4YY3T

30s ribosomal subunit- higb complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
source organism Proteus vulgaris
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4yy3T00
4JI2T 1HR0T 2UUAT 5IWAT 4X62T 1N33T 4GKKT 4NXNT 4JI0T 4GKJT 4DV6T 4AQYT 5BR8T 4JYAT 2UXDT 4YHHT 2F4VT 5LMUT 4JI1T 4LF9T 4NXMT 4K0KT 4JI8T 1N36T 4LF4T 1IBLT 4DR5T 1I94T 4KHPT 4DV2T 3OTOT 1HNZT 4DR7T 4X66T 1XMOT 4DV4T 1IBKT 4LFCT 4DV5T 5LMNT 1N34T 4LF8T 2ZM6T 2UUBT 4DR6T 1J5ET 1XNRT 1XNQT 2UXCT 4JI7T 2UU9T 1IBMT 4B3MT 4LF6T 4B3RT 4OX9T 4DR1T 4X65T 2VQET 1HNXT 4JI3T 4DV0T 2UXBT 4X64T 4B3TT 4YY3T 1HNWT 3T1YT 2VQFT 4JI6T 4JV5T 4JI5T 2UUCT 4DUYT 2HHHT 4DV1T 1FJGT 4LFBT 1N32T 4B3ST 1XMQT 4DR2T 4DR3T 3T1HT 4DV7T 4LF5T 4DR4T 4LF7T 2E5LT 4JI4T 4DUZT 4DV3T 4LFAT
chains in the Genus database with same CATH superfamily
3H37A 3L09A 3OBVE 4PJNA 5ABFB 2XZEA 3TLUA 2IHR1 2KWIB 2UXDT 3GMIA 3PTRB 3AA0B 4F6RC 5LG4A 3I0QA 1XDPA 3UUNA 3UU3A 2BG9B 2SPCA 4H9OC 3ANWA 3CPZA 2W63A 4TUYE 2WB5A 4MHCA 4AQFA 4UXNB 4BJNA 2LM2A 5HEGA 4YSYA 1D1BA 1QUUA 4AQGA 3M65A 4YJ2E 1EZ3A 4X1KE 1J1JA 4DMWA 3P50A 4CI1B 2WP9A 3UU8A 4EB6E 1XWMA 2W2UA 3JC6D 3ZMZB 3ZYLA 1E7PA 3UUXB 4UR9A 3R6NA 1FEWA 2BS2A 5J2TE 2XSAA 2XSBA 4JI5T 4H9NC 3PU8A 5DABA 5ABFA 3Q9DA 4ILAA 3AAIA 2X0LB 1YW0A 2CWYA 2BVMA 3N9OA 2D9DA 3C51A 4OFZA 4QWNB 2ODUA 4AQFC 4PW8A 1BR2A 2CE7A 3IEEA 4GK5E 1MMDA 2UUAT 4GYSA 2YDRA 3JCFA 3ONLC 1BR4A 3FBZA 2E5VA 3AE5A 3VKHA 3IF8B 4Z90A 2I6HA 4K0KT 3PUSA 4LF4T 3MK7C 4ZS2A 4Z91A 2KNDA 4DR7T 5M4YA 1XMOT 1IBKT 2BKNA 2M6BA 3Q2MA 2N1GA 4G63A 5L3DB 3RYFE 2WMOA 3SS1A 4LF6T 3AEDA 4UEMA 3FZHB 3PUAA 3ZN1B 1YKEB 2MBGA 4IE5A 4AISA 2BG9C 2EHOD 4DBQA 5LCYA 3FZMB 4DIDB 3ZC0A 4I50E 4HFCA 1G73A 4GYRA 4HGAA 2WWVA 4KMCA 1UUSA 5FVKA 3PUZF 4UF0B 2ZMAA 4ZS3A 5FP3A 2BDEA 1ZOYA 3AVSA 1XMQT 4DR3T 4ANJA 2HN2A 4DO0A 1U5PA 1WYBA 2NTYA 2QGSA 4DR4T 4EAHA 5AQQB 3EVYA 2E5LT 4TV9E 3RPUA 2H7VC 3NZQA 4TZ4C 3I9YA 2OV9A 3MACA 2MAWA 1YQ4A 3BQLA 5HWXA 3JADA 3MXZA 3P4WA 2MTQA 5AQHB 4NXMT 3JAEA 2YEVC 5AQSB 4AXPA 2E2AA 3HKBE 2LSKA 4IE4A 1SUMB 2V7MA 5JR9B 1T72A 2K48A 1MNEA 2V6YB 2VKDA 1OEDE 4OYJA 2XQ7A 5LMNT 2WZIA 1N34T 4ZHQE 3CMLA 4UVBB 2JMHA 4Q25A 2NR4A 4UF0A 2XQ3A 2N9DA 1MMAA 2IAKA 2XAQB 4O2AE 4OX9T 2WCAA 3QUJA 1IAPA 5HEJA 1Z0PA 3VKGA 1T98A 3ZSTA 4O4HE 4ZZBA 3C4WA 1WFDA 4JV5T 1WRDA 5LXTE 4ISSA 2NTXA 3RYCE 1N32T 5AQRB 4CN1A 4ADZA 3HR0A 1UURA 3CVRA 5KXJA 4IDNA 3B13A 2UXNB 3VR9A 4CI3B 2WS3A 2YU1A 4C91A 4U74A 4YT0A 3UU4A 2IUBA 3ZJ1A 2LHRA 3AA1B 5CJ5A 2P9BA 2F4VT 4GIWA 1W0AA 3DP7A 4DBRA 5LA6E 2X67A 2XQ6A 5FY1A 1J5WA 5AQVB 5AQFB 5AQTB 4NIQA 5LGUB 3E22E 2AXDS 3KVAA 5CB4E 1BR1A 3ONJA 2H7OA 3FXEB 2E9XA 1UCUA 3EABA 3ZCIA 4YJ3E 4LMKA 3PJAJ 3A8YC 2IDOB 5LB7B 3C98B 3PUWF 2WWUA 5FXWA 5JR9C 3DJBA 4HTEA 2XQ4A 3AEFA 5J2UE 2ZM8A 2BS4A 4O2BE 1HX1B 5L4HA 2WDQA 3ZT7A 1E2AA 3ABVA 4JEUB 1LRZA 3RKGA 4KI0F 4EOZB 3RI5A 3ZCJA 4PJJA 5ABGA 2Y8DA 2VKHA 1OXZA 3ETVA 4JI2T 4AKLA 2KXPB 2IIUA 4X62T 3AEEA 4PK5A 4X5TA 5AFUL 3A7MA 4C90A 3OKQA 2V7IA 2HPLA 