4DV0T

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, u20g
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 37
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4dv0T00
4JI5T 4GKJT 4JI3T 4JI4T 4NXMT 2HHHT 4DV0T 4B3MT 1FJGT 1HNXT 4DV5T 2F4VT 5LMUT 4DR3T 1IBMT 4JI7T 4KHPT 2UXCT 4X62T 4DR2T 4JI1T 4GKKT 5BR8T 4K0KT 4X64T 4B3TT 1HNWT 4JI8T 4DR1T 1J5ET 2UUCT 1XNRT 2UXBT 2UU9T 4LFAT 4JI6T 4B3ST 5IWAT 4JI0T 4LF9T 4DV7T 2VQFT 4YY3T 2E5LT 1N32T 1HNZT 4LF8T 1IBLT 4X65T 4LFBT 2UXDT 4DUZT 1N36T 4LFCT 4LF6T 4OX9T 4LF5T 1N33T 4JI2T 5LMNT 2UUBT 4NXNT 1XMOT 2ZM6T 1N34T 4LF4T 1XNQT 4DV6T 4YHHT 1IBKT 4AQYT 4B3RT 4DR5T 4DV2T 4DV4T 4DR7T 4DV1T 1I94T 4DR6T 4LF7T 4DV3T 3T1HT 2VQET 4X66T 4JYAT 4JV5T 4DUYT 3T1YT 1HR0T 1XMQT 2UUAT 4DR4T 3OTOT
chains in the Genus database with same CATH superfamily
3TLSA 5LHGB 2JQKA 3WI3A 1HS7A 2FJAA 4B3MT 2B1EA 2DL1A 3CX8B 3AE2A 4UELA 1IBMT 2VKOA 5AQFB 2X9XA 5BR8T 5C3JA 5CGMA 5L2LA 3O9XA 2XAJB 2X9YA 4DR1T 1J5ET 3HKDE 4U33A 2ACZA 3QOFA 3PUWF 3CVRA 3FZKB 2CWYA 4LFCT 3LG7A 2WB5A 3PJAJ 1KNZA 3B13A 3P50A 2V7JA 5JREA 3RRCA 1MIWA 3KINB 1EZ3A 1CHUA 5FMNA 3PUVF 2LSGA 4UXNB 2DCFA 4B3RT 2KSRA 2BG9C 3NVOA 2Y6XA 3OYXA 1SA0E 2VQET 4UV8B 3V5SA 4H9QC 5CFBA 2LRKA 1XDOA 3ZCIA 3AEFA 5HEGA 3K8PC 1KFYA 3ZPOA 5IYZE 2YN6A 4X20E 5GONE 2CRBA 3AAIA 2QA7A 5HEHA 2X0LB 2F4VT 2KWIB 3E0ZA 3P4SA 2Z6EA 4X62T 4I50E 2XSBA 2XAFB 4O4LE 4H9NC 3QC9A 3IBPA 3JCFA 3RKGA 4IDQA 2E9XB 3CK6A 4EYUA 2V6YB 4L0RA 2M67A 4C90A 2FJEA 4LF8T 5TAOA 5ETWA 2V1DB 4TNVA 1D0ZA 2WWUA 1NEKA 2N9DA 3Q5WA 3L8RA 3HI2A 4ZZCA 3AE9A 2FUPA 2LT3A 2WM9A 3RLFF 1FMWA 1OEDE 3FXDB 3AE5A 2IAKA 2LHRA 4PW8A 1LVKA 3Q5DA 2YK0A 3RQWA 1FMVA 3MXZA 3WAKA 4G2AA 5F8PA 3NRYA 2MOZA 2CA5A 2X0YA 3AECA 3B57A 3AAAB 4X66T 4P09A 3H3AA 2CMRA 4WW0A 3ZLIA 1LKXA 3OTOT 1UX5A 2HPJA 2BKPA 3N5LA 2WZIA 4PAGA 2MTQA 1UCUA 1FJGT 1I6ZA 3O1IA 4ISTA 2Q9QB 1ZHCA 2WDRA 4UVCB 2RPAA 2IHR1 2QGSA 3PV0F 2VB6A 5LNKA 1M62A 2W61A 4QX8B 2LHNA 3J9X1 1ZV4X 2LKHA 4GYRA 3TLVA 3UTKA 5JRCA 2OV9A 2UUCT 2UXBT 4HFDA 5F5WA 4O2BE 3AA7B 4JI0T 5L3FB 4LF6T 1HFAA 2LSKA 4OX9T 5J2UE 2NW9A 2WY2A 2J62A 3L39A 2ZLYA 3AEAA 3IEEA 3ANWB 5JQGE 2PJQA 5CB4E 1ZOYA 1MIVA 3U3IA 2DHRA 1IBKT 5AQLB 2YDSA 4OFZA 4DV1T 2V8SV 5H6QB 2HPLA 3VR8A 4TWDA 3UU5A 5LHHB 5JDLA 3ZC0A 2CLYC 5FP3A 2RP4A 4HGAA 5LCYA 2X0HA 2WZHA 5HXEA 2NTXA 2BS4A 3LK42 3Q5XA 3ZSTA 3I9YA 4DR3T 4YFSA 3AA6B 3AEGA 2BBJA 3L09A 4YSYA 4U72A 1OEDB 2XQ8A 2IMLA 3AVSA 2YU2A 3ZN0B 3AVRA 5JDHA 2LE8A 4HWFA 1HG5A 2KINB 5AQMB 4MALA 3C4XA 2WWVA 5CJ5A 2ZMAA 4YY3T 4EEBA 4J2CA 1X9BA 3ONXA 3RKOA 2B76A 3CQGB 4TN7B 3EAMA 1GQEA 1W09A 2CBJA 2ZM6T 2J4GA 1N34T 2W00A 1OWAA 2K9AA 2W63A 4DV6T 4CXXA 5AQGB 2XHEB 5EK2A 3MJXA 4F6RC 3P4PA 5DQVA 3OJAA 2VK9A 4M1PA 5FY1A 3D0TA 4DV3T 2ODUA 4PJNA 2CPTA 3X1DA 5ABFB 1MMAA 4WBNE 2LOSA 1D0XA 4H9OC 4DUYT 2FJBA 4YHJA 4OYJA 3VR9A 2WSSV 4UIGA 3WAJA 3RRWA 5FYMA 2A2FX 2DNXA 3F31A 3MKDA 3SFDA 3BQLA 3FB2A 3PUGA 5LYJE 2LM9A 4A97A 5FL1A 3P4RA 2BS3A 2C5KT 2XPKA 2LM2A 1XZYA 3KVBA 