4YY3T

30s ribosomal subunit- higb complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4yy3T00
4JI1T 4B3ST 4DR4T 4LFBT 1XNRT 4JI7T 4LF6T 1N34T 4X62T 4DR6T 4DR7T 2ZM6T 4OX9T 4JV5T 4DV4T 4B3MT 4X66T 4YHHT 4NXNT 1XNQT 2F4VT 2E5LT 4LFCT 2VQET 2UXDT 3T1YT 1IBMT 4DR2T 4GKKT 1I94T 1J5ET 4DV2T 2UUCT 4JI8T 4B3RT 1IBLT 1N33T 4JI5T 4B3TT 4K0KT 4LFAT 4LF4T 4JI0T 2UXBT 4DUYT 4DR1T 5IWAT 2VQFT 4KHPT 4X64T 4DR3T 4JI4T 4JYAT 5BR8T 1HNXT 4DV1T 4LF9T 2UXCT 4DV7T 5LMNT 4DV0T 4DV3T 2UU9T 4JI2T 1XMOT 4JI6T 1HNZT 1FJGT 4JI3T 4X65T 2HHHT 4YY3T 4LF7T 4DUZT 4DR5T 1HNWT 1N32T 4AQYT 4GKJT 4DV5T 3OTOT 4DV6T 2UUAT 4LF5T 4NXMT 3T1HT 1IBKT 5LMUT 1N36T 2UUBT 1HR0T 4LF8T 1XMQT
chains in the Genus database with same CATH superfamily
4QH1A 2LOSA 1Z0PA 1GQEA 4IDOA 4LF6T 1ZV4X 2IAKA 2XQYA 1UCUA 2F4VT 3HKDE 5LHIB 5JREA 1MNDA 4M1PA 3CWZB 4YT0A 2WMOA 5J1GA 2R6GF 1T8BA 4QX7B 4H9NC 4V1Av 5FYMA 3EAMA 2YU2A 5EK4A 3K1SA 1YQ3A 3P7IA 3IBPA 1M62A 4YTMA 5FXXA 5JRCB 4JUYA 3KV4A 4JI4T 4UR9A 4UVAB 5AQMB 3C64A 1S94A 3C98B 2KSRA 2MAWA 3DJBA 5M4YA 1OXZA 2NP9A 3N2OA 2XQ5A 5A1LA 2KXPB 3PUAA 3TLWA 3L3PA 3AEDA 2PTFA 5J0ZA 4OHFA 3FZKB 5FXVA 5ABHA 2D9DA 4HFEA 5DQWA 3UULA 3KV6A 4DV5T 2PJQA 3RIUA 3QB5A 3RIAA 3P4QA 2CWOA 4AQGA 4YTNA 3N2KE 1O3XA 5CFBA 5AQPB 2HN2A 3RRCA 1XMQT 3I9WA 1BR2A 4CN4A 1XNRT 1FIOA 2IC6A 5JDHA 2QA7A 3LK2B 2X0HA 4OX9T 4BA9A 1ZP0A 3AE6A 3MACA 2E5LT 4UXNB 3QUJA 2DNXA 1WR6A 3S4UA 2IHR1 2CBIA 3DTOA 3UFGA 4AKIA 3C50A 3PUQA 2NOXA 3ONXA 3PU8A 5AQKB 4U33A 1QUUA 2KZ7B 5DQVA 2LSYA 5AQGB 4E7SA 2CM0A 4DR3T 2VK9A 2D5UA 3EDUA 3MZKB 5L4HA 2CEAA 2V26A 2UXCT 1H7CA 1E1HB 1SUMB 4DV3T 3FXEB 2LSJA 4HEAA 5LP6E 4YY3T 2KNDA 4ILAA 5F8PA 3AAEB 4PJMA 3NZPA 2XSAA 2WMNA 4OYJA 4IE7A 3SRZA 2E9XA 4IE4A 2PFVA 2WWUA 5HEGA 5JH7E 1X9BA 3L09A 2NTYA 5FXZA 3ZC0A 4TNVA 2BG9C 4QKNA 2JMHA 2KT9A 2WU5A 5ABEA 4DV4T 4B6XA 1HX1B 2RA1A 3RYCE 5LA6E 3KBUA 4EEBA 3NKZA 5L2LA 2LHNA 2JRKA 2W66A 1Y64B 2FBWA 4DR2T 3TLUA 4OK0A 1AJ3A 2C0SA 3SOLA 4WBOA 4UF0A 3MJXA 3O4XE 3KFWX 3U3IA 1OEDE 3AEAA 2WDVA 3ZT6A 4KMCA 3AE8A 2PG8A 4JYAT 5L3DB 4HGAA 2LRLA 1BR4A 4PK4A 2JQQA 4ZI3D 5JRCA 5LB7B 1D1CA 3Q5EA 4ILUA 3KVAA 3I9YA 5FL0A 3MXZA 3P4SA 5H6RB 1J1JA 2RP4A 3AB3B 4AQFA 1Z8UA 4AKLA 4O4HE 2K48A 3BK9A 5JDNA 2LSIA 3KVBA 3J7Yq 2FUPA 4EZHA 4QX8B 4H63H 2K3WA 2P9BA 2V5DA 2XHEB 4EAHA 5KMGP 2DL1A 5J2UE 3H37A 2FJDA 4AI6A 5FL1A 3KV9A 4ISSA 5LCYA 3JC6D 3CKDA 2H89A 2G0UA 3CQGB 3AVSA 3ZMSB 2X66A 4ERRA 3ZJ2A 3GA8A 5FMNA 4QXHB 4MHCA 1IBMT 1VCSA 3PJAA 3RYHE 2XQ3A 3BQLA 3JC6C 1ZHCA 1HCIA 3W15B 4DMWA 1YKEB 3OPCA 2JQ9A 1X79A 3LBXA 4TUYE 5F5WA 4QHOA 2HPLA 5BR8T 1WFDA 3RQUA 2KMFA 3WAJA 2XM2A 3IEEA 1SHZC 4WNKA 2FJEA 3GWHA 4ZS3A 3ZT7A 2W62A 2D0TA 3JADA 2C5IT 2V7IA 3AE2A 4KBMB 2KINB 4DR5T 5L3EB 3FB2A 5KX5E 3NRYA 1N32T 3AEBA 2M6BA 4GKJT 3K3NA 4IT4A 2CCQA 4DV6T 4AIUA 2J4GA 4NPPA 1XWMA 3FZLB 2CHOA 4YHJA 4CI3B 4HFBA 5L3FB 3T8OA 2LLYA 4C90A 3FZFB 1Y01A 3PTRB 4CN1A 4JI7T 3OKQA 1SE7A 4TN7B 4X62T 5L3BB 2V7KA 2ZM6T 2Q9QC 1KNPA 2BKOA 5GONE 