3S4UA

Crystal structure of open, unliganded e. coli phnd h157a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
302
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGAETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli
total genus 95
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3s4uA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA02
1LAGE 3G3HA 3B6TA 1LBCA 3KBRA 4OESA 2X9YA 3MP6A 3OO6A 2ZYOA 4RPOA 4F2OA 2CZLA 2I3VA 2B65A 3FXEB 3L6HA 1SYIA 2UVJA 3S2VA 1XOCA 3PPOA 3IL1B 4KI0E 3R7XA 2DWAA 5AA4A 2D5WA 3OO8A 3FGSA 4NF8A 1D9YA 3D4GA 4NF6A 1MY4A 1B7UA 3TQLA 3O6HA 1JW1A 4MFIA 1JNFA 1MXWA 4C0RA 3B6QA 4L0RA 1B51A 1ZKEA 3TTMA 3QYTA 4F2QA 1JQFA 4GXSB 4JSDA 4FATA 3LUYA 5B7DA 4WEDA 4YAHX 1A7LA 3H6UA 2QMWA 1LFIA 2XXTA 1USYE 2Y84A 3OELA 1NL5A 1DSNA 3VV5A 1M5FA 3OENA 4Q5TA 1B5IA 4H5FA 2V3TA 4IO2A 3MVZA 4KD5A 1SW2A 4NMYA 5DYHA 1L5TA 1ZBMA 1LSTA 3KSXA 3B6WA 5I56A 4X9TA 3U8QA 2P2AA 1Y20A 2X7PA 1F9BA 1H3DA 2F7CA 2UYFA 4KR5A 3LC8A 2F6PA 3EN3A 4J2CA 4DXCA 3TTLA 1N04A 3RTFB 3SEWA 4DDDA 1S50A 1H43A 1N3WA 3CSBA 3VVEA 3WAFA 4XKNA 3FZVA 3DLNA 3T9VA 3VE1B 3VXCA 1DTGA 2OWSA 4NF4B 2DP8A 1NNKA 5KZTA 3C36A 3EHTA 2IC6A 2XXHA 4R72A 1N76A 2E0SA 1QW0A 3OMBA 3QUJA 2XD2A 5H8FB 1N84A 3M3KA 2GH9A 4U1ZA 4XKRA 1T0KA 5J1DA 5H8NA 2Q2AA 1PB7A 3RGYA 1URDA 4YKPA 1I6QA 4F39A 1US5A 1FTLA 5AA3A 3KZGA 4YMAA 5DVFA 4ZZEA 1NH8A 3FVNA 4DLDA 4TLLB 3O28A 4YICA 3PUYE 5K2YA 3BFTA 1FQCA 1BP5A 1VFDA 5TPAB 2HFBA 1MXVA 4EQ9A 5DVJA 3K01A 3ILUB 2C5IT 3GBBA 4YB5A 3H6WA 1OLCA 4DCXA 3TDJA 5L8DA 5DTBA 3KFMA 4LZ5A 3G3GA 4XKQA 4ZEBA 4EDPA 3JZJA 4KCCA 3KJ7A 1M5BA 1N7WA 4G4PA 2PMSA 3RPWA 4DXBA 1EZOA 3K00A 5DEXA 2Y7IA 1D4NA 5KDTA 2R71A 4EF2A 1NNPA 4FEBA 1ZIUA 2ANJA 4BLAA 1BLFA 3UORA 2UXAA 4F19A 4F31B 3OOAA 1MM7A 4HCYA 4U4SA 2QMXA 4GLIA 2V25A 1JEVA 2RC9A 3H4ZA 1B2HA 3UN6A 3V83A 2I4CA 5JTYA 1YAEA 1GGGA 2I6EA 4FIMA 1Z0PA 4C1UA 2IA4A 3IOWA 1P1WA 2DXYA 2GRVA 2QS4A 3OSRA 4BDLA 1B4ZA 4QFKA 3SERA 3G7WA 1B3GA 4ZEFA 1OVTA 3O6IA 3RLFE 2QL3A 1FQBA 5CC2A 1B1XA 1QKAA 4H5GA 1MXXA 1O63A 3VLVA 4RYAA 3OD7A 2I48A 1B46A 2QPQA 1SW1A 2FYIA 3QIMA 3FJGA 1B05A 2HXWA 4R6HA 3K6WA 4TQUQ 1I6AA 4ND9A 3C32A 2NXOA 4WKMA 1MDQA 3RNNA 1SBPA 3SKPA 1TXFA 3THIA 2OJTA 3K4UA 4U4XA 5BUUA 1AH5A 3IX1A 3AXFA 3HV1A 2ESNA 1A8EA 2Q9TA 2Z8EA 3QXMA 1BTJA 2OLBA 1JETA 1POY1 2ONRA 5F7VA 2DS9A 1QJMA 3IB1A 1LB8A 2X26A 1ZLQA 1R9LA 4I62A 1I6BA 2I0CA 2KWIB 4XKPA 4KPTA 5I58B 4PP0A 1Z7NE 4FI5A 2O51A 4FJPA 1LVFA 2A5SA 3I3VA 3LBSA 1DMBA 3U92A 4XIGQ 1MPBA 4NEDA 4IY5A 4EYYR 1CB6A 1JVYA 3E4RA 4G8MA 1IXCA 1QULA 3A3CA 2HAVA 1B5JA 2Q2CA 3PUZE 4X1BA 2XXYA 5CRYA 1PEBA 4JDFA 2CA5A 1MQGA 3L6GA 4MH5A 2Z23A 3MVWA 3G3KA 2AYSA 4ELPA 4OFLA 1LCFA 3K1MA 1UTHA 5L9MA 5M2VA 1Y3QA 1AIVA 1FQFA 1H7CA 1WVJA 3CRBA 1DOTA 3ILTB 4JWYA 3TYHA 2YLNA 3K6VA 4F1UA 4K3FA 3MXZA 3LSFB 3SDFA 4OMBA 3EHUA 4THIA 3QK6A 3ZKLA 1ZU0A 3FD3A 3Q27A 1Q1KA 3KGCA 5H8HA 2V3UA 1ZKBA 2RKMA 1M5DA 2FA7A 5CMKA 2XX8A 3G3JA 5JEIA 4IO4A 2QSXA 2G29A 4PQJA 1HSJA 4F22A 3EHSA 3T93B 1FQDA 1B3FA 2RCAA 3K1PA 2Z8DA 3VVDA 3M3FA 3MPKA 3MZ9A 5HBCA 2AIXA 1LAXA 4KQPA 5HPQA 2PX1A 4KYDA 4NWDA 1DTZA 2DYXA 4EXKA 3LSXA 5H8QB 4H65A 2NVUB 3T96B 3TPAA 1B32A 4IO5A 2A5TB 3H7MA 3LR1A 3FIRA 1URGA 2LAOA 3PMWA 3PPNA 3MQ9A 3U94A 1FCKA 4CQIA 3IO6A 2VP1A 3U93A 1AL3A 3Q29A 3IR1A 3SEVA 1DPEA 2W7YA 4OQOA 4AB6A 1SDXA 1ZJLA 4LP2B 4U21A 1Y9UA 4LQ2A 2RCBA 4I1DA 3N5LA 3T66A 4QHQA 1Q35A 1QKBA 3O2AA 4LUBA 4ZS9A 1FW0A 1MXYA 1PDAA 3R26A 3H6TA 3IAZA 3H3GA 2F7AA 4KFQA 4DXUA 4JBZA 2Y7WA 4RY1A 1MG1A 3CFLA 3MBPA 3S4UA 2YJPA 3H06B 2F7BA 3OO7A 3E13X 3FJMA 4R6YA 5AA2D 1Y4CA 4QSDA 2XX7A 2UYEA 4DE8A 3MVYA 4NF4A 4YKJA 2DVCA 3Q25A 3FUZA 1I69A 1XVXA 3PMXA 3OEKA 1P1NA 1EZ9A 2QS3A 1XT8A 1P1QA 1MY0A 3FXUA 3MAMA 2B3BA 4WEPA 5H8FA 5KCJB 3KOSA 5FHOA 5ICTA 4BDQA 3CSGA 3TFLA 3FV1A 1TFAA 2O6AA 3UP9A 4IGTA 4RPNA 4M1VA 4H8IA 4OXVA 3R6UA 3MPLA 3K6XA 5A5XB 3W9VA 4ESXA 4ZEDA 4G2ZA 1Y3PA 1MQHA 1R1NA 3CKDA 5BWJA 4NTLA 2XXXA 1A55A 2DWIA 2I49A 1B5HA 3TCHA 5EYFA 1RKMA 2REGA 5AA4B 1QUKA 3TCFA 2ZMBA 5ISUA 5CMMA 1MPDA 4N07A 3K02A 4NF8B 1XS5A 2I0BA 1TFDA 3TTKA 3MP1A 2XX9A 3O6GA 1HSLA 4G68B 3JV9A 1VFEA 4O3AA 3N6TA 2FNCA 2DE4A 4MLVA 4F3BA 2ALUA 3U72A 2H4IA 3TQWA 2HEUA 1SQYA 1SD3A 4F3PA 4G68C 5I2KB 3HPIA 4PE5B 1MH3A 4U22A 3W9WA 4OVJA 1A54A 3TKDA 2O7IA 2HQ0A 4EQBA 1NFTA 3W15C 1NNFA 4L17A 1GTKA 2ZYNA 4ONYA 4QFNA 3JYRA 2F36A 1B52A 2ZNUA 4RK9A 1OLAA 3DP4A 2DWJA 4OERA 3TEPA 3RTWB 3KJTA 3HCQA 1DPPA 1TWYA 4Z0IA 2DQVA 3CG1A 4PETA 3MWBA 3TODA 1ELJA 3IB0A 3CIJA 2KWHA 2REJA 1IQ7A 2MBGA 4H6DA 3IO4A 5I57A 3Q26A 4GFRA 5K2XA 3T22A 1LBBA 1O7TA 2F6GA 3TAJA 5AA2B 1H76A 1SVXB 2F8DA 4P11A 1FQEA 5I2NB 4ZE9A 4H1XA 3C35A 1IIWA 3N94A 4XXUA 4LQ5A 3T9XB 3PPQA 3IOVA 3FVKA 4GWOA 2RC7A 1B3EA 2RF1A 2ONKE 3FASA 1XVYA 5AA1A 5I84A 2UVGA 1IJ6A 1R6ZA 4Q8RA 4DNDA 4F3GA 2UVHA 4NF5B 5I59B 4ZE8A 2XHDA 4C1TA 3FXRA 1B7HA 5I58A 2H99A 2F5XA 4PFYA 3B7DA 1A40A 1D3KA 3MP8A 3K1NA 2VOZA 4JB7A 1O64A 4F29A 2Z22A 2I58A 3PU5A 4ZZAA 3CVRA 3IJOB 2Z8FA 2DE2A 4HW8A 2XTLA 3PD9A 4UA8A 2ZNSA 3KN7A 3PPRA 3O29A 5ITOA 3TMGA 5CBRA 4XTCQ 2OWTA 1XC1A 2AL4A 2VGQA 1NNTA 2ONSA 1Y3NA 4JSOA 3V8XB 4BDOA 4U1OA 2QS1A 2V84A 3OSQA 2V93A 3QSLA 1MPCA 3WAEA 4EUOA 2Y7PA 3VVFA 3PUWE 3CVGA 2XXRA 3MVXA 4QFPA 2O84X 3ECRA 5JTYB 3H6VA 4MF3A 1ZMGA 4EQ7A 2NUVA 4TOZA 5FTHA 3OXNA 1MS7A 1S7YA 3SEUA 1B40A 3DELB 3O66A 1B1HA 3KG2A 3N6UA 2DSFA 4OEVA 2GHBA 1IEJA 3D4CA 4FECA 3VXBA 4R6KA 2XXVA 3O9PA 1PB8A 1VSOA 2H9BA 1ANFA 1Z7ME 3FJ7A 2G0UA 4KYSA 4I9DA 5H8QA 2K48A 3VDFA 4IO7A 2A5TA 4G8NA 4POXA 2RINA 5IKBA 4LZ8A 1B3HA 5TP9B 5JK4A 3QAXA 4IO3A 2PT2A 4IO6A 4ZDMA 1NMUA 3RT6B 2DXRA 4YB7A 3HHGA 3RY3A 4OEUA 3S9EA 3MJNA 1UTBB 5FTIA 4YU0A 1MDP1 3O97A 5DVIA 3KN8A 3RUMA 3GXAA 4FE8A 4ELRA 1B6HA 2B3FA 4ISUA 1ZTYA 3SETA 3A09A 3M8UA 1FTKA 1EH3A 4FORA 1UIUA 2HCAA 3I5OA 3PUXE 4ZEIA 2VD2A 2Q89A 1WDNA 2E1SA 3TUSA 