2YOEA 4OK0A 4QXHB 4EYYR 3I0QA 3DJBA 4L5GA 1O3XA 1B7TA 3ZMVB 1Z0PA 3N2KE 2ES0A 1HCIA 3R84B 5KX5E 3RHWA 1N36T 4EV6A 3AE3A 4HFEA 2N1GA 4I4TE 2ODVA 2E9XD 3P4QA 4U7YA 4YTNA 3VU7H 1XNQT 3RPUA 4TZ4C 3TLTA 2XM2A 1US7B 4KP3C 5HYAA 1FEWA 3CIRA 1U4QA 3SWHA 4JEHB 3B5MA 3FZLB 5HXSA 3AA1B 5KMGP 3FXEB 4HWCA 3SS1A 3AXJA 1KF6A 4U2ZA 2HH7A 2WDVA 3RIUC 3MK7C 3K3OA 3NKZA 2YEVC 4EEDA 4L9IA 4XZCA 3VHLA 5CA1E 2X51A 3ZYKA 3Q9DA 5AQNB 4K0UA 1D1CA 2XQ9A 3TLWA 1T8BA 5C2TA 4B3TT 3RQUA 4HE8A 2WMOA 4QKNA 3RIFA 3AEDA 2KXPB 3C4WA 2ZM2A 2VQFT 4GYSA 2G0UA 4EXTA 4C91A 2UUBT 2JIWA 1VRBA 4IDZA 2LEHA 2IIUA 5HEJA 2AXDS 2CWOA 3DTOA 4KI0F 3PU8A 2IUBA 4DV2T 3ZN1B 1VCTA 2PTFA 3ZYLA 4LMLA 1T7SA 4HKAA 4AKLA 3KV9A 4IL4A 3ZYMA 1T72A 4X1IE 5LGTB 2BG9B 3PTRB 4JYAT 3UT5E 4PNIA 4JV5T 2YDQA 2EHOA 1UK5A 4DR4T 4WYVA 2UXNB 4NIQA 2M6IA 1XDPA 4NXMT 3RYIE 1ZKEA 1D0YA 4DV0T 4FJOA 5IUXA 1KNRA 4CN1A 4DR2T 1DU2A 4PK5A 4X1KE 2YKSA 3M65A 4X64T 2BVLA 4HFVA 5A1LA 4EZ4A 2A72A 3DP7A 2YINA 4DMWA 3ZMSB 2XASB 1AJ3A 2WDQA 2NW7A 4DMVA 3UUNA 4JI6T 4IT4A 4ERRA 2JPFA 2I59A 3I0OA 4ZI2D 3LBXB 5AQVB 1KK7A 2GK9A 2DLRA 5LJNA 4KUMB 5AFUL 5L4HA 5JR9A 3UULA 1BR0A 4MFRA 4HFBA 3ZT7A 5LBMA 5E0OA 3LSVA 2NW8A 1U5PA 2WBLA 2EHOD 3UFEA 4O8SA 3RC3A 1WLXA 5LGNB 4ZHQE 4PFOA 2E2AA 2UXXB 1XMQT 1YQ3A 3NWIA 2E8IA 3RIUA 2XQ7A 2E9XC 5HWXA 1G8XA 5J1GA 2MPKA 4E7SA 5LG4A 1JNRA 5LMUT 4ADZA 4IE7A 4ZS2A 3EVYA 4TUYE 3MZKB 4TV8E 3ETUA 5EK4A 3C50A 3C51A 4A98A 5FXWA 2KLQA 3ETVA 3CMLA 4DVDA 5JH7E 1IZNB 4A5XA 4I0UA 4XBFB 2VVNA 5H6RB 4LF9T 2CXLA 4DV7T 4MHCA 2QYWA 3GN5A 4IIJE 3A5XA 3AEEA 4CXWA 2XAHB 3N9NA 2V7LA 3K3NA 4AKIA 4UF0B 3JC6D 4OHFA 1S94A 4QWNB 3M3ZB 2WP9A 4CI2B 3GWHA 3RF1A 4DO0A 3EDVA 2VL8A 2WQYA 3NZPA 3OPCA 3UFGA 1R8IA 2V7IA 3LK2B 3HA4A 2XQ5A 2K5BB 2QVAA 2CM0A 2K48A 5HXRA 5LP6E 4KHZF 1J1JA 4JI3T 1OXZA 4ZEYA 3AB3B 3RYHE 3ZMTB 2LJLA 2W2UA 3LJCA 2ZM0A 2V6XA 4YTMA 3UUMA 2R6GF 3T8OA 2JJ9A 1HNWT 3CX6B 2M6BA 4IGUA 5FY7A 1YD8G 1XNRT 2L9QA 4TV9E 1MIYA 3QNUA 2D9DA 4YTPA 3JADA 4ANJA 3FBLA 5HAXA 5HEUA 2E5LT 4LMJA 2CXFA 5LGUB 4DUZT 4YJ3E 1D1AA 5L3EB 2J47A 4A56A 3E22E 4JI2T 5LMNT 3MA9A 4BJMA 1W0BA 2CHNA 3FZHB 3Q2MA 4N78D 2X9WA 1SHZC 1BR2A 5L3CB 4DBQA 3H37A 1YXRA 2ZM8A 4ZOLE 1X79A 2H7VC 3P4WA 2AE9A 3PUSA 4O4JE 4BA9A 5LB7B 3T1HT 1OEDC 4IL9A 2NWBA 3UQ7A 3G06A 4ILAA 4ZI2C 1HF8A 3T1YT 2JRKA 2OA5A 1HR0T 2H7OA 3FBZA 5ADXL 5FXXA 4X5TA 5JDQA 3RGLA 4ZZBA 2E9XA 3R6NA 2HN2A 4AKRB 5ABEA 5J2TE 2WCAA 2V6YA 2VVSA 4IE6A 2JQHA 5LXTE 3NZQA 2YDRA 3W15B 1BR4A 2EHOC 4GK5E 5FXVA 2XQYA 2BKOA 2RA1A 1LVFA 4TNWA 4IREA 5JDGA 1D1BA 4XAXB 3E08A 3SOLA 3EABA 2XQ4A 3PUZF 4O2AE 3ZJ1A 2UU9T 5LHIB 3F57A 2D0UA 4B3ST 5AQSB 3LDQB 2MYSA 1UURA 2VKDA 4Q25A 4ILUA 1HX1B 4I43B 3CWZB 5J0ZA 2V7KA 2A9UA 4CI1B 1H7CA 3F2EA 1XMOT 1IAPA 4KBMB 1NWMX 2BG9E 4WNKA 1SE7A 4DV4T 4KMCA 4WZXA 1I94T 2QRXA 1UGOA 4LF7T 2L8KA 2Q9QA 4DIDB 2ACXA 2W4XA 5JR9C 2KZ7B 4V1Av 1WYBA 5FVKA 3PUYF 3S4UA 2W62A 3ZT6A 2C5IT 4G63A 4CXYA 5FXZA 5LG3A 4EGWA 2VASA 5KDMC 3Q5EA 2KWHA 2V5DA 2LSIA 4GKJT 4PK4A 2JMKA 3HL6A 