3S4UA

Crystal structure of open, unliganded e. coli phnd h157a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
302
Chain Sequence
b'KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGAETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAMSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 95
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3s4uA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA02
2XXPA 4NF5A 3H6VA 4OZ9A 2ZYKA 3PPRA 3RQTA 2H98A 4OERA 4JDFA 2X9YA 1P1WA 1Y4TA 2Z8DA 2I58A 3EPEA 2E0SA 3LSFB 1PEBA 3TODA 5TP9A 3N6TA 1MXXA 3ODBA 3GLBA 5AA1A 5CMCA 4LA9A 1B58A 3K01A 2DE4A 2OWTA 1OQHA 2QPQA 4Q30B 3ECRA 4F31B 4JSDA 1FTOA 3USDA 1YTVA 3AXFA 1B3LA 4P0GA 1VFEA 3JV9A 1AL3A 1OIBA 4ELPA 4GL0A 1Y4CA 3R7XA 2I0CA 1MG1A 2Q2AA 1L5TA 4GF8A 4FIMA 4X1DA 1FTKA 2Z23A 4RPNA 1II5A 4HS7A 3PPOA 2E1SA 2VD3A 1OLCA 3MWBA 5L9MA 1Y1ZA 1NKXA 2O68A 2XD3A 2HQ0A 1O64A 3QSLA 2K48A 2YPNA 2F35A 2C5IT 5H8FB 2VD2A 5CI5A 3M3FA 2O1LA 3CFZA 4X1BA 4RY1A 2KWHA 2Q8JA 5KCJA 1POTA 1MH4A 4B6XA 4R2BA 4YB7A 1XHYA 1GVCA 4J2CA 3KGCA 3TDJA 1N84A 4RA1A 3K0VA 5LOMA 1OVBA 4H67A 1NMUA 1P1NA 3TUSA 4KD5A 3H6TA 5AE4A 3TKDA 1VR5A 5TPAB 3MVZA 3KSJA 3EQ1A 2M8CA 4LZ5A 4JWYA 5IAIA 1LGBC 1US4A 2DS9A 4QRZA 1XC1A 4G4PA 3FD3A 1B7ZA 4OEUA 3SEVA 4GWOA 4I9DA 2HZLA 3WAFA 1WVJA 3F11A 4N13A 3G3IA 1S9TA 5JTYB 3CKDA 2G93A 5AA4B 1M5CA 1M5BA 3LUYA 2HFBA 4KQPA 3W15C 1SW1A 3O2AA 2AYSA 4JBZA 4BDMA 1JVXA 2X9XA 3KFMA 3MQ9A 4RXLA 3K00A 1D4NA 5I57B 1DOTA 1DMBA 2OCUA 3PV0E 5DVJA 4JSOA 4IGTA 1ATGA 4ZZEA 1MXVA 2HAUA 1SW4A 1IZ1A 5H8NB 3I5OA 1QULA 3A09A 4EF1A 2DSFA 3UN6A 4NF4A 3O66A 1B46A 3KBRA 4O3CA 4OXVA 4AB5A 3VVDA 2ONRA 1P1UA 2XXUA 1VE4A 1IUDA 1B05A 3EF7A 3IL1B 3T9XB 3G3HA 2Z8FA 3H6UA 1SQYA 3UGWA 4ZDMA 2O7UA 4KYSA 1TXFA 4U4SA 5I59A 3JYRA 2AL5A 3U72A 1HSLA 1HSEA 2H9BA 3UA8A 4M1VA 1SYIA 3H4ZA 4Z7EA 1P1QA 2P2AA 3FJ7A 3VVFA 2H4IA 4IO4A 4XKRA 3U93A 3FV2A 1ELJA 4ZZAA 4G68B 2Y7KA 1S50A 2X7QA 3FXEB 2F8DA 1IEJA 1UIUA 1LBCA 4RK9A 3PPQA 1SBPA 1O7TA 4F22A 1B5JA 1MDP1 3B7DA 4KFQA 2CA5A 4IY5A 4E0WA 3B6TA 2F6PA 4R2FA 5TU0A 2Y84A 1FCKA 2I3WA 4YB6A 1B9JA 3IOTA 3HPIA 4NF5B 1QVSA 2QMXA 3RGYA 4HTGA 1IJ5A 3T96B 3GBBA 2ALUA 3B6WA 1VFDA 1P99A 4RPOA 1NL5A 4U21A 1LFHA 3E13X 2F78A 3M3KA 3QIMA 4KCDA 4R75A 4BLAA 3HO7A 1LAFE 3TKLB 4LP2B 4GD5A 2X7PA 5L9SA 2NOOA 1D9VA 1NNFA 2RCAA 4QF9A 4YU0A 1US5A 2DP8A 3CR9A 3LBSA 1MQGA 3PUYE 3FXUA 1MY2A 3HN0A 1NH8A 2UVGA 4ONYA 2P1SA 1ZIUA 3PUWE 3FZVA 4XKNA 2QMWA 3IORA 3KN3A 3EHSA 2XXWA 3ONMA 1MM7A 2UYEA 4X48A 2C5JA 5IKBA 1JEUA 1B1XA 4G2ZA 3G3GA 3E4RA 3QAXA 4EF2A 3WAEA 2I48A 5JK4A 3UK4A 4F29A 3N94A 4ZE9A 1OMPA 1Y1MA 2UXAA 2RKMA 3RNNA 2FA7A 3K6UA 4GXAA 2RC9A 3N26A 5H8SA 5AA2A 2X9WA 5KCJB 1FQDA 2X26A 5AA3A 2V84A 5ITOA 4POWA 1TFAA 3I6VA 3PUZE 2RF1A 3B6QA 3OO8A 1XS5A 3RY3A 3IX1A 2F7BA 2HEUA 5ISUA 3SEUA 1JNFA 3EHTA 4IO7A 2Y7PA 4XKQA 3R26A 4LATA 2QS3A 4FORA 4F1VA 5DEXA 5H8HA 4JWOA 3BKIB 4QSEA 3LSLA 4KCCA 3QUFA 1LLSA 3TCGA 1Y3QA 1SW2A 3EHUA 2I6EA 2QL3A 4NE4A 4CQIA 3O9PA 2XXYA 2HXWA 4NTLA 4IO2A 4C1TA 4E0XA 1M5FA 3BFTA 1J1NA 3PGFA 3EN3A 2OLBA 4QFLA 5FTIA 2XXHA 1MDQA 2HCAA 3IO6A 1VSOA 3KG2A 2IC6A 3Q28A 4R9FA 4G68C 3DELB 5HM4B 4ZEFA 3GXAA 1LAGE 4DCXA 3CG3A 1SI0A 3ILTB 3TMGA 3PU5A 4N6PA 4G8HA 4WXJA 5HBCA 4K3FA 3C4MA 4FAJA 2DVCA 5I2KA 3K6VA 2RC8A 2REGA 1URDA 1R1NA 1JETA 4ISUA 3TTRA 1DPEA 2V93A 2QJEA 3MZ9A 1DTGA 1SVXB 1BKAA 2HAVA 1JW1A 4EXKA 4OENA 1URSA 5I58A 4DIGA 3T66A 4AQ4A 2DE3A 2UVIA 1OVTA 1MRPA 3TFLA 2O69A 5F7VA 4LZ7A 1DSNA 5FTHA 5ICTA 3LSWA 4NF8A 3IJXB 2PMSA 4OTEA 3H3GA 3FIRA 3UORA 3VVEA 1MXWA 4RNSA 4ZECA 2Y7IA 1DPPA 5CMBA 1O63A 1MQJA 1LB9A 3PPNA 4FATA 3RT6B 3OEKA 3CRBA 3L6GA 3TQLA 3OO9A 4YKJA 3MBPA 4POXA 3N6UA 4YICA 4YMAA 3S9NC 3CFXA 4P11A 1H76A 3SKPA 3VLVA 1A55A 1ZBMA 4Q8RA 3G7WA 1TT1A 1SI1A 1N04A 4XXUA 5I56A 3K1NA 3TCFA 1B40A 2XX9A 1B3GA 3OD7A 3TTNA 1MPBA 2V3TA 3JZJA 1MS7A 1PBPA 3C35A 5CMKA 1N76A 3RLFE 2VOZA 1OQGA 4H1XA 1FTMA 3T93B 1UTBA 1MY4A 2Z22A 1EZ9A 1ZMGA 2F6GA 2FNCA 4GIZA 1SYHA 2QS4A 5F1QA 3FVKA 2XX8A 3K1MA 3S9EA 5AA2D 4H6DA 4R6YA 1ZTYA 3KN7A 4MBPA 1Q1KA 1B3EA 2XHDA 3KZGA 1KWHA 4HCYA 5DVFA 3FV1A 1QUJA 3DP4A 5BWJA 3FUZA 4I1DA 5EYFA 3FJMA 3VXBA 2IA4A 1MY0A 3H7MA 3VLUA 2KWIB 4PFTA 2GH9A 4H8IA 4YAHX 1Z7NE 1B5HA 4H0WA 1I6AA 4IO6A 4KI0E 1LB8A 2H25A 1IQ7A 4WEDA 4X9TA 1Y9UA 5K2YA 2VHAA 4ZEKA 1IJ6A 2RINA 3TTKA 1B32A 1PB7A 4NWCA 4H65A 1LFGA 2LAOA 1IIWA 2C5KT 3MC2A 4FI5A 5KDTA 1R6ZA 2ABHA 4DZ1A 3LC8A 5AA2B 4IO3A 4QHQA 2YLNA 4TLLB 3D4CA 2XXVA 3FGSA 3U94A 2G29A 1RYXA 3S9MC 4ELRA 5ICQA 3C36A 3KSXA 2I4BA 4IB2A 4PE5B 4MLQA 2ZMBA 3TCHA 1ZLQA 1MQIA 3K1PA 4R6KA 1GGGA 1Y20A 1B52A 5DYHA 4DDDA 2W7YA 1SW5A 3R6UA 4OFJA 4WKMA 1RYOA 1UIVA 2PT2A 1UTHA 4FECA 4EYYR 5DEXB 1QJMA 1QW0A 2V3UA 2ZYMA 4NF6A 5H8HB 2PVUA 1AOVA 3IOVA 3FXQA 5TPAA 2VP1A 1UQWA 1IXHA 1QKBA 4QFPA 3T9VA 1YPNA 3GZGA 5I2NA 1FQEA 1XVXA 1FQBA 4Q0CA 3MPKA 2NWJA 3O6HA 3RN8A 4FE8A 4IGRA 1EU8A 2PT1A 1OLAA 1WODA 3TEPA 5CBRA 2ZXTA 5TP9B 4XTCQ 3CG1A 1MM6A 4QFOA 1QUKA 1GTKA 1FTJA 1H44A 4TOZA 4G8NA 3MP1A 5A5XA 3PUXE 2ZNSA 4F18A 2XXTA 4DXUA 1USYE 1TWYA 3MUQA 3TELA 2DXRA 4L17A 3RTWB 2OWSA 4QFKA 4O3AA 3MP8A 4IO5A 4U1OA 3VLWA 3KJTA 4OEVA 4QSDA 2QS2A 3QUJA 3HCQA 2DQVA 3FVNA 4OWDA 2O6AA 1B3HA 1N3WA 3FVOA 2DXYA 4ELQA 2B3BA 1NNKA 1A8FA 4ESWA 1MXYA 4C0RA 1GR2A 2XXQA 5CMMA 4GVOA 3RUMA 1B1HA 3IAZA 4HCWA 2D5WA 5I58B 3S4UA 4GQOA 5FHOA 2I4CA 2YJPA 3KJ7A 5I84A 2ESNA 2ZYOA 3VV5A 4BDLA 1B4HA 4H5GA 4NF8B 3C9HA 3H03A 1M5DA 5EHMA 2PBWA 1NNPA 3G3FA 2XXXA 1N0TA 1NFTA 3VDFA 1H3DA 3VXCA 1B6HA 1I6QA 4JB7A 3TQWA 4O3BA 1BTJA 2OJTA 1YAEA 1Q35A 4NEDA 4EDPA 1JQFA 3OO7A 4F2OA 3MZ1A 1BLFA 4PP0A 4RK2A 2DE2A 3SEYA 1B51A 2F7CA 3SDFA 3ZKLA 2QS1A 3QK6A 2Y7WA 1RKMA 5I56B 4GRKA 5L8DA 4FEDA 1IXIA 1QSDA 4DCYA 5EHSA 2D21A 4MH5A 3ZS6A 4OVJA 3CIJA 3OSRA 3IK6B 1MXUA 3VE1B 2D3IA 1BP5A 1SD3A 4LONB 4EUOA 4OFLA 4BDOA 1EH3A 5B7DA 