4H0WA 1IXIA 4FEDA 3KOTA 4QF9A 1GR2A 4R2FA 3UGWA 4HCWA 2IEEA 4EF1A 1B4HA 3M3LA 2DOJA 3TTNA 3HHFA 4DIGA 1QUIA 1D9VA 1H44A 2HZKA 4GOTA 1UIVA 2P1SA 1Y1MA 4OHNA 3FVGA 1MXZA 3ZSFA 4QSCA 3FV2A 1M5EA 4F18A 3IORA 2NWJA 3EQ1A 4RK2A 3QUFA 1VE4A 5CM6A 4OFOA 3EPEA 2R6GE 5KCJA 1YCJA 2XD3A 1JEUA 4E0WA 2QS2A 1JW5A 3RN8A 4OTEA 3PV0E 5A5XA 1YTVA 4IB2A 2XXWA 3UA8A 3PD8A 4KYEA 3IOTA 3MUQA 3VLWA 3GZGA 2D21A 2O69A 4N13A 4O3BA 2X9XA 3MZBA 3C33A 3Q28A 1TT1A 3C9HA 3IB2A 1RYXA 5L9OA 1IXHA 1R9QA 3CR9A 3LSWA 4G68A 1HSEA 3CI8A 4BDNA 4HTGA 4ECFA 1VR5A 4F1VA 2UVIA 1FTJA 5CI5A 5CMBA 4G77A 4R9FA 1B7ZA 4GRKA 3ZKKA 1LLSA 1A99A 5I2KA 3C34A 4ELQA 3EF7A 2OK2A 1OVBA 1PBPA 2O1LA 2D3IA 3VLUA 4JWXA 1FTMA 4LATA 4OZ9A 1N3XA 5FHNA 2QJEA 4GQOA 3S9NC 4EXLA 5TPAA 1QUJA 1IZ1A 1B3LA 2ABHA 4NF6B 4YKKA 3HO7A 1LAFE 1SW5A 2ZXTA 4F3SA 3PMVA 4LZ7A 1A8FA 4YMBA 1OQGA 3U1OA 2PT1A 2XXUA 3G3FA 3ONMA 3FXDB 1US4A 4DCYA 2I4BA 1SYHA 3FATA 4R75A 4FAJA 4UACA 1P1OA 4OENA 4P0GA 4QFOA 4ELOA 3F11A 5B70A 5ITPA 1LAHE 1FTOA 4Z7EA 4O3CA 2Q8JA 4GL8A 4R2BA 5AA2A 1II5A 2Q88A 5I2NA 4ESWA 1BIYA 3CFZA 2O1MA 2ZYMA 5I56B 4B6XA 4OWDA 4AQ4A 3E9XA 2G93A 5CMCA 3DP8A 4PFUA 4JXIA 3TZAA 1XHYA 3OO9A 4YZZA 3DP6A 3TKLB 1POTA 2ZNTA 2C5KT 4ZEKA 3BKIB 5EHMA 4QFLA 2HZLA 4RJZA 3L3PA 4NF5A 5CBSA 5I59A 1B0HA 3USDA 4QRZA 1MRPA 2C5JA 3T9UA 2ZYKA 2XXIA 2F35A 4F1YA 1USYH 1BKAA 4BDRA 5LOMA 1OMPA 1GVCA 2Y7RA 1EZPA 3S9MC 2IC9A 4RXLA 5F1QA 4GL0A 5H8NB 4WXJA 4U2RA 3ZS6A 3ODBA 2XXPA 2PYYA 3PGFA 3K6UA 1QVSA 1NH7A 2OBGA 1MY1A 3MC2A 1AOVA 3C4MA 3KN3A 3OEMA 1J1NA 4GIZA 4NE4A 4X48A 1JVXA 2VD3A 2I3WA 2R9JA 3TTRA 1P1UA 3GLBA 1LRZA 5HM4B 1B0LA 2CMOA 5ELVA 1RYOA 4OFJA 3G3IA 4H67A 4OYVA 1SW4A 3V89B 1AMFA 1OIBA 4HS7A 3A3UA 4GF8A 3HN0A 3C31A 2X9WA 2VHAA 4QSEA 4KHZE 4E0XA 5DEXB 3S9LC 4IY6A 3MZ1A 5KDTB 4ZECA 2QRYA 4GVOA 5I57B 2KLFA 2O7UA 2H5YA 2DE3A 2HAUA 3N26A 4LVQA 3SESA 1MY2A 2Y7KA 1MXUA 5TP9A 4GXAA 5TU0A 4G8HA 1SI1A 3PUVE 4N6PA 5IAIA 3IK6B 4LA9A 4R9GA 3UK4A 3DM0A 2GFEA 4AB5A 1UTBA 1S9TA 4MLQA 1GV8A 3GBAA 3P7IA 1LFHA 4LONB 3T9HB 3K2DA 1URSA 1IJ5A 2O68A 1OQHA 4RNSA 1MY3A 2F78A 5L9SA 4M4GA 1ATGA 4BDMA 5DT6A 3V5AA 3HSTA 2DVZA 3UIFA 2RC8A 1UQWA 1LFGA 1H45A 3MW0A 3BFUA 3H03A 2M8CA 1M5CA 2THIA 3CG3A 4R73A 4PFTA 1WODA 2BJJX 2NOOA 1N7XA 2OCUA 4X1DA 4JWOA 1PC3A 1B9JA 1IUDA 1P99A 2H25A 1LGBC 1CE2A 4TLMB 4YB6A 4PFWA 1QSDA 2P0SA 3E3KA 3LSLA 3PPPA 4R74A 4H8JA 2F34A 3KEIA 5EHSA 1MQIA 1EU8A 2X7QA 3TELA 2WKYA 1LCTA 2OZZA 2F97A 3FXQA 5AE4A 2V3QA 4P0IA 4YKIA 3TCGA 3RQTA 1IITA 3CFXA 3KSJA 3SEYA 3K0VA 1PBQA 5ICQA 2XXQA 1Y1ZA 1N0TA 1SI0A 3VFJA 3BBRA 4OETA 4MBPA 2PVUA 3IOUA 2GHAA 4U23A 4RA1A 4Q30B 1UTHB 1IXGA 3FVOA 4KCDA 1LB9A 4IGRA 2DWHA 1NKXA 1B58A 2AL5A 3I6VA 3IJXB 1MQJA 5H8SA 4GD5A 5FHMA 2YPNA 2PBWA 1PB9A 1YPNA 4DZ1A 4I8CA 1FQAA 4NWCA 3SEXA 5H8HB 3RT8A 1JW4A 1MM6A 4Q0CA 4POWA 2H98A 1Y4TA 1KWHA 1MH4A 1MQDA
chains in the Genus database with same CATH superfamily
2YEVC 5LHHB 1LAGE 3G3HA 3B6TA 4H9SE 4N15A 5IWAT 1LBCA 3KBRA 4AQYT 4OESA 2X9YA 3TLUA 3RYCE 3MP6A 3OO6A 4JI8T 5IYZE 4QHOA 2ZYOA 4RPOA 5FBPA 4F2OA 1HF8A 5HEGA 1T98A 2CZLA 4MALA 2V4CA 2I3VA 1N33T 4WZXA 2B65A 3FXEB 3L6HA 1SYIA 3AEBA 2UVJA 3S2VA 3RKOA 3PUYF 1XOCA 3PPOA 4UVAB 3IL1B 4KI0E 3AE9A 3PURA 4BJMA 4CXWA 1D0YA 2DWAA 3R7XA 1NV4A 3VKHA 1US7B 3ZMTB 5AA4A 5JREA 4EAHA 2D5WA 4UELA 3OO8A 3HKCE 4GWSA 5EK2A 3P4RA 3UUMA 3FGSA 4NF8A 5FXWA 3N9PA 1D9YA 1NV1A 3D4GA 4NF6A 4IE7A 2E5LT 5HXRA 4QH4A 1MY4A 2V26A 1B7UA 3TQLA 3HKEE 4GKJT 3O6HA 3E08A 1JW1A 5TAOA 4MFIA 1JNFA 1MXWA 1D1BA 3B13A 4C0RA 3B6QA 4UF0B 4L0RA 5JH7E 3DJBA 1B51A 1N32T 3O1IA 1ZKEA 3TTMA 1BR1A 4EZHA 3QYTA 4F2QA 4EGWA 3CQXC 1JQFA 4GXSB 4JSDA 3L39A 2LJLA 4FATA 4XFEA 5LA6E 5FY7A 3LUYA 2C0SA 2RP4A 5B7DA 4UV8B 5HXHA 2ACZA 4WEDA 4YAHX 2VURA 3KBUA 1A7LA 3H6UA 5LXTE 2QMWA 1LFIA 2XXTA 3IFCA 4UEMA 1USYE 2Y84A 3GYYA 3OELA 1NL5A 1DSNA 4B3TT 1M5FA 3VV5A 1MMGA 1BR2A 3QC9A 3OENA 4Q5TA 3FZLB 1B5IA 4H5FA 4NHBA 4HN9A 2NTXA 2V3TA 4IO2A 3MVZA 4KD5A 1K9YA 4U74A 2VASA 1SW2A 4NMYA 5DYHA 2EHOB 1ZBMA 1L5TA 5HWYA 1LSTA 3KSXA 4H45A 1DBZA 3F2EA 2IMLA 3MYUA 3ZMVB 1FMVA 4PFRA 2WMOA 4X66T 3B6WA 5I56A 4X9TA 3UU4A 5HCJA 2UU9T 3U8QA 4E7ZA 2P2AA 2WU5A 1Y20A 4GKKT 2X7PA 2XQAA 2EHOC 1F9BA 1H3DA 2CE7A 4QKNA 3GWHA 2F7CA 5HEUA 2UYFA 5AQSB 4KR5A 2PFYA 1NV5A 2BS4A 3LC8A 2JQQA 2F6PA 3EN3A 4J2CA 4DXCA 3TTLA 1N04A 2V6YB 4DR2T 3RTFB 5IZZA 3JADA 2WY2A 3P4WA 4PFIA 3SEWA 4DDDA 1S50A 1H43A 4HE0A 1N3WA 3CSBA 3VVEA 4I4TE 5LB7B 3WAFA 4DR1T 4XKNA 4GWWA 2Y5LA 4AS5A 4U2ZA 3FZVA 3DLNA 3T9VA 3VE1B 3VXCA 1DTGA 4AKGA 2OWSA 4NF4B 2DP8A 3MZKB 1NNKA 5KZTA 4DO0A 3C36A 3O4XE 3RLFF 3EHTA 1MMDA 2CLYB 2IC6A 2YU2A 4U7IA 1IMFA 2XXHA 4O8SA 4NGUA 4R72A 1N76A 1LBVA 3BQIA 2KMFA 2E0SA 2A72A 1QW0A 4TNWA 5CA1E 3OMBA 3QUJA 2XD2A 3ZYKA 3LBXB 4IR8A 4PJNA 5H8FB 4MX6A 1UGOA 1N84A 3AE8A 5CGMA 2XY8B 3M3KA 2GH9A 4U1ZA 2CLYC 2VKHA 4XKRA 5CB4E 1T0KA 3OBVE 4CI3B 5LHIB 5J1DA 3H3AA 5JRCA 5H8NA 2X0LB 4KUMB 2Q2AA 1PB7A 3RGYA 3FBZA 3BIGA 5KXJA 4EOZB 1VCSA 1URDA 5CA0E 4YKPA 1I6QA 1AWBA 4I3YA 4F39A 1YXRA 1US5A 1FTLA 4P1NA 1HNXT 5AA3A 3KZGA 3OYXA 4QX8B 5DVFA 2HPGA 5ESYA 4YMAA 4ZZEA 1XNQT 3NRYA 5AQLB 1NH8A 3FVNA 4DLDA 4TLLB 3O28A 1JNRA 4YICA 4PK4A 3PUYE 3A29A 5K2YA 1XDPA 3BFTA 4JLEA 3K1SA 4CN6A 5KX5E 2XPKA 1IZNB 1FQCA 1BP5A 4OYKA 5HEOA 1VFDA 2UUAT 5TPAB 4X20E 3AEFA 2HFBA 2QFLA 1NUYA 1MXVA 4EQ9A 5DVJA 2DI4A 3K01A 3ILUB 4OVSA 2C5IT 4IHJE 3GBBA 4YB5A 3H6WA 1OLCA 4DCXA 3TDJA 2I59A 5L8DA 5DTBA 3KFMA 3JC6D 4XEQA 1DK4A 4LZ5A 3IA3A 3G3GA 2JQKA 2NWBA 4XKQA 4ZEBA 4EDPA 3JZJA 3OJAA 4KCCA 1UCUA 3KJ7A 3F57A 1M5BA 3RYHE 1N7WA 2PCRA 4G4PA 4ILCA 2WEFA 5AFUL 2AE9A 2PMSA 4H9PC 3RPWA 4DXBA 1R8IA 1EZOA 3K00A 2W0GA 4HWHA 4PAKA 5DEXA 4CI2B 2DCFA 2Y7IA 1D4NA 5KDTA 2R71A 3PTRB 4EF2A 3Q5XA 1NNPA 2KT9A 3PUZF 4FEBA 4OK0A 1ZIUA 2ANJA 4BLAA 1BLFA 2CHOA 3UORA 3N9MA 2UXAA 4F19A 5IZ3B 4P0AA 4F31B 5T3JA 1ZV4X 2Q9QD 