K5B B;  1S94 A;  4KHZ F;  4C91 A;  4IDQ A;  2UXX B;  1V9D A;  2YOE A;  4LFA T;  2VQF T;  3NBX X;  3P4S A;  5H6R B;  2CMR A;  2BKP A;  2DHR A;  2HPL A;  4TN7 B;  4LML A;  4UEL A;  3ONL C;  4MLK A;  2WU2 A;  3AA6 B;  1NEN A;  2N2N A;  3OTO T;  1J1J A;  1Z8U A;  4ZS2 A;  1NAF A;  3N9M A;  3LK3 B;  5JH7 E;  1YD8 G;  1I94 T;  1FJG T;  2WY2 A;  2QVA A;  1MMN A;  4CN6 A;  4PAG A;  3H3M A;  4GK0 E;  4AKR B;  4LF8 T;  5LB7 B;  5FNV E;  2FJB A;  3I0Q A;  3AB3 B;  5JTG A;  2I59 A;  3W15 B;  2VK9 A;  4UR9 A;  4X1I E;  4F8H A;  3O9X A;  4DID B;  3EAM A;  4WYV A;  3AE6 A;  2XZE A;  2Y6X A;  2BS2 A;  2D0T A;  2V7K A;  2WM9 A;  3MK7 C;  3KVB A;  4ZZB A;  1YQ4 A;  4ILU A;  4U31 A;  4JEH B;  3NRX A;  2CXL A;  2E2A A;  2YDQ A;  3LBX B;  2X0Y A;  4DV7 T;  2IML A;  2V7L A;  2WP9 A;  4N78 D;  4U7I A;  5DQW A;  3U3I A;  2OV9 A;  2XJ7 A;  2L9Q A;  4JBW F;  5HEJ A;  3FZL B;  4U3C A;  1HF8 A;  3UUN A;  1FIO A;  2C0S A;  1T98 A;  2E5V A;  3FXE B;  2NTY A;  3KIN B;  3LBX A;  4GOU A;  2C5K T;  3QNU A;  4H63 H;  3UU3 A;  4PJL A;  3PUY F;  4QKN A;  3P4W A;  2F4V T;  2I0M A;  3N9Q A;  1D0Y A;  3SWH A;  2NWB A;  4TV9 E;  3DTO A;  4GIW A;  5AQI B;  4B3R T;  2D9D A;  2ZM6 T;  1BR4 A;  2XPK A;  3BK9 A;  5EK4 A;  3AE8 A;  3RIU A;  5LXT E;  2D2S A;  4GKJ T;  2MAW A;  3N9O A;  2AE9 A;  3FBZ A;  4LF9 T;  2NR4 A;  4J2C A;  2M67 A;  2NW8 A;  2LOS A;  5L3C B;  1CUN A;  3T1H T;  5JDQ A;  4O2B E;  2WAU A;  1ZP0 A;  3PDY A;  2DL1 A;  4IGU A;  3LSV A;  1HG5 A;  3OJA A;  2LLY A;  3PTR B;  2DLR A;  4H9O C;  2Q9Q D;  2V6X A;  3O4X E;  3L8R A;  1MIV A;  1WRD A;  5AQR B;  1G73 A;  5J2U E;  4O4I E;  5HXH A;  3PUQ A;  3N2K E;  3CQC B;  5E0O A;  5LG3 A;  1IBL T;  1WR6 A;  2BKN A;  2LSK A;  5L47 A;  4EEB A;  4M1P A;  3FXD B;  4ISS A;  1HG2 A;  2WCA A;  4PW8 A;  5BMV E;  3RRC A;  4LMK A;  1QSD A;  3QB5 A;  3FZM B;  3QUJ A;  4L0R A;  4E7Z A;  3HI2 A;  1M62 A;  3QB5 K;  1YKE B;  2Y48 B;  4U74 A;  2X0H A;  4KHP T;  3M3Z B;  4QHO A;  2H3R A;  3OYX A;  1ZKE A;  3PUW F;  