3S4UA

Crystal structure of open, unliganded e. coli phnd h157a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
302
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGAETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 95
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3s4uA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA02
5CMBA 2UYFA 2K48A 4QRZA 1JEVA 4DXCA 5IKBA 4KD5A 5FTIA 2Z8FA 4KHZE 3PMVA 4MLVA 4ECFA 5K2XA 4YMAA 3OO8A 2KLFA 5K2YA 1TWYA 1N3XA 1N84A 2OWTA 2RCBA 3TAJA 4POXA 3L6HA 2XXHA 1JEUA 1GGGA 4QSDA 4MBPA 4LVQA 2RF1A 2Q89A 1UTHA 1MY2A 4Q0CA 4N07A 2DWJA 4RXLA 3HPIA 4MLQA 4F39A 1SBPA 5DVJA 4EDPA 3LSXA 3T96B 4H8IA 2I0CA 2REJA 4J2CA 3PV0E 2UVHA 3I6VA 1FW0A 1MQGA 4IO5A 3IORA 5FHOA 3MQ9A 2P2AA 1MG1A 4NWCA 5A5XB 1B58A 1NNPA 1II5A 4GF8A 3OEMA 4U4SA 1ZBMA 3RNNA 3AXFA 2F6PA 3IX1A 4U22A 1XOCA 5CBRA 4GFRA 1QUIA 3SERA 3H7MA 2KWIB 4H5FA 4NWDA 3O28A 3VVEA 2ONKE 1PEBA 1PB9A 2RINA 3K4UA 4HS7A 4EUOA 3PPNA 2I4CA 2ABHA 4RY1A 1LAGE 4O3AA 2UXAA 4Q5TA 4F22A 1ANFA 3C35A 4GWOA 2OCUA 4R74A 5H8HA 5AA1A 4IO3A 3KOSA 2RC7A 1NNFA 4R2FA 3H6VA 5I58A 4HCYA 2AIXA 4JSOA 1AOVA 1HSLA 2CA5A 1AL3A 1Z0PA 4NF5A 4F2QA 1GR2A 3KG2A 5EHSA 4R6YA 2X26A 4OYVA 1WODA 3FJ7A 3K6UA 1SD3A 4H65A 1UTBB 4PFYA 5IAIA 1EH3A 3IK6B 4MFIA 1PDAA 4KR5A 1A8FA 1Y4TA 4C1UA 3R6UA 4FAJA 4Z7EA 2C5IT 2QS3A 2XXVA 3C9HA 3HHGA 4E0WA 4NF8B 3K6XA 1OQHA 3RTFB 3P7IA 4WEPA 1A8EA 4AB6A 2ALUA 1I69A 1D9VA 3RT8A 3RQTA 2ANJA 3RT6B 2XXTA 1CE2A 2F97A 3U72A 2QL3A 3TYHA 1PBQA 2QRYA 3K2DA 2ZNSA 4DXBA 3TZAA 1VR5A 3FUZA 3R26A 1QVSA 3USDA 3ONMA 5A5XA 3N5LA 2VHAA 4NF4A 4G68C 1A55A 2XXPA 1US5A 4YB6A 1R6ZA 4QHQA 1IZ1A 1YAEA 4F2OA 5L9OA 3VVDA 2Y84A 1GTKA 1XVXA 5KZTA 2OZZA 4OHNA 5DTBA 1D9YA 2DE2A 3EF7A 5CRYA 3G3JA 1B4ZA 1Y4CA 4X9TA 5AA2D 1LFGA 3N6TA 4KCDA 2P0SA 3Q26A 4YICA 3UORA 5I2KA 4OESA 3VDFA 3V89B 3L6GA 4FIMA 4G68B 5EYFA 2Q2CA 4LZ7A 4OFJA 1OVTA 1NH7A 3T93B 3C32A 4F1YA 3RTWB 4JB7A 2I0BA 1JW5A 1B7UA 2PT2A 4KFQA 5DEXB 4ZECA 1MPBA 3H6TA 4H8JA 