2X9HA 2FVZA 2KSRA 2QA7A 4QXHB 3OOAA 4OVTA 1MM7A 4HCYA 4U4SA 3J7Yq 2QMXA 4XAXB 2D0UA 3CX8B 1O3XA 4O4LE 4V1Av 2WDVA 4GLIA 3LJCA 2V25A 1JEVA 2RC9A 3H4ZA 1B2HA 2MKZA 3UN6A 2I4CA 2LHRA 5JTYA 3V83A 3ZJ2A 5L3GB 2YDRA 3LDQB 2JQHA 4ZHQE 2JJ9A 1YAEA 1GGGA 2WSSV 2I6EA 4FIMA 1Z0PA 4JI2T 2XQYA 3P4SA 4C1UA 3P50A 2LSIA 2IA4A 3IOWA 1P1WA 2DXYA 2GRVA 2QS4A 3OSRA 4IE0A 2VKDA 4BDLA 4X64T 1B4ZA 4QFKA 4JBWF 3SERA 3G7WA 1B3GA 3C4XA 4ZEFA 4ILAA 4HFBA 1OVTA 3O6IA 2QL3A 1FQBA 2UXNB 3RLFE 5CC2A 1B1XA 1QKAA 2XZEA 4H5GA 3Q9DA 1HTJF 5L47A 1MXXA 2BVMA 5EQAA 3RYDA 1DCUA 3CK6A 1O63A 3VLVA 4RYAA 3OD7A 2I48A 1B46A 2QPQA 1SW1A 2FYIA 3QIMA 3FJGA 5JDGA 1B05A 2HXWA 4R6HA 3K6WA 3K3QC 4TQUQ 1I6ZA 1I6AA 4PDDA 3PUAA 4AIUA 4ND9A 4DR4T 2QRXA 3C32A 4IGUA 1XMOT 4O7IA 2NXOA 4YSZA 4LMKA 2LKHA 4TUYE 2H7VC 4F6RC 4WKMA 1MDQA 1KEYA 3RNNA 3ANWA 4ZZCA 1IBLT 3HFUA 4P9KA 1SUMB 1SBPA 1FBDA 1TXFA 3SKPA 4LF6T 4ZZBA 3THIA 2OJTA 1KNZA 3K4UA 2W67A 3IF8B 1W09A 4QX7B 5BMVE 4U4XA 5BUUA 3EAMA 1AH5A 3IX1A 3AXFA 1G8XA 4N6KA 3HV1A 2ESNA 1A8EA 2K24A 3UUBA 2Q9TA 2Z8EA 3QXMA 1BTJA 4MLKA 2OLBA 1JETA 1POY1 2ONRA 3LK3B 2XHEB 5F7VA 3AE3A 5ET5A 1BK4A 5ABHA 5DJQC 4HWDA 2DS9A 1QJMA 3IB1A 1LB8A 2X26A 1ZLQA 1R9LA 4UVBB 5FL1A 4I62A 4I40A 1I6BA 2I0CA 5FVKA 4KMCA 2KWIB 2WBBA 3ZCIA 4XKPA 5HXEA 3LV0A 1T8BA 4KPTA 3RYIE 5I58B 4PP0A 1Z7NE 4FI5A 2LOSA 2LSYA 3AXJB 2O51A 2QVUA 2PFVA 3DTOA 3ZPOA 4FJPA 1LVFA 2A5SA 3I3VA 3LBSA 5L3FB 4X5TA 3PUQA 1BR0A 1DMBA 3U92A 2YK0A 2CZIA 3SOLA 4XIGQ 1S94A 2N2NA 2V5CA 3RIUC 1MPBA 4NEDA 4IY5A 4EYYR 2JPFA 4LFBT 1CB6A 1JVYA 4N6DA 3E4RA 1FPDA 1YYZA 4G8MA 1IXCA 1QULA 3E22E 2B4LA 3HR0A 3QOFA 1J5WA 3F31A 4HE8A 3A3CA 1HS7A 2HAVA 1B5JA 2Q2CA 3UUNA 3B57A 3PUZE 4X1BA 1X9BA 3RQWA 1PEBA 2XXYA 5CRYA 1E1HB 2DNXA 4OVPA 4JDFA 2CA5A 2WAUA 1MQGA 3L6GA 4MH5A 2Z23A 3MVWA 2W66A 2H88A 3G3KA 4UXNB 2EHOD 2AYSA 3LFMA 4ELPA 1CUNA 4JVCA 4BAYB 4OFLA 4PW8A 1LCFA 3K1MA 1UTHA 5LDZA 2NOXA 3N9NA 3MSTA 5L9MA 5M2VA 1IMDA 2LKGA 3ZSTA 3ZC0A 1Y3QA 1AIVA 1BR4A 1H7CA 1FQFA 1WVJA 4H9OC 4GWYA 4JYAT 4LFCT 1DOTA 3CRBA 3Q2MA 3ILTB 4JWYA 3TYHA 4CI1B 1OEDE 5ABFB 2YLNA 4PE3A 3K6VA 5LMNT 3N2OA 3RGLA 3UQ4A 4F1UA 4P09A 4K3FA 1FRPA 4AISA 1NV7A 3MXZA 3LSFB 5DQWA 2XQ5A 3SDFA 4U33A 4OMBA 3EHUA 4THIA 3QK6A 3ZKLA 1ZU0A 3FD3A 3Q27A 1Q1KA 2ZM8A 3FXBA 3KGCA 5H8HA 2V3UA 2N9DA 1ZKBA 2RKMA 1M5DA 2FA7A 5CMKA 2XX8A 3G3JA 1SE7A 5JEIA 4IO4A 2QSXA 2G29A 4PQJA 1HSJA 2XASB 3KC1A 5FY1A 4F22A 3EHSA 3KV6A 3T93B 4AQGA 1FQDA 4ZI7E 1B3FA 3UFEA 2RCAA 4XF5A 1FPGA 1YW0A 4WNKA 3K1PA 1MNDA 3M65A 2Z8DA 3VVDA 3PJAA 3VHLA 5HCMA 4NX1A 4Q25A 1L0VA 3AECA 3M3FA 3MPKA 3MZ9A 5HBCA 2Y5KA 2AIXA 1LAXA 4KQPA 2W63A 5HPQA 2PX1A 4KYDA 4NWDA 1DTZA 2DYXA 4EXKA 3LSXA 5H8QB 4H65A 2NVUB 2VPOA 3T96B 3TPAA 3HI2A 2DWKA 2WBLA 1B32A 4IO5A 2E8IA 3SS1A 3O1HA 2A5TB 3H7MA 4ZS2A 1KNRA 3AE7A 4PTKA 3LR1A 3FIRA 1URGA 3N2GE 1INPA 2FJBA 4TZ4C 2LAOA 3PMWA 3PPNA 2HHMA 3MQ9A 4TX5A 2OV9A 3U94A 4NG7A 2XAQB 2VWAA 1LBYA 1FCKA 1FBGA 1JNZA 1YZ0A 5FKYA 3SRZA 2IDOB 4CQIA 3IO6A 3N9LA 4GYSA 1QLBA 2IUBA 2Z6EA 2VP1A 3U93A 1AL3A 3K3OA 3Q29A 4P1EA 3AA6B 2XAHB 3AAAB 3IR1A 3SEVA 1DPEA 2W7YA 4AS4A 4OQOA 4AB6A 1SDXA 2VT5A 2NW8A 2VB6A 1Z8UA 1K9ZA 3ZKRA 1XI6A 3FZKB 2CEYA 3RIFA 5J2UE 1ZJLA 4LP2B 4U21A 1Y9UA 4LQ2A 2RCBA 4ILBA 3ZLIA 1T7SA 4I1DA 3AA7B 3N5LA 3ONXA 2VVNA 4AQFA 1XZYA 3T66A 2W61A 4QHQA 1Q35A 1QKBA 3O2AA 4YLHA 4LUBA 4ZS9A 1M62A 4X1KE 1FW0A 1MXYA 1PDAA 3R26A 3H6TA 3IAZA 3H3GA 2NTYA 2F7AA 3AA0B 4KFQA 5AQNB 1WLXA 4DXUA 3FZHB 2ZM6T 4JBZA 5AQOB 3KBTA 2H7OA 2Y7WA 4IL4A 4TWFA 4RY1A 1MG1A 3IBPA 2RA1A 2JJKA 1N34T 3CFLA 3B8BA 3H3MA 3MBPA 2BDEA 3S4UA 4TWDA 3ZYMA 2MYSA 3TLSA 4DBRA 2V6YA 2CEXA 2YJPA 3H06B 2F7BA 5L2LA 4H46A 3ZN0B 3OO7A 3VR9A 4OA4A 3E13X 5A5LA 3WI3A 4IDPA 4A98A 2UUCT 3FJMA 4IE6A 4R6YA 2WYKA 2ZM0A 5AA2D 1Y4CA 4QSDA 3I0QA 3D1RA 2XX7A 2UYEA 4G2AA 4DE8A 3MVYA 2OA5A 4NF4A 4YKJA 2V7IA 2DVCA 3K8PC 4N81A 2DL1A 3IFAA 3Q25A 2A3DA 1FBHA 1S35A 2QVRA 3ROJA 3FUZA 5I7IA 1I69A 1XVXA 3PMXA 3KV9A 4ZI2D 4ZXLA 4I55E 4WW0A 3OEKA 4Z90A 5LG3A 5FY0A 1EZ9A 1P1NA 2FJEA 2QS3A 3KFWX 3RKGA 3OTOT 1XT8A 4GOUA 4ILUA 1P1QA 4JI4T 3RPLB 1MY0A 3FXUA 3MAMA 3LBXA 2B3BA 4WEPA 5H8FA 1I94T 5KCJB 3LG7A 2VPNA 3KOSA 5FHOA 5ICTA 4BDQA 5GONE 2BS3A 3CSGA 3FV1A 3TFLA 1TFAA 4KHPT 2O6AA 5FXZA 3UP9A 2FHYA 4IGTA 5AQGB 4DBQA 5EK3A 3KC0A 3ABVA 4RPNA 4M1VA 4HFIA 1Y01A 4IT4A 4H8IA 1E2AA 1OEDC 4OXVA 3UU8A 1FJ6A 3R6UA 2V7JA 3OVUA 3MPLA 2ES0A 3K6XA 5LJMA 5A5XB 1QGXA 3MJXA 3UU5A 3W9VA 2FIEA 4ESXA 4ZEDA 5AQTB 4G2ZA 1Y3PA 3PU8A 2BG9B 5H6RB 1MQHA 1R1NA 1WYCA 3CKDA 3ESLA 5BWJA 4NTLA 3EUHA 5F3JA 1WR0A 5ABEA 1IBKT 2XXXA 1A55A 4G63A 4A56A 2DWIA 2I49A 4BJNA 1B5HA 1EZ3A 3TCHA 5EYFA 1RKMA 5BR8T 2REGA 3NVOA 5AA4B 1QUKA 2VVSA 2X0YA 3WAJA 3TCFA 2ZMBA 5ISUA 5CMMA 1MPDA 4N07A 4NAPA 4NF0A 4E7SA 3K02A 1UK5A 4NF8B 1XS5A 2BG9C 2FIXA 2I0BA 3AEGA 2LSJA 1YQ3A 1TFDA 3TTKA 3MP1A 4LF7T 2XX9A 4GK0E 3O6GA 4NPPA 1HSLA 4G68B 1X79A 3JV9A 4P0BA 1VFEA 1FPEA 4L9IA 3U78A 3NRXA 2A9UA 3CIRA 4O3AA 4MNIA 3N6TA 1CHUA 1W0AA 2FNCA 2DE4A 4MLVA 4F3BA 1SHZC 2JIWA 3AE4A 2ALUA 3U72A 4MHCA 3AE6A 2H4IA 4X62T 1FMWA 3TQWA 3AVSA 2MOZA 4C91A 2HEUA 1SQYA 1RDXA 1SD3A 5FXVA 4ADZA 4PAFA 4F3PA 3W15B 1LKXA 2XSBA 4G68C 4DMWA 2JRKA 5I2KB 3HPIA 2ZLYA 3UQ7A 2V7MA 4PE5B 1MH3A 4YHJA 4U22A 3W9WA 5E0OA 4OVJA 2YDSA 5FVLA 1A54A 3TKDA 3DP7A 2O7IA 2WDQA 2HQ0A 2ODUA 4EQBA 3GA8A 2V6XA 3D0TA 1NFTA 4GK5E 2ACXA 1SPIA 3W15C 1FPIA 5IZ3A 1NNFA 4L17A 3C4ZA 1GTKA 2ZYNA 4Z8XA 4O94A 1FSAA 4O4IE 4EXTA 4ONYA 4QFNA 3JYRA 2LOPA 2UXCT 2CXFA 2F36A 5DQVA 2M6IA 3PUWF 1B52A 2ZNUA 4RK9A 1OLAA 4PFPA 1NV0A 3DP4A 5F24A 2HPLA 1D0ZA 2DWJA 4JI1T 2YDQA 4OERA 4PNIA 3TEPA 3RTWB 2WYPA 3KJTA 5LG4A 2UXBT 4N78D 4YY3T 1HX8A 4PAGA 5AQHB 3HCQA 1HCIA 4TV9E 1DPPA 1TWYA 4U2YA 3RC3A 1NUZA 5JDFA 4Z0IA 4NXNT 2XUEA 3KDSE 1VDWA 5LJNA 5ABGA 4JVDA 2DWGA 3KV4A 2DQVA 1YKHB 4JI0T 2QGSA 4NUVA 3CG1A 3ONLC 3PTYA 2XQ9A 2XQ6A 