4YY3T

30s ribosomal subunit- higb complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4yy3T00
4LF6T 2VQET 4LFCT 4JI8T 2UXBT 4DV6T 4JI0T 2ZM6T 4LF9T 1J5ET 4DR4T 1IBMT 2E5LT 4X66T 4DR2T 1N34T 5LMUT 4GKKT 4B3ST 1FJGT 4DV3T 4OX9T 1N32T 4DR7T 1HR0T 1N36T 4LF4T 4KHPT 4DUZT 4JI1T 4JI2T 4X65T 2VQFT 4DV0T 2UXDT 2UU9T 1HNXT 1I94T 4DV2T 4DR5T 4JI7T 4DR1T 1XMOT 4JI5T 4DV4T 4NXMT 4YHHT 4B3MT 3T1YT 1IBLT 4LF7T 4GKJT 4DR6T 4JI4T 4B3TT 4DV7T 3OTOT 1XNQT 4NXNT 1XNRT 5BR8T 1HNWT 1XMQT 4YY3T 2F4VT 4LF5T 5LMNT 4B3RT 4JI3T 4K0KT 4X62T 4LFBT 4DV1T 4AQYT 3T1HT 4DUYT 4X64T 2HHHT 2UXCT 1N33T 4LFAT 4JV5T 4LF8T 5IWAT 2UUBT 2UUCT 1IBKT 4JYAT 4DV5T 1HNZT 2UUAT 4JI6T 4DR3T
chains in the Genus database with same CATH superfamily
2VQET 3ESLA 5CA0E 1HCIA 2RP4A 2X68A 3NRYA 2V7KA 4YXDA 3P50A 3ETVA 2XQ7A 3JAFA 2W00A 3L3PA 5LP6E 5LOVE 5JDQA 4HFCA 3AB3B 1T7SA 4TN7B 3W15B 2VKJA 3AE6A 3RQUA 3ZT5A 3SFEA 5C2TA 3ZT6A 3CQCB 4NPPA 4U33A 5F3JA 4B3MT 3PUAA 5IUXA 1LKXA 2HH7A 2LLYA 2PJQA 3X1DA 4HFBA 3CPZA 2V7LA 2DWGA 5LMNT 3EHZA 2N1GA 5DABA 3N2OA 3L8RA 2VL8A 5L3BB 1D1BA 3CX7B 2NTYA 2BBHA 2KWHA 3ZSTA 3LK2B 1FIOA 1WR0A 3PUYF 2P9BA 2VKHA 4AQFA 2NWBA 1R8IA 3JAEA 3AAEB 2CXDA 4LFCT 2UXBT 3Q9DA 4DV6T 2WWUA 1MMGA 3E08A 3RC8A 4AQGA 5TAOA 2BS4A 2NW7A 5C3JA 2VK9A 2CEAA 3NKZA 4IDZA 2YDQA 5FL1A 4F8HA 3M3ZB 3HKBE 1OEDA 3KVBA 2JQKA 2JRKA 5LGUB 4YJ2E 4GOUA 4DBRA 3EVYA 2YDSA 5AFUL 3TLVA 5L4EA 3CWZB 2E9XD 4EV6A 3RGLA 4JI4T 4B3TT 4YLHA 3HKCE 2Q9QA 1YW0A 5JDGA 5F8PA 1B7TA 1W09A 5LJMA 3ABVA 1CUNA 2BDEA 2YINA 4YHJA 2XQAA 3I9YA 3KV9A 2LHRA 1YQ3A 4OYJA 2UXCT 3ZSSA 2C5KT 5C8YE 4JYAT 2WDQA 5LA6E 2BS3A 2QRXA 3F57A 3LG7A 3OJAA 2NR4A 5CGMA 3CKDA 2KXPB 1U4QA 1SA0E 5JR9C 3LFMA 2LKGA 1IZNB 4WZXA 2WZIA 4O4JE 3AEDA 4Z91A 2IW5B 3HL6A 3QB5A 5L3GB 5LG4A 4DR2T 5KDMC 2CXLA 1NWMX 2BKNA 1V9DA 4ZS2A 3VHLA 3AA6B 2W63A 1HR0T 5ABGA 4IE5A 3FZHB 3PDYA 4F6RC 2OV9A 1HF8A 1WYCA 1W9RA 3BQLA 2WDVA 2XHEB 2XJ7A 1D0YA 3T8OA 3UU4A 3AXJB 2VKDA 3BQKA 1J1JA 2X51A 5KXJA 5LBMA 3LJCA 2D5UA 2L8KA 3O4XE 3U78A 5L3FB 5ABFB 2BKPA 3RYHE 5FXZA 2E5VA 3KBTA 2MOZA 3CX8B 4K0UA 2ACZA 3BK9A 3ZCJA 2D9DA 4TNVA 2WCAA 4EIWA 3OPCA 5FY1A 4PK6A 4QH4A 1DU2A 3ZMVB 3IF8B 1MMNA 2IMLA 4YTMA 5J0ZA 2BVMA 2LSJA 1UX5A 2E5LT 4HGAA 2IDOB 2Y48B 1YD8G 3FBZA 3VR8A 4KI0F 3EDVA 1NENA 4LMJA 5FY0A 4EXTA 4H9PC 4LF4T 4X65T 1H7CA 2MAWA 5F5WA 3ZKRA 4QH5A 3WAJA 2UU9T 3L09A 1I94T 3ZC0A 2KSRA 4DR1T 4TNWA 2H7OA 3Q5XA 5HXCA 3UUNA 2QVAA 2PFVA 3AEBA 1XMQT 1SHZC 3LK3B 3C4XA 1IJ6A 4IL9A 1W0AA 4A5XA 3AEGA 2CA5A 3N9QA 3AE1A 1OEDC 3NBXX 3KDSE 4B3RT 4U2ZA 4X62T 5AQSB 4WBNE 3AXJA 1MIYA 4X64T 2YOEA 3SOLA 2IC9A 3KINB 2PG8A 4IT4A 2QGSA 2YU2A 1UGOA 4ADZA 3ANWB 4PJMA 3OKQA 2BG9B 3PURA 3PV0F 5ETWA 2JMKA 3F2EA 1MIVA 5JH7E 1WFDA 4EOZB 4O8SA 3TLWA 2XQ9A 2JQ9A 4O4IE 4PK5A 4G63A 1N36T 3MZKB 3NVOA 4XZCA 2VQFT 5FXVA 4DV2T 3JC6C 4JI7T 4QX8B 2JQQA 4UELA 4AISA 2LEHA 2W62A 1ZP0A 2JQHA 4DBQA 4J2CA 4EEBA 4UXNB 5ABEA 2YU1A 2K9AA 3ZN1B 4HFDA 2VVSA 3MK7C 2YN6A 4JI3T 2XM2A 5LJNA 