3JC6C 2WU2A 4QX7B 3OBVE 2XSAA 1UUSA 2JMHA 4U31A 4AQFA 1S35A 3AEBA 2WU5A 3ZJ2A 4H9PC 3BQKA 2BZBA 3ANWA 4Z91A 2D5UA 5JVDE 4PJMA 5FVLA 3GA8A 2W0GA 5F3JA 4PJJA 5L4EA 3OVUA 4HWDA 4NPPA 2A3DA 5L3DB 2IW5B 3K1SA 3CKDA 4EZHA 1E1HB 2XQ6A 3LFMA 4LF5T 1N33T 4AIUA 4CQIA 3JAFA 4NXNT 3HKBE 3VKGA 2Q9QD 3PUQA 5ABGA 3C64A 5JRCB 3KFWX 4HWIB 4YJ2E 4ZXLA 4HFHA 4HWHA 2CXDA 5JDNA 4I55E 1OEDA 5EZYE 2I6HA 4B6XA 4EIWA 3P7IA 4O4IE 1UX4A 2X66A 2Y48B 1E7PA 1QUUA 2YU1A 4O4HE 4IDNA 4GK0E 3KVAA 2JQQA 3PUXF 3I9WA 2UXCT 1WCRA 1Z8UA 2LLYA 3ZC1A 4IE5A 2I0MA 4QXBB 3IHRA 5BMVE 3TKLB 3UU8A 4IDOA 2D0TA 4BAYB 2IDOB 2IC6A 4U7IA 3NRXA 3EI0A 4TWHA 5HCMA 1IBLT 3JAEA 5M4YA 2UXDT 5ABFA 3ESLA 4PJLA 5HXHA 2P9BA 2MAWA 2X9HA 2WMNA 3N9OA 3IF8B 4WBOA 3VRAA 2VWAA 1QSDA 4CI3B 4ILBA 3GMIA 2DI4A 4DBRA 4AI6A 4DR7T 3AE6A 2H89A 2HN1A 4IDPA 4UVBB 3KBTA 4YT0A 4JBWF 4AKGA 1QLBA 3KV5A 1J5WA 2X68A 3PUAA 3OKQA 4H63V 2SPCA 3N9MA 3RIAA 5FKYA 1M7KA 4JI4T 1KNPA 4E7ZA 4YXDA 3ZCJA 4UV9B 1WRDA 4CN6A 1HNXT 5LBQB 4P1NA 5AQOB 2NR4A 4P0AA 3O1JA 4JI1T 3L3PA 5AQKB 2VL0A 3BQIA 4MBQA 3N2GE 4LMKA 1NENA 2V26A 4TWFA 5L3GB 4UVAB 2LKGA 1NAFA 3SFEA 1MNEA 4EAHA 1N32T 3BK9A 4NUVA 3EHZA 3UU3A 4AQGA 1VOMA 4UR9A 4BJNA 1YKHB 2CBIA 3N2OA 4ZI7E 4CZZB 2PG8A 3ZMUB 3ABVA 2FJDA 3C4ZA 1IJ5A 2E5VA 2XQAA 3PE0A 3O4XE 1YKEB 2W67A 5CA0E 3RC8A 2NP9A 2FBWA 4YSXA 1HG2A 3QB5A 2XZEA 2CEAA 3LK3B 2UUAT 3P8CD 2VKJA 5JTGA 4HFCA 4Z8XA 4PK6A 2Q9QC 2PFVA 3PDYA 3FZFB 3PU3A 3CPZA 2JQ9A 4ZI3D 4GOUA 2H3RA 4DV5T 4YLHA 5L3BB 3AE8A 1ZP0A 3AAEB 4ISSA 2D2SA 4KHPT 4QH4A 2N2NA 3I1AA 4HEAA 4AKHA 4K0KT 3AXJB 3RYCE 3HKEE 4JUYA 2LSYA 2XTLA 2CLYB 3RH3A 4TX5A 1WR0A 1ZEEA 4HFIA 1WYCA 2BBHA 3UQ4A 5DQWA 4AQFC 3VKHA 4COFA 1Y64B 1HNZT 1WFDA 2C5JA 3QB5K 2BG9A 2CHOA 5HEOA 1E2AA 3EUHA 5AQRB 4PFPA 4MLKA 3ZMZB 3QK6A 5HXCA 5DABA 2VKHA 1IJ6A 4H63H 4U3CA 4GIWA 5AQTB 4YHHT 3AE7A 1JNZA 2LSJA 4IE4A 4DR6T 3PURA 3VRBA 4DNDA 5LOVE 2KMFA 3ONLC 4CN4A 2C0SA 4X1YE 1YW0A 3H3MA 4QH5A 1L0VA 2V5CA 1T98A 4JI5T 4JLEA 4AXPA 3QUJA 4IHJE 3RX6A 4P0BA 2NTYA 1HX8A 2HHHT 3FZMB 3UUXB 2J1DG 4JI7T 2KNDA 3CQXC 3LBXA 1MMDA 3N9QA 5DJQC 2CE7A 3TLUA 1XWMA 5JDMA 2V7MA 2OLTA 2EHOB 1MNDA 3OYZA 1Y01A 2XAGB 3HKCE 2KT9A 3MACA 5LJMA 2XAQB 3AE1A 3UU4A 2XQ3A 5AQIB 3KBUA 5HWYA 3A7MA 3K3QC 4FI5A 4LFBT 2VURA 4IE0A 1SUMB 1W0AA 3RYFE 3EDUA 2PBIA 5AQJB 2CCQA 2XM1A 3CX7B 4EOZB 4U2YA 3HR0A 3ZKRA 3V5UA 3J7Yq 5HCJA 3CQCB 3FHNA 1CUNA 1V9DA 1MMNA 4EB6E 4HN9A 5KXJA 4Z90A 1W9RA 4ASKA 3AE4A 2K24A 5ABHA 2H88A 3KV6A 2Y8DA 2K3WA 3ONJA 4QH1A 2LRLA 5JR9B 1MMGA 4ZS3A 3A8YC 2MBGA 2X67A 5FL0A 3SRZA 2XJ7A 3N9PA 3PJAA 5AQQB 4ILCA 2XUEA 3AA0B 3UU6A 4UEMA 5L47A 3C98B 3O1HA 4H9SE 4NUUA 4GKKT 4F8HA 1KEYA 4H9RC 3ZT5A 2IC9A 5AQUB 1HTJF 1YQ4A 4JI8T 3RI5A 3ZSSA 4UF0A 4U74A 5AQHB 4OYKA 1VCSA 3KV4A 4LFAT 5C8YE 2NOXA 3ZEFB 3UUBA 4QXCB 2LOPA 3N9LA 5EK3A 5IWAT 5FNVE 2L3LA 5JDFA 5IHYA 4ZI3C 4X65T 5AQPB 2WS3A 5LA6E 1LRZA 2WAUA 2XY8B 4JEUB 3KDSE 4KX6A 3IA3A 1BR1A 4LF4T 4QHOA 4AQYT 4DR5T 2DWKA 1G73A 2W66A 2BVMA 1WR6A 3U78A 2BKNA 4AISA 5FY0A 4HTEA 3GN5B 2BDEA 2DWGA 3NBXX 1FIOA 2BS2A 4YSZA