4PETA 3MWBA 4PGPA 3TODA 1ELJA 3IB0A 3UULA 2X51A 3CIJA 2KWHA 4IIJE 4IREA 5AQUB 2REJA 2XWKA 1IQ7A 3OKQA 2ZZVA 2KINB 1KF6A 3CHGA 2MBGA 4H6DA 5KMGP 3BIHA 2XQ4A 2SPCA 2WCAA 5FMNA 3TLTA 3IO4A 2BZBA 5I57A 3Q26A 4GFRA 2LEHA 5K2XA 1VOMA 5JR9B 4DUZT 1LBBA 4XZCA 4NQ8A 3T22A 1O7TA 2F6GA 3I0OA 3TAJA 5AA2B 1H76A 1SVXB 4CN1A 4QXCB 4HFEA 3J9X1 2F8DA 4P11A 1FQEA 2V7LA 1LBZA 5I2NB 2FBPA 4ZE9A 4CXXA 4H1XA 5JRCB 3C35A 2D9DA 1XMQT 1IIWA 3N94A 4OVQA 3BQLA 4FBPA 5JDHA 4XXUA 1Y64B 4LQ5A 4YSYA 4PK6A 3T9XB 5L3CB 4P47A 3PPQA 3IOVA 3FVKA 5JR9C 4EEDA 4G61A 4GWOA 5DABA 2RC7A 5H6QB 2BKOA 1B3EA 2RF1A 5EQ9A 4ERRA 3ZSSA 2ONKE 2LT3A 1HG2A 3FASA 1XVYA 5AA1A 5I84A 4HFCA 4JVIA 2UVGA 4HFDA 3N2KE 2R8TA 2CZKA 1IJ6A 3G06A 4JI3T 1R6ZA 4YJ3E 2L5VA 4Q8RA 1FPJA 5EK4A 4ZI2C 2E5VA 4DNDA 4M1PA 2E9XD 3SFDA 3ZCJA 3PE0A 1NV3A 4F3GA 3I1AA 2UVHA 2M6BA 2V8SV 4NF5B 4HFVA 5I59B 4ZE8A 2XHDA 3NWIA 4PDHA 4DV7T 5LOVE 4C1TA 4QXDA 2M67A 3FXRA 1B7HA 4DI3D 5I58A 5C3JA 2H99A 4P8BA 2F5XA 4DVDA 4PFYA 3AXJA 4HWFA 4H63V 4NUUA 3B7DA 1A40A 3TLVA 1D3KA 3MP8A 3K1NA 2VOZA 4JB7A 3B50A 4JI7T 3PUXF 1O64A 4F29A 3HA4A 2Z22A 5HXCA 2I58A 3PU5A 4LN5A 4ZZAA 3O1JA 4EEBA 1YD8G 3CVRA 5HEHA 3IJOB 2LM2A 4DR3T 4HE2A 4WBNE 2Z8FA 3OPCA 2DE2A 4HW8A 2XTLA 3PD9A 4UA8A 3QB5K 2ZNSA 3KN7A 3PPRA 5LGUB 3LK42 5LNKA 4IDQA 3O29A 5ITOA 3TMGA 4DV6T 3K3NA 3ZT5A 4OVRA 5CBRA 4IE4A 3RRWA 4H9QC 2H3RA 4N4UA 3H37A 4XTCQ 2OWTA 1XC1A 4N8YA 2D2SA 2VKOA 2K5BB 5HXSA 2AL4A 2VGQA 1NNTA 2ONSA 1Y3NA 4JSOA 2NW9A 3V8XB 3CQCB 4LF5T 4BDOA 4U1OA 1DU2A 4CXYA 2QS1A 2V84A 3OSQA 2V93A 2HPJA 5LGTB 5LP6E 4DV2T 3VRBA 3QSLA 1MPCA 4B3ST 4LF8T 4N8GA 3WAEA 4EUOA 2Y7PA 3VVFA 3FB2A 4X65T 3PUWE 3CVGA 2CHNA 2D5UA 3AA1B 3RYFE 2XXRA 3MVXA 4QFPA 4ZI3C 4PBHA 4LMJA 3UUXB 2LHNA 2OWZA 2R6GF 2O84X 3ECRA 3A8YC 5JTYB 3H6VA 4PK5A 1EYKA 4MF3A 4FJOA 1ZMGA 3RX6A 4P3LA 2Q74A 4EQ7A 3OYZA 4PCDA 2F3DA 2LRLA 2NUVA 4TOZA 4MNPA 2NW7A 3ONJA 5FTHA 5JTGA 3OXNA 2W4XA 1MS7A 4NN3A 1S7YA 4QWNB 4YTNA 1G0HA 3SEUA 4GIWA 2Q9QA 1B40A 3DELB 3PV0F 2XWOA 2W62A 3JCFA 4DIDB 3O66A 2JMHA 1B1HA 2XQ7A 3KG2A 2CBJA 3N6UA 2E2AA 2DSFA 4OEVA 1MIVA 2GHBA 1IEJA 3D4CA 1MNEA 4FECA 4H9NC 3VXBA 3R84B 4EV6A 5L3BB 2XXVA 1PB8A 3O9PA 1VSOA 2H9BA 4R6KA 5ET7A 1ANFA 5IZ1A 1Z7ME 3FJ7A 2G0UA 1G73A 4KYSA 4P56A 4EYUA 4I9DA 2BBHA 5L3EB 4JV5T 5H8QA 2K48A 4OX9T 2IAKA 4YHHT 1HNWT 4DV4T 3VDFA 2FUPA 5JQGE 5EZYE 4IO7A 1HR0T 2A5TA 1W9RA 2UUBT 4G8NA 4POXA 4PGNA 2RINA 2X68A 5IKBA 4PC9A 2WX9A 3ETVA 3I9WA 4LZ8A 4AKIA 1B3HA 5TP9B 5JK4A 3QAXA 4IO3A 4ZS3A 5JDMA 2PT2A 4IO6A 5FP3A 4ZDMA 5AQFB 1NMUA 3E78A 3RT6B 2DXRA 4YB7A 3HHGA 2CM0A 3RY3A 2W2UA 4OEUA 3S9EA 3MJNA 3I9YA 2ODVA 1UTBB 5FTIA 3PUSA 4YU0A 1MDP1 2CZHA 3O97A 2X0HA 3CX7B 5DVIA 3KN8A 5L4EA 4DV5T 3RUMA 3MA9A 1D9QA 3GXAA 4FE8A 2WWVA 5EQ7A 4ELRA 4P1LA 5AQKB 1LBWA 4LF4T 4K0UA 1B6HA 1W0BA 4O2AE 1J1JA 2LM9A 2B3FA 4ISUA 4TN7B 1MMNA 3FBPA 1ZTYA 3SETA 3A09A 2CBIA 3M8UA 5M4YA 4GX3A 1FTKA 5FYMA 1EH3A 5ET6A 4FORA 1UIUA 4MAGA 2HCAA 3I5OA 2MPKA 4F8HA 3PUXE 4N17A 4ZEIA 2VD2A 2ZZXA 3N9QA 2Q89A 2WZHA 1WDNA 3CMLA 3LUZA 2E1SA 2HHHT 3TUSA 1FIOA 2PFZA 3JAEA 2YU1A 4PFOA 1MMAA 2KQZA 1KA0A 4H0WA 2E9XB 1IXIA 4FEDA 4U3CA 3KOTA 4QF9A 1IMAA 1GR2A 4R2FA 2WM9A 3KVAA 1FBFA 3UGWA 2WB5A 4HCWA 3HL6A 2IEEA 4EF1A 2CCQA 2V5DA 1ZHCA 5LHGB 1B4HA 3M3LA 2DOJA 4B3MT 3TTNA 3HHFA 1B7TA 2LE8A 4DIGA 4UF0A 4AI6A 1VRBA 1QUIA 1D1AA 1D9VA 1H44A 2NP9A 1UUSA 2HZKA 4GOTA 1UIVA 2P1SA 1OXZA 5HWXA 2E9XC 1Y1MA 2KNDA 5IHYA 4GYRA 3ZMUB 4OHNA 3FVGA 1NENA 3A5XA 1MXZA 4IDOA 3ZSFA 4QSCA 2YOEA 3FV2A 1M5EA 4F18A 3IORA 4AKHA 2NWJA 3EQ1A 4I50E 1WFDA 1ZEEA 4RK2A 2L3LA 3FZMB 3L8RA 1VE4A 3QUFA 5CM6A 4OFOA 3ZC1A 4O2BE 3EPEA 2R6GE 3RPLA 3CQGB 4YXDA 4TWHA 1NAFA 5KCJA 4HWCA 3AAEB 1YCJA 2XD3A 3NZQA 2EHOA 2P3VA 1JEUA 4E0WA 4EIWA 5A1LA 3SFEA 2QS2A 2LRKA 1JW5A 2HN2A 4K0KT 3RN8A 3N9OA 3VU7H 4OTEA 3AB3B 3ZYLA 3PV0E 4O4JE 1FPFA 1RDYA 2L8KA 2WP9A 5IUXA 4AKLA 5A5XA 3FBLA 1YTVA 1WRDA 4IB2A 1WR6A 2DHRA 5J2TE 4I0UA 2XXWA 3ZEFB 2XXKA 3UA8A 4MIJA 3PD8A 2BG9A 4AKRB 4KYEA 3IOTA 3PU3A 1JP4A 3MUQA 5EQ8A 2L9QA 3V5UA 3VLWA 4WBOA 3GZGA 2D21A 2O69A 4DR7T 4N13A 4JEUB 4O3BA 2X9XA 5LGNB 3MZBA 3C33A 2J1DG 1XNRT 3Q28A 4UVCB 3AE2A 4N91A 2BKPA 3VRAA 2CXLA 1LBXA 2BBJA 1TT1A 4GWZA 3C9HA 3IHRA 2WWUA 1J5ET 5EYHA 3IB2A 3M3ZB 1RYXA 5L9OA 1IXHA 4DV3T 1FBPA 4UIGA 2FJDA 1R9QA 4MEVA 2J47A 4LF9T 3CR9A 1U5PA 2ZM2A 2N1GA 3LSWA 4HE1A 5F8PA 1HSEA 3CI8A 4G68A 4BDNA 4HTGA 5I5PA 3RI5A 4YTMA 1OEDB 4ECFA 1VR5A 4F1VA 2UVIA 2WS3A 1FJGT 1FTJA 5AQRB 5CI5A 5J16A 2WBDA 5CMBA 4G77A 4HGAA 4TNVA 3CWZB 4OANA 4R9FA 1B7ZA 3PDYA 2VQFT 4O7MA 1FTAA 2KLQA 3VR8A 4GRKA 4GWUA 3ZKKA 3GN5B 3SWHA 1YXIA 3AE1A 4EZ4A 1FPLA 1LLSA 1FEWA 1D1CA 1A99A 4YTPA 1NUXA 5I2KA 3C34A 2CRBA 4ISTA 2XA5A 4ELQA 4GX4A 3RC8A 3EF7A 2OK2A 1OVBA 4AXPA 1PBPA 2O1LA 2D3IA 5AQJB 4MJOA 3VLUA 4JWXA 1FTMA 2JMKA 4LATA 1N3XA 4OZ9A 5FHNA 2QJEA 5EYGA 5JDNA 4A97A 4GQOA 3S9NC 4QH1A 5TPAA 4EXLA 3ZJ1A 1QUJA 3C50A 1IZ1A 1HX1B 1B3LA 2ABHA 2XWIA 3BQKA 4AQFC 5CFBA 3EDUA 1Q9DA 2LSKA 4OHFA 2HXRA 4NF6B 5LCYA 3RH3A 3EDVA 2CEAA 2OLTA 4YKKA 1LVKA 3VKGA 2K9AA 2QVVA 3HO7A 1LAFE 2K3WA 1SW5A 2ZXTA 5KDMC 5ADXL 4F3SA 3X1DA 3PMVA 4LZ7A 1A8FA 4YMBA 2MAWA 1OQGA 3U1OA 2PT1A 2QVAA 2YKSA 3RHWA 4MHFA 2XXUA 3G3FA 4DR6T 3ONMA 4ZI3D 3FXDB 1US4A 4GX6A 3Q5WA 4JUYA 5FXXA 3ISPA 3KV5A 4DCYA 3EHZA 2I4BA 1SYHA 3FATA 4R75A 5L3DB 2MTQA 2DLRA 3T1HT 4FAJA 4UACA 1P1OA 3T0JA 2Y48B 4OENA 4P0GA 4QFOA 4QXBB 4ELOA 2B4MA 3F11A 5B70A 2CPTA 2PTFA 5ITPA 1ZOYA 4KHZF 2WDRA 1LAHE 1LEVA 1FTOA 3RF1A 2WMNA 4Z7EA 4O3CA 1NEKA 5LBMA 2Q8JA 4UV9B 4GL8A 5JR9A 4R2BA 5C2TA 2FJAA 1KNPA 5AA2A 2J62A 2YINA 1AJ3A 1T72A 5ETWA 1II5A 4QH5A 2Q88A 5I2NA 4ESWA 1BIYA 4B3RT 2X66A 5HEJA 3CFZA 2O1MA 2VL0A 2ZYMA 1YQ4A 5C8YE 5I56B 4DUYT 3ZT7A 1HG5A 1KK7A 4MNCA 4B6XA 4OWDA 2JQ9A 1V9DA 4NXMT 4MCOA 1FJ9A 1NV6A 4AQ4A 1IBMT 3E9XA 3NZPA 2X67A 3PUVF 2G93A 5CMCA 3DP8A 4PFUA 3ETUA 4JXIA 