4YY3T

30s ribosomal subunit- higb complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4yy3T00
1XNRT 1HNWT 4JYAT 4LF6T 1XNQT 4LF9T 4KHPT 4LF7T 2UUCT 4DV7T 4B3RT 1IBMT 1N32T 4DV0T 4NXMT 4B3TT 4DR1T 4NXNT 2VQET 4JI0T 4JI6T 1IBLT 3T1YT 2UXDT 4YHHT 4DR7T 4DV3T 1HNXT 1I94T 4DV1T 1J5ET 4DV6T 4DV5T 4JI7T 2HHHT 4DUYT 4LFBT 2E5LT 5LMNT 4OX9T 4DR6T 4DR3T 4LFCT 2UXCT 4LFAT 1N34T 2F4VT 3OTOT 4DV4T 4JI4T 1HNZT 1HR0T 4JI3T 2UXBT 2UUAT 1N33T 1IBKT 4JI1T 2UU9T 4X65T 4DUZT 1FJGT 2UUBT 4DV2T 4LF5T 4DR2T 4DR5T 1XMQT 4B3MT 4LF8T 4GKKT 4JI5T 4X64T 3T1HT 4AQYT 5IWAT 1XMOT 4K0KT 2VQFT 4YY3T 4B3ST 4LF4T 4JI8T 1N36T 2ZM6T 4JV5T 5BR8T 4DR4T 4X62T 5LMUT 4GKJT 4JI2T 4X66T
chains in the Genus database with same CATH superfamily
2Z6EA 5JDQA 2BKOA 3PJAJ 4HN9A 2JIWA 3CQCB 4UVCB 2W0GA 2H7VC 5JDLA 2X9XA 2FUPA 2Y48B 2HPJA 3NRYA 4PK6A 3UUMA 2XASB 2A2FX 3ONLC 2ES0A 2VVNA 3RX6A 4EZ4A 4YHJA 4YSXA 2E8IA 3W15B 2EHOB 2BKPA 2L8KA 3LK3B 4PAGA 4NPPA 2YU1A 2ACXA 3KBUA 1XNQT 2X66A 5HEOA 3UU8A 4LF9T 3VRBA 2W2UA 3EUHA 4ZZCA 1ZKEA 4O4HE 5JREA 1M62A 3ZC0A 2IDOB 3WAJA 4DV7T 4B3RT 1WFDA 2WQYA 4GIWA 4TWDA 4ZS3A 5LJNA 3N2OA 4IDOA 5LXTE 4UXNB 2YKSA 2VL0A 5AQVB 2LSIA 3OBVE 3ZMVB 2XAGB 2ODVA 3SOLA 5L3BB 4CN1A 5H6RB 1MIWA 3RLFF 3CVRA 1NEKA 2WZHA 2LOPA 4HTEA 1L0VA 1XWMA 2CHOA 4TNVA 3N9QA 5L4EA 2M6BA 3AA1B 4F6RC 1J1JA 5HXHA 1WYBA 4Z90A 3OKQA 4Q25A 4IE5A 3L39A 2V7KA 5EK2A 5L2LA 2I0MA 4UELA 4DMWA 1HNXT 5FVLA 1JNRA 2QYWA 3IA3A 2YOEA 1KF6A 2YU2A 1T8BA 2XQYA 4GK0E 4O4JE 2MAWA 4OYKA 5LOVE 2L3LA 3ZPOA 4DV5T 5FP3A 3UUXB 5JDNA 5M4YA 5L3FB 2HHHT 2N1GA 4XBFB 2QGSA 3RYCE 2LOSA 2VURA 4LFBT 2W00A 4AKIA 2K3WA 3FBZA 4OX9T 4TWHA 1D1AA 2XHEB 1XDPA 5HEGA 4H9RC 3EDUA 2LLYA 3AEEA 2OA5A 4DR3T 2CCQA 4Z8XA 2WMNA 4ILBA 3UU6A 4YT0A 3MK7C 1BR2A 2B76A 3ESLA 5F5WA 2PG8A 1UK5A 1B7TA 2CXDA 1HX1B 2E2AA 3RGLA 4CXXA 4DMVA 2V5DA 4PFOA 3R84B 3TLUA 3AXJB 2K24A 4AKLA 4HFBA 4DBRA 4ISTA 4OK0A 4YTPA 3AEFA 3AEGA 4IIJE 4TZ4C 3PDYA 3Q5XA 2NP9A 4I0UA 5ETWA 3FZLB 3NRXA 1R8IA 4DUYT 1IBKT 5ABEA 3GN5A 5AQTB 2DWKA 3KV6A 2BZBA 3FZKB 4UVBB 5AFUL 4ZEYA 4U31A 3P4PA 1Y64B 2B1EA 1FMVA 3K3QC 3PJAA 5FXVA 4DUZT 1WR6A 1LRZA 2LE8A 4JYAT 2I59A 2Y6XA 4K0UA 5HEUA 2BVLA 4ZI2C 3I0OA 3AE4A 2X0LB 3C4XA 2A3DA 5LBQB 3DJBA 2JRKA 4ZI2D 5HWXA 4YSZA 4OHFA 4U7IA 2D5UA 3SS1A 5ABFB 4DR2T 3I1AA 2XQ5A 3UFGA 3NWIA 4DBQA 1MIVA 2UXCT 3ZN1B 5H6QB 4HFCA 4LMKA 1QLBA 4LF8T 4KBMB 3UQ4A 4HFHA 2OV9A 2E9XD 5KX5E 5J2UE 4ISSA 3UQ7A 2DNXA 1IAPA 5FYMA 3VKGA 3P8CD 2E5VA 3LDQB 3PTRB 2E5LT 1MMGA 2VKHA 4MBQA 5CFBA 2KINB 2XQ9A 3BQLA 3TKLB 2BBJA 2BS3A 2H7OA 3Q5DA 4EAHA 5C8YE 4JI8T 4IE4A 3RRCA 2MPKA 3AA0B 2RPAA 4IDZA 2KZ7B 4YTNA 2XQ4A 5LB7B 2WCAA 2X67A 5F8PA 2DCFA 2LSYA 3B13A 3Q2MA 2BG9E 3O1HA 2LKGA 5C2TA 1I6ZA 3JAEA 4DR4T 3E08A 4X62T 3CX7B 4U7YA 1KNRA 2BS2A 3SRZA 4FJOA 5AQIB 2W4XA 2IMLA 2QVAA 2XQ3A 4H9QC 1D1BA 1D0XA 4I4TE 1UX4A 3CX6B 4EOZB 4X66T 4HFDA 1VOMA 2EHOA 1OEDB 3ABVA 2J47A 3IHRA 4WYVA 2AE9A 5AQOB 4KUMB 1SE7A 3AEAA 3ETUA 5J0ZA 3CKDA 3Q5EA 4CI1B 2WZIA 