3TTMA 2I49A 1JNFA 1USYH 1B40A 4GVOA 2ZYKA 3TTKA 2DWHA 2I48A 5M2VA 4LZ5A 2H98A 3GXAA 1XHYA 3KEIA 3LSLA 3FXQA 3S4UA 3Q25A 4PQJA 3SEXA 4R75A 4HTGA 3M8UA 4PP0A 1SW4A 1ELJA 4QFNA 1ZTYA 3PU5A 3B6QA 3CFZA 2HZKA 1N3WA 3VXBA 4PFTA 3SEWA 1URGA 3MP6A 1IJ5A 3HV1A 3KGCA 4LUBA 2YPNA 4KI0E 3U92A 4DCYA 1MDP1 3MW0A 4KYDA 2XXRA 3MZ1A 4P0GA 4RK2A 3KSXA 4ELPA 2G29A 1B2HA 4LA9A 4R6KA 4YB7A 4TLMB 1JETA 1LB8A 3O6HA 2FNCA 4R9FA 1FQBA 4F1UA 3TUSA 3PUVE 5DVIA 3MJNA 3JV9A 4KYEA 3VV5A 3JYRA 1UTHB 2VD2A 1FQCA 1B3EA 3Q29A 1SI1A 3K1MA 3FGSA 1PB7A 2G0UA 4GL8A 3IR1A 1BP5A 1IITA 3ZSFA 2HQ0A 3N94A 1SW1A 2I4BA 2ZYNA 4Z0IA 2H99A 1OQGA 3E3KA 3K1NA 1B3LA 4BDMA 2A5SA 2O1MA 2XX9A 3O2AA 1FCKA 4K3FA 3M3FA 4X1DA 1MQDA 2R6GE 1IEJA 2VD3A 2QMXA 3FVNA 1L5TA 3S2VA 2XXQA 1Q1KA 3FV2A 2DOJA 3S9NC 4Q8RA 4U2RA 2QPQA 3GZGA 3TQWA 5L9SA 5BWJA 2X9XA 4FATA 2XX7A 2AL5A 1P99A 3MP8A 4H1XA 3OOAA 4Q30B 4OFOA 3S9MC 1MXVA 1O64A 5H8HB 4GD5A 2NVUB 1LRZA 4OTEA 1FQDA 5I59B 2VGQA 2B3FA 4GOTA 4I8CA 4WKMA 5I58B 2PMSA 1DPPA 4G4PA 4QSCA 4JWYA 3PMWA 4TOZA 3TEPA 2XXXA 3B6WA 2AL4A 5HBCA 4U1OA 3VFJA 4EQ7A 3FVGA 4G8HA 4IY6A 2DS9A 2I6EA 4KPTA 3CG1A 4ZEBA 4IY5A 4F19A 1IIWA 4L17A 4YKKA 1LBBA 5CMMA 3ZKKA 1NMUA 4LP2B 1YPNA 2GHAA 3RY3A 4H6DA 2V3UA 5KDTA 1MPDA 5JK4A 2O6AA 1BIYA 1M5CA 4OETA 1LGBC 3TTRA 1MXXA 1B52A 2Y7PA 3TTNA 5ELVA 1MY3A 3MVWA 3OELA 2DWAA 1IXHA 4CQIA 3FXRA 4YMBA 5FHNA 4ISUA 2VOZA 4ZEFA 5H8FA 3N6UA 2Q2AA 1SYIA 3EHTA 2QSXA 2UYEA 2ZMBA 3U1OA 3RN8A 3EQ1A 4XXUA 1BTJA 2XXWA 4NF4B 4ZE9A 1S50A 1URSA 1MM7A 5FHMA 1B1XA 4U1ZA 3MBPA 5J1DA 3V5AA 5CI5A 2GHBA 4BDLA 3ODBA 4ZEDA 1B7ZA 1QKBA 5LOMA 3KOTA 2BJJX 2NWJA 1LCFA 1PBPA 3CFXA 3HCQA 1QULA 3TCHA 5I2KB 4E0XA 4L0RA 3QK6A 1B5IA 1MXWA 3CKDA 1ZMGA 3QUJA 1GV8A 1D4NA 4ZZEA 3KFMA 3TTLA 2Z8EA 2X7PA 4ZDMA 1MXZA 2I3WA 3SEVA 4MH5A 3MZBA 3QAXA 4I9DA 3HSTA 2XHDA 4JDFA 1US4A 3E9XA 5I2NB 1OLAA 4GXSB 3UP9A 3OEKA 5I59A 1SW5A 4XIGQ 3T9HB 3FIRA 4NTLA 3O29A 3CSBA 1VSOA 4FORA 1B51A 2NUVA 2E1SA 5ICTA 1TXFA 1MM6A 1JW4A 3W9VA 