3NRXA 5JDFA 3SOLA 1WCRA 3AE8A 3CX8B 2PFVA 4JI1T 3C4ZA 4ILUA 4HEAA 2CA5A 2LKGA 4ASKA 4AIUA 3J9X1 4IDOA 2NW7A 4ILBA 1E1HB 3L8RA 5KX5E 4X66T 2Q9QA 3N9MA 4DV4T 5CGMA 5JDGA 4QX7B 4A56A 3HKDE 3ZYKA 4X1IE 5FXVA 4CXYA 3AXJA 4HE8A 2Q9QD 2UXCT 2X9XA 2CHNA 4AKHA 3KV5A 4G2AA 3RC3A 3LBXB 3FB2A 4ZI2C 3PUXF 5JREA 5CFBA 1KNPA 3UU6A 3H3AA 2W0GA 1MIVA 5HYAA 4JI6T 5KMGP 3OVUA 2UUCT 4I55E 2ES0A 3TLVA 3UU5A 3KV4A 4IE6A 2MYSA 2D0UA 2PTFA 4B3ST 5AQIB 5KDMC 2V7KA 4H63V 4IT4A 2Y6XA 1KK7A 4L5GA 4KX6A 4PK6A 4ZI7E 2K5BB 2H3RA 2FJAA 4EGWA 3IBPA 1MNDA 4EZHA 3C4XA 3RC8A 3FHNA 1OEDB 4UVCB 2RA1A 1XZYA 3LFMA 3LBXA 4N78D 4YTPA 2LHNA 4DV2T 1IJ6A 5LNKA 3CX7B 3N5LA 4U72A 4EYUA 5JRCB 2HH7A 3AE2A 3O1HA 5FKYA 5IHYA 2ZM2A 4WZXA 5JTGA 4JI7T 3PV0F 2K24A 4H9RC 3F57A 4U2YA 2ODVA 3PDYA 2A9UA 4WNKA 4B3TT 1HG5A 4HWHA 4KUMB 2MPKA 2BBJA 2BS3A 2VQFT 3P4PA 5EK4A 3PE0A 4DUYT 2LEHA 3D0TA 2JJ9A 2V7JA 1ZV4X 2WDRA 2LSIA 3TLTA 4XBFB 3EDVA 3EI0A 3N2OA 5ETWA 2D5UA 1HS7A 1ZP0A 4HWFA 2W4XA 3M3ZB 5HXRA 2C5IT 2CBJA 3U78A 3J7Yq 3VU7H 2VKOA 2KWHA 4JYAT 3ETUA 2X9HA 1OWAA 2BG9A 3QK6A 2YINA 3C64A 3F2EA 3BK9A 3TLWA 4MLKA 1HNZT 2J1DG 4AI6A 4FJOA 4EZ4A 2BBHA 3O1IA 3RX6A 1IZNB 3CIRA 1VOMA 2KMFA 3AA6B 4TX5A 2J4GA 5CA0E 1OEDC 4JUYA 1FIOA 3EDUA 4IL9A 3RQWA 1HNXT 4H9QC 4CI2B 2YKSA 4K0UA 4QXHB 4HFDA 2WZHA 4Z8XA 4ISTA 3EHZA 2M67A 5LYJE 2W61A 3G06A 4TNVA 2Z6EA 4UELA 3FZFB 3C50A 2I0MA 3KV9A 5TAOA 4P1NA 3RIAA 4YSZA 5L2LA 2V7LA 3L3PA 2W62A 4WYVA 2LKHA 3WAJA 2ACZA 1UX4A 2V1DB 4EEBA 2B1EA 1X9BA 4CXXA 3ESLA 4HWDA 4IHJE 3N2KE 1HR0T 3LK3B 3LG7A 4CN6A 4AQYT 5BR8T 5HEOA 4YHHT 3UULA 1ZEEA 2KLQA 3RYHE 5AQJB 3KDSE 4HWIB 3VRAA 3KVBA 2JQ9A 3UUMA 2B76A 1HX8A 3UTKA 1MIWA 2V6XA 4DVDA 2CM0A 4ZOLE 2UXXB 5AQKB 2UU9T 4IDQA 3BQIA 3MKDA 4U31A 4U7YA 4ZZCA 1KFYA 3EUHA 2BKPA 4IDPA 2AE9A 4HFHA 3NBXX 4U3CA 5AQMB 3S4UA 1VRBA 4ILCA 1NWMX 5AQNB 2KSRA 4M1PA 3RIFA 2KINB 5AQUB 3AEAA 3RIUC 4TN7B 3JAFA 3K3OA 1D1AA 4QX8B 2WM9A 3ZMUB 4TWDA 1L0VA 1S35A 2CHOA 4YXDA 1B7TA 2LOSA 2LT3A 5LMUT 4A98A 2PG8A 1T8BA 3ZC1A 2NW8A 5JR9A 4IIJE 2V6YA 3O9XA 4BA9A 4WBNE 5HCMA 4CQIA 3N9PA 1Y01A 1VCSA 1US7B 4P0AA 4WW0A 5AQOB 3P8CD 3MJXA 5L4EA 1IJ5A 4B3MT 3HKEE 2NOXA 2FJEA 1V9DA 4BJMA 1CHUA 5JDHA 2W00A 4IREA 2DL1A 3FZLB 3CWZB 5DJQC 4A97A 5HEHA 1NENA 2WY2A 5ABEA 4KP3C 1WYCA 3CK6A 1SA0E 2CEAA 4ZI3D 2HHHT 3Q5WA 2LRLA 4NPPA 2XASB 2FBWA 3VR8A 3KBUA 2E9XD 4LMJA 3AA7B 1G8XA 2C5KT 4JI4T 2YDQA 3B57A 3V5SA 4L9IA 4GKKT 1HFAA 2V8SV 3NRYA 3Q5EA 2WMNA 4DV6T 5LGTB 2RP4A 4PAGA 3ZPOA 1W9RA 5FL0A 3NKZA 3NWIA 2LJLA 5LP6E 1WLXA 3UFEA 3OTOT 4ZI2D 5L3GB 4OK0A 2WAUA 5L3BB 2PJQA 1KNRA 2ZM6T 2DI4A 4L0RA 2XM2A 1Y64B 2W67A 4MALA 5HWYA 1XNRT 1VCTA 4JLEA 4UV8B 3LJCA 2IC6A 3KV6A 4DR1T 3I1AA 3KBTA 4YTMA 2JRKA 5L3EB 4YTNA 2FJDA 4UVAB 4DV0T 1SE7A 2VASA 5DQVA 2PBIA 3TKLB 4CXWA 2G0UA 4DNDA 1UGOA 3RYIE 2ACXA 2HPJA 3CQCB 3ZKRA 1WR0A 5LHIB 3T1HT 4DV7T 2X68A 5FNVE 2L9QA 3AEBA 1X79A 1ZKEA 2DNXA 4PJLA 3T8OA 4LFAT 3AE9A 3LDQB 2VL0A 2X66A 3CKDA 4OHFA 3P4RA 3PJAA 2LRKA 3UFGA 2L3LA 5JDLA 3PUYF 