3S4UA

Crystal structure of open, unliganded e. coli phnd h157a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
302
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGAETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 95
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3s4uA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA02
3T9UA 1VSOA 2PVUA 2REJA 4U4SA 5H8NB 3M3LA 3V89B 3FVNA 4IO6A 5K2YA 2XX8A 1TXFA 2XXIA 1T0KA 1M5EA 1S50A 3G3JA 3T66A 3C33A 4KHZE 1I6QA 2DXRA 1D4NA 2NXOA 3KEIA 2DWJA 3IORA 3MJNA 1B58A 3K4UA 3CIJA 1XT8A 1SVXB 3IJXB 4QFPA 2PYYA 4F3BA 4P11A 1WODA 3CG1A 1Y1MA 2DWHA 2E1SA 1ZKEA 2W7YA 3A3UA 3H3GA 1QUIA 3PUWE 4IY6A 4Z0IA 5CI5A 3KSXA 1LB9A 2YPNA 3N6UA 3RGYA 3TPAA 3MXZA 2BJJX 3TODA 1Q1KA 2HQ0A 3R6UA 3K6XA 5CMKA 1MPDA 1BTJA 1WDNA 3MZ1A 3FXDB 3L3PA 3O28A 3KGCA 1IXHA 1OVTA 3K6VA 3B6QA 1LRZA 1B1HA 1US5A 4MLQA 5LOMA 1TFDA 3T9HB 3CFXA 3Q25A 4GWOA 3RPWA 5AA4B 3MP6A 1B4HA 3CFLA 4Q30B 2V84A 3MZ9A 4RXLA 3A09A 1PEBA 3OD7A 3HCQA 1UIUA 2XXTA 2I58A 3IB0A 3ONMA 1NNPA 4R6YA 2QJEA 4BLAA 2OZZA 2UVGA 3CI8A 5B7DA 5ICTA 3CR9A 3PPQA 1EZ9A 4AQ4A 2UVHA 1H76A 1B3EA 3N26A 5I2KA 1H7CA 1B5IA 1IUDA 1LAXA 1R6ZA 3VE1B 4P0GA 3K6UA 3MQ9A 3PPOA 3V8XB 4ESWA 4HCYA 2Y84A 2ZNUA 3TDJA 3QYTA 1Y4TA 2GRVA 3SEUA 4R6KA 3H06B 3OO8A 4FJPA 2RF1A 1SW1A 2R6GE 2XHDA 3C35A 3CVGA 1PDAA 3FV1A 4GLIA 1S9TA 1A7LA 2C5IT 3IO4A 1VFDA 1B7ZA 4H1XA 4EQBA 1P1WA 4YZZA 1MPBA 3C36A 4O3AA 4G4PA 1AOVA 3B6WA 1WVJA 3PU5A 4N07A 4RYAA 1B5HA 2DWAA 1HSJA 3ZKKA 5I58A 2DSFA 1NNTA 4BDOA 5AA2A 4NF6A 4EQ7A 3ZSFA 1CB6A 1Y3NA 3TQLA 3H6UA 4QFLA 4UA8A 1AIVA 4BDQA 3G3KA 2I0CA 3W15C 3JYRA 3O6HA 4KFQA 3LSXA 3ZS6A 2AIXA 2XXXA 3EN3A 5KDTA 1ZKBA 3FUZA 4L17A 3CSGA 3PPRA 4PFWA 2DQVA 1B1XA 1LFGA 3FXRA 3SEYA 5A5XB 3KZGA 3TZAA 2UYFA 2PX1A 4KCCA 3F11A 2VHAA 4ZZEA 2Q2AA 1QKBA 4DDDA 2R71A 3VVDA 4OHNA 4F1VA 3OXNA 2ZXTA 3U92A 3S9MC 1NNFA 5FHNA 1B3FA 3CRBA 5JTYA 4OESA 5BWJA 1URDA 4KYEA 2IC9A 1SI0A 4M1VA 4LA9A 4XKNA 5FTIA 2IEEA 4JWXA 2DXYA 4EQ9A 1USYE 4OFLA 1GV8A 5I56A 3IAZA 2Y7IA 3VFJA 2FYIA 4O3BA 2WKYA 1ZIUA 1NNKA 2F8DA 3H7MA 3SEVA 1EZPA 2G0UA 2THIA 4F3GA 2CZLA 3OMBA 4C0RA 3DP4A 5DEXB 5CMCA 4IO5A 4DE8A 4F22A 5IAIA 3JV9A 2I0BA 1B32A 1SQYA 2NWJA 1QJMA 2NUVA 3PUXE 1R9LA 4IO2A 1P1NA 4YB7A 1OLCA 1XVYA 4NF4B 4WKMA 3O97A 4RY1A 3RQTA 3KFMA 2ONKE 3UIFA 4NTLA 1HSLA 2OBGA 4ECFA 1SDXA 1LAHE 1N76A 3KN8A 3HHGA 4UACA 4YMAA 3OSQA 3TCGA 1NL5A 4BDLA 3Q27A 1B5JA 2QMWA 1B0HA 2ZNTA 1JW4A 4QSEA 5DVFA 4YAHX 1O63A 3CSBA 4IO4A 4R9GA 5DT6A 5I2KB 5TP9B 5IKBA 5ISUA 2XD3A 4OENA 4EF1A 2DVZA 1MH3A 4LVQA 4N6PA 4R73A 3MVWA 4KQPA 3FJ7A 3VDFA 4C1UA 1JQFA 1YTVA 4LATA 5I2NA 1ZU0A 1H43A 1RYOA 4QFNA 1KWHA 2YJPA 4ELQA 5ITOA 1OQHA 3FGSA 2QL3A 4MBPA 4ZE8A 1PB8A 1SBPA 3CG3A 3UK4A 2ABHA 1MQIA 4THIA 5H8HA 1MY0A 1FQDA 1SW2A 4R75A 3SDFA 3S2VA 2RCBA 1MQDA 3FJMA 1FQAA 5AA1A 1BLFA 3TAJA 2I3WA 3H03A 1MDP1 3PPNA 4U23A 1XOCA 3OO6A 1B9JA 2GHAA 3G3FA 3PUYE 4KCDA 2XXWA 3H6WA 5CRYA 5DTBA 3E13X 5H8QA 3GZGA 3MVXA 1B3HA 1P99A 2FNCA 2Z23A 4F39A 1PB9A 3OO9A 1QULA 3KN7A 1F9BA 1PBPA 2Y7KA 4IO3A 4KYSA 3TCHA 2F6PA 1JEUA 1LVFA 1SW4A 2OWSA 3MVZA 5HBCA 3FASA 4FIMA 1SW5A 1B3LA 4NF4A 4DCYA 3TEPA 3IL1B 1DTGA 2G29A 2RKMA 3VV5A 3FV2A 1ZLQA 3SEWA 2HCAA 1S7YA 1YPNA 2XXYA 3K2DA 3PPPA 3USDA 3IO6A 1NFTA 2ZMBA 2HZLA 3BFTA 4I9DA 1JW5A 2NVUB 1BP5A 1M5BA 2CMOA 2UXAA 3LSFB 4H8JA 4XIGQ 4PQJA 2RINA 2AYSA 4XKPA 1D9VA 1MM6A 1SD3A 2O51A 2OK2A 4GIZA 4NF5A 5TU0A 5B70A 5HM4B 1UTBA 1XS5A 3DM0A 4KD5A 4H5GA 2PT2A 2HEUA 2P0SA 1OIBA 3MUQA 4ZEBA 4NE4A 1UTHA 2DS9A 4OZ9A 4QHQA 4R72A 1XHYA 3PMVA 2UVJA 1MQHA 3W9WA 1R9QA 4O3CA 2B65A 4TOZA 3U1OA 1SYIA 3C34A 3GXAA 2KLFA 3PMXA 3QUFA 3HO7A 4H8IA 3W9VA 3OSRA 4OFJA 2F5XA 4ZEIA 1MRPA 3LSWA 3S9LC 4JWOA 4IO7A 3OEKA 1LLSA 2D5WA 2HAVA 4OTEA 1N04A 2F7BA 2VD2A 3O66A 5FHOA 3RT6B 2IA4A 2K48A 1EU8A 1NH7A 4Q0CA 5AA3A 3KOTA 1JNFA 3PV0E 3TTRA 4ZZAA 1SYHA 3TKDA 1QKAA 4YICA 4NMYA 3E9XA 2QSXA 3FJGA 3PGFA 3D4GA 4ZEDA 1QUKA 3VLUA 3K1PA 2ZYKA 4RJZA 1IXCA 3PUZE 4XTCQ 4OEUA 4FATA 4H6DA 4EXKA 1EZOA 4Q5TA 4RPNA 2XXUA 5H8HB 2H25A 1POY1 3TTNA 3AXFA 2ESNA 4TQUQ 3WAEA 1LAFE 3JZJA 4QRZA 3R7XA 3RTWB 4F2QA 1L5TA 3S9EA 3T96B 1BIYA 1D9YA 3B6TA 4G77A 4IGTA 4ESXA 1CE2A 1GTKA 1LCTA 2ALUA 3DP8A 4FE8A 4G2ZA 2Q8JA 3RY3A 1MQJA 3TUSA 3PMWA 2I49A 2X9WA 1JETA 3VLVA 4YB5A 5BUUA 4YKJA 4XXUA 1M5FA 3T9VA 2ANJA 2RC7A 3M3KA 4P0IA 1B6HA 4TLLB 5L9MA 1FQEA 1I6BA 1N7WA 3E3KA 3IOVA 1HSEA 1FTKA 4GOTA 1Z0PA 4JXIA 3PD9A 4OXVA 2QMXA 4U1ZA 5H8FB 4HS7A 3VXCA 5L8DA 5ITPA 3K1MA 2XTLA 4X48A 1JEVA 2O1LA 1ZMGA 5H8SA 1UQWA 2O6AA 3T9XB 2MBGA 4F2OA 3ODBA 4X1DA 1MY1A 1MY3A 2NOOA 2Z8FA 3EPEA 4ONYA 3IR1A 4FEBA 2B3FA 1FQBA 1LCFA 2HXWA 5I2NB 2M8CA 1GVCA 1MDQA 4ELOA 3QK6A 1OMPA 4H5FA 3G3GA 1B7HA 4YB6A 1MXZA 3FATA 1IXIA 1VR5A 2DP8A 1VE4A 1LFIA 3KG2A 4JSOA 1B05A 2G93A 5JTYB 4Q8RA 3SERA 3WAFA 4YKKA 4DLDA 1DPPA 3CVRA 1VFEA 2Q9TA 1Y1ZA 3MBPA 4B6XA 3MPLA 1AMFA 2CA5A 4LQ2A 4F1UA 4KYDA 1IIWA 3CKDA 1N84A 2QPQA 3TKLB 3FVGA 1Y4CA 2V3UA 4ZEKA 4RK9A 5AE4A 2I4CA 3A3CA 4LONB 2HAUA 2ZNSA 4GVOA 4JSDA 4M4GA 3M3FA 5KDTB 4F29A 1YAEA 2UYEA 5H8NA 1Y3QA 2DYXA 1QUJA 1DPEA 3HV1A 4DNDA 4I1DA 1MXXA 5F7VA 5AA4A 2GHBA 3QUJA 2AL5A 2OWTA 4RK2A 5KCJA 4PFUA 4F18A 1GGGA 3MW0A 3GBBA 2AL4A 2QS2A 3CFZA 1JVYA 4AB6A 3UORA 1DSNA 4OWDA 2DE4A 4MH5A 3KJ7A 3G3HA 3KN3A 2C5KT 4L0RA 4U22A 5EYFA 5AA2D 5I58B 1RYXA 2DVCA 1P1QA 2F6GA 5TPAA 4H65A 3MC2A 3U8QA 3GLBA 4EYYR 3Q26A 5I56B 4GL8A 1FQCA 4YU0A 4ELRA 4MFIA 2V3TA 2ZYMA 3KJTA 2A5TB 1IITA 2DWIA 4FORA 5KZTA 1MXVA 5A5XA 1TWYA 3RLFE 1A8FA 1LSTA 3P7IA 2RCAA 1TT1A 3D4CA 3HSTA 4WEPA 3T22A 3I5OA 3N6TA 3S9NC 3BKIB 1M5DA 4GQOA 5KCJB 1IXGA 2Q89A 4KPTA 1FTMA 2E0SA 3DELB 1O7TA 3FXUA 3UA8A 4QSCA 2ZYNA 5I57A 4DCXA 1US4A 1A40A 1DMBA 3TQWA 1MXYA 3IX1A 2H5YA 4ZS9A 1I69A 3OOAA 4XKRA 3L6HA 3RT8A 2X7QA 3MAMA 1TFAA 4IB2A 1IJ6A 2P2AA 3FXQA 4IGRA 3SETA 4NF5B 4DXCA 2A5SA 2F34A 