4QHOA 2J62A 3UUBA 4K0KT 2C0SA 4AKIA 5L3DB 3MXZA 1WRDA 4PJNA 5HEOA 5LG3A 2XQ6A 5LXTE 4BA9A 2VB6A 3PU8A 2OLTA 3RKGA 2NP9A 4JI6T 3ZEFB 3AVRA 4CXWA 1S35A 3JCFA 1SE7A 3UU5A 4PJLA 1FMWA 3PJAA 2CWOA 3K3QC 5JDHA 3NRXA 2FJDA 2LRKA 1YQ4A 3LDQB 2NW9A 4B3ST 4OX9T 2WDRA 4JI1T 2WQYA 4IE4A 3ONJA 4I0UA 5HXRA 4PNIA 2WP9A 4ANJA 3ANWA 5LHIB 3P4SA 2BG9A 4IE7A 3P7IA 2E9XC 2Q9QD 1FMVA 2CBIA 2XAGB 4DMWA 1OEDE 2LHNA 3O1HA 3RLFF 4TWDA 1IJ5A 3V5UA 5ABHA 3GN5B 4LMLA 4YT0A 4COFA 4IDPA 2FJEA 2HPLA 4H9SE 5L47A 2M6BA 2Y6XA 4AQYT 3IHRA 3G06A 4DUYT 3N9NA 5A1LA 2FBWA 2RPAA 5BMVE 3ZYKA 1XDOA 3C64A 4B6XA 4DV5T 3C4WA 4P0BA 3K3OA 2X66A 1HS7A 5CB4E 2WBLA 4JUYA 4MBQA 1LVFA 3I0OA 4TV8E 3ZT7A 5J2UE 4YTNA 2HN2A 3MACA 1J5ET 3RIUA 3PUQA 1IBMT 1XDPA 3N9OA 5FP3A 2X9WA 5JDLA 3KVAA 4X20E 4X1KE 2UXXB 1FJGT 3FHNA 3VKHA 2V6YB 1UCUA 4MHCA 3UFEA 4U7YA 1WYBA 2ZMAA 4X1IE 4H63V 2DCFA 4E7ZA 2EHOD 4WYVA 4AKHA 2XQ5A 1UUSA 3ZLIA 3P4PA 4GKJT 5E0OA 3SFDA 1MIWA 5HXEA 3RC3A 4IGUA 4IREA 2V26A 4HWIB 1UK5A 2CCQA 2NOXA 2K3WA 5IHYA 2LOSA 5AQPB 3DJBA 3FZKB 2YDRA 4TZ4C 5L4HA 4Z8XA 2WAUA 3ONLC 5EK2A 1QUUA 2XSAA 3ZPOA 1O3XA 2E9XB 4LF6T 4A56A 1U5PA 3MA9A 3AAIA 3GN5A 2V7IA 2DL1A 4I4TE 5FNVE 3Q2MA 3O1JA 5L3CB 2CPTA 1OXZA 4HFVA 4MLKA 2LOPA 4Q25A 4CQIA 4DR7T 3FBLA 1UX4A 4ILBA 4ZEYA 3MJXA 5AQUB 5JDFA 4DMVA 1MNDA 4CN6A 2A9UA 3CMLA 3MKDA 4NIQA 2J47A 5FXWA 3SWHA 4TUYE 1XMOT 3I1AA 4EEDA 2XASB 4U74A 4L0RA 4JEUB 5EK4A 3O9XA 3PTRB 3ONXA 3CQGB 5HEGA 2GK9A 5EZYE 2X9HA 4YTPA 3RYCE 2ACXA 4YJ3E 3N2GE 4KBMB 3UUXB 3U3IA 3A7MA 4BJMA 2KZ7B 4X1YE 2G0UA 1KF6A 2LT3A 2V6YA 2W0GA 1L0VA 2H88A 3T1HT 5HCMA 5JRCB 3PUZF 2WZHA 4ZHQE 3K8PC 2BG9C 4LF8T 5AQJB 2IAKA 3AEEA 1Y01A 2UUAT 1T98A 2K5BB 1E2AA 3Q5EA 4U31A 4A98A 4OHFA 5AQFB 1D0XA 3TKLB 2PTFA 5HEJA 3LK42 3PUWF 4CXXA 2XAFB 1ZV4X 1WLXA 5AQGB 3J7Yq 4PAGA 3QOFA 3FZLB 1HX1B 3VRAA 4MFRA 3VKGA 5HXSA 2XY8B 3RYIE 1N32T 1JNRA 5FY7A 4DUZT 2BBJA 4EYYR 3GMIA 2E9XA 1HNXT 3AE3A 5AQKB 1LVKA 4HFIA 2H89A 2LE8A 5FKYA 1ZOYA 1YKEB 2MPKA 4MALA 1YKHB 2C5JA 3N9PA 1G73A 3AE8A 3RIUC 2JPFA 4NUVA 2B76A 4KMCA 1WR6A 1MMAA 2CHOA 2JIWA 4YSYA 3M65A 4P09A 4EGWA 3RI5A 1KNPA 4G2AA 2XQ8A 3UT5E 4ZOLE 1IAPA 2DHRA 3PUGA 5HWYA 4AKLA 2AXDS 3N9MA 4LFBT 1HTJF 5L2LA 4DV1T 4ZI2C 4I50E 5LHGB 2D0UA 5H6QB 4GYSA 3ZMSB 5AQOB 5LNKA 1ZKEA 4HN9A 5HYAA 3EUHA 4PK4A 2XM1A 3AE5A 3ZMTB 2J4GA 3FZFB 4JI0T 3KBUA 3UFGA 3HKDE 1VCSA 5AQVB 3CX6B 4PFOA 1X9BA 1D1CA 3EI0A 5HCJA 2X0HA 2W2UA 2XAHB 2CHNA 3QUJA 5LMUT 4EB6E 5JRCA 3QB5K 3EAMA 3KFWX 3WI3A 5JREA 3B13A 3I0QA 4QKNA 1SUMB 4I55E 5ABFA 5DQVA 5KMGP 5GONE 5IYZE 4C91A 1Y64B 2ZM2A 4H9RC 5M4YA 4DO0A 3R84B 2ZLYA 3UQ4A 5DQWA 4HWCA 1IBLT 2ZM8A 3B5MA 4LF7T 1US7B 2WB5A 4P1NA 1BR4A 4EAHA 1Z8UA 1NAFA 4NXNT 2B1EA 4EYUA 3ZYMA 4WBOA 2NTXA 4DVDA 4DNDA 3TLSA 4WW0A 3N5LA 4UIGA 2BG9E 2CRBA 2M67A 5AQTB 3F31A 3OBVE 4HE8A 3KV4A 3CVRA 2DWKA 2IHR1 4ZXLA 1VOMA 4QH1A 2D0TA 3D0TA 1BR1A 4IE0A 2VURA 2LJLA 4BJNA 3H37A 3P4WA 4L5GA 4GIWA 4HWDA 3ZMUB 4M1PA 4DR3T 3AA7B 5ADXL 3IA3A 2VASA 5FVLA 4KHZF 4GK0E 