4X1YE 3TLVA 3RIUC 1HNWT 1T98A 3N2GE 2W62A 2G0UA 4EV6A 4HWDA 1BR0A 1MMDA 4NIQA 2D2SA 2M6IA 1HG5A 1YQ4A 4LF6T 2WDQA 1S35A 3OJAA 3EHZA 3AE1A 2D0UA 3PE0A 4CXWA 2XAHB 4HWHA 2JMKA 1OWAA 3H3AA 3LG7A 2X51A 4HWFA 4UF0B 2X9YA 3F31A 2VVSA 1SUMB 3L8RA 4U33A 4ZHQE 4NUUA 4OYJA 2NW8A 4PJNA 2N9DA 2LM9A 4WZXA 5JTGA 3HL6A 2KWIB 1VRBA 1NENA 5BMVE 2CHNA 2Y8DA 3AAAB 3MJXA 4XZCA 4YTMA 3R6NA 3QOFA 3A7MA 4KP3C 4P0AA 1T7SA 1WLXA 2LEHA 5JVDE 4NXNT 5ABFA 1KNPA 3P4WA 4I43B 2V7MA 2WWUA 3Q9DA 5AQRB 1IBLT 4JI6T 4JI0T 2UXDT 3NVOA 4H63H 5KMGP 2Q9QA 1LVFA 3EAMA 3N9MA 3TLTA 4AQFA 3N2KE 3CIRA 5C3JA 3PUSA 2DWGA 4L0RA 2HPLA 4X1IE 3TLWA 2X68A 1J5ET 2EHOC 2IUBA 3HI2A 2M67A 3RF1A 3VHLA 2YN6A 5KXJA 4HE8A 3RC3A 5LYJE 3JC6C 3GA8A 2V26A 4ZI3D 5LHHB 1QUUA 2XQ7A 3KV5A 5FNVE 4AISA 2MTQA 2K48A 3Q5WA 5LMNT 3RYFE 4LFCT 4DR6T 3PUYF 4F8HA 4TNWA 3LFMA 2CXFA 3CQGB 2WU5A 3UUBA 4CQIA 5JR9B 3AE7A 4MALA 3ONXA 4QX7B 1N34T 4JI4T 2MBGA 5DABA 2WM9A 3K1SA 2SPCA 4PW8A 4QHOA 3PUVF 3AAIA 3FBLA 2WDVA 3GN5B 3PUWF 1WCRA 1IZNB 2CE7A 4NUVA 4Z91A 5FVKA 3C98B 3ZYLA 3ONJA 5L3EB 1N33T 2DL1A 2JJ9A 3MZKB 2HH7A 1YD8G 5AQLB 4JI1T 2V6YB 3RPUA 1Z8UA 1V9DA 4J2CA 3FXDB 3FZFB 2KT9A 3RIUA 1KEYA 2IC9A 3EDVA 3QC9A 1FJGT 1U5PA 2FJAA 2LSGA 5L4HA 3P4SA 3C4WA 3UFEA 5JDMA 2D9DA 4DV2T 4GK5E 3KDSE 2JMHA 3O4XE 4H9NC 2VKJA 4IDPA 2BG9A 4IT4A 3V5UA 1IJ5A 5JDGA 5JR9C 4H9SE 2V6YA 4LF5T 2KXPB 4O4IE 1VCTA 3C51A 2GK9A 4AIUA 2CBJA 4A97A 2WP9A 2ZM0A 5LHGB 2XM1A 5HEHA 3HKCE 2WWVA 4A98A 4PFPA 3ZSTA 2VB6A 4E7SA 4ZZBA 5HYAA 3AA7B 4X20E 4X64T 5CGMA 2UXXB 3MA9A 2KLQA 4B6XA 4ERRA 5LP6E 4IE6A 4A5XA 3ZLIA 4YFSA 2VL8A 3H3MA 5AQFB 2NWBA 3L09A 1D1CA 3J9X1 5JH7E 2KMFA 1O3XA 2D0TA 5IYZE 4UIGA 3KV4A 5FXZA 3ZKRA 2LKHA 5J2TE 4HFVA 2ZM6T 2P9BA 3EI0A 4P1NA 1X9BA 4JV5T 2BG9B 2V5CA 2CPTA 2WB5A 5L47A 5BR8T 5LA6E 3AE9A 4CI2B 1T72A 2WS3A 3G06A 3ZT7A 3RI5A 1ZP0A 3CPZA 3PV0F 3ZMTB 3N9NA 3ZMZB 2XAJB 4ILCA 4MLKA 5HXEA 4TX5A 1AJ3A 3AE8A 5JQGE 4CXYA 2K5BB 2VKDA 2WBLA 2ZM8A 2CRBA 1Z0PA 3BQIA 3IEEA 1NAFA 2NTXA 2I6HA 3FZMB 4KHZF 3RH3A 1FMWA 2R6GF 2Q9QC 4CN4A 2X9WA 5LCYA 2XJ7A 2AXDS 4AKHA 4X5TA 4BJNA 5FL0A 2CM0A 3FHNA 5DJQC 3GMIA 5AQNB 2PTFA 2CBIA 1MMAA 5HXRA 2ODUA 3HKEE 4JEHB 4QXHB 5AQGB 5JR9A 5HXCA 3VR9A 2C0SA 3UU4A 4N78D 1WR0A 2J62A 2WY2A 4EYUA 5ADXL 4KHPT 4UR9A 4LF7T 5HWYA 4EZHA 1W09A 2UUCT 2XM2A 2J1DG 4YJ3E 4JEUB 3N5LA 2WAUA 3RYIE 4A56A 3CX8B 2PFVA 3OYXA 3P4RA 4V1Av 3RQUA 3PUZF 4TN7B 4NXMT 4B3TT 1VCSA 2H88A 2W66A 3IBPA 4IDQA 5FXXA 1MIYA 5GONE 4EEDA 4WBNE 3VKHA 2VK9A 2XAFB 4M1PA 3ZCJA 2DHRA 5JRCB 2KSRA 1ZOYA 3JC6D 4YJ2E 4PK5A 2LJLA 2VQET 1HF8A 2EHOD 4WW0A 5LGTB 3RC8A 3A5XA 4YHHT 2XPKA 2WSSV 3E22E 1N32T 5AQHB 5CB4E 3O1JA 5A1LA 5E0OA 2IIUA 2CMRA 4U74A 5FY0A 4TUYE 4DV3T 3I9WA 2QA7A 3J7Yq 3DTOA 1I94T 3X1DA 3AECA 3UT5E 4QH1A 3HKBE 4H9PC 4UEMA 3ZYKA 4DV6T 2HN1A 4E7ZA 3A8YC 4JI7T 1S94A 5AQQB 4P0BA 3WI3A 1HS7A 2IC6A 2YK0A 3FB2A 2XQ6A 3VRAA 3NZQA 2BVMA 2VWAA 5IHYA 3SFEA 4IL9A 2F4VT 3KVAA 1UCUA 4EYYR 3JAFA 2WDRA 5ABHA 2XAQB 3ETVA 4HEAA 2NTYA 