2YK0 A;  5HXC A;  3SFD A;  5FXV A;  2EHO A;  3SFE A;  4DV4 T;  2LRK A;  5F8P A;  2BZB A;  4HFV A;  1XDO A;  2XY8 B;  4LF7 T;  2A2F X;  3WAK A;  5LGN B;  3H3A A;  2XQ4 A;  3OBV E;  2XAG B;  5FXX A;  2YDR A;  4CN1 A;  2UUB T;  3UUB A;  3UQ7 A;  2FUP A;  4PFP A;  4NXM T;  3RKG A;  2ZLY A;  4HFI A;  5JDF A;  2W0G A;  3UQ4 A;  5JDG A;  1UCU A;  3MJX A;  5L3B B;  1SHZ C;  3CQX C;  3AE7 A;  3AE5 A;  4MAL A;  3UFG A;  4PFO A;  3CIR A;  3ZMZ B;  3N2O A;  4UIG A;  4HWF A;  2JPF A;  3EUH A;  4IT4 A;  3AE2 A;  4QWN B;  2M6I A;  5CJ5 A;  1HX8 A;  5HYA A;  2KND A;  2L8K A;  3JAD A;  4JI8 T;  3B5M A;  3F31 A;  4EV6 A;  5LHG B;  3ZC0 A;  3EHZ A;  3KV5 A;  2ZM0 A;  2WWV A;  3TLU A;  4A56 A;  4YXD A;  5AQN B;  1KK7 A;  2XAQ B;  3AAE B;  2JQQ A;  2C5J A;  2W2U A;  4DUZ T;  2BBH A;  2J62 A;  3P4R A;  2WU5 A;  4ASK A;  4DV0 T;  2UXD T;  3VKH A;  1XWM A;  2C5I T;  3CPZ A;  3O1H A;  3DP7 A;  3ZJ2 A;  5AQK B;  2JMK A;  3E08 A;  3VU7 H;  4EYY R;  5C3J A;  1KNP A;  1UUR A;  2KSR A;  3WI3 A;  1XDP A;  2K48 A;  2QRX A;  2V7M A;  4GYS A;  4KBM B;  1ZV4 X;  4LF6 T;  2XSA A;  2MYS A;  2E8I A;  2OLT A;  2NTX A;  4AKG A;  2LKH A;  3K3Q C;  3K3O A;  4OHF A;  4UF0 B;  1OXZ A;  3MZK B;  1B7T A;  2CWO A;  3MA9 A;  2IUB A;  2KZ7 B;  2XQ7 A;  1KFY A;  1US7 B;  3CX6 B;  3KBU A;  5AQO B;  2ES0 A;  4HKA A;  4BJM A;  3RRW A;  3CML A;  3HKC E;  4HFD A;  1BR1 A;  3EAB A;  3TLS A;  5J1G A;  4EXT A;  2IAK A;  3J7Y q;  2W66 A;  4IDZ A;  1NWM X;  5L3E B;  2L3L A;  2IDO B;  2ZMA A;  3L39 A;  2P9B A;  2CCQ A;  3AEC A;  5L3D B;  3T1Y T;  1L0V A;  5FKY A;  5HEH A;  3LK2 B;  5ABH A;  4JYA T;  3C4X A;  4OFZ A;  4QXB B;  3KVA A;  4JI5 T;  3RC3 A;  3AE1 A;  1VOM A;  4CXY A;  1E1H B;  1Z0P A;  4HFE A;  4WW0 A;  4DV1 T;  5AQU B;  4V1A v;  4IDO A;  4HFB A;  5AQM B;  4I4T E;  3PJA A;  2WB5 A;  3ZLI A;  1T8B A;  2LSJ A;  4CI2 B;  2CBJ A;  2BDE A;  4UVA B;  4Z8X A;  2MBG A;  4YFS A;  4UVC B;  4AKH A;  5FVK A;  2CBI A;  4G63 A;  4JI2 T;  1N33 T;  2FJD A;  5L4H A;  3RKO