3U94A 1B46A 2QS3A 3TFLA 2XXPA 3TMGA 1QVSA 2Z8EA 1XVXA 3M8UA 3K00A 1XC1A 5H8FA 1P1OA 3FXEB 3E4RA 4DIGA 4MLVA 5CM6A 1N3WA 2O7UA 2Q2CA 4R6HA 3IOTA 3K02A 4NF8B 3RNNA 1BKAA 4K3FA 2Z22A 2RC8A 3FD3A 5L9OA 1II5A 4CQIA 1ATGA 1B7UA 1MPCA 1B2HA 1H3DA 4OQOA 2KWIB 1A8EA 4R2FA 4LUBA 4YKIA 4LP2B 5I84A 1LAGE 3QIMA 4MF3A 1PB7A 1R1NA 1AL3A 2VOZA 3C9HA 4GF8A 4JB7A 5DVJA 5H8QB 3EF7A 1URSA 1OQGA 3BBRA 1SI1A 3QSLA 3U72A 4LZ8A 1Z7NE 2OLBA 3TYHA 2O68A 2X7PA 1N7XA 4G68B 5K2XA 1B51A 2PBWA 2P1SA 3LUYA 4R9FA 1B40A 3N94A 3O6IA 5EHMA 3RUMA 4RPOA 2B3BA 1LB8A 5DVIA 1JW1A 2FA7A 2VD3A 4GRKA 3IB2A 4JBZA 4ELPA 1FW0A 4I62A 1MG1A 4R74A 4EXLA 3MZBA 1OVBA 4HTGA 2X9YA 2I4BA 1MH4A 1O64A 4IY5A 1A54A 3KBRA 3PD8A 4QSDA 2VP1A 5ELVA 5TP9A 2PMSA 4R2BA 4FEDA 2O1MA 3O29A 4U21A 3T93B 3C32A 4OMBA 3SKPA 3ECRA 1NKXA 1LFHA 5JK4A 5ICQA 3MPKA 2DE2A 2XX9A 2YLNA 3UN6A 2V3QA 2KWHA 4G68C 2F7CA 4EF2A 3FIRA 3KOSA 2QS1A 4KR5A 2ONSA 5I59B 1A55A 1MY2A 4F1YA 5CC2A 1Z7ME 5I59A 4PP0A 2OCUA 4TLMB 4X1BA 3IJOB 1NMUA 5M2VA 2H9BA 1B0LA 1IQ7A 1B3GA 1MS7A 1IEJA 3HN0A 4XKQA 3OENA 4PETA 1OLAA 1QW0A 4WXJA 4F19A 2O69A 3BFUA 1MQGA 2A5TA 3KSJA 2LAOA 2RC9A 1GR2A 4GFRA 4LZ5A 5CBSA 4OEVA 1RKMA 4POWA 4E0XA 2ONRA 3FVOA 2F97A 5DEXA 4EDPA 3V83A 3TTMA 3Q28A 3N5LA 1UTHB 2VGQA 5TPAB 4OFOA 3VLWA 3K01A 2Z8DA 1J1NA 4H67A 3PUVE 3H6VA 3H4ZA 3LBSA 3IK6B 4NF6B 4OVJA 1UTBB 5J1DA 1ELJA 2F35A 3EHSA 3O2AA 3R26A 1JVXA 3I3VA 5CMMA 1MXUA 3ZKLA 4RNSA 1NH8A 3O9PA 1Y9UA 3MP8A 2D21A 2Y7WA 2I6EA 4PFYA 4DXBA 2GH9A 1IJ5A 3SEXA 4G8NA 3U93A 2D3IA 1PC3A 3IOUA 1N0TA 4FECA 1LBBA 4LZ7A 1FTLA 4NWDA 3V5AA 1MXWA 4G8MA 2ZYOA 2H98A 4ZE9A 1DOTA 2GFEA 3K6WA 3MP1A 3QXMA 2XD2A 1LBCA 3I6VA 4POXA 4QFOA 4EUOA 5EHSA 4U4XA 5JEIA 3RTFB 3TTLA 4FI5A 3UGWA 4C1TA 5L9SA 2XXHA 5FTHA 1FTOA 2HFBA 4GXAA 3K1NA 4OETA 4OYVA 4ZDMA 1FQFA 3TTKA 1ZTYA 3B7DA 1DTZA 4NF8A 1ZJLA 3SESA 5FHMA 3UP9A 5AA2B 1Y20A 3LC8A 3EHUA 4F3SA 2C5JA 1D3KA 3FVKA 3EHTA 3H6TA 2XX7A 4H0WA 3LR1A 4JWYA 4NWCA 1LGBC 1URGA 2XXQA 3HHFA 3ILTB 3VVEA 3EQ1A 1QSDA 4N13A 1M5CA 4X9TA 4BDMA 3MWBA 3DLNA 2REGA 3LSLA 4U2RA 3DP6A 4DXUA 1POTA 4BDRA 1IZ1A 4G68A 4DZ1A 3FZVA 4Z7EA 2IC6A 4RA1A 3VVFA 2UVIA 3G7WA 1B52A 4J2CA 3OEMA 4GD5A 2O7IA 3GBAA 3L6GA 4G8HA 2V93A 4GL0A 4AB5A 2DOJA 3TELA 3IB1A 3ILUB 1MM7A 3C4MA 3K0VA 4HCWA 2H99A 1EH3A 2I3VA 4GXSB 4I8CA 5F1QA 3HPIA 2R9JA 1AH5A 2O84X 4QFKA 2X9XA 2PT1A 4ISUA 1USYH 4ZECA 2QS4A 4PFTA 3RN8A 3IOWA 2X26A 3O6GA 1Y3PA 1N3XA 4WEDA 4YMBA 4YKPA 1H45A 3TCFA 1PBQA 1Q35A 3MVYA 1ZBMA 3C31A 4HW8A 1UIVA 3OELA 1H44A 2F78A 2OJTA 2QRYA 4QF9A 4ZEFA 3Q29A 3QAXA 5HPQA 2XXVA 1ANFA 2Y7PA 4OERA 3S4UA 4ND9A 4BDNA 3VXBA 5DYHA 5CMBA 4F3PA 1B4ZA 2Y7RA 4FAJA 4JDFA 1MY4A 2DE3A 4PE5B 3OO7A 2F7AA 4U1OA 2I48A 1A99A 2V25A 4NEDA 4LQ5A 5I57B 1FCKA 2HZKA 2F36A 2XXRA 4F31B 5CBRA 1YCJA 4KI0E 2H4IA 3THIA 1P1UA 1FTJA 4E0WA 2Q88A 1I6AA 3G3IA
chains in the Genus database with same CATH superfamily
3V89B 2XX8A 1M5EA 3G3JA 2Y5LA 3T66A 1I6QA 1D4NA 5FXZA 1XT8A 4O7MA 1NV6A 5BMVE 1WODA 3CX6B 5LG3A 3PUWE 4IY6A 1MNEA 5CI5A 2YPNA 3N6UA 3RGYA 2BJJX 1NAFA 1QUUA 3ZPOA 4K0KT 5FNVE 1US5A 2NW8A 3PU3A 5CA0E 1VDWA 3KVAA 3T9HB 3Q25A 3P4WA 5L4HA 1B4HA 4RXLA 2V84A 3UUXB 4IL9A 4U33A 3CHGA 3R84B 3IB0A 2KINB 4DV2T 2QJEA 3CQCB 1T72A 2KMFA 1FIOA 3HKEE 1IUDA 1QLBA 1NUZA 3K6UA 3MQ9A 4PC9A 5IZ3A 2ZNUA 3TDJA 2K5BB 4FJPA 2RF1A 3T1BA 5HCJA 1S9TA 2C5IT 1VFDA 2WX9A 4H1XA 4EQBA 3RIUC 5JDGA 5HXHA 1MPBA 3UQ4A 4G4PA 2KNDA 3AB3B 5L3EB 1WVJA 4O3AA 2DSFA 4JLEA 5EYGA 2KT9A 2DCFA 3RYFE 4P56A 1D9QA 4EQ7A 1Y3NA 3RPUA 2N2NA 3H6UA 1G0HA 4UA8A 1YD8G 1NV2A 3KINB 3U78A 4L17A 3CSGA 2CRBA 2Q9QC 3ZMTB 4OX9T 3RYIE 3V5SA 4EOZB 3TZAA 5EZYE 2UYFA 4KCCA 4ZZEA 2CBIA 1M7KA 4KHZF 2Q2AA 3VVDA 4WZXA 2ZXTA 4KBMB 4OESA 5BWJA 2FBPA 4XKNA 5I56A 1GV8A 3BQLA 2UXCT 3LFMA 2F8DA 3H7MA 2WBBA 2CZLA 1XNQT 5DEXB 4N15A 4CZZB 2I0BA 3BQIA 2NWJA 1QJMA 3KFMA 3UIFA 4IREA 2C0SA 2OBGA 4ECFA 4MHFA 3KN8A 1HG2A 4AI6A 3EVYA 1B0HA 1YQ3A 5I2KB 5IKBA 5H6RB 5TP9B 2V7KA 3RYDA 2DVZA 1MH3A 5JREA 3B50A 1H43A 2CHOA 4QFNA 3BIGA 1OQHA 4MBPA 2XAQB 5HXEA 3UK4A 2ABHA 5JTGA 4XAXB 4HWIB 5H8HA 1MY0A 3SDFA 4PTKA 3S2VA 2OA5A 5DQWA 1BLFA 1MDP1 4U23A 2AXDS 5L3GB 2KLQA 2BVMA 3G3FA 3ZT7A 3PUYE 4MIJA 5EYHA 1VRBA 4WBOA 1BR0A 3GZGA 3MVXA 2FNCA 1PB9A 1PBPA 4KYSA 2BS3A 4N6KA 2XQYA 5HBCA 3FB2A 4MCOA 2ES0A 4FIMA 1SW5A 3ZT5A 3AEEA 5ABEA 5HEGA 3IL1B 1FPDA 4XEQA 2G29A 3VV5A 4PGNA 2H88A 2HCAA 1YPNA 3USDA 4JUYA 4ZS2A 5HYAA 1NFTA 2ZMBA 2HZLA 4I9DA 1JW5A 2NTYA 1G0IA 3AE3A 4XIGQ 3T0JA 2OK2A 4DV0T 2Q9QB 1MM6A 1NWMX 3N2OA 1UTBA 1UCUA 1XS5A 4HKAA 2XHEB 2XASB 2PT2A 1OIBA 4NE4A 2DS9A 2UVJA 1MQHA 4DR5T 4O3CA 4TOZA 3U1OA 3JCFA 4DVDA 3HO7A 4OFJA 2M6BA 2F5XA 2WB5A 4TX5A 4I3YA 2M67A 4QX8B 2ZM0A 3P4QA 4KUMB 4IO7A 1US7B 4PCDA 4UELA 1EU8A 4Q0CA 2LRLA 3KOTA 1JNFA 3TKDA 4AKLA 3E9XA 4JI6T 1MMNA 1FMVA 5IUXA 1IXCA 3MZKB 3RKOA 4XTCQ 1N34T 4LF6T 2I0MA 4RPNA 2H25A 3LK2B 4WNKA 2ESNA 4DR4T 2YDSA 3AXFA 2Y48B 2WEFA 3WAEA 3JZJA 4QRZA 4F2QA 3VR9A 4EZ4A 4G77A 4HFVA 1CE2A 1GTKA 4UV8B 3DP8A 1MNDA 4BJMA 3TUSA 2I49A 3VLVA 5ABFB 4YB5A 4NUUA 3EDVA 4TLLB 3GA8A 1N7WA 3IOVA 4GOTA 5CRYA 4JXIA 3C51A 1MIWA 2YN6A 1XZYA 5LHIB 5ITPA 2FJAA 2XTLA 4X48A 1ZMGA 2QRXA 3B5MA 2XQ5A 2YK0A 2QYWA 2XM2A 4YJ3E 2Z8FA 2W67A 4NHBA 5DJQC 3J9X1 4O2AE 5LBMA 4ZI2C 1GVCA 5I2NB 4ELOA 3QK6A 4O94A 1MXZA 1VE4A 4H9RC 1LFIA 2G93A 4E7ZA 2WBDA 3WAFA 3AE4A 4DLDA 3MPLA 4LQ2A 1AMFA 2CA5A 2EHOB 3SZPA 4KYDA 4MJOA 1IIWA 1LEVA 1EYIA 1Y4CA 2FIEA 2B4LA 2I4CA 4ILUA 4LONB 2ZNSA 5DQVA 4M4GA 2LSIA 5KDTB 4F29A 1YAEA 5AQMB 2DYXA 3HV1A 4DNDA 5KCJA 2WWUA 1GGGA 2J1DG 5JR9B 2N1GA 1JVYA 4OVTA 3IF8B 4MH5A 1KF6A 3RIFA 1FBCA 2DVCA 3ONJA 5JDFA 4H65A 5I56B 4ZZBA 4GL8A 2CBJA 4YU0A 3PJAJ 2V3TA 4NQ8A 3ZMVB 3U65A 4XF5A 5A5XA 3PUXF 3LBXB 3KFWX 1A8FA 3T22A 3S9NC 4GQOA 5JR9C 1IBMT 1KNZA 4EIWA 4KXPA 2CZIA 5FXVA 4N8YA 4IDQA 2E0SA 1Y01A 1O7TA 3UA8A 1G8XA 5AQNB 3ESLA 2VKJA 4DCXA 