1HR0T 4MFRA 3RRWA 2E9XB 4U3CA 4JI3T 3MXZA 5FL1A 3SWHA 4HWIB 2LT3A 1HTJF 1ZV4X 2WU2A 2XY8B 2YDRA 3C64A 3LBXA 4GYRA 2XSBA 4PJLA 3RHWA 3RYHE 4AI6A 4IGUA 4YSYA 1UURA 1YKEB 2FJBA 4EGWA 4PK4A 3TLSA 3AEDA 2W63A 3N9PA 1WYCA 1CHUA 3PURA 5HCMA 5HXSA 1UGOA 5KDMC 3O9XA 1E1HB 3C50A 4QH4A 1ZEEA 2YDQA 5FY1A 3AE3A 4TV9E 2ZLYA 2V7IA 3CMLA 1X79A 5FXWA 4CI3B 1XZYA 2DI4A 3E0ZA 3QUJA 3ZJ1A 3CWZB 3U78A 4IHJE 1HX8A 3HR0A 2DLRA 2JQHA 1W0BA 4EXTA 2K9AA 5HEJA 3K3OA 5J1GA 4JLEA 4O2AE 4GKKT 2L9QA 4O4LE 3ZJ2A 3T1HT 4IE7A 2QRXA 3D0TA 3PU3A 1BR1A 2PBIA 1XMOT 2JQKA 1M7KA 1XDOA 2YINA 4GYSA 1W9RA 2VQFT 4B3ST 5JDFA 2N2NA 5HAXA 1ZHCA 5FMNA 4ZXLA 4LF4T 4KMCA 2CXLA 3VU7H 3WAKA 3ZC1A 1SHZC 2LHRA 3NKZA 4YLHA 5CA0E 2IAKA 2XQAA 4QXCB 5L3GB 1N36T 1EZ3A 2FBWA 1G73A 4TV8E 2XTLA 4C91A 3F2EA 2HN2A 2X9HA 4AQGA 4AXPA 1J5WA 2X0HA 2V6XA 1HG2A 3NBXX 1E7PA 2E9XC 2XSAA 1MMNA 2UUBT 5JRCA 3QB5A 1MNDA 2ACZA 3QB5K 3K8PC 3ZEFB 4WBOA 3P50A 4HWCA 4LMLA 4HGAA 3N9OA 2ZM2A 4XAXB 3OYZA 3KVBA 1XNRT 1DU2A 2V8SV 3F57A 2NW9A 3P4QA 4EB6E 3SFDA 1LKXA 2CEAA 3V5SA 2IHR1 3AE2A 3BQKA 5L3DB 3LK2B 4UVAB 4PJJA 2LSJA 3FXEB 4IDNA 1D0ZA 2JQQA 5L3CB 3ZN0B 1IJ6A 1US7B 4DNDA 2V1DB 3K3NA 2Q9QB 3NZPA 2VASA 2BKNA 4I55E 4L9IA 4COFA 3RKGA 3P7IA 2JQ9A 3N9LA 3KV9A 4QWNB 3ZT6A 1OXZA 3PUXF 2W67A 3DP7A 3QNUA 4KX6A 4OFZA 2CLYC 5LJMA 4G2AA 1IBMT 2PJQA 4DV0T 1JNZA 3GWHA 4UV8B 1KK7A 2V7JA 5TAOA 2XQ8A 2RP4A 3ZSSA 1KNZA 5FKYA 3AE6A 1Y01A 3BK9A 3H37A 3MACA 1UUSA 2FJEA 4ZI3C 4BAYB 4DR1T 3EVYA 2LM2A 2Q9QD 2MYSA 4P09A 4UF0A 4EIWA 5CJ5A 5DQVA 3OPCA 3AVSA 4BJMA 1E2AA 1OEDA 2CWOA 4L5GA 3ZT5A 2YEVC 5LHIB 3T1YT 3QK6A 4GOUA 2LSKA 3PUGA 5ABGA 3UU3A 2KWHA 4G63A 4I50E 4ZOLE 1HNZT 5AQSB 2NOXA 4DV1T 3L3PA 1BR4A 1YW0A 1FIOA 3AAEB 2NR4A 3FZHB 3LBXB 3RQWA 3T8OA 5FY7A 2CWYA 5AQPB 1UX5A 2H89A 4BA9A 4WNKA 5LG3A 3CK6A 2MOZA 4ASKA 1HCIA 1LVKA 1FEWA 2E9XA 2V7LA 3I9YA 4LMJA 4O8SA 3UU5A 4DIDB 2WMOA 3B57A 3CQXC 5AQJB 2A72A 4ILAA 4IREA 4PNIA 4LFAT 3UUNA 1D0YA 5AQUB 4ZS2A 3OTOT 4DV4T 5LGNB 4JUYA 1CUNA 2BS4A 3JADA 3AEBA 3O1IA 3PUAA 4U2YA 3ANWB 2UXBT 2UUAT 5LG4A 2KNDA 4QH5A 5HCJA 2UXNB 2XZEA 4H63V 3UTKA 4QKNA 3ZMUB 4HKAA 2BG9C 1GQEA 2UU9T 4X65T 3VR8A 2FJDA 3AVRA 5EZYE 4EEBA 5LGUB 2LHNA 3RIFA 5JDHA 4TWFA 3EABA 3PUQA 4PJMA 4H9OC 1KFYA 3C4ZA 4IE0A 2BDEA 4ZI7E 2X0YA 3LJCA 3MKDA 3LK42 4KI0F 1OEDC 3M65A 3JCFA 4UV9B 3U3IA 3OVUA 2NW7A 4ANJA 4DR5T 3ANWA 1XMQT 3KBTA 2IW5B 4B3MT 4AKGA 3AA6B 3I0QA 3HKDE 4QXBB 3ZCIA 2C5IT 1WRDA 2LRKA 4HFIA 4QX8B 5EK3A 1MNEA 4JI5T 1YQ3A 2LRLA 4IL4A 3UULA 4DO0A 1NWMX 2W61A 1H7CA 4YXDA 1G8XA 2A9UA 5IWAT 4U72A 5F3JA 4AQYT 2C5JA 2JPFA 3RIAA 3ZYMA 4CN6A 4K0KT 4JBWF 4YY3T 4DR7T 1HFAA 1U4QA 5IUXA 2H3RA 2ZMAA 1SA0E 2BBHA 2YDSA 5DQWA 3M3ZB 4ADZA 2XUEA 3S4UA 5LNKA 4X1KE 4U2ZA 5CA1E 2RA1A 4C90A 3AE5A 4AQFC 4MHCA 4ILUA 3LSVA 5EK4A 2C5KT 3KFWX 4DVDA 2VKOA 3HA4A 5LMUT 2J4GA 1YXRA 2OLTA 3AXJA 3IF8B 2CA5A 3KINB 4O2BE 3RKOA 3PU8A 3ZMSB 4CZZB 4FI5A 4GKJT 4HFEA 4JI2T 1W0AA 5AQMB 5LBMA 4AKRB 2CLYB 5AQKB 3AB3B 1QSDA 1YKHB 3B5MA 1OEDE
