4YY3T

30s ribosomal subunit- higb complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
molecule tags Ribosome
source organism Proteus vulgaris
publication title mRNA bound to the 30S subunit is a HigB toxin substrate.
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4yy3T00
4X62T 1HNZT 4LF4T 4LF9T 1N34T 4DR2T 5IWAT 4DR3T 4DR4T 4DR7T 4NXNT 1N33T 4JI2T 4JI7T 3T1YT 4LF6T 4DV2T 4B3RT 4B3MT 1XMQT 4X64T 2UXCT 4JI0T 4X66T 5LMNT 4B3ST 4K0KT 4YY3T 4LFAT 2UXDT 1HR0T 4DUZT 2ZM6T 4JI8T 3T1HT 1XNRT 4DR1T 4DUYT 4AQYT 4B3TT 4NXMT 5BR8T 4JI3T 2VQET 4GKKT 2HHHT 4DR5T 2UUCT 4LF8T 4DR6T 4LF5T 1IBLT 1IBMT 1IBKT 1FJGT 4LFBT 2VQFT 1N36T 4DV0T 2UXBT 4KHPT 2UU9T 3OTOT 4DV1T 2UUAT 4YHHT 4DV3T 4JI1T 2E5LT 4OX9T 4JV5T 4JYAT 1XNQT 2F4VT 1XMOT 1HNXT 2UUBT 4LFCT 4LF7T 1J5ET 4JI6T 4DV7T 1N32T 1I94T 4JI5T 1HNWT 4DV4T 4GKJT 4DV6T 4X65T 5LMUT 4JI4T 4DV5T
chains in the Genus database with same CATH superfamily
2CBIA 4YTMA 3AE7A 5JDLA 2W0GA 4U33A 5AQHB 1YW0A 1WYCA 4HWDA 5HXEA 4B6XA 5JDHA 3Q5EA 2XTLA 4TNWA 1W0BA 3RIUA 1WCRA 2LRLA 2W4XA 2FJAA 5ABGA 1UK5A 2WWVA 4AKRB 2JQ9A 2LSIA 2M67A 5EZYE 3PE0A 2BG9B 3LK3B 5DQVA 4HTEA 1MMGA 1OXZA 3ZT7A 4TV8E 3F31A 3AE1A 3WAKA 1H7CA 2I6HA 4H9SE 1KNRA 2CXFA 4YT0A 2RA1A 4HFHA 5AQFB 3VKHA 2J1DG 2WU2A 3ETVA 4IDQA 5JRCA 3P50A 4EAHA 2X51A 3UQ4A 4IT4A 3KFWX 5HCMA 5JDNA 1LRZA 1MNDA 4EGWA 3T1YT 2H3RA 3FBZA 2CM0A 3VKGA 1L0VA 3FXEB 4X5TA 2BBHA 2AXDS 2DLRA 4Z90A 4WNKA 3ANWB 4IL4A 2ACZA 4QH4A 4U2ZA 2KWIB 4FJOA 2JPFA 3AA1B 3FZFB 4UF0A 3TLUA 3C64A 4UV9B 1T72A 3WI3A 3ZT6A 5BMVE 3F2EA 2C5KT 4X1IE 3V5UA 3W15B 5H6QB 1X79A 1FMWA 2NWBA 4P1NA 2N2NA 2VASA 3ABVA 2WZHA 1UX5A 5AQNB 2FBWA 2KXPB 5IYZE 3PUXF 1WRDA 2BVMA 4QHOA 4B3ST 3MA9A 3EAMA 3IEEA 1M7KA 2BKPA 4QX7B 5LBMA 2R6GF 1W09A 2Q9QA 3GN5B 2FUPA 4IDZA 1J5WA 2MPKA 2UXXB 4WYVA 3RIAA 1IJ5A 3MJXA 2VKHA 4H9QC 1YD8G 4DO0A 4J2CA 1MMDA 2J4GA 2XAGB 1QLBA 3CQXC 1IZNB 2QYWA 4DR1T 3C4XA 1KF6A 3RIUC 3PUAA 3Q9DA 4ZOLE 3C4ZA 3ZC1A 4JI3T 5C3JA 5IUXA 1FMVA 2HHHT 4Z8XA 2UUCT 4LF8T 4DR6T 1XDPA 3OKQA 3P4RA 3UQ7A 2XQ6A 1VRBA 2XASB 3GWHA 3T8OA 5E0OA 4A5XA 4CI2B 5JR9C 4LF5T 2VVSA 5L3EB 1MMAA 2PBIA 5C2TA 1I6ZA 5LGTB 4U3CA 2L3LA 4HWCA 1D0XA 4DV0T 1MIWA 2V6YA 5L3BB 3KVAA 2NW7A 4QKNA 4PFPA 5J1GA 4KHPT 2Z6EA 4PJMA 2IUBA 1J1JA 1U5PA 3AEGA 4L5GA 2LM9A 3CX8B 1XWMA 4BA9A 3UU6A 4TX5A 5JDGA 4YSXA 4YLHA 2H89A 2KT9A 3EABA 4ZXLA 3U78A 3QC9A 4QXHB 3ZLIA 2NW9A 5HEHA 3ZN0B 4DVDA 4AKHA 1MMNA 2B1EA 2W00A 3JCFA 2XAQB 2XPKA 2D5UA 5L4HA 4E7SA 1HG5A 3CKDA 2EHOC 2MAWA 2V7JA 4V1Av 4YTPA 3OJAA 4AQFC 4YHJA 5HXHA 1W9RA 2MOZA 5DQWA 3ZPOA 2WS3A 2LKGA 2QRXA 2XQ7A 2KSRA 4JEUB 2IHR1 3TLVA 4I4TE 2XAHB 2E5LT 2IMLA 3AXJB 3OBVE 3N9MA 3SWHA 4IGUA 3K3OA 3RC3A 1Y64B 4JYAT 2KZ7B 5L4EA 5HEOA 4UIGA 5JVDE 2KWHA 5LG4A 2WWUA 2JJ9A 3CQCB 4ILAA 4UXNB 4Q25A 1HNXT 2UUBT 5FL0A 2XQ5A 4DBRA 4KP3C 2OA5A 2CXDA 1J5ET 4XBFB 3ZYKA 2BZBA 3C4WA 2JQHA 5CJ5A 2J62A 4DV7T 2CHOA 3ZC0A 3A8YC 2IC6A 3FZKB 3PUYF 1YXRA 4PNIA 2WMNA 4JI5T 5A1LA 3EDUA 3M65A 2WDRA 3BK9A 2LSKA 5LOVE 5L3CB 