1YKHB 5F5WA 1DMBA 1I94T 1W0BA 3OOAA 2X7QA 3SOLA 1TFAA 3MAMA 4DXCA 4NF5B 3E08A 1SE7A 2FBWA 3TFLA 1BR4A 5FXWA 1XVXA 3M8UA 1XC1A 2JJKA 2VVSA 3E4RA 4MLVA 4DBRA 3L39A 3IOTA 3K02A 4C91A 3KBZA 2RC8A 3O4XE 1II5A 4PAIA 1N36T 2X67A 1ATGA 1MPCA 3MACA 2KWIB 1A8EA 4LUBA 3P4RA 4ZS3A 2UXNB 1LAGE 3QIMA 2LKGA 1PB7A 1R1NA 1YYZA 2VOZA 3C9HA 5H8QB 4AQGA 2P9BA 3I0QA 3AXJB 2X7PA 1YKEB 3TQLA 2PBWA 3ZLIA 3FZFB 4CN4A 4CN6A 3RUMA 2IMLA 3O1HA 2E9XB 1JW1A 2FA7A 2VD3A 4P1NA 4NIQA 1W09A 5ADXL 1OVBA 2W4XA 3MZBA 4EXLA 4NXMT 5ELVA 4XZCA 4QSDA 5LGNB 1HX8A 1FBGA 5LHGB 4PK5A 5J1GA 4OVSA 1HX1B 2V3QA 2KWHA 3ZMUB 4X04A 2QS1A 1FRPA 4PBHA 2LEHA 4M1PA 2E9XC 2OCUA 3MA9A 3Q5WA 4I3EA 1IEJA 4PETA 4B3ST 2XWKA 2XAJB 3NRYA 5C3JA 4DV1T 4JEUB 3FVOA 1RDXA 2L8KA 4GX3A 3TTMA 3V83A 3AVRA 5I3SA 3H6VA 3FHNA 4OVJA 2BKOA 1DBZA 1ELJA 2F35A 3EHSA 3R26A 1JVXA 4JBWF 3T1HT 4FBPA 1PC3A 4LZ7A 4NWDA 1GQEA 4PFOA 3AEAA 2KZ7B 5HXRA 2XJ7A 2GFEA 3RPLA 2W61A 4POXA 5ET7A 1FBDA 5JEIA 2VPOA 3D1RA 3DTOA 4AXPA 2EHOC 4NF8A 5FHMA 4IE6A 5FP3A 4F3SA 1U5PA 3ZJ2A 2XX7A 4JWYA 3RQUA 1M5CA 4JI2T 3MWBA 4DXUA 1POTA 4BDRA 4YXDA 2WSSV 4RA1A 4L5GA 2UVIA 5DYHA 4GD5A 2O7IA 4GL0A 2V93A 1N33T 2WU2A 2BKPA 3CPZA 3C4MA 4HCWA 1EH3A 2I3VA 4I8CA 3HPIA 2O84X 2WMOA 3UU4A 3ZEFB 3LDQB 3O6GA 4AKIA 2MYSA 1H45A 5ESYA 1D1CA 3K3NA 1ZBMA 1UIVA 5HPQA 2F78A 2HHMA 2OJTA 3QAXA 2XXVA 4HN9A 4OERA 3S4UA 4U31A 2DE3A 4PE5B 3CX7B 3HI2A 1FCKA 2F36A 3WAKA 2VPNA 4E0WA 2Q88A 5DW8A 3AA0B 5HCMA 2REJA 5H8NB 4U4SA 4PFPA 5K2YA 5IZ1A 4E7SA 2FVZA 4MFRA 3C33A 4MALA 4KHZE 4I0UA 2DXRA 5AQSB 3MJNA 3IJXB 3HKBE 4A5XA 4P11A 1FPKA 4O4JE 4YHJA 4EYUA 2W7YA 4Z0IA 4LMKA 1QUIA 4B3MT 4F6RC 3TODA 1Q1KA 1MMDA 2WP9A 1WDNA 1Z8UA 3VRBA 3FXDB 1JP4A 3KGCA 5C2TA 3K6VA 3B6QA 4IT4A 3RQWA 4GWOA 5AA4B 2VQET 4X5TA 1SHZC 3MZ9A 5ET6A 3HCQA 1UIUA 4O4LE 1KK7A 4BLAA 3VU7H 5ICTA 3PPQA 2WZIA 3BK9A 4AQ4A 4GWSA 1B3EA 1VCTA 2V7IA 1H7CA 3N26A 3VE1B 3NRXA 4P0GA 1Q9DA 2Y84A 3UU5A 2FJDA 1Y4TA 3SEUA 4UEMA 3H06B 4QX7B 2R6GE 3HL6A 2XHDA 3C35A 3CVGA 4JI8T 2ZZWA 1B7ZA 4UR9A 1P1WA 4YZZA 1EYJA 3PU5A 4RYAA 5I58A 1B5HA 2BS2A 1XI6A 2DWKA 4GBVA 4NF6A 4GK5E 3OYZA 5KXJA 3JAEA 2RA1A 4IDZA 3ZC1A 4QFLA 1AIVA 2UXBT 3W15C 3O6HA 4CI1B 4GX6A 3UU8A 5IYZE 1W0AA 1ZKBA 5F24A 1RDYA 3LK3B 3ABVA 1B1XA 4JI7T 2LSYA 3HKDE 1E7PA 5A5XB 4JI0T 4HFEA 3F11A 3I9YA 1K9ZA 3OXNA 3S9MC 4AIUA 5FHNA 4PJLA 1B3FA 5JTYA 4M1VA 2IC9A 1NUXA 1SI0A 5FTIA 2MOZA 4JWXA 4HWCA 1USYE 3IAZA 2Y7IA 2WKYA 3Q2MA 1FPJA 1EZPA 5ET5A 3OMBA 1WYBA 4C0RA 2NP9A 4DE8A 1SUMB 3RRWA 1R9LA 1VCSA 4DMVA 3RLFF 4NF4B 4WKMA 3UT5E 1WCRA 3O97A 4RY1A 2ONKE 4PFRA 4YSZA 4OK0A 4KX6A 4OYJA 3HHGA 1NL5A 1B5JA 2QMWA 2ZNTA 5BR8T 2ACZA 1O63A 4R9GA 4YAHX 5DT6A 5ISUA 3QB5K 1OEDB 2XD3A 3OYXA 4N6PA 4C1UA 3MVWA 4X1KE 3FJ7A 1YTVA 5I2NA 1ZU0A 1RYOA 3SFDA 2ZM2A 3FGSA 4DV4T 3FZLB 1PB8A 1SBPA 2CE7A 2PFZA 4THIA 1MQIA 1EYKA 2NW9A 2RCBA 4YFSA 1MQDA 2H3RA 1IMBA 2PCRA 3FJMA 5AA1A 3TAJA 2I3WA 4JVCA 3JC6C 4IL4A 1ZP0A 5AQHB 1D0ZA 1B9JA 2GHAA 4NPPA 3HKCE 1IMAA 2Z23A 3OO9A 1QULA 4BAYB 1F9BA 5ABFA 2F6PA 4P3LA 5HEHA 1SW4A 3FASA 1X79A 1B3LA 2ODUA 1HFAA 2A3DA 2CPTA 5LGTB 2XXYA 3Q5XA 3PPPA 3NBXX 3IO6A 3LV0A 3W15B 1BP5A 1M5BA 1V9DA 4XKPA 4GK0E 2UU9T 2AYSA 2RINA 4PQJA 2O51A 5TU0A 4NF5A 5B70A 2IW5B 2XAHB 1BR2A 1D1BA 2H7VC 1YW0A 4H5GA 3MUQA 3RKGA 1UX5A 1UTHA 2YKSA 3FBZA 2DNXA 3Q9DA 3CQXC 1XHYA 4R72A 3W9WA 4HWFA 3TLTA 1XMQT 3QUFA 4KI0F 3W9VA 4ZEIA 3S9LC 4LMLA 2VVNA 4OTEA 1HNXT 4PAKA 4UABA 2V7MA 1N04A 2VD2A 2QFLA 3TLUA 4U7YA 3O66A 3ANWB 4EGWA 5AA3A 1SYHA 4YICA 2VKOA 2QSXA 3RHWA 1QUKA 4TV8E 3IEEA 5HWXA 1KA1A 3PUZE 2CEYA 2XXUA 2LRKA 3ZN1B 2BG9B 1KNPA 2V5DA 1LAFE 4JVIA 1OEDC 3S9EA 3B6TA 4IGTA 1SA0E 2R8TA 4CXWA 2ALUA 1LKXA 2VKDA 4G2ZA 2XQ4A 4HFHA 3HFUA 2YINA 3PMWA 1FPGA 5EQ8A 1VOMA 4P0BA 4ZOLE 4WW0A 1M5FA 4P0IA 1B7TA 5JRCA 1B6HA 4HE8A 2OLTA 2PFYA 3C4ZA 4OXVA 1HSEA 1Z0PA 4U1ZA 3H3AA 4IDPA 2JQ9A 4QXBB 3LK42 3T9XB 4AKGA 3E79A 1MY1A 4X1DA 4ONYA 2ZMAA 4FEBA 3ZJ1A 1KEYA 2JMHA 1IZNB 2ODVA 4NUVA 1B7HA 2DP8A 4JSOA 4LF5T 5JTYB 2A72A 4QH5A 1VFEA 5CMCA 4F1UA 3O9XA 1FPLA 4YTPA 4OHFA 4QXHB 4ZEYA 2HAUA 4GVOA 4JSDA 5EQ9A 3M3FA 4X1IE 1DPEA 5AA4A 2JQKA 3PV0F 4F18A 2CEXA 3GBBA 4U3CA 3CFZA 4AB6A 4OWDA 3KJ7A 3KN3A 1FBEA 2C5KT 4L0RA 3E78A 5I58B 2YEVC 1WLXA 2F6GA 2Y8DA 3U8QA 5L47A 4HFCA 3Q26A 2LSGA 1AJ3A 4MFIA 3AVSA 2ZYMA 1HNWT 1IITA 5KZTA 1MXVA 4I43B 3ETVA 3HSTA 4WEPA 3BKIB 3UTKA 5LGUB 3RGLA 4CI2B 3DELB 2V5CA 4YSXA 5ETWA 4YY3T 1YQ4A 4QSCA 4HE0A 5EK2A 4OANA 1A40A 2GQ1A 1AWBA 3GYYA 1XWMA 2XAGB 3IX1A 2H5YA 4JEHB 4X64T 1I69A 3RT8A 4IB2A 3FBLA 2L3LA 4EV6A 4DV7T 3TMGA 3K3OA 2KR0A 3K00A 1WRDA 2PG8A 3FXEB 2O7UA 2Q2CA 3IHRA 2LHRA 3ONLC 3RNNA 2F4VT 4JYAT 4JI1T 2CLYC 1B7UA 4YKIA 1H3DA 2IUBA 4HTEA 4YTMA 2WDVA 3KC1A 3TLVA 3BBRA 2KSRA 5C8YE 2O68A 4UVCB 1UUSA 1B51A 2P1SA 1Y64B 2CXFA 5EHMA 3O6IA 1UGOA 3ZYMA 3H3MA 2XAFB 5DVIA 1ZV4X 4ELPA 2CLYB 4AQFA 1FW0A 2L5VA 4I62A 1MG1A 1WR0A 2D0UA 3PURA 4QXDA 2VKHA 4IY5A 2NOXA 2PFVA 2ZM6T 4FEDA 2O1MA 3O29A 4XBFB 3C32A 3SKPA 3BIHA 3ECRA 5ICQA 4B3TT 3AA1B 2F7CA 1FBHA 5AQTB 3KV5A 1NI9A 2ONSA 3KC0A 1A55A 4PF8A 5I59A 4PP0A 2BBJA 5FYMA 3AE7A 1LBWA 1B0LA 1MS7A 3HN0A 4XKQA 2BS4A 4PJJA 3N9NA 2OX3A 3P50A 1QW0A 4WXJA 1MQGA 2A5TA 5LJMA 2E2AA 2UUAT 5J0ZA 1DK4A 4DR1T 5DABA 1RKMA 4E0XA 5DEXA 4EDPA 5E0OA 2BVLA 3CMLA 3Q28A 2VGQA 4MBQA 4UF0A 4H63V 4LMJA 4O4HE 2Z8DA 1YZ0A 1J1NA 4H67A 2MTQA 2LLYA 4NF6B 4PE3A 4UVAB 1FPFA 4RNSA 4Q25A 3AA6B 3IOUA 4LF7T 2E5VA 1N0TA 4FECA 3V5AA 4DI3D 2FHYA 4G8MA 3ROJA 4O7IA 2IDOB 3QXMA 3I6VA 4EUOA 4MHCA 2NWBA 3TTLA 3N9OA 4FI5A 2JJ9A 3EAMA 1FTOA 5FTHA 4PW8A 4ZDMA 5ABHA 3TTKA 1ZTYA 1EZOA 3SESA 1ZJLA 3CK6A 3LC8A 2C5JA 3FVKA 3H6TA 3EHTA 4QHQA 3T9UA 2XXQA 3ILTB 4PK4A 1QSDA 3CX8B 3DLNA 2REGA 4YJ2E 4DZ1A 3AXJA 3D0TA 3P4SA 3OEMA 4AQYT 4G8HA 3ZN0B 4AB5A 3TELA 5CA1E 5JDMA 4F8HA 5FXXA 1MM7A 4AQFC 2H99A 4TN7B 2KXPB 3K3QC 2PT1A 2GK9A 4ISUA 4ZECA 1LBYA 2QS4A 4PFTA 