chains in the Genus database with same CATH topology
4JI5T 4GKJT 4JI3T 4JI4T 4NXMT 2HHHT 4DV0T 4B3MT 1FJGT 1HNXT 4DV5T 2F4VT 5LMUT 4DR3T 1IBMT 4JI7T 4KHPT 2UXCT 4X62T 4DR2T 4JI1T 4GKKT 5BR8T 4K0KT 4X64T 4B3TT 1HNWT 4JI8T 4DR1T 1J5ET 2UUCT 1XNRT 2UXBT 2UU9T 4LFAT 4JI6T 4B3ST 5IWAT 4JI0T 4LF9T 4DV7T 2VQFT 4YY3T 2E5LT 1N32T 1HNZT 4LF8T 1IBLT 4X65T 4LFBT 2UXDT 4DUZT 1N36T 4LFCT 4LF6T 4OX9T 4LF5T 1N33T 4JI2T 5LMNT 2UUBT 4NXNT 1XMOT 2ZM6T 1N34T 4LF4T 1XNQT 4DV6T 4YHHT 1IBKT 4AQYT 4B3RT 4DR5T 4DV2T 4DV4T 4DR7T 4DV1T 1I94T 4DR6T 4LF7T 4DV3T 3T1HT 2VQET 4X66T 4JYAT 4JV5T 4DUYT 3T1YT 1HR0T 1XMQT 2UUAT 4DR4T 3OTOT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI5 T;  4GKJ T;  4JI3 T;  4JI4 T;  4NXM T;  2HHH T;  4DV0 T;  4B3M T;  1FJG T;  1HNX T;  4DV5 T;  2F4V T;  5LMU T;  4DR3 T;  1IBM T;  4JI7 T;  4KHP T;  2UXC T;  4X62 T;  4DR2 T;  4JI1 T;  4GKK T;  5BR8 T;  4K0K T;  4X64 T;  4B3T T;  1HNW T;  4JI8 T;  4DR1 T;  1J5E T;  2UUC T;  1XNR T;  2UXB T;  2UU9 T;  4LFA T;  4JI6 T;  4B3S T;  5IWA T;  4JI0 T;  4LF9 T;  4DV7 T;  2VQF T;  4YY3 T;  2E5L T;  1N32 T;  1HNZ T;  4LF8 T;  1IBL T;  4X65 T;  4LFB T;  2UXD T;  4DUZ T;  1N36 T;  4LFC T;  4LF6 T;  4OX9 T;  4LF5 T;  1N33 T;  4JI2 T;  5LMN T;  2UUB T;  4NXN T;  1XMO T;  2ZM6 T;  1N34 T;  4LF4 T;  1XNQ T;  4DV6 T;  4YHH T;  1IBK T;  4AQY T;  4B3R T;  4DR5 T;  4DV2 T;  4DV4 T;  4DR7 T;  4DV1 T;  1I94 T;  4DR6 T;  4LF7 T;  4DV3 T;  3T1H T;  2VQE T;  4X66 T;  4JYA T;  4JV5 T;  4DUY T;  3T1Y T;  1HR0 T;  1XMQ T;  2UUA T;  4DR4 T;  3OTO T; 
#chains in the Genus database with same CATH topology
 3TLS A;  5LHG B;  2JQK A;  3WI3 A;  1HS7 A;  2FJA A;  4B3M T;  2B1E A;  2DL1 A;  3CX8 B;  3AE2 A;  4UEL A;  1IBM T;  2VKO A;  5AQF B;  2X9X A;  5BR8 T;  5C3J A;  5CGM A;  5L2L A;  3O9X A;  2XAJ B;  2X9Y A;  4DR1 T;  1J5E T;  3HKD E;  4U33 A;  2ACZ A;  3QOF A;  3PUW F;  3CVR A;  3FZK B;  2CWY A;  4LFC T;  3LG7 A;  2WB5 A;  3PJA J;  1KNZ A;  3B13 A;  3P50 A;  2V7J A;  5JRE A;  3RRC A;  1MIW A;  3KIN B;  1EZ3 A;  1CHU A;  5FMN A;  3PUV F;  2LSG A;  4UXN B;  2DCF A;  4B3R T;  2KSR A;  2BG9 C;  3NVO A;  2Y6X A;  3OYX A;  1SA0 E;  2VQE T;  4UV8 B;  3V5S A;  4H9Q C;  5CFB A;  2LRK A;  1XDO A;  3ZCI A;  3AEF A;  5HEG A;  3K8P C;  1KFY A;  3ZPO A;  5IYZ E;  2YN6 A;  4X20 E;  5GON E;  2CRB A;  3AAI A;  2QA7 A;  5HEH A;  2X0L B;  2F4V T;  2KWI B;  3E0Z A;  3P4S A;  2Z6E A;  4X62 T;  4I50 E;  2XSB A;  2XAF B;  4O4L E;  4H9N C;  3QC9 A;  3IBP A;  3JCF A;  3RKG A;  4IDQ A;  2E9X B;  3CK6 A;  4EYU A;  2V6Y B;  4L0R A;  2M67 A;  4C90 A;  2FJE A;  4LF8 T;  5TAO A;  5ETW A;  2V1D B;  4TNV A;  1D0Z A;  2WWU A;  1NEK A;  2N9D A;  3Q5W A;  3L8R A;  3HI2 A;  4ZZC A;  3AE9 A;  2FUP A;  2LT3 A;  2WM9 A;  3RLF F;  1FMW A;  1OED E;  3FXD B;  3AE5 A;  2IAK A;  2LHR A;  4PW8 A;  1LVK A;  3Q5D A;  2YK0 A;  3RQW A;  1FMV A;  3MXZ A;  3WAK A;  4G2A A;  5F8P A;  3NRY A;  2MOZ A;  2CA5 A;  2X0Y A;  3AEC A;  3B57 A;  3AAA B;  4X66 T;  4P09 A;  3H3A A;  2CMR A;  4WW0 A;  3ZLI A;  1LKX A;  3OTO T;  1UX5 A;  2HPJ A;  2BKP A;  3N5L A;  2WZI A;  4PAG A;  2MTQ A;  1UCU A;  1FJG T;  1I6Z A;  3O1I A;  4IST A;  2Q9Q B;  1ZHC A;  2WDR A;  4UVC B;  2RPA A;  2IHR 1;  2QGS A;  3PV0 F;  2VB6 A;  5LNK A;  1M62 A;  2W61 A;  4QX8 B;  2LHN A;  3J9X 1;  1ZV4 X;  2LKH A;  4GYR A;  3TLV A;  3UTK A;  5JRC A;  2OV9 A;  2UUC T;  2UXB T;  4HFD A;  5F5W A;  4O2B E;  3AA7 B;  4JI0 T;  5L3F B;  4LF6 T;  1HFA A;  2LSK A;  4OX9 T;  5J2U E;  2NW9 A;  2WY2 A;  2J62 A;  3L39 A;  2ZLY A;  3AEA A;  3IEE A;  3ANW B;  5JQG E;  2PJQ A;  5CB4 E;  1ZOY A;  1MIV A;  3U3I A;  2DHR A;  1IBK T;  5AQL B;  2YDS A;  4OFZ A;  4DV1 T;  2V8S V;  5H6Q B;  2HPL A;  3VR8 A;  4TWD A;  3UU5 A;  5LHH B;  5JDL A;  3ZC0 A;  2CLY C;  5FP3 A;  2RP4 A;  4HGA A;  5LCY A;  2X0H A;  2WZH A;  5HXE A;  2NTX A;  2BS4 A;  3LK4 2;  3Q5X A;  3ZST A;  3I9Y A;  4DR3 T;  4YFS A;  3AA6 B;  3AEG A;  2BBJ A;  3L09 A;  4YSY A;  4U72 A;  1OED B;  2XQ8 A;  2IML A;  3AVS A;  2YU2 A;  3ZN0 B;  3AVR A;  5JDH A;  2LE8 A;  4HWF A;  1HG5 A;  2KIN B;  5AQM B;  4MAL A;  3C4X A;  2WWV A;  5CJ5 A;  2ZMA A;  4YY3 T;  4EEB A;  4J2C A;  1X9B A;  3ONX A;  3RKO A;  2B76 A;  3CQG B;  4TN7 B;  3EAM A;  1GQE A;  1W09 A;  2CBJ A;  2ZM6 T;  2J4G A;  1N34 T;  2W00 A;  1OWA A;  2K9A A;  2W63 A;  4DV6 T;  4CXX A;  5AQG B;  2XHE B;  5EK2 A;  3MJX A;  4F6R C;  3P4P A;  5DQV A;  3OJA A;  2VK9 A;  4M1P A;  5FY1 A;  3D0T A;  4DV3 T;  2ODU A;  4PJN A;  2CPT A;  3X1D A;  5ABF B;  1MMA A;  4WBN E;  2LOS A;  1D0X A;  4H9O C;  4DUY T;  2FJB A;  4YHJ A;  4OYJ A;  3VR9 A;  2WSS V;  4UIG A;  3WAJ A;  3RRW A;  5FYM A;  2A2F X;  2DNX A;  3F31 A;  3MKD A;  3SFD A;  3BQL A;  3FB2 A;  3PUG A;  5LYJ E;  2LM9 A;  4A97 A;  5FL1 A;  3P4R A;  2BS3 A;  2C5K T;  2XPK A;  2LM2 A;  1XZY A;  3KVB A;  2YOE A;  4OK0 A;  4QXH B;  4EYY R;  3I0Q A;  3DJB A;  4L5G A;  1O3X A;  1B7T A;  3ZMV B;  1Z0P A;  3N2K E;  2ES0 A;  1HCI A;  3R84 B;  5KX5 E;  3RHW A;  1N36 T;  4EV6 A;  3AE3 A;  4HFE A;  2N1G A;  4I4T E;  2ODV A;  2E9X D;  3P4Q A;  4U7Y A;  4YTN A;  3VU7 H;  1XNQ T;  3RPU A;  4TZ4 C;  3TLT A;  2XM2 A;  1US7 B;  4KP3 C;  5HYA A;  1FEW A;  3CIR A;  1U4Q A;  3SWH A;  4JEH B;  3B5M A;  3FZL B;  5HXS A;  3AA1 B;  5KMG P;  3FXE B;  4HWC A;  3SS1 A;  3AXJ A;  1KF6 A;  4U2Z A;  2HH7 A;  2WDV A;  3RIU C;  3MK7 C;  3K3O A;  3NKZ A;  2YEV C;  4EED A;  4L9I A;  4XZC A;  3VHL A;  5CA1 E;  2X51 A;  3ZYK A;  3Q9D A;  5AQN B;  4K0U A;  1D1C A;  2XQ9 A;  3TLW A;  1T8B A;  5C2T A;  4B3T T;  3RQU A;  4HE8 A;  2WMO A;  4QKN A;  3RIF A;  3AED A;  2KXP B;  3C4W A;  2ZM2 A;  2VQF T;  4GYS A;  2G0U A;  4EXT A;  4C91 A;  2UUB T;  2JIW A;  1VRB A;  4IDZ A;  2LEH A;  2IIU A;  5HEJ A;  2AXD S;  2CWO A;  3DTO A;  4KI0 F;  3PU8 A;  2IUB A;  4DV2 T;  3ZN1 B;  1VCT A;  2PTF A;  3ZYL A;  4LML A;  1T7S A;  4HKA A;  4AKL A;  3KV9 A;  4IL4 A;  3ZYM A;  1T72 A;  4X1I E;  5LGT B;  2BG9 B;  3PTR B;  4JYA T;  3UT5 E;  4PNI A;  4JV5 T;  2YDQ A;  2EHO A;  1UK5 A;  4DR4 T;  4WYV A;  2UXN B;  4NIQ A;  2M6I A;  1XDP A;  4NXM T;  3RYI E;  1ZKE A;  1D0Y A;  4DV0 T;  4FJO A;  5IUX A;  1KNR A;  4CN1 A;  4DR2 T;  1DU2 A;  4PK5 A;  4X1K E;  2YKS A;  3M65 A;  4X64 T;  2BVL A;  4HFV A;  5A1L A;  4EZ4 A;  2A72 A;  3DP7 A;  2YIN A;  4DMW A;  3ZMS B;  2XAS B;  1AJ3 A;  2WDQ A;  2NW7 A;  4DMV A;  3UUN A;  4JI6 T;  4IT4 A;  4ERR A;  2JPF A;  2I59 A;  3I0O A;  4ZI2 D;  3LBX B;  5AQV B;  1KK7 A;  2GK9 A;  2DLR A;  5LJN A;  4KUM B;  5AFU L;  5L4H A;  5JR9 A;  3UUL A;  1BR0 A;  4MFR A;  4HFB A;  3ZT7 A;  5LBM A;  5E0O A;  3LSV A;  2NW8 A;  1U5P A;  2WBL A;  2EHO D;  3UFE A;  4O8S A;  3RC3 A;  1WLX A;  5LGN B;  4ZHQ E;  4PFO A;  2E2A A;  2UXX B;  1XMQ T;  1YQ3 A;  3NWI A;  2E8I A;  3RIU A;  2XQ7 A;  2E9X C;  5HWX A;  1G8X A;  5J1G A;  2MPK A;  4E7S A;  5LG4 A;  1JNR A;  5LMU T;  4ADZ A;  4IE7 A;  4ZS2 A;  3EVY A;  4TUY E;  3MZK B;  4TV8 E;  3ETU A;  5EK4 A;  3C50 A;  3C51 A;  4A98 A;  5FXW A;  2KLQ A;  3ETV A;  3CML A;  4DVD A;  5JH7 E;  1IZN B;  4A5X A;  4I0U A;  4XBF B;  2VVN A;  5H6R B;  4LF9 T;  2CXL A;  4DV7 T;  4MHC A;  2QYW A;  3GN5 A;  4IIJ E;  3A5X A;  3AEE A;  4CXW A;  2XAH B;  3N9N A;  2V7L A;  3K3N A;  4AKI A;  4UF0 B;  3JC6 D;  4OHF A;  1S94 A;  4QWN B;  3M3Z B;  2WP9 A;  4CI2 B;  3GWH A;  3RF1 A;  4DO0 A;  3EDV A;  2VL8 A;  2WQY A;  3NZP A;  3OPC A;  3UFG A;  1R8I A;  2V7I A;  3LK2 B;  3HA4 A;  2XQ5 A;  2K5B B;  2QVA A;  2CM0 A;  2K48 A;  5HXR A;  5LP6 E;  4KHZ F;  1J1J A;  4JI3 T;  1OXZ A;  4ZEY A;  3AB3 B;  3RYH E;  3ZMT B;  2LJL A;  2W2U A;  3LJC A;  2ZM0 A;  2V6X A;  4YTM A;  3UUM A;  2R6G F;  3T8O A;  2JJ9 A;  1HNW T;  3CX6 B;  2M6B A;  4IGU A;  5FY7 A;  1YD8 G;  1XNR T;  2L9Q A;  4TV9 E;  1MIY A;  3QNU A;  2D9D A;  4YTP A;  3JAD A;  4ANJ A;  3FBL A;  5HAX A;  5HEU A;  2E5L T;  4LMJ A;  2CXF A;  5LGU B;  4DUZ T;  4YJ3 E;  1D1A A;  5L3E B;  2J47 A;  4A56 A;  3E22 E;  4JI2 T;  5LMN T;  3MA9 A;  4BJM A;  1W0B A;  2CHN A;  3FZH B;  3Q2M A;  4N78 D;  2X9W A;  1SHZ C;  1BR2 A;  5L3C B;  4DBQ A;  3H37 A;  1YXR A;  2ZM8 A;  4ZOL E;  1X79 A;  2H7V C;  3P4W A;  2AE9 A;  3PUS A;  4O4J E;  4BA9 A;  5LB7 B;  3T1H T;  1OED C;  4IL9 A;  2NWB A;  3UQ7 A;  3G06 A;  4ILA A;  4ZI2 C;  1HF8 A;  3T1Y T;  2JRK A;  2OA5 A;  1HR0 T;  2H7O A;  3FBZ A;  5ADX L;  5FXX A;  4X5T A;  5JDQ A;  3RGL A;  4ZZB A;  2E9X A;  3R6N A;  2HN2 A;  4AKR B;  5ABE A;  5J2T E;  2WCA A;  2V6Y A;  2VVS A;  4IE6 A;  2JQH A;  5LXT E;  3NZQ A;  2YDR A;  3W15 B;  1BR4 A;  2EHO C;  4GK5 E;  5FXV A;  2XQY A;  2BKO A;  2RA1 A;  1LVF A;  4TNW A;  4IRE A;  5JDG A;  1D1B A;  4XAX B;  3E08 A;  3SOL A;  3EAB A;  2XQ4 A;  3PUZ F;  4O2A E;  3ZJ1 A;  2UU9 T;  5LHI B;  3F57 A;  2D0U A;  4B3S T;  5AQS B;  3LDQ B;  2MYS A;  1UUR A;  2VKD A;  4Q25 A;  4ILU A;  1HX1 B;  4I43 B;  3CWZ B;  5J0Z A;  2V7K A;  2A9U A;  4CI1 B;  1H7C