5FYMA 1ZV4X 5C8YE 4H9NC 4X65T 4ILBA 4KUMB 3A7MA 3VU7H 5LMUT 1YKHB 4CI1B 5FXZA 2P9BA 3JADA 4I50E 4PJNA 3PDYA 4C91A 4ZI7E 3AAIA 3LK2B 4EYUA 4OYKA 4MFRA 5TAOA 4DV5T 2RP4A 2LHNA 4PJJA 4IIJE 3UFGA 1D0YA 2XHEB 2X0LB 1YQ4A 2L9QA 3C51A 3IHRA 5AQSB 1ZOYA 2E8IA 4PJLA 4ZS2A 3O1IA 3TKLB 3RQWA 2LLYA 1E1HB 4ZEYA 2A9UA 2LOPA 2DL1A 3S4UA 2A2FX 3UT5E 5HWXA 5KX5E 2WB5A 2XQYA 1M62A 3RF1A 4BJNA 3K3QC 2CMRA 4DR4T 4O4HE 3J9X1 2Q9QB 3N2GE 4KMCA 2DI4A 4MHCA 1HX1B 3EVYA 2CHNA 3M3ZB 1V9DA 3ZMTB 1MNEA 5LHIB 4LF6T 1Y01A 4U31A 4TV9E 5LYJE 4U7YA 5ABEA 3PUZF 3RYCE 1MIVA 1WR0A 3N9NA 4IE7A 3ZYMA 1Z0PA 2CLYC 2VL0A 2XAJB 3Q2MA 4HFCA 2PG8A 3JAEA 4U72A 4AISA 2XSBA 5LGUB 2CRBA 2K9AA 3O1HA 3LJCA 2XM2A 4X64T 4MLKA 1D1BA 3CIRA 4WZXA 3J7Yq 2HH7A 3AEBA 4TN7B 4Z91A 1E2AA 1JNZA 3E0ZA 4GYSA 4O2BE 3CPZA 4IE4A 3AAAB 3AE4A 2JMKA 4CXWA 4DNDA 4EV6A 3SRZA 3OPCA 3KVBA 4OHFA 4WBNE 1HR0T 3V5SA 3ZJ2A 3RKGA 4H63V 2VURA 5HEUA 1OEDC 3N9OA 2DCFA 2EHOB 1QSDA 4O4JE 2CWOA 5AQGB 2V7IA 5LG3A 5FY7A 1FEWA 5HEJA 1OEDE 5LGNB 2W66A 3AE2A 4DUYT 3DTOA 4PK4A 5AQRB 2JMHA 2K3WA 3QNUA 2XQ3A 4GK0E 2XZEA 1B7TA 1R8IA 3AE9A 3UTKA 3UU3A 2VQET 5AQMB 5LBQB 2FJBA 4ANJA 4DR5T 1U4QA 1NEKA 1O3XA 2NP9A 2UXNB 2FJEA 4LMKA 3RLFF 3MACA 1FJGT 3ZSTA 2LSJA 5HXCA 3ZMSB 3JAFA 3MK7C 2VQFT 2UXBT 2DWGA 3RPUA 1VOMA 3JC6C 2LT3A 4K0UA 5FP3A 5JDMA 3PUGA 4I43B 2K24A 3IBPA 3ZCIA 4C90A 2XM1A 3EUHA 1XZYA 3AEEA 3QB5A 4XZCA 3KDSE 3DJBA 3OTOT 2WAUA 1BR2A 3ZMVB 5LHHB 1US7B 2NTYA 3N2KE 2UUAT 1S94A 2VVNA 3LSVA 1S35A 3CK6A 4EZ4A 5ABFA 5DABA 5KMGP 3UFEA 2NR4A 2V5DA 4HFDA 2XQAA 4WBOA 2W2UA 4JI1T 4UVCB 2Y48B 4OK0A 3AVRA 3BQIA 3HA4A 5LB7B 2WP9A 2CWYA 3KINB 2KNDA 3L39A 2L8KA 2WDVA 2YINA 3GMIA 1XNQT 2CE7A 1XMOT 4CXYA 4ASKA 3KV9A 2E9XC 3MXZA 4LFCT 1XDOA 1D0ZA 4YJ2E 1UURA 3N9QA 2VK9A 5AQVB 4ERRA 2ZLYA 2Y8DA 4JI6T 5EK4A 2ZMAA 4P0AA 2CBJA 3P4PA 2X9WA 2VKDA 4COFA 2XUEA 4QH1A 1I94T 2NW8A 5AQTB 2QVAA 1WR6A 2CLYB 4WW0A 1ZHCA 1YKEB 4IE5A 3SS1A 1HNWT 3AXJA 2LRKA 3UU4A 1AJ3A 5JQGE 5HXSA 5AQOB 2WZIA 3DP7A 1HFAA 2XAFB 3AAEB 3E22E 3EDVA 4P0BA 1HG2A 1BR1A 3X1DA 2WSSV 2BKNA 3SOLA 5ETWA 5HXRA 2JIWA 3AECA 3IA3A 4AI6A 2VKJA 1HTJF 2E9XA 4YSYA 2A3DA 3AEFA 3WAJA 2H7OA 4H9PC 3AA7B 2D0TA 5J2TE 1HS7A 3ZJ1A 1UCUA 4ILCA 3L3PA 3LFMA 4HFEA 4UEMA 2LJLA 5JREA 1UX4A 4IDOA 4DR7T 1BR4A 1Z8UA 2V8SV 2GK9A 3VHLA 2LM2A 1N33T 1OWAA 4NUUA 2YKSA 4M1PA 4JI2T 4HFVA 4ZHQE 5KDMC 2H7VC 1D1AA 4KI0F 3D0TA 2C0SA 3I1AA 3RKOA 4ILUA 3UU5A 2HN2A 3ZT5A 4KBMB 4ZI3D 3C98B 4YXDA 4QXBB 3FHNA 2V7MA 3TLTA 2IDOB 4JI8T 4B3MT 1XMQT 1NAFA 2I0MA 3LBXB 4JBWF 2W61A 4HN9A 4TWHA 2EHOA 3HI2A 3AE6A 2WBLA 3P4SA 4ISTA 4BAYB 4H9OC 3Q5XA 4UVBB 4CN6A 2BDEA 4O4IE 2UXCT 4JI0T 2HPLA 4HGAA 3O9XA 3AB3B 3RYHE 3HKBE 1LKXA 2WM9A 3QOFA 3NRYA 4O2AE 3HKDE 3AE5A 3HL6A 4QXCB 3FXDB 1LVKA 3EI0A 3GN5A 3ZYLA 4I0UA 3UULA 5JDQA 2X9HA 4ZS3A 2BBJA 4HFIA 4DUZT 2MTQA 3O1JA 4U74A 4GYRA 3L8RA 2K5BB 3AEAA 4KHZF 1CUNA 3T1HT 1XNRT 3ZKRA 2QA7A 5AQQB 2WMOA 3LK42 3AE8A 3UUMA 4TUYE 1MIYA 4HEAA 3RRWA 1KK7A 4U2YA 4B3TT 2ZM2A 4NXMT 4BJMA 2LSYA 5BR8T 