chains in the Genus database with same CATH topology
1XNRT 1HNWT 4JYAT 4LF6T 1XNQT 4LF9T 4KHPT 4LF7T 2UUCT 4DV7T 4B3RT 1IBMT 1N32T 4DV0T 4NXMT 4B3TT 4DR1T 4NXNT 2VQET 4JI0T 4JI6T 1IBLT 3T1YT 2UXDT 4YHHT 4DR7T 4DV3T 1HNXT 1I94T 4DV1T 1J5ET 4DV6T 4DV5T 4JI7T 2HHHT 4DUYT 4LFBT 2E5LT 5LMNT 4OX9T 4DR6T 4DR3T 4LFCT 2UXCT 4LFAT 1N34T 2F4VT 3OTOT 4DV4T 4JI4T 1HNZT 1HR0T 4JI3T 2UXBT 2UUAT 1N33T 1IBKT 4JI1T 2UU9T 4X65T 4DUZT 1FJGT 2UUBT 4DV2T 4LF5T 4DR2T 4DR5T 1XMQT 4B3MT 4LF8T 4GKKT 4JI5T 4X64T 3T1HT 4AQYT 5IWAT 1XMOT 4K0KT 2VQFT 4YY3T 4B3ST 4LF4T 4JI8T 1N36T 2ZM6T 4JV5T 5BR8T 4DR4T 4X62T 5LMUT 4GKJT 4JI2T 4X66T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XNR T;  1HNW T;  4JYA T;  4LF6 T;  1XNQ T;  4LF9 T;  4KHP T;  4LF7 T;  2UUC T;  4DV7 T;  4B3R T;  1IBM T;  1N32 T;  4DV0 T;  4NXM T;  4B3T T;  4DR1 T;  4NXN T;  2VQE T;  4JI0 T;  4JI6 T;  1IBL T;  3T1Y T;  2UXD T;  4YHH T;  4DR7 T;  4DV3 T;  1HNX T;  1I94 T;  4DV1 T;  1J5E T;  4DV6 T;  4DV5 T;  4JI7 T;  2HHH T;  4DUY T;  4LFB T;  2E5L T;  5LMN T;  4OX9 T;  4DR6 T;  4DR3 T;  4LFC T;  2UXC T;  4LFA T;  1N34 T;  2F4V T;  3OTO T;  4DV4 T;  4JI4 T;  1HNZ T;  1HR0 T;  4JI3 T;  2UXB T;  2UUA T;  1N33 T;  1IBK T;  4JI1 T;  2UU9 T;  4X65 T;  4DUZ T;  1FJG T;  2UUB T;  4DV2 T;  4LF5 T;  4DR2 T;  4DR5 T;  1XMQ T;  4B3M T;  4LF8 T;  4GKK T;  4JI5 T;  4X64 T;  3T1H T;  4AQY T;  5IWA T;  1XMO T;  4K0K T;  2VQF T;  4YY3 T;  4B3S T;  4LF4 T;  4JI8 T;  1N36 T;  2ZM6 T;  4JV5 T;  5BR8 T;  4DR4 T;  4X62 T;  5LMU T;  4GKJ T;  4JI2 T;  4X66 T; 
#chains in the Genus database with same CATH topology
 2Z6E A;  5JDQ A;  2BKO A;  3PJA J;  4HN9 A;  2JIW A;  3CQC B;  4UVC B;  2W0G A;  2H7V C;  5JDL A;  2X9X A;  2FUP A;  2Y48 B;  2HPJ A;  3NRY A;  4PK6 A;  3UUM A;  2XAS B;  2A2F X;  3ONL C;  2ES0 A;  2VVN A;  3RX6 A;  4EZ4 A;  4YHJ A;  4YSX A;  2E8I A;  3W15 B;  2EHO B;  2BKP A;  2L8K A;  3LK3 B;  4PAG A;  4NPP A;  2YU1 A;  2ACX A;  3KBU A;  1XNQ T;  2X66 A;  5HEO A;  3UU8 A;  4LF9 T;  3VRB A;  2W2U A;  3EUH A;  4ZZC A;  1ZKE A;  4O4H E;  5JRE A;  1M62 A;  3ZC0 A;  2IDO B;  3WAJ A;  4DV7 T;  4B3R T;  1WFD A;  2WQY A;  4GIW A;  4TWD A;  4ZS3 A;  5LJN A;  3N2O A;  4IDO A;  5LXT E;  4UXN B;  2YKS A;  2VL0 A;  5AQV B;  2LSI A;  3OBV E;  3ZMV B;  2XAG B;  2ODV A;  3SOL A;  5L3B B;  4CN1 A;  5H6R B;  1MIW A;  3RLF F;  3CVR A;  1NEK A;  2WZH A;  2LOP A;  4HTE A;  1L0V A;  1XWM A;  2CHO A;  4TNV A;  3N9Q A;  5L4E A;  2M6B A;  3AA1 B;  4F6R C;  1J1J A;  5HXH A;  1WYB A;  4Z90 A;  3OKQ A;  4Q25 A;  4IE5 A;  3L39 A;  2V7K A;  5EK2 A;  5L2L A;  2I0M A;  4UEL A;  4DMW A;  1HNX T;  5FVL A;  1JNR A;  2QYW A;  3IA3 A;  2YOE A;  1KF6 A;  2YU2 A;  1T8B A;  2XQY A;  4GK0 E;  4O4J E;  2MAW A;  4OYK A;  5LOV E;  2L3L A;  3ZPO A;  4DV5 T;  5FP3 A;  3UUX B;  5JDN A;  5M4Y A;  5L3F B;  2HHH T;  2N1G A;  4XBF B;  2QGS A;  3RYC E;  2LOS A;  2VUR A;  4LFB T;  2W00 A;  4AKI A;  2K3W A;  3FBZ A;  4OX9 T;  4TWH