A;  1UGO A;  2CRB A;  1G8X A;  5A1L A;  5LYJ E;  5J0Z A;  5LMN T;  4H63 V;  4PK6 A;  5LA6 E;  1OED E;  3R84 B;  1W0A A;  3IF8 B;  2CM0 A;  3AA7 B;  3SS1 A;  3ZST A;  3ZT6 A;  4DVD A;  3UU8 A;  1HNX T;  2WDV A;  4IE6 A;  1OWA A;  2PJQ A;  3UUL A;  1JNZ A;  2CLY C;  3LG7 A;  4LFC T;  4HWD A;  5LNK A;  2KT9 A;  4OYJ A;  1KNR A;  3HL6 A;  3ZN0 B;  4E7S A;  3GN5 B;  5J2T E;  4ILB A;  4ZXL A;  4ILC A;  3PUX F;  1W09 A;  1ZHC A;  5LMU T;  3V5U A;  5HXE A;  4QH1 A;  4KP3 C;  4ZI2 D;  4YY3 T;  1O3X A;  2V8S V;  3MXZ A;  3UT5 E;  4ZEY A;  4DV3 T;  1KNZ A;  2YKS A;  3U78 A;  1UK5 A;  3TKL B;  3VHL A;  2V7I A;  4ZZC A;  2G0U A;  5LBM A;  3HR0 A;  4AIU A;  2QYW A;  3NKZ A;  3BQI A;  3N9P A;  3UUX B;  2LEH A;  5EK2 A;  3ANW B;  2VL0 A;  5FMN A;  1VRB A;  5AFU L;  1QLB A;  2XAS B;  3JC6 D;  5JVD E;  1HCI A;  3RYI E;  1KEY A;  4U7Y A;  5FL0 A;  4HN9 A;  2V1D B;  3UUM A;  4DR5 T;  4TWD A;  3F57 A;  5FXZ A;  3JAE A;  5L4E A;  4FI5 A;  3N5L A;  4YTM A;  2CEA A;  3RQW A;  3RIU C;  4ZHQ E;  5KDM C;  2XAJ B;  1XZY A;  2E9X A;  4HFC A;  4O8S A;  4B6X A;  4GKK T;  3AA1 B;  4PJN A;  4QH4 A;  4YSZ A;  3A5X A;  3K1S A;  4QXH B;  4UEM A;  4YLH A;  2XQ8 A;  3AED A;  3KV9 A;  4XAX B;  1Y01 A;  3SOL A;  3ZSS A;  4EAH A;  2LJL A;  1WYB A;  4CI3 B;  5ABF A;  1MIW A;  1OED B;  4UVB B;  2V6Y B;  4AIS A;  2HH7 A;  2J1D G;  2XQA A;  4LFB T;  3Q5D A;  5HEU A;  3CKD A;  1OED C;  4PK4 A;  5LGU B;  3OKQ A;  2SPC A;  4IE4 A;  2IC9 A;  4WBO A;  5ABE A;  5JR9 C;  3ZMT B;  4BJN A;  1MMD A;  4DO0 A;  4CQI A;  3HKE E;  3RX6 A;  3VR9 A;  2CHN A;  1BR0 A;  2VKO A;  3OVU A;  2XAF B;  2LE8 A;  2UXB T;  2V5D A;  3MAC A;  4I55 E;  5HCJ A;  1XNQ T;  4TWH A;  2CXD A;  4O4L E;  2BG9 C;  3RH3 A;  2BS4 A;  4HWC A;  5L2L A;  2IIU A;  4BAY B;  1U5P A;  4O4J E;  2VWA A;  3ZJ1 A;  3ZYK A;  2CPT A;  5FP3 A;  3UU6 A;  4AXP A;  3P4P A;  1VCS A;  5AQF B;  3QK6 A;  5L3G B;  5JRE A;  3EVY A;  5CFB A;  3RYF E;  1SUM B;  2LSI A;  3FBL A;  2IC6 A;  2WQY A;  3AEA A;  3AVS A;  