2N9DA 4UF0B 5JR9B 4GKKT 4YSZA 4DMWA 3PUSA 1JNRA 1KNPA 2CEAA 2E9XB 3AVSA 2NTXA 4MBQA 4QH5A 5CGMA 1IBMT 4LFBT 3NKZA 3MZKB 5FMNA 3HKEE 1LVFA 4PFOA 5LHGB 5JRCB 1N36T 4L9IA 4OYJA 3PUWF 4ZI2C 4F6RC 3OVUA 4G63A 4I55E 5AQLB 3NVOA 3VR8A 2D9DA 3H3MA 1SUMB 4CN1A 1BR0A 2DWKA 5FXVA 3SFEA 2J47A 3CVRA 5LA6E 2PTFA 3N9PA 5HCJA 3B57A 4DBQA 2UU9T 4NUVA 4E7ZA 2WCAA 3ZMUB 4K0KT 4LMLA 2XQ4A 1HX8A 4EEDA 3OYXA 3H37A 2HN1A 4HFBA 4FI5A 4EYYR 4YHHT 4TWDA 2XQ8A 3QUJA 4GOUA 4DV3T 2ODVA 2W67A 4X1KE 1ZP0A 4EXTA 5CFBA 4HE8A 2WY2A 2VL8A 4YJ3E 2SPCA 4NIQA 3B13A 5HEGA 1N34T 4O8SA 2M6IA 3UUBA 2V5CA 2KINB 4ZZBA 4JEHB 4JUYA 2Y6XA 2X9XA 4F8HA 5M4YA 3G06A 2Q9QD 5HYAA 3K3NA 4NPPA 4EOZB 2LKHA 3N5LA 2VKOA 4GIWA 4CI3B 4CN4A 5ABFB 2W62A 2XSAA 4HKAA 1X9BA 1KNZA 1T8BA 4UELA 3QB5K 1NWMX 2YDSA 4X1YE 1N32T 4P09A 5L2LA 3KV5A 3GA8A 1HF8A 3EHZA 3Q5DA 3RHWA 4L0RA 4UV8B 2V7LA 5FY1A 2E2AA 2ES0A 2K48A 3KV4A 1SA0E 2BG9C 2EHOD 3IF8B 5LP6E 3H3AA 2VB6A 4DV6T 2G0UA 2YU2A 1WYBA 2BG9A 3HR0A 4AQGA 1KEYA 1GQEA 5DJQC 3F57A 2LE8A 5FXWA 4GK5E 3JC6D 2YN6A 2YOEA 5LJNA 2XJ7A 5FKYA 5CA0E 4UVAB 2PJQA 3P7IA 3PU8A 4TNVA 2LSGA 1DU2A 4X62T 4QX8B 5JDFA 5F3JA 1HNZT 4LF9T 4DR2T 2WDQA 2NOXA 5IWAT 4IDPA 5LNKA 5H6RB 3BQKA 3PU3A 3ZMZB 4AXPA 4DR3T 3RH3A 3AEDA 2BS3A 4NXNT 4IE0A 2LOSA 3B5MA 3CX7B 5FNVE 2IW5B 3TLWA 5L3GB 4JI7T 1CHUA 3NBXX 5AQPB 3N2OA 1IJ6A 3AA0B 4PW8A 1QUUA 3U3IA 2BS4A 1VCSA 3PJAA 4IREA 3NWIA 4EIWA 3LBXA 5LCYA 3ZN1B 4DV2T 4CZZB 4B3RT 3NZQA 4IHJE 4A56A 4HWIB 1T7SA 4PK6A 1WLXA 2CXLA 2E9XD 2X0HA 2YEVC 3UU8A 3ZSSA 4DMVA 5CA1E 3I9WA 3UUXB 2DHRA 2WQYA 3LDQB 3FB2A 2OV9A 3VRBA 1OEDA 5J0ZA 1KFYA 4TWFA 4X66T 4PAGA 4EB6E 4ZZCA 2IC9A 5LMNT 3AE3A 3K8PC 5JTGA 4AQFA 2X0YA 1E7PA 2HPJA 3QK6A 5FXXA 5JR9A 5F8PA 1T98A 2JQKA 4IDNA 4YY3T 4TZ4C 3N9LA 4LFAT 2UXDT 1ZEEA 5KXJA 3FZHB 4EEBA 3RI5A 4IE6A 2ZM6T 2LHRA 2V26A 1G73A 4EZHA 3KBUA 2YU1A 2JQQA 2ZM0A 3C50A 3CQGB 2D0UA 3L09A 3OYZA 2MYSA 3I9YA 3AA6B 4YFSA 3PURA 2V6YB 2D2SA 3ETUA 3P4WA 2C5JA 3ESLA 4ZI2D 5L3DB 3R84B 1OEDB 2X67A 5JH7E 1WFDA 4AQYT 2XY8B 5IHYA 3R6NA 4HWHA 2YDRA 2VWAA 3RYIE 3SFDA 2I59A 2IIUA 3ONXA 3VR9A 5L3FB 2FJDA 2X9YA 2M6BA 3P8CD 3PV0F 2YK0A 3RX6A 3Q5WA 2V1DB 1IBLT 3ONLC 1IBKT 5GONE 2WU5A 3CWZB 3FBLA 2CA5A 3UUNA 5AQIB 4PK5A 2AE9A 5FL1A 3P4QA 3PUVF 5ABHA 2B76A 2V7KA 4ADZA 4CQIA 4O4LE 4H9RC 4XAXB 1HCIA 5FVLA 5FY0A 1NENA 3VRAA 2JRKA 2LEHA 3O4XE 5J2UE 4AKIA 2ZM8A 3ZEFB 4DV1T 3I0QA 4KX6A 1FIOA 4IL9A 4LF4T 3RC8A 2Q9QC 1SE7A 2BVLA 2IAKA 1EZ3A 4OFZA 1VCTA 1YQ3A 2ACXA 3NRXA 5EK3A 4MALA 2C5IT 4LMJA 5CB4E 2BS2A 3ONJA 5FVKA 2KLQA 2YDQA 3I0OA 3PJAJ 4AIUA 3ANWA 4CXXA 4QWNB 2E5VA 4X20E 5AFUL 5LXTE 4OX9T 4JV5T 4ZI3C 2XQ9A 3FZMB 5HWYA 5F5WA 3FZLB 4ISSA 4YTNA 4U7IA 4AKGA 3E08A 5L47A 2F4VT 2X66A 3HKCE 2KMFA 5HAXA 3RGLA 1D1CA 4H63H 3RQUA 4LF7T 4HWFA 1SHZC 3CMLA 3RYFE 2DNXA 3MKDA 3PUQA 3K1SA 4N78D 1G8XA 2BG9E 5ADXL 2X68A 1UGOA 2RPAA 5AQJB 5AQUB 2PFVA 5AQKB 3A5XA 3KV6A 5LJMA 5EK2A 1ZKEA 4DV4T 2N1GA 3ZCJA 4JLEA 3BQLA 4GKJT 4DIDB 1UUSA 2ODUA 2V6XA 4AKLA 2MBGA 4A98A 3TLSA 2W63A 2A72A 2H88A 2BKOA 3CX6B 2CCQA 3KBTA 2CPTA 3LG7A 2OLTA 3NZPA 3PTRB 4G2AA 3RRCA 1W0AA 1IAPA 4UR9A 4JI4T 3RIFA 4A97A 2QGSA