4A5XA 5ETWA 5LOVE 3V5UA 2H7OA 3CX8B 4YXDA 4ZZBA 2M67A 2X67A 4JEUB 2YN6A 2LSKA 4YTPA 4XZCA 4QH5A 5FY0A 4MBQA 2UXXB 3JCFA 5HEJA 1OEDA 4HKAA 4UVBB 4CZZB 3AXJB 5AQQB 2XQ9A 2Y6XA 1QSDA 1L0VA 3CX7B 4YSZA 4X64T 3ZCJA 4LF9T 2XPKA 1VRBA 4CQIA 4HWFA 2DHRA 2LHRA 2ZMAA 2XM1A 4JEHB 3PE0A 2V6XA 2NW9A 1KNRA 1XZYA 5KXJA 4Z90A 5ABFB 2YDQA 5F3JA 3ZKRA 2FJBA 5HEUA 2X0YA 3P4RA 2YINA 4F8HA 2IUBA 1UUSA 4CXYA 5JTGA 3ZT5A 4N78D 4I0UA 2LSGA 3UU5A 2XTLA 4TX5A 4LFBT 4OFZA 4U7YA 1N34T 4O2AE 5FKYA 4JV5T 4WZXA 5AFUL 4NXNT 3K3QC 5CB4E 4KHZF 2A2FX 3P4PA 4DIDB 2V6YB 1J5ET 5L4EA 4JI5T 1MIVA 4LFAT 1UX5A 4HFIA 4ZI7E 2BG9B 3N9QA 2B76A 3N9MA 1NWMX 5AQOB 4P0AA 2Z6EA 3RYFE 4NIQA 5EK3A 4AKRB 5JQGE 2IC9A 3D0TA 4O4IE 1W9RA 4MLKA 3AE5A 5JVDE 3O9XA 5LGUB 2W0GA 2BG9E 2LM2A 3UUXB 3DP7A 2E2AA 4A56A 3SWHA 4TWDA 2BS3A 2XQ6A 2L3LA 1NAFA 2LRKA 2DI4A 3F31A 3ONJA 1IBKT 2X9XA 4WW0A 2AE9A 3ZMZB 2VKJA 1HR0T 3F2EA 3QOFA 1WR0A 4H9RC 1IJ6A 3V5SA 4L9IA 1EZ3A 4UV8B 3AE1A 3OBVE 2XUEA 3RIUC 1MMAA 5FVLA 3ZPOA 4EYYR 4O4JE 3AA1B 1FMWA 4ZS2A 4F6RC 5J2TE 4DV2T 5LGTB 2LJLA 1V9DA 2WP9A 4PJJA 3MKDA 4CXXA 4JI0T 2A9UA 4DUYT 4H63V 1XDOA 3PUSA 5TAOA 2XASB 4MALA 1U5PA 2B1EA 3A7MA 2LEHA 2WAUA 4ILCA 5HCMA 1ZKEA 2BVMA 1G73A 2MBGA 4ASKA 2YKSA 4IDZA 2CWYA 3E0ZA 4EXTA 3ZYLA 4GYSA 3AXJA 3UUNA 4TWFA 4WYVA 2WCAA 2SPCA 4XBFB 2V7MA 4H9PC 4A97A 3I0OA 2H7VC 5AQSB 5AQHB 2N2NA 2LOPA 1YXRA 2CBJA 4QH4A 5FY1A 4H9QC 3KBTA 3RQWA 4ZHQE 3E08A 5ABFA 3O1HA 1KNZA 2J62A 4YJ3E 3AE9A 4HTEA 2PBIA 2EHOD 4I55E 1IJ5A 4UVCB 1ZEEA 3UU8A 4YHHT 3ZCIA 3RHWA 3SFDA 3T1YT 4HWHA 4FJOA 3AEEA 3RX6A 2V7LA 3CPZA 2EHOC 3P8CD 2IIUA 1XDPA 2QGSA 1MIWA 1KK7A 4YSYA 2Q9QB 3LK3B 2XAJB 2V6YA 2V1DB 3AA7B 1WLXA 3WAKA 5CJ5A 2BG9A 4DV0T 1T98A 2OV9A 4KX6A 3RIFA 1D0YA 1FJGT 3RLFF 2YDSA 2JIWA 3FZHB 2CLYC 2ACZA 3B13A 5H6QB 2VURA 2D2SA 3VRBA 3SFEA 2JMKA 3HKEE 4IIJE 4ILBA 5LGNB 4IL4A 4TWHA 2BBJA 5HXSA 3RKGA 5FXWA 2BDEA 2VWAA 4PFOA 1MMNA 3T1HT 3L39A 2XAQB 4AQFC 1T72A 4JI1T 2BKPA 5HXHA 2DLRA 4X20E 4DR7T 2I0MA 2NR4A 4O4LE 3RH3A 1BR0A 4AKGA 2XJ7A 4IDPA 3CQXC 2VKDA 5L3CB 2X0LB 2E5VA 5CA0E 3AEFA 2OLTA 2YK0A 4HN9A 3OJAA 4GKKT 2FJAA 2ODVA 5C2TA 1LVFA 1UX4A 2NWBA 4B3TT 4MFRA 2GK9A 1NENA 4P1NA 2XAFB 3VHLA 5JDGA 3M65A 5AQRB 5AQIB 1VCTA 3ZEFB 2VL8A 3M3ZB 1MIYA 3C51A 5FNVE 2K9AA 1MNEA 2MYSA 5LMNT 1G8XA 5FY7A 2ODUA 5L3GB 4BJMA 3AECA 1B7TA 3K8PC 4I50E 4QXCB 1UURA 1KF6A 4YFSA 3ANWB 3X1DA 5L47A 2VB6A 3LDQB 4DO0A 1WYBA 2ZLYA 2X9HA 1D0XA 2V8SV 4BJNA 1WCRA 4YLHA 2W4XA 3FZMB 4WBNE 2KWHA 5LG4A 2WDQA 2X51A 1T7SA 2L9QA 4IHJE 5LHHB 4HWIB 3PUVF 3Q5DA 2CMRA 5IHYA 3IA3A 4H9OC 2A72A 1J5WA 3AAAB 3EDVA 4NUVA 3ONLC 4PJLA 2Q9QD 1OWAA 3CQCB 5LG3A 2CXDA 2ZM2A 2UXDT 2VKOA 4X1YE 1DU2A 2YEVC 4B3RT 4K0KT 1CUNA 4EB6E 4K0UA 3AA6B 3CIRA 3FBZA 3BQIA 2V5CA 4G63A 3ZSTA 3N2GE 3QC9A 3PU3A 1OEDC 4EOZB 5AQTB 3H3AA 4JI6T 2WBLA 2WZHA 5AQVB 1W0AA 2Q9QA 3MA9A 2E8IA 5AQUB 2W2UA 3VKHA 3IF8B 3P50A 3GN5B 2ES0A 4I4TE 2XAHB 3PUWF 5KDMC 3B5MA 5LNKA 3GMIA 3VR8A 3HKCE 2Y48B 2QYWA 5JR9C 4NUUA 3I1AA 4P0BA 