1UTBB 4M4GA 3C31A 4U2RA 4R6HA 4DE8A 1LVFA 2DOJA 3PPPA 3TTMA 1MXZA 3V5AA 2FYIA 1YCJA 2IC9A 1B2HA 4R74A 1QKAA 3Q26A 2XD2A 4YKPA 3MVYA 4LUBA 5FHMA 4ZS9A 3OSQA 1IITA 1PB8A 3M8UA 3E9XA 1ANFA 4LVQA 2O7IA 3MP6A 2Y7RA 2THIA 3L6HA 1JW4A 4QSCA 3K4UA 2Q2CA 4L0RA 1LRZA 1A40A 1IXGA 4H5FA 4NF4B 1XOCA 1MY1A 3OELA 2V3QA 4BDNA 3A3CA 3S2VA 3SESA 2ONSA 4Z0IA 4XKPA 1AMFA 2UVJA 4EQBA 3HHFA 4R73A 3HHGA 2OBGA 3K6WA 1ZKBA 2REJA 4YZZA 2B65A 1F9BA 3PMWA 3W9VA 4GLIA 3O6IA 1A54A 5I59B 3IO4A 5J1DA 2GRVA 4OYVA 1ZJLA 3O28A 5KDTB 3PMXA 2ZYNA 4KR5A 1PC3A 4F39A 3SETA 3FXDB 3P7IA 3CVRA 1PDAA 3BFUA 2NVUB 1XT8A 1LCTA 4FEBA 3HSTA 2PYYA 4JWXA 3HV1A 3KOTA 2KLFA 5L9OA 5CBSA 1BIYA 3TTLA 2UYFA 4R72A 3RTFB 5CC2A 4ZEDA 2F5XA 4F3BA 4F3GA 1EZOA 5DTBA 1CB6A 4OFOA 4DNDA 3H6WA 4ND9A 3IB2A 1SDXA 2VGQA 4ZE8A 4OESA 4OETA 1UTHB 2O1MA 3U8QA 4UA8A 2OZZA 3TPAA 2R71A 3KEIA 4U4XA 3TAJA 4NF6B 3CI8A 2Q88A 4GOTA 2QRYA 4ZEBA 5I2NB 4XIGQ 1LCFA 2AL4A 4PFYA 3MXZA 4TQUQ 2A5TA 4PETA 2RCBA 5H8QA 3FATA 5M2VA 3IJOB 4U22A 2QSXA 3ZKKA 4OMBA 2R9JA 2ONKE 4ESXA 2Z8EA 1B4ZA 1N7WA 3MZBA 3V89B 5JEIA 1B0LA 2I49A 4ZEIA 2O51A 3IB1A 1B7HA 3OMBA 1LFIA 3V83A 3H06B 1T0KA 4I62A 5A5XB 3CFLA 1ZKEA 1MPCA 3DLNA 1LAHE 2R6GE 3I3VA 2DWIA 3MAMA 4UACA 3UIFA 4LZ8A 3PUVE 2WKYA 2ZNUA 1MH3A 1B7UA 1A7LA 3S9LC 1FQAA 4MF3A 2HZKA 3O97A 1FTLA 4P0IA 1B0HA 4DXCA 2Q89A 1AIVA 4N07A 2OK2A 1D3KA 3ZSFA 2DWJA 5ITPA 3MVXA 3G3KA 2P0SA 4PFUA 2B3FA 3BBRA 3K2DA 3SEXA 1A8EA 3RPWA 2V25A 1I6BA 4KYDA 4YB5A 3C34A 1FQCA 2F36A 4I8CA 4KHZE 3Q25A 3PMVA 3UP9A 5K2XA 2G0UA 1URGA 1TFDA 4F1YA 3U92A 5H8FA 4DLDA 4R9GA 2GHAA 2F97A 4KPTA 5B70A 1AH5A 2H99A 3OEMA 4NWDA 3PD9A 3QYTA 3FVGA 4ELOA 1FW0A 3MPLA 3C32A 4RJZA 1LBBA 2ANJA 3OO6A 1USYH 3A3UA 4OQOA 5ELVA 1MY3A 4IY6A 2UVHA 3SEWA 4JXIA 1MQHA 3DM0A 1NNTA 4BDQA 1PB9A 4LQ2A 1PBQA 4YMBA 2GFEA 3K6XA 2H5YA 1WDNA 1JEVA 2CZLA 1POY1 4GXSB 4EXLA 1IXCA 2DVZA 1H7CA 3IOUA 2AIXA 2MBGA 4F3PA 4HW8A 1QUIA 1H43A 2CMOA 3DP6A 3M3LA 2ZNTA 2DYXA 1LSTA 3OXNA 2RC7A 1Y3NA 2XXIA 3O6GA 3KOSA 3TYHA 3IB0A 3IOWA 3SERA 4LQ5A 3MW0A 3E3KA 4QFNA 5JTYA 4GFRA 2XTLA 5AA4A 3G3JA 4F2QA 2I3VA 3W9WA 2A5SA 3TZAA 1H45A 3RT8A 4U23A 4F1UA 1P1OA 4AB6A 4MLVA 3L3PA 5I57A 2IEEA 3FXRA 3MJNA 3V8XB 4MFIA 4GL8A 1R9LA 5I2KB 4TLMB 1D9YA 1B3FA 5HPQA 3K02A 4F3SA 5FHNA 1R9QA 3VFJA 4BDRA 3T22A 5H8NA 1ZU0A 1JW5A 1Y3PA 2F7AA 1DTZA 2BJJX 4ECFA 4EQ7A 3Q27A 3THIA 4G77A 3T9UA 4RYAA 4C1UA 3CSGA 2I0BA 4PQJA 1XVYA 4FJPA 3FJGA 3LR1A 5KZTA 2GHBA 3LSXA 1M5EA 2DWAA 4KYEA 1S7YA 3QXMA 3O29A 4Q5TA 1Z0PA 3N5LA 1N3XA 2NXOA 3DP8A 3IR1A 3OENA 5CM6A 3D4GA 1A99A 4THIA 5DVIA 2O84X 2NUVA 3T9HB 1GV8A 4NMYA 2Q9TA 3KN8A 1LAXA 2F34A 3ILUB 3Q29A 1B5IA 1N7XA 1Z7ME 4DXBA 1MPDA 5DT6A 2XXRA 4YKIA 3C33A 4U1ZA 2DWHA 5BUUA 4YKKA 4G68A 3FASA 4EQ9A 5CRYA 1NH7A 4G8MA 3CSBA 1HSJA 4OHNA 3CVGA 4H8JA 1MQDA 1JVYA 2XX7A 1CE2A 1EZPA 2PX1A 2A5TB 3OOAA 4WEPA 5H8QB 3PD8A 4PFWA 1I69A 3U1OA 3MVWA 3GBAA 1FQFA 4F19A
chains in the Genus database with same CATH superfamily
3N9OA 2XXPA 4NF5A 1D1AA 4O7MA 4ZEYA 2X67A 3H6VA 2ZYKA 3PPRA 4OZ9A 3RQTA 1OEDB 2H98A 4OERA 4JDFA 3LK3B 2X9YA 2XSAA 1P1WA 4DVDA 4ZS2A 4LF4T 3B5MA 1Y4TA 2Z8DA 4OYKA 3O9XA 2I58A 3EPEA 4NXNT 2WMNA 2WYKA 3RH3A 2E0SA 3LSFB 1PEBA 2XQAA 5EYGA 3TODA 2CWOA 4MAGA 3CQXC 2QFLA 5EZYE 4KUMB 1YW0A 5TP9A 5H6QB 4MIJA 1E7PA 5CA1E 3U78A 4OHFA 3N6TA 1MXXA 3ODBA 5LA6E 3GLBA 4YSXA 5AA1A 5CMCA 2WZHA 1CNQA 4YXDA 3P50A 4LA9A 1QGXA 2LSIA 1B58A 3X1DA 3K01A 5LMUT 2DE4A 4KBMB 2OWTA 1OQHA 4IHJE 2DWKA 4QX8B 2QPQA 4Q30B 2VKHA 3ECRA 4F31B 4O4JE 4JSDA 5LG4A 1FTOA 3USDA 2MTQA 3A29A 3M65A 1YTVA 3AXFA 1B3LA 2VK9A 4P0GA 1VFEA 3JV9A 1AL3A 1OIBA 4ELPA 4GL0A 1Y4CA 3R7XA 2I0CA 2WSSV 4PAKA 3ETUA 2LJLA 1MG1A 2Q2AA 1R8IA 1L5TA 4GF8A 5HYAA 4FIMA 4X1DA 1VCSA 3ZYKA 4TNVA 1FTKA 2HHMA 2Z23A 4RPNA 2HN2A 1II5A 3AA1B 4HE8A 1FPDA 4HS7A 3PPOA 2E1SA 2VD3A 3C64A 3T1BA 4LF9T 4MNCA 3RQUA 4DV6T 3TLUA 2J62A 3N9NA 1OLCA 3MWBA 5LXTE 5L9MA 4EXTA 5FY1A 4PCDA 3L09A 5AQOB 4P0AA 1Y1ZA 4LFAT 1NKXA 2O68A 2XD3A 2BS3A 2WWUA 5JDGA 1M7KA 2HQ0A 2M6IA 3MJXA 2BG9E 3ZEFB 1O64A 3ZSTA 1INPA 3QSLA 2PFVA 2K48A 4XZCA 4Z91A 2YPNA 2XASB 4AQYT 2F35A 2C5IT 2GQ1A 5H8FB 2XHEB 3AXJB 2VD2A 5EQAA 2WCAA 5CI5A 2D9DA 4H9RC 5L3GB 5C3JA 3M3FA 2O1LA 3OPCA 3CFZA 4X1BA 4NAPA 3AVRA 3RGLA 5AQFB 4PFPA 4RY1A 4EOZB 2WB5A 2KWHA 2NW9A 2Q8JA 1B7TA 5KCJA 1POTA 2FIEA 3ZT7A 1MH4A 4B6XA 4YFSA 4R2BA 1IMEA 4DIDB 4U2ZA 5ABFB 4YB7A 3IF8B 2V7KA 2YU2A 1XHYA 1IMDA 4EZHA 3GWHA 3N9LA 1NV0A 1GVCA 4J2CA 4V1Av 5M4YA 1DBZA 4LMJA 3KGCA 3TDJA 1N84A 3PURA 4RA1A 3K0VA 5LOMA 1U4QA 1OVBA 4H67A 2AXDS 1NMUA 1P1NA 3TUSA 4KD5A 3H6TA 2MPKA 3HKBE 5AE4A 3TKDA 3UQ7A 2X0LB 1VR5A 5A5LA 5TPAB 3MVZA 3KSJA 3EQ1A 2XM2A 2M8CA 3RPLB 3FZHB 4LZ5A 4JWYA 5IAIA 4O4IE 1LGBC 4EB6E 1US4A 2DS9A 4QRZA 1XC1A 3ZCJA 5LB7B 2CHNA 3DTOA 3J7Yq 5AQLB 4G4PA 2K9AA 4PAIA 4AI6A 5AQIB 3ZCIA 2XQ5A 3FD3A 1B7ZA 4OEUA 4MMPA 4I43B 3SEVA 4GWOA 4I9DA 2HZLA 2CLYC 3WAFA 3VR8A 1G8XA 1WVJA 4H9QC 2QVUA 3F11A 4N13A 5DQWA 4HE1A 1N36T 2WYPA 3G3IA 1S9TA 5JTYB 3CKDA 2WMOA 3PV0F 2JMKA 2G93A 2DLRA 2PFYA 5AA4B 2W61A 4OX9T 2LLYA 1M5CA 1M5BA 1VDWA 2K3WA 5CFBA 4H63V 2BG9A 3LUYA 4QH5A 3U65A 4ZI3D 2HFBA 4YTNA 3HKDE 4KQPA 1OWAA 3W15C 3N2OA 1SW1A 3O2AA 2XA5A 4IR8A 2AYSA 4JBZA 4BDMA 4PAFA 1JVXA 2W66A 2X9XA 3KFMA 4GWSA 3MQ9A 4RXLA 2V5CA 3ZLIA 3K00A 4OVQA 1D4NA 1MIWA 5I57B 1DOTA 1IMBA 1DMBA 2A9UA 2OCUA 3PV0E 5DVJA 4UF0B 4JSOA 4IGTA 4JEHB 1HNZT 1BR2A 5LGTB 4DR1T 4OYJA 1FPFA 1ATGA 1HCIA 3JAEA 4ZZEA 1HG2A 1MXVA 4GKJT 1SW4A 2HAUA 4I4TE 1IZ1A 5H8NB 3I5OA 1QULA 3A09A 4DO0A 1W9RA 4EF1A 2LEHA 2NOXA 2D0UA 2DSFA 3N9MA 2UXNB 2YU1A 4JVCA 4QBAA 3UN6A 4O7IA 2PTFA 3UU8A 3ROJA 1E1HB 4N81A 3JAFA 4NF4A 5FL0A 2XM1A 1HX1B 3O66A 3B13A 3KFWX 1B46A 3FBZA 3EABA 5JR9B 3ZJ1A 3KBRA 4KMCA 4O3CA 4OXVA 2IDOB 2L5VA 4AB5A 4DR2T 3VVDA 2ONRA 1P1UA 2XXUA 2CEXA 1VE4A 1OEDC 1IUDA 2NWBA 2XQ8A 4IDOA 1B05A 3EF7A 2LKHA 2CZHA 3IL1B 