3K8PC 3RN8A 2X26A 4PFIA 1NUWA 5AQIB 1IBLT 3AE6A 3MVYA 4A56A 4AKHA 3Q29A 3ONXA 2XWVA 2WCAA 1ANFA 2CWYA 2Y7PA 4ND9A 2A2FX 1B4ZA 2Y7RA 4JDFA 2E9XA 4Z8XA 3P8CD 2HZKA 2XXRA 4IE0A 5CBRA 1YCJA 2XXKA 3THIA 1P1UA 3MYUA 3MZ1A 1I6AA 2FIXA 3G3IA 5FY7A 5JQGE 3M3LA 3OBVE 1FJ6A 3FVNA 2XXIA 1T0KA 1S50A 1N32T 4Z90A 4H46A 3KEIA 3LBXA 2D5UA 5ABGA 1B58A 3K4UA 4QFPA 2PYYA 4OVRA 4HFBA 2W0GA 3CG1A 1Y1MA 3H37A 4HWDA 2E1SA 3A3UA 3H3GA 2X51A 1LB9A 3TPAA 4LF4T 4O2BE 5CMKA 2DHRA 2HQ0A 3K6XA 2P3NA 1XDPA 4FJOA 2XQ8A 3I1AA 2SPCA 3AAIA 2BKNA 3L3PA 1U4QA 1MMGA 2LKHA 1IXHA 2UUCT 1B1HA 1D0XA 4CN1A 1TFDA 3OVUA 3RPWA 1FPBA 4HWHA 3MP6A 4Q30B 1HTJF 1HG5A 1PEBA 3OD7A 3NWIA 3ONMA 3LUZA 2J47A 3CI8A 2HPLA 5FKYA 5B7DA 4LFCT 1EZ9A 2LOSA 3PU8A 2UVHA 2QVAA 1H76A 5I2KA 4QKNA 2D2SA 3PPOA 4G61A 3V8XB 4HCYA 3PUWF 4CXXA 3PTRB 3QYTA 2GRVA 4R6KA 1YXRA 1SW1A 1PDAA 4IE7A 2V1DB 4P0AA 4DR7T 2DWGA 2XQ6A 3GMIA 3C36A 1AOVA 3ZKKA 1HSJA 2V7LA 2HN1A 5L4EA 4H9OC 2W66A 5JR9A 3PJAA 1FBFA 4QHOA 3AEGA 4BDQA 5LMNT 3RC3A 3G3KA 5CFBA 4DR2T 3LSXA 4IHJE 3R6NA 2AIXA 2XXXA 5KDTA 4EAHA 3G06A 3FUZA 3U3IA 2DQVA 4PFWA 4AISA 1EZ3A 3EDUA 4DMWA 4JI5T 3KZGA 2PX1A 2CCQA 2VHAA 4F1VA 2R71A 2ACXA 4P09A 5A1LA 3U92A 4YLHA 1NNFA 2FUPA 3CRBA 3EHZA 1URDA 4ISTA 3N9PA 3EI0A 5CJ5A 3IFAA 3CWZB 2DXYA 3RYCE 4OFLA 1FPEA 4U72A 2FYIA 1ZIUA 2X9HA 1NNKA 3SEVA 3RX6A 2J62A 2THIA 4F3GA 2H89A 2LT3A 2DDKA 3DP4A 1JNZA 3RF1A 4IO5A 4F22A 3ZKRA 5IAIA 5HEUA 3JV9A 1SQYA 2X0HA 4X20E 2NUVA 5CB4E 3WI3A 3PUXE 4IO2A 4TNVA 4TV9E 1XVYA 2OWZA 5LDZA 3RQTA 4N4UA 2WWVA 1HSLA 4LN5A 1N76A 4HE1A 1IMDA 5AQPB 4DBQA 2V8SV 4YMAA 3TCGA 4BDLA 3VLUA 4QSEA 1JW4A 4DIGA 3CSBA 4IO4A 2XUEA 4OENA 4EF1A 2W63A 4R73A 4DV3T 1W9RA 1JQFA 4LATA 4HGAA 1YXIA 3LJCA 2WU5A 1KWHA 2YJPA 5ITOA 4ELQA 2QL3A 3CG3A 4R75A 2NTXA 1FQDA 2WDQA 1SW2A 3TLSA 4GWWA 3H03A 4MMPA 2B76A 1KZ8A 1XOCA 1ZEEA 4B3RT 5DTBA 1UURA 3E13X 5H8QA 1P99A 4FAJA 5TAOA 4IO3A 3TCHA 5A5LA 5FY0A 2D0TA 3AA7B 4G63A 4H9NC 1LVFA 1JEUA 2OWSA 3MVZA 4PGPA 4HE2A 1LBVA 4NGUA 4IDNA 4DCYA 3TEPA 1IMEA 1DTGA 2RKMA 4I4TE 3FV2A 1ZLQA 4EEBA 1NENA 1CHUA 2IHR1 1S7YA 4QBAA 4PAFA 3BFTA 2H7OA 2CMOA 4H8JA 2HN2A 1D9VA 1SD3A 2WM9A 5HM4B 2LSKA 4GIZA 3DM0A 3OJAA 4N81A 1IAPA 3PUYF 4IDOA 2HEUA 2P0SA 3NKZA 4N17A 2VK9A 4OZ9A 3PMVA 3NVOA 3ZT6A 3N9QA 1R9QA 2B65A 1SYIA 3C34A 3GXAA 4U7IA 2PBIA 1G73A 1MRPA 3LSVA 2MPKA 3MJXA 5LBQB 4H63H 2F7BA 2CMRA 1NH7A 1IMCA 3PV0E 3TTRA 4ZZAA 2WYKA 2CZKA 3A5XA 4CXYA 4WBNE 3PGFA 4ZEDA 4OEUA 4X62T 3B13A 4EXKA 4Q5TA 5H8HB 3FZMB 3R7XA 3RTWB 5M4YA 4MX6A 4UVBB 1L5TA 2XM1A 1S35A 4FE8A 2Q8JA 3I9WA 3RY3A 2QGSA 2ANJA 2RC7A 3M3KA 3AEBA 1FQEA 1I6BA 1FTKA 5KX5E 5H8FB 2QMXA 1ZHCA 4HEAA 5L8DA 2VWAA 5H8SA 3VKHA 2O6AA 2MBGA 3OPCA 5EQ7A 3IR1A 2F3DA 3KBUA 1FQBA 4QXCB 4V1Av 2HXWA 4X66T 1MDQA 3ZCIA 1OMPA 4H5FA 4YB6A 3FATA 4C90A 3PUAA 5AQVB 4Q8RA 2A9UA 4GYSA 3TLWA 4YKKA 5JDHA 3CVRA 1XNRT 2Q9TA 2FJEA 3UU3A 4ZI3D 3UFEA 4TWFA 3FVGA 2QPQA 3TKLB 4MNCA 4UIGA 2V4CA 2CHNA 2JRKA 3A3CA 2YDRA 2UYEA 5H8NA 5F7VA 4I1DA 1MXXA 3CIRA 1J1JA 3QUJA 2AL5A 2OWTA 4PFUA 5FVLA 4U74A 3MW0A 2XPKA 2QS2A 4EEDA 1DSNA 2QVRA 3G3HA 5AA2D 5AFUL 1RYXA 1CNQA 5AQKB 5TPAA 3NOHA 2Q9QA 1FQCA 1FPIA 3NZQA 2WBLA 1OEDE 5AQFB 1TWYA 3RYHE 2RCAA 3D4CA 3B8BA 5EK3A 1M5DA 3GWHA 5LCYA 5AQUB 2QVVA 2Q89A 2B1EA 5GONE 5HEOA 2UXXB 2ZYNA 3QNUA 5I57A 1US4A 4EB6E 4NAPA 4GX4A 3KVBA 4CI3B 3MKDA 3SRZA 1IJ6A 2P2AA 3MK7C 3FXQA 3SETA 2A5SA 2F34A 5AQRB 3I0OA 5H8FA 1P1OA 3Q5DA 1N3WA 4OFZA 4OVPA 4NF8B 1BKAA 4K3FA 2Z22A 3FD3A 5L9OA 4CQIA 4PDDA 1B2HA 4YT0A 4MF3A 4PF6A 5DVJA 1AL3A 4JB7A 5J2UE 3EF7A 1URSA 1OQGA 1SI1A 2EHOD 4LFBT 3AE5A 4LZ8A 1Z7NE 3L09A 4PBQA 2D9DA 3TYHA 1KFYA 1N7XA 2JQHA 4DV5T 1B40A 1HCIA 5LOVE 2MKZA 2B3BA 1LB8A 4JBZA 5F3JA 3RH3A 2W62A 3EKIA 1MH4A 2BZBA 1FBPA 1O64A 3N2GE 1A54A 3KBRA 5TP9A 5KCJB 4AS5A 1DCUA 4OMBA 2WS3A 5AQGB 1NKXA 3MPKA 2DE2A 2XX9A 3UN6A 4G68C 4P47A 3F57A 3FIRA 3KOSA 4KR5A 4N8GA 5I59B 3KV6A 4G2AA 1MY2A 3AE9A 4F1YA 5CC2A 3LG7A 4TLMB 4X1BA 2YU1A 3HA4A 5FY1A 2H9BA 1IQ7A 1B3GA 2EHOA 2K3WA 1IMFA 1OLAA 4ERRA 2O69A 3KSJA 2LAOA 2CXDA 1GR2A 2HXRA 4GFRA 4OEVA 4POWA 3E0ZA 3ZMZB 2F97A 3N5LA 1UTHB 2N9DA 5TPAB 4OFOA 3K01A 3LBSA 5J1DA 1MMAA 3I3VA 4H45A 1CUNA 1NH8A 1Y9UA 4PFYA 4NXNT 2I6EA 4ILBA 2OV9A 1MXWA 2M6IA 2LOPA 2H98A 2ZYOA 5IZ3B 4DI4B 4COFA 2XWIA 4QFOA 3EUHA 3RTFB 2JMKA 4PJMA 2XXHA 1E2AA 2HFBA 4GXAA 4OETA 4OYVA 2XY8B 1FQFA 3UP9A 1DTZA 5HAXA 2Y6XA 5AQLB 4ZHQE 1NUYA 5IZZA 5JDQA 3WAJA 3LR1A 4N6DA 1R8IA 2Q8MA 1LBXA 3VVEA 1UX4A 3AAEB 3EQ1A 4X9TA 4BDMA 3J7Yq 3LSLA 4U2RA 2CXLA 1IZ1A 4G68A 4Z7EA 3FZVA 1B52A 4J2CA 3L6GA 1BR1A 3IB1A 4ZI7E 4ISSA 3EABA 2R9JA 1AH5A 2IIUA 5IM2A 5AQJB 3IOWA 3ZYLA 1N3XA 3VHLA 3FBPA 2Y5KA 4Z91A 2VB6A 3QMFA 1Q35A 4HW8A 4QF9A 3ZSFA 1H44A 3NZPA 2QRYA 3MSTA 1LBZA 4F3PA 5IGAA 4AKRB 4X8RA 3N2KE 2YDQA 3ZYKA 3KV9A 2F7AA 4IR8A 2V25A 4NEDA 1FJ9A 4LQ5A 4H9QC 3C4WA 5LG4A 3IA3A 4KI0E 2H4IA 1FTJA 1NV0A 1ZOYA 2XSAA 1VSOA 3C64A 3RI5A 2PVUA 4IO6A 2CM0A 1TXFA 4O8SA 5LMUT 3VKGA 1FMWA 2NXOA 2DWJA 4EXTA 3IORA 2WAUA 3CIJA 1SVXB 2Q74A 4F3BA 3IBPA 5J16A 1HNZT 1T8BA 2W2UA 2DWHA 1ZKEA 4L9IA 3B57A 3KSXA 3PUZF 5ET8A 3MXZA 3R6UA 1MPDA 1BTJA 2VL0A 4AS4A 1NV3A 5FVKA 3O28A 1OVTA 3F2EA 1LRZA 4MLQA 5LOMA 4IE4A 3CFXA 2L9QA 3CFLA 3A09A 4IGUA 5JRCB 2XXTA 2I58A 5BUUA 4R6YA 1NNPA 2OZZA 2UVGA 3CR9A 3M65A 1LAXA 1B5IA 1R6ZA 1FSAA 4TNWA 5LJNA 5T3JA 4ESWA 2VURA 3FZKB 5L3CB 1BK4A 3N9LA 3OO8A 4GLIA 3FV1A 3PUVF 1A7LA 3IO4A 4HFIA 4ADZA 1NEKA 1O3XA 1NV1A 5I7IA 3Q5EA 3B6WA 4N07A 1QGXA 4H9SE 2DWAA 5AA2A 1NNTA 4BDOA 2LM2A 1M62A 1CB6A 4I40A 3GN5A 2I0CA 4GYRA 3JYRA 4KFQA 3ZS6A 3EN3A 4PK6A 1HR0T 3ZSSA 3PPRA 2WYPA 5F8PA 3FXRA 1LFGA 5EQAA 2YU2A 2HHHT 3SEYA 4DDDA 5HWYA 4N78D 1QKBA 4OHNA 2WY2A 2CZHA 4KYEA 4LA9A 2IEEA 2XZEA 3P4PA 4EQ9A 3PUGA 3VFJA 3GN5B 4O3BA 4XFEA 4ANJA 2G0UA 5FBPA 3C4XA 2Z6EA 4ZI3C 5L3BB 2J4GA 3O1JA 5AQOB 1B32A 4BJNA 1P1NA 4YB7A 1OLCA 1HS7A 