3VU7H 5AQLB 2IDOB 1E2AA 2AXDS 2UXNB 4EYUA 5AQFB 3JAEA 3AVRA 2A3DA 5ABGA 2UUCT 1IBLT 1HF8A 3OVUA 2J47A 4TV9E 3RPUA 1LRZA 4HFHA 2XZEA 3CX6B 2VQFT 4LMJA 5DJQC 1UK5A 4U74A 2I6HA 4U31A 5BMVE 4XAXB 3JAFA 4EGWA 4I43B 5JDLA 4LMKA 3ETUA 4DV7T 4ZZCA 3ZSSA 4U2YA 3OYZA 2JQHA 3PJAJ 2EHOB 3ZYMA 1HX8A 3F57A 3ZN0B 4X65T 2J1DG 2W63A 4IE5A 4BAYB 2HPJA 5LJNA 4DUZT 5FP3A 3NZQA 2WU2A 2DCFA 4UF0B 3ZC1A 3ZJ1A 3ANWA 3ZN1B 3C4WA 3KINB 2CLYB 3N9PA 2LKHA 2W00A 5HEOA 3Q9DA 3H3MA 4UIGA 5HWYA 4PK6A 4EEDA 3N9NA 3R6NA 1VOMA 2Y8DA 2C5KT 3NVOA 4TNWA 3ZMVB 2K24A 2XQ8A 3C4XA 1JNZA 3EABA 4PK5A 1D0ZA 4HWCA 2KWIB 4YJ2E 4KHPT 3BQKA 2XQAA 2H3RA 4GYRA 3FHNA 3LSVA 2YOEA 5HEHA 3ETVA 3HL6A 4PNIA 4HFDA 4P09A 2ZM0A 3KDSE 1WRDA 4X1IE 4LF7T 2BVLA 1SA0E 2XQ7A 4DMVA 2BS2A 1NEKA 4ZOLE 3OTOT 4OYKA 3K3OA 4A98A 3TLSA 3UTKA 3ESLA 2RPAA 5LMUT 1N36T 2QVAA 3LBXB 3ZMUB 5LBMA 2LKGA 2WZIA 4LMLA 5JDFA 4O2BE 3MK7C 1W09A 2MOZA 2CXLA 3L8RA 3UU4A 3GN5A 3EUHA 1M7KA 2MTQA 2XY8B 4QXBB 2LM9A 4EV6A 5ADXL 2WSSV 3AEGA 2WB5A 3LG7A 3UUMA 4B3MT 2E9XD 4X66T 2DWKA 3UT5E 1FMVA 4UELA 2VQET 5HCJA 3TLTA 3E22E 4C91A 2NTXA 2CE7A 3A8YC 4J2CA 3QNUA 2XQ4A 5HXEA 3WI3A 4COFA 2JPFA 2CA5A 1MMGA 2CPTA 4X5TA 3Q5XA 2E9XC 2V7JA 2K5BB 3QB5K 3VKGA 3LFMA 3VR9A 1HG5A 1JNRA 5LBQB 5IYZE 4TV8E 3N9OA 2L8KA 4JI2T 5CA1E 3HKBE 1LKXA 5HWXA 1WYCA 3IHRA 2WWVA 2W67A 1E7PA 3VRAA 2M6IA 3UQ7A 4U72A 3HI2A 4IREA 2KLQA 1HNWT 4DBQA 2EHOA 4CI1B 1OEDB 2CHNA 2UUBT 4CI2B 4DNDA 4ADZA 4AKHA 3FXDB 4LF8T 3PDYA 3KV5A 3RGLA 4B3ST 2VASA 1D1BA 5JDQA 2BS4A 3R84B 4IL9A 3NBXX 4DR6T 1HFAA 1QLBA 3PUXF 4UEMA 3AE4A 1XNQT 4Z91A 1LVKA 3P4WA 5EZYE 3Q2MA 2NW8A 4ZI2D 2N1GA 1KFYA 2CXFA 4HFVA 2ZM8A 2LE8A 4UV9B 2H88A 5JR9B 3ZMTB 1S35A 4ZXLA 3CMLA 5AQNB 3AE7A 1I6ZA 3LK42 2HN1A 3PV0F 4ZI2C 3OYXA 3RRWA 4KUMB 1W0BA 2VVNA 3RC3A 2UU9T 1HTJF 1XMOT 4ZI3C 2ACXA 4HE8A 3TLVA 3FBLA 3CVRA 2IW5B 4CN6A 2MPKA 2IMLA 2BKNA 3CK6A 2LT3A 3Q5WA 3A5XA 4DBRA 3I0QA 4G2AA 3G06A 3EHZA 3NRXA 4E7ZA 3EI0A 5LJMA 2CRBA 5C8YE 1D1AA 4U3CA 2XSBA 3EVYA 4O8SA 2VL0A 3RI5A 3B57A 4IDQA 2HH7A 4DVDA 4IE6A 5LHGB 3HA4A 2WM9A 5LYJE 5FVKA 4JLEA 4PFPA 2JJ9A 5IUXA 1YW0A 3PUYF 2I59A 3RC8A 2WDRA 2BBHA 2X68A 4EIWA 4JI8T 5HXRA 4AXPA 4KP3C 3AE3A 3UUBA 4L5GA 2VKHA 3TKLB 5EK2A 2C5JA 3O1JA 1IAPA 2W61A 5JDMA 1HG2A 1HNXT 3RF1A 4GK5E 5LXTE 4CXWA 4GK0E 2QRXA 3AAIA 4QWNB 4L0RA 1HNZT 4JI3T 4PAGA 2OA5A 1IZNB 4IDNA 4U7IA 5CGMA 4H9SE 4GIWA 3RKOA 4YSXA 4PJNA 4AQYT 5HAXA 2UUAT 4ZEYA 4NXMT 1HS7A 1YD8G 4KI0F 3N5LA 3RYIE 3LJCA 5AQJB 4FI5A 3UU6A 1MMDA 4DR4T 1YQ4A 2XAGB 2YDRA 1R8IA 4HWDA 3NWIA 3ZLIA 4Z8XA 2WY2A 3J9X1 3PUGA 4LFCT 1U4QA 2VVSA 2X9YA 4IE0A 2WQYA 5C3JA 4HFCA 4ANJA 4PW8A 1I94T 2N9DA 3SS1A 1ZOYA 5DABA 3ZYKA 1N33T 3C4ZA 2BZBA 4LF4T 2JQKA 2UXBT 4DR1T 1US7B 5IWAT 1FEWA 3O1IA 4JBWF 3ABVA 2DWGA 5HXCA 1YKHB 3UU3A 3UQ4A 4DV1T 5JR9A 4ISTA 2YU1A 4Q25A 3N9LA 3QK6A 4X1KE 3UFEA 1BR1A 3U78A 2D0UA 2WS3A 2NW7A 2HHHT 2E9XB 5HYAA 1UGOA 4IGUA 2X9WA 4U2ZA 5E0OA 3HR0A 1KEYA 4AISA 3AA0B 4LF5T 1CHUA 4GOUA 4TZ4C 4EZ4A 3PUZF 3PURA