chains in the Genus database with same CATH topology
4X62T 1HNZT 4LF4T 4LF9T 1N34T 4DR2T 5IWAT 4DR3T 4DR4T 4DR7T 4NXNT 1N33T 4JI2T 4JI7T 3T1YT 4LF6T 4DV2T 4B3RT 4B3MT 1XMQT 4X64T 2UXCT 4JI0T 4X66T 5LMNT 4B3ST 4K0KT 4YY3T 4LFAT 2UXDT 1HR0T 4DUZT 2ZM6T 4JI8T 3T1HT 1XNRT 4DR1T 4DUYT 4AQYT 4B3TT 4NXMT 5BR8T 4JI3T 2VQET 4GKKT 2HHHT 4DR5T 2UUCT 4LF8T 4DR6T 4LF5T 1IBLT 1IBMT 1IBKT 1FJGT 4LFBT 2VQFT 1N36T 4DV0T 2UXBT 4KHPT 2UU9T 3OTOT 4DV1T 2UUAT 4YHHT 4DV3T 4JI1T 2E5LT 4OX9T 4JV5T 4JYAT 1XNQT 2F4VT 1XMOT 1HNXT 2UUBT 4LFCT 4LF7T 1J5ET 4JI6T 4DV7T 1N32T 1I94T 4JI5T 1HNWT 4DV4T 4GKJT 4DV6T 4X65T 5LMUT 4JI4T 4DV5T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X62 T;  1HNZ T;  4LF4 T;  4LF9 T;  1N34 T;  4DR2 T;  5IWA T;  4DR3 T;  4DR4 T;  4DR7 T;  4NXN T;  1N33 T;  4JI2 T;  4JI7 T;  3T1Y T;  4LF6 T;  4DV2 T;  4B3R T;  4B3M T;  1XMQ T;  4X64 T;  2UXC T;  4JI0 T;  4X66 T;  5LMN T;  4B3S T;  4K0K T;  4YY3 T;  4LFA T;  2UXD T;  1HR0 T;  4DUZ T;  2ZM6 T;  4JI8 T;  3T1H T;  1XNR T;  4DR1 T;  4DUY T;  4AQY T;  4B3T T;  4NXM T;  5BR8 T;  4JI3 T;  2VQE T;  4GKK T;  2HHH T;  4DR5 T;  2UUC T;  4LF8 T;  4DR6 T;  4LF5 T;  1IBL T;  1IBM T;  1IBK T;  1FJG T;  4LFB T;  2VQF T;  1N36 T;  4DV0 T;  2UXB T;  4KHP T;  2UU9 T;  3OTO T;  4DV1 T;  2UUA T;  4YHH T;  4DV3 T;  4JI1 T;  2E5L T;  4OX9 T;  4JV5 T;  4JYA T;  1XNQ T;  2F4V T;  1XMO T;  1HNX T;  2UUB T;  4LFC T;  4LF7 T;  1J5E T;  4JI6 T;  4DV7 T;  1N32 T;  1I94 T;  4JI5 T;  1HNW T;  4DV4 T;  4GKJ T;  4DV6 T;  4X65 T;  5LMU T;  4JI4 T;  4DV5 T; 
#chains in the Genus database with same CATH topology
 2CBI A;  4YTM A;  3AE7 A;  5JDL A;  2W0G A;  4U33 A;  5AQH B;  1YW0 A;  1WYC A;  4HWD A;  5HXE A;  4B6X A;  5JDH A;  3Q5E A;  2XTL A;  4TNW A;  1W0B A;  3RIU A;  1WCR A;  2LRL A;  2W4X A;  2FJA A;  5ABG A;  1UK5 A;  2WWV A;  4AKR B;  2JQ9 A;  2LSI A;  2M67 A;  5EZY E;  3PE0 A;  2BG9 B;  3LK3 B;  5DQV A;  4HTE A;  1MMG A;  1OXZ A;  3ZT7 A;  4TV8 E;  3F31 A;  3AE1 A;  3WAK A;  1H7C A;  2I6H A;  4H9S E;  1KNR A;  2CXF A;  4YT0 A;  2RA1 A;  4HFH A;  5AQF B;  3VKH A;  2J1D G;  2WU2 A;  3ETV A;  4IDQ A;  5JRC A;  3P50 A;  4EAH A;  2X51 A;  3UQ4 A;  4IT4 A;  3KFW X;  5HCM A;  5JDN A;  1LRZ A;  1MND A;  4EGW A;  3T1Y T;  2H3R A;  3FBZ A;  2CM0 A;  3VKG A;  1L0V A;  3FXE B;  4X5T A;  2BBH A;  2AXD S;  2DLR A;  4Z90 A;  4WNK A;  3ANW B;  4IL4 A;  2ACZ A;  4QH4 A;  4U2Z A;  2KWI B;  4FJO A;  2JPF A;  3AA1 B;  3FZF B;  4UF0 A;  3TLU A;  3C64 A;  4UV9 B;  1T72 A;  3WI3 A;  3ZT6 A;  5BMV E;  3F2E A;  2C5K T;  4X1I E;  3V5U A;  3W15 B;  5H6Q B;  1X79 A;  1FMW A;  2NWB A;  4P1N A;  2N2N A;  2VAS A;  3ABV A;  2WZH A;  1UX5 A;  5AQN B;  2FBW A;  2KXP B;  5IYZ E;  3PUX F;  1WRD A;  2BVM A;  4QHO A;  4B3S T;  3MA9 A;  3EAM A;  3IEE A;  1M7K A;  2BKP A;  4QX7 B;  5LBM A;  2R6G F;  1W09 A;  2Q9Q A;  3GN5 B;  