A;  1D1A A;  2XHE B;  1XDP A;  5HEG A;  4H9R C;  3EDU A;  2LLY A;  3AEE A;  2OA5 A;  4DR3 T;  2CCQ A;  4Z8X A;  2WMN A;  4ILB A;  3UU6 A;  4YT0 A;  3MK7 C;  1BR2 A;  2B76 A;  3ESL A;  5F5W A;  2PG8 A;  1UK5 A;  1B7T A;  2CXD A;  1HX1 B;  2E2A A;  3RGL A;  4CXX A;  4DMV A;  2V5D A;  4PFO A;  3R84 B;  3TLU A;  3AXJ B;  2K24 A;  4AKL A;  4HFB A;  4DBR A;  4IST A;  4OK0 A;  4YTP A;  3AEF A;  3AEG A;  4IIJ E;  4TZ4 C;  3PDY A;  3Q5X A;  2NP9 A;  4I0U A;  5ETW A;  3FZL B;  3NRX A;  1R8I A;  4DUY T;  1IBK T;  5ABE A;  3GN5 A;  5AQT B;  2DWK A;  3KV6 A;  2BZB A;  3FZK B;  4UVB B;  5AFU L;  4ZEY A;  4U31 A;  3P4P A;  1Y64 B;  2B1E A;  1FMV A;  3K3Q C;  3PJA A;  5FXV A;  4DUZ T;  1WR6 A;  1LRZ A;  2LE8 A;  4JYA T;  2I59 A;  2Y6X A;  4K0U A;  5HEU A;  2BVL A;  4ZI2 C;  3I0O A;  3AE4 A;  2X0L B;  3C4X A;  2A3D A;  5LBQ B;  3DJB A;  2JRK A;  4ZI2 D;  5HWX A;  4YSZ A;  4OHF A;  4U7I A;  2D5U A;  3SS1 A;  5ABF B;  4DR2 T;  3I1A A;  2XQ5 A;  3UFG A;  3NWI A;  4DBQ A;  1MIV A;  2UXC T;  3ZN1 B;  5H6Q B;  4HFC A;  4LMK A;  1QLB A;  4LF8 T;  4KBM B;  3UQ4 A;  4HFH A;  2OV9 A;  2E9X D;  5KX5 E;  5J2U E;  4ISS A;  3UQ7 A;  2DNX A;  1IAP A;  5FYM A;  3VKG A;  3P8C D;  2E5V A;  3LDQ B;  3PTR B;  2E5L T;  1MMG A;  2VKH A;  4MBQ A;  5CFB A;  2KIN B;  2XQ9 A;  3BQL A;  3TKL B;  2BBJ A;  2BS3 A;  2H7O A;  3Q5D A;  4EAH A;  5C8Y E;  4JI8 T;  4IE4 A;  3RRC A;  2MPK A;  3AA0 B;  2RPA A;  4IDZ A;  2KZ7 B;  4YTN A;  2XQ4 A;  5LB7 B;  2WCA A;  2X67 A;  5F8P A;  2DCF A;  2LSY A;  3B13 A;  3Q2M A;  2BG9 E;  3O1H A;  2LKG A;  5C2T A;  1I6Z A;  3JAE A;  4DR4 T;  3E08 A;  4X62 T;  3CX7 B;  4U7Y A;  1KNR A;  2BS2 A;  3SRZ A;  4FJO A;  5AQI B;  2W4X A;  2IML A;  2QVA A;  2XQ3 A;  4H9Q C;  1D1B A;  1D0X A;  4I4T E;  1UX4 A;  3CX6 B;  4EOZ B;  4X66 T;  4HFD A;  1VOM A;  2EHO A;  1OED B;  3ABV A;  2J47 A;  3IHR A;  4WYV A;  2AE9 A;  5AQO B;  4KUM B;  1SE7 A;  3AEA A;  3ETU A;  5J0Z A;  3CKD A;  3Q5E A;  4CI1 B;  2WZI A;  4X1Y E;  3TLV A;  3RIU C;  1HNW T;  1T98 A;  3N2G E;  2W62 A;  2G0U A;  4EV6 A;  4HWD A;  1BR0 A;  1MMD A;  4NIQ A;  2D2S A;  2M6I A;  1HG5 A;  1YQ4 A;  4LF6 T;  2WDQ A;  1S35 A;  3OJA A;  3EHZ A;  3AE1 A;  2D0U A;  3PE0 A;  4CXW A;  2XAH B;  4HWH A;  2JMK A;  1OWA A;  3H3A A;  3LG7 A;  2X51 A;  4HWF A;  4UF0 B;  2X9Y A;  3F31 A;  2VVS A;  1SUM B;  3L8R A;  4U33 A;  4ZHQ E;  4NUU A;  4OYJ A;  2NW8 A;  4PJN A;  2N9D A;  2LM9 A;  4WZX A;  5JTG A;  3HL6 A;  2KWI B;  1VRB A;  1NEN A;  5BMV E;  2CHN A;  2Y8D A;  3AAA B;  3MJX A;  4XZC A;  4YTM A;  3R6N A;  3QOF A;  3A7M A;  4KP3 C;  4P0A A;  1T7S A;  1WLX A;  2LEH A;  5JVD E;  4NXN T;  5ABF A;  1KNP A;  3P4W A;  4I43 B;  2V7M A;  2WWU A;  3Q9D A;  5AQR B;  1IBL T;  4JI6 T;  4JI0 T;  2UXD T;  3NVO A;  4H63 H;  5KMG P;  2Q9Q A;  1LVF A;  3EAM A;  3N9M A;  3TLT A;  4AQF A;  3N2K E;  3CIR A;  5C3J A;  3PUS A;  2DWG A;  4L0R A;  2HPL A;  4X1I E;  3TLW A;  2X68 A;  1J5E T;  2EHO C;  2IUB