chains in the Genus database with same CATH topology
4JI1T 4B3ST 4DR4T 4LFBT 1XNRT 4JI7T 4LF6T 1N34T 4X62T 4DR6T 4DR7T 2ZM6T 4OX9T 4JV5T 4DV4T 4B3MT 4X66T 4YHHT 4NXNT 1XNQT 2F4VT 2E5LT 4LFCT 2VQET 2UXDT 3T1YT 1IBMT 4DR2T 4GKKT 1I94T 1J5ET 4DV2T 2UUCT 4JI8T 4B3RT 1IBLT 1N33T 4JI5T 4B3TT 4K0KT 4LFAT 4LF4T 4JI0T 2UXBT 4DUYT 4DR1T 5IWAT 2VQFT 4KHPT 4X64T 4DR3T 4JI4T 4JYAT 5BR8T 1HNXT 4DV1T 4LF9T 2UXCT 4DV7T 5LMNT 4DV0T 4DV3T 2UU9T 4JI2T 1XMOT 4JI6T 1HNZT 1FJGT 4JI3T 4X65T 2HHHT 4YY3T 4LF7T 4DUZT 4DR5T 1HNWT 1N32T 4AQYT 4GKJT 4DV5T 3OTOT 4DV6T 2UUAT 4LF5T 4NXMT 3T1HT 1IBKT 5LMUT 1N36T 2UUBT 1HR0T 4LF8T 1XMQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI1 T;  4B3S T;  4DR4 T;  4LFB T;  1XNR T;  4JI7 T;  4LF6 T;  1N34 T;  4X62 T;  4DR6 T;  4DR7 T;  2ZM6 T;  4OX9 T;  4JV5 T;  4DV4 T;  4B3M T;  4X66 T;  4YHH T;  4NXN T;  1XNQ T;  2F4V T;  2E5L T;  4LFC T;  2VQE T;  2UXD T;  3T1Y T;  1IBM T;  4DR2 T;  4GKK T;  1I94 T;  1J5E T;  4DV2 T;  2UUC T;  4JI8 T;  4B3R T;  1IBL T;  1N33 T;  4JI5 T;  4B3T T;  4K0K T;  4LFA T;  4LF4 T;  4JI0 T;  2UXB T;  4DUY T;  4DR1 T;  5IWA T;  2VQF T;  4KHP T;  4X64 T;  4DR3 T;  4JI4 T;  4JYA T;  5BR8 T;  1HNX T;  4DV1 T;  4LF9 T;  2UXC T;  4DV7 T;  5LMN T;  4DV0 T;  4DV3 T;  2UU9 T;  4JI2 T;  1XMO T;  4JI6 T;  1HNZ T;  1FJG T;  4JI3 T;  4X65 T;  2HHH T;  4YY3 T;  4LF7 T;  4DUZ T;  4DR5 T;  1HNW T;  1N32 T;  4AQY T;  4GKJ T;  4DV5 T;  3OTO T;  4DV6 T;  2UUA T;  4LF5 T;  4NXM T;  3T1H T;  1IBK T;  5LMU T;  1N36 T;  2UUB T;  1HR0 T;  4LF8 T;  1XMQ T; 
#chains in the Genus database with same CATH topology
 4QH1 A;  2LOS A;  1Z0P A;  1GQE A;  4IDO A;  4LF6 T;  1ZV4 X;  2IAK A;  2XQY A;  1UCU A;  2F4V T;  3HKD E;  5LHI B;  5JRE A;  1MND A;  4M1P A;  3CWZ B;  4YT0 A;  2WMO A;  5J1G A;  2R6G F;  1T8B A;  4QX7 B;  4H9N C;  4V1A v;  5FYM A;  3EAM A;  2YU2 A;  5EK4 A;  3K1S A;  1YQ3 A;  3P7I A;  3IBP A;  1M62 A;  4YTM A;  5FXX A;  5JRC B;  4JUY A;  3KV4 A;  4JI4 T;  4UR9 A;  4UVA B;  5AQM B;  3C64 A;  1S94 A;  3C98 B;  2KSR A;  2MAW A;  3DJB A;  5M4Y A;  1OXZ A;  2NP9 A;  3N2O A;  2XQ5 A;  5A1L A;  2KXP B;  3PUA A;  3TLW A;  3L3P A;  3AED A;  2PTF A;  5J0Z A;  4OHF A;  3FZK B;  5FXV A;  5ABH A;  2D9D A;  4HFE A;  5DQW A;  3UUL A;  3KV6 A;  4DV5 T;  2PJQ A;  3RIU A;  3QB5 A;  3RIA A;  3P4Q A;  2CWO A;  4AQG A;  4YTN A;  3N2K E;  1O3X A;  5CFB A;  5AQP B;  2HN2 A;  3RRC A;  1XMQ T;  3I9W A;  1BR2 A;  4CN4 A;  1XNR T;  1FIO A;  2IC6 A;  5JDH A;  2QA7 A;  3LK2 B;  2X0H A;  4OX9 T;  4BA9 A;  1ZP0 A;  3AE6 A;  3MAC A;  2E5L T;  4UXN B;  3QUJ A;  2DNX A;  1WR6 A;  3S4U A;  2IHR 1;  2CBI A;  3DTO A;  3UFG A;  4AKI A;  3C50 A;  3PUQ A;  2NOX A;  3ONX A;  3PU8 A;  5AQK B;  4U33 A;  1QUU A;  2KZ7 B;  5DQV A;  2LSY A;  5AQG B;  4E7S A;  2CM0 A;  4DR3 T;  2VK9 A;  2D5U A;  3EDU A;  3MZK B;  5L4H A;  2CEA A;  2V26 A;  2UXC T;  1H7C A;  1E1H B;  1SUM B;  4DV3 T;  3FXE B;  2LSJ A;  4HEA A;  5LP6 E;  4YY3 