1T98A 4NTLA 5LTCA 4N91A 5H6QB 1LAHE 1SDXA 1T7SA 4UACA 3OSQA 3Q27A 5DVFA 2MAWA 4O4IE 5EK4A 3M3ZB 2PTFA 4LVQA 3A8YC 4KQPA 3VDFA 1MIVA 4DO0A 2JQQA 4ZE8A 2X68A 2LHNA 2VASA 1NV7A 1RDZA 2WQYA 5FL0A 4P9KA 1FQAA 3PPNA 3OO6A 4KCDA 2XXWA 3H6WA 4OVQA 3VR8A 1B3HA 4F39A 3AEDA 3KN7A 2PJQA 2Y7KA 2LJLA 3PDYA 1KA0A 2ZM8A 4LF9T 2JIWA 4NF4A 2XSBA 4GWXA 5I5PA 3SEWA 3K2DA 2HH7A 2QVUA 5HEJA 4LFAT 2NVUB 3LSFB 2UXAA 2BG9A 3UUBA 1K9YA 3PTYA 1OWAA 4KD5A 2LM9A 4ZEBA 3ZC0A 2X0LB 2IAKA 4OA4A 3FXBA 2KQZA 3PMXA 2KLFA 3DJBA 4H8IA 2E8IA 3OSRA 3LSWA 4KP3C 3AE2A 4UV9B 2XQ3A 4JWOA 3OEKA 1LLSA 2D5WA 2HAVA 2LSJA 1FJGT 1D1AA 3ZMSB 4ILCA 5FHOA 3RT6B 2IA4A 2K48A 5JDLA 3ISPA 3DP7A 2BG9C 1QKAA 4NMYA 3FJGA 4O8MA 4DR3T 3D4GA 4IIJE 3K1SA 2UXDT 2BG9E 3K1PA 2ZYKA 4RJZA 3F31A 4QH4A 2E9XD 3UQ7A 1KNRA 4FATA 2Q9QD 3T8OA 3X1DA 4H6DA 3PUQA 1POY1 3TTNA 4GOUA 1WYCA 3AE8A 2ZLYA 4X1YE 3UFGA 1BIYA 1D9YA 3T96B 4ESXA 2XQ7A 3JADA 5CGMA 5L3DB 1LCTA 4H9PC 1MQJA 2X9WA 4KHPT 3RC8A 1JETA 2ZZXA 4YKJA 4XXUA 5LNKA 3T9VA 5LHHB 4UXNB 5L9MA 4A97A 1XMOT 3SFEA 3E3KA 2FJBA 3PD9A 3VXCA 4HS7A 3K1MA 1JEVA 2O1LA 4NG7A 1UQWA 2VT5A 2VQFT 4P1LA 4F2OA 3ODBA 1MY3A 2NOOA 3EPEA 4MEVA 3QC9A 4DUYT 1I6ZA 2B3FA 4PNIA 1LCFA 4MNIA 1DU2A 3L8RA 3UU6A 5LXTE 2M8CA 3VRAA 3PUSA 5LA6E 3G3GA 4A98A 1IXIA 1VR5A 3KG2A 1B05A 2E5LT 4GIWA 1IBKT 3SERA 4TWDA 1DPPA 1SPIA 3MBPA 1Y1ZA 4B6XA 3PE0A 4WYVA 4TUYE 3AECA 3CKDA 2BBHA 1N84A 5AE4A 3JAFA 2V3UA 4ZEKA 4P1EA 4RK9A 3OKQA 4MNPA 3UUMA 2V26A 3KBTA 1D0YA 2K9AA 5L3FB 1Y3QA 1QUJA 2GHBA 4RK2A 2DL1A 5LB7B 4HFDA 5FL1A 2UUBT 2AL4A 4PDHA 3UORA 2CEAA 2DE4A 4U22A 5EYFA 1P1QA 2JPFA 2BJIA 1NV4A 3A7MA 3MC2A 3GLBA 2WDRA 4EYYR 1LVKA 4ELRA 4HXVA 3KJTA 2A5TB 2DWIA 4FORA 3RLFE 4KMCA 1LSTA 2V6YA 3P7IA 4X65T 1TT1A 2HPJA 3I5OA 3N6TA 2W00A 5L2LA 1OXZA 4YHHT 4K0UA 3T1YT 1IXGA 4KPTA 1FTMA 4NN3A 2XA5A 3FXUA 4QH1A 4GWUA 2XWOA 3HR0A 5JDNA 3TQWA 4PAGA 1MXYA 4ZS9A 4XKRA 4U2YA 3L6HA 2NR4A 4IGRA 1INPA 3U94A 1B46A 2QS3A 2XXPA 1QVSA 2Z8EA 3UUNA 4GWZA 2P3VA 1X9BA 5CM6A 2CWOA 4R6HA 2V6XA 3V5UA 3ZCJA 1J5ET 4DR6T 3RRCA 1NV5A 2BDEA 4ZI2D 3ZSTA 3FZHB 4GKJT 3RPLB 4R2FA 4OQOA 2DLRA 5I84A 4LP2B 4GF8A 5JH7E 4TZ4C 2V6YB 3AEFA 3QSLA 3U72A 3KDSE 2OLBA 4YTNA 1L0VA 4G68B 5K2XA 4R9FA 3LUYA 2I6HA 5HXSA 3UULA 3N94A 4RPOA 3C98B 4GRKA 3C50A 3IB2A 3QOFA 4R74A 4HTGA 2X9YA 2K24A 2I4BA 2LE8A 1JNRA 5J2TE 2HPGA 3PD8A 2VP1A 3O1IA 2PMSA 4R2BA 3T93B 4U21A 1LFHA 2WMNA 4LF8T 4DUZT 5JK4A 5LP6E 2YLNA 4EF2A 5HXCA 4JVDA 3A29A 1Z7ME 2F3BA 5M2VA 3IJOB 1NMUA 5KMGP 3OENA 5IWAT 2X0YA 4F19A 3BQKA 3BFUA 3QB5A 2B4MA 4OYKA 2RC9A 5CBSA 4LZ5A 3OTOT 2X66A 2ONRA 4MAGA 3VLWA 3PUVE 3H4ZA 5FMNA 3IK6B 2I59A 1UTBB 3AE1A 3O2AA 3ZKLA 5CMMA 1MXUA 4NF0A 5AQQB 3O9PA 4DXBA 2VL8A 2D21A 2Y7WA 3MP8A 4ILAA 4GWYA 2GH9A 1IJ5A 3AAAB 3SEXA 4G8NA 3U93A 2D3IA 1LBBA 1FTLA 2NW7A 3JC6D 5IHYA 4JV5T 2DI4A 1WR6A 4ZE9A 4NX1A 4PFBA 1DOTA 3K6WA 3MP1A 3KV4A 1LBCA 2XD2A 4ZZCA 5EHSA 4U4XA 4DV6T 4C1TA 5L9SA 3RIUA 3K1NA 2RPAA 2XQ9A 3N9MA 3UGWA 3B7DA 4I50E 5AA2B 5JVDE 4GBWA 1Y20A 4EZHA 3EHUA 4JI4T 1D3KA 1S94A 2RP4A 4H0WA 4NWCA 1LGBC 1URGA 4QWNB 4U2ZA 3HHFA 4N13A 4IE5A 4PJNA 5LYJE 3ETUA 4GKKT 3DP6A 1J5WA 3E22E 4ASKA 1OEDA 2IC6A 2YOEA 3VVFA 3G7WA 4TQUQ 3GBAA 1HF8A 1MIYA 2DOJA 2V7JA 3SS1A 2AE9A 3ILUB 3K0VA 4GXSB 5F1QA 1XDOA 4DIDB 4QFKA 2X9XA 1USYH 2WZHA 2R6GF 1Y3PA 3IFCA 4JI3T 1FEWA 4WEDA 4YMBA 4YKPA 5KDMC 4TWHA 3TCFA 4MLKA 4YSYA 1PBQA 3C31A 1WFDA 3OELA 4ZEFA 4I55E 2ZZVA 4UF0B 3RIAA 4BDNA 3VXBA 4ZXLA 5CMBA 1UK5A 2QA7A 4P8BA 1MY4A 3SWHA 2XQAA 3OO7A 4U1OA 2I48A 1A99A 5I57B 3CQGB 4F31B 1FTAA 1E1HB 3ANWA 4BA9A
chains in the Genus database with same CATH topology
3V89B 2XX8A 1M5EA 3G3JA 3T66A 1I6QA 1D4NA 5FXZA 1XT8A 5BMVE 1WODA 3CX6B 3PUWE 4IY6A 1MNEA 5CI5A 2YPNA 3N6UA 3RGYA 2BJJX 1NAFA 1QUUA 3ZPOA 5FNVE 1US5A 2NW8A 3PU3A 5CA0E 3T9HB 3KVAA 3Q25A 1B4HA 4RXLA 2V84A 3UUXB 3R84B 3IB0A 2KINB 2QJEA 3CQCB 2KMFA 1FIOA 3HKEE 1IUDA 3K6UA 3MQ9A 2ZNUA 3TDJA 2K5BB 4FJPA 2RF1A 1S9TA 2C5IT 1VFDA 4H1XA 4EQBA 5JDGA 5HXHA 1MPBA 4G4PA 4O3AA 2KNDA 3AB3B 5L3EB 1WVJA 2DSFA 4JLEA 2KT9A 2DCFA 3RYFE 4EQ7A 1Y3NA 3RPUA 2N2NA 3H6UA 4UA8A 1YD8G 3KINB 3U78A 4L17A 3CSGA 2Q9QC 3ZMTB 3RYIE 3V5SA 4EOZB 3TZAA 5EZYE 2UYFA 4KCCA 4ZZEA 2Q2AA 3VVDA 2ZXTA 4KBMB 4OESA 5BWJA 4XKNA 5I56A 1GV8A 3BQLA 3LFMA 2F8DA 3H7MA 2CZLA 5DEXB 4CZZB 2I0BA 3BQIA 2NWJA 1QJMA 3KFMA 3UIFA 2C0SA 2OBGA 4ECFA 3KN8A 1HG2A 4AI6A 3EVYA 1B0HA 5I2KB 5IKBA 5H6RB 5TP9B 2V7KA 2DVZA 1MH3A 5JREA 1H43A 4QFNA 1OQHA 4MBPA 2XAQB 5HXEA 3UK4A 2ABHA 4XAXB 5H8HA 1MY0A 3SDFA 3S2VA 2OA5A 5DQWA 1BLFA 1MDP1 4U23A 5L3GB 2KLQA 2BVMA 3G3FA 3PUYE 1VRBA 4WBOA 1BR0A 3GZGA 3MVXA 2FNCA 1PB9A 1PBPA 4KYSA 2XQYA 5HBCA 3FB2A 2ES0A 4FIMA 1SW5A 3IL1B 2G29A 3VV5A 2HCAA 1YPNA 3USDA 4JUYA 4ZS2A 5HYAA 1NFTA 2ZMBA 2HZLA 4I9DA 1JW5A 2NTYA 4XIGQ 2OK2A 1MM6A 2Q9QB 1NWMX 3N2OA 1UTBA 1UCUA 1XS5A 4HKAA 2XHEB 2XASB 2PT2A 1OIBA 4NE4A 2DS9A 2UVJA 1MQHA 4O3CA 4TOZA 3U1OA 4DVDA 3HO7A 4OFJA 2F5XA 4TX5A 2M67A 4QX8B 2ZM0A 4KUMB 4IO7A 1US7B 4UELA 1EU8A 4Q0CA 3KOTA 1JNFA 3TKDA 4AKLA 3E9XA 1MMNA 1FMVA 1IXCA 3MZKB 3RKOA 4XTCQ 4RPNA 2H25A 3LK2B 4WNKA 2ESNA 3AXFA 2Y48B 3WAEA 3JZJA 4QRZA 4F2QA 4EZ4A 4G77A 4HFVA 1CE2A 1GTKA 4UV8B 3DP8A 1MNDA 4BJMA 3TUSA 2I49A 3VLVA 4YB5A 4NUUA 3EDVA 4TLLB 3GA8A 1N7WA 3IOVA 4GOTA 5CRYA 4JXIA 3C51A 1MIWA 5ITPA 5LHIB 2XTLA 4X48A 1ZMGA 2YK0A 4YJ3E 2Z8FA 5DJQC 3J9X1 4O2AE 5LBMA 4ZI2C 1GVCA 5I2NB 4ELOA 3QK6A 1MXZA 1VE4A 4H9RC 1LFIA 2G93A 4E7ZA 3WAFA 4DLDA 3MPLA 4LQ2A 1AMFA 2CA5A 2EHOB 4KYDA 1IIWA 1Y4CA 2I4CA 4ILUA 4LONB 2ZNSA 5DQVA 4M4GA 2LSIA 5KDTB 4F29A 1YAEA 2DYXA 3HV1A 4DNDA 5KCJA 2WWUA 1GGGA 2J1DG 5JR9B 2N1GA 1JVYA 3IF8B 4MH5A 2DVCA 5JDFA 4H65A 5I56B 4GL8A 4YU0A 2V3TA 3ZMVB 5A5XA 3LBXB 3KFWX 1A8FA 3T22A 3S9NC 4GQOA 5JR9C 1KNZA 4EIWA 5FXVA 2E0SA 1O7TA 3UA8A 1G8XA 3ESLA 2VKJA 4DCXA 1YKHB 1DMBA 3OOAA 2X7QA 3SOLA 1TFAA 3MAMA 4DXCA 4NF5B 3E08A 