1N32T 4PJNA 4F6RC 4YT0A 1UURA 3LBXA 3T9XB 3G3HA 2Z8FA 4PDHA 4WBNE 3H6UA 1SQYA 3KBUA 3UGWA 4ZDMA 4DR3T 2PJQA 4DI3D 3UUNA 1NV1A 1MMNA 2O7UA 4KYSA 3EDVA 1TXFA 3R6NA 3BQKA 2KXPB 2CXLA 4U4SA 1MMDA 5FVKA 2V6XA 1NI9A 4X20E 3VHLA 4HFCA 5I59A 3KINB 3VU7H 3JYRA 2E2AA 2AL5A 4X65T 4PBHA 5HXSA 2IAKA 3U72A 5AQRB 2B76A 1HSLA 1HSEA 2H9BA 4GWZA 3UA8A 4M1VA 3PDYA 2W62A 2VASA 4A98A 4U31A 1SYIA 2M6BA 3H4ZA 1NUWA 4TNWA 1P1QA 4XF5A 3PE0A 5EQ9A 5EK2A 4Z7EA 5IGAA 2P2AA 3FJ7A 3VVFA 2CE7A 3H37A 2H4IA 4IO4A 4XKRA 3U93A 3RIUC 2Y6XA 3NZPA 3FV2A 1ELJA 1FEWA 4ZZAA 4G68B 2V8SV 2Y7KA 1S50A 1FPGA 3HL6A 1XMOT 2X7QA 2OLTA 3FXEB 2F8DA 3KV9A 1IEJA 4I3YA 1UIUA 4CN6A 1LBCA 4RK9A 5AQPB 3UT5E 2OV9A 3F2EA 3SZPA 3PPQA 2LRKA 2F4VT 3FZMB 1SBPA 2VQET 1O7TA 1WYBA 2AE9A 1HNWT 5J2TE 4F22A 4KX6A 5LHHB 3QB5K 4JBWF 2UXBT 2XWVA 1B5JA 3IFAA 4L5GA 1MDP1 2CHOA 3K3NA 3B7DA 1ZV4X 4KFQA 2CA5A 4IY5A 4E0WA 5HEUA 1WR6A 4U74A 4U3CA 2XSBA 3MACA 2F6PA 3B6TA 4R2FA 5TU0A 2Y84A 3C4WA 1FCKA 2I3WA 4YB6A 1B9JA 2KQZA 3IOTA 4A97A 3HPIA 4NF5B 3KC0A 3ONXA 5DQVA 4H9PC 2CZIA 2ZM0A 4AKHA 1QVSA 2XAGB 5JREA 2QMXA 3RGYA 5HXHA 4GWYA 1EZ3A 4HTGA 1IJ5A 2F3BA 5ABEA 5DW8A 3T96B 4NHBA 4KXPA 2FJAA 3LK42 3ZMTB 4HWDA 3GBBA 3Q5EA 2ALUA 3B6WA 4P47A 1VFDA 1P99A 4RPOA 1NL5A 5LOVE 2DNXA 4U21A 1IMAA 5T3JA 1LFHA 4GK0E 4JVDA 3E13X 2VPOA 2F78A 2FHYA 3M3KA 4IL4A 3QIMA 2I6HA 3PUYF 4KCDA 2CBJA 4R75A 3KBZA 3H3AA 5GONE 4BLAA 3QC9A 4K0UA 2J4GA 3HO7A 1WYCA 1LAFE 2FJDA 3PUWF 3TKLB 4LP2B 4GD5A 3IEEA 2MKZA 1DK4A 3EUHA 1G73A 5FXXA 2X7PA 5L9SA 4C90A 2NOOA 3NVOA 1D9VA 5LCYA 1NNFA 2RCAA 2HHHT 5CB4E 5HEJA 1RDZA 1US5A 2DP8A 4QF9A 4YU0A 2Q8MA 2JQHA 3CR9A 2LSYA 1EYKA 3LBSA 3ZYMA 4IGUA 1MQGA 3PUYE 3FXUA 1SA0E 2YINA 3CK6A 1MY2A 3HN0A 1DCUA 3PTRB 2YEVC 5LGNB 1NH8A 2UVGA 4ONYA 4FBPA 5L4EA 2P1SA 1ZIUA 3PUWE 3FZVA 2BJIA 3O1HA 4XKNA 5AQUB 3T1HT 2H3RA 2QMWA 3IORA 4AS4A 4NGUA 3KN3A 3EHSA 3AE3A 2XXWA 3ONMA 1MM7A 2UYEA 2CCQA 4X48A 2C5JA 5IKBA 4HFVA 3AEGA 1JEUA 5LG3A 1B1XA 1FIOA 4G2ZA 3G3GA 4IE6A 4IE7A 4ZI2D 3E4RA 1SUMB 3QAXA 4EF2A 2JJ9A 3PUZF 2XQ4A 2XUEA 1BK4A 2N1GA 3WAEA 2I48A 4H46A 5JK4A 1US7B 3L8RA 3UK4A 4F29A 4DMWA 3N94A 3K3QC 2QVAA 4ZE9A 1BR0A 1OMPA 4GX3A 1Y1MA 2EHOA 3HA4A 2UXAA 2RKMA 2FA7A 3K6UA 3RNNA 4GXAA 2RC9A 2X0HA 3N26A 5H8SA 5AA2A 2X9WA 2GK9A 1FQDA 5KCJB 4P8BA 2X26A 5JDHA 5AA3A 2V84A 5ITOA 4POWA 3AE6A 1TFAA 1D1CA 3U3IA 3I6VA 5AFUL 3PUZE 4X1YE 2RF1A 3VKGA 1IMFA 3B6QA 3OO8A 2I59A 4P9KA 4U7IA 2QA7A 1XS5A 3RY3A 3AE5A 3AEFA 4HWHA 3GYYA 3IX1A 2QRXA 2MOZA 2F7BA 1NWMX 4CZZB 4P09A 4Z8XA 5HXEA 4ZI7E 4COFA 1N34T 2HEUA 2RP4A 5EK4A 5ISUA 3SEUA 2LOPA 5JR9C 4E7ZA 1JNFA 1UX5A 3EHTA 4IO7A 3V5UA 4O94A 2Y7PA 4XKQA 2KINB 1UX4A 5LMNT 1KNRA 4GWWA 1FBGA 3ANWA 3R26A 4LATA 2QS3A 4FORA 5JDMA 4F1VA 2NTXA 4AKLA 1D1BA 2E5VA 5DEXA 5H8HA 4DBRA 4JWOA 3BKIB 4QSEA 4LMKA 3LSLA 4KCCA 3N2KE 3QUFA 1LLSA 3TCGA 3CX8B 5L3BB 1Y3QA 1SW2A 3EHUA 1FBEA 4JEUB 4DV4T 5I7IA 2I6EA 2QL3A 4ZI3C 2VURA 4GKKT 2PFZA 2RPAA 4NE4A 3BIHA 4CQIA 3O9PA 2LM2A 2XXYA 4DBQA 2Q74A 2HXWA 4NTLA 2E5LT 4IO2A 4UELA 4C1TA 4MEVA 4BJMA 3UUXB 5F3JA 4HN9A 4E0XA 1UGOA 1I6ZA 1K9ZA 1KFYA 1M5FA 3BFTA 3PU3A 4ZS3A 3O4XE 1J1NA 3ZN0B 3PGFA 3OVUA 2VPNA 2L8KA 5AQMB 3EN3A 1SHZC 2WAUA 3ZSSA 2OLBA 4QFLA 5FTIA 4PGNA 2XXHA 2WDRA 3D1RA 1MDQA 2V5DA 2HCAA 1VSOA 3IO6A 2IC6A 3KG2A 3Q28A 2XWKA 4G68C 3DELB 4QH1A 4R9FA 5HM4B 4ZEFA 1NV4A 4U2YA 5ET8A 3GXAA 3R84B 4TZ4C 1LAGE 4DCXA 3CG3A 1SI0A 5FKYA 3ILTB 3TMGA 4UXNB 3PU5A 4N6PA 2HPJA 1FBFA 3CPZA 4G8HA 4PTKA 4LFCT 4WXJA 4DR4T 5HBCA 3I0OA 3C51A 3UU5A 3C4MA 4K3FA 4FAJA 5IZZA 2DVCA 4I3EA 5I2KA 3K6VA 2RC8A 5JVDE 2REGA 2M67A 5AQNB 4B3RT 4PBQA 1URDA 1R1NA 1JETA 4JI1T 3AA7B 4ISUA 3TTRA 1DPEA 2V93A 2QJEA 3K8PC 3A8YC 3EKIA 3RYFE 4QXBB 1DTGA 3MZ9A 3ZMUB 1M62A 4ILCA 1SVXB 1YQ3A 1U5PA 3L39A 4TUYE 4DI4B 1BKAA 1LBYA 2HAVA 1FPKA 1JW1A 3EI0A 2BVLA 4EXKA 4OENA 4DV0T 1URSA 4LN5A 2KT9A 4JLEA 5JDLA 5I58A 4L9IA 4MX6A 4QXHB 4DIGA 5HEHA 5BMVE 3LBXB 3T66A 4AQ4A 5AQQB 1NUYA 2DE3A 2UVIA 3FBLA 4NIQA 1OVTA 1OEDE 2LSKA 1KF6A 1MRPA 1SPIA 3TFLA 4YHHT 1S35A 4OVRA 3O1JA 2O69A 2LE8A 4LZ7A 5F7VA 1DSNA 5FTHA 5ICTA 3LSWA 4NF8A 1LBXA 2IIUA 3IJXB 2PMSA 4N8GA 3SFEA 4OTEA 3H3GA 4YY3T 3FIRA 2VWAA 3UORA 3VVEA 4X1KE 1MXWA 4RNSA 2DDKA 2ZM6T 4ZECA 2Y7IA 4DR5T 3RRCA 5ESYA 1DPPA 5CMBA 1O63A 1MQJA 1LB9A 3DJBA 3PPNA 4WBOA 2X0YA 4BA9A 4KHPT 4FATA 3RT6B 3OEKA 3CRBA 1FTAA 3L6GA 1EYIA 1KA1A 4I50E 3TQLA 3OO9A 1HFAA 2H89A 4YKJA 2NP9A 4JI8T 3MBPA 2WWVA 1GQEA 4POXA 3N6UA 4YICA 1NV7A 3K3OA 4YMAA 3S9NC 2VVNA 3CFXA 4EAHA 1FBHA 2NW8A 4OFZA 4P11A 1H76A 5DJQC 3ABVA 3SKPA 3VLVA 1A55A 1ZBMA 3H3MA 1HS7A 4Q8RA 3RLFF 5JRCA 3G7WA 3E08A 1TT1A 2VL0A 1SI1A 1N04A 2B4LA 1QUUA 4XXUA 5ADXL 4UIGA 2ACXA 4IE5A 4WNKA 4O8SA 2XQ3A 3HI2A 4ILUA 4UEMA 4DMVA 5I56A 1NEKA 4I0UA 5LNKA 3K1NA 3F57A 3TCFA 2JIWA 2P3VA 5FYMA 1B40A 2XX9A 2B4MA 1B3GA 3UTKA 3OYXA 2VT5A 3OD7A 3TTNA 1MPBA 3SS1A 2V3TA 5FL1A 3JZJA 3WI3A 1MS7A 4UV8B 1PBPA 2XQ6A 4IE0A 5IZ1A 1L0VA 1FMWA 3C35A 5J16A 4U72A 2K24A 5CMKA 1N76A 3RLFE 4CXXA 1KNPA 4NN3A 2VOZA 4MJOA 4AKGA 4QXDA 1MMAA 1OQGA 2W0GA 3KV6A 4H1XA 1MNEA 2P9BA 2CXFA 5LGUB 1FTMA 3AEEA 3UU6A 3T93B 3C4ZA 1UTBA 1MY4A 2C0SA 2Z22A 5FY0A 1EZ9A 1ZMGA 4UR9A 2F6GA 2FNCA 2EHOD 4KP3C 4GIZA 1SYHA 2QS4A 5F1QA 3FVKA 2XX8A 4JI2T 3K1MA 3S9EA 5AA2D 4H6DA 4R6YA 2XZEA 1ZTYA 4G61A 3KN7A 3D0TA 1J5WA 4MBPA 2Y5KA 1Q1KA 4MFRA 1B3EA 2XHDA 3KZGA 2XQ9A 1KWHA 4HCYA 4P56A 2BKOA 3WAJA 2BS2A 5DVFA 2WBLA 3FV1A 1QUJA 3SWHA 3DP4A 5BWJA 4KI0F 2UUAT 3FUZA 4JI5T 2WBDA 4I1DA 2PBIA 5EYFA 4AIUA 5FY7A 3ETVA 3ONLC 3FJMA 3C50A 5HWXA 3VXBA 2IA4A 1MY0A 3H7MA 3VLUA 2KWIB 4P1LA 4PFOA 4PFTA 2GH9A 3HKEE 4H8IA 2W4XA 4YAHX 1MIYA 1Z7NE 4A56A 5L47A 1WLXA 1B5HA 5CA0E 4P1NA 4H0WA 2V4CA 1I6AA 3FXBA 2XY8B 1BR1A 4IO6A 3T1YT 4KI0E 4PK5A 1LB8A 2YDQA 3ZC0A 2H25A 1IQ7A 4WEDA 1T98A 4X9TA 4ZI2C 1Y9UA 3EVYA 2E9XD 2VHAA 5K2YA 3AE4A 1MNDA 1YD8G 4ZEKA 3QMFA 1IJ6A 2RINA 