T;  2KND A;  4ILA A;  5F8P A;  3AAE B;  4PJM A;  3NZP A;  2XSA A;  2WMN A;  4OYJ A;  4IE7 A;  3SRZ A;  2E9X A;  4IE4 A;  2PFV A;  2WWU A;  5HEG A;  5JH7 E;  1X9B A;  3L09 A;  2NTY A;  5FXZ A;  3ZC0 A;  4TNV A;  2BG9 C;  4QKN A;  2JMH A;  2KT9 A;  2WU5 A;  5ABE A;  4DV4 T;  4B6X A;  1HX1 B;  2RA1 A;  3RYC E;  5LA6 E;  3KBU A;  4EEB A;  3NKZ A;  5L2L A;  2LHN A;  2JRK A;  2W66 A;  1Y64 B;  2FBW A;  4DR2 T;  3TLU A;  4OK0 A;  1AJ3 A;  2C0S A;  3SOL A;  4WBO A;  4UF0 A;  3MJX A;  3O4X E;  3KFW X;  3U3I A;  1OED E;  3AEA A;  2WDV A;  3ZT6 A;  4KMC A;  3AE8 A;  2PG8 A;  4JYA T;  5L3D B;  4HGA A;  2LRL A;  1BR4 A;  4PK4 A;  2JQQ A;  4ZI3 D;  5JRC A;  5LB7 B;  1D1C A;  3Q5E A;  4ILU A;  3KVA A;  3I9Y A;  5FL0 A;  3MXZ A;  3P4S A;  5H6R B;  1J1J A;  2RP4 A;  3AB3 B;  4AQF A;  1Z8U A;  4AKL A;  4O4H E;  2K48 A;  3BK9 A;  5JDN A;  2LSI A;  3KVB A;  3J7Y q;  2FUP A;  4EZH A;  4QX8 B;  4H63 H;  2K3W A;  2P9B A;  2V5D A;  2XHE B;  4EAH A;  5KMG P;  2DL1 A;  5J2U E;  3H37 A;  2FJD A;  4AI6 A;  5FL1 A;  3KV9 A;  4ISS A;  5LCY A;  3JC6 D;  3CKD A;  2H89 A;  2G0U A;  3CQG B;  3AVS A;  3ZMS B;  2X66 A;  4ERR A;  3ZJ2 A;  3GA8 A;  5FMN A;  4QXH B;  4MHC A;  1IBM T;  1VCS A;  3PJA A;  3RYH E;  2XQ3 A;  3BQL A;  3JC6 C;  1ZHC A;  1HCI A;  3W15 B;  4DMW A;  1YKE B;  3OPC A;  2JQ9 A;  1X79 A;  3LBX A;  4TUY E;  5F5W A;  4QHO A;  2HPL A;  5BR8 T;  1WFD A;  3RQU A;  2KMF A;  3WAJ A;  2XM2 A;  3IEE A;  1SHZ C;  4WNK A;  2FJE A;  3GWH A;  4ZS3 A;  3ZT7 A;  2W62 A;  2D0T A;  3JAD A;  2C5I T;  2V7I A;  3AE2 A;  4KBM B;  2KIN B;  4DR5 T;  5L3E B;  3FB2 A;  5KX5 E;  3NRY A;  1N32 T;  3AEB A;  2M6B A;  4GKJ T;  3K3N A;  4IT4 A;  2CCQ A;  4DV6 T;  4AIU A;  2J4G A;  4NPP A;  1XWM A;  3FZL B;  2CHO A;  4YHJ A;  4CI3 B;  4HFB A;  5L3F B;  3T8O A;  2LLY A;  4C90 A;  3FZF B;  1Y01 A;  3PTR B;  4CN1 A;  4JI7 T;  3OKQ A;  1SE7 A;  4TN7 B;  4X62 T;  5L3B B;  2V7K A;  2ZM6 T;  2Q9Q C;  1KNP A;  2BKO A;  5GON E;  4A5X A;  5ETW A;  5LOV E;  3V5U A;  2H7O A;  3CX8 B;  4YXD A;  4ZZB A;  2M67 A;  2X67 A;  4JEU B;  2YN6 A;  2LSK A;  4YTP A;  4XZC A;  4QH5 A;  5FY0 A;  4MBQ A;  2UXX B;  3JCF A;  5HEJ A;  1OED A;  4HKA A;  4UVB B;  4CZZ B;  3AXJ B;  5AQQ B;  2XQ9 A;  2Y6X A;  1QSD A;  1L0V A;  3CX7 B;  4YSZ A;  4X64 T;  3ZCJ A;  4LF9 T;  2XPK A;  1VRB A;  4CQI A;  4HWF A;  2DHR A;  2LHR A;  2ZMA A;  2XM1 A;  4JEH B;  3PE0 A;  2V6X A;  2NW9 A;  1KNR A;  1XZY A;  5KXJ A;  4Z90 A;  5ABF B;  2YDQ A;  5F3J A;  3ZKR A;  2FJB A;  5HEU A;  2X0Y A;  3P4R A;  2YIN A;  4F8H A;  2IUB A;  1UUS A;  4CXY A;  5JTG A;  3ZT5 A;  4N78 D;  4I0U A;  2LSG A;  3UU5 A;  2XTL A;  4TX5 A;  4LFB T;  4OFZ A;  4U7Y A;  1N34 T;  4O2A E;  5FKY A;  4JV5 T;  4WZX A;  5AFU L;  4NXN T;  3K3Q C;  5CB4 E;  4KHZ F;  2A2F X;  3P4P A;  4DID B;  2V6Y B;  1J5E T;  5L4E A;  4JI5 T;  1MIV A;  4LFA T;  1UX5 A;  4HFI A;  4ZI7 E;  2BG9 B;  3N9Q A;  2B76 A;  3N9M A;  1NWM X;  5AQO B;  4P0A A;  2Z6E