2UXXB 3TZAA 3JAFA 4CN4A 2B1EA 1U4QA 1XHYA 3O9XA 3OO9A 2F3BA 4IE5A 3DP6A 4YZZA 3UU3A 3TKLB 1POTA 4KBMB 2ZNTA 2C5KT 4HXVA 4ZEKA 4JEHB 3C51A 3BKIB 4WYVA 5EHMA 5FNVE 4ASKA 4QFLA 1EYJA 4DR5T 2HZLA 5AQQB 4RJZA 4HTEA 3L3PA 4NF5A 5CBSA 5JVDE 2XAGB 5I59A 1B0HA 3USDA 4QRZA 2LSGA 1WYBA 1MRPA 3E0ZA 2C5JA 3T9UA 2ZYKA 1ZP0A 1KA1A 2CWOA 2XXIA 2PG8A 2F35A 4F1YA 2F4VT 4KX6A 3C98B 2Q8MA 1KFYA 3P4PA 1USYH 1BKAA 3ZMZB 5AQIB 1E7PA 4BDRA 5LOMA 1OMPA 4O4HE 1GVCA 2OX3A 2Y7RA 1EZPA 3S9MC 2IC9A 4DV0T 4DMVA 2WU2A 4RXLA 5F1QA 3CX6B 2XQ8A 3RPUA 3Q5DA 2ZZWA 2QYWA 4GL0A 5H8NB 4YJ2E 4WXJA 4U2RA 4GBWA 3ZS6A 2BJIA 3ODBA 3P4QA 2XXPA 2PYYA 4ZEYA 3AEDA 3PGFA 2WQYA 4KP3C 3K6UA 4PAIA 1QVSA 5AQPB 5J0ZA 2NR4A 4PJJA 1NH7A 3UU6A 4X04A 4MBQA 2OBGA 4EB6E 1MY1A 4L5GA 4JI5T 2IIUA 3GMIA 3MC2A 2V7KA 4IDZA 1AOVA 3C4MA 2P9BA 4COFA 3KN3A 3OEMA 4HKAA 2I0MA 1J1NA 4GIZA 2A2FX 3FZFB 4MFRA 4NE4A 1M7KA 4X48A 1JVXA 2VD3A 3RIUA 3LSVA 3TLWA 1XDOA 1D0XA 2I3WA 2R9JA 3TTRA 1P1UA 3BK9A 3GLBA 4Z91A 1WCRA 4UABA 1LRZA 5HM4B 1B0LA 2CMOA 4YSXA 5ELVA 1OWAA 1RYOA 4OFJA 4XBFB 1VCTA 2HN1A 3G3IA 4H67A 4OYVA 2BS2A 1SW4A 2XWVA 4PFBA 3V89B 1RDZA 4PJLA 1G0IA 1AMFA 1OIBA 4HS7A 3A3UA 4GF8A 1IMBA 2VK9A 3HN0A 3C31A 3Q5EA 4PBQA 2X9WA 3U65A 2VHAA 5AQMB 1IMCA 4QSEA 4KHZE 4E0XA 5DEXB 4HWIB 3S9LC 4IY6A 3MZ1A 5KDTB 4ZOLE 4ZECA 2QRYA 4GVOA 2B76A 5I57B 2IW5B 2KLFA 2O7UA 2H5YA 2V1DB 2XSAA 3PJAJ 2DE3A 2HAUA 2I6HA 4X1YE 3L09A 3N26A 2CXDA 4LVQA 4O8MA 1FPBA 2IHR1 3SESA 3LK2B 3T1YT 4ANJA 4ISSA 3UFGA 1MY2A 3EKIA 5LBQB 4PJMA 5ABFA 2Y7KA 1MXUA 2XAJB 5TP9A 4GXAA 5TU0A 4G8HA 1SI1A 3PUVE 4N6PA 4X1IE 5IAIA 4IL9A 3IK6B 4LA9A 3KVBA 1MIWA 4U7YA 4R9GA 3UK4A 3DM0A 5IGAA 2GFEA 4AB5A 1UTBA 1CNQA 5HYAA 2WZIA 3E79A 1S9TA 4MLQA 2XM1A 3AE5A 1HFAA 2H89A 1GV8A 4YT0A 3GBAA 3P7IA 1LFHA 4LONB 3T9HB 3K2DA 1URSA 4U31A 1FPKA 3AVRA 4HFHA 1IJ5A 2O68A 4CZZB 1OQHA 4RNSA 1MY3A 5HAXA 4X8RA 4H9RC 3EVYA 2F78A 5L9SA 2XAFB 1KZ8A 4M4GA 5LYJE 5J1GA 1UX4A 1ATGA 4QBAA 3UT5E 5JDLA 2VL8A 2ZMAA 3A7MA 3MACA 5DT6A 4TV8E 3V5AA 4BDMA 1NV2A 3HSTA 1FBEA 2Y6XA 2DVZA 3UIFA 4LFAT 2RC8A 4NIQA 4KI0F 4I43B 3ZN1B 4OFZA 5L4HA 1UQWA 5I3SA 1SA0E 1NI9A 2E9XA 1LFGA 3SZPA 1XWMA 2PBIA 1H45A 3MW0A 2VQET 4UR9A 3BFUA 3H03A 2M8CA 1M5CA 1NUWA 4GBVA 2THIA 3HKBE 4A5XA 3QNUA 3CG3A 3RIAA 2UXDT 4R73A 2BVLA 4PFTA 3ANWB 1WODA 4I3EA 3C64A 2BJJX 2NOOA 4H63H 1N7XA 2D0TA 2OCUA 1MIYA 4X1DA 4JWOA 2BKNA 1PC3A 1B9JA 1IUDA 4KXPA 1P99A 3P8CD 2H25A 3WAKA 1IMEA 1YKEB 1LGBC 1CE2A 3MK7C 1HNZT 4OYJA 2KR0A 2AXDS 4TLMB 4YB6A 4PFWA 1QSDA 5LMUT 2P0SA 3E3KA 3LSLA 4U72A 2P3NA 4MMPA 2KXPB 3JC6C 3PPPA 4R74A 4H8JA 2F34A 3KEIA 5EHSA 5DW8A 1MQIA 1EU8A 3T1BA 3RQUA 2X7QA 3TELA 2HH7A 1UX5A 2Y8DA 2WKYA 3UTKA 2DDKA 2CWYA 1LCTA 2OZZA 4PF6A 4BA9A 2LLYA 2F97A 1NWMX 3FXQA 5AE4A 3IEEA 3QB5A 3R6NA 2V3QA 4P0IA 4IDNA 3PUGA 2YN6A 3AAIA 4YKIA 2XQ3A 3NBXX 3TCGA 2Q9QB 3RQTA 1IITA 3CFXA 4YFSA 5CJ5A 3KSJA 3ZT6A 3HKDE 2CMRA 3SEYA 2BG9E 3CPZA 5IM2A 3K0VA 1PBQA 5ICQA 3RRCA 2XXQA 1Y1ZA 4JI6T 4PF8A 3T8OA 1N0TA 4GWXA 3C4WA 2RPAA 1SI0A 5ET8A 3NKZA 3VFJA 3BBRA 4OETA 4MBPA 2PVUA 2PJQA 4C90A 2Q9QC 3MKDA 4LMLA 3IOUA 5F5WA 5AQVB 5JDQA 2GHAA 3AEEA 4DI4B 3U3IA 4U23A 1EYIA 2KZ7B 4RA1A 1QUUA 4Q30B 3KBZA 4DV1T 2VKJA 1UTHB 4HEAA 1IXGA 1GQEA 3FVOA 4KCDA 1LB9A 3NOHA 1FBCA 2XJ7A 2FBWA 3KINB 4IGRA 2DWHA 5FL0A 1NKXA 1B58A 2AL5A 1OEDA 3FHNA 2W00A 3I6VA 2GK9A 3IJXB 3AEAA 2GQ1A 3ZMSB 1MQJA 5H8SA 1UURA 4GD5A 3EI0A 5FHMA 2YPNA 5LTCA 2J4GA 3B5MA 2PBWA 1N36T 1PB9A 1YPNA 4DZ1A 4I8CA 1FQAA 2XM2A 4NWCA 3SEXA 5H8HB 3RT8A 1JW4A 3EABA 3GN5A 1MM6A 4Q0CA 4POWA 2H98A 1Y4TA 1KWHA 1MH4A 3QMFA 1MQDA 3V5SA 1IAPA
chains in the Genus database with same CATH topology
2YEVC 5LHHB 1LAGE 3G3HA 3B6TA 4H9SE 1LBCA 3KBRA 4OESA 2X9YA 3RYCE 3MP6A 3OO6A 5IYZE 4QHOA 2ZYOA 4RPOA 4F2OA 1HF8A 1T98A 2CZLA 4MALA 2I3VA 2B65A 3FXEB 3L6HA 1SYIA 2UVJA 3S2VA 3RKOA 1XOCA 3PPOA 4UVAB 3IL1B 4KI0E 3PURA 4BJMA 4CXWA 1D0YA 2DWAA 3R7XA 3VKHA 1US7B 3ZMTB 5AA4A 5JREA 4EAHA 2D5WA 4UELA 3OO8A 3HKCE 5EK2A 3UUMA 3FGSA 4NF8A 5FXWA 3N9PA 1D9YA 3D4GA 4NF6A 4IE7A 5HXRA 1MY4A 2V26A 1B7UA 3TQLA 3HKEE 3O6HA 3E08A 1JW1A 5TAOA 4MFIA 1JNFA 1MXWA 1D1BA 3B13A 4C0RA 3B6QA 4UF0B 4L0RA 5JH7E 3DJBA 1B51A 3O1IA 1ZKEA 3TTMA 1BR1A 4EZHA 3QYTA 4F2QA 3CQXC 1JQFA 4GXSB 4JSDA 2LJLA 4FATA 5LA6E 5FY7A 3LUYA 2C0SA 2RP4A 5B7DA 4UV8B 5HXHA 4WEDA 4YAHX 3KBUA 1A7LA 3H6UA 5LXTE 2QMWA 1LFIA 2XXTA 4UEMA 1USYE 2Y84A 3OELA 1NL5A 1DSNA 3VV5A 1M5FA 1MMGA 1BR2A 3QC9A 3OENA 4Q5TA 1B5IA 4H5FA 4HN9A 2NTXA 2V3TA 4IO2A 3MVZA 4KD5A 4U74A 2VASA 1SW2A 4NMYA 5DYHA 2EHOB 1ZBMA 1L5TA 5HWYA 1LSTA 3KSXA 3F2EA 3ZMVB 1FMVA 2WMOA 3B6WA 5I56A 4X9TA 3U8QA 4E7ZA 2P2AA 1Y20A 2X7PA 2EHOC 1F9BA 1H3DA 2CE7A 4QKNA 3GWHA 2F7CA 2UYFA 4KR5A 3LC8A 2JQQA 2F6PA 3EN3A 4J2CA 4DXCA 3TTLA 1N04A 3RTFB 3SEWA 4DDDA 1S50A 1H43A 1N3WA 3CSBA 3VVEA 4I4TE 3WAFA 4XKNA 3FZVA 3DLNA 3T9VA 3VE1B 3VXCA 1DTGA 4AKGA 2OWSA 4NF4B 2DP8A 3MZKB 1NNKA 5KZTA 4DO0A 3C36A 3O4XE 3EHTA 1MMDA 2CLYB 2IC6A 2YU2A 2XXHA 4O8SA 4R72A 1N76A 3BQIA 2KMFA 2E0SA 2A72A 1QW0A 5CA1E 3OMBA 3QUJA 2XD2A 3ZYKA 3LBXB 4PJNA 5H8FB 1N84A 3M3KA 2GH9A 4U1ZA 2CLYC 2VKHA 4XKRA 5CB4E 1T0KA 3OBVE 4CI3B 5LHIB 5J1DA 3H3AA 5JRCA 5H8NA 2X0LB 4KUMB 2Q2AA 1PB7A 3RGYA 3FBZA 4EOZB 1URDA 5CA0E 4YKPA 1I6QA 4F39A 1US5A 1FTLA 5AA3A 3KZGA 3OYXA 4QX8B 5DVFA 4YMAA 4ZZEA 3NRYA 1NH8A 3FVNA 4DLDA 4TLLB 3O28A 4YICA 4PK4A 3PUYE 5K2YA 3BFTA 4JLEA 5KX5E 1IZNB 1FQCA 1BP5A 4OYKA 1VFDA 5TPAB 4X20E 2HFBA 1MXVA 4EQ9A 5DVJA 2DI4A 3K01A 3ILUB 2C5IT 4IHJE 3GBBA 4YB5A 3H6WA 1OLCA 4DCXA 3TDJA 2I59A 5L8DA 5DTBA 3KFMA 3JC6D 4LZ5A 3G3GA 2NWBA 4XKQA 4ZEBA 4EDPA 3JZJA 3OJAA 4KCCA 1UCUA 3KJ7A 3F57A 1M5BA 3RYHE 1N7WA 4G4PA 5AFUL 2PMSA 4H9PC 3RPWA 4DXBA 1EZOA 3K00A 2W0GA 5DEXA 4CI2B 2DCFA 2Y7IA 1D4NA 5KDTA 2R71A 3PTRB 4EF2A 3Q5XA 1NNPA 2KT9A 4FEBA 4OK0A 1ZIUA 2ANJA 4BLAA 1BLFA 3UORA 3N9MA 2UXAA 4F19A 4P0AA 4F31B 