4A5XA 1LVFA 4IL4A 4LF9T 4IE7A 4I0UA 2H89A 4KBMB 3RGLA 5E0OA 1LVKA 4WBOA 4I43B 3QC9A 5J1GA 3ZMTB 4TWFA 4DMVA 5EZYE 3AE6A 2N2NA 4HN9A 4QXCB 3VHLA 2W66A 4LF8T 2JQKA 3F31A 4QH4A 3UQ7A 2KZ7B 4B3RT 2WU5A 1O3XA 4YHJA 2DLRA 2VVSA 5LJNA 1GQEA 4TV8E 2ZM0A 4JI3T 2LM9A 5HAXA 4U7IA 3FZKB 2XAJB 4AKRB 1JNRA 3BQKA 4H63H 2XAFB 2D0TA 2JQQA 3K3QC 4OYKA 3FXDB 1HG2A 3ZMVB 3RQUA 4QHOA 4XZCA 4O8SA 4P09A 3GA8A 5C8YE 3O1JA 3GWHA 2J62A 2K3WA 2FUPA 2CMRA 3AVRA 4HFEA 4DV3T 3ONXA 2OLTA 1BR0A 2QVAA 2FJBA 1N33T 3AE7A 1W09A 3N9QA 1XDOA 5HXHA 2WDVA 4QKNA 3UT5E 4GKJT 4MBQA 5L47A 4AKGA 4IGUA 3RKOA 1OEDA 1T7SA 3CQXC 2XAGB 2A72A 5LGNB 3QOFA 5DQWA 1QSDA 5BMVE 4U33A 3W15B 5IYZE 2YU2A 2DHRA 2LE8A 3WI3A 2GK9A 2CRBA 3PUQA 5HCJA 4KHZF 3UUBA 2JPFA 3KINB 5LJMA 3FBLA 4U2ZA 5JRCA 4I4TE 2X51A 2EHOB 4JEHB 2V26A 1U4QA 5HXEA 5AQPB 2IMLA 3X1DA 5L3CB 2CPTA 5JVDE 3OYZA 1LKXA 2NW9A 4PJMA 5GONE 3Q5DA 4ZXLA 4PFOA 2NWBA 4X1YE 3ZYMA 2K9AA 4MFRA 4J2CA 3SWHA 3WAKA 2XJ7A 4COFA 5JH7E 4H9SE 2HN1A 3JC6C 2E8IA 2CXFA 3P4QA 3P4SA 2XHEB 4EEDA 5FVLA 3QNUA 3RH3A 5JDQA 2CWOA 3ZMSB 2NP9A 4V1Av 5HEUA 5H6RB 4HKAA 2IC9A 5FL1A 4YSXA 3EAMA 3AE3A 3E0ZA 2EHOA 3HA4A 2XQYA 4JI8T 2BVLA 4EIWA 2C0SA 3LSVA 4YLHA 4HFIA 1S94A 3N2GE 4HFVA 1IBLT 3A5XA 1CUNA 2VURA 2LSYA 2IW5B 4UIGA 3U3IA 2X9YA 4DR6T 5ADXL 3DTOA 2XTLA 3Q5XA 1IBMT 2CXLA 2QYWA 3PURA 1D0XA 3RIUA 1D0YA 2CBIA 2VB6A 2VVNA 5LBMA 1AJ3A 3TLSA 4NUVA 2X0YA 2DWGA 3VRBA 4QH5A 3T1YT 2H88A 2VK9A 3CQGB 3SRZA 2M6IA 2ZLYA 3E08A 1NEKA 2EHOC 4LFBT 5FY7A 1MMGA 1FMWA 5LHGB 3K3NA 3AE1A 4QXBB 2RPAA 2LSGA 4GK0E 4ERRA 5AQGB 4FI5A 2V5DA 2WQYA 2DWKA 3L39A 3HI2A 2CLYB 3PUVF 5FY0A 4B6XA 5FXXA 1R8IA 2JIWA 5JDMA 2VKJA 2XY8B 1KF6A 2XQ5A 2VWAA 3ZT6A 2XQ8A 4XAXB 3V5UA 3O4XE 2A2FX 3AAAB 5ABHA 3ZSSA 5F5WA 4DR5T 5IUXA 1I94T 2Y48B 3K8PC 3I0OA 2BZBA 4DV5T 5FYMA 2BG9E 4NUUA 4O4JE 1JNZA 2XQAA 2UUBT 1D1CA 1XNQT 2OA5A 3PU3A 1YD8G 4E7ZA 2E9XB 3QB5A 2J47A 3ZN0B 2VQET 3AB3B 3MZKB 5AQLB 2XPKA 2UXBT 3GN5B 4X64T 4YY3T 1HF8A 2L8KA 3OPCA 2V5CA 1HTJF 2YN6A 2D2SA 1M62A 2YK0A 3I9WA 3LK2B 3AEGA 4DV1T 1M7KA 1MIYA 4IE0A 3QB5K 1MMNA 2C5JA 3ZLIA 4E7SA 3CX6B 4LF7T 5C3JA 1D0ZA 4AKIA 3AE4A 3OJAA 3SFDA 4JI0T 5JDNA 3ZT5A 4EV6A 1NAFA 1YXRA 2XM1A 1QLBA 2JMKA 1N36T 1WR6A 4O4IE 3IA3A 3PUGA 1YQ3A 3R84B 4HWCA 5F3JA 2YOEA 2Q9QB 4LMLA 3GN5A 5LBQB 2CLYC 5F8PA 5HXCA 4IDZA 5EK3A 1J5ET 3H3MA 3KFWX 3AXJB 4QH1A 4X65T 1KEYA 1KNZA 3MA9A 4TWHA 4PFPA 2QA7A 2LSJA 1UX5A 2R6GF 1H7CA 3UQ4A 4GOUA 4EYYR 3RLFF 4PK4A 1DU2A 1ZHCA 4ZI3C 1FJGT 2E9XC 3SFEA 2BKOA 3RRCA 4O4LE 5L3FB 2MOZA 2VL8A 2XQ9A 3AECA 4YFSA 3ZJ2A 4ZEYA 3N9LA 2XAHB 5FMNA 5FXZA 5IWAT 5EK2A 4PNIA 5CA1E 2LLYA 4NXNT 3RF1A 1HCIA 2JQHA 2YDSA 2XUEA 3ZEFB 1I6ZA 3RHWA 4F8HA 1YKHB 5LHHB 3RRWA 4EXTA 3LK42 2WSSV 3HL6A 2WU2A 4KHPT 5LG3A 5A1LA 4LFCT 3HKCE 3OYXA 1Z8UA 3IHRA 4JBWF 5H6QB 3N9NA 4TNWA 4BAYB 4P0BA 4X20E 1FMVA 4CZZB 3ANWB 5JQGE 5C2TA 3B5MA 1SHZC 2X9WA 2WBLA 2LOPA 3K1SA 1HNWT 2CXDA 2QRXA 1UK5A 2Q9QC 3AAEB 3NZPA 1W0BA 3NVOA 5J0ZA 5LOVE 2KT9A 2X0HA 4DR2T 2A3DA 4HFBA 4LF5T 4H9PC 2DCFA 2I59A 3P7IA 4CN4A 4DUZT 2CCQA 5HXSA 4UV9B