A;  3HI2 A;  2M67 A;  3RF1 A;  3VHL A;  2YN6 A;  5KXJ A;  4HE8 A;  3RC3 A;  5LYJ E;  3JC6 C;  3GA8 A;  2V26 A;  4ZI3 D;  5LHH B;  1QUU A;  2XQ7 A;  3KV5 A;  5FNV E;  4AIS A;  2MTQ A;  2K48 A;  3Q5W A;  5LMN T;  3RYF E;  4LFC T;  4DR6 T;  3PUY F;  4F8H A;  4TNW A;  3LFM A;  2CXF A;  3CQG B;  2WU5 A;  3UUB A;  4CQI A;  5JR9 B;  3AE7 A;  4MAL A;  3ONX A;  4QX7 B;  1N34 T;  4JI4 T;  2MBG A;  5DAB A;  2WM9 A;  3K1S A;  2SPC A;  4PW8 A;  4QHO A;  3PUV F;  3AAI A;  3FBL A;  2WDV A;  3GN5 B;  3PUW F;  1WCR A;  1IZN B;  2CE7 A;  4NUV A;  4Z91 A;  5FVK A;  3C98 B;  3ZYL A;  3ONJ A;  5L3E B;  1N33 T;  2DL1 A;  2JJ9 A;  3MZK B;  2HH7 A;  1YD8 G;  5AQL B;  4JI1 T;  2V6Y B;  3RPU A;  1Z8U A;  1V9D A;  4J2C A;  3FXD B;  3FZF B;  2KT9 A;  3RIU A;  1KEY A;  2IC9 A;  3EDV A;  3QC9 A;  1FJG T;  1U5P A;  2FJA A;  2LSG A;  5L4H A;  3P4S A;  3C4W A;  3UFE A;  5JDM A;  2D9D A;  4DV2 T;  4GK5 E;  3KDS E;  2JMH A;  3O4X E;  4H9N C;  2VKJ A;  4IDP A;  2BG9 A;  4IT4 A;  3V5U A;  1IJ5 A;  5JDG A;  5JR9 C;  4H9S E;  2V6Y A;  4LF5 T;  2KXP B;  4O4I E;  1VCT A;  3C51 A;  2GK9 A;  4AIU A;  2CBJ A;  4A97 A;  2WP9 A;  2ZM0 A;  5LHG B;  2XM1 A;  5HEH A;  3HKC E;  2WWV A;  4A98 A;  4PFP A;  3ZST A;  2VB6 A;  4E7S A;  4ZZB A;  5HYA A;  3AA7 B;  4X20 E;  4X64 T;  5CGM A;  2UXX B;  3MA9 A;  2KLQ A;  4B6X A;  4ERR A;  5LP6 E;  4IE6 A;  4A5X A;  3ZLI A;  4YFS A;  2VL8 A;  3H3M A;  5AQF B;  2NWB A;  3L09 A;  1D1C A;  3J9X 1;  5JH7 E;  2KMF A;  1O3X A;  2D0T A;  5IYZ E;  4UIG A;  3KV4 A;  5FXZ A;  3ZKR A;  2LKH A;  5J2T E;  4HFV A;  2ZM6 T;  2P9B A;  3EI0 A;  4P1N A;  1X9B A;  4JV5 T;  2BG9 B;  2V5C A;  2CPT A;  2WB5 A;  5L47 A;  5BR8 T;  5LA6 E;  3AE9 A;  4CI2 B;  1T72 A;  2WS3 A;  3G06 A;  3ZT7 A;  3RI5 A;  1ZP0 A;  3CPZ A;  3PV0 F;  3ZMT B;  3N9N A;  3ZMZ B;  2XAJ B;  4ILC A;  4MLK A;  5HXE A;  4TX5 A;  1AJ3 A;  3AE8 A;  5JQG E;  4CXY A;  2K5B B;  2VKD A;  2WBL A;  2ZM8 A;  2CRB A;  1Z0P A;  3BQI A;  3IEE A;  1NAF A;  2NTX A;  2I6H A;  3FZM B;  4KHZ F;  3RH3 A;  1FMW A;  2R6G F;  2Q9Q C;  4CN4 A;  2X9W A;  5LCY A;  2XJ7 A;  2AXD S;  4AKH A;  4X5T A;  4BJN A;  5FL0 A;  2CM0 A;  3FHN A;  5DJQ C;  3GMI A;  5AQN B;  2PTF A;  2CBI A;  1MMA A;  5HXR A;  2ODU A;  3HKE E;  4JEH B;  4QXH B;  5AQG B;  5JR9 A;  5HXC A;  3VR9 A;  2C0S A;  3UU4 A;  4N78 D;  1WR0 A;  2J62 A;  2WY2 A;  4EYU A;  5ADX L;  4KHP T;  4UR9 A;  4LF7 T;  5HWY A;  4EZH A;  1W09 A;  2UUC T;  2XM2 A;  2J1D G;  4YJ3 E;  4JEU B;  3N5L A;  2WAU A;  3RYI E;  4A56 A;  3CX8 B;  2PFV A;  3OYX A;  3P4R A;  4V1A v;  3RQU A;  3PUZ F;  4TN7 B;  4NXM T;  4B3T T;  1VCS A;  2H88 A;  2W66 A;  3IBP A;  4IDQ A;  5FXX A;  1MIY A;  5GON E;  4EED A;  4WBN E;  3VKH A;  2VK9 A;  2XAF B;  4M1P A;  3ZCJ A;  2DHR A;  5JRC B;  2KSR A;  1ZOY A;  3JC6 D;  4YJ2 E;  4PK5 A;  2LJL A;  2VQE T;  1HF8 A;  2EHO D;  4WW0 A;  5LGT B;  3RC8 A;  3A5X A;  4YHH T;  2XPK A;  2WSS V;  3E22 E;  1N32 T;  5AQH B;  5CB4 E;  3O1J