3TTKA 2VKJA 1B32A 5FNVE 1PB7A 3PUGA 4NWCA 2WY2A 3ZJ2A 3AEAA 3OTOT 4UVCB 4H65A 3UUMA 4E7SA 4Z90A 4PAGA 1LFGA 2JQKA 2KZ7B 2LAOA 1IIWA 2C5KT 2FBPA 3MC2A 4HWIB 4FI5A 1FPIA 4NG7A 2R8TA 2EHOB 5ABHA 5KDTA 1R6ZA 2V6YB 5JTGA 2ABHA 4DZ1A 3LC8A 5AA2B 5AQSB 1XNQT 4IO3A 1LKXA 4N4UA 4QHQA 2YLNA 4TLLB 4CN1A 5KMGP 3D4CA 2XXVA 2WP9A 4P3LA 3LJCA 1Z8UA 3FGSA 3U94A 1FBPA 4XEQA 1D0XA 2DHRA 2G29A 3IBPA 1RYXA 3S9MC 4ILBA 4ELRA 5ICQA 5JQGE 3ZMSB 3C36A 3AA6B 1HR0T 5TAOA 3KSXA 1AWBA 2I4BA 4K0KT 4IB2A 4PE5B 2X68A 4MLQA 2ZMBA 4NXMT 1XDPA 4JUYA 4PFIA 3TCHA 3E0ZA 3ZMZB 3LK2B 1ZLQA 1MQIA 5ABFA 3K1PA 3MYUA 1WR0A 3KV5A 1NUXA 4R6KA 1FJ9A 5LYJE 1GGGA 4H45A 1Y20A 1B52A 5DYHA 2JMHA 4DDDA 2LSGA 2OA5A 5IWAT 2W7YA 3LDQB 5LBQB 5FXVA 3DP7A 1SW5A 3R6UA 4OFJA 4WKMA 1RYOA 4MHFA 3ANWB 3JC6D 4TN7B 1KEYA 1UIVA 1UTHA 2PT2A 2CRBA 4PE3A 4FECA 4EYYR 5DEXB 2W00A 1QJMA 1QW0A 2V3UA 2ZYMA 4NF6A 5H8HB 3AE1A 4QHOA 2PVUA 1AOVA 3IOVA 2E9XB 3FXQA 5TPAA 2VP1A 4ILAA 1UQWA 1XWMA 2DI4A 1IXHA 1QKBA 2ZM2A 4QFPA 3T9VA 5F5WA 1YPNA 3GZGA 1X79A 5I2NA 4BAYB 1FQEA 1XVXA 5JH7E 2XWIA 1NV2A 3E78A 3PUXF 1FQBA 4Q0CA 4HFEA 3MPKA 3I0QA 2NWJA 3O6HA 3RN8A 4FE8A 4GYSA 4IGRA 3C98B 1EU8A 5FXZA 2PT1A 4UVAB 4AKRB 1OLAA 2VVSA 1WODA 1J5ET 4PFRA 5LHIB 2XJ7A 3KBTA 3TEPA 1JNZA 5CBRA 1T72A 2ZXTA 5TP9B 4MLKA 4XTCQ 3CG1A 1MM6A 5HCMA 4QFOA 1QUKA 4EYUA 1HG5A 4AISA 4PFBA 4UABA 3AE2A 1DU2A 2V7LA 3AE7A 1GTKA 2QVVA 2WBBA 4AQGA 1FTJA 2MAWA 3KVAA 1H44A 1WRDA 4G8NA 4TOZA 5KX5E 3LUZA 3ONJA 4NUVA 3MP1A 5A5XA 3PUXE 2ZNSA 1FMVA 4N15A 4F18A 2XXTA 4DXUA 1UCUA 1TWYA 1USYE 3MUQA 3TELA 2DXRA 5L2LA 4L17A 3RTWB 2OWSA 3QNUA 5LJNA 4QFKA 4O3AA 3AEBA 3MP8A 4IO5A 4U1OA 3VLWA 3PU8A 1YKHB 5HEGA 1FSAA 4HKAA 3KJTA 4OEVA 4QSDA 5HEOA 2QS2A 3FBPA 3QUJA 2BBHA 3HCQA 1SE7A 2DQVA 3FVNA 4OWDA 3HR0A 2O6AA 1B3HA 1N3WA 3FVOA 2CEYA 2DXYA 2ZM8A 4ELQA 1G0IA 2B3BA 4GBWA 1ZEEA 1YZ0A 2Z6EA 1NNKA 1A8FA 3ISPA 1D0YA 2FVZA 2H7VC 1WFDA 2KR0A 4U7YA 4ESWA 3E22E 1MXYA 2BKNA 1GR2A 1W09A 2XXQA 4C0RA 4JI7T 5CMMA 4GVOA 3RUMA 1Y01A 2XAHB 1B1HA 2ACZA 2QVRA 3IAZA 2WM9A 5AQHB 4HCWA 4MNIA 4DV7T 3Q5XA 5F24A 4MALA 2D5WA 5I58B 3S4UA 5IM2A 2LHNA 4GQOA 4JI0T 2I4CA 5FHOA 1KNZA 2YJPA 4MNPA 2CWYA 4U33A 3KJ7A 5I84A 3B57A 2ESNA 2ZYOA 2UUCT 2CBIA 2VL8A 4ERRA 3VV5A 2WQYA 2LM9A 3BQLA 4BDLA 5JR9A 4YTMA 1IBLT 4JI6T 5LTCA 2L9QA 1B4HA 5ET7A 4TV9E 3RIFA 4ANJA 1VRBA 4H5GA 4NF8B 2BVMA 3C9HA 2OX3A 3H03A 2Q9QA 1M5DA 5EHMA 2XQ7A 4NPPA 2PBWA 1NNPA 2IW5B 4NQ8A 4DV1T 3G3FA 2XXXA 4M1PA 1N0TA 1NFTA 4PGPA 2H88A 3VDFA 1H3DA 4ZZBA 3VXCA 4HEAA 4QXCB 4CI3B 2WEFA 5IZ3A 4DR6T 3PTYA 1B6HA 3NKZA 1I6QA 4JB7A 4TWHA 2DWGA 3TQWA 3TLSA 4O3BA 1BTJA 2SPCA 4GWUA 2OJTA 4HFDA 2LKGA 1YAEA 3WAKA 1Q35A 5L4HA 3QB5A 4NEDA 4EDPA 4ZHQE 2WZIA 3RC8A 1JQFA 3PUAA 1V9DA 1W0BA 4GYRA 3OO7A 4F2OA 3MZ1A 3CIRA 1BLFA 4PP0A 4RK2A 2DE2A 3SEYA 4WW0A 1B51A 2F7CA 2P3NA 3SFDA 2J1DG 3SDFA 3ZKLA 4AS5A 4IL9A 4I40A 2HH7A 2V26A 1FBDA 2QS1A 3QK6A 2Y7WA 2L3LA 3GA8A 1RKMA 5I56B 4PK6A 1FJGT 3PJAJ 4GRKA 5E0OA 4OA4A 4ZXLA 5L8DA 5FVLA 3OKQA 4FEDA 1IXIA 1QSDA 4DCYA 5EHSA 2D2SA 1LBVA 2D21A 4MH5A 3ZS6A 4LF8T 2CM0A 5LP6E 3QOFA 5IYZE 4OVJA 4P0BA 3UU3A 2KNDA 4CXWA 3CIJA 5LBMA 4UV9B 3OSRA 3PUSA 3IK6B 2XAFB 1MXUA 4AQFC 3VE1B 2D3IA 1BP5A 4OVPA 4HXVA 4H9OC 1IBKT 2EHOC 3BK9A 1SD3A 3VRBA 4LONB 4EUOA 3RIAA 3HKCE 4OFLA 4BDOA 2CPTA 1EH3A 2BG9B 5B7DA 1UTBB 4M4GA 3C31A 4U2RA 4R6HA 3M3ZB 3RYIE 4DE8A 1LVFA 2DOJA 5HWYA 3PPPA 5J0ZA 3TTMA 1MXZA 4N6DA 3V5AA 2FJEA 3ZKRA 2BZBA 4EZ4A 4HFHA 2YK0A 2FYIA 3N2GE 3GN5A 5LHGB 2IC9A 1B2HA 1YCJA 4R74A 1QKAA 3Q26A 4ZZCA 4X62T 4JV5T 4HFIA 4X5TA 2WX9A 2XD2A 4YKPA 3MVYA 4LUBA 2BS4A 4ISSA 5FHMA 5AQVB 4ZS9A 3OSQA 3EDUA 1IITA 1PB8A 3M8UA 5JDNA 4LF6T 2OWZA 3E9XA 1ANFA 4MHCA 2WS3A 4LVQA 2O7IA 2BBJA 4CI2B 3MP6A 2Y7RA 3T0JA 2THIA 3L6HA 5EYHA 1JW4A 3T8OA 4QSCA 1XI6A 2V1DB 3VRAA 2XQYA 3K4UA 2Q2CA 2FBWA 4L0RA 1LRZA 4HWFA 3A5XA 1FPLA 3RQWA 1A40A 1IXGA 3OYZA 4H5FA 1XOCA 4NF4B 2D5UA 1MY1A 2UUBT 2E9XC 4CI1B 3E79A 3OELA 5AQKB 4XFEA 2QYWA 1Y64B 3EHZA 5DABA 2D0TA 2V3QA 4DV5T 3A3CA 4BDNA 3S2VA 3SESA 2UXDT 1NUZA 2ONSA 1XNRT 4Z0IA 2MYSA 1RDXA 4YSYA 2Y48B 2FJBA 4XKPA 1AMFA 3BQIA 5L3DB 2UVJA 1VCTA 4EQBA 3ZN1B 3HHFA 4QWNB 2H7OA 3BIGA 2HPGA 1FBCA 4NX1A 3HHGA 1MMGA 4R73A 2OBGA 1ZHCA 3K6WA 3P4PA 1ZKBA 2REJA 4GBVA 4LF7T 4YZZA 2B65A 1F9BA 2XPKA 3PMWA 2ZZVA 3N9QA 1IMCA 5C8YE 3NOHA 4EV6A 4YHJA 3W9VA 4A5XA 4GLIA 1FJ6A 1XZYA 3O6IA 1A54A 4PC9A 5I59B 3IO4A 5I5PA 5J1DA 2GRVA 1K9YA 4OYVA 1ZJLA 3O28A 3Q5WA 5KDTB 3PMXA 2ZYNA 3NRYA 4KR5A 2I0MA 3IHRA 3TLVA 1PC3A 4F39A 3SETA 3P4QA 3FXDB 2W2UA 2IHR1 3P7IA 3CVRA 4B3ST 1PDAA 3BFUA 3SOLA 1IZNB 3EAMA 2NVUB 1XT8A 1LCTA 4ADZA 1J1JA 2K5BB 4FEBA 3PUQA 2FUPA 5IHYA 2X66A 3HSTA 2PG8A 2PYYA 3AE8A 4JWXA 1EYJA 3HV1A 2B1EA 3KOTA 5HAXA 1HF8A 3NBXX 2KLFA 5L9OA 5CBSA 4MBQA 1BIYA 3TTLA 2UYFA 4AXPA 4R72A 4O2AE 1LEVA 4OANA 1KK7A 3VR9A 3MA9A 3FZFB 3P4RA 1ZP0A 3RTFB 3MSTA 3JC6C 5CC2A 4ZEDA 2F5XA 4F3BA 4F3GA 4O2BE 1EZOA 5DTBA 1CB6A 4OFOA 4DNDA 4LFBT 1Q9DA 3H6WA 3IB2A 4HE2A 4ND9A 1SDXA 2VGQA 3RF1A 4ZE8A 3PJAA 4OESA 4OETA 1UTHB 2O1MA 3U8QA 5BR8T 3CWZB 3RI5A 4UA8A 2OZZA 3TPAA 2R71A 3KEIA 4U4XA 3TAJA 1ZOYA 3NRXA 4YLHA 4NF6B 1HX8A 3B8BA 5ET6A 3CI8A 2Q88A 5A1LA 2ES0A 4EIWA 4I55E 4GOTA 2NTYA 2QRYA 4ZEBA 4GIWA 5I2NB 4B3TT 4XIGQ 2V7MA 4IE4A 1LCFA 2AL4A 3RX6A 4PFYA 3MXZA 4TQUQ 4AKIA 2A5TA 2KMFA 4PETA 2RCBA 5H8QA 2R6GF 3AVSA 3FATA 3LV0A 3A7MA 5M2VA 4X8RA 3IJOB 1JP4A 4U22A 2QSXA 3ZKKA 3ZC1A 3MKDA 3RKOA 2ONKE 2R9JA 2Z8EA 4OMBA 4ESXA 1B4ZA 1N7WA 3MZBA 2Q9QD 3V89B 5JEIA 1B0LA 3I1AA 2I49A 2YN6A 3NWIA 3PUVF 4ZEIA 4TX5A 1XMQT 1OEDA 5KXJA 2O51A 3IB1A 2CMRA 1B7HA 5LJMA 2V7JA 3OMBA 1LFIA 3B50A 3V83A 2ZLYA 1NV6A 2LT3A 3H06B 1T0KA 4I62A 5A5XB 3AECA 3CFLA 1ZKEA 1MPCA 3DLNA 2N9DA 1LAHE 2J47A 4IDQA 2R6GE 3I3VA 3KC1A 1YXIA 3AAIA 5FXWA 2DWIA 4P1EA 3MAMA 4UACA 3UIFA 1KA0A 3KV4A 2Y5LA 3G06A 4LZ8A 3OJAA 2CZKA 3PUVE 1NENA 2WKYA 2ZNUA 