chains in the Genus database with same CATH topology
4JI2T 1HR0T 2UUAT 5IWAT 4X62T 1N33T 4GKKT 4NXNT 4JI0T 4GKJT 4DV6T 4AQYT 5BR8T 4JYAT 2UXDT 4YHHT 2F4VT 5LMUT 4JI1T 4LF9T 4NXMT 4K0KT 4JI8T 1N36T 4LF4T 1IBLT 4DR5T 1I94T 4KHPT 4DV2T 3OTOT 1HNZT 4DR7T 4X66T 1XMOT 4DV4T 1IBKT 4LFCT 4DV5T 5LMNT 1N34T 4LF8T 2ZM6T 2UUBT 4DR6T 1J5ET 1XNRT 1XNQT 2UXCT 4JI7T 2UU9T 1IBMT 4B3MT 4LF6T 4B3RT 4OX9T 4DR1T 4X65T 2VQET 1HNXT 4JI3T 4DV0T 2UXBT 4X64T 4B3TT 4YY3T 1HNWT 3T1YT 2VQFT 4JI6T 4JV5T 4JI5T 2UUCT 4DUYT 2HHHT 4DV1T 1FJGT 4LFBT 1N32T 4B3ST 1XMQT 4DR2T 4DR3T 3T1HT 4DV7T 4LF5T 4DR4T 4LF7T 2E5LT 4JI4T 4DUZT 4DV3T 4LFAT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 T;  1HR0 T;  2UUA T;  5IWA T;  4X62 T;  1N33 T;  4GKK T;  4NXN T;  4JI0 T;  4GKJ T;  4DV6 T;  4AQY T;  5BR8 T;  4JYA T;  2UXD T;  4YHH T;  2F4V T;  5LMU T;  4JI1 T;  4LF9 T;  4NXM T;  4K0K T;  4JI8 T;  1N36 T;  4LF4 T;  1IBL T;  4DR5 T;  1I94 T;  4KHP T;  4DV2 T;  3OTO T;  1HNZ T;  4DR7 T;  4X66 T;  1XMO T;  4DV4 T;  1IBK T;  4LFC T;  4DV5 T;  5LMN T;  1N34 T;  4LF8 T;  2ZM6 T;  2UUB T;  4DR6 T;  1J5E T;  1XNR T;  1XNQ T;  2UXC T;  4JI7 T;  2UU9 T;  1IBM T;  4B3M T;  4LF6 T;  4B3R T;  4OX9 T;  4DR1 T;  4X65 T;  2VQE T;  1HNX T;  4JI3 T;  4DV0 T;  2UXB T;  4X64 T;  4B3T T;  4YY3 T;  1HNW T;  3T1Y T;  2VQF T;  4JI6 T;  4JV5 T;  4JI5 T;  2UUC T;  4DUY T;  2HHH T;  4DV1 T;  1FJG T;  4LFB T;  1N32 T;  4B3S T;  1XMQ T;  4DR2 T;  4DR3 T;  3T1H T;  4DV7 T;  4LF5 T;  4DR4 T;  4LF7 T;  2E5L T;  4JI4 T;  4DUZ T;  4DV3 T;  4LFA T; 
#chains in the Genus database with same CATH topology
 3H37 A;  3L09 A;  3OBV E;  4PJN A;  5ABF B;  2XZE A;  3TLU A;  2IHR 1;  2KWI B;  2UXD T;  3GMI A;  3PTR B;  3AA0 B;  4F6R C;  5LG4 A;  3I0Q A;  1XDP A;  3UUN A;  3UU3 A;  2BG9 B;  2SPC A;  4H9O C;  3ANW A;  3CPZ A;  2W63 A;  4TUY E;  2WB5 A;  4MHC A;  4AQF A;  4UXN B;  4BJN A;  2LM2 A;  5HEG A;  4YSY A;  1D1B A;  1QUU A;  4AQG A;  3M65 A;  4YJ2 E;  1EZ3 A;  4X1K E;  1J1J A;  4DMW A;  3P50 A;  4CI1 B;  2WP9 A;  3UU8 A;  4EB6 E;  1XWM A;  2W2U A;  3JC6 D;  3ZMZ B;  3ZYL A;  1E7P A;  3UUX B;  4UR9 A;  3R6N A;  1FEW A;  2BS2 A;  5J2T E;  2XSA A;  2XSB A;  4JI5 T;  4H9N C;  3PU8 A;  5DAB A;  5ABF A;  3Q9D A;  4ILA A;  3AAI A;  2X0L B;  1YW0 A;  2CWY A;  2BVM A;  3N9O A;  2D9D A;  3C51 A;  4OFZ A;  4QWN B;  2ODU A;  4AQF C;  4PW8 A;  1BR2 A;  2CE7 A;  3IEE A;  4GK5 E;  1MMD A;  2UUA T;  4GYS A;  2YDR A;  3JCF A;  3ONL C;  1BR4 A;  3FBZ A;  2E5V A;  3AE5 A;  3VKH A;  3IF8 B;  4Z90 A;  2I6H A;  4K0K T;  3PUS A;  4LF4 T;  3MK7 C;  4ZS2 A;  4Z91 A;  2KND A;  4DR7 T;  5M4Y A;  1XMO T;  1IBK T;  2BKN A;  2M6B A;  3Q2M A;  2N1G A;  4G63 A;  5L3D B;  3RYF E;  2WMO A;  3SS1 A;  4LF6 T;  3AED A;  4UEM A;  3FZH B;  3PUA A;  3ZN1 B;  1YKE B;  2MBG A;  4IE5 A;  4AIS A;  2BG9 C;  2EHO D;  4DBQ A;  5LCY A;  3FZM B;  4DID B;  3ZC0 A;  4I50 E;  4HFC A;  1G73 