4XBFB 1M62A 4OK0A 3Q5DA 2W67A 4U7IA 5J1GA 1BR2A 3AE2A 3HR0A 4H9NC 2WWVA 2FJBA 3RH3A 5L3EB 2LSKA 3ZJ1A 1KNZA 2BKOA 1OWAA 1N34T 2R6GF 2NW8A 4DV3T 2BZBA 3AECA 4KHPT 3P4RA 2VVNA 2KT9A 3E0ZA 4DV0T 3EDUA 4JLEA 5AQMB 2VL0A 4DR5T 3JADA 1FEWA 1MNEA 4ASKA 3CIRA 5JTGA 3CQXC 4JI5T 5FXXA 4YFSA 2V7MA 1M7KA 2I59A 2MYSA 1QSDA 2D2SA 2OA5A 5AQRB 2WS3A 3PU3A 2V7JA 3RRWA 3L39A 4UR9A 3KV5A 4TWHA 2H7VC 4EZHA 4ZI3D 4UVBB 3PE0A 3FXDB 1UURA 3WAKA 2Q9QB 3EABA 4CN4A 2WSSV 2IIUA 1HNZT 2Z6EA 2AE9A 4AXPA 2LSGA 3GWHA 4QX7B 2A72A 4Z90A 4YSZA 4JI8T 1Z0PA 4LMKA 5FMNA 2IUBA 3ETUA 5AQNB 2LM9A 3AEAA 3JC6D 5AQLB 1W0BA 3FXEB 2X9XA 4ZI7E 4HEAA 2WMOA 4IDOA 1HG5A 2CWYA 2CBJA 4IHJE 3FB2A 4ZZCA 3I9WA 5J2TE 4UVAB 3AE9A 4U2YA 3RIFA 4AKGA 4UEMA 1YXRA 4V1Av 3C4ZA 4DV4T 4ISTA 2K24A 4IDQA 2FJAA 2RA1A 2XQ3A 3O1IA 5LGTB 3S4UA 2CLYB 2V1DB 3UQ7A 2X0LB 4O2AE 3PUXF 2YEVC 3K1SA 3RX6A 2XPKA 4HFEA 2KLQA 3C51A 3ZYLA 4PJJA 4DIDB 2EHOB 3AVSA 2IC6A 1HFAA 2K48A 4H9QC 2M6IA 2UUBT 1IBKT 5H6RB 2W61A 2J1DG 2L3LA 3OYXA 5HXHA 1BR0A 4PFPA 3TLTA 2XTLA 4HKAA 4KUMB 4JEHB 4UV8B 2Y8DA 3ZMZB 3RF1A 4X66T 3K3NA 4TWFA 2CXFA 2N2NA 2VWAA 4N78D 4UF0B 3GA8A 4JI2T 2LRLA 4FJOA 2I0MA 1LRZA 3NZQA 1VCTA 2JMHA 4P0AA 2JJ9A 5HAXA 4C90A 4NXMT 5JDNA 2KNDA 4TX5A 3T1YT 3B57A 3PJAJ 5HWXA 2W66A 4DR6T 2ES0A 1KNRA 3OTOT 3DP7A 4QXHB 3PUSA 3LBXB 3FZMB 1XNRT 5BR8T 3UULA 3IBPA 3R6NA 4IL4A 1ZHCA 4UVCB 4LF5T 4QXCB 2LSIA 1KEYA 2V6XA 5JDMA 4OFZA 4XAXB 3OYZA 3RYFE 5CFBA 4L9IA 4H9OC 1NEKA 2BVLA 3J9X1 2XSBA 2CMRA 2A2FX 4IIJE 2QA7A 1I6ZA 1E7PA 3AA1B 2LSYA 4IE6A 1D0ZA 4DR4T 2XAJB 3E22E 2BS2A 2N9DA 3AE7A 3A8YC 2I6HA 5LGNB 2XQYA 3AAAB 3ZJ2A 5CA1E 1KFYA 5FYMA 2WU2A 3Q5WA 3QK6A 2VKOA 4E7SA 5HEUA 3N9LA 2EHOA 2V5DA 2YK0A 2WMNA 2UXDT 4QWNB 5LCYA 3HKEE 2XZEA 3RQWA 1S94A 4A97A 3SRZA 4YHHT 1WCRA 1X79A 5LB7B 4DV7T 1T72A 2W4XA 1HNWT 4PW8A 4O2BE 4YY3T 2KWIB 3SS1A 5FL0A 4UF0A 3RHWA 2XUEA 3VR9A 1JNZA 4TV9E 3RKOA 3VRBA 1CHUA 4JBWF 4ILCA 2WU5A 5JVDE 4CXYA 2HHHT 5LBQB 1QLBA 3KV6A 3NWIA 4JV5T 5AQHB 3AA0B 4ISSA 3NZPA 4HWHA 3HA4A 5DJQC 4ERRA 3LBXA 5AQQB 4X5TA 3A5XA 3TLUA 3UU3A 2FUPA 4CN1A 1D1AA 2PBIA 2KMFA 2ZM6T 4AQFC 4UV9B 4KP3C 2WM9A 2DLRA 1VRBA 1KK7A 4QXBB 3UU6A 5JR9B 4AI6A 1HG2A 4HWFA 2XQ4A 3ZN0B 4ZZBA 1MMDA 2YKSA 4WNKA 3V5SA 3H3MA 5JQGE 4O4LE 1E1HB 2WY2A 1XNQT 1EZ3A 3P8CD 3VU7H 2ZM0A 2MBGA 1T8BA 4ILUA 2V8SV 2F4VT 2ODVA 1GQEA 5CJ5A 2XAQB 2DI4A 4GK5E 2X9YA 2LM2A 2Q9QC 2H3RA 2C5IT 4ZI3C 3LSVA 2SPCA 4AKRB 1N33T 4LFAT 2KINB 5IWAT 4NUUA 3OVUA 2QYWA 3AE4A 4IDNA 2CM0A 2X0YA 3C98B 3IEEA 4CZZB 2DNXA 4CI1B 4U72A 4AIUA 4HFHA 1XWMA 4LF9T 5LYJE 3QC9A 2MTQA 2E8IA 2CE7A 1G8XA 4KX6A 4OYKA 4GKKT 4CI3B 5AQIB 5LHHB 4H63H 4U3CA 4EZ4A 3CK6A 2HN1A 3C50A 2CLYC 4HTEA 3RPUA 3DTOA 3ZCIA 2X67A 2E2AA 1AJ3A 4CI2B 4ZS3A 3UTKA 3H3AA 3ZC1A 2L9QA 1XZYA 3P4QA 3N2KE 3HI2A 5EK3A 4ZI2D 3BQIA 5JR9A 4O4HE 1ZEEA 2LKHA 3AEFA 4I43B 2EHOC 4FI5A 4ILAA 4BAYB 2HPJA 5KX5E 2V5CA 3PUVF 3UUMA 3QNUA 4YSXA 2A3DA 3RRCA 4GYRA 1HX8A 3UU8A 3RIAA 1J5WA 1OEDB 2UUCT 2UXNB 2ODUA 5FVKA 5HEHA