A;  3F2E A;  1XMO T;  1IAP A;  4KBM B;  1NWM X;  2BG9 E;  4WNK A;  1SE7 A;  4DV4 T;  4KMC A;  4WZX A;  1I94 T;  2QRX A;  1UGO A;  4LF7 T;  2L8K A;  2Q9Q A;  4DID B;  2ACX A;  2W4X A;  5JR9 C;  2KZ7 B;  4V1A v;  1WYB A;  5FVK A;  3PUY F;  3S4U A;  2W62 A;  3ZT6 A;  2C5I T;  4G63 A;  4CXY A;  5FXZ A;  5LG3 A;  4EGW A;  2VAS A;  5KDM C;  3Q5E A;  2KWH A;  2V5D A;  2LSI A;  4GKJ T;  4PK4 A;  2JMK A;  3HL6 A;  3JC6 C;  2WU2 A;  4QX7 B;  3OBV E;  2XSA A;  1UUS A;  2JMH A;  4U31 A;  4AQF A;  1S35 A;  3AEB A;  2WU5 A;  3ZJ2 A;  4H9P C;  3BQK A;  2BZB A;  3ANW A;  4Z91 A;  2D5U A;  5JVD E;  4PJM A;  5FVL A;  3GA8 A;  2W0G A;  5F3J A;  4PJJ A;  5L4E A;  3OVU A;  4HWD A;  4NPP A;  2A3D A;  5L3D B;  2IW5 B;  3K1S A;  3CKD A;  4EZH A;  1E1H B;  2XQ6 A;  3LFM A;  4LF5 T;  1N33 T;  4AIU A;  4CQI A;  3JAF A;  4NXN T;  3HKB E;  3VKG A;  2Q9Q D;  3PUQ A;  5ABG A;  3C64 A;  5JRC B;  3KFW X;  4HWI B;  4YJ2 E;  4ZXL A;  4HFH A;  4HWH A;  2CXD A;  5JDN A;  4I55 E;  1OED A;  5EZY E;  2I6H A;  4B6X A;  4EIW A;  3P7I A;  4O4I E;  1UX4 A;  2X66 A;  2Y48 B;  1E7P A;  1QUU A;  2YU1 A;  4O4H E;  4IDN A;  4GK0 E;  3KVA A;  2JQQ A;  3PUX F;  3I9W A;  2UXC T;  1WCR A;  1Z8U A;  2LLY A;  3ZC1 A;  4IE5 A;  2I0M A;  4QXB B;  3IHR A;  5BMV E;  3TKL B;  3UU8 A;  4IDO A;  2D0T A;  4BAY B;  2IDO B;  2IC6 A;  4U7I A;  3NRX A;  3EI0 A;  4TWH A;  5HCM A;  1IBL T;  3JAE A;  5M4Y A;  2UXD T;  5ABF A;  3ESL A;  4PJL A;  5HXH A;  2P9B A;  2MAW A;  2X9H A;  2WMN A;  3N9O A;  3IF8 B;  4WBO A;  3VRA A;  2VWA A;  1QSD A;  4CI3 B;  4ILB A;  3GMI A;  2DI4 A;  4DBR A;  4AI6 A;  4DR7 T;  3AE6 A;  2H89 A;  2HN1 A;  4IDP A;  4UVB B;  3KBT A;  4YT0 A;  4JBW F;  4AKG A;  1QLB A;  3KV5 A;  1J5W A;  2X68 A;  3PUA A;  3OKQ A;  4H63 V;  2SPC A;  3N9M A;  3RIA A;  5FKY A;  1M7K A;  4JI4 T;  1KNP A;  4E7Z A;  4YXD A;  3ZCJ A;  4UV9 B;  1WRD A;  4CN6 A;  1HNX T;  5LBQ B;  4P1N A;  5AQO B;  2NR4 A;  4P0A A;  3O1J A;  4JI1 T;  3L3P A;  5AQK B;  2VL0 A;  3BQI A;  4MBQ A;  3N2G E;  4LMK A;  1NEN A;  2V26 A;  4TWF A;  5L3G B;  4UVA B;  2LKG A;  1NAF A;  3SFE A;  1MNE A;  4EAH A;  1N32 T;  3BK9 A;  4NUV A;  3EHZ A;  3UU3 A;  4AQG A;  1VOM A;  4UR9 A;  4BJN A;  1YKH B;  2CBI A;  3N2O A;  4ZI7 E;  4CZZ B;  2PG8 A;  3ZMU B;  3ABV A;  2FJD A;  3C4Z A;  1IJ5 A;  2E5V A;  2XQA A;  3PE0 A;  3O4X E;  1YKE B;  2W67 A;  5CA0 E;  3RC8 A;  2NP9 A;  2FBW A;  4YSX A;  1HG2 A;  3QB5 A;  2XZE A;  2CEA A;  3LK3 B;  2UUA T;  3P8C D;  2VKJ A;  5JTG A;  4HFC A;  4Z8X A;  4PK6 A;  2Q9Q C;  2PFV A;  3PDY A;  3FZF B;  3PU3 A;  3CPZ A;  2JQ9 A;  4ZI3 D;  4GOU A;  2H3R A;  4DV5 T;  4YLH A;  5L3B B;  3AE8 A;  1ZP0 A;  3AAE B;  4ISS A;  2D2S A;  4KHP T;  4QH4 A;  2N2N A;  3I1A A;  4HEA A;  4AKH A;  4K0K T;  3AXJ B;  3RYC E;  3HKE E;  4JUY A;  2LSY A;  2XTL A;  2CLY B;  3RH3 A;  4TX5 A;  1WR0 A;  1ZEE A;  4HFI A;  1WYC A;  2BBH A;  3UQ4 A;  5DQW A;  4AQF C;  3VKH A;  4COF A;  1Y64 B;  1HNZ T;  1WFD A;  2C5J