1ZV4X 2Q9QD 2X9HA 2QA7A 4QXHB 3OOAA 1MM7A 4HCYA 4U4SA 3J7Yq 2QMXA 4XAXB 2D0UA 3CX8B 1O3XA 4O4LE 4V1Av 4GLIA 3LJCA 2V25A 1JEVA 2RC9A 3H4ZA 1B2HA 3UN6A 3V83A 2I4CA 2LHRA 5JTYA 3ZJ2A 5L3GB 4ZHQE 2JJ9A 1YAEA 1GGGA 2WSSV 2I6EA 4FIMA 1Z0PA 2XQYA 4C1UA 2LSIA 2IA4A 3IOWA 1P1WA 2DXYA 2QS4A 2GRVA 3OSRA 4IE0A 2VKDA 4BDLA 1B4ZA 4QFKA 3SERA 3G7WA 1B3GA 3C4XA 4ZEFA 1OVTA 3O6IA 2QL3A 1FQBA 2UXNB 3RLFE 5CC2A 1B1XA 1QKAA 4H5GA 3Q9DA 1HTJF 1MXXA 2BVMA 1O63A 3VLVA 4RYAA 3OD7A 2I48A 1B46A 2QPQA 1SW1A 2FYIA 3QIMA 3FJGA 5JDGA 1B05A 2HXWA 4R6HA 3K6WA 3K3QC 4TQUQ 1I6AA 3PUAA 4ND9A 3C32A 4IGUA 2NXOA 4TUYE 2H7VC 4F6RC 4WKMA 1MDQA 3RNNA 3ANWA 1SBPA 3SKPA 1TXFA 3THIA 2OJTA 1KNZA 3K4UA 3IF8B 4QX7B 5BMVE 4U4XA 5BUUA 1AH5A 3IX1A 3AXFA 1G8XA 3HV1A 2ESNA 1A8EA 2K24A 2Q9TA 2Z8EA 3QXMA 1BTJA 4MLKA 2OLBA 1JETA 1POY1 2ONRA 3LK3B 2XHEB 5F7VA 5DJQC 2DS9A 1QJMA 3IB1A 1LB8A 2X26A 1ZLQA 1R9LA 4UVBB 4I62A 1I6BA 2I0CA 4KMCA 2KWIB 3ZCIA 4XKPA 5HXEA 4KPTA 3RYIE 5I58B 4PP0A 1Z7NE 4FI5A 2LOSA 2LSYA 2O51A 2PFVA 3DTOA 3ZPOA 4FJPA 1LVFA 2A5SA 3I3VA 3LBSA 5L3FB 3PUQA 1BR0A 1DMBA 3U92A 2YK0A 3SOLA 4XIGQ 1S94A 2N2NA 1MPBA 4NEDA 4IY5A 4EYYR 2JPFA 1CB6A 1JVYA 3E4RA 4G8MA 1IXCA 1QULA 3E22E 3HR0A 4HE8A 3F31A 3A3CA 1HS7A 2HAVA 1B5JA 2Q2CA 3UUNA 3B57A 3PUZE 4X1BA 2XXYA 5CRYA 1PEBA 1E1HB 2DNXA 4JDFA 2CA5A 2WAUA 1MQGA 3L6GA 4MH5A 2Z23A 3MVWA 3G3KA 4UXNB 2EHOD 2AYSA 3LFMA 4ELPA 1CUNA 4BAYB 4OFLA 4PW8A 1LCFA 3K1MA 1UTHA 2NOXA 3N9NA 5L9MA 5M2VA 3ZC0A 1Y3QA 1AIVA 1BR4A 1H7CA 1FQFA 1WVJA 4H9OC 3CRBA 1DOTA 3ILTB 3Q2MA 4JWYA 3TYHA 4CI1B 2YLNA 3K6VA 3N2OA 4F1UA 4P09A 4K3FA 3MXZA 3LSFB 5DQWA 3SDFA 4OMBA 3EHUA 4THIA 3QK6A 3ZKLA 1ZU0A 3FD3A 3Q27A 1Q1KA 2ZM8A 3KGCA 5H8HA 2V3UA 2N9DA 1ZKBA 2RKMA 1M5DA 2FA7A 5CMKA 2XX8A 3G3JA 5JEIA 4IO4A 2QSXA 2G29A 4PQJA 1HSJA 2XASB 5FY1A 4F22A 3EHSA 3KV6A 3T93B 4AQGA 1FQDA 4ZI7E 1B3FA 3UFEA 2RCAA 1YW0A 4WNKA 3K1PA 1MNDA 3M65A 2Z8DA 3VVDA 3VHLA 3M3FA 3MPKA 3MZ9A 5HBCA 2AIXA 1LAXA 4KQPA 2W63A 5HPQA 2PX1A 4KYDA 4NWDA 1DTZA 2DYXA 4EXKA 3LSXA 5H8QB 4H65A 2NVUB 3T96B 3TPAA 3HI2A 2DWKA 2WBLA 1B32A 4IO5A 2E8IA 3SS1A 3O1HA 2A5TB 3H7MA 4ZS2A 3LR1A 3FIRA 1URGA 3N2GE 4TZ4C 2LAOA 3PMWA 3PPNA 3MQ9A 4TX5A 3U94A 2XAQB 2VWAA 1FCKA 3SRZA 4CQIA 3IO6A 3N9LA 4GYSA 2Z6EA 2VP1A 3U93A 1AL3A 3K3OA 3Q29A 3AA6B 2XAHB 3AAAB 3IR1A 3SEVA 1DPEA 2W7YA 4OQOA 4AB6A 1SDXA 2NW8A 2VB6A 5J2UE 1ZJLA 4LP2B 4U21A 1Y9UA 4LQ2A 2RCBA 3ZLIA 4I1DA 3AA7B 3N5LA 3ONXA 4AQFA 3T66A 2W61A 4QHQA 1Q35A 1QKBA 3O2AA 4YLHA 4LUBA 4ZS9A 4X1KE 1FW0A 1MXYA 1PDAA 3R26A 3H6TA 3IAZA 3H3GA 2NTYA 2F7AA 3AA0B 4KFQA 1WLXA 4DXUA 4JBZA 3KBTA 2H7OA 2Y7WA 4RY1A 1MG1A 3IBPA 2RA1A 3CFLA 3MBPA 2BDEA 3S4UA 3ZYMA 2MYSA 4DBRA 2YJPA 3H06B 2F7BA 5L2LA 3ZN0B 3OO7A 3E13X 3WI3A 3FJMA 4IE6A 4R6YA 2ZM0A 5AA2D 1Y4CA 4QSDA 3I0QA 2XX7A 2UYEA 4G2AA 4DE8A 3MVYA 2OA5A 4NF4A 4YKJA 2V7IA 2DVCA 3K8PC 3Q25A 2A3DA 1S35A 3FUZA 1I69A 1XVXA 3PMXA 3KV9A 4ZI2D 4I55E 4WW0A 3OEKA 5FY0A 1EZ9A 1P1NA 2QS3A 3KFWX 1XT8A 4GOUA 4ILUA 1P1QA 1MY0A 3FXUA 3MAMA 3LBXA 2B3BA 4WEPA 5H8FA 5KCJB 3LG7A 3KOSA 5FHOA 5ICTA 4BDQA 5GONE 3CSGA 3TFLA 3FV1A 1TFAA 2O6AA 5FXZA 3UP9A 4IGTA 4DBQA 5EK3A 4RPNA 4M1VA 4H8IA 4OXVA 3R6UA 2V7JA 3MPLA 2ES0A 3K6XA 5LJMA 5A5XB 3MJXA 3W9VA 4ESXA 4ZEDA 4G2ZA 1Y3PA 3PU8A 5H6RB 1MQHA 1R1NA 1WYCA 3CKDA 3ESLA 5BWJA 4NTLA 3EUHA 5F3JA 2XXXA 1A55A 4G63A 4A56A 2DWIA 2I49A 4BJNA 1B5HA 1EZ3A 3TCHA 5EYFA 1RKMA 2REGA 5AA4B 1QUKA 3WAJA 3TCFA 2ZMBA 5ISUA 5CMMA 1MPDA 4N07A 4E7SA 3K02A 4NF8B 1XS5A 2I0BA 2LSJA 1TFDA 3TTKA 3MP1A 2XX9A 4GK0E 3O6GA 1HSLA 4G68B 1X79A 3JV9A 4P0BA 1VFEA 4L9IA 3U78A 3NRXA 4O3AA 3N6TA 2FNCA 2DE4A 4MLVA 4F3BA 1SHZC 2ALUA 3U72A 4MHCA 2H4IA 1FMWA 3TQWA 3AVSA 2MOZA 2HEUA 4C91A 1SQYA 1SD3A 5FXVA 4ADZA 4F3PA 3W15B 1LKXA 4G68C 4DMWA 2JRKA 5I2KB 3HPIA 2ZLYA 4PE5B 2V7MA 1MH3A 4YHJA 4U22A 3W9WA 5E0OA 4OVJA 1A54A 3TKDA 3DP7A 2O7IA 2HQ0A 2ODUA 4EQBA 3GA8A 3D0TA 1NFTA 4GK5E 2ACXA 3W15C 1NNFA 4L17A 3C4ZA 1GTKA 2ZYNA 4Z8XA 4O4IE 4EXTA 4ONYA 4QFNA 3JYRA 2LOPA 2CXFA 2F36A 5DQVA 1B52A 2ZNUA 4RK9A 1OLAA 4PFPA 3DP4A 2HPLA 1D0ZA 2DWJA 4OERA 4PNIA 3TEPA 3RTWB 3KJTA 5LG4A 4N78D 1HX8A 4PAGA 3HCQA 1HCIA 4TV9E 1DPPA 1TWYA 3RC3A 5JDFA 4Z0IA 2XUEA 3KDSE 5LJNA 2DWGA 3KV4A 2DQVA 1YKHB 2QGSA 4NUVA 3CG1A 4PETA 3MWBA 3TODA 1ELJA 3IB0A 3UULA 2X51A 3CIJA 2KWHA 4IIJE 2REJA 1IQ7A 3OKQA 2KINB 2MBGA 4H6DA 5KMGP 2SPCA 5FMNA 3IO4A 2BZBA 5I57A 3Q26A 4GFRA 2LEHA 5K2XA 1VOMA 5JR9B 3T22A 1LBBA 4XZCA 1O7TA 2F6GA 3I0OA 3TAJA 5AA2B 1H76A 1SVXB 4QXCB 2F8DA 3J9X1 4P11A 1FQEA 2V7LA 5I2NB 4ZE9A 4CXXA 4H1XA 5JRCB 3C35A 1IIWA 3N94A 3BQLA 5JDHA 4XXUA 1Y64B 4LQ5A 4PK6A 3T9XB 5L3CB 3PPQA 3IOVA 3FVKA 5JR9C 4GWOA 5DABA 2RC7A 5H6QB 1B3EA 2RF1A 4ERRA 2ONKE 2LT3A 1HG2A 3FASA 1XVYA 5AA1A 5I84A 2UVGA 3N2KE 1IJ6A 1R6ZA 4YJ3E 4Q8RA 5EK4A 4ZI2C 4DNDA 4M1PA 2E9XD 3ZCJA 3PE0A 4F3GA 3I1AA 2UVHA 4NF5B 4HFVA 5I59B 4ZE8A 2XHDA 5LOVE 4C1TA 2M67A 3FXRA 1B7HA 5I58A 2H99A 2F5XA 4DVDA 4PFYA 4H63V 4NUUA 3B7DA 1A40A 1D3KA 3MP8A 3K1NA 2VOZA 4JB7A 1O64A 4F29A 3HA4A 2Z22A 5HXCA 2I58A 3PU5A 4ZZAA 3O1JA 1YD8G 3CVRA 3IJOB 4WBNE 2Z8FA 2DE2A 4HW8A 2XTLA 3PD9A 4UA8A 2ZNSA 3KN7A 3PPRA 5LGUB 3LK42 5LNKA 3O29A 5ITOA 3TMGA 3K3NA 5CBRA 4IE4A 3RRWA 4H9QC 2H3RA 3H37A 4XTCQ 2OWTA 1XC1A 2D2SA 2VKOA 2K5BB 5HXSA 2AL4A 2VGQA 1NNTA 2ONSA 1Y3NA 4JSOA 2NW9A 3V8XB 3CQCB 4BDOA 4U1OA 4CXYA 2QS1A 2V84A 3OSQA 2V93A 2HPJA 5LGTB 5LP6E 3QSLA 1MPCA 3WAEA 4EUOA 2Y7PA 3VVFA 3FB2A 3PUWE 3CVGA 2D5UA 3AA1B 3RYFE 2XXRA 3MVXA 4QFPA 4ZI3C 3UUXB 2LHNA 2O84X 3ECRA 5JTYB 3H6VA 4PK5A 4MF3A 4FJOA 1ZMGA 3RX6A 4EQ7A 3OYZA 2NUVA 4TOZA 2NW7A 5FTHA 3OXNA 1MS7A 1S7YA 4QWNB 3SEUA 4GIWA 2Q9QA 1B40A 3DELB 2W62A 3O66A 2JMHA 1B1HA 3KG2A 3N6UA 2DSFA 4OEVA 1MIVA 2GHBA 1IEJA 3D4CA 1MNEA 4FECA 4H9NC 3VXBA 3R84B 5L3BB 2XXVA 3O9PA 1PB8A 4R6KA 1VSOA 2H9BA 1ANFA 1Z7ME 3FJ7A 2G0UA 1G73A 4KYSA 4EYUA 4I9DA 5L3EB 5H8QA 