2A2FX 1MH3A 1B7UA 1A7LA 2E8IA 3S9LC 2JRKA 1S94A 1YQ4A 1I94T 3LG7A 4QKNA 5AQGB 1FQAA 4G63A 3O1IA 5FP3A 4MF3A 2HZKA 4PK4A 3O97A 3HFUA 3FZKB 1FTLA 4P0IA 1B0HA 4DXCA 1FPEA 4IDPA 2Q89A 4KHZF 3RIUA 3V5SA 5J1GA 4IT4A 4H63H 1AIVA 2X51A 4N07A 4X66T 3Q9DA 4WYVA 1D3KA 1FPBA 2OK2A 3ZSFA 2DWJA 5ITPA 1T7SA 5F8PA 3MVXA 2W67A 3G3KA 5L3FB 2JQQA 2P0SA 4PFUA 2B3FA 2BG9C 2ZZWA 4PNIA 3BBRA 3AAEB 3K2DA 3SEXA 3AE9A 1YXRA 1A8EA 3RPWA 2V25A 1I6BA 4HE0A 4KYDA 4YB5A 3C34A 4O4HE 4DUZT 5L3CB 1FQCA 4QH4A 4PJJA 2F36A 2KSRA 4I8CA 2Q9QB 4YTPA 3P8CD 4B3MT 1RDYA 4KHZE 3J9X1 3UFGA 3Q25A 3PMVA 1YKEB 3ZPOA 4YJ2E 3UP9A 5K2XA 2NR4A 2JQ9A 2G0UA 3UUBA 1URGA 1TFDA 1IBMT 4F1YA 3KVBA 5IZ3B 3U92A 5H8FA 4DV3T 3GMIA 4JVIA 4R9GA 4DLDA 3AXJA 4H9NC 2GHAA 2N2NA 4TV8E 2F97A 1XDOA 5C2TA 1AH5A 4KPTA 5B70A 3Q5DA 2H99A 3P4SA 2XAQB 3RKGA 2W63A 3CQCB 4X1IE 3OEMA 4NWDA 3PD9A 3AAAB 4TWFA 3QYTA 5HXCA 5FBPA 3CMLA 3FVGA 4ELOA 4DUYT 2HPLA 1FW0A 3MPLA 3C32A 2BKPA 4RJZA 1LBBA 3ESLA 2WU2A 3LSVA 3RYCE 4N17A 4BJNA 2ODVA 5J2UE 2ANJA 1USYH 3OO6A 3CQGB 3A3UA 4OQOA 5ELVA 5ETWA 1MY3A 4IY6A 2UVHA 3SEWA 5HXRA 4JXIA 1MIVA 1MQHA 4O4LE 2HN1A 4N6KA 3DM0A 5FMNA 1NNTA 4BDQA 1PB9A 4LQ2A 1PBQA 1NAFA 4N8YA 3OBVE 4YMBA 3TLWA 2GFEA 3MK7C 4CXYA 3K6XA 1NV3A 2H5YA 4WZXA 1WDNA 1JEVA 3RPLA 4IREA 2CZLA 1POY1 2UXCT 4GXSB 4EXLA 3RYHE 1IXCA 2QGSA 2DVZA 1H7CA 3ZT5A 4LF5T 3IOUA 3UU4A 1OXZA 2MBGA 2AIXA 4F3PA 4HW8A 1QUIA 3AEDA 2Y8DA 5AQTB 1H43A 2CMOA 1LBWA 3DP6A 3M3LA 2ZNTA 3AB3B 2DYXA 2XWOA 2F3DA 1LSTA 2CEAA 3OXNA 2RC7A 2VQFT 1X9BA 1Y3NA 5H6RB 5L3EB 2XXIA 3KOSA 2A72A 3O6GA 3TYHA 5ABGA 3IB0A 3IOWA 2DL1A 5JDQA 3RRWA 3SERA 1D0ZA 4LQ5A 3MW0A 3E3KA 4GWXA 4QFNA 5JTYA 1IAPA 2V7IA 2KLQA 2XTLA 3NZQA 3G3JA 4GFRA 4F2QA 5AA4A 3GN5B 4UVBB 2I3VA 3RYDA 3W9WA 2A5SA 1CUNA 4YSZA 3TZAA 1H45A 2VKOA 3RT8A 4ZOLE 3RC3A 4GX4A 3TLTA 2JPFA 1HNXT 3Q2MA 4U23A 5EQ8A 3JCFA 4F1UA 1P1OA 3F31A 2XXKA 4AB6A 1E2AA 4Q25A 4MLVA 3JADA 3L3PA 5I57A 1YYZA 2IEEA 3FXRA 3MJNA 4H9SE 4MFIA 3V8XB 4GL8A 1R9LA 5I2KB 4TLMB 1D9YA 2IUBA 4XAXB 4UF0A 1B3FA 5EQ7A 4HTEA 5HPQA 2DCFA 5JDFA 4F8HA 3K02A 4PF8A 4JI3T 4XBFB 1HTJF 4F3SA 5FHNA 4NF0A 1R9QA 3VFJA 2CXDA 3T22A 4BDRA 5H8NA 1ZU0A 1JW5A 3I9YA 1Y3PA 2ZMAA 2F7AA 4GK5E 4GOUA 4FJOA 1LBZA 1DTZA 2PCRA 1UK5A 2BJJX 4LMLA 4C91A 4HGAA 1G0HA 4ECFA 2WDVA 2XAJB 5HCJA 4EQ7A 3Q27A 3THIA 4G77A 4MCOA 4HWCA 3VKHA 2FIXA 3T9UA 4RYAA 1WCRA 4C1UA 3CSGA 5ET5A 2I0BA 4PQJA 1XVYA 3KDSE 4FJPA 3FJGA 3LR1A 4ISTA 2LHRA 5KZTA 5LDZA 3IFCA 1W0AA 1AJ3A 4IIJE 1FPJA 4EEDA 2GHBA 3LSXA 1M5EA 2RA1A 2DWAA 3CHGA 2X9HA 2YOEA 3N9PA 4KYEA 4PF6A 2YKSA 1CHUA 1S7YA 3QXMA 3O29A 2UXXB 4X04A 4Q5TA 1Z0PA 3N5LA 1N3XA 4PW8A 2NXOA 3DP8A 3IR1A 3I9WA 3RPUA 3RHWA 3UULA 3K1SA 4PJLA 4QX7B 3OENA 5CM6A 2ZZXA 2A3DA 2VB6A 1T8BA 2VKDA 2CLYB 3D4GA 1A99A 4THIA 2WDQA 5DVIA 2O84X 4N78D 4TWDA 4JYAT 2NUVA 4DV2T 4O8MA 1GV8A 3T9HB 4NUUA 4NMYA 3SRZA 2Q9TA 5I3SA 2NW7A 4AQFA 5CJ5A 2IMLA 3CX6B 1KZ8A 4N91A 5KDMC 3IA3A 3KN8A 3ZT6A 3UFEA 4JI4T 2V6YA 2YDSA 1LAXA 2F34A 3ILUB 3Q29A 1B5IA 3P4WA 4G2AA 1N7XA 3ZYLA 1LVKA 4CN4A 5IUXA 3FHNA 3W15B 1Z7ME 4X64T 1N33T 4DXBA 1O3XA 1MPDA 5JRCB 5DT6A 2XXRA 4YKIA 3LFMA 3C33A 2HXRA 2JJKA 4IDZA 4OVTA 2WU5A 4EEBA 5AQJB 4IDNA 4PDDA 4U1ZA 2DWHA 5BUUA 4YKKA 4G68A 3FASA 1D9QA 3FZLB 4EQ9A 2ODUA 5CGMA 5CRYA 4YJ3E 3UQ4A 1NH7A 4ASKA 4G8MA 1FRPA 1NV5A 4OVSA 3FB2A 3CSBA 4DR7T 1HSJA 1VOMA 3ZMVB 4EGWA 4OHNA 3MZKB 1JNRA 3CVGA 4H8JA 3C4XA 1MQDA 1UUSA 1JVYA 2LOSA 5EK3A 2XX7A 4PJMA 1CE2A 1EZPA 2YDRA 2PX1A 2Q9QC 2A5TB 3OOAA 3CX7B 4WEPA 5H8QB 3PD8A 3AA0B 4HFBA 4PFWA 1QLBA 1I69A 3U1OA 2E9XA 3MVWA 3GBAA 1BR4A 4OK0A 4GX6A 2UU9T 2BDEA 1FQFA 2LSJA 2LRLA 4F19A
chains in the Genus database with same CATH topology
3N9OA 2XXPA 4NF5A 1D1AA 2X67A 3H6VA 2ZYKA 3PPRA 4OZ9A 3RQTA 2H98A 4OERA 4JDFA 3LK3B 2X9YA 1P1WA 4DVDA 4ZS2A 1Y4TA 2Z8DA 4OYKA 3O9XA 2I58A 3EPEA 2WMNA 3RH3A 2E0SA 3LSFB 1PEBA 3TODA 2CWOA 3CQXC 5EZYE 4KUMB 1YW0A 5TP9A 5H6QB 5CA1E 3U78A 4OHFA 3N6TA 1MXXA 3ODBA 5LA6E 3GLBA 5AA1A 5CMCA 4LA9A 2LSIA 1B58A 3K01A 2DE4A 4KBMB 2OWTA 1OQHA 4IHJE 2DWKA 4QX8B 2QPQA 4Q30B 2VKHA 3ECRA 4F31B 4O4JE 4JSDA 5LG4A 1FTOA 3USDA 2MTQA 3M65A 1YTVA 3AXFA 1B3LA 2VK9A 4P0GA 1VFEA 3JV9A 1AL3A 1OIBA 4ELPA 4GL0A 1Y4CA 3R7XA 2I0CA 2WSSV 3ETUA 2LJLA 1MG1A 2Q2AA 1L5TA 4GF8A 5HYAA 4FIMA 4X1DA 3ZYKA 1FTKA 2Z23A 4RPNA 1II5A 3AA1B 4HE8A 4HS7A 3PPOA 2E1SA 2VD3A 3C64A 3N9NA 1OLCA 3MWBA 5LXTE 5L9MA 4EXTA 5FY1A 3L09A 4P0AA 1Y1ZA 1NKXA 2O68A 2XD3A 2WWUA 5JDGA 2HQ0A 3MJXA 3ZEFB 1O64A 3QSLA 2PFVA 2K48A 4XZCA 2YPNA 2XASB 2F35A 2C5IT 5H8FB 2XHEB 2VD2A 5CI5A 4H9RC 5L3GB 3M3FA 2O1LA 3CFZA 4X1BA 3AVRA 4RY1A 4PFPA 4EOZB 2KWHA 2NW9A 2Q8JA 1B7TA 5KCJA 1POTA 1MH4A 4B6XA 4YFSA 4R2BA 4YB7A 3IF8B 2V7KA 2YU2A 1XHYA 1GVCA 4EZHA 3GWHA 3N9LA 4J2CA 4V1Av 5M4YA 3KGCA 3TDJA 1N84A 3PURA 4RA1A 3K0VA 5LOMA 1U4QA 1OVBA 4H67A 1NMUA 1P1NA 3TUSA 4KD5A 3H6TA 3HKBE 5AE4A 3TKDA 2X0LB 1VR5A 5TPAB 3MVZA 3KSJA 3EQ1A 2M8CA 4LZ5A 4JWYA 5IAIA 4O4IE 1LGBC 4EB6E 1US4A 2DS9A 4QRZA 1XC1A 3ZCJA 3DTOA 3J7Yq 4G4PA 2K9AA 4AI6A 3ZCIA 3FD3A 1B7ZA 4OEUA 3SEVA 4I43B 4GWOA 4I9DA 2HZLA 2CLYC 3WAFA 1G8XA 1WVJA 4H9QC 3F11A 4N13A 5DQWA 3G3IA 1S9TA 5JTYB 3CKDA 2WMOA 2JMKA 2G93A 2DLRA 5AA4B 2W61A 1M5CA 1M5BA 4H63V 3LUYA 4ZI3D 2HFBA 3HKDE 4KQPA 1OWAA 3W15C 3N2OA 1SW1A 3O2AA 2AYSA 4JBZA 4BDMA 1JVXA 2X9XA 3KFMA 3MQ9A 4RXLA 3ZLIA 3K00A 1D4NA 1MIWA 5I57B 1DOTA 1DMBA 2OCUA 3PV0E 5DVJA 4UF0B 4JSOA 4IGTA 4JEHB 1BR2A 5LGTB 4OYJA 1ATGA 1HCIA 4ZZEA 1HG2A 1MXVA 2HAUA 1SW4A 4I4TE 1IZ1A 5H8NB 3I5OA 1QULA 3A09A 4DO0A 4EF1A 2LEHA 2NOXA 2D0UA 2DSFA 3N9MA 2UXNB 2YU1A 3UN6A 1E1HB 4NF4A 3O66A 3B13A 3KFWX 1B46A 3FBZA 5JR9B 3ZJ1A 3KBRA 4KMCA 4O3CA 4OXVA 4AB5A 3VVDA 2ONRA 1P1UA 2XXUA 1VE4A 1IUDA 2NWBA 1B05A 3EF7A 3IL1B 4PJNA 4F6RC 3LBXA 3T9XB 3G3HA 2Z8FA 4WBNE 3H6UA 1SQYA 3KBUA 3UGWA 4ZDMA 2PJQA 3UUNA 1MMNA 2O7UA 4KYSA 3EDVA 1TXFA 3R6NA 3BQKA 2KXPB 2CXLA 