A;  3QB5 K;  2BG9 A;  2CHO A;  5HEO A;  1E2A A;  3EUH A;  5AQR B;  4PFP A;  4MLK A;  3ZMZ B;  3QK6 A;  5HXC A;  5DAB A;  2VKH A;  1IJ6 A;  4H63 H;  4U3C A;  4GIW A;  5AQT B;  4YHH T;  3AE7 A;  1JNZ A;  2LSJ A;  4IE4 A;  4DR6 T;  3PUR A;  3VRB A;  4DND A;  5LOV E;  2KMF A;  3ONL C;  4CN4 A;  2C0S A;  4X1Y E;  1YW0 A;  3H3M A;  4QH5 A;  1L0V A;  2V5C A;  1T98 A;  4JI5 T;  4JLE A;  4AXP A;  3QUJ A;  4IHJ E;  3RX6 A;  4P0B A;  2NTY A;  1HX8 A;  2HHH T;  3FZM B;  3UUX B;  2J1D G;  4JI7 T;  2KND A;  3CQX C;  3LBX A;  1MMD A;  3N9Q A;  5DJQ C;  2CE7 A;  3TLU A;  1XWM A;  5JDM A;  2V7M A;  2OLT A;  2EHO B;  1MND A;  3OYZ A;  1Y01 A;  2XAG B;  3HKC E;  2KT9 A;  3MAC A;  5LJM A;  2XAQ B;  3AE1 A;  3UU4 A;  2XQ3 A;  5AQI B;  3KBU A;  5HWY A;  3A7M A;  3K3Q C;  4FI5 A;  4LFB T;  2VUR A;  4IE0 A;  1SUM B;  1W0A A;  3RYF E;  3EDU A;  2PBI A;  5AQJ B;  2CCQ A;  2XM1 A;  3CX7 B;  4EOZ B;  4U2Y A;  3HR0 A;  3ZKR A;  3V5U A;  3J7Y q;  5HCJ A;  3CQC B;  3FHN A;  1CUN A;  1V9D A;  1MMN A;  4EB6 E;  4HN9 A;  5KXJ A;  4Z90 A;  1W9R A;  4ASK A;  3AE4 A;  2K24 A;  5ABH A;  2H88 A;  3KV6 A;  2Y8D A;  2K3W A;  3ONJ A;  4QH1 A;  2LRL A;  5JR9 B;  1MMG A;  4ZS3 A;  3A8Y C;  2MBG A;  2X67 A;  5FL0 A;  3SRZ A;  2XJ7 A;  3N9P A;  3PJA A;  5AQQ B;  4ILC A;  2XUE A;  3AA0 B;  3UU6 A;  4UEM A;  5L47 A;  3C98 B;  3O1H A;  4H9S E;  4NUU A;  4GKK T;  4F8H A;  1KEY A;  4H9R C;  3ZT5 A;  2IC9 A;  5AQU B;  1HTJ F;  1YQ4 A;  4JI8 T;  3RI5 A;  3ZSS A;  4UF0 A;  4U74 A;  5AQH B;  4OYK A;  1VCS A;  3KV4 A;  4LFA T;  5C8Y E;  2NOX A;  3ZEF B;  3UUB A;  4QXC B;  2LOP A;  3N9L A;  5EK3 A;  5IWA T;  5FNV E;  2L3L A;  5JDF A;  5IHY A;  4ZI3 C;  4X65 T;  5AQP B;  2WS3 A;  5LA6 E;  1LRZ A;  2WAU A;  2XY8 B;  4JEU B;  3KDS E;  4KX6 A;  3IA3 A;  1BR1 A;  4LF4 T;  4QHO A;  4AQY T;  4DR5 T;  2DWK A;  1G73 A;  2W66 A;  2BVM A;  1WR6 A;  3U78 A;  2BKN A;  4AIS A;  5FY0 A;  4HTE A;  3GN5 B;  2BDE A;  2DWG A;  3NBX X;  1FIO A;  2BS2 A;  4YSZ A; 
#chains in the Genus database with same CATH homology
 4JI5 T;  4GKJ T;  4JI3 T;  4JI4 T;  4NXM T;  2HHH T;  4DV0 T;  4B3M T;  1FJG T;  1HNX T;  4DV5 T;  2F4V T;  5LMU T;  4DR3 T;  1IBM T;  4JI7 T;  4KHP T;  2UXC T;  4X62 T;  4DR2 T;  4JI1 T;  4GKK T;  5BR8 T;  4K0K T;  4X64 T;  4B3T T;  1HNW T;  4JI8 T;  4DR1 T;  1J5E T;  2UUC T;  1XNR T;  2UXB T;  2UU9 T;  4LFA T;  4JI6 T;  4B3S T;  5IWA T;  4JI0 T;  4LF9 T;  4DV7 T;  2VQF T;  4YY3 T;  2E5L T;  1N32 T;  1HNZ T;  4LF8 T;  1IBL T;  4X65 T;  4LFB T;  2UXD T;  4DUZ T;  1N36 T;  4LFC T;  4LF6 T;  4OX9 T;  4LF5 T;  1N33 T;  4JI2 T;  5LMN T;  2UUB T;  4NXN T;  1XMO T;  2ZM6 T;  1N34 T;  4LF4 T;  1XNQ T;  4DV6 T;  4YHH T;  1IBK T;  4AQY T;  4B3R T;  4DR5 T;  4DV2 T;  4DV4 T;  4DR7 T;  4DV1 T;  1I94 T;  4DR6 T;  4LF7 T;  4DV3 T;  3T1H T;  2VQE T;  4X66 T;  4JYA T;  4JV5 T;  4DUY T;  3T1Y T;  1HR0 T;  1XMQ T;  2UUA T;  4DR4 T;  3OTO T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...