2K48A 2IAKA 3VDFA 5JQGE 5EZYE 4IO7A 2A5TA 4G8NA 4POXA 2RINA 2X68A 5IKBA 3ETVA 3I9WA 4LZ8A 4AKIA 1B3HA 5TP9B 5JK4A 3QAXA 4IO3A 4ZS3A 5JDMA 2PT2A 4IO6A 5FP3A 4ZDMA 1NMUA 3RT6B 2DXRA 4YB7A 3HHGA 2CM0A 3RY3A 4OEUA 3S9EA 3MJNA 3I9YA 2ODVA 1UTBB 5FTIA 3PUSA 4YU0A 1MDP1 3O97A 3CX7B 5DVIA 3KN8A 3RUMA 3MA9A 3GXAA 4FE8A 4ELRA 1B6HA 4K0UA 4O2AE 2LM9A 2B3FA 4ISUA 4TN7B 1MMNA 1ZTYA 3SETA 3A09A 3M8UA 5M4YA 1FTKA 5FYMA 1EH3A 4FORA 1UIUA 2HCAA 3I5OA 3PUXE 4ZEIA 2VD2A 3N9QA 2Q89A 1WDNA 3CMLA 2E1SA 3TUSA 1FIOA 2YU1A 4PFOA 1MMAA 4H0WA 2E9XB 1IXIA 4FEDA 3KOTA 4QF9A 1GR2A 4R2FA 2WM9A 3KVAA 3UGWA 4HCWA 3HL6A 2IEEA 4EF1A 2CCQA 1ZHCA 5LHGB 1B4HA 3M3LA 2DOJA 3TTNA 3HHFA 1B7TA 2LE8A 4DIGA 4UF0A 4AI6A 1VRBA 1QUIA 1D1AA 1D9VA 1H44A 2NP9A 2HZKA 4GOTA 1UIVA 2P1SA 1OXZA 5HWXA 2E9XC 1Y1MA 2KNDA 5IHYA 4GYRA 3ZMUB 4OHNA 3FVGA 3A5XA 1MXZA 3ZSFA 4QSCA 3FV2A 1M5EA 4F18A 3IORA 4AKHA 2NWJA 3EQ1A 4I50E 1ZEEA 4RK2A 2L3LA 3QUFA 1VE4A 5CM6A 4OFOA 3ZC1A 4O2BE 3EPEA 2R6GE 3CQGB 1NAFA 5KCJA 3AAEB 1YCJA 2XD3A 3NZQA 2EHOA 1JEUA 4E0WA 4EIWA 5A1LA 2QS2A 1JW5A 3RN8A 3N9OA 3VU7H 4OTEA 3AB3B 3ZYLA 3PV0E 4O4JE 2L8KA 5A5XA 4AKLA 3FBLA 1YTVA 1WRDA 4IB2A 1WR6A 2DHRA 5J2TE 2XXWA 3ZEFB 3UA8A 3PD8A 4AKRB 4KYEA 3IOTA 3PU3A 3MUQA 2L9QA 3V5UA 3VLWA 4WBOA 3GZGA 2D21A 2O69A 4N13A 4JEUB 4O3BA 2X9XA 5LGNB 3MZBA 3C33A 2J1DG 3Q28A 4UVCB 1TT1A 2CXLA 3C9HA 3IHRA 2WWUA 3IB2A 1RYXA 5L9OA 1IXHA 4UIGA 1R9QA 3CR9A 1U5PA 2ZM2A 2N1GA 3LSWA 5F8PA 1HSEA 3CI8A 4G68A 4BDNA 4HTGA 4ECFA 1VR5A 4F1VA 2UVIA 1FTJA 5CI5A 5CMBA 4G77A 4HGAA 3CWZB 4R9FA 1B7ZA 3PDYA 2KLQA 4GRKA 3ZKKA 3GN5B 3SWHA 4EZ4A 1LLSA 1FEWA 1D1CA 1A99A 5I2KA 3C34A 4ISTA 4ELQA 3RC8A 3EF7A 2OK2A 1OVBA 4AXPA 1PBPA 2O1LA 2D3IA 3VLUA 4JWXA 1FTMA 2JMKA 4LATA 1N3XA 4OZ9A 5FHNA 2QJEA 5JDNA 4GQOA 3S9NC 4EXLA 5TPAA 3ZJ1A 1QUJA 3C50A 1IZ1A 1B3LA 2ABHA 3BQKA 4AQFC 3EDUA 2LSKA 4OHFA 4NF6B 5LCYA 3RH3A 3EDVA 2CEAA 4YKKA 1LVKA 3VKGA 2K9AA 3HO7A 1LAFE 1SW5A 2ZXTA 5KDMC 5ADXL 4F3SA 3PMVA 4LZ7A 1A8FA 4YMBA 1OQGA 3U1OA 2PT1A 2XXUA 3G3FA 3ONMA 4ZI3D 3FXDB 1US4A 3Q5WA 4JUYA 5FXXA 3KV5A 4DCYA 2I4BA 1SYHA 3FATA 4R75A 5L3DB 2MTQA 2DLRA 4FAJA 4UACA 1P1OA 2Y48B 4OENA 4P0GA 4QFOA 4QXBB 4ELOA 3F11A 5B70A 5ITPA 1LAHE 1FTOA 2WMNA 4Z7EA 4O3CA 5LBMA 2Q8JA 4UV9B 4GL8A 5JR9A 4R2BA 5AA2A 2YINA 1AJ3A 1II5A 5ETWA 2Q88A 5I2NA 4ESWA 1BIYA 2X66A 3CFZA 2O1MA 2ZYMA 5C8YE 5I56B 1HG5A 1KK7A 4B6XA 4OWDA 1V9DA 4AQ4A 3E9XA 3NZPA 2X67A 2G93A 5CMCA 3DP8A 4PFUA 3ETUA 4JXIA 2UXXB 3TZAA 1XHYA 2B1EA 1U4QA 3O9XA 3OO9A 4YZZA 4IE5A 3DP6A 3TKLB 1POTA 4KBMB 2ZNTA 2C5KT 4ZEKA 4JEHB 3C51A 3BKIB 5EHMA 5FNVE 4ASKA 4QFLA 2HZLA 4RJZA 4HTEA 3L3PA 4NF5A 5CBSA 5JVDE 2XAGB 5I59A 1B0HA 3USDA 4QRZA 2LSGA 1WYBA 1MRPA 3E0ZA 2C5JA 3T9UA 2ZYKA 2CWOA 2XXIA 2PG8A 2F35A 4F1YA 3C98B 1USYH 1BKAA 3ZMZB 4BDRA 5LOMA 1OMPA 4O4HE 1GVCA 2Y7RA 1EZPA 3S9MC 2IC9A 4DMVA 4RXLA 5F1QA 3CX6B 3RPUA 4GL0A 5H8NB 4YJ2E 4WXJA 4U2RA 3ZS6A 3ODBA 2XXPA 2PYYA 3PGFA 4KP3C 3K6UA 1QVSA 4PJJA 1NH7A 4MBQA 2OBGA 4EB6E 1MY1A 4L5GA 3GMIA 3MC2A 2V7KA 4IDZA 1AOVA 3C4MA 2P9BA 3KN3A 3OEMA 4HKAA 1J1NA 4GIZA 2A2FX 4MFRA 4NE4A 4X48A 1JVXA 2VD3A 1D0XA 2I3WA 2R9JA 3TTRA 1P1UA 3BK9A 3GLBA 1LRZA 5HM4B 1B0LA 2CMOA 5ELVA 1OWAA 1RYOA 4OFJA 4XBFB 3G3IA 4H67A 4OYVA 1SW4A 3V89B 4PJLA 1AMFA 1OIBA 4HS7A 3A3UA 4GF8A 2VK9A 3HN0A 3C31A 2X9WA 2VHAA 4QSEA 4KHZE 4E0XA 5DEXB 3S9LC 4IY6A 3MZ1A 5KDTB 4ZOLE 4ZECA 2QRYA 4GVOA 5I57B 2IW5B 2KLFA 2O7UA 2H5YA 2V1DB 2DE3A 2HAUA 4X1YE 3L09A 3N26A 2CXDA 4LVQA 3SESA 3LK2B 4ANJA 4ISSA 1MY2A 5LBQB 4PJMA 2Y7KA 1MXUA 2XAJB 5TP9A 4GXAA 5TU0A 4G8HA 1SI1A 3PUVE 4N6PA 4X1IE 5IAIA 3IK6B 4LA9A 3KVBA 1MIWA 4R9GA 3UK4A 3DM0A 2GFEA 4AB5A 1UTBA 5HYAA 1S9TA 4MLQA 1HFAA 1GV8A 3GBAA 3P7IA 1LFHA 4LONB 3T9HB 3K2DA 1URSA 3AVRA 1IJ5A 2O68A 4CZZB 1OQHA 4RNSA 1MY3A 5HAXA 4H9RC 3EVYA 2F78A 5L9SA 2XAFB 4M4GA 5LYJE 5J1GA 1UX4A 1ATGA 3UT5E 2VL8A 2ZMAA 3MACA 5JDLA 5DT6A 4BDMA 4TV8E 3V5AA 3HSTA 2Y6XA 2DVZA 3UIFA 2RC8A 4I43B 3ZN1B 4OFZA 1UQWA 1SA0E 2E9XA 1LFGA 2PBIA 1H45A 3MW0A 3BFUA 3H03A 2M8CA 1M5CA 2THIA 3HKBE 3CG3A 4R73A 2BVLA 4PFTA 3ANWB 1WODA 3C64A 2BJJX 2NOOA 4H63H 1N7XA 2D0TA 2OCUA 1MIYA 4X1DA 4JWOA 1PC3A 1B9JA 1IUDA 1P99A 3P8CD 2H25A 3WAKA 1YKEB 1LGBC 1CE2A 3MK7C 4OYJA 4TLMB 4YB6A 4PFWA 1QSDA 2P0SA 3E3KA 3LSLA 4U72A 2KXPB 3JC6C 3PPPA 4R74A 4H8JA 2F34A 3KEIA 5EHSA 1MQIA 1EU8A 2X7QA 3TELA 2HH7A 1UX5A 2Y8DA 2WKYA 3UTKA 2CWYA 1LCTA 2OZZA 4BA9A 2F97A 3FXQA 1NWMX 5AE4A 3IEEA 2V3QA 3R6NA 4P0IA 3PUGA 3AAIA 4YKIA 3NBXX 3TCGA 2Q9QB 3RQTA 1IITA 3CFXA 4YFSA 3KSJA 3HKDE 2CMRA 3SEYA 3CPZA 3K0VA 1PBQA 5ICQA 3RRCA 2XXQA 1Y1ZA 3T8OA 1N0TA 3C4WA 1SI0A 3VFJA 3BBRA 4OETA 4MBPA 2PVUA 2PJQA 4C90A 2Q9QC 3MKDA 3IOUA 5JDQA 2GHAA 3U3IA 4U23A 2KZ7B 4RA1A 1QUUA 4Q30B 2VKJA 1UTHB 4HEAA 1IXGA 3FVOA 4KCDA 1LB9A 3KINB 4IGRA 2DWHA 1NKXA 2AL5A 1B58A 3FHNA 2W00A 3I6VA 2GK9A 3IJXB 3ZMSB 1MQJA 5H8SA 4GD5A 5FHMA 2YPNA 2PBWA 1PB9A 1YPNA 4DZ1A 4I8CA 1FQAA 4NWCA 3SEXA 5H8HB 3RT8A 1JW4A 3GN5A 1MM6A 4Q0CA 4POWA 2H98A 1Y4TA 1KWHA 1MH4A 1MQDA 3V5SA 1IAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAG E;  3G3H A;  3B6T A;  1LBC A;  3KBR A;  4OES A;  2X9Y A;  3MP6 A;  3OO6 A;  2ZYO A;  4RPO A;  4F2O A;  2CZL A;  2I3V A;  2B65 A;  3FXE B;  3L6H A;  1SYI A;  2UVJ A;  3S2V A;  1XOC A;  3PPO A;  3IL1 B;  4KI0 E;  3R7X A;  2DWA A;  5AA4 A;  2D5W A;  3OO8 A;  3FGS A;  4NF8 A;  1D9Y A;  3D4G A;  4NF6 A;  1MY4 A;  1B7U A;  3TQL A;  3O6H A;  1JW1 A;  4MFI A;  1JNF A;  1MXW A;  4C0R A;  3B6Q A;  4L0R A;  1B51 A;  1ZKE A;  3TTM A;  3QYT A;  4F2Q A;  1JQF A;  4GXS B;  4JSD A;  4FAT A;  3LUY A;  5B7D A;  4WED A;  4YAH X;  1A7L A;  3H6U A;  2QMW A;  1LFI A;  2XXT A;  1USY E;  2Y84 A;  3OEL A;  1NL5 A;  1DSN A;  3VV5 A;  1M5F A;  3OEN A;  4Q5T A;  1B5I A;  4H5F A;  2V3T A;  4IO2 A;  3MVZ A;  4KD5 A;  1SW2 A;  4NMY A;  5DYH A;  1L5T A;  1ZBM A;  1LST