4U4SA 1MMDA 4X20E 3VHLA 5I59A 3KINB 3VU7H 3JYRA 2AL5A 5HXSA 2IAKA 3U72A 1HSLA 1HSEA 2H9BA 3UA8A 4M1VA 3PDYA 2W62A 2VASA 1SYIA 3H4ZA 4Z7EA 1P1QA 3PE0A 5EK2A 2P2AA 3FJ7A 3VVFA 2CE7A 3H37A 2H4IA 4IO4A 4XKRA 3U93A 2Y6XA 3NZPA 3FV2A 1ELJA 1FEWA 4ZZAA 4G68B 2Y7KA 1S50A 3HL6A 2X7QA 3FXEB 2F8DA 3KV9A 1IEJA 1UIUA 1LBCA 4RK9A 3UT5E 3F2EA 3PPQA 1SBPA 1O7TA 1WYBA 5J2TE 4F22A 5LHHB 1B5JA 4L5GA 1MDP1 3K3NA 3B7DA 1ZV4X 4KFQA 2CA5A 4IY5A 4E0WA 1WR6A 4U74A 3B6TA 3MACA 2F6PA 4R2FA 5TU0A 2Y84A 3C4WA 1FCKA 2I3WA 4YB6A 1B9JA 3IOTA 3HPIA 4NF5B 3ONXA 5DQVA 4H9PC 2ZM0A 4AKHA 1QVSA 2XAGB 5JREA 2QMXA 3RGYA 5HXHA 1EZ3A 4HTGA 1IJ5A 3T96B 3LK42 3ZMTB 3GBBA 2ALUA 3B6WA 1VFDA 1P99A 4RPOA 1NL5A 5LOVE 2DNXA 4U21A 1LFHA 4GK0E 3E13X 2F78A 3M3KA 3QIMA 4KCDA 4R75A 3H3AA 5GONE 4BLAA 3QC9A 4K0UA 3HO7A 1WYCA 1LAFE 3TKLB 4LP2B 4GD5A 3IEEA 3EUHA 1G73A 5FXXA 2X7PA 5L9SA 4C90A 2NOOA 1D9VA 5LCYA 1NNFA 2RCAA 5CB4E 4QF9A 4YU0A 1US5A 2DP8A 3CR9A 2LSYA 3LBSA 3ZYMA 4IGUA 1MQGA 3PUYE 3FXUA 1SA0E 2YINA 1MY2A 3HN0A 3PTRB 2YEVC 5LGNB 1NH8A 2UVGA 4ONYA 2P1SA 1ZIUA 3PUWE 3FZVA 3O1HA 4XKNA 2H3RA 2QMWA 3IORA 3KN3A 3EHSA 2XXWA 3ONMA 1MM7A 2UYEA 2CCQA 4X48A 2C5JA 5IKBA 4HFVA 1JEUA 1B1XA 1FIOA 4G2ZA 3G3GA 4IE6A 4IE7A 4ZI2D 3E4RA 3QAXA 4EF2A 2JJ9A 2XUEA 2N1GA 3WAEA 2I48A 5JK4A 1US7B 3UK4A 4F29A 4DMWA 3N94A 3K3QC 4ZE9A 1BR0A 1OMPA 1Y1MA 2EHOA 3HA4A 2UXAA 2RKMA 2FA7A 3K6UA 3RNNA 4GXAA 2RC9A 3N26A 5H8SA 5AA2A 2X9WA 2GK9A 1FQDA 5KCJB 2X26A 5JDHA 5AA3A 2V84A 5ITOA 4POWA 1TFAA 1D1CA 3U3IA 3I6VA 5AFUL 3PUZE 4X1YE 2RF1A 3VKGA 3B6QA 3OO8A 2I59A 2QA7A 1XS5A 3RY3A 3IX1A 2F7BA 2MOZA 1NWMX 4CZZB 4P09A 4Z8XA 5HXEA 4ZI7E 2HEUA 2RP4A 5EK4A 5ISUA 3SEUA 2LOPA 5JR9C 4E7ZA 1JNFA 1UX5A 3EHTA 4IO7A 3V5UA 2Y7PA 4XKQA 2KINB 1UX4A 3ANWA 3R26A 4LATA 2QS3A 4FORA 5JDMA 4F1VA 2NTXA 4AKLA 1D1BA 5DEXA 5H8HA 4DBRA 4JWOA 3BKIB 4QSEA 3LSLA 4KCCA 3N2KE 3QUFA 1LLSA 3TCGA 3CX8B 5L3BB 1Y3QA 1SW2A 3EHUA 4JEUB 2I6EA 2QL3A 4ZI3C 4NE4A 4CQIA 3O9PA 2XXYA 4DBQA 2HXWA 4NTLA 4IO2A 4UELA 4C1TA 4BJMA 3UUXB 5F3JA 4HN9A 4E0XA 1M5FA 3BFTA 3PU3A 4ZS3A 3O4XE 1J1NA 3ZN0B 3PGFA 2L8KA 3EN3A 1SHZC 2WAUA 2OLBA 4QFLA 5FTIA 2XXHA 1MDQA 2HCAA 3IO6A 1VSOA 3KG2A 2IC6A 3Q28A 4R9FA 4G68C 3DELB 5HM4B 4ZEFA 3GXAA 3R84B 4TZ4C 1LAGE 4DCXA 3CG3A 1SI0A 3ILTB 3TMGA 4UXNB 3PU5A 4N6PA 2HPJA 3CPZA 4G8HA 4WXJA 5HBCA 3I0OA 3C51A 4K3FA 3C4MA 4FAJA 2DVCA 5I2KA 3K6VA 2RC8A 5JVDE 2REGA 2M67A 1URDA 1R1NA 1JETA 4ISUA 3AA7B 3TTRA 1DPEA 2V93A 2QJEA 3K8PC 3RYFE 4QXBB 1DTGA 3MZ9A 3ZMUB 1SVXB 4TUYE 1U5PA 1BKAA 2HAVA 1JW1A 2BVLA 4EXKA 4OENA 1URSA 2KT9A 4JLEA 5JDLA 5I58A 4L9IA 4QXHB 4DIGA 5BMVE 3LBXB 3T66A 4AQ4A 2DE3A 2UVIA 3FBLA 1OVTA 2LSKA 1MRPA 3TFLA 1S35A 3O1JA 2O69A 2LE8A 4LZ7A 5F7VA 1DSNA 5FTHA 5ICTA 3LSWA 4NF8A 3IJXB 2PMSA 4OTEA 3H3GA 3FIRA 2VWAA 3UORA 3VVEA 4X1KE 1MXWA 4RNSA 4ZECA 2Y7IA 3RRCA 1DPPA 5CMBA 1O63A 1MQJA 1LB9A 3DJBA 3PPNA 4WBOA 4BA9A 4FATA 3RT6B 3OEKA 3CRBA 3L6GA 3TQLA 4I50E 3OO9A 1HFAA 4YKJA 2NP9A 3MBPA 4POXA 3N6UA 4YICA 4YMAA 3K3OA 3S9NC 3CFXA 4EAHA 2NW8A 4OFZA 4P11A 1H76A 5DJQC 3SKPA 3VLVA 1A55A 1ZBMA 1HS7A 4Q8RA 5JRCA 3G7WA 3E08A 1TT1A 1SI1A 1N04A 1QUUA 4XXUA 5ADXL 4UIGA 2ACXA 4IE5A 4WNKA 4O8SA 3HI2A 4ILUA 4UEMA 4DMVA 5I56A 5LNKA 3K1NA 3F57A 3TCFA 5FYMA 1B40A 2XX9A 1B3GA 3UTKA 3OYXA 3OD7A 3TTNA 1MPBA 3SS1A 2V3TA 3JZJA 3WI3A 1MS7A 4UV8B 1PBPA 4IE0A 3C35A 1FMWA 4U72A 2K24A 5CMKA 1N76A 3RLFE 4CXXA 2VOZA 4AKGA 1MMAA 1OQGA 2W0GA 3KV6A 4H1XA 1MNEA 2P9BA 2CXFA 5LGUB 1FTMA 3T93B 1UTBA 3C4ZA 1MY4A 2C0SA 2Z22A 5FY0A 1EZ9A 1ZMGA 2F6GA 2FNCA 2EHOD 4KP3C 4GIZA 1SYHA 2QS4A 5F1QA 3FVKA 2XX8A 3K1MA 3S9EA 5AA2D 4H6DA 4R6YA 1ZTYA 3KN7A 3D0TA 4MBPA 1Q1KA 4MFRA 1B3EA 2XHDA 3KZGA 1KWHA 4HCYA 3WAJA 5DVFA 2WBLA 3FV1A 1QUJA 3SWHA 3DP4A 5BWJA 3FUZA 4I1DA 2PBIA 5EYFA 5FY7A 3ETVA 3FJMA 3C50A 5HWXA 3VXBA 2IA4A 1MY0A 3H7MA 3VLUA 2KWIB 4PFOA 4PFTA 2GH9A 3HKEE 4H8IA 4YAHX 1MIYA 1Z7NE 4A56A 1WLXA 1B5HA 5CA0E 4H0WA 1I6AA 1BR1A 4IO6A 4KI0E 4PK5A 1LB8A 3ZC0A 2H25A 1IQ7A 4WEDA 1T98A 4X9TA 4ZI2C 1Y9UA 3EVYA 2E9XD 2VHAA 5K2YA 1MNDA 1YD8G 4ZEKA 1IJ6A 2RINA 3TTKA 2VKJA 1B32A 5FNVE 1PB7A 3PUGA 4NWCA 3ZJ2A 4UVCB 4H65A 3UUMA 4E7SA 4PAGA 1LFGA 2KZ7B 2LAOA 1IIWA 2C5KT 3MC2A 4FI5A 2EHOB 5KDTA 1R6ZA 2ABHA 4DZ1A 3LC8A 5AA2B 4IO3A 1LKXA 4QHQA 2YLNA 4TLLB 5KMGP 3D4CA 2XXVA 3LJCA 3FGSA 3U94A 1D0XA 2DHRA 2G29A 3IBPA 1RYXA 3S9MC 4ELRA 5ICQA 5JQGE 3ZMSB 3C36A 3AA6B 5TAOA 3KSXA 2I4BA 4IB2A 4PE5B 2X68A 4MLQA 2ZMBA 4JUYA 3TCHA 3E0ZA 3ZMZB 3LK2B 1ZLQA 1MQIA 3K1PA 3KV5A 4R6KA 5LYJE 1GGGA 1Y20A 1B52A 5DYHA 2JMHA 4DDDA 2LSGA 2OA5A 2W7YA 5LBQB 5FXVA 3DP7A 1SW5A 3R6UA 4OFJA 4WKMA 1RYOA 3ANWB 3JC6D 4TN7B 1UIVA 1UTHA 2PT2A 4FECA 4EYYR 5DEXB 2W00A 1QJMA 1QW0A 2V3UA 2ZYMA 4NF6A 5H8HB 4QHOA 2PVUA 1AOVA 3IOVA 2E9XB 3FXQA 5TPAA 2VP1A 1UQWA 2DI4A 1IXHA 1QKBA 2ZM2A 4QFPA 3T9VA 1YPNA 3GZGA 1X79A 5I2NA 4BAYB 1FQEA 1XVXA 5JH7E 1FQBA 4Q0CA 3MPKA 3I0QA 2NWJA 3O6HA 3RN8A 4FE8A 4GYSA 4IGRA 3C98B 1EU8A 5FXZA 2PT1A 4UVAB 4AKRB 1OLAA 1WODA 5LHIB 3KBTA 3TEPA 5CBRA 2ZXTA 5TP9B 4MLKA 4XTCQ 3CG1A 1MM6A 4QFOA 1QUKA 4EYUA 1HG5A 2V7LA 1GTKA 4AQGA 1FTJA 3KVAA 1H44A 1WRDA 4G8NA 4TOZA 5KX5E 4NUVA 3MP1A 5A5XA 3PUXE 2ZNSA 1FMVA 4F18A 2XXTA 4DXUA 1UCUA 1TWYA 1USYE 3MUQA 3TELA 2DXRA 5L2LA 4L17A 3RTWB 2OWSA 5LJNA 4QFKA 4O3AA 3MP8A 4IO5A 4U1OA 3VLWA 3PU8A 1YKHB 3KJTA 4HKAA 4OEVA 4QSDA 2QS2A 3QUJA 3HCQA 2DQVA 3FVNA 4OWDA 3HR0A 2O6AA 1B3HA 1N3WA 3FVOA 2DXYA 2ZM8A 4ELQA 2B3BA 1ZEEA 2Z6EA 1NNKA 1A8FA 1D0YA 2H7VC 4ESWA 3E22E 1MXYA 4C0RA 1GR2A 2XXQA 5CMMA 4GVOA 3RUMA 2XAHB 1B1HA 3IAZA 2WM9A 4HCWA 3Q5XA 4MALA 2D5WA 5I58B 3S4UA 2LHNA 4GQOA 5FHOA 2I4CA 1KNZA 2YJPA 2CWYA 3KJ7A 5I84A 3B57A 2ESNA 2ZYOA 2VL8A 4ERRA 3VV5A 2LM9A 3BQLA 4BDLA 5JR9A 2L9QA 1B4HA 4TV9E 4ANJA 1VRBA 4H5GA 4NF8B 2BVMA 3C9HA 3H03A 2Q9QA 1M5DA 5EHMA 2PBWA 1NNPA 2IW5B 3G3FA 2XXXA 4M1PA 1N0TA 1NFTA 3VDFA 1H3DA 3VXCA 4HEAA 4QXCB 