3TFLA 1BR4A 5FXWA 1XVXA 3M8UA 1XC1A 3E4RA 4MLVA 4DBRA 3IOTA 3K02A 4C91A 2RC8A 3O4XE 1II5A 2X67A 1ATGA 1MPCA 3MACA 2KWIB 1A8EA 4LUBA 4ZS3A 2UXNB 1LAGE 3QIMA 1PB7A 1R1NA 2VOZA 5H8QB 3C9HA 4AQGA 2P9BA 3I0QA 2X7PA 1YKEB 3TQLA 2PBWA 3ZLIA 3RUMA 3O1HA 2E9XB 1JW1A 2FA7A 2VD3A 5ADXL 4EXLA 3MZBA 1OVBA 5ELVA 4XZCA 4QSDA 5LGNB 1HX8A 5LHGB 4PK5A 5J1GA 2V3QA 2KWHA 3ZMUB 2QS1A 2LEHA 4M1PA 2E9XC 2OCUA 3MA9A 3Q5WA 1IEJA 4PETA 2XAJB 3NRYA 3FVOA 4JEUB 3V83A 2L8KA 3TTMA 3AVRA 3H6VA 3FHNA 4OVJA 1ELJA 2F35A 3EHSA 3R26A 1JVXA 1PC3A 4LZ7A 4NWDA 4PFOA 2KZ7B 5HXRA 2GFEA 2W61A 4POXA 5JEIA 3DTOA 4AXPA 2EHOC 4NF8A 5FHMA 4IE6A 5FP3A 4F3SA 1U5PA 3ZJ2A 2XX7A 4JWYA 1M5CA 3MWBA 4DXUA 1POTA 4BDRA 2WSSV 4RA1A 4L5GA 2UVIA 5DYHA 4GD5A 2O7IA 4GL0A 2V93A 3CPZA 3C4MA 4HCWA 1EH3A 2I3VA 4I8CA 3HPIA 2O84X 2WMOA 3ZEFB 3O6GA 4AKIA 2MYSA 1H45A 1D1CA 3K3NA 1ZBMA 1UIVA 5HPQA 2F78A 2OJTA 3QAXA 2XXVA 4HN9A 4OERA 3S4UA 2DE3A 4PE5B 3CX7B 3HI2A 1FCKA 2F36A 3WAKA 4E0WA 2Q88A 3AA0B 2REJA 5H8NB 4U4SA 4PFPA 5K2YA 4E7SA 4MFRA 3C33A 4MALA 4KHZE 2DXRA 3MJNA 3IJXB 3HKBE 4P11A 4O4JE 4YHJA 4EYUA 2W7YA 4Z0IA 1QUIA 4F6RC 3TODA 1Q1KA 1MMDA 1WDNA 3FXDB 3KGCA 3K6VA 3B6QA 4GWOA 5AA4B 1SHZC 3MZ9A 3HCQA 1UIUA 4O4LE 1KK7A 4BLAA 3VU7H 5ICTA 3PPQA 4AQ4A 3BK9A 1B3EA 2V7IA 3N26A 1H7CA 3VE1B 3NRXA 4P0GA 2Y84A 1Y4TA 3SEUA 4UEMA 3H06B 4QX7B 2R6GE 3HL6A 2XHDA 3C35A 3CVGA 1B7ZA 1P1WA 4YZZA 3PU5A 4RYAA 5I58A 1B5HA 2DWKA 4NF6A 4GK5E 3OYZA 2RA1A 4IDZA 3ZC1A 4QFLA 1AIVA 3W15C 3O6HA 4CI1B 5IYZE 1ZKBA 3LK3B 1B1XA 2LSYA 3HKDE 5A5XB 3F11A 3I9YA 3OXNA 3S9MC 5FHNA 4PJLA 1B3FA 5JTYA 4M1VA 2IC9A 1SI0A 5FTIA 2MOZA 4JWXA 1USYE 3IAZA 2Y7IA 2WKYA 3Q2MA 1EZPA 3OMBA 1WYBA 4C0RA 2NP9A 4DE8A 3RRWA 1R9LA 4DMVA 4NF4B 4WKMA 3UT5E 3O97A 4RY1A 2ONKE 4OK0A 3HHGA 4OYJA 1NL5A 1B5JA 2QMWA 2ZNTA 4YAHX 1O63A 4R9GA 5DT6A 5ISUA 2XD3A 3OYXA 4N6PA 4C1UA 3MVWA 4X1KE 3FJ7A 1YTVA 5I2NA 1ZU0A 1RYOA 2ZM2A 3FGSA 1PB8A 1SBPA 2CE7A 4THIA 1MQIA 2NW9A 2RCBA 4YFSA 1MQDA 2H3RA 3FJMA 5AA1A 3TAJA 2I3WA 3JC6C 1D0ZA 1B9JA 2GHAA 3HKCE 2Z23A 3OO9A 1QULA 4BAYB 1F9BA 2F6PA 1SW4A 3FASA 1X79A 1B3LA 2ODUA 1HFAA 2A3DA 5LGTB 2XXYA 3Q5XA 3PPPA 3NBXX 3IO6A 3W15B 1BP5A 1M5BA 1V9DA 4XKPA 4GK0E 2RINA 2AYSA 4PQJA 5TU0A 2O51A 5B70A 4NF5A 2IW5B 2XAHB 1BR2A 1D1BA 2H7VC 1YW0A 4H5GA 3MUQA 1UX5A 1UTHA 3FBZA 2DNXA 3Q9DA 3CQXC 1XHYA 4R72A 3W9WA 3QUFA 3W9VA 4ZEIA 3S9LC 4OTEA 2V7MA 1N04A 2VD2A 3O66A 3ANWB 5AA3A 1SYHA 4YICA 2VKOA 2QSXA 1QUKA 4TV8E 3IEEA 5HWXA 3PUZE 2XXUA 3ZN1B 1LAFE 3S9EA 3B6TA 4IGTA 1SA0E 2ALUA 4CXWA 1LKXA 2VKDA 4G2ZA 2YINA 3PMWA 1VOMA 4P0BA 4ZOLE 4WW0A 1M5FA 4P0IA 1B7TA 5JRCA 1B6HA 4HE8A 3C4ZA 4OXVA 1HSEA 1Z0PA 4U1ZA 3H3AA 4QXBB 3LK42 3T9XB 4AKGA 4X1DA 1MY1A 4ONYA 2ZMAA 4FEBA 3ZJ1A 2JMHA 1IZNB 2ODVA 4NUVA 1B7HA 2DP8A 4JSOA 5JTYB 2A72A 1VFEA 5CMCA 4F1UA 3O9XA 4OHFA 4QXHB 2HAUA 4GVOA 4JSDA 3M3FA 4X1IE 1DPEA 5AA4A 4F18A 3GBBA 3CFZA 4AB6A 4OWDA 3KJ7A 3KN3A 2C5KT 4L0RA 5I58B 2YEVC 1WLXA 2F6GA 2Y8DA 3U8QA 3Q26A 2LSGA 1AJ3A 4MFIA 3AVSA 2ZYMA 1IITA 5KZTA 1MXVA 4I43B 3ETVA 3HSTA 4WEPA 3BKIB 3UTKA 5LGUB 4CI2B 3DELB 5ETWA 4QSCA 5EK2A 1A40A 2XAGB 3IX1A 2H5YA 4JEHB 1I69A 3RT8A 4IB2A 3FBLA 2L3LA 3TMGA 3K3OA 3K00A 1WRDA 2PG8A 3FXEB 2O7UA 2Q2CA 3IHRA 2LHRA 3RNNA 2CLYC 1B7UA 4YKIA 1H3DA 4HTEA 3BBRA 5C8YE 2O68A 4UVCB 1B51A 5EHMA 2P1SA 1Y64B 2CXFA 3O6IA 3ZYMA 2XAFB 5DVIA 1ZV4X 4ELPA 2CLYB 4AQFA 1FW0A 4I62A 1MG1A 2D0UA 3PURA 2VKHA 4IY5A 2NOXA 2PFVA 4FEDA 2O1MA 3O29A 4XBFB 3C32A 3SKPA 3ECRA 5ICQA 3AA1B 2F7CA 3KV5A 2ONSA 1A55A 5I59A 4PP0A 5FYMA 1B0LA 1MS7A 3HN0A 4XKQA 4PJJA 3N9NA 1QW0A 4WXJA 1MQGA 2A5TA 5LJMA 1RKMA 4E0XA 5DABA 4EDPA 5DEXA 5E0OA 2BVLA 3CMLA 3Q28A 2VGQA 4MBQA 4UF0A 4H63V 4O4HE 2Z8DA 1J1NA 4H67A 2MTQA 4NF6B 4UVAB 4RNSA 3AA6B 3IOUA 4FECA 1N0TA 3V5AA 4G8MA 3QXMA 3I6VA 4EUOA 4MHCA 2NWBA 3TTLA 3N9OA 4FI5A 2JJ9A 5FTHA 1FTOA 4PW8A 4ZDMA 3TTKA 1EZOA 1ZTYA 3SESA 1ZJLA 3LC8A 2C5JA 3FVKA 3H6TA 3EHTA 4QHQA 3T9UA 2XXQA 3ILTB 4PK4A 1QSDA 3CX8B 3DLNA 2REGA 4YJ2E 4DZ1A 3D0TA 3OEMA 4G8HA 3ZN0B 4AB5A 3TELA 5CA1E 5JDMA 5FXXA 1MM7A 4AQFC 2H99A 4TN7B 2KXPB 3K3QC 2PT1A 2GK9A 4ISUA 4ZECA 2QS4A 4PFTA 3K8PC 3RN8A 2X26A 3MVYA 4A56A 4AKHA 3Q29A 3ONXA 1ANFA 2CWYA 2Y7PA 4ND9A 2A2FX 1B4ZA 2Y7RA 4JDFA 2E9XA 4Z8XA 3P8CD 2HZKA 2XXRA 4IE0A 5CBRA 1YCJA 3THIA 1P1UA 3MZ1A 1I6AA 3G3IA 5FY7A 5JQGE 3M3LA 3OBVE 3FVNA 2XXIA 1T0KA 1S50A 3KEIA 3LBXA 2D5UA 1B58A 3K4UA 4QFPA 2PYYA 2W0GA 3CG1A 1Y1MA 3H37A 2E1SA 3A3UA 3H3GA 2X51A 1LB9A 3TPAA 4O2BE 5CMKA 2DHRA 2HQ0A 3K6XA 4FJOA 3I1AA 2SPCA 3AAIA 3L3PA 1U4QA 1MMGA 1IXHA 1B1HA 1D0XA 1TFDA 3RPWA 3MP6A 4Q30B 1HTJF 1HG5A 1PEBA 3OD7A 3ONMA 3CI8A 2HPLA 5B7DA 1EZ9A 2LOSA 3PU8A 2UVHA 1H76A 5I2KA 4QKNA 2D2SA 3PPOA 3V8XB 4HCYA 4CXXA 3PTRB 3QYTA 2GRVA 4R6KA 1SW1A 1PDAA 4IE7A 2V1DB 4P0AA 2DWGA 3GMIA 3C36A 1AOVA 3ZKKA 1HSJA 2V7LA 4H9OC 5JR9A 4QHOA 4BDQA 3G3KA 3RC3A 3LSXA 4IHJE 3R6NA 2AIXA 2XXXA 5KDTA 4EAHA 3FUZA 3U3IA 2DQVA 4PFWA 1EZ3A 3EDUA 4DMWA 3KZGA 2PX1A 2CCQA 2VHAA 4F1VA 2R71A 2ACXA 4P09A 5A1LA 3U92A 4YLHA 1NNFA 3CRBA 1URDA 4ISTA 3N9PA 3CWZB 2DXYA 3RYCE 4OFLA 4U72A 2FYIA 1ZIUA 2X9HA 1NNKA 3SEVA 3RX6A 2THIA 4F3GA 2LT3A 3DP4A 4IO5A 4F22A 5IAIA 3JV9A 1SQYA 4X20E 2NUVA 5CB4E 3WI3A 3PUXE 4IO2A 4TV9E 1XVYA 3RQTA 1HSLA 1N76A 4DBQA 4YMAA 3TCGA 4BDLA 3VLUA 4QSEA 1JW4A 4DIGA 3CSBA 4IO4A 2XUEA 4OENA 4EF1A 2W63A 4R73A 1JQFA 4LATA 4HGAA 3LJCA 1KWHA 2YJPA 4ELQA 5ITOA 2QL3A 3CG3A 4R75A 2NTXA 1FQDA 1SW2A 3H03A 1XOCA 1ZEEA 5DTBA 3E13X 5H8QA 1P99A 4FAJA 5TAOA 4IO3A 3TCHA 5FY0A 2D0TA 3AA7B 4G63A 4H9NC 1LVFA 1JEUA 2OWSA 3MVZA 4DCYA 3TEPA 1DTGA 2RKMA 4I4TE 3FV2A 1ZLQA 1S7YA 3BFTA 2H7OA 2CMOA 4H8JA 1D9VA 1SD3A 2WM9A 5HM4B 2LSKA 4GIZA 3DM0A 3OJAA 1IAPA 2HEUA 2P0SA 4OZ9A 2VK9A 3PMVA 3N9QA 1R9QA 2B65A 1SYIA 3C34A 3GXAA 2PBIA 1G73A 1MRPA 3MJXA 5LBQB 4H63H 2F7BA 2CMRA 1NH7A 3PV0E 3TTRA 4ZZAA 3A5XA 4CXYA 4WBNE 3PGFA 4ZEDA 4OEUA 3B13A 