A;  4GYR A;  4HGA A;  2WWV A;  4KMC A;  1UUS A;  5FVK A;  3PUZ F;  4UF0 B;  2ZMA A;  4ZS3 A;  5FP3 A;  2BDE A;  1ZOY A;  3AVS A;  1XMQ T;  4DR3 T;  4ANJ A;  2HN2 A;  4DO0 A;  1U5P A;  1WYB A;  2NTY A;  2QGS A;  4DR4 T;  4EAH A;  5AQQ B;  3EVY A;  2E5L T;  4TV9 E;  3RPU A;  2H7V C;  3NZQ A;  4TZ4 C;  3I9Y A;  2OV9 A;  3MAC A;  2MAW A;  1YQ4 A;  3BQL A;  5HWX A;  3JAD A;  3MXZ A;  3P4W A;  2MTQ A;  5AQH B;  4NXM T;  3JAE A;  2YEV C;  5AQS B;  4AXP A;  2E2A A;  3HKB E;  2LSK A;  4IE4 A;  1SUM B;  2V7M A;  5JR9 B;  1T72 A;  2K48 A;  1MNE A;  2V6Y B;  2VKD A;  1OED E;  4OYJ A;  2XQ7 A;  5LMN T;  2WZI A;  1N34 T;  4ZHQ E;  3CML A;  4UVB B;  2JMH A;  4Q25 A;  2NR4 A;  4UF0 A;  2XQ3 A;  2N9D A;  1MMA A;  2IAK A;  2XAQ B;  4O2A E;  4OX9 T;  2WCA A;  3QUJ A;  1IAP A;  5HEJ A;  1Z0P A;  3VKG A;  1T98 A;  3ZST A;  4O4H E;  4ZZB A;  3C4W A;  1WFD A;  4JV5 T;  1WRD A;  5LXT E;  4ISS A;  2NTX A;  3RYC E;  1N32 T;  5AQR B;  4CN1 A;  4ADZ A;  3HR0 A;  1UUR A;  3CVR A;  5KXJ A;  4IDN A;  3B13 A;  2UXN B;  3VR9 A;  4CI3 B;  2WS3 A;  2YU1 A;  4C91 A;  4U74 A;  4YT0 A;  3UU4 A;  2IUB A;  3ZJ1 A;  2LHR A;  3AA1 B;  5CJ5 A;  2P9B A;  2F4V T;  4GIW A;  1W0A A;  3DP7 A;  4DBR A;  5LA6 E;  2X67 A;  2XQ6 A;  5FY1 A;  1J5W A;  5AQV B;  5AQF B;  5AQT B;  4NIQ A;  5LGU B;  3E22 E;  2AXD S;  3KVA A;  5CB4 E;  1BR1 A;  3ONJ A;  2H7O A;  3FXE B;  2E9X A;  1UCU A;  3EAB A;  3ZCI A;  4YJ3 E;  4LMK A;  3PJA J;  3A8Y C;  2IDO B;  5LB7 B;  3C98 B;  3PUW F;  2WWU A;  5FXW A;  5JR9 C;  3DJB A;  4HTE A;  2XQ4 A;  3AEF A;  5J2U E;  2ZM8 A;  2BS4 A;  4O2B E;  1HX1 B;  5L4H A;  2WDQ A;  3ZT7 A;  1E2A A;  3ABV A;  4JEU B;  1LRZ A;  3RKG A;  4KI0 F;  4EOZ B;  3RI5 A;  3ZCJ A;  4PJJ A;  5ABG A;  2Y8D A;  2VKH A;  1OXZ A;  3ETV A;  4JI2 T;  4AKL A;  2KXP B;  2IIU A;  4X62 T;  3AEE A;  4PK5 A;  4X5T A;  5AFU L;  3A7M A;  4C90 A;  3OKQ A;  2V7I A;  2HPL A;  3NRX A;  5JDF A;  3SOL A;  1WCR A;  3AE8 A;  3CX8 B;  2PFV A;  4JI1 T;  3C4Z A;  4ILU A;  4HEA A;  2CA5 A;  2LKG A;  4ASK A;  4AIU A;  3J9X 1;  4IDO A;  2NW7 A;  4ILB A;  1E1H B;  3L8R A;  5KX5 E;  4X66 T;  2Q9Q A;  3N9M A;  4DV4 T;  5CGM A;  5JDG A;  4QX7 B;  4A56 A;  3HKD E;  3ZYK A;  4X1I E;  5FXV A;  4CXY A;  3AXJ A;  4HE8 A;  2Q9Q D;  2UXC T;  2X9X A;  2CHN A;  4AKH A;  3KV5 A;  4G2A A;  3RC3 A;  3LBX B;  3FB2 A;  4ZI2 C;  3PUX F;  5JRE A;  5CFB A;  1KNP A;  3UU6 A;  3H3A A;  2W0G A;  1MIV A;  5HYA A;  4JI6 T;  5KMG P;  3OVU A;  2UUC T;  4I55 E;  2ES0 A;  3TLV A;  3UU5 A;  3KV4 A;  4IE6 A;  2MYS A;  2D0U A;  2PTF A;  4B3S T;  5AQI B;  5KDM C;  2V7K A;  4H63 V;  4IT4 A;  2Y6X A;  1KK7 A;  4L5G A;  4KX6 A;  4PK6 A;  4ZI7 E;  2K5B B;  2H3R A;  2FJA A;  4EGW A;  3IBP A;  1MND A;  4EZH A;  3C4X A;  3RC8 A;  3FHN A;  1OED B;  4UVC B;  2RA1 A;  1XZY A;  3LFM A;  3LBX A;  4N78 D;  4YTP A;  2LHN A;  4DV2 T;  1IJ6 A;  5LNK A;  3CX7 B;  3N5L A;  4U72 A;  4EYU A;  5JRC B;  2HH7 A;  3AE2 A;  3O1H A;  5FKY A;  5IHY A;  