chains in the Genus database with same CATH topology
4LF6T 2VQET 4LFCT 4JI8T 2UXBT 4DV6T 4JI0T 2ZM6T 4LF9T 1J5ET 4DR4T 1IBMT 2E5LT 4X66T 4DR2T 1N34T 5LMUT 4GKKT 4B3ST 1FJGT 4DV3T 4OX9T 1N32T 4DR7T 1HR0T 1N36T 4LF4T 4KHPT 4DUZT 4JI1T 4JI2T 4X65T 2VQFT 4DV0T 2UXDT 2UU9T 1HNXT 1I94T 4DV2T 4DR5T 4JI7T 4DR1T 1XMOT 4JI5T 4DV4T 4NXMT 4YHHT 4B3MT 3T1YT 1IBLT 4LF7T 4GKJT 4DR6T 4JI4T 4B3TT 4DV7T 3OTOT 1XNQT 4NXNT 1XNRT 5BR8T 1HNWT 1XMQT 4YY3T 2F4VT 4LF5T 5LMNT 4B3RT 4JI3T 4K0KT 4X62T 4LFBT 4DV1T 4AQYT 3T1HT 4DUYT 4X64T 2HHHT 2UXCT 1N33T 4LFAT 4JV5T 4LF8T 5IWAT 2UUBT 2UUCT 1IBKT 4JYAT 4DV5T 1HNZT 2UUAT 4JI6T 4DR3T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 T;  2VQE T;  4LFC T;  4JI8 T;  2UXB T;  4DV6 T;  4JI0 T;  2ZM6 T;  4LF9 T;  1J5E T;  4DR4 T;  1IBM T;  2E5L T;  4X66 T;  4DR2 T;  1N34 T;  5LMU T;  4GKK T;  4B3S T;  1FJG T;  4DV3 T;  4OX9 T;  1N32 T;  4DR7 T;  1HR0 T;  1N36 T;  4LF4 T;  4KHP T;  4DUZ T;  4JI1 T;  4JI2 T;  4X65 T;  2VQF T;  4DV0 T;  2UXD T;  2UU9 T;  1HNX T;  1I94 T;  4DV2 T;  4DR5 T;  4JI7 T;  4DR1 T;  1XMO T;  4JI5 T;  4DV4 T;  4NXM T;  4YHH T;  4B3M T;  3T1Y T;  1IBL T;  4LF7 T;  4GKJ T;  4DR6 T;  4JI4 T;  4B3T T;  4DV7 T;  3OTO T;  1XNQ T;  4NXN T;  1XNR T;  5BR8 T;  1HNW T;  1XMQ T;  4YY3 T;  2F4V T;  4LF5 T;  5LMN T;  4B3R T;  4JI3 T;  4K0K T;  4X62 T;  4LFB T;  4DV1 T;  4AQY T;  3T1H T;  4DUY T;  4X64 T;  2HHH T;  2UXC T;  1N33 T;  4LFA T;  4JV5 T;  4LF8 T;  5IWA T;  2UUB T;  2UUC T;  1IBK T;  4JYA T;  4DV5 T;  1HNZ T;  2UUA T;  4JI6 T;  4DR3 T; 
#chains in the Genus database with same CATH topology
 2VQE T;  3ESL A;  5CA0 E;  1HCI A;  2RP4 A;  2X68 A;  3NRY A;  2V7K A;  4YXD A;  3P50 A;  3ETV A;  2XQ7 A;  3JAF A;  2W00 A;  3L3P A;  5LP6 E;  5LOV E;  5JDQ A;  4HFC A;  3AB3 B;  1T7S A;  4TN7 B;  3W15 B;  2VKJ A;  3AE6 A;  3RQU A;  3ZT5 A;  3SFE A;  5C2T A;  3ZT6 A;  3CQC B;  4NPP A;  4U33 A;  5F3J A;  4B3M T;  3PUA A;  5IUX A;  1LKX A;  2HH7 A;  2LLY A;  2PJQ A;  3X1D A;  4HFB A;  3CPZ A;  2V7L A;  2DWG A;  5LMN T;  3EHZ A;  2N1G A;  5DAB A;  3N2O A;  3L8R A;  2VL8 A;  5L3B B;  1D1B A;  3CX7 B;  2NTY A;  2BBH A;  2KWH A;  3ZST A;  3LK2 B;  1FIO A;  1WR0 A;  3PUY F;  2P9B A;  2VKH A;  4AQF A;  2NWB A;  1R8I A;  3JAE A;  3AAE B;  2CXD A;  4LFC T;  2UXB T;  3Q9D A;  4DV6 T;  2WWU A;  1MMG A;  3E08 A;  3RC8 A;  4AQG A;  5TAO A;  2BS4 A;  2NW7 A;  5C3J A;  2VK9 A;  2CEA A;  3NKZ A;  4IDZ A;  2YDQ A;  5FL1 A;  4F8H A;  3M3Z B;  3HKB E;  1OED A;  3KVB A;  2JQK A;  2JRK A;  5LGU B;  4YJ2 E;  4GOU A;  4DBR A;  3EVY A;  2YDS A;  5AFU L;  3TLV A;  5L4E A;  3CWZ B;  2E9X D;  4EV6 A;  3RGL A;  4JI4 T;  4B3T T;  4YLH A;  3HKC E;  2Q9Q A;  1YW0 A;  5JDG A;  5F8P A;  1B7T A;  1W09 A;  5LJM A;  3ABV A;  1CUN A;  2BDE A;  2YIN A;  4YHJ A;  2XQA A;  3I9Y A;  3KV9 A;  2LHR A;  1YQ3 A;  4OYJ A;  2UXC T;  3ZSS A;  2C5K T;  5C8Y E;  4JYA T;  2WDQ A;  5LA6 E;  2BS3 A;  2QRX A;  3F57 A;  3LG7 A;  3OJA