2FUP A;  4IDZ A;  1J5W A;  2MPK A;  2UXX B;  4WYV A;  3RIA A;  1IJ5 A;  3MJX A;  2VKH A;  4H9Q C;  1YD8 G;  4DO0 A;  4J2C A;  1MMD A;  2J4G A;  2XAG B;  1QLB A;  3CQX C;  1IZN B;  2QYW A;  4DR1 T;  3C4X A;  1KF6 A;  3RIU C;  3PUA A;  3Q9D A;  4ZOL E;  3C4Z A;  3ZC1 A;  4JI3 T;  5C3J A;  5IUX A;  1FMV A;  2HHH T;  4Z8X A;  2UUC T;  4LF8 T;  4DR6 T;  1XDP A;  3OKQ A;  3P4R A;  3UQ7 A;  2XQ6 A;  1VRB A;  2XAS B;  3GWH A;  3T8O A;  5E0O A;  4A5X A;  4CI2 B;  5JR9 C;  4LF5 T;  2VVS A;  5L3E B;  1MMA A;  2PBI A;  5C2T A;  1I6Z A;  5LGT B;  4U3C A;  2L3L A;  4HWC A;  1D0X A;  4DV0 T;  1MIW A;  2V6Y A;  5L3B B;  3KVA A;  2NW7 A;  4QKN A;  4PFP A;  5J1G A;  4KHP T;  2Z6E A;  4PJM A;  2IUB A;  1J1J A;  1U5P A;  3AEG A;  4L5G A;  2LM9 A;  3CX8 B;  1XWM A;  4BA9 A;  3UU6 A;  4TX5 A;  5JDG A;  4YSX A;  4YLH A;  2H89 A;  2KT9 A;  3EAB A;  4ZXL A;  3U78 A;  3QC9 A;  4QXH B;  3ZLI A;  2NW9 A;  5HEH A;  3ZN0 B;  4DVD A;  4AKH A;  1MMN A;  2B1E A;  2W00 A;  3JCF A;  2XAQ B;  2XPK A;  2D5U A;  5L4H A;  4E7S A;  1HG5 A;  3CKD A;  2EHO C;  2MAW A;  2V7J A;  4V1A v;  4YTP A;  3OJA A;  4AQF C;  4YHJ A;  5HXH A;  1W9R A;  2MOZ A;  5DQW A;  3ZPO A;  2WS3 A;  2LKG A;  2QRX A;  2XQ7 A;  2KSR A;  4JEU B;  2IHR 1;  3TLV A;  4I4T E;  2XAH B;  2E5L T;  2IML A;  3AXJ B;  3OBV E;  3N9M A;  3SWH A;  4IGU A;  3K3O A;  3RC3 A;  1Y64 B;  4JYA T;  2KZ7 B;  5L4E A;  5HEO A;  4UIG A;  5JVD E;  2KWH A;  5LG4 A;  2WWU A;  2JJ9 A;  3CQC B;  4ILA A;  4UXN B;  4Q25 A;  1HNX T;  2UUB T;  5FL0 A;  2XQ5 A;  4DBR A;  4KP3 C;  2OA5 A;  2CXD A;  1J5E T;  4XBF B;  3ZYK A;  2BZB A;  3C4W A;  2JQH A;  5CJ5 A;  2J62 A;  4DV7 T;  2CHO A;  3ZC0 A;  3A8Y C;  2IC6 A;  3FZK B;  3PUY F;  1YXR A;  4PNI A;  2WMN A;  4JI5 T;  5A1L A;  3EDU A;  3M65 A;  2WDR A;  3BK9 A;  2LSK A;  5LOV E;  5L3C B;  5FYM A;  1ZV4 X;  5C8Y E;  4H9N C;  4X65 T;  4ILB A;  4KUM B;  3A7M A;  3VU7 H;  5LMU T;  1YKH B;  4CI1 B;  5FXZ A;  2P9B A;  3JAD A;  4I50 E;  4PJN A;  3PDY A;  4C91 A;  4ZI7 E;  3AAI A;  3LK2 B;  4EYU A;  4OYK A;  4MFR A;  5TAO A;  4DV5 T;  2RP4 A;  2LHN A;  4PJJ A;  4IIJ E;  3UFG A;  1D0Y A;  2XHE B;  2X0L B;  1YQ4 A;  2L9Q A;  3C51 A;  3IHR A;  5AQS B;  1ZOY A;  2E8I A;  4PJL A;  4ZS2 A;  3O1I A;  3TKL B;  3RQW A;  2LLY A;  1E1H B;  4ZEY A;  2A9U A;  2LOP A;  2DL1 A;  3S4U A;  2A2F X;  3UT5 E;  5HWX A;  5KX5 E;  2WB5 A;  2XQY A;  1M62 A;  3RF1 A;  4BJN A;  3K3Q C;  2CMR A;  4DR4 T;  4O4H E;  3J9X 1;  2Q9Q B;  3N2G E;  4KMC A;  2DI4 A;  4MHC A;  1HX1 B;  3EVY A;  2CHN A;  3M3Z B;  1V9D A;  3ZMT B;  1MNE A;  5LHI B;  4LF6 T;  1Y01 A;  4U31 A;  4TV9 E;  5LYJ E;  4U7Y A;  5ABE A;  3PUZ F;  3RYC E;  1MIV A;  1WR0 A;  3N9N A;  4IE7 A;  3ZYM A;  1Z0P A;  2CLY C;  2VL0 A;  2XAJ B;  3Q2M A;  4HFC A;  2PG8 A;  3JAE A;  4U72 A;  4AIS A;  2XSB A;  5LGU B;  2CRB A;  2K9A A;  3O1H A;  3LJC A;  2XM2 A;  4X64 T;  4MLK A;  1D1B A;  3CIR A;  4WZX A;  3J7Y q;  2HH7 A;  3AEB A;  4TN7 B;  4Z91 A;  1E2A A;  1JNZ A;  