A;  3KSX A;  3B6W A;  5I56 A;  4X9T A;  3U8Q A;  2P2A A;  1Y20 A;  2X7P A;  1F9B A;  1H3D A;  2F7C A;  2UYF A;  4KR5 A;  3LC8 A;  2F6P A;  3EN3 A;  4J2C A;  4DXC A;  3TTL A;  1N04 A;  3RTF B;  3SEW A;  4DDD A;  1S50 A;  1H43 A;  1N3W A;  3CSB A;  3VVE A;  3WAF A;  4XKN A;  3FZV A;  3DLN A;  3T9V A;  3VE1 B;  3VXC A;  1DTG A;  2OWS A;  4NF4 B;  2DP8 A;  1NNK A;  5KZT A;  3C36 A;  3EHT A;  2IC6 A;  2XXH A;  4R72 A;  1N76 A;  2E0S A;  1QW0 A;  3OMB A;  3QUJ A;  2XD2 A;  5H8F B;  1N84 A;  3M3K A;  2GH9 A;  4U1Z A;  4XKR A;  1T0K A;  5J1D A;  5H8N A;  2Q2A A;  1PB7 A;  3RGY A;  1URD A;  4YKP A;  1I6Q A;  4F39 A;  1US5 A;  1FTL A;  5AA3 A;  3KZG A;  4YMA A;  5DVF A;  4ZZE A;  1NH8 A;  3FVN A;  4DLD A;  4TLL B;  3O28 A;  4YIC A;  3PUY E;  5K2Y A;  3BFT A;  1FQC A;  1BP5 A;  1VFD A;  5TPA B;  2HFB A;  1MXV A;  4EQ9 A;  5DVJ A;  3K01 A;  3ILU B;  2C5I T;  3GBB A;  4YB5 A;  3H6W A;  1OLC A;  4DCX A;  3TDJ A;  5L8D A;  5DTB A;  3KFM A;  4LZ5 A;  3G3G A;  4XKQ A;  4ZEB A;  4EDP A;  3JZJ A;  4KCC A;  3KJ7 A;  1M5B A;  1N7W A;  4G4P A;  2PMS A;  3RPW A;  4DXB A;  1EZO A;  3K00 A;  5DEX A;  2Y7I A;  1D4N A;  5KDT A;  2R71 A;  4EF2 A;  1NNP A;  4FEB A;  1ZIU A;  2ANJ A;  4BLA A;  1BLF A;  3UOR A;  2UXA A;  4F19 A;  4F31 B;  3OOA A;  1MM7 A;  4HCY A;  4U4S A;  2QMX A;  4GLI A;  2V25 A;  1JEV A;  2RC9 A;  3H4Z A;  1B2H A;  3UN6 A;  3V83 A;  2I4C A;  5JTY A;  1YAE A;  1GGG A;  2I6E A;  4FIM A;  1Z0P A;  4C1U A;  2IA4 A;  3IOW A;  1P1W A;  2DXY A;  2GRV A;  2QS4 A;  3OSR A;  4BDL A;  1B4Z A;  4QFK A;  3SER A;  3G7W A;  1B3G A;  4ZEF A;  1OVT A;  3O6I A;  3RLF E;  2QL3 A;  1FQB A;  5CC2 A;  1B1X A;  1QKA A;  4H5G A;  1MXX A;  1O63 A;  3VLV A;  4RYA A;  3OD7 A;  2I48 A;  1B46 A;  2QPQ A;  1SW1 A;  2FYI A;  3QIM A;  3FJG A;  1B05 A;  2HXW A;  4R6H A;  3K6W A;  4TQU Q;  1I6A A;  4ND9 A;  3C32 A;  2NXO A;  4WKM A;  1MDQ A;  3RNN A;  1SBP A;  3SKP A;  1TXF A;  3THI A;  2OJT A;  3K4U A;  4U4X A;  5BUU A;  1AH5 A;  3IX1 A;  3AXF A;  3HV1 A;  2ESN A;  1A8E A;  2Q9T A;  2Z8E A;  3QXM A;  1BTJ A;  2OLB A;  1JET A;  1POY 1;  2ONR A;  5F7V A;  2DS9 A;  1QJM A;  3IB1 A;  1LB8 A;  2X26 A;  1ZLQ A;  1R9L A;  4I62 A;  1I6B A;  2I0C A;  2KWI B;  4XKP A;  4KPT A;  5I58 B;  4PP0 A;  1Z7N E;  4FI5 A;  2O51 A;  4FJP A;  1LVF A;  2A5S A;  3I3V A;  3LBS A;  1DMB A;  3U92 A;  4XIG Q;  1MPB A;  4NED A;  4IY5 A;  4EYY R;  1CB6 A;  1JVY A;  3E4R A;  4G8M A;  1IXC A;  1QUL A;  3A3C A;  2HAV A;  1B5J A;  2Q2C A;  3PUZ E;  4X1B A;  2XXY A;  5CRY A;  1PEB A;  4JDF A;  2CA5 A;  1MQG A;  3L6G A;  4MH5 A;  2Z23 A;  3MVW A;  3G3K A;  2AYS A;  4ELP A;  4OFL A;  1LCF A;  3K1M A;  1UTH A;  5L9M A;  5M2V A;  1Y3Q A;  1AIV A;  1FQF A;  1H7C A;  1WVJ A;  3CRB A;  1DOT A;  3ILT B;  4JWY A;  3TYH A;  2YLN A;  3K6V A;  4F1U A;  4K3F A;  3MXZ A;  3LSF B;  3SDF A;  4OMB A;  3EHU A;  4THI A;  3QK6 A;  3ZKL A;  1ZU0 A;  3FD3 A;  3Q27 A;  1Q1K A;  3KGC A;  5H8H A;  2V3U A;  1ZKB A;  2RKM A;  1M5D A;  2FA7 A;  5CMK A;  2XX8 A;  3G3J A;  5JEI A;  4IO4 A;  2QSX A;  2G29 A;  4PQJ A;  1HSJ A;  4F22 A;  3EHS A;  3T93 B;  1FQD A;  1B3F A;  2RCA A;  3K1P A;  2Z8D A;  3VVD A;  3M3F A;  3MPK A;  3MZ9 A;  5HBC A;  2AIX A;  1LAX A;  4KQP A;  5HPQ A;  2PX1 A;  4KYD A;  4NWD A;  1DTZ A;  2DYX A;  4EXK A;  3LSX A;  5H8Q B;  4H65 A;  2NVU B;  3T96 B;  3TPA A;  1B32 A;  4IO5 A;  2A5T B;  3H7M A;  3LR1 A;  3FIR A;  1URG A;  2LAO A;  3PMW A;  3PPN A;  3MQ9 A;  3U94 A;  1FCK A;  4CQI A;  3IO6 A;  2VP1 A;  3U93 A;  1AL3 A;  3Q29 A;  3IR1 A;  3SEV A;  1DPE A;  2W7Y A;  4OQO A;  4AB6 A;  1SDX A;  1ZJL A;  4LP2 B;  4U21 A;  1Y9U A;  4LQ2 A;  2RCB A;  4I1D A;  3N5L A;  3T66 A;  4QHQ A;  1Q35 A;  1QKB A;  3O2A A;  4LUB A;  4ZS9 A;  1FW0 A;  1MXY A;  1PDA A;  3R26 A;  3H6T A;  3IAZ A;  3H3G A;  2F7A A;  4KFQ A;  4DXU A;  4JBZ A;  2Y7W A;  4RY1 A;  1MG1 A;  3CFL A;  3MBP A;  3S4U A;  2YJP A;  3H06 B;  2F7B A;  3OO7 A;  3E13 X;  3FJM A;  4R6Y A;  5AA2 D;  1Y4C A;  4QSD A;  2XX7 A;  2UYE A;  4DE8 A;  3MVY A;  4NF4 A;  4YKJ A;  2DVC A;  3Q25 A;  3FUZ A;  1I69 A;  1XVX A;  3PMX A;  3OEK A;  1P1N A;  1EZ9 A;  2QS3 A;  1XT8 A;  1P1Q A;  1MY0 A;  3FXU A;  3MAM A;  2B3B A;  4WEP A;  5H8F A;  5KCJ B;  3KOS A;  5FHO A;  5ICT A;  4BDQ A;  3CSG A;  3TFL A;  3FV1 A;  1TFA A;  2O6A A;  3UP9 A;  4IGT A;  4RPN A;  4M1V A;  4H8I A;  4OXV A;  3R6U A;  3MPL A;  3K6X A;  5A5X B;  3W9V A;  4ESX A;  4ZED A;  4G2Z A;  1Y3P A;  1MQH A;  1R1N A;  3CKD A;  5BWJ A;  4NTL A;  2XXX A;  1A55 A;  2DWI A;  2I49 A;  1B5H A;  3TCH A;  5EYF A;  1RKM A;  2REG A;  5AA4 B;  1QUK A;  3TCF A;  2ZMB A;  5ISU A;  5CMM A;  1MPD A;  4N07 A;  3K02 A;  4NF8 B;  1XS5 A;  2I0B A;  1TFD A;  3TTK A;  3MP1 A;  2XX9 A;  3O6G A;  1HSL A;  4G68 B;  3JV9 A;  1VFE A;  4O3A A;  3N6T A;  2FNC A;  2DE4 A;  4MLV A;  4F3B A;  2ALU A;  3U72 A;  2H4I A;  3TQW A;  2HEU A;  1SQY A;  1SD3 A;  4F3P A;  4G68 C;  5I2K B;  3HPI A;  4PE5 B;  1MH3 A;  4U22 A;  3W9W A;  4OVJ A;  1A54 A;  3TKD A;  2O7I A;  2HQ0 A;  4EQB A;  1NFT A;  3W15 C;  1NNF A;  4L17 A;  1GTK A;  2ZYN A;  4ONY A;  4QFN A;  3JYR A;  2F36 A;  1B52 A;  2ZNU A;  4RK9 A;  1OLA A;  3DP4 A;  2DWJ A;  4OER A;  3TEP A;  3RTW B;  3KJT A;  3HCQ A;  1DPP A;  1TWY A;  4Z0I A;  2DQV A;  3CG1 A;  4PET A;  3MWB A;  3TOD A;  1ELJ A;  3IB0 A;  3CIJ A;  2KWH A;  2REJ A;  1IQ7 A;  2MBG A;  4H6D A;  3IO4 A;  5I57 A;  3Q26 A;  4GFR A;  5K2X A;  3T22 A;  1LBB A;  1O7T A;  2F6G A;  3TAJ A;  5AA2 B;  1H76 A;  1SVX B;  2F8D A;  4P11 A;  1FQE A;  5I2N B;  4ZE9 A;  4H1X A;  3C35 A;  1IIW A;  3N94 A;  4XXU A;  4LQ5 A;  3T9X B;  3PPQ A;  3IOV A;  3FVK A;  4GWO A;  2RC7 A;  1B3E A;  2RF1 A;  2ONK E;  3FAS A;  1XVY A;  5AA1 A;  5I84 A;  2UVG A;  1IJ6 A;  1R6Z A;  4Q8R A;  4DND A;  4