A;  3RYF E;  4NIQ A;  5EK3 A;  4AKR B;  5JQG E;  2IC9 A;  3D0T A;  4O4I E;  1W9R A;  4MLK A;  3AE5 A;  5JVD E;  3O9X A;  5LGU B;  2W0G A;  2BG9 E;  2LM2 A;  3UUX B;  3DP7 A;  2E2A A;  4A56 A;  3SWH A;  4TWD A;  2BS3 A;  2XQ6 A;  2L3L A;  1NAF A;  2LRK A;  2DI4 A;  3F31 A;  3ONJ A;  1IBK T;  2X9X A;  4WW0 A;  2AE9 A;  3ZMZ B;  2VKJ A;  1HR0 T;  3F2E A;  3QOF A;  1WR0 A;  4H9R C;  1IJ6 A;  3V5S A;  4L9I A;  1EZ3 A;  4UV8 B;  3AE1 A;  3OBV E;  2XUE A;  3RIU C;  1MMA A;  5FVL A;  3ZPO A;  4EYY R;  4O4J E;  3AA1 B;  1FMW A;  4ZS2 A;  4F6R C;  5J2T E;  4DV2 T;  5LGT B;  2LJL A;  1V9D A;  2WP9 A;  4PJJ A;  3MKD A;  4CXX A;  4JI0 T;  2A9U A;  4DUY T;  4H63 V;  1XDO A;  3PUS A;  5TAO A;  2XAS B;  4MAL A;  1U5P A;  2B1E A;  3A7M A;  2LEH A;  2WAU A;  4ILC A;  5HCM A;  1ZKE A;  2BVM A;  1G73 A;  2MBG A;  4ASK A;  2YKS A;  4IDZ A;  2CWY A;  3E0Z A;  4EXT A;  3ZYL A;  4GYS A;  3AXJ A;  3UUN A;  4TWF A;  4WYV A;  2WCA A;  2SPC A;  4XBF B;  2V7M A;  4H9P C;  4A97 A;  3I0O A;  2H7V C;  5AQS B;  5AQH B;  2N2N A;  2LOP A;  1YXR A;  2CBJ A;  4QH4 A;  5FY1 A;  4H9Q C;  3KBT A;  3RQW A;  4ZHQ E;  3E08 A;  5ABF A;  3O1H A;  1KNZ A;  2J62 A;  4YJ3 E;  3AE9 A;  4HTE A;  2PBI A;  2EHO D;  4I55 E;  1IJ5 A;  4UVC B;  1ZEE A;  3UU8 A;  4YHH T;  3ZCI A;  3RHW A;  3SFD A;  3T1Y T;  4HWH A;  4FJO A;  3AEE A;  3RX6 A;  2V7L A;  3CPZ A;  2EHO C;  3P8C D;  2IIU A;  1XDP A;  2QGS A;  1MIW A;  1KK7 A;  4YSY A;  2Q9Q B;  3LK3 B;  2XAJ B;  2V6Y A;  2V1D B;  3AA7 B;  1WLX A;  3WAK A;  5CJ5 A;  2BG9 A;  4DV0 T;  1T98 A;  2OV9 A;  4KX6 A;  3RIF A;  1D0Y A;  1FJG T;  3RLF F;  2YDS A;  2JIW A;  3FZH B;  2CLY C;  2ACZ A;  3B13 A;  5H6Q B;  2VUR A;  2D2S A;  3VRB A;  3SFE A;  2JMK A;  3HKE E;  4IIJ E;  4ILB A;  5LGN B;  4IL4 A;  4TWH A;  2BBJ A;  5HXS A;  3RKG A;  5FXW A;  2BDE A;  2VWA A;  4PFO A;  1MMN A;  3T1H T;  3L39 A;  2XAQ B;  4AQF C;  1T72 A;  4JI1 T;  2BKP A;  5HXH A;  2DLR A;  4X20 E;  4DR7 T;  2I0M A;  2NR4 A;  4O4L E;  3RH3 A;  1BR0 A;  4AKG A;  2XJ7 A;  4IDP A;  3CQX C;  2VKD A;  5L3C B;  2X0L B;  2E5V A;  5CA0 E;  3AEF A;  2OLT A;  2YK0 A;  4HN9 A;  3OJA A;  4GKK T;  2FJA A;  2ODV A;  5C2T A;  1LVF A;  1UX4 A;  2NWB A;  4B3T T;  4MFR A;  2GK9 A;  1NEN A;  4P1N A;  2XAF B;  3VHL A;  5JDG A;  3M65 A;  5AQR B;  5AQI B;  1VCT A;  3ZEF B;  2VL8 A;  3M3Z B;  1MIY A;  3C51 A;  5FNV E;  2K9A A;  1MNE A;  2MYS A;  5LMN T;  1G8X A;  5FY7 A;  2ODU A;  5L3G B;  4BJM A;  3AEC A;  1B7T A;  3K8P C;  4I50 E;  4QXC B;  1UUR A;  1KF6 A;  4YFS A;  3ANW B;  3X1D A;  5L47 A;  2VB6 A;  3LDQ B;  4DO0 A;  1WYB A;  2ZLY A;  2X9H A;  1D0X A;  2V8S V;  4BJN A;  1WCR A;  4YLH A;  2W4X A;  3FZM B;  4WBN E;  2KWH A;  5LG4 A;  2WDQ A;  2X51 A;  1T7S A;  2L9Q A;  4IHJ E;  5LHH B;  4HWI B;  3PUV F;  3Q5D A;  2CMR A;  5IHY A;  3IA3 A;  4H9O C;  2A72 A;  1J5W A;  3AAA B;  3EDV A;  4NUV A;  3ONL C;  4PJL A;  2Q9Q D;  1OWA A;  3CQC B;  5LG3 A;  2CXD A;  2ZM2 A;  2UXD