2ZM2 A;  4WZX A;  5JTG A;  4JI7 T;  3PV0 F;  2K24 A;  4H9R C;  3F57 A;  4U2Y A;  2ODV A;  3PDY A;  2A9U A;  4WNK A;  4B3T T;  1HG5 A;  4HWH A;  4KUM B;  2MPK A;  2BBJ A;  2BS3 A;  2VQF T;  3P4P A;  5EK4 A;  3PE0 A;  4DUY T;  2LEH A;  3D0T A;  2JJ9 A;  2V7J A;  1ZV4 X;  2WDR A;  2LSI A;  3TLT A;  4XBF B;  3EDV A;  3EI0 A;  3N2O A;  5ETW A;  2D5U A;  1HS7 A;  1ZP0 A;  4HWF A;  2W4X A;  3M3Z B;  5HXR A;  2C5I T;  2CBJ A;  3U78 A;  3J7Y q;  3VU7 H;  2VKO A;  2KWH A;  4JYA T;  3ETU A;  2X9H A;  1OWA A;  2BG9 A;  3QK6 A;  2YIN A;  3C64 A;  3F2E A;  3BK9 A;  3TLW A;  4MLK A;  1HNZ T;  2J1D G;  4AI6 A;  4FJO A;  4EZ4 A;  2BBH A;  3O1I A;  3RX6 A;  1IZN B;  3CIR A;  1VOM A;  2KMF A;  3AA6 B;  4TX5 A;  2J4G A;  5CA0 E;  1OED C;  4JUY A;  1FIO A;  3EDU A;  4IL9 A;  3RQW A;  1HNX T;  4H9Q C;  4CI2 B;  2YKS A;  4K0U A;  4QXH B;  4HFD A;  2WZH A;  4Z8X A;  4IST A;  3EHZ A;  2M67 A;  5LYJ E;  2W61 A;  3G06 A;  4TNV A;  2Z6E A;  4UEL A;  3FZF B;  3C50 A;  2I0M A;  3KV9 A;  5TAO A;  4P1N A;  3RIA A;  4YSZ A;  5L2L A;  2V7L A;  3L3P A;  2W62 A;  4WYV A;  2LKH A;  3WAJ A;  2ACZ A;  1UX4 A;  2V1D B;  4EEB A;  2B1E A;  1X9B A;  4CXX A;  3ESL A;  4HWD A;  4IHJ E;  3N2K E;  1HR0 T;  3LK3 B;  3LG7 A;  4CN6 A;  4AQY T;  5BR8 T;  5HEO A;  4YHH T;  3UUL A;  1ZEE A;  2KLQ A;  3RYH E;  5AQJ B;  3KDS E;  4HWI B;  3VRA A;  3KVB A;  2JQ9 A;  3UUM A;  2B76 A;  1HX8 A;  3UTK A;  1MIW A;  2V6X A;  4DVD A;  2CM0 A;  4ZOL E;  2UXX B;  5AQK B;  2UU9 T;  4IDQ A;  3BQI A;  3MKD A;  4U31 A;  4U7Y A;  4ZZC A;  1KFY A;  3EUH A;  2BKP A;  4IDP A;  2AE9 A;  4HFH A;  3NBX X;  4U3C A;  5AQM B;  3S4U A;  1VRB A;  4ILC A;  1NWM X;  5AQN B;  2KSR A;  4M1P A;  3RIF A;  2KIN B;  5AQU B;  3AEA A;  3RIU C;  4TN7 B;  3JAF A;  3K3O A;  1D1A A;  4QX8 B;  2WM9 A;  3ZMU B;  4TWD A;  1L0V A;  1S35 A;  2CHO A;  4YXD A;  1B7T A;  2LOS A;  2LT3 A;  5LMU T;  4A98 A;  2PG8 A;  1T8B A;  3ZC1 A;  2NW8 A;  5JR9 A;  4IIJ E;  2V6Y A;  3O9X A;  4BA9 A;  4WBN E;  5HCM A;  4CQI A;  3N9P A;  1Y01 A;  1VCS A;  1US7 B;  4P0A A;  4WW0 A;  5AQO B;  3P8C D;  3MJX A;  5L4E A;  1IJ5 A;  4B3M T;  3HKE E;  2NOX A;  2FJE A;  1V9D A;  4BJM A;  1CHU A;  5JDH A;  2W00 A;  4IRE A;  2DL1 A;  3FZL B;  3CWZ B;  5DJQ C;  4A97 A;  5HEH A;  1NEN A;  2WY2 A;  5ABE A;  4KP3 C;  1WYC A;  3CK6 A;  1SA0 E;  2CEA A;  4ZI3 D;  2HHH T;  3Q5W A;  2LRL A;  4NPP A;  2XAS B;  2FBW A;  3VR8 A;  3KBU A;  2E9X D;  4LMJ A;  3AA7 B;  1G8X A;  2C5K T;  4JI4 T;  2YDQ A;  3B57 A;  3V5S A;  4L9I A;  4GKK T;  1HFA A;  2V8S V;  3NRY A;  3Q5E A;  2WMN A;  4DV6 T;  5LGT B;  2RP4 A;  4PAG A;  3ZPO A;  1W9R A;  5FL0 A;  3NKZ A;  3NWI A;  2LJL A;  5LP6 E;  1WLX A;  3UFE A;  3OTO T;  4ZI2 D;  5L3G B;  4OK0 A;  2WAU A;  5L3B B;  2PJQ A;  1KNR A;  2ZM6 T;  2DI4 A;  4L0R A;  2XM2 A;  1Y64 B;  2W67 A;  4MAL A;  5HWY A;  1XNR T;  1VCT A;  4JLE A;  4UV8 B;  3LJC A;  2IC6 A;  3KV6 A;  4DR1 T;  3I1A A;  3KBT A;  4YTM A;  2JRK A;  5L3E B;  4YTN