3E0Z A;  4GYS A;  4O2B E;  3CPZ A;  4IE4 A;  3AAA B;  3AE4 A;  2JMK A;  4CXW A;  4DND A;  4EV6 A;  3SRZ A;  3OPC A;  3KVB A;  4OHF A;  4WBN E;  1HR0 T;  3V5S A;  3ZJ2 A;  3RKG A;  4H63 V;  2VUR A;  5HEU A;  1OED C;  3N9O A;  2DCF A;  2EHO B;  1QSD A;  4O4J E;  2CWO A;  5AQG B;  2V7I A;  5LG3 A;  5FY7 A;  1FEW A;  5HEJ A;  1OED E;  5LGN B;  2W66 A;  3AE2 A;  4DUY T;  3DTO A;  4PK4 A;  5AQR B;  2JMH A;  2K3W A;  3QNU A;  2XQ3 A;  4GK0 E;  2XZE A;  1B7T A;  1R8I A;  3AE9 A;  3UTK A;  3UU3 A;  2VQE T;  5AQM B;  5LBQ B;  2FJB A;  4ANJ A;  4DR5 T;  1U4Q A;  1NEK A;  1O3X A;  2NP9 A;  2UXN B;  2FJE A;  4LMK A;  3RLF F;  3MAC A;  1FJG T;  3ZST A;  2LSJ A;  5HXC A;  3ZMS B;  3JAF A;  3MK7 C;  2VQF T;  2UXB T;  2DWG A;  3RPU A;  1VOM A;  3JC6 C;  2LT3 A;  4K0U A;  5FP3 A;  5JDM A;  3PUG A;  4I43 B;  2K24 A;  3IBP A;  3ZCI A;  4C90 A;  2XM1 A;  3EUH A;  1XZY A;  3AEE A;  3QB5 A;  4XZC A;  3KDS E;  3DJB A;  3OTO T;  2WAU A;  1BR2 A;  3ZMV B;  5LHH B;  1US7 B;  2NTY A;  3N2K E;  2UUA T;  1S94 A;  2VVN A;  3LSV A;  1S35 A;  3CK6 A;  4EZ4 A;  5ABF A;  5DAB A;  5KMG P;  3UFE A;  2NR4 A;  2V5D A;  4HFD A;  2XQA A;  4WBO A;  2W2U A;  4JI1 T;  4UVC B;  2Y48 B;  4OK0 A;  3AVR A;  3BQI A;  3HA4 A;  5LB7 B;  2WP9 A;  2CWY A;  3KIN B;  2KND A;  3L39 A;  2L8K A;  2WDV A;  2YIN A;  3GMI A;  1XNQ T;  2CE7 A;  1XMO T;  4CXY A;  4ASK A;  3KV9 A;  2E9X C;  3MXZ A;  4LFC T;  1XDO A;  1D0Z A;  4YJ2 E;  1UUR A;  3N9Q A;  2VK9 A;  5AQV B;  4ERR A;  2ZLY A;  2Y8D A;  4JI6 T;  5EK4 A;  2ZMA A;  4P0A A;  2CBJ A;  3P4P A;  2X9W A;  2VKD A;  4COF A;  2XUE A;  4QH1 A;  1I94 T;  2NW8 A;  5AQT B;  2QVA A;  1WR6 A;  2CLY B;  4WW0 A;  1ZHC A;  1YKE B;  4IE5 A;  3SS1 A;  1HNW T;  3AXJ A;  2LRK A;  3UU4 A;  1AJ3 A;  5JQG E;  5HXS A;  5AQO B;  2WZI A;  3DP7 A;  1HFA A;  2XAF B;  3AAE B;  3E22 E;  3EDV A;  4P0B A;  1HG2 A;  1BR1 A;  3X1D A;  2WSS V;  2BKN A;  3SOL A;  5ETW A;  5HXR A;  2JIW A;  3AEC A;  3IA3 A;  4AI6 A;  2VKJ A;  1HTJ F;  2E9X A;  4YSY A;  2A3D A;  3AEF A;  3WAJ A;  2H7O A;  4H9P C;  3AA7 B;  2D0T A;  5J2T E;  1HS7 A;  3ZJ1 A;  1UCU A;  4ILC A;  3L3P A;  3LFM A;  4HFE A;  4UEM A;  2LJL A;  5JRE A;  1UX4 A;  4IDO A;  4DR7 T;  1BR4 A;  1Z8U A;  2V8S V;  2GK9 A;  3VHL A;  2LM2 A;  1N33 T;  1OWA A;  4NUU A;  2YKS A;  4M1P A;  4JI2 T;  4HFV A;  4ZHQ E;  5KDM C;  2H7V C;  1D1A A;  4KI0 F;  3D0T A;  2C0S A;  3I1A A;  3RKO A;  4ILU A;  3UU5 A;  2HN2 A;  3ZT5 A;  4KBM B;  4ZI3 D;  3C98 B;  4YXD A;  4QXB B;  3FHN A;  2V7M A;  3TLT A;  2IDO B;  4JI8 T;  4B3M T;  1XMQ T;  1NAF A;  2I0M A;  3LBX B;  4JBW F;  2W61 A;  4HN9 A;  4TWH A;  2EHO A;  3HI2 A;  3AE6 A;  2WBL A;  3P4S A;  4IST A;  4BAY B;  4H9O C;  3Q5X A;  4UVB B;  4CN6 A;  2BDE A;  4O4I E;  2UXC T;  4JI0 T;  2HPL A;  4HGA A;  3O9X A;  3AB3 B;  3RYH E;  3HKB E;  1LKX A;  2WM9 A;  3QOF A;  3NRY A;  4O2A E;  3HKD E;  3AE5 A;  3HL6 A;  4QXC B;  3FXD B;  1LVK A;  3EI0 A;  3GN5 A;  3ZYL A;  4I0U A;  3UUL A;  5JDQ A;  2X9H A;  4ZS3 A;  2BBJ A;  4HFI A;  4DUZ T;  2MTQ A;  3O1J A;  4U74 A;  4GYR A;  3L8R A;  2K5B B;  3AEA A;  4KHZ F;  1CUN A;  3T1H T;  1XNR T;  3ZKR A;  2QA7 A;  5AQQ B;  2WMO A;  3LK4 2;  3AE8 A;  3UUM A;  4TUY E;  1MIY A;  4HEA A;  3RRW A;  1KK7 A;  4U2Y A;  4B3T T;  2ZM2 A;  4NXM T;  4BJM A;  2LSY A;  5BR8 T;  2N9D A;  4UF0 B;  5JR9 B;  4GKK T;  4YSZ A;  4DMW A;  3PUS A;  1JNR A;  1KNP A;  2CEA A;  2E9X B;  3AVS A;  2NTX A;  4MBQ A;  4QH5 A;  5CGM A;  1IBM T;  4LFB T;  3NKZ A;  3MZK B;  5FMN A;  3HKE E;  1LVF A;  4PFO A;  5LHG B;  5JRC B;  1N36 T;  4L9I A;  4OYJ A;  3PUW F;  4ZI2 C;  4F6R C;  3OVU A;  4G63 A;  4I55 E;  5AQL B;  3NVO A;  3VR8 A;  2D9D A;  3H3M A;  1SUM B;  4CN1 A;  1BR0 A;  2DWK A;  5FXV A;  3SFE A;  2J47 A;  3CVR A;  5LA6 E;  2PTF A;  3N9P A;  5HCJ A;  3B57 A;  4DBQ A;  2UU9 T;  4NUV A;  4E7Z A;  2WCA A;  3ZMU B;  4K0K T;  4LML A;  2XQ4 A;  1HX8 A;  4EED A;  3OYX A;  3H37 A;  2HN1 A;  4HFB A;  4FI5 A;  4EYY R;  4YHH T;  4TWD A;  2XQ8 A;  3QUJ A;  4GOU A;  4DV3 T;  2ODV A;  2W67 A;  4X1K E;  1ZP0 A;  4EXT A;  5CFB A;  4HE8 A;  2WY2 A;  2VL8 A;  4YJ3 E;  2SPC A;  4NIQ A;  3B13 A;  5HEG A;  1N34 T;  4O8S A;  2M6I A;  3UUB A;  2V5C A;  2KIN B;  4ZZB A;  4JEH B;  4JUY A;  2Y6X A;  2X9X A;  4F8H A;  5M4Y A;  3G06 A;  2Q9Q D;  5HYA A;  3K3N A;  4NPP A;  4EOZ B;  2LKH A;  3N5L A;  2VKO A;  4GIW A;  4CI3 B;  4CN4 A;  5ABF B;  2W62 A;  2XSA A;  4HKA A;  1X9B A;  1KNZ A;  1T8B A;  4UEL A;  3QB5 K;  1NWM X;  2YDS A;  4X1Y E;  1N32 T;  4P09 A;  5L2L A;  3KV5 A;  3GA8 A;  1HF8 A;  3EHZ A;  3Q5D A;  3RHW A;  4L0R A;  4UV8 B;  2V7L A;  5FY1 A;  2E2A A;  2ES0 A;  2K48 A;  3KV4 A;  1SA0 E;  2BG9 C;  2EHO D;  3IF8 B;  5LP6 E;  3H3A A;  2VB6 A;  4DV6 T;  2G0U A;  2YU2 A;  1WYB A;  2BG9 A;  3HR0 A;  4AQG A;  1KEY A;  1GQE A;  5DJQ C;  3F57 A;  2LE8 A;  5FXW A;  4GK5 E;  3JC6 D;  2YN6 A;  2YOE A;  5LJN A;  2XJ7 A;  5FKY A;  5CA0 E;  4UVA B;  2PJQ A;  3P7I A;  3PU8 A;  4TNV A;  2LSG A;  1DU2 A;  4X62 T;  4QX8 B;  5JDF A;  5F3J A;  1HNZ T;  4LF9 T;  4DR2 T;  2WDQ A;  2NOX A;  5IWA T;  4IDP A;  5LNK A;  5H6R B;  3BQK A;  3PU3 A;  3ZMZ B;  4AXP A;  4DR3 T;  3RH3 A;  3AED A;  2BS3 A;  4NXN T;  4IE0 A;  2LOS A;  3B5M A;  3CX7 B;  5FNV E;  2IW5 B;  3TLW A;  5L3G B;  4JI7 T;  1CHU A;  3NBX X;  5AQP B;  3N2O A;  1IJ6 A;  3AA0 B;  4PW8 A;  1QUU A;  3U3I A;  2BS4 A;  1VCS A;  3PJA A;  4IRE A;  3NWI A;  4EIW A;  3LBX A;  5LCY A;  3ZN1 B;  4DV2 T;  4CZZ B;  4B3R T;  3NZQ A;  4IHJ E;  4A56 A;  4HWI B;  1T7S A;  4PK6 A;  1WLX A;  2CXL A;  2E9X D;  2X0H A;  2YEV C;  3UU8 A;  3ZSS A;  4DMV A;  5CA1 E;  3I9W A;  3UUX B;  2DHR A;  2WQY A;  3LDQ B;  3FB2 A;  2OV9 A;  3VRB A;  1OED A;  5J0Z A;  1KFY A;  4TWF A;  4X66 T;  4PAG A;  4EB6 E;  4ZZC A;  2IC9 A;  5LMN T;  3AE3 A;  3K8P C;  5JTG A;  4AQF A;  2X0Y A;  1E7P A;  2HPJ A;  3QK6 A;  5FXX A;  5JR9 A;  5F8P A;  1T98 A;  2JQK A;  4IDN A;  4YY3 T;  4TZ4 C;  3N9L A;  4LFA T;  2UXD T;  1ZEE A;  