4EXKA 4Q5TA 5H8HB 3R7XA 3RTWB 5M4YA 1L5TA 4UVBB 1S35A 4FE8A 2Q8JA 3I9WA 3RY3A 2QGSA 2ANJA 2RC7A 3M3KA 1FQEA 1I6BA 1FTKA 5KX5E 5H8FB 2QMXA 1ZHCA 4HEAA 5L8DA 2VWAA 5H8SA 3VKHA 2O6AA 2MBGA 3IR1A 3KBUA 1FQBA 4QXCB 4V1Av 2HXWA 1MDQA 3ZCIA 1OMPA 4H5FA 4YB6A 3FATA 4C90A 3PUAA 4Q8RA 4GYSA 4YKKA 5JDHA 3CVRA 2Q9TA 4ZI3D 3UFEA 3FVGA 2QPQA 3TKLB 4UIGA 3A3CA 2JRKA 2UYEA 5H8NA 5F7VA 4I1DA 1MXXA 3QUJA 2AL5A 2OWTA 4PFUA 4U74A 3MW0A 2QS2A 1DSNA 3G3HA 5AA2D 5AFUL 1RYXA 5TPAA 2Q9QA 1FQCA 3NZQA 2WBLA 1TWYA 3RYHE 2RCAA 3D4CA 5EK3A 1M5DA 3GWHA 5LCYA 2Q89A 2B1EA 5GONE 2UXXB 2ZYNA 5I57A 1US4A 4EB6E 3KVBA 4CI3B 3MKDA 3SRZA 1IJ6A 2P2AA 3MK7C 3FXQA 3SETA 2A5SA 2F34A 3I0OA 5H8FA 1P1OA 1N3WA 4OFZA 4NF8B 1BKAA 4K3FA 2Z22A 3FD3A 5L9OA 4CQIA 1B2HA 4MF3A 5DVJA 1AL3A 4JB7A 5J2UE 3EF7A 1URSA 1OQGA 1SI1A 2EHOD 4LZ8A 1Z7NE 3L09A 3TYHA 1N7XA 1B40A 1HCIA 5LOVE 2B3BA 1LB8A 4JBZA 5F3JA 3RH3A 2W62A 1MH4A 2BZBA 1O64A 3N2GE 1A54A 3KBRA 5TP9A 5KCJB 4OMBA 1NKXA 3MPKA 2DE2A 2XX9A 3UN6A 4G68C 3F57A 3FIRA 3KOSA 4KR5A 5I59B 3KV6A 4G2AA 1MY2A 4F1YA 5CC2A 3LG7A 4TLMB 4X1BA 2YU1A 2H9BA 3HA4A 5FY1A 1IQ7A 1B3GA 2EHOA 1OLAA 4ERRA 2O69A 3KSJA 2LAOA 2CXDA 1GR2A 4GFRA 4OEVA 4POWA 3E0ZA 3ZMZB 2F97A 3N5LA 1UTHB 2N9DA 5TPAB 4OFOA 3K01A 3LBSA 5J1DA 1MMAA 3I3VA 1CUNA 1NH8A 1Y9UA 4PFYA 2I6EA 1MXWA 2LOPA 2H98A 2ZYOA 4QFOA 3EUHA 3RTFB 2JMKA 4PJMA 2XXHA 2HFBA 4GXAA 4OETA 4OYVA 1FQFA 3UP9A 1DTZA 5HAXA 2Y6XA 4ZHQE 5JDQA 3WAJA 3LR1A 3VVEA 1UX4A 3AAEB 3EQ1A 4X9TA 4BDMA 3J7Yq 3LSLA 4U2RA 2CXLA 1IZ1A 4G68A 4Z7EA 3FZVA 1B52A 4J2CA 3L6GA 1BR1A 3IB1A 4ZI7E 4ISSA 2R9JA 1AH5A 3IOWA 3ZYLA 1N3XA 3VHLA 2VB6A 1Q35A 4HW8A 4QF9A 3ZSFA 1H44A 3NZPA 2QRYA 4F3PA 4AKRB 3N2KE 3ZYKA 3KV9A 2F7AA 2V25A 4NEDA 4LQ5A 4H9QC 3C4WA 5LG4A 4KI0E 2H4IA 1FTJA 1VSOA 3C64A 2PVUA 4IO6A 2CM0A 1TXFA 4O8SA 3VKGA 1FMWA 2NXOA 2DWJA 4EXTA 3IORA 2WAUA 3CIJA 1SVXB 4F3BA 3IBPA 2DWHA 1ZKEA 4L9IA 3B57A 3KSXA 3MXZA 3R6UA 1MPDA 1BTJA 3O28A 1OVTA 3F2EA 1LRZA 4MLQA 5LOMA 4IE4A 3CFXA 2L9QA 3CFLA 3A09A 4IGUA 5JRCB 2XXTA 2I58A 5BUUA 4R6YA 1NNPA 2OZZA 2UVGA 3CR9A 3M65A 1LAXA 1B5IA 1R6ZA 5LJNA 4ESWA 5L3CB 3OO8A 3N9LA 4GLIA 3FV1A 1A7LA 3IO4A 4ADZA 1O3XA 3B6WA 4N07A 2DWAA 4H9SE 5AA2A 1NNTA 4BDOA 1CB6A 3GN5A 2I0CA 4GYRA 3JYRA 4KFQA 3ZS6A 3EN3A 4PK6A 3PPRA 5F8PA 3FXRA 1LFGA 2YU2A 3SEYA 4DDDA 5HWYA 4N78D 1QKBA 4OHNA 4KYEA 4LA9A 2IEEA 4EQ9A 3PUGA 3VFJA 3GN5B 4O3BA 4ANJA 2G0UA 3C4XA 2Z6EA 4ZI3C 5L3BB 3O1JA 1B32A 4BJNA 1P1NA 4YB7A 1OLCA 1HS7A 1T98A 4NTLA 5H6QB 1LAHE 1SDXA 4UACA 3OSQA 3Q27A 5DVFA 4O4IE 5EK4A 4LVQA 4KQPA 3VDFA 1MIVA 4DO0A 2JQQA 4ZE8A 2X68A 2LHNA 2VASA 1FQAA 3PPNA 3OO6A 4KCDA 2XXWA 3H6WA 1B3HA 4F39A 3KN7A 2PJQA 2Y7KA 2LJLA 3PDYA 2ZM8A 4NF4A 3SEWA 3K2DA 2HH7A 2NVUB 3LSFB 2UXAA 1OWAA 4KD5A 2LM9A 4ZEBA 3ZC0A 2X0LB 2IAKA 3PMXA 2KLFA 3DJBA 4H8IA 2E8IA 3OSRA 3LSWA 4KP3C 4UV9B 4JWOA 3OEKA 1LLSA 2D5WA 2HAVA 2LSJA 1D1AA 3ZMSB 5FHOA 3RT6B 2IA4A 2K48A 5JDLA 3DP7A 1QKAA 4NMYA 3FJGA 3D4GA 4IIJE 3K1PA 2ZYKA 4RJZA 3F31A 2E9XD 4FATA 2Q9QD 3T8OA 4H6DA 3PUQA 1POY1 3TTNA 4GOUA 1WYCA 2ZLYA 4X1YE 3T96B 1BIYA 1D9YA 4ESXA 5L3DB 1LCTA 4H9PC 1MQJA 2X9WA 3RC8A 1JETA 4YKJA 4XXUA 5LNKA 3T9VA 5LHHB 4UXNB 5L9MA 3E3KA 3PD9A 3VXCA 4HS7A 3K1MA 1JEVA 2O1LA 1UQWA 4F2OA 3ODBA 1MY3A 2NOOA 3EPEA 3QC9A 2B3FA 1LCFA 4PNIA 5LXTE 2M8CA 3PUSA 5LA6E 3G3GA 1IXIA 1VR5A 3KG2A 1B05A 4GIWA 3SERA 1DPPA 3MBPA 1Y1ZA 4B6XA 3PE0A 4TUYE 3CKDA 1N84A 5AE4A 2V3UA 4ZEKA 4RK9A 3OKQA 3UUMA 2V26A 3KBTA 1D0YA 2K9AA 5L3FB 1Y3QA 1QUJA 2GHBA 4RK2A 2AL4A 3UORA 2CEAA 2DE4A 4U22A 5EYFA 1P1QA 2JPFA 3MC2A 3GLBA 4EYYR 1LVKA 4ELRA 3KJTA 2A5TB 2DWIA 4FORA 3RLFE 4KMCA 1LSTA 3P7IA 1TT1A 2HPJA 3I5OA 3N6TA 2W00A 5L2LA 1OXZA 4K0UA 1IXGA 4KPTA 1FTMA 3FXUA 3HR0A 5JDNA 3TQWA 4PAGA 1MXYA 4ZS9A 4XKRA 3L6HA 4IGRA 3U94A 1B46A 2QS3A 2XXPA 1QVSA 2Z8EA 3UUNA 5CM6A 2CWOA 4R6HA 3V5UA 3ZCJA 3RRCA 2BDEA 4ZI2D 4R2FA 4OQOA 2DLRA 5I84A 4LP2B 4GF8A 5JH7E 4TZ4C 3QSLA 3U72A 3KDSE 2OLBA 4G68B 5K2XA 4R9FA 3LUYA 5HXSA 3UULA 3N94A 4RPOA 3C98B 4GRKA 3C50A 3IB2A 4R74A 4HTGA 2X9YA 2K24A 2I4BA 2LE8A 5J2TE 3PD8A 2VP1A 3O1IA 2PMSA 4R2BA 3T93B 4U21A 1LFHA 2WMNA 5JK4A 5LP6E 2YLNA 4EF2A 5HXCA 1Z7ME 5M2VA 3IJOB 1NMUA 5KMGP 3OENA 4F19A 3BQKA 3BFUA 4OYKA 2RC9A 5CBSA 4LZ5A 2X66A 2ONRA 3VLWA 3PUVE 3H4ZA 5FMNA 3IK6B 2I59A 1UTBB 3O2AA 3ZKLA 5CMMA 1MXUA 3O9PA 4DXBA 2VL8A 2D21A 2Y7WA 3MP8A 2GH9A 1IJ5A 3AAAB 3SEXA 4G8NA 3U93A 2D3IA 1LBBA 1FTLA 2NW7A 3JC6D 5IHYA 2DI4A 1WR6A 4ZE9A 1DOTA 3K6WA 3MP1A 3KV4A 1LBCA 2XD2A 5EHSA 4U4XA 4C1TA 5L9SA 3K1NA 3UGWA 3N9MA 3B7DA 4I50E 5AA2B 5JVDE 1Y20A 4EZHA 3EHUA 1D3KA 1S94A 2RP4A 4H0WA 4NWCA 1LGBC 1URGA 4QWNB 3HHFA 4N13A 4IE5A 4PJNA 5LYJE 3ETUA 3DP6A 3E22E 4ASKA 2IC6A 3VVFA 3G7WA 4TQUQ 3GBAA 1HF8A 1MIYA 2DOJA 2V7JA 3SS1A 3ILUB 3K0VA 4GXSB 5F1QA 4QFKA 2X9XA 1USYH 1Y3PA 1FEWA 4WEDA 4YMBA 4YKPA 5KDMC 3TCFA 4MLKA 1PBQA 3C31A 3OELA 4ZEFA 4I55E 4UF0B 4BDNA 3VXBA 5CMBA 2QA7A 1MY4A 3SWHA 3OO7A 4U1OA 2I48A 1A99A 5I57B 3CQGB 4F31B 1E1HB 3ANWA 4BA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T9U A;  1VSO A;  2PVU A;  2REJ A;  4U4S A;  5H8N B;  3M3L A;  3V89 B;  3FVN A;  4IO6 A;  5K2Y A;  2XX8 A;  1TXF A;  2XXI A;  1T0K A;  1M5E A;  1S50 A;  3G3J A;  3T66 A;  3C33 A;  4KHZ E;  1I6Q A;  2DXR A;  1D4N A;  2NXO A;  3KEI A;  2DWJ A;  3IOR A;  3MJN A;  1B58 A;  3K4U A;  3CIJ A;  1XT8 A;  1SVX B;  3IJX B;  4QFP A;  2PYY A;  4F3B A;  4P11 A;  1WOD A;  3CG1 A;  1Y1M A;  2DWH A;  2E1S A;  1ZKE A;  2W7Y A;  3A3U A;  3H3G A;  1QUI A;  3PUW E;  4IY6 A;  4Z0I A;  5CI5 A;  3KSX A;  1LB9 A;  2YPN A;  3N6U A;  3RGY A;  3TPA A;  3MXZ A;  2BJJ X;  3TOD A;  1Q1K A;  2HQ0 A;  3R6U A;  3K6X A;  5CMK A;  1MPD A;  1BTJ A;  1WDN A;  3MZ1 A;  3FXD B;  3L3P A;  3O28 A;  3KGC A;  1IXH A;  1OVT A;  3K6V A;  3B6Q A;  1LRZ A;  1B1H A;  1US5 A;  4MLQ A;  5LOM A;  1TFD A;  3T9H B;  3CFX A;  3Q25 A;  