A;  2FJD A;  4UVA B;  4DV0 T;  1SE7 A;  2VAS A;  5DQV A;  2PBI A;  3TKL B;  4CXW A;  2G0U A;  4DND A;  1UGO A;  3RYI E;  2ACX A;  2HPJ A;  3CQC B;  3ZKR A;  1WR0 A;  5LHI B;  3T1H T;  4DV7 T;  2X68 A;  5FNV E;  2L9Q A;  3AEB A;  1X79 A;  1ZKE A;  2DNX A;  4PJL A;  3T8O A;  4LFA T;  3AE9 A;  3LDQ B;  2VL0 A;  2X66 A;  3CKD A;  4OHF A;  3P4R A;  3PJA A;  2LRK A;  3UFG A;  2L3L A;  5JDL A;  3PUY F;  4A5X A;  1LVF A;  4IL4 A;  4LF9 T;  4IE7 A;  4I0U A;  2H89 A;  4KBM B;  3RGL A;  5E0O A;  1LVK A;  4WBO A;  4I43 B;  3QC9 A;  5J1G A;  3ZMT B;  4TWF A;  4DMV A;  5EZY E;  3AE6 A;  2N2N A;  4HN9 A;  4QXC B;  3VHL A;  2W66 A;  4LF8 T;  2JQK A;  3F31 A;  4QH4 A;  3UQ7 A;  2KZ7 B;  4B3R T;  2WU5 A;  1O3X A;  4YHJ A;  2DLR A;  2VVS A;  5LJN A;  1GQE A;  4TV8 E;  2ZM0 A;  4JI3 T;  2LM9 A;  5HAX A;  4U7I A;  3FZK B;  2XAJ B;  4AKR B;  1JNR A;  3BQK A;  4H63 H;  2XAF B;  2D0T A;  2JQQ A;  3K3Q C;  4OYK A;  3FXD B;  1HG2 A;  3ZMV B;  3RQU A;  4QHO A;  4XZC A;  4O8S A;  4P09 A;  3GA8 A;  5C8Y E;  3O1J A;  3GWH A;  2J62 A;  2K3W A;  2FUP A;  2CMR A;  3AVR A;  4HFE A;  4DV3 T;  3ONX A;  2OLT A;  1BR0 A;  2QVA A;  2FJB A;  1N33 T;  3AE7 A;  1W09 A;  3N9Q A;  1XDO A;  5HXH A;  2WDV A;  4QKN A;  3UT5 E;  4GKJ T;  4MBQ A;  5L47 A;  4AKG A;  4IGU A;  3RKO A;  1OED A;  1T7S A;  3CQX C;  2XAG B;  2A72 A;  5LGN B;  3QOF A;  5DQW A;  1QSD A;  5BMV E;  4U33 A;  3W15 B;  5IYZ E;  2YU2 A;  2DHR A;  2LE8 A;  3WI3 A;  2GK9 A;  2CRB A;  3PUQ A;  5HCJ A;  4KHZ F;  3UUB A;  2JPF A;  3KIN B;  5LJM A;  3FBL A;  4U2Z A;  5JRC A;  4I4T E;  2X51 A;  2EHO B;  4JEH B;  2V26 A;  1U4Q A;  5HXE A;  5AQP B;  2IML A;  3X1D A;  5L3C B;  2CPT A;  5JVD E;  3OYZ A;  1LKX A;  2NW9 A;  4PJM A;  5GON E;  3Q5D A;  4ZXL A;  4PFO A;  2NWB A;  4X1Y E;  3ZYM A;  2K9A A;  4MFR A;  4J2C A;  3SWH A;  3WAK A;  2XJ7 A;  4COF A;  5JH7 E;  4H9S E;  2HN1 A;  3JC6 C;  2E8I A;  2CXF A;  3P4Q A;  3P4S A;  2XHE B;  4EED A;  5FVL A;  3QNU A;  3RH3 A;  5JDQ A;  2CWO A;  3ZMS B;  2NP9 A;  4V1A v;  5HEU A;  5H6R B;  4HKA A;  2IC9 A;  5FL1 A;  4YSX A;  3EAM A;  3AE3 A;  3E0Z A;  2EHO A;  3HA4 A;  2XQY A;  4JI8 T;  2BVL A;  4EIW A;  2C0S A;  3LSV A;  4YLH A;  4HFI A;  1S94 A;  3N2G E;  4HFV A;  1IBL T;  3A5X A;  1CUN A;  2VUR A;  2LSY A;  2IW5 B;  4UIG A;  3U3I A;  2X9Y A;  4DR6 T;  5ADX L;  3DTO A;  2XTL A;  3Q5X A;  1IBM T;  2CXL A;  2QYW A;  3PUR A;  1D0X A;  3RIU A;  1D0Y A;  2CBI A;  2VB6 A;  2VVN A;  5LBM A;  1AJ3 A;  3TLS A;  4NUV A;  2X0Y A;  2DWG A;  3VRB A;  4QH5 A;  3T1Y T;  2H88 A;  2VK9 A;  3CQG B;  3SRZ A;  2M6I A;  2ZLY A;  3E08 A;  1NEK A;  2EHO C;  4LFB T;  5FY7 A;  1MMG A;  1FMW A;  5LHG B;  3K3N A;  3AE1 A;  4QXB B;  2RPA A;  2LSG A;  4GK0 E;  4ERR A;  5AQG B;  4FI5 A;  2V5D A;  2WQY A;  2DWK A;  3L39 A;  3HI2 A;  2CLY B;  3PUV F;  5FY0 A;  4B6X A;  5FXX A;  1R8I A;  2JIW A;  5JDM A;  2VKJ A;  2XY8 B;  1KF6 A;  2XQ5 A;  2VWA A;  3ZT6 A;  2XQ8 A;  4XAX B;  3V5U A;  3O4X