A;  2NR4 A;  5CGM A;  3CKD A;  2KXP B;  1U4Q A;  1SA0 E;  5JR9 C;  3LFM A;  2LKG A;  1IZN B;  4WZX A;  2WZI A;  4O4J E;  3AED A;  4Z91 A;  2IW5 B;  3HL6 A;  3QB5 A;  5L3G B;  5LG4 A;  4DR2 T;  5KDM C;  2CXL A;  1NWM X;  2BKN A;  1V9D A;  4ZS2 A;  3VHL A;  3AA6 B;  2W63 A;  1HR0 T;  5ABG A;  4IE5 A;  3FZH B;  3PDY A;  4F6R C;  2OV9 A;  1HF8 A;  1WYC A;  1W9R A;  3BQL A;  2WDV A;  2XHE B;  2XJ7 A;  1D0Y A;  3T8O A;  3UU4 A;  3AXJ B;  2VKD A;  3BQK A;  1J1J A;  2X51 A;  5KXJ A;  5LBM A;  3LJC A;  2D5U A;  2L8K A;  3O4X E;  3U78 A;  5L3F B;  5ABF B;  2BKP A;  3RYH E;  5FXZ A;  2E5V A;  3KBT A;  2MOZ A;  3CX8 B;  4K0U A;  2ACZ A;  3BK9 A;  3ZCJ A;  2D9D A;  4TNV A;  2WCA A;  4EIW A;  3OPC A;  5FY1 A;  4PK6 A;  4QH4 A;  1DU2 A;  3ZMV B;  3IF8 B;  1MMN A;  2IML A;  4YTM A;  5J0Z A;  2BVM A;  2LSJ A;  1UX5 A;  2E5L T;  4HGA A;  2IDO B;  2Y48 B;  1YD8 G;  3FBZ A;  3VR8 A;  4KI0 F;  3EDV A;  1NEN A;  4LMJ A;  5FY0 A;  4EXT A;  4H9P C;  4LF4 T;  4X65 T;  1H7C A;  2MAW A;  5F5W A;  3ZKR A;  4QH5 A;  3WAJ A;  2UU9 T;  3L09 A;  1I94 T;  3ZC0 A;  2KSR A;  4DR1 T;  4TNW A;  2H7O A;  3Q5X A;  5HXC A;  3UUN A;  2QVA A;  2PFV A;  3AEB A;  1XMQ T;  1SHZ C;  3LK3 B;  3C4X A;  1IJ6 A;  4IL9 A;  1W0A A;  4A5X A;  3AEG A;  2CA5 A;  3N9Q A;  3AE1 A;  1OED C;  3NBX X;  3KDS E;  4B3R T;  4U2Z A;  4X62 T;  5AQS B;  4WBN E;  3AXJ A;  1MIY A;  4X64 T;  2YOE A;  3SOL A;  2IC9 A;  3KIN B;  2PG8 A;  4IT4 A;  2QGS A;  2YU2 A;  1UGO A;  4ADZ A;  3ANW B;  4PJM A;  3OKQ A;  2BG9 B;  3PUR A;  3PV0 F;  5ETW A;  2JMK A;  3F2E A;  1MIV A;  5JH7 E;  1WFD A;  4EOZ B;  4O8S A;  3TLW A;  2XQ9 A;  2JQ9 A;  4O4I E;  4PK5 A;  4G63 A;  1N36 T;  3MZK B;  3NVO A;  4XZC A;  2VQF T;  5FXV A;  4DV2 T;  3JC6 C;  4JI7 T;  4QX8 B;  2JQQ A;  4UEL A;  4AIS A;  2LEH A;  2W62 A;  1ZP0 A;  2JQH A;  4DBQ A;  4J2C A;  4EEB A;  4UXN B;  5ABE A;  2YU1 A;  2K9A A;  3ZN1 B;  4HFD A;  2VVS A;  3MK7 C;  2YN6 A;  4JI3 T;  2XM2 A;  5LJN A;  4QHO A;  2J62 A;  3UUB A;  4K0K T;  2C0S A;  4AKI A;  5L3D B;  3MXZ A;  1WRD A;  4PJN A;  5HEO A;  5LG3 A;  2XQ6 A;  5LXT E;  4BA9 A;  2VB6 A;  3PU8 A;  2OLT A;  3RKG A;  2NP9 A;  4JI6 T;  3ZEF B;  3AVR A;  4CXW A;  1S35 A;  3JCF A;  1SE7 A;  3UU5 A;  4PJL A;  1FMW A;  3PJA A;  2CWO A;  3K3Q C;  5JDH A;  3NRX A;  2FJD A;  2LRK A;  1YQ4 A;  3LDQ B;  2NW9 A;  4B3S T;  4OX9 T;  2WDR A;  4JI1 T;  2WQY A;  4IE4 A;  3ONJ A;  4I0U A;  5HXR A;  4PNI A;  2WP9 A;  4ANJ A;  3ANW A;  5LHI B;  3P4S A;  2BG9 A;  4IE7 A;  3P7I A;  2E9X C;  2Q9Q D;  1FMV A;  2CBI A;  2XAG B;  4DMW A;  1OED E;  2LHN A;  3O1H A;  3RLF F;  4TWD A;  1IJ5 A;  3V5U A;  5ABH A;  3GN5 B;  4LML A;  4YT0 A;  4COF A;  4IDP A;  2FJE A;  2HPL A;  4H9S E;  5L47 A;  2M6B A;  2Y6X A;  4AQY T;  3IHR A;  3G06 A;  4DUY T;  3N9N A;  5A1L A;  2FBW A;  2RPA A;  5BMV E;  3ZYK A;  1XDO A;  3C64 A;  4B6X A;  4DV5 T;  3C4W A;  4P0B A;  3K3O A;  2X66 A;  1HS7 A;  5CB4 E;  2WBL A;  4JUY A;  4MBQ A;  1LVF A;  3I0O A;  4TV8 E;  3ZT7 A;  5J2U E;  4YTN A;  2HN2 A;  3MAC A;  1J5E T;  3RIU A;  3PUQ A;  1IBM T;  1XDP A;  3N9O A;  5FP3 A;  2X9W A;  5JDL A;  3KVA A;  4X20 E;  4X1K E;  2UXX B;  1FJG T;  3FHN A;  3VKH A;  2V6Y B;  1UCU A;  4MHC A;  3UFE A;  4U7Y A;  1WYB A;  2ZMA A;  4X1I E;  4H63 V;  2DCF A;  4E7Z A;  2EHO D;  4WYV A;  4AKH A;  2XQ5 A;  1UUS A;  3ZLI A;  3P4P A;  4GKJ T;  5E0O A;  3SFD A;  1MIW A;  5HXE A;  3RC3 A;  4IGU A;  4IRE A;  2V26 A;  4HWI B;  1UK5 A;  2CCQ A;  2NOX A;  2K3W A;  5IHY A;  2LOS A;  5AQP B;  3DJB A;  3FZK B;  2YDR A;  4TZ4 C;  5L4H A;  4Z8X A;  2WAU A;  3ONL C;  5EK2 A;  1QUU A;  2XSA A;  3ZPO A;  1O3X A;  2E9X B;  4LF6 T;  4A56 A;  1U5P A;  3MA9 A;  3AAI A;  3GN5 A;  2V7I A;  2DL1 A;  4I4T E;  5FNV E;  3Q2M A;  3O1J A;  5L3C B;  2CPT A;  1OXZ A;  4HFV A;  4MLK A;  2LOP A;  4Q25 A;  4CQI A;  4DR7 T;  3FBL A;  1UX4 A;  4ILB A;  4ZEY A;  3MJX A;  5AQU B;  5JDF A;  4DMV A;  1MND A;  4CN6 A;  2A9U A;  3CML A;  3MKD A;  4NIQ A;  2J47 A;  5FXW A;  3SWH A;  4TUY E;  1XMO T;  3I1A A;  4EED A;  2XAS B;  4U74 A;  4L0R A;  4JEU B;  5EK4 A;  3O9X A;  3PTR B;  3ONX A;  3CQG B;  5HEG A;  2GK9 A;  5EZY E;  2X9H A;  4YTP A;  3RYC E;  2ACX A;  4YJ3 E;  3N2G E;  4KBM B;  3UUX B;  3U3I A;  3A7M A;  4BJM A;  2KZ7 B;  4X1Y E;  2G0U A;  1KF6 A;  2LT3 A;  2V6Y A;  2W0G A;  1L0V A;  2H88 A;  3T1H T;  5HCM A;  5JRC B;  3PUZ F;  2WZH A;  4ZHQ E;  3K8P C;  2BG9 C;  4LF8 T;  5AQJ B;  2IAK A;  3AEE A;  1Y01 A;  2UUA T;  1T98 A;  2K5B B;  1E2A A;  3Q5E A;  4U31 A;  4A98 A;  4OHF A;  5AQF B;  1D0X A;  3TKL B;  2PTF A;  5HEJ A;  3LK4 2;  3PUW F;  4CXX A;  2XAF B;  1ZV4 X;  1WLX A;  5AQG B;  3J7Y q;  4PAG A;  3QOF A;  3FZL B;  1HX1 B;  3VRA A;  4MFR A;  3VKG A;  5HXS A;  2XY8 B;  3RYI E;  1N32 T;  1JNR A;  5FY7 A;  4DUZ T;  2BBJ A;  4EYY R;  3GMI A;  2E9X A;  1HNX T;  3AE3 A;  5AQK B;  1LVK A;  4HFI A;  2H89 A;  2LE8 A;  5FKY A;  1ZOY A;  1YKE B;  2MPK A;  4MAL A;  1YKH B;  2C5J A;  3N9P A;  1G73 A;  3AE8 A;  3RIU C;  2JPF A;  4NUV A;  2B76 A;  4KMC A;  1WR6 A;  1MMA A;  2CHO A;  2JIW A;  4YSY A;  3M65 A;  4P09 A;  4EGW A;  3RI5 A;  1KNP A;  4G2A A;  2XQ8 A;  3UT5 E;  4ZOL E;  1IAP A;  2DHR A;  3PUG A;  5HWY A;  4AKL A;  2AXD S;  3N9M A;  4LFB T;  1HTJ F;  5L2L A;  4DV1 T;  4ZI2 C;  4I50 E;  5LHG B;  2D0U A;  5H6Q B;  4GYS A;  3ZMS B;  5AQO B;  5LNK A;  1ZKE A;  4HN9 A;  5HYA A;  3EUH A;  4PK4 A;  2XM1 A;  3AE5 A;  3ZMT B;  2J4G A;  3FZF B;  4JI0 T;  3KBU A;  3UFG A;  3HKD E;  1VCS A;  5AQV B;  3CX6 B;  4PFO A;  1X9B A;  1D1C A;  3EI0 A;  5HCJ A;  2X0H A;  2W2U A;  2XAH B;  2CHN A;  3QUJ A;  5LMU T;  4EB6 E;  5JRC A;  3QB5 K;  3EAM A;  3KFW X;  3WI3 A;  5JRE A;  3B13 A;  3I0Q A;  4QKN A;  1SUM B;  4I55 E;  5ABF A;  5DQV A;  5KMG P;  5GON E;  5IYZ E;  4C91 A;  1Y64 B;  2ZM2 A;  4H9R C;  5M4Y A;  4DO0 A;  3R84 B;  2ZLY A;  3UQ4 A;  5DQW A;  4HWC A;  1IBL T;  2ZM8 A;  3B5M A;  4LF7 T;  1US7 B;  2WB5 