3FZF B;  4IIJ E;  5AQJ B;  5FY7 A;  4HWH A;  2PG8 A;  2UUC T;  2X67 A;  3C51 A;  3QC9 A;  2LHN A;  2LOP A;  3KFW X;  2HN1 A;  2WSS V;  3G06 A;  2WS3 A;  2JRK A;  4DR1 T;  4QH5 A;  3ZC1 A;  4ZI3 D;  3PUA A;  2A72 A;  2JIW A;  4FJO A;  4AI6 A;  4U2Y A;  2VKH A;  2HN2 A;  2KXP B;  3AE4 A;  3PUG A;  1ZOY A;  3CX8 B;  5ABG A;  2HHH T;  2H88 A;  3H37 A;  2N1G A;  2VVN A;  1U4Q A;  2K24 A;  2ODV A;  3N9L A;  5AQL B;  3R6N A;  3ZPO A;  4DR6 T;  1WCR A;  2YU1 A;  4DMW A;  3AXJ B;  1AJ3 A;  1IBK T;  3FZK B;  3AEG A;  4OX9 T;  2ZM8 A;  1E2A A;  2LM2 A;  2PFV A;  4HFH A;  3RIF A;  5BR8 T;  4DR3 T;  4JI3 T;  4IDP A;  3AEE A;  3I9Y A;  5FY1 A;  3ZYM A;  2XM2 A;  2YU2 A;  3C50 A;  2Q9Q A;  3RIA A;  3ZMV B;  3M65 A;  4JUY A;  3JCF A;  2UXN B;  3K8P C;  3ONX A;  3LK4 2;  4LMJ A;  3Q5W A;  3VRA A;  2FBW A;  4P1N A;  4LF5 T;  1YKH B;  3PJA J;  5JQG E;  3KBT A;  2Q9Q B;  4DV5 T;  1LKX A;  2LHR A;  2XSB A;  2BG9 B;  2ACX A;  2XTL A;  3C98 B;  1FMV A;  3EDU A;  5JR9 A;  4A97 A;  4CI1 B;  5JRC B;  2UU9 T; 
#chains in the Genus database with same CATH homology
 4X62 T;  1J5E T;  2ZM6 T;  2VQE T;  1HNX T;  1XMQ T;  4JV5 T;  4GKJ T;  4LF9 T;  4LFC T;  4LF4 T;  4B3S T;  1HR0 T;  1IBM T;  3T1H T;  2UUA T;  5LMU T;  2E5L T;  4AQY T;  4JI1 T;  4DR7 T;  4B3M T;  4DV3 T;  4DV2 T;  4DV6 T;  1XNR T;  1IBL T;  4JI4 T;  4DR5 T;  1N36 T;  4KHP T;  4DV4 T;  5LMN T;  4GKK T;  4B3T T;  4X65 T;  4X66 T;  4DR2 T;  4LF7 T;  2UUB T;  4NXM T;  4DUY T;  4LFB T;  4NXN T;  4DR4 T;  4JI6 T;  4K0K T;  5IWA T;  4JI8 T;  2UXB T;  1HNW T;  2UXC T;  1XNQ T;  4DUZ T;  4DV0 T;  2UXD T;  2UUC T;  4LFA T;  2VQF T;  4LF6 T;  4DR1 T;  3OTO T;  1I94 T;  1FJG T;  4YY3 T;  2HHH T;  4LF8 T;  4DR6 T;  1IBK T;  4OX9 T;  5BR8 T;  3T1Y T;  4JI3 T;  4DR3 T;  4JYA T;  4X64 T;  4JI5 T;  4DV7 T;  4JI0 T;  4DV1 T;  4JI7 T;  4LF5 T;  1HNZ T;  4YHH T;  1N32 T;  4DV5 T;  1XMO T;  4JI2 T;  2F4V T;  1N34 T;  1N33 T;  2UU9 T;  4B3R T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...