E;  2A2F X;  3AAA B;  5ABH A;  3ZSS A;  5F5W A;  4DR5 T;  5IUX A;  1I94 T;  2Y48 B;  3K8P C;  3I0O A;  2BZB A;  4DV5 T;  5FYM A;  2BG9 E;  4NUU A;  4O4J E;  1JNZ A;  2XQA A;  2UUB T;  1D1C A;  1XNQ T;  2OA5 A;  3PU3 A;  1YD8 G;  4E7Z A;  2E9X B;  3QB5 A;  2J47 A;  3ZN0 B;  2VQE T;  3AB3 B;  3MZK B;  5AQL B;  2XPK A;  2UXB T;  3GN5 B;  4X64 T;  4YY3 T;  1HF8 A;  2L8K A;  3OPC A;  2V5C A;  1HTJ F;  2YN6 A;  2D2S A;  1M62 A;  2YK0 A;  3I9W A;  3LK2 B;  3AEG A;  4DV1 T;  1M7K A;  1MIY A;  4IE0 A;  3QB5 K;  1MMN A;  2C5J A;  3ZLI A;  4E7S A;  3CX6 B;  4LF7 T;  5C3J A;  1D0Z A;  4AKI A;  3AE4 A;  3OJA A;  3SFD A;  4JI0 T;  5JDN A;  3ZT5 A;  4EV6 A;  1NAF A;  1YXR A;  2XM1 A;  1QLB A;  2JMK A;  1N36 T;  1WR6 A;  4O4I E;  3IA3 A;  3PUG A;  1YQ3 A;  3R84 B;  4HWC A;  5F3J A;  2YOE A;  2Q9Q B;  4LML A;  3GN5 A;  5LBQ B;  2CLY C;  5F8P A;  5HXC A;  4IDZ A;  5EK3 A;  1J5E T;  3H3M A;  3KFW X;  3AXJ B;  4QH1 A;  4X65 T;  1KEY A;  1KNZ A;  3MA9 A;  4TWH A;  4PFP A;  2QA7 A;  2LSJ A;  1UX5 A;  2R6G F;  1H7C A;  3UQ4 A;  4GOU A;  4EYY R;  3RLF F;  4PK4 A;  1DU2 A;  1ZHC A;  4ZI3 C;  1FJG T;  2E9X C;  3SFE A;  2BKO A;  3RRC A;  4O4L E;  5L3F B;  2MOZ A;  2VL8 A;  2XQ9 A;  3AEC A;  4YFS A;  3ZJ2 A;  4ZEY A;  3N9L A;  2XAH B;  5FMN A;  5FXZ A;  5IWA T;  5EK2 A;  4PNI A;  5CA1 E;  2LLY A;  4NXN T;  3RF1 A;  1HCI A;  2JQH A;  2YDS A;  2XUE A;  3ZEF B;  1I6Z A;  3RHW A;  4F8H A;  1YKH B;  5LHH B;  3RRW A;  4EXT A;  3LK4 2;  2WSS V;  3HL6 A;  2WU2 A;  4KHP T;  5LG3 A;  5A1L A;  4LFC T;  3HKC E;  3OYX A;  1Z8U A;  3IHR A;  4JBW F;  5H6Q B;  3N9N A;  4TNW A;  4BAY B;  4P0B A;  4X20 E;  1FMV A;  4CZZ B;  3ANW B;  5JQG E;  5C2T A;  3B5M A;  1SHZ C;  2X9W A;  2WBL A;  2LOP A;  3K1S A;  1HNW T;  2CXD A;  2QRX A;  1UK5 A;  2Q9Q C;  3AAE B;  3NZP A;  1W0B A;  3NVO A;  5J0Z A;  5LOV E;  2KT9 A;  2X0H A;  4DR2 T;  2A3D A;  4HFB A;  4LF5 T;  4H9P C;  2DCF A;  2I59 A;  3P7I A;  4CN4 A;  4DUZ T;  2CCQ A;  5HXS A;  4UV9 B; 
#chains in the Genus database with same CATH homology
 4JI2 T;  1HR0 T;  2UUA T;  5IWA T;  4X62 T;  1N33 T;  4GKK T;  4NXN T;  4JI0 T;  4GKJ T;  4DV6 T;  4AQY T;  5BR8 T;  4JYA T;  2UXD T;  4YHH T;  2F4V T;  5LMU T;  4JI1 T;  4LF9 T;  4NXM T;  4K0K T;  4JI8 T;  1N36 T;  4LF4 T;  1IBL T;  4DR5 T;  1I94 T;  4KHP T;  4DV2 T;  3OTO T;  1HNZ T;  4DR7 T;  4X66 T;  1XMO T;  4DV4 T;  1IBK T;  4LFC T;  4DV5 T;  5LMN T;  1N34 T;  4LF8 T;  2ZM6 T;  2UUB T;  4DR6 T;  1J5E T;  1XNR T;  1XNQ T;  2UXC T;  4JI7 T;  2UU9 T;  1IBM T;  4B3M T;  4LF6 T;  4B3R T;  4OX9 T;  4DR1 T;  4X65 T;  2VQE T;  1HNX T;  4JI3 T;  4DV0 T;  2UXB T;  4X64 T;  4B3T T;  4YY3 T;  1HNW T;  3T1Y T;  2VQF T;  4JI6 T;  4JV5 T;  4JI5 T;  2UUC T;  4DUY T;  2HHH T;  4DV1 T;  1FJG T;  4LFB T;  1N32 T;  4B3S T;  1XMQ T;  4DR2 T;  4DR3 T;  3T1H T;  4DV7 T;  4LF5 T;  4DR4 T;  4LF7 T;  2E5L T;  4JI4 T;  4DUZ T;  4DV3 T;  4LFA T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...