A;  5A1L A;  5E0O A;  2IIU A;  2CMR A;  4U74 A;  5FY0 A;  4TUY E;  4DV3 T;  3I9W A;  2QA7 A;  3J7Y q;  3DTO A;  1I94 T;  3X1D A;  3AEC A;  3UT5 E;  4QH1 A;  3HKB E;  4H9P C;  4UEM A;  3ZYK A;  4DV6 T;  2HN1 A;  4E7Z A;  3A8Y C;  4JI7 T;  1S94 A;  5AQQ B;  4P0B A;  3WI3 A;  1HS7 A;  2IC6 A;  2YK0 A;  3FB2 A;  2XQ6 A;  3VRA A;  3NZQ A;  2BVM A;  2VWA A;  5IHY A;  3SFE A;  4IL9 A;  2F4V T;  3KVA A;  1UCU A;  4EYY R;  3JAF A;  2WDR A;  5ABH A;  2XAQ B;  3ETV A;  4HEA A;  2NTY A;  1HR0 T;  4MFR A;  3RRW A;  2E9X B;  4U3C A;  4JI3 T;  3MXZ A;  5FL1 A;  3SWH A;  4HWI B;  2LT3 A;  1HTJ F;  1ZV4 X;  2WU2 A;  2XY8 B;  2YDR A;  3C64 A;  3LBX A;  4GYR A;  2XSB A;  4PJL A;  3RHW A;  3RYH E;  4AI6 A;  4IGU A;  4YSY A;  1UUR A;  1YKE B;  2FJB A;  4EGW A;  4PK4 A;  3TLS A;  3AED A;  2W63 A;  3N9P A;  1WYC A;  1CHU A;  3PUR A;  5HCM A;  5HXS A;  1UGO A;  5KDM C;  3O9X A;  1E1H B;  3C50 A;  4QH4 A;  1ZEE A;  2YDQ A;  5FY1 A;  3AE3 A;  4TV9 E;  2ZLY A;  2V7I A;  3CML A;  1X79 A;  5FXW A;  4CI3 B;  1XZY A;  2DI4 A;  3E0Z A;  3QUJ A;  3ZJ1 A;  3CWZ B;  3U78 A;  4IHJ E;  1HX8 A;  3HR0 A;  2DLR A;  2JQH A;  1W0B A;  4EXT A;  2K9A A;  5HEJ A;  3K3O A;  5J1G A;  4JLE A;  4O2A E;  4GKK T;  2L9Q A;  4O4L E;  3ZJ2 A;  3T1H T;  4IE7 A;  2QRX A;  3D0T A;  3PU3 A;  1BR1 A;  2PBI A;  1XMO T;  2JQK A;  1M7K A;  1XDO A;  2YIN A;  4GYS A;  1W9R A;  2VQF T;  4B3S T;  5JDF A;  2N2N A;  5HAX A;  1ZHC A;  5FMN A;  4ZXL A;  4LF4 T;  4KMC A;  2CXL A;  3VU7 H;  3WAK A;  3ZC1 A;  1SHZ C;  2LHR A;  3NKZ A;  4YLH A;  5CA0 E;  2IAK A;  2XQA A;  4QXC B;  5L3G B;  1N36 T;  1EZ3 A;  2FBW A;  1G73 A;  4TV8 E;  2XTL A;  4C91 A;  3F2E A;  2HN2 A;  2X9H A;  4AQG A;  4AXP A;  1J5W A;  2X0H A;  2V6X A;  1HG2 A;  3NBX X;  1E7P A;  2E9X C;  2XSA A;  1MMN A;  2UUB T;  5JRC A;  3QB5 A;  1MND A;  2ACZ A;  3QB5 K;  3K8P C;  3ZEF B;  4WBO A;  3P50 A;  4HWC A;  4LML A;  4HGA A;  3N9O A;  2ZM2 A;  4XAX B;  3OYZ A;  3KVB A;  1XNR T;  1DU2 A;  2V8S V;  3F57 A;  2NW9 A;  3P4Q A;  4EB6 E;  3SFD A;  1LKX A;  2CEA A;  3V5S A;  2IHR 1;  3AE2 A;  3BQK A;  5L3D B;  3LK2 B;  4UVA B;  4PJJ A;  2LSJ A;  3FXE B;  4IDN A;  1D0Z A;  2JQQ A;  5L3C B;  3ZN0 B;  1IJ6 A;  1US7 B;  4DND A;  2V1D B;  3K3N A;  2Q9Q B;  3NZP A;  2VAS A;  2BKN A;  4I55 E;  4L9I A;  4COF A;  3RKG A;  3P7I A;  2JQ9 A;  3N9L A;  3KV9 A;  4QWN B;  3ZT6 A;  1OXZ A;  3PUX F;  2W67 A;  3DP7 A;  3QNU A;  4KX6 A;  4OFZ A;  2CLY C;  5LJM A;  4G2A A;  1IBM T;  2PJQ A;  4DV0 T;  1JNZ A;  3GWH A;  4UV8 B;  1KK7 A;  2V7J A;  5TAO A;  2XQ8 A;  2RP4 A;  3ZSS A;  1KNZ A;  5FKY A;  3AE6 A;  1Y01 A;  3BK9 A;  3H37 A;  3MAC A;  1UUS A;  2FJE A;  4ZI3 C;  4BAY B;  4DR1 T;  3EVY A;  2LM2 A;  2Q9Q D;  2MYS A;  4P09 A;  4UF0 A;  4EIW A;  5CJ5 A;  5DQV A;  3OPC A;  3AVS A;  4BJM A;  1E2A A;  1OED A;  2CWO A;  4L5G A;  3ZT5 A;  2YEV C;  5LHI B;  3T1Y T;  3QK6 A;  4GOU A;  2LSK A;  3PUG A;  5ABG A;  3UU3 A;  2KWH A;  4G63 A;  4I50 