T;  2VKO A;  4X1Y E;  1DU2 A;  2YEV C;  4B3R T;  4K0K T;  1CUN A;  4EB6 E;  4K0U A;  3AA6 B;  3CIR A;  3FBZ A;  3BQI A;  2V5C A;  4G63 A;  3ZST A;  3N2G E;  3QC9 A;  3PU3 A;  1OED C;  4EOZ B;  5AQT B;  3H3A A;  4JI6 T;  2WBL A;  2WZH A;  5AQV B;  1W0A A;  2Q9Q A;  3MA9 A;  2E8I A;  5AQU B;  2W2U A;  3VKH A;  3IF8 B;  3P50 A;  3GN5 B;  2ES0 A;  4I4T E;  2XAH B;  3PUW F;  5KDM C;  3B5M A;  5LNK A;  3GMI A;  3VR8 A;  3HKC E;  2Y48 B;  2QYW A;  5JR9 C;  4NUU A;  3I1A A;  4P0B A;  3VU7 H;  5AQL B;  2IDO B;  1E2A A;  2AXD S;  2UXN B;  4EYU A;  5AQF B;  3JAE A;  3AVR A;  2A3D A;  5ABG A;  2UUC T;  1IBL T;  1HF8 A;  3OVU A;  2J47 A;  4TV9 E;  3RPU A;  1LRZ A;  4HFH A;  2XZE A;  3CX6 B;  2VQF T;  4LMJ A;  5DJQ C;  1UK5 A;  4U74 A;  2I6H A;  4U31 A;  5BMV E;  4XAX B;  3JAF A;  4EGW A;  4I43 B;  5JDL A;  4LMK A;  3ETU A;  4DV7 T;  4ZZC A;  3ZSS A;  4U2Y A;  3OYZ A;  2JQH A;  3PJA J;  2EHO B;  3ZYM A;  1HX8 A;  3F57 A;  3ZN0 B;  4X65 T;  2J1D G;  2W63 A;  4IE5 A;  4BAY B;  2HPJ A;  5LJN A;  4DUZ T;  5FP3 A;  3NZQ A;  2WU2 A;  2DCF A;  4UF0 B;  3ZC1 A;  3ZJ1 A;  3ANW A;  3ZN1 B;  3C4W A;  3KIN B;  2CLY B;  3N9P A;  2LKH A;  2W00 A;  5HEO A;  3Q9D A;  3H3M A;  4UIG A;  5HWY A;  4PK6 A;  4EED A;  3N9N A;  3R6N A;  1VOM A;  2Y8D A;  2C5K T;  3NVO A;  4TNW A;  3ZMV B;  2K24 A;  2XQ8 A;  3C4X A;  1JNZ A;  3EAB A;  4PK5 A;  1D0Z A;  4HWC A;  2KWI B;  4YJ2 E;  4KHP T;  3BQK A;  2XQA A;  2H3R A;  4GYR A;  3FHN A;  3LSV A;  2YOE A;  5HEH A;  3ETV A;  3HL6 A;  4PNI A;  4HFD A;  4P09 A;  2ZM0 A;  3KDS E;  1WRD A;  4X1I E;  4LF7 T;  2BVL A;  1SA0 E;  2XQ7 A;  4DMV A;  2BS2 A;  1NEK A;  4ZOL E;  3OTO T;  4OYK A;  3K3O A;  4A98 A;  3TLS A;  3UTK A;  3ESL A;  2RPA A;  5LMU T;  1N36 T;  2QVA A;  3LBX B;  3ZMU B;  5LBM A;  2LKG A;  2WZI A;  4LML A;  5JDF A;  4O2B E;  3MK7 C;  1W09 A;  2MOZ A;  2CXL A;  3L8R A;  3UU4 A;  3GN5 A;  3EUH A;  1M7K A;  2MTQ A;  2XY8 B;  4QXB B;  2LM9 A;  4EV6 A;  5ADX L;  2WSS V;  3AEG A;  2WB5 A;  3LG7 A;  3UUM A;  4B3M T;  2E9X D;  4X66 T;  2DWK A;  3UT5 E;  1FMV A;  4UEL A;  2VQE T;  5HCJ A;  3TLT A;  3E22 E;  4C91 A;  2NTX A;  2CE7 A;  3A8Y C;  4J2C A;  3QNU A;  2XQ4 A;  5HXE A;  3WI3 A;  4COF A;  2JPF A;  2CA5 A;  1MMG A;  2CPT A;  4X5T A;  3Q5X A;  2E9X C;  2V7J A;  2K5B B;  3QB5 K;  3VKG A;  3LFM A;  3VR9 A;  1HG5 A;  1JNR A;  5LBQ B;  5IYZ E;  4TV8 E;  3N9O A;  2L8K A;  4JI2 T;  5CA1 E;  3HKB E;  1LKX A;  5HWX A;  1WYC A;  3IHR A;  2WWV A;  2W67 A;  1E7P A;  3VRA A;  2M6I A;  3UQ7 A;  4U72 A;  3HI2 A;  4IRE A;  2KLQ A;  1HNW T;  4DBQ A;  2EHO A;  4CI1 B;  1OED B;  2CHN A;  2UUB T;  4CI2 B;  4DND A;  4ADZ A;  4AKH A;  3FXD B;  4LF8 T;  3PDY A;  3KV5 A;  3RGL A;  4B3S T;  2VAS A;  1D1B A;  5JDQ A;  2BS4 A;  3R84 B;  4IL9 A;  3NBX X;  4DR6 T;  1HFA A;  1QLB A;  3PUX F;  4UEM A;  3AE4 A;  1XNQ T;  4Z91 A;  1LVK A;  3P4W A;  5EZY E;  3Q2M A;  2NW8 A;  4ZI2 D;  2N1G A;  1KFY A;  2CXF A;  4HFV A;  2ZM8 