4CI3B 1B6HA 1I6QA 4JB7A 3TQWA 2DWGA 4O3BA 1BTJA 2SPCA 2OJTA 1YAEA 3WAKA 1Q35A 4NEDA 4EDPA 4ZHQE 3RC8A 1JQFA 3PUAA 1V9DA 4GYRA 3OO7A 4F2OA 3MZ1A 1BLFA 4PP0A 4RK2A 2DE2A 3SEYA 4WW0A 1B51A 2F7CA 2J1DG 3SDFA 3ZKLA 2HH7A 2V26A 2QS1A 3QK6A 2Y7WA 2L3LA 3GA8A 1RKMA 5I56B 4PK6A 4GRKA 5E0OA 5L8DA 3OKQA 4FEDA 1IXIA 1QSDA 4DCYA 5EHSA 2D2SA 2D21A 4MH5A 3ZS6A 2CM0A 5LP6E 5IYZE 4OVJA 4P0BA 2KNDA 4CXWA 3CIJA 5LBMA 4UV9B 3OSRA 3PUSA 3IK6B 2XAFB 1MXUA 4AQFC 3VE1B 2D3IA 1BP5A 4H9OC 2EHOC 3BK9A 1SD3A 4LONB 4EUOA 3HKCE 4OFLA 4BDOA 1EH3A 5B7DA 1UTBB 4M4GA 3C31A 4U2RA 4R6HA 3RYIE 4DE8A 1LVFA 2DOJA 5HWYA 3PPPA 3TTMA 1MXZA 3V5AA 2BZBA 4EZ4A 2YK0A 2FYIA 3N2GE 3GN5A 5LHGB 2IC9A 1B2HA 1YCJA 4R74A 1QKAA 3Q26A 2XD2A 4YKPA 3MVYA 4LUBA 4ISSA 5FHMA 4ZS9A 3OSQA 3EDUA 1IITA 1PB8A 3M8UA 5JDNA 3E9XA 1ANFA 4MHCA 4LVQA 2O7IA 4CI2B 3MP6A 2Y7RA 2THIA 3L6HA 1JW4A 3T8OA 4QSCA 2V1DB 2XQYA 3K4UA 2Q2CA 4L0RA 1LRZA 3A5XA 1A40A 1IXGA 4H5FA 3OYZA 4NF4B 1XOCA 2D5UA 1MY1A 2E9XC 4CI1B 3OELA 1Y64B 5DABA 2D0TA 2V3QA 4BDNA 3A3CA 3S2VA 3SESA 2ONSA 4Z0IA 2MYSA 2Y48B 4XKPA 1AMFA 3BQIA 5L3DB 2UVJA 4EQBA 3ZN1B 3HHFA 4QWNB 2H7OA 4R73A 3HHGA 1MMGA 2OBGA 1ZHCA 3K6WA 1ZKBA 2REJA 4YZZA 2B65A 1F9BA 3PMWA 3N9QA 5C8YE 4YHJA 3W9VA 4GLIA 3O6IA 1A54A 5I59B 3IO4A 5J1DA 2GRVA 4OYVA 1ZJLA 3O28A 3Q5WA 5KDTB 3PMXA 2ZYNA 3NRYA 4KR5A 3IHRA 1PC3A 4F39A 3SETA 3FXDB 3P7IA 3CVRA 1PDAA 3BFUA 3SOLA 1IZNB 2NVUB 1XT8A 1LCTA 4ADZA 2K5BB 4FEBA 3PUQA 5IHYA 2X66A 3HSTA 2PG8A 2PYYA 4JWXA 3HV1A 2B1EA 3KOTA 5HAXA 1HF8A 3NBXX 2KLFA 5L9OA 5CBSA 4MBQA 1BIYA 3TTLA 2UYFA 4AXPA 4R72A 4O2AE 1KK7A 3MA9A 3RTFB 3JC6C 5CC2A 4ZEDA 2F5XA 4F3BA 4F3GA 4O2BE 1EZOA 5DTBA 1CB6A 4OFOA 4DNDA 3H6WA 4ND9A 3IB2A 1SDXA 2VGQA 4ZE8A 4OESA 4OETA 1UTHB 2O1MA 3U8QA 3CWZB 4UA8A 2OZZA 3TPAA 2R71A 3KEIA 4U4XA 3TAJA 4NF6B 3NRXA 4YLHA 1HX8A 3CI8A 2Q88A 5A1LA 2ES0A 4EIWA 4I55E 4GOTA 2NTYA 2QRYA 4ZEBA 4GIWA 5I2NB 4XIGQ 2V7MA 4IE4A 1LCFA 2AL4A 3RX6A 4PFYA 3MXZA 4TQUQ 4AKIA 2A5TA 2KMFA 4PETA 2RCBA 5H8QA 3AVSA 3FATA 5M2VA 3IJOB 4U22A 2QSXA 3ZKKA 3ZC1A 3MKDA 3RKOA 2ONKE 2R9JA 2Z8EA 4OMBA 4ESXA 1B4ZA 1N7WA 3MZBA 2Q9QD 3V89B 5JEIA 1B0LA 3I1AA 2I49A 4ZEIA 4TX5A 2O51A 3IB1A 2CMRA 1B7HA 5LJMA 2V7JA 3OMBA 1LFIA 3V83A 2ZLYA 2LT3A 3H06B 1T0KA 4I62A 5A5XB 3CFLA 1ZKEA 1MPCA 3DLNA 2N9DA 1LAHE 2R6GE 3I3VA 3AAIA 5FXWA 2DWIA 3MAMA 4UACA 3UIFA 3KV4A 4LZ8A 3OJAA 3PUVE 2WKYA 2ZNUA 2A2FX 1MH3A 1B7UA 1A7LA 2E8IA 3S9LC 2JRKA 1S94A 3LG7A 4QKNA 1FQAA 4G63A 3O1IA 5FP3A 4MF3A 2HZKA 4PK4A 3O97A 1FTLA 4P0IA 1B0HA 4DXCA 2Q89A 3V5SA 5J1GA 4H63H 1AIVA 2X51A 4N07A 3Q9DA 2OK2A 1D3KA 3ZSFA 2DWJA 5ITPA 3MVXA 5F8PA 3G3KA 5L3FB 2JQQA 2P0SA 4PFUA 2B3FA 4PNIA 3BBRA 3AAEB 3K2DA 3SEXA 1A8EA 3RPWA 2V25A 1I6BA 4KYDA 4YB5A 3C34A 4O4HE 5L3CB 1FQCA 4PJJA 2F36A 4I8CA 2Q9QB 4KHZE 3P8CD 3J9X1 3Q25A 3PMVA 1YKEB 3ZPOA 4YJ2E 3UP9A 5K2XA 2G0UA 1URGA 1TFDA 4F1YA 3KVBA 3U92A 5H8FA 3GMIA 4DLDA 4R9GA 4H9NC 2GHAA 2N2NA 4TV8E 2F97A 4KPTA 5B70A 1AH5A 2H99A 2XAQB 2W63A 3CQCB 4X1IE 3OEMA 4NWDA 3PD9A 3AAAB 3QYTA 5HXCA 3CMLA 3FVGA 4ELOA 2HPLA 1FW0A 3MPLA 3C32A 4RJZA 1LBBA 3ESLA 3RYCE 4BJNA 2ODVA 5J2UE 2ANJA 1USYH 3OO6A 3CQGB 3A3UA 4OQOA 5ELVA 5ETWA 1MY3A 4IY6A 2UVHA 3SEWA 5HXRA 4JXIA 1MIVA 1MQHA 4O4LE 3DM0A 5FMNA 1NNTA 4BDQA 1PB9A 4LQ2A 1PBQA 1NAFA 3OBVE 4YMBA 2GFEA 3MK7C 4CXYA 3K6XA 2H5YA 1WDNA 1JEVA 2CZLA 1POY1 4GXSB 4EXLA 3RYHE 1IXCA 2QGSA 2DVZA 1H7CA 3IOUA 1OXZA 2MBGA 2AIXA 4F3PA 4HW8A 1QUIA 2Y8DA 1H43A 2CMOA 3DP6A 3M3LA 2ZNTA 3AB3B 2DYXA 1LSTA 2CEAA 3OXNA 2RC7A 1Y3NA 5H6RB 5L3EB 2XXIA 3KOSA 2A72A 3O6GA 3TYHA 3IB0A 3IOWA 5JDQA 3RRWA 3SERA 1D0ZA 4LQ5A 3MW0A 3E3KA 4QFNA 5JTYA 1IAPA 2V7IA 2KLQA 2XTLA 3NZQA 3G3JA 4GFRA 4F2QA 5AA4A 3GN5B 4UVBB 2I3VA 3W9WA 2A5SA 1CUNA 3TZAA 1H45A 2VKOA 3RT8A 4ZOLE 3RC3A 2JPFA 3Q2MA 4U23A 4F1UA 1P1OA 3F31A 4AB6A 4MLVA 3L3PA 5I57A 2IEEA 3FXRA 3MJNA 4H9SE 4MFIA 3V8XB 4GL8A 1R9LA 5I2KB 4TLMB 1D9YA 4XAXB 4UF0A 1B3FA 4HTEA 5HPQA 2DCFA 5JDFA 3K02A 4XBFB 1HTJF 4F3SA 5FHNA 1R9QA 3VFJA 2CXDA 3T22A 4BDRA 5H8NA 1ZU0A 1JW5A 3I9YA 1Y3PA 2ZMAA 2F7AA 4GK5E 4GOUA 4FJOA 1DTZA 2BJJX 4C91A 4HGAA 4ECFA 4EQ7A 2XAJB 3Q27A 3THIA 4G77A 3VKHA 3T9UA 4RYAA 4C1UA 3CSGA 2I0BA 4PQJA 1XVYA 3KDSE 4FJPA 3FJGA 3LR1A 4ISTA 2LHRA 5KZTA 1AJ3A 4IIJE 2GHBA 3LSXA 1M5EA 2RA1A 2DWAA 2X9HA 3N9PA 4KYEA 1S7YA 3QXMA 3O29A 2UXXB 4Q5TA 1Z0PA 3N5LA 1N3XA 4PW8A 2NXOA 3DP8A 3IR1A 3I9WA 3RPUA 3UULA 4PJLA 3OENA 4QX7B 5CM6A 2A3DA 2VB6A 2VKDA 2CLYB 3D4GA 1A99A 4THIA 5DVIA 2O84X 4N78D 2NUVA 3T9HB 1GV8A 4NUUA 4NMYA 3SRZA 2Q9TA 2NW7A 4AQFA 3CX6B 5KDMC 3KN8A 3UFEA 1LAXA 2F34A 3ILUB 3Q29A 1B5IA 4G2AA 1N7XA 3ZYLA 1LVKA 1Z7ME 3FHNA 3W15B 4DXBA 1O3XA 1MPDA 5JRCB 5DT6A 2XXRA 4YKIA 3LFMA 3C33A 4IDZA 4U1ZA 2DWHA 5BUUA 4YKKA 4G68A 3FASA 4EQ9A 2ODUA 5CRYA 4YJ3E 1NH7A 4ASKA 4G8MA 3FB2A 3CSBA 1HSJA 1VOMA 3ZMVB 4OHNA 3MZKB 3CVGA 4H8JA 3C4XA 1MQDA 1JVYA 2LOSA 5EK3A 2XX7A 4PJMA 1CE2A 1EZPA 2PX1A 2Q9QC 2A5TB 3OOAA 3CX7B 4WEPA 5H8QB 3PD8A 3AA0B 4PFWA 1I69A 3U1OA 2E9XA 3MVWA 3GBAA 1BR4A 4OK0A 2BDEA 1FQFA 2LSJA 4F19A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXP A;  4NF5 A;  3H6V A;  4OZ9 A;  2ZYK A;  3PPR A;  3RQT A;  2H98 A;  4OER A;  4JDF A;  2X9Y A;  1P1W A;  1Y4T A;  2Z8D A;  2I58 A;  3EPE A;  2E0S A;  3LSF B;  1PEB A;  3TOD A;  5TP9 A;  3N6T A;  1MXX A;  3ODB A;  3GLB A;  5AA1 A;  5CMC A;  4LA9 A;  1B58 A;  3K01 A;  2DE4 A;  2OWT A;  1OQH A;  2QPQ A;  4Q30 B;  3ECR A;  4F31 B;  4JSD A;  1FTO A;  3USD A;  1YTV A;  3AXF A;  1B3L A;  4P0G A;  1VFE A;  3JV9 A;  1AL3 A;  1OIB A;  4ELP A;  4GL0 A;  1Y4C A;  3R7X A;  2I0C A;  1MG1 A;  2Q2A A;  1L5T A;  4GF8 A;  4FIM A;  4X1D A;  1FTK A;  2Z23 A;  4RPN A;  1II5 A;  4HS7 A;  3PPO A;  2E1S A;  2VD3 A;  1OLC A;  3MWB A;  5L9M A;  1Y1Z A;  1NKX A;  2O68 A;  2XD3 A;  2HQ0 A;  1O64 A;  3QSL A;  2K48 A;  2YPN A;  2F35 A;  2C5I T;  5H8F B;  2VD2 A;  