4M1VA 3QIMA 2I58A 4EF1A 2P1SA 2HAVA 2OWSA 4RA1A 4JWXA 2Z8DA 3OO9A 1IUDA 3ECRA 4ONYA 1B9JA 4OZ9A 2GRVA 2DVCA 5I56A 1URDA 3FV1A 3WAFA 1FTKA 3N26A 2NOOA 3A09A 3PD8A 1MH3A 1MDQA 1O63A 3IOUA 2FA7A 4XTCQ 4EXKA 4IO6A 4IO7A 4RNSA 4C0RA 2DVZA 1LFHA 4FEDA 2RKMA 4G8MA 2QS4A 5AE4A 4ZEIA 1OIBA 4EXLA 2CZLA 3DP8A 3TODA 3TKDA 1JVYA 4JWOA 3THIA 1B4HA 3IAZA 1ZLQA 4ZS9A 3MXZA 3PMXA 2D3IA 2H25A 4NE4A 5I84A 3OD7A 3F11A 3EN3A 3CR9A 3DELB 3LC8A 1I6QA 3MUQA 1Z7NE 3UIFA 1H45A 2WKYA 3IB2A 2B65A 1MS7A 4U4XA 1LAXA 4F3GA 3Q28A 2GFEA 1IQ7A 5KCJB 2HXWA 2C5JA 4O3CA 5I2NA 3U8QA 1IJ6A 1RYOA 4ND9A 1NL5A 3QXMA 1EU8A 2F36A 4IGRA 3SETA 1M5FA 2ZNTA 3T22A 3OO7A 1IXCA 4PETA 3TPAA 1YTVA 3TKLB 3PPOA 4OQOA 4F29A 3FVOA 3LSWA 4JSDA 1Y1ZA 2G93A 2O7IA 3D4GA 1DTGA 5BUUA 1MH4A 2AYSA 3C34A 2HEUA 4YKJA 4ESWA 3FJGA 4PFUA 2X9WA 4JXIA 4DXUA 4OEUA 2XXYA 4BDRA 1P1OA 4F3SA 1AH5A 1FQFA 3PD9A 5AA2B 2F35A 1SYHA 2QS1A 1MPCA 5CMCA 3DP6A 1M5BA 3IL1B 3V8XB 3MVZA 4YKIA 1J1NA 1N04A 3IB1A 3QYTA 4HCWA 4RK9A 2R9JA 2PYYA 5H8NA 2HFBA 2R71A 2PT1A 4WXJA 3T9UA 4DDDA 5KDTB 4H5GA 3C33A 2XD3A 4G2ZA 4THIA 5I57B 1QSDA 4R9GA 2O51A 3IO4A 1A54A 1S7YA 3VE1B 3VVFA 4ESXA 4LONB 2O7UA 3K6WA 1HSJA 4RYAA 4ZZAA 4KCCA 3K6VA 3FJMA 4F31B 5H8FB 2B3BA 1A99A 3L3PA 1B32A 1MY1A 4PE5B 1LBCA 1PB8A 3IOVA 3U94A 4C1TA 5HPQA 5KCJA 4IB2A 2THIA 1DSNA 1YCJA 1AMFA 3SEYA 1LAHE 4OERA 1D3KA 1NFTA 2ONRA 2V25A 1MY4A 1UQWA 4OFLA 2GH9A 1R9LA 2LAOA 1B0LA 2Y7RA 4EQBA 1JW1A 3LR1A 3HO7A 1JQFA 3KN7A 3PPQA 4NEDA 3O66A 2KWHA 1I6BA 1IXIA 1FTOA 3IO6A 4LATA 4WEDA 2Z23A 3UN6A 3CSGA 1SI0A 2F6GA 1SDXA 4RPNA 2CMOA 3LUYA 2ZXTA 4R73A 3KBRA 4QFOA 2M8CA 3PGFA 4QFLA 1EZOA 3HN0A 4GQOA 1H44A 4YZZA 1VFDA 1B6HA 3K00A 1EZPA 3PPPA 5H8SA 3W9WA 3BFUA 1LSTA 1MXYA 3KZGA 1BKAA 1FTMA 3C31A 2XXIA 5AA2A 3S9EA 3T9VA 3KJ7A 3CI8A 4GLIA 4F18A 3UA8A 3GBAA 1A40A 3SESA 2I3VA 3QSLA 2DP8A 2Z22A 4FEBA 4RPOA 1QUKA 3FXEB 3LBSA 4OWDA 5B7DA 2E0SA 4R6HA 1B1HA 2ZNUA 4NF6B 3GLBA 1TT1A 1IXGA 3ILTB 5DVFA 2XXUA 4QFKA 3TELA 3K01A 5I56B 1VE4A 