A;  4P1N A;  1BR4 A;  4EAH A;  1Z8U A;  1NAF A;  4NXN T;  2B1E A;  4EYU A;  3ZYM A;  4WBO A;  2NTX A;  4DVD A;  4DND A;  3TLS A;  4WW0 A;  3N5L A;  4UIG A;  2BG9 E;  2CRB A;  2M67 A;  5AQT B;  3F31 A;  3OBV E;  4HE8 A;  3KV4 A;  3CVR A;  2DWK A;  2IHR 1;  4ZXL A;  1VOM A;  4QH1 A;  2D0T A;  3D0T A;  1BR1 A;  4IE0 A;  2VUR A;  2LJL A;  4BJN A;  3H37 A;  3P4W A;  4L5G A;  4GIW A;  4HWD A;  3ZMU B;  4M1P A;  4DR3 T;  3AA7 B;  5ADX L;  3IA3 A;  2VAS A;  5FVL A;  4KHZ F;  4GK0 E;  4XBF B;  1M62 A;  4OK0 A;  3Q5D A;  2W67 A;  4U7I A;  5J1G A;  1BR2 A;  3AE2 A;  3HR0 A;  4H9N C;  2WWV A;  2FJB A;  3RH3 A;  5L3E B;  2LSK A;  3ZJ1 A;  1KNZ A;  2BKO A;  1OWA A;  1N34 T;  2R6G F;  2NW8 A;  4DV3 T;  2BZB A;  3AEC A;  4KHP T;  3P4R A;  2VVN A;  2KT9 A;  3E0Z A;  4DV0 T;  3EDU A;  4JLE A;  5AQM B;  2VL0 A;  4DR5 T;  3JAD A;  1FEW A;  1MNE A;  4ASK A;  3CIR A;  5JTG A;  3CQX C;  4JI5 T;  5FXX A;  4YFS A;  2V7M A;  1M7K A;  2I59 A;  2MYS A;  1QSD A;  2D2S A;  2OA5 A;  5AQR B;  2WS3 A;  3PU3 A;  2V7J A;  3RRW A;  3L39 A;  4UR9 A;  3KV5 A;  4TWH A;  2H7V C;  4EZH A;  4ZI3 D;  4UVB B;  3PE0 A;  3FXD B;  1UUR A;  3WAK A;  2Q9Q B;  3EAB A;  4CN4 A;  2WSS V;  2IIU A;  1HNZ T;  2Z6E A;  2AE9 A;  4AXP A;  2LSG A;  3GWH A;  4QX7 B;  2A72 A;  4Z90 A;  4YSZ A;  4JI8 T;  1Z0P A;  4LMK A;  5FMN A;  2IUB A;  3ETU A;  5AQN B;  2LM9 A;  3AEA A;  3JC6 D;  5AQL B;  1W0B A;  3FXE B;  2X9X A;  4ZI7 E;  4HEA A;  2WMO A;  4IDO A;  1HG5 A;  2CWY A;  2CBJ A;  4IHJ E;  3FB2 A;  4ZZC A;  3I9W A;  5J2T E;  4UVA B;  3AE9 A;  4U2Y A;  3RIF A;  4AKG A;  4UEM A;  1YXR A;  4V1A v;  3C4Z A;  4DV4 T;  4IST A;  2K24 A;  4IDQ A;  2FJA A;  2RA1 A;  2XQ3 A;  3O1I A;  5LGT B;  3S4U A;  2CLY B;  2V1D B;  3UQ7 A;  2X0L B;  4O2A E;  3PUX F;  2YEV C;  3K1S A;  3RX6 A;  2XPK A;  4HFE A;  2KLQ A;  3C51 A;  3ZYL A;  4PJJ A;  4DID B;  2EHO B;  3AVS A;  2IC6 A;  1HFA A;  2K48 A;  4H9Q C;  2M6I A;  2UUB T;  1IBK T;  5H6R B;  2W61 A;  2J1D G;  2L3L A;  3OYX A;  5HXH A;  1BR0 A;  4PFP A;  3TLT A;  2XTL A;  4HKA A;  4KUM B;  4JEH B;  4UV8 B;  2Y8D A;  3ZMZ B;  3RF1 A;  4X66 T;  3K3N A;  4TWF A;  2CXF A;  2N2N A;  2VWA A;  4N78 D;  4UF0 B;  3GA8 A;  4JI2 T;  2LRL A;  4FJO A;  2I0M A;  1LRZ A;  3NZQ A;  1VCT A;  2JMH A;  4P0A A;  2JJ9 A;  5HAX A;  4C90 A;  4NXM T;  5JDN A;  2KND A;  4TX5 A;  3T1Y T;  3B57 A;  3PJA J;  5HWX A;  2W66 A;  4DR6 T;  2ES0 A;  1KNR A;  3OTO T;  3DP7 A;  4QXH B;  3PUS A;  3LBX B;  3FZM B;  1XNR T;  5BR8 T;  3UUL A;  3IBP A;  3R6N A;  4IL4 A;  1ZHC A;  4UVC B;  4LF5 T;  4QXC B;  2LSI A;  1KEY A;  2V6X A;  5JDM A;  4OFZ A;  4XAX B;  3OYZ A;  3RYF E;  5CFB A;  4L9I A;  4H9O C;  1NEK A;  2BVL A;  3J9X 1;  2XSB A;  2CMR A;  2A2F X;  4IIJ E;  2QA7 A;  1I6Z A;  1E7P A;  3AA1 B;  2LSY A;  4IE6 A;  1D0Z A;  4DR4 T;  2XAJ B;  3E22 E;  2BS2 A;  2N9D A;  3AE7 A;  3A8Y C;  2I6H A;  5LGN B;  2XQY A;  3AAA B;  3ZJ2 A;  5CA1 E;  1KFY A;  5FYM A;  2WU2 A;  3Q5W A;  