5CI5 A;  3M3F A;  2O1L A;  3CFZ A;  4X1B A;  4RY1 A;  2KWH A;  2Q8J A;  5KCJ A;  1POT A;  1MH4 A;  4B6X A;  4R2B A;  4YB7 A;  1XHY A;  1GVC A;  4J2C A;  3KGC A;  3TDJ A;  1N84 A;  4RA1 A;  3K0V A;  5LOM A;  1OVB A;  4H67 A;  1NMU A;  1P1N A;  3TUS A;  4KD5 A;  3H6T A;  5AE4 A;  3TKD A;  1VR5 A;  5TPA B;  3MVZ A;  3KSJ A;  3EQ1 A;  2M8C A;  4LZ5 A;  4JWY A;  5IAI A;  1LGB C;  1US4 A;  2DS9 A;  4QRZ A;  1XC1 A;  4G4P A;  3FD3 A;  1B7Z A;  4OEU A;  3SEV A;  4GWO A;  4I9D A;  2HZL A;  3WAF A;  1WVJ A;  3F11 A;  4N13 A;  3G3I A;  1S9T A;  5JTY B;  3CKD A;  2G93 A;  5AA4 B;  1M5C A;  1M5B A;  3LUY A;  2HFB A;  4KQP A;  3W15 C;  1SW1 A;  3O2A A;  2AYS A;  4JBZ A;  4BDM A;  1JVX A;  2X9X A;  3KFM A;  3MQ9 A;  4RXL A;  3K00 A;  1D4N A;  5I57 B;  1DOT A;  1DMB A;  2OCU A;  3PV0 E;  5DVJ A;  4JSO A;  4IGT A;  1ATG A;  4ZZE A;  1MXV A;  2HAU A;  1SW4 A;  1IZ1 A;  5H8N B;  3I5O A;  1QUL A;  3A09 A;  4EF1 A;  2DSF A;  3UN6 A;  4NF4 A;  3O66 A;  1B46 A;  3KBR A;  4O3C A;  4OXV A;  4AB5 A;  3VVD A;  2ONR A;  1P1U A;  2XXU A;  1VE4 A;  1IUD A;  1B05 A;  3EF7 A;  3IL1 B;  3T9X B;  3G3H A;  2Z8F A;  3H6U A;  1SQY A;  3UGW A;  4ZDM A;  2O7U A;  4KYS A;  1TXF A;  4U4S A;  5I59 A;  3JYR A;  2AL5 A;  3U72 A;  1HSL A;  1HSE A;  2H9B A;  3UA8 A;  4M1V A;  1SYI A;  3H4Z A;  4Z7E A;  1P1Q A;  2P2A A;  3FJ7 A;  3VVF A;  2H4I A;  4IO4 A;  4XKR A;  3U93 A;  3FV2 A;  1ELJ A;  4ZZA A;  4G68 B;  2Y7K A;  1S50 A;  2X7Q A;  3FXE B;  2F8D A;  1IEJ A;  1UIU A;  1LBC A;  4RK9 A;  3PPQ A;  1SBP A;  1O7T A;  4F22 A;  1B5J A;  1MDP 1;  3B7D A;  4KFQ A;  2CA5 A;  4IY5 A;  4E0W A;  3B6T A;  2F6P A;  4R2F A;  5TU0 A;  2Y84 A;  1FCK A;  2I3W A;  4YB6 A;  1B9J A;  3IOT A;  3HPI A;  4NF5 B;  1QVS A;  2QMX A;  3RGY A;  4HTG A;  1IJ5 A;  3T96 B;  3GBB A;  2ALU A;  3B6W A;  1VFD A;  1P99 A;  4RPO A;  1NL5 A;  4U21 A;  1LFH A;  3E13 X;  2F78 A;  3M3K A;  3QIM A;  4KCD A;  4R75 A;  4BLA A;  3HO7 A;  1LAF E;  3TKL B;  4LP2 B;  4GD5 A;  2X7P A;  5L9S A;  2NOO A;  1D9V A;  1NNF A;  2RCA A;  4QF9 A;  4YU0 A;  1US5 A;  2DP8 A;  3CR9 A;  3LBS A;  1MQG A;  3PUY E;  3FXU A;  1MY2 A;  3HN0 A;  1NH8 A;  2UVG A;  4ONY A;  2P1S A;  1ZIU A;  3PUW E;  3FZV A;  4XKN A;  2QMW A;  3IOR A;  3KN3 A;  3EHS A;  2XXW A;  3ONM A;  1MM7 A;  2UYE A;  4X48 A;  2C5J A;  5IKB A;  1JEU A;  1B1X A;  4G2Z A;  3G3G A;  3E4R A;  3QAX A;  4EF2 A;  3WAE A;  2I48 A;  5JK4 A;  3UK4 A;  4F29 A;  3N94 A;  4ZE9 A;  1OMP A;  1Y1M A;  2UXA A;  2RKM A;  3RNN A;  2FA7 A;  3K6U A;  4GXA A;  2RC9 A;  3N26 A;  5H8S A;  5AA2 A;  2X9W A;  5KCJ B;  1FQD A;  2X26 A;  5AA3 A;  2V84 A;  5ITO A;  4POW A;  1TFA A;  3I6V A;  3PUZ E;  2RF1 A;  3B6Q A;  3OO8 A;  1XS5 A;  3RY3 A;  3IX1 A;  2F7B A;  2HEU A;  5ISU A;  3SEU A;  1JNF A;  3EHT A;  4IO7 A;  2Y7P A;  4XKQ A;  3R26 A;  4LAT A;  2QS3 A;  4FOR A;  4F1V A;  5DEX A;  5H8H A;  4JWO A;  3BKI B;  4QSE A;  3LSL A;  4KCC A;  3QUF A;  1LLS A;  3TCG A;  1Y3Q A;  1SW2 A;  3EHU A;  2I6E A;  2QL3 A;  4NE4 A;  4CQI A;  3O9P A;  2XXY A;  2HXW A;  4NTL A;  4IO2 A;  4C1T A;  4E0X A;  1M5F A;  3BFT A;  1J1N A;  3PGF A;  3EN3 A;  2OLB A;  4QFL A;  5FTI A;  2XXH A;  1MDQ A;  2HCA A;  3IO6 A;  1VSO A;  3KG2 A;  2IC6 A;  3Q28 A;  4R9F A;  4G68 C;  3DEL B;  5HM4 B;  4ZEF A;  3GXA A;  1LAG E;  4DCX A;  3CG3 A;  1SI0 A;  3ILT B;  3TMG A;  3PU5 A;  4N6P A;  4G8H A;  4WXJ A;  5HBC A;  4K3F A;  3C4M A;  4FAJ A;  2DVC A;  5I2K A;  3K6V A;  2RC8 A;  2REG A;  1URD A;  1R1N A;  1JET A;  4ISU A;  3TTR A;  1DPE A;  2V93 A;  2QJE A;  3MZ9 A;  1DTG A;  1SVX B;  1BKA A;  2HAV A;  1JW1 A;  4EXK A;  4OEN A;  1URS A;  5I58 A;  4DIG A;  3T66 A;  4AQ4 A;  2DE3 A;  2UVI A;  1OVT A;  1MRP A;  3TFL A;  2O69 A;  5F7V A;  4LZ7 A;  1DSN A;  5FTH A;  5ICT A;  3LSW A;  4NF8 A;  3IJX B;  2PMS A;  4OTE A;  3H3G A;  3FIR A;  3UOR A;  3VVE A;  1MXW A;  4RNS A;  4ZEC A;  2Y7I A;  1DPP A;  5CMB A;  1O63 A;  1MQJ A;  1LB9 A;  3PPN A;  4FAT A;  3RT6 B;  3OEK A;  3CRB A;  3L6G A;  3TQL A;  3OO9 A;  4YKJ A;  3MBP A;  4POX A;  3N6U A;  4YIC A;  4YMA A;  3S9N C;  3CFX A;  4P11 A;  1H76 A;  3SKP A;  3VLV A;  1A55 A;  1ZBM A;  4Q8R A;  3G7W A;  1TT1 A;  1SI1 A;  1N04 A;  4XXU A;  5I56 A;  3K1N A;  3TCF A;  1B40 A;  2XX9 A;  1B3G A;  3OD7 A;  3TTN A;  1MPB A;  2V3T A;  3JZJ A;  1MS7 A;  1PBP A;  3C35 A;  5CMK A;  1N76 A;  3RLF E;  2VOZ A;  1OQG A;  4H1X A;  1FTM A;  3T93 B;  1UTB A;  1MY4 A;  2Z22 A;  1EZ9 A;  1ZMG A;  2F6G A;  2FNC A;  4GIZ A;  1SYH A;  2QS4 A;  5F1Q A;  3FVK A;  2XX8 A;  3K1M A;  3S9E A;  5AA2 D;  4H6D A;  4R6Y A;  1ZTY A;  3KN7 A;  4MBP A;  1Q1K A;  1B3E A;  2XHD A;  3KZG A;  1KWH A;  4HCY A;  5DVF A;  3FV1 A;  1QUJ A;  3DP4 A;  5BWJ A;  3FUZ A;  4I1D A;  5EYF A;  3FJM A;  3VXB A;  2IA4 A;  1MY0 A;  3H7M A;  3VLU A;  2KWI B;  4PFT A;  2GH9 A;  4H8I A;  4YAH X;  1Z7N E;  1B5H A;  4H0W A;  1I6A A;  4IO6 A;  4KI0 E;  1LB8 A;  2H25 A;  1IQ7 A;  4WED A;  4X9T A;  1Y9U A;  5K2Y A;  2VHA A;  4ZEK A;  1IJ6 A;  2RIN A;  3TTK A;  1B32 A;  1PB7 A;  4NWC A;  4H65 A;  1LFG A;  2LAO A;  1IIW A;  2C5K T;  3MC2 A;  4FI5 A;  5KDT A;  1R6Z A;  2ABH A;  4DZ1 A;  3LC8 A;  5AA2 B;  4IO3 A;  4QHQ A;  2YLN A;  4TLL B;  3D4C A;  2XXV A;  3FGS A;  3U94 A;  2G29 A;  1RYX A;  3S9M C;  4ELR A;  5ICQ A;  3C36 A;  3KSX A;  2I4B A;  4IB2 A;  4PE5 B;  4MLQ A;  2ZMB A;  3TCH A;  1ZLQ A;  1MQI A;  3K1P A;  4R6K A;  1GGG A;  1Y20 A;  1B52 A;  5DYH A;  4DDD A;  2W7Y A;  1SW5 A;  3R6U A;  4OFJ A;  4WKM A;  1RYO A;  1UIV A;  2PT2 A;  1UTH A;  4FEC A;  4EYY R;  5DEX B;  1QJM A;  1QW0 A;  2V3U A;  2ZYM A;  4NF6 A;  5H8H B;  2PVU A;  1AOV A;  3IOV A;  3FXQ A;  5TPA A;  2VP1 A;  1UQW A;  1IXH A;  1QKB A;  4QFP A;  3T9V A;  1YPN A;  3GZG A;  5I2N A;  1FQE A;  1XVX A;  1FQB A;  4Q0C A;  3MPK A;  2NWJ A;