A;  2LE8 A;  4UV9 B;  2H88 A;  5JR9 B;  3ZMT B;  1S35 A;  4ZXL A;  3CML A;  5AQN B;  3AE7 A;  1I6Z A;  3LK4 2;  2HN1 A;  3PV0 F;  4ZI2 C;  3OYX A;  3RRW A;  4KUM B;  1W0B A;  2VVN A;  3RC3 A;  2UU9 T;  1HTJ F;  1XMO T;  4ZI3 C;  2ACX A;  4HE8 A;  3TLV A;  3FBL A;  3CVR A;  2IW5 B;  4CN6 A;  2MPK A;  2IML A;  2BKN A;  3CK6 A;  2LT3 A;  3Q5W A;  3A5X A;  4DBR A;  3I0Q A;  4G2A A;  3G06 A;  3EHZ A;  3NRX A;  4E7Z A;  3EI0 A;  5LJM A;  2CRB A;  5C8Y E;  1D1A A;  4U3C A;  2XSB A;  3EVY A;  4O8S A;  2VL0 A;  3RI5 A;  3B57 A;  4IDQ A;  2HH7 A;  4DVD A;  4IE6 A;  5LHG B;  3HA4 A;  2WM9 A;  5LYJ E;  5FVK A;  4JLE A;  4PFP A;  2JJ9 A;  5IUX A;  1YW0 A;  3PUY F;  2I59 A;  3RC8 A;  2WDR A;  2BBH A;  2X68 A;  4EIW A;  4JI8 T;  5HXR A;  4AXP A;  4KP3 C;  3AE3 A;  3UUB A;  4L5G A;  2VKH A;  3TKL B;  5EK2 A;  2C5J A;  3O1J A;  1IAP A;  2W61 A;  5JDM A;  1HG2 A;  1HNX T;  3RF1 A;  4GK5 E;  5LXT E;  4CXW A;  4GK0 E;  2QRX A;  3AAI A;  4QWN B;  4L0R A;  1HNZ T;  4JI3 T;  4PAG A;  2OA5 A;  1IZN B;  4IDN A;  4U7I A;  5CGM A;  4H9S E;  4GIW A;  3RKO A;  4YSX A;  4PJN A;  4AQY T;  5HAX A;  2UUA T;  4ZEY A;  4NXM T;  1HS7 A;  1YD8 G;  4KI0 F;  3N5L A;  3RYI E;  3LJC A;  5AQJ B;  4FI5 A;  3UU6 A;  1MMD A;  4DR4 T;  1YQ4 A;  2XAG B;  2YDR A;  1R8I A;  4HWD A;  3NWI A;  3ZLI A;  4Z8X A;  2WY2 A;  3J9X 1;  3PUG A;  4LFC T;  1U4Q A;  2VVS A;  2X9Y A;  4IE0 A;  2WQY A;  5C3J A;  4HFC A;  4ANJ A;  4PW8 A;  1I94 T;  2N9D A;  3SS1 A;  1ZOY A;  5DAB A;  3ZYK A;  1N33 T;  3C4Z A;  2BZB A;  4LF4 T;  2JQK A;  2UXB T;  4DR1 T;  1US7 B;  5IWA T;  1FEW A;  3O1I A;  4JBW F;  3ABV A;  2DWG A;  5HXC A;  1YKH B;  3UU3 A;  3UQ4 A;  4DV1 T;  5JR9 A;  4IST A;  2YU1 A;  4Q25 A;  3N9L A;  3QK6 A;  4X1K E;  3UFE A;  1BR1 A;  3U78 A;  2D0U A;  2WS3 A;  2NW7 A;  2HHH T;  2E9X B;  5HYA A;  1UGO A;  4IGU A;  2X9W A;  4U2Z A;  5E0O A;  3HR0 A;  1KEY A;  4AIS A;  3AA0 B;  4LF5 T;  1CHU A;  4GOU A;  4TZ4 C;  4EZ4 A;  3PUZ F;  3PUR A; 
#chains in the Genus database with same CATH homology
 4JI1 T;  4B3S T;  4DR4 T;  4LFB T;  1XNR T;  4JI7 T;  4LF6 T;  1N34 T;  4X62 T;  4DR6 T;  4DR7 T;  2ZM6 T;  4OX9 T;  4JV5 T;  4DV4 T;  4B3M T;  4X66 T;  4YHH T;  4NXN T;  1XNQ T;  2F4V T;  2E5L T;  4LFC T;  2VQE T;  2UXD T;  3T1Y T;  1IBM T;  4DR2 T;  4GKK T;  1I94 T;  1J5E T;  4DV2 T;  2UUC T;  4JI8 T;  4B3R T;  1IBL T;  1N33 T;  4JI5 T;  4B3T T;  4K0K T;  4LFA T;  4LF4 T;  4JI0 T;  2UXB T;  4DUY T;  4DR1 T;  5IWA T;  2VQF T;  4KHP T;  4X64 T;  4DR3 T;  4JI4 T;  4JYA T;  5BR8 T;  1HNX T;  4DV1 T;  4LF9 T;  2UXC T;  4DV7 T;  5LMN T;  4DV0 T;  4DV3 T;  2UU9 T;  4JI2 T;  1XMO T;  4JI6 T;  1HNZ T;  1FJG T;  4JI3 T;  4X65 T;  2HHH T;  4YY3 T;  4LF7 T;  4DUZ T;  4DR5 T;  1HNW T;  1N32 T;  4AQY T;  4GKJ T;  4DV5 T;  3OTO T;  4DV6 T;  2UUA T;  4LF5 T;  4NXM T;  3T1H T;  1IBK T;  5LMU T;  1N36 T;  2UUB T;  1HR0 T;  4LF8 T;  1XMQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...