5KXJ A;  3FZH B;  4EEB A;  3RI5 A;  4IE6 A;  2ZM6 T;  2LHR A;  2V26 A;  1G73 A;  4EZH A;  3KBU A;  2YU1 A;  2JQQ A;  2ZM0 A;  3C50 A;  3CQG B;  2D0U A;  3L09 A;  3OYZ A;  2MYS A;  3I9Y A;  3AA6 B;  4YFS A;  3PUR A;  2V6Y B;  2D2S A;  3ETU A;  3P4W A;  2C5J A;  3ESL A;  4ZI2 D;  5L3D B;  3R84 B;  1OED B;  2X67 A;  5JH7 E;  1WFD A;  4AQY T;  2XY8 B;  5IHY A;  3R6N A;  4HWH A;  2YDR A;  2VWA A;  3RYI E;  3SFD A;  2I59 A;  2IIU A;  3ONX A;  3VR9 A;  5L3F B;  2FJD A;  2X9Y A;  2M6B A;  3P8C D;  3PV0 F;  2YK0 A;  3RX6 A;  3Q5W A;  2V1D B;  1IBL T;  3ONL C;  1IBK T;  5GON E;  2WU5 A;  3CWZ B;  3FBL A;  2CA5 A;  3UUN A;  5AQI B;  4PK5 A;  2AE9 A;  5FL1 A;  3P4Q A;  3PUV F;  5ABH A;  2B76 A;  2V7K A;  4ADZ A;  4CQI A;  4O4L E;  4H9R C;  4XAX B;  1HCI A;  5FVL A;  5FY0 A;  1NEN A;  3VRA A;  2JRK A;  2LEH A;  3O4X E;  5J2U E;  4AKI A;  2ZM8 A;  3ZEF B;  4DV1 T;  3I0Q A;  4KX6 A;  1FIO A;  4IL9 A;  4LF4 T;  3RC8 A;  2Q9Q C;  1SE7 A;  2BVL A;  2IAK A;  1EZ3 A;  4OFZ A;  1VCT A;  1YQ3 A;  2ACX A;  3NRX A;  5EK3 A;  4MAL A;  2C5I T;  4LMJ A;  5CB4 E;  2BS2 A;  3ONJ A;  5FVK A;  2KLQ A;  2YDQ A;  3I0O A;  3PJA J;  4AIU A;  3ANW A;  4CXX A;  4QWN B;  2E5V A;  4X20 E;  5AFU L;  5LXT E;  4OX9 T;  4JV5 T;  4ZI3 C;  2XQ9 A;  3FZM B;  5HWY A;  5F5W A;  3FZL B;  4ISS A;  4YTN A;  4U7I A;  4AKG A;  3E08 A;  5L47 A;  2F4V T;  2X66 A;  3HKC E;  2KMF A;  5HAX A;  3RGL A;  1D1C A;  4H63 H;  3RQU A;  4LF7 T;  4HWF A;  1SHZ C;  3CML A;  3RYF E;  2DNX A;  3MKD A;  3PUQ A;  3K1S A;  4N78 D;  1G8X A;  2BG9 E;  5ADX L;  2X68 A;  1UGO A;  2RPA A;  5AQJ B;  5AQU B;  2PFV A;  5AQK B;  3A5X A;  3KV6 A;  5LJM A;  5EK2 A;  1ZKE A;  4DV4 T;  2N1G A;  3ZCJ A;  4JLE A;  3BQL A;  4GKJ T;  4DID B;  1UUS A;  2ODU A;  2V6X A;  4AKL A;  2MBG A;  4A98 A;  3TLS A;  2W63 A;  2A72 A;  2H88 A;  2BKO A;  3CX6 B;  2CCQ A;  3KBT A;  2CPT A;  3LG7 A;  2OLT A;  3NZP A;  3PTR B;  4G2A A;  3RRC A;  1W0A A;  1IAP A;  4UR9 A;  4JI4 T;  3RIF A;  4A97 A;  2QGS A; 
#chains in the Genus database with same CATH homology
 4X62 T;  1HNZ T;  4LF4 T;  4LF9 T;  1N34 T;  4DR2 T;  5IWA T;  4DR3 T;  4DR4 T;  4DR7 T;  4NXN T;  1N33 T;  4JI2 T;  4JI7 T;  3T1Y T;  4LF6 T;  4DV2 T;  4B3R T;  4B3M T;  1XMQ T;  4X64 T;  2UXC T;  4JI0 T;  4X66 T;  5LMN T;  4B3S T;  4K0K T;  4YY3 T;  4LFA T;  2UXD T;  1HR0 T;  4DUZ T;  2ZM6 T;  4JI8 T;  3T1H T;  1XNR T;  4DR1 T;  4DUY T;  4AQY T;  4B3T T;  4NXM T;  5BR8 T;  4JI3 T;  2VQE T;  4GKK T;  2HHH T;  4DR5 T;  2UUC T;  4LF8 T;  4DR6 T;  4LF5 T;  1IBL T;  1IBM T;  1IBK T;  1FJG T;  4LFB T;  2VQF T;  1N36 T;  4DV0 T;  2UXB T;  4KHP T;  2UU9 T;  3OTO T;  4DV1 T;  2UUA T;  4YHH T;  4DV3 T;  4JI1 T;  2E5L T;  4OX9 T;  4JV5 T;  4JYA T;  1XNQ T;  2F4V T;  1XMO T;  1HNX T;  2UUB T;  4LFC T;  4LF7 T;  1J5E T;  4JI6 T;  4DV7 T;  1N32 T;  1I94 T;  4JI5 T;  1HNW T;  4DV4 T;  4GKJ T;  4DV6 T;  4X65 T;  5LMU T;  4JI4 T;  4DV5 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...