3QK6 A;  2VKO A;  4E7S A;  5HEU A;  3N9L A;  2EHO A;  2V5D A;  2YK0 A;  2WMN A;  2UXD T;  4QWN B;  5LCY A;  3HKE E;  2XZE A;  3RQW A;  1S94 A;  4A97 A;  3SRZ A;  4YHH T;  1WCR A;  1X79 A;  5LB7 B;  4DV7 T;  1T72 A;  2W4X A;  1HNW T;  4PW8 A;  4O2B E;  4YY3 T;  2KWI B;  3SS1 A;  5FL0 A;  4UF0 A;  3RHW A;  2XUE A;  3VR9 A;  1JNZ A;  4TV9 E;  3RKO A;  3VRB A;  1CHU A;  4JBW F;  4ILC A;  2WU5 A;  5JVD E;  4CXY A;  2HHH T;  5LBQ B;  1QLB A;  3KV6 A;  3NWI A;  4JV5 T;  5AQH B;  3AA0 B;  4ISS A;  3NZP A;  4HWH A;  3HA4 A;  5DJQ C;  4ERR A;  3LBX A;  5AQQ B;  4X5T A;  3A5X A;  3TLU A;  3UU3 A;  2FUP A;  4CN1 A;  1D1A A;  2PBI A;  2KMF A;  2ZM6 T;  4AQF C;  4UV9 B;  4KP3 C;  2WM9 A;  2DLR A;  1VRB A;  1KK7 A;  4QXB B;  3UU6 A;  5JR9 B;  4AI6 A;  1HG2 A;  4HWF A;  2XQ4 A;  3ZN0 B;  4ZZB A;  1MMD A;  2YKS A;  4WNK A;  3V5S A;  3H3M A;  5JQG E;  4O4L E;  1E1H B;  2WY2 A;  1XNQ T;  1EZ3 A;  3P8C D;  3VU7 H;  2ZM0 A;  2MBG A;  1T8B A;  4ILU A;  2V8S V;  2F4V T;  2ODV A;  1GQE A;  5CJ5 A;  2XAQ B;  2DI4 A;  4GK5 E;  2X9Y A;  2LM2 A;  2Q9Q C;  2H3R A;  2C5I T;  4ZI3 C;  3LSV A;  2SPC A;  4AKR B;  1N33 T;  4LFA T;  2KIN B;  5IWA T;  4NUU A;  3OVU A;  2QYW A;  3AE4 A;  4IDN A;  2CM0 A;  2X0Y A;  3C98 B;  3IEE A;  4CZZ B;  2DNX A;  4CI1 B;  4U72 A;  4AIU A;  4HFH A;  1XWM A;  4LF9 T;  5LYJ E;  3QC9 A;  2MTQ A;  2E8I A;  2CE7 A;  1G8X A;  4KX6 A;  4OYK A;  4GKK T;  4CI3 B;  5AQI B;  5LHH B;  4H63 H;  4U3C A;  4EZ4 A;  3CK6 A;  2HN1 A;  3C50 A;  2CLY C;  4HTE A;  3RPU A;  3DTO A;  3ZCI A;  2X67 A;  2E2A A;  1AJ3 A;  4CI2 B;  4ZS3 A;  3UTK A;  3H3A A;  3ZC1 A;  2L9Q A;  1XZY A;  3P4Q A;  3N2K E;  3HI2 A;  5EK3 A;  4ZI2 D;  3BQI A;  5JR9 A;  4O4H E;  1ZEE A;  2LKH A;  3AEF A;  4I43 B;  2EHO C;  4FI5 A;  4ILA A;  4BAY B;  2HPJ A;  5KX5 E;  2V5C A;  3PUV F;  3UUM A;  3QNU A;  4YSX A;  2A3D A;  3RRC A;  4GYR A;  1HX8 A;  3UU8 A;  3RIA A;  1J5W A;  1OED B;  2UUC T;  2UXN B;  2ODU A;  5FVK A;  5HEH A; 
#chains in the Genus database with same CATH homology
 4LF6 T;  2VQE T;  4LFC T;  4JI8 T;  2UXB T;  4DV6 T;  4JI0 T;  2ZM6 T;  4LF9 T;  1J5E T;  4DR4 T;  1IBM T;  2E5L T;  4X66 T;  4DR2 T;  1N34 T;  5LMU T;  4GKK T;  4B3S T;  1FJG T;  4DV3 T;  4OX9 T;  1N32 T;  4DR7 T;  1HR0 T;  1N36 T;  4LF4 T;  4KHP T;  4DUZ T;  4JI1 T;  4JI2 T;  4X65 T;  2VQF T;  4DV0 T;  2UXD T;  2UU9 T;  1HNX T;  1I94 T;  4DV2 T;  4DR5 T;  4JI7 T;  4DR1 T;  1XMO T;  4JI5 T;  4DV4 T;  4NXM T;  4YHH T;  4B3M T;  3T1Y T;  1IBL T;  4LF7 T;  4GKJ T;  4DR6 T;  4JI4 T;  4B3T T;  4DV7 T;  3OTO T;  1XNQ T;  4NXN T;  1XNR T;  5BR8 T;  1HNW T;  1XMQ T;  4YY3 T;  2F4V T;  4LF5 T;  5LMN T;  4B3R T;  4JI3 T;  4K0K T;  4X62 T;  4LFB T;  4DV1 T;  4AQY T;  3T1H T;  4DUY T;  4X64 T;  2HHH T;  2UXC T;  1N33 T;  4LFA T;  4JV5 T;  4LF8 T;  5IWA T;  2UUB T;  2UUC T;  1IBK T;  4JYA T;  4DV5 T;  1HNZ T;  2UUA T;  4JI6 T;  4DR3 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...