4GWO A;  3RPW A;  5AA4 B;  3MP6 A;  1B4H A;  3CFL A;  4Q30 B;  2V84 A;  3MZ9 A;  4RXL A;  3A09 A;  1PEB A;  3OD7 A;  3HCQ A;  1UIU A;  2XXT A;  2I58 A;  3IB0 A;  3ONM A;  1NNP A;  4R6Y A;  2QJE A;  4BLA A;  2OZZ A;  2UVG A;  3CI8 A;  5B7D A;  5ICT A;  3CR9 A;  3PPQ A;  1EZ9 A;  4AQ4 A;  2UVH A;  1H76 A;  1B3E A;  3N26 A;  5I2K A;  1H7C A;  1B5I A;  1IUD A;  1LAX A;  1R6Z A;  3VE1 B;  4P0G A;  3K6U A;  3MQ9 A;  3PPO A;  3V8X B;  4ESW A;  4HCY A;  2Y84 A;  2ZNU A;  3TDJ A;  3QYT A;  1Y4T A;  2GRV A;  3SEU A;  4R6K A;  3H06 B;  3OO8 A;  4FJP A;  2RF1 A;  1SW1 A;  2R6G E;  2XHD A;  3C35 A;  3CVG A;  1PDA A;  3FV1 A;  4GLI A;  1S9T A;  1A7L A;  2C5I T;  3IO4 A;  1VFD A;  1B7Z A;  4H1X A;  4EQB A;  1P1W A;  4YZZ A;  1MPB A;  3C36 A;  4O3A A;  4G4P A;  1AOV A;  3B6W A;  1WVJ A;  3PU5 A;  4N07 A;  4RYA A;  1B5H A;  2DWA A;  1HSJ A;  3ZKK A;  5I58 A;  2DSF A;  1NNT A;  4BDO A;  5AA2 A;  4NF6 A;  4EQ7 A;  3ZSF A;  1CB6 A;  1Y3N A;  3TQL A;  3H6U A;  4QFL A;  4UA8 A;  1AIV A;  4BDQ A;  3G3K A;  2I0C A;  3W15 C;  3JYR A;  3O6H A;  4KFQ A;  3LSX A;  3ZS6 A;  2AIX A;  2XXX A;  3EN3 A;  5KDT A;  1ZKB A;  3FUZ A;  4L17 A;  3CSG A;  3PPR A;  4PFW A;  2DQV A;  1B1X A;  1LFG A;  3FXR A;  3SEY A;  5A5X B;  3KZG A;  3TZA A;  2UYF A;  2PX1 A;  4KCC A;  3F11 A;  2VHA A;  4ZZE A;  2Q2A A;  1QKB A;  4DDD A;  2R71 A;  3VVD A;  4OHN A;  4F1V A;  3OXN A;  2ZXT A;  3U92 A;  3S9M C;  1NNF A;  5FHN A;  1B3F A;  3CRB A;  5JTY A;  4OES A;  5BWJ A;  1URD A;  4KYE A;  2IC9 A;  1SI0 A;  4M1V A;  4LA9 A;  4XKN A;  5FTI A;  2IEE A;  4JWX A;  2DXY A;  4EQ9 A;  1USY E;  4OFL A;  1GV8 A;  5I56 A;  3IAZ A;  2Y7I A;  3VFJ A;  2FYI A;  4O3B A;  2WKY A;  1ZIU A;  1NNK A;  2F8D A;  3H7M A;  3SEV A;  1EZP A;  2G0U A;  2THI A;  4F3G A;  2CZL A;  3OMB A;  4C0R A;  3DP4 A;  5DEX B;  5CMC A;  4IO5 A;  4DE8 A;  4F22 A;  5IAI A;  3JV9 A;  2I0B A;  1B32 A;  1SQY A;  2NWJ A;  1QJM A;  2NUV A;  3PUX E;  1R9L A;  4IO2 A;  1P1N A;  4YB7 A;  1OLC A;  1XVY A;  4NF4 B;  4WKM A;  3O97 A;  4RY1 A;  3RQT A;  3KFM A;  2ONK E;  3UIF A;  4NTL A;  1HSL A;  2OBG A;  4ECF A;  1SDX A;  1LAH E;  1N76 A;  3KN8 A;  3HHG A;  4UAC A;  4YMA A;  3OSQ A;  3TCG A;  1NL5 A;  4BDL A;  3Q27 A;  1B5J A;  2QMW A;  1B0H A;  2ZNT A;  1JW4 A;  4QSE A;  5DVF A;  4YAH X;  1O63 A;  3CSB A;  4IO4 A;  4R9G A;  5DT6 A;  5I2K B;  5TP9 B;  5IKB A;  5ISU A;  2XD3 A;  4OEN A;  4EF1 A;  2DVZ A;  1MH3 A;  4LVQ A;  4N6P A;  4R73 A;  3MVW A;  4KQP A;  3FJ7 A;  3VDF A;  4C1U A;  1JQF A;  1YTV A;  4LAT A;  5I2N A;  1ZU0 A;  1H43 A;  1RYO A;  4QFN A;  1KWH A;  2YJP A;  4ELQ A;  5ITO A;  1OQH A;  3FGS A;  2QL3 A;  4MBP A;  4ZE8 A;  1PB8 A;  1SBP A;  3CG3 A;  3UK4 A;  2ABH A;  1MQI A;  4THI A;  5H8H A;  1MY0 A;  1FQD A;  1SW2 A;  4R75 A;  3SDF A;  3S2V A;  2RCB A;  1MQD A;  3FJM A;  1FQA A;  5AA1 A;  1BLF A;  3TAJ A;  2I3W A;  3H03 A;  1MDP 1;  3PPN A;  4U23 A;  1XOC A;  3OO6 A;  1B9J A;  2GHA A;  3G3F A;  3PUY E;  4KCD A;  2XXW A;  3H6W A;  5CRY A;  5DTB A;  3E13 X;  5H8Q A;  3GZG A;  3MVX A;  1B3H A;  1P99 A;  2FNC A;  2Z23 A;  4F39 A;  1PB9 A;  3OO9 A;  1QUL A;  3KN7 A;  1F9B A;  1PBP A;  2Y7K A;  4IO3 A;  4KYS A;  3TCH A;  2F6P A;  1JEU A;  1LVF A;  1SW4 A;  2OWS A;  3MVZ A;  5HBC A;  3FAS A;  4FIM A;  1SW5 A;  1B3L A;  4NF4 A;  4DCY A;  3TEP A;  3IL1 B;  1DTG A;  2G29 A;  2RKM A;  3VV5 A;  3FV2 A;  1ZLQ A;  3SEW A;  2HCA A;  1S7Y A;  1YPN A;  2XXY A;  3K2D A;  3PPP A;  3USD A;  3IO6 A;  1NFT A;  2ZMB A;  2HZL A;  3BFT A;  4I9D A;  1JW5 A;  2NVU B;  1BP5 A;  1M5B A;  2CMO A;  2UXA A;  3LSF B;  4H8J A;  4XIG Q;  4PQJ A;  2RIN A;  2AYS A;  4XKP A;  1D9V A;  1MM6 A;  1SD3 A;  2O51 A;  2OK2 A;  4GIZ A;  4NF5 A;  5TU0 A;  5B70 A;  5HM4 B;  1UTB A;  1XS5 A;  3DM0 A;  4KD5 A;  4H5G A;  2PT2 A;  2HEU A;  2P0S A;  1OIB A;  3MUQ A;  4ZEB A;  4NE4 A;  1UTH A;  2DS9 A;  4OZ9 A;  4QHQ A;  4R72 A;  1XHY A;  3PMV A;  2UVJ A;  1MQH A;  3W9W A;  1R9Q A;  4O3C A;  2B65 A;  4TOZ A;  3U1O A;  1SYI A;  3C34 A;  3GXA A;  2KLF A;  3PMX A;  3QUF A;  3HO7 A;  4H8I A;  3W9V A;  3OSR A;  4OFJ A;  2F5X A;  4ZEI A;  1MRP A;  3LSW A;  3S9L C;  4JWO A;  4IO7 A;  3OEK A;  1LLS A;  2D5W A;  2HAV A;  4OTE A;  1N04 A;  2F7B A;  2VD2 A;  3O66 A;  5FHO A;  3RT6 B;  2IA4 A;  2K48 A;  1EU8 A;  1NH7 A;  4Q0C A;  5AA3 A;  3KOT A;  1JNF A;  3PV0 E;  3TTR A;  4ZZA A;  1SYH A;  3TKD A;  1QKA A;  4YIC A;  4NMY A;  3E9X A;  2QSX A;  3FJG A;  3PGF A;  3D4G A;  4ZED A;  1QUK A;  3VLU A;  3K1P A;  2ZYK A;  4RJZ A;  1IXC A;  3PUZ E;  4XTC Q;  4OEU A;  4FAT A;  4H6D A;  4EXK A;  1EZO A;  4Q5T A;  4RPN A;  2XXU A;  5H8H B;  2H25 A;  1POY 1;  3TTN A;  3AXF A;  2ESN A;  4TQU Q;  3WAE A;  1LAF E;  3JZJ A;  4QRZ A;  3R7X A;  3RTW B;  4F2Q A;  1L5T A;  3S9E A;  3T96 B;  1BIY A;  1D9Y A;  3B6T A;  4G77 A;  4IGT A;  4ESX A;  1CE2 A;  1GTK A;  1LCT A;  2ALU A;  3DP8 A;  4FE8 A;  4G2Z A;  2Q8J A;  3RY3 A;  1MQJ A;  3TUS A;  3PMW A;  2I49 A;  2X9W A;  1JET A;  3VLV A;  4YB5 A;  5BUU A;  4YKJ A;  4XXU A;  1M5F A;  3T9V A;  2ANJ A;  2RC7 A;  3M3K A;  4P0I A;  1B6H A;  4TLL B;  5L9M A;  1FQE A;  1I6B A;  1N7W A;  3E3K A;  3IOV A;  1HSE A;  1FTK A;  4GOT A;  1Z0P A;  4JXI A;  3PD9 A;  4OXV A;  2QMX A;  4U1Z A;  5H8F B;  4HS7 A;  3VXC A;  5L8D A;  5ITP A;  3K1M A;  2XTL A;  4X48 A;  1JEV A;  2O1L A;  1ZMG A;  5H8S A;  1UQW A;  2O6A A;  3T9X B;  2MBG A;  4F2O A;  3ODB A;  4X1D A;  1MY1 A;  1MY3 A;  2NOO A;  2Z8F A;  3EPE A;  4ONY A;  3IR1 A;  4FEB A;  2B3F A;  1FQB A;  1LCF A;  2HXW A;  5I2N B;  2M8C A;  1GVC A;  1MDQ A;  4ELO A;  3QK6 A;  1OMP A;  4H5F A;  3G3G A;  1B7H A;  4YB6 A;  1MXZ A;  3FAT A;  1IXI A;  1VR5 A;  2DP8 A;  1VE4 A;  1LFI A;  3KG2 A;  4JSO A;  1B05 A;  2G93 A;  5JTY B;  4Q8R A;  3SER A;  3WAF A;  4YKK A;  4DLD