E;  4ZOL E;  1HNZ T;  5AQS B;  2NOX A;  4DV1 T;  3L3P A;  1BR4 A;  1YW0 A;  1FIO A;  3AAE B;  2NR4 A;  3FZH B;  3LBX B;  3RQW A;  3T8O A;  5FY7 A;  2CWY A;  5AQP B;  1UX5 A;  2H89 A;  4BA9 A;  4WNK A;  5LG3 A;  3CK6 A;  2MOZ A;  4ASK A;  1HCI A;  1LVK A;  1FEW A;  2E9X A;  2V7L A;  3I9Y A;  4LMJ A;  4O8S A;  3UU5 A;  4DID B;  2WMO A;  3B57 A;  3CQX C;  5AQJ B;  2A72 A;  4ILA A;  4IRE A;  4PNI A;  4LFA T;  3UUN A;  1D0Y A;  5AQU B;  4ZS2 A;  3OTO T;  4DV4 T;  5LGN B;  4JUY A;  1CUN A;  2BS4 A;  3JAD A;  3AEB A;  3O1I A;  3PUA A;  4U2Y A;  3ANW B;  2UXB T;  2UUA T;  5LG4 A;  2KND A;  4QH5 A;  5HCJ A;  2UXN B;  2XZE A;  4H63 V;  3UTK A;  4QKN A;  3ZMU B;  4HKA A;  2BG9 C;  1GQE A;  2UU9 T;  4X65 T;  3VR8 A;  2FJD A;  3AVR A;  5EZY E;  4EEB A;  5LGU B;  2LHN A;  3RIF A;  5JDH A;  4TWF A;  3EAB A;  3PUQ A;  4PJM A;  4H9O C;  1KFY A;  3C4Z A;  4IE0 A;  2BDE A;  4ZI7 E;  2X0Y A;  3LJC A;  3MKD A;  3LK4 2;  4KI0 F;  1OED C;  3M65 A;  3JCF A;  4UV9 B;  3U3I A;  3OVU A;  2NW7 A;  4ANJ A;  4DR5 T;  3ANW A;  1XMQ T;  3KBT A;  2IW5 B;  4B3M T;  4AKG A;  3AA6 B;  3I0Q A;  3HKD E;  4QXB B;  3ZCI A;  2C5I T;  1WRD A;  2LRK A;  4HFI A;  4QX8 B;  5EK3 A;  1MNE A;  4JI5 T;  1YQ3 A;  2LRL A;  4IL4 A;  3UUL A;  4DO0 A;  1NWM X;  2W61 A;  1H7C A;  4YXD A;  1G8X A;  2A9U A;  5IWA T;  4U72 A;  5F3J A;  4AQY T;  2C5J A;  2JPF A;  3RIA A;  3ZYM A;  4CN6 A;  4K0K T;  4JBW F;  4YY3 T;  4DR7 T;  1HFA A;  1U4Q A;  5IUX A;  2H3R A;  2ZMA A;  1SA0 E;  2BBH A;  2YDS A;  5DQW A;  3M3Z B;  4ADZ A;  2XUE A;  3S4U A;  5LNK A;  4X1K E;  4U2Z A;  5CA1 E;  2RA1 A;  4C90 A;  3AE5 A;  4AQF C;  4MHC A;  4ILU A;  3LSV A;  5EK4 A;  2C5K T;  3KFW X;  4DVD A;  2VKO A;  3HA4 A;  5LMU T;  2J4G A;  1YXR A;  2OLT A;  3AXJ A;  3IF8 B;  2CA5 A;  3KIN B;  4O2B E;  3RKO A;  3PU8 A;  3ZMS B;  4CZZ B;  4FI5 A;  4GKJ T;  4HFE A;  4JI2 T;  1W0A A;  5AQM B;  5LBM A;  4AKR B;  2CLY B;  5AQK B;  3AB3 B;  1QSD A;  1YKH B;  3B5M A;  1OED E; 
#chains in the Genus database with same CATH homology
 1XNR T;  1HNW T;  4JYA T;  4LF6 T;  1XNQ T;  4LF9 T;  4KHP T;  4LF7 T;  2UUC T;  4DV7 T;  4B3R T;  1IBM T;  1N32 T;  4DV0 T;  4NXM T;  4B3T T;  4DR1 T;  4NXN T;  2VQE T;  4JI0 T;  4JI6 T;  1IBL T;  3T1Y T;  2UXD T;  4YHH T;  4DR7 T;  4DV3 T;  1HNX T;  1I94 T;  4DV1 T;  1J5E T;  4DV6 T;  4DV5 T;  4JI7 T;  2HHH T;  4DUY T;  4LFB T;  2E5L T;  5LMN T;  4OX9 T;  4DR6 T;  4DR3 T;  4LFC T;  2UXC T;  4LFA T;  1N34 T;  2F4V T;  3OTO T;  4DV4 T;  4JI4 T;  1HNZ T;  1HR0 T;  4JI3 T;  2UXB T;  2UUA T;  1N33 T;  1IBK T;  4JI1 T;  2UU9 T;  4X65 T;  4DUZ T;  1FJG T;  2UUB T;  4DV2 T;  4LF5 T;  4DR2 T;  4DR5 T;  1XMQ T;  4B3M T;  4LF8 T;  4GKK T;  4JI5 T;  4X64 T;  3T1H T;  4AQY T;  5IWA T;  1XMO T;  4K0K T;  2VQF T;  4YY3 T;  4B3S T;  4LF4 T;  4JI8 T;  1N36 T;  2ZM6 T;  4JV5 T;  5BR8 T;  4DR4 T;  4X62 T;  5LMU T;  4GKJ T;  4JI2 T;  4X66 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...