4U23A 4YU0A 2UVIA 4XKRA 5I57A 3O6IA 1ZKBA 1VFEA 5ICQA 3PUZE 3O97A 1POY1 2ONSA 4P0IA 4DLDA 4ELRA 3H6UA 2DWIA 2DQVA 3HHFA 4AB5A 4TQUQ 2IA4A 2HAUA 5CC2A 2ZYOA 2RCAA 2F7AA 5TP9A 4JBZA 1JVXA 1TFAA 4UACA 2OBGA 4LQ2A 4H67A 1GVCA 2D5WA 2REGA 4IO4A 1DOTA 3G3FA 1P1WA 3CFLA 3FXUA 5CM6A 1NKXA 3ILUB 2O84X 3E4RA 1POTA 2O69A 2ESNA 2D21A 2F7CA 3EHUA 1SQYA 2O1LA 1DTZA 5TPAB 3KJTA 4QFPA 3RGYA 2XX8A 1SW2A 3WAEA 2V3QA 3Q27A 4KQPA 1Y9UA 2QJEA 2V93A 3SEUA 1N7WA 3FATA 4GIZA 1I6AA 3U93A 3PUXE 4YB5A 1F9BA 5H8QA 2F8DA 3G3HA 2UVGA 5DT6A 2H9BA 3OSQA 1MRPA 5ITPA 1A7LA 1LCTA 1O7TA 4ZEKA 3S9LC 1H43A 5HM4B 2DE4A 3SDFA 5AA4A 3VLVA 5TU0A 4YAHX 1FQAA 4FJPA 4G8NA 5AA3A 5F7VA 1R1NA 3TCFA 2PX1A 4LZ8A 3W15C 2DXRA 1KWHA 1B46A 3K1PA 3E13X 3ZKLA 1N76A 3KN8A 2YJPA 4OEVA 4BDQA 1H7CA 4AQ4A 4BLAA 3DP4A 3QUFA 3MZ9A 1R9QA 2IC9A 1ZJLA 4NF6A 3C4MA 3MP1A 1Q35A 3B7DA 4MF3A 1DMBA 3H4ZA 1CB6A 1UIUA 1M5EA 5ITOA 2XD2A 1ZU0A 2DSFA 2YLNA 3H03A 1OLCA 2UVJA 4N6PA 1Y3PA 3MC2A 3A3CA 2IC6A 3G7WA 3I3VA 3RPWA 2OK2A 4R2BA 3ZS6A 3VXCA 4B6XA 3H06B 5H8NB 3G3IA 4DE8A 1OVBA 3UGWA 2X7QA 5L8DA 4EF2A 2NXOA 3VLWA 4R72A 1T0KA 1P1QA 3VLUA 4F1VA 1H76A 1ATGA 3FD3A 3MPKA 1XC1A 2A5TB 4GRKA 3CIJA 2X9YA 2FYIA 3IB0A 5TPAA 4LQ5A 2Q9TA 3LSFB 3MWBA 4EYYR 4UA8A 1MQJA 4POWA 1UIVA 3BKIB 1WDNA 2QMWA 3K02A 1NNKA 2PVUA 4FI5A 1B7HA 1M5DA 5B70A 3OXNA 5FTHA 5ISUA 3IJOB 4X1BA 4QF9A 1USYE 1LAFE 1Y3QA 3CVGA 1RYXA 3H6WA 4PFWA 1EZ9A 2Q88A 3T66A 4XKQA 1LLSA 2V84A 4XKNA 4DZ1A 3BFTA 4M4GA 3O9PA 3TCGA 1LB9A 4GXAA 4O3BA 4I62A 1BLFA 1B0HA 2F78A 4RJZA 3G3GA 1B3FA 1TFDA 4DCXA 4ELQA 3CG3A 3TFLA 3DM0A 2O68A 3OSRA 3MPLA 3FASA 4QSEA 4EQ9A 2QS2A 4U21A 1P1NA 2RC9A 3PUWE 3C36A 1S9TA 1UTBA 3OMBA 1Y3NA 1B5JA 3SKPA 1XS5A 1AIVA 2IEEA 4F3BA 4DNDA 3FZVA 3EPEA 4BDNA 3IOWA 1NNTA 2F7BA 1LVFA 1MQHA 3RUMA 1H3DA 4F3PA 4NF8A 3KN3A 1B5HA 4IGTA 5CBSA 5JTYB 1QW0A 1RKMA 3B6TA 1PC3A 3TDJA 1B3HA 5JEIA 3CRBA 1Y20A 1MQIA 2Q8JA 3T9XB 3IJXB 1MXUA 1ZIUA 1B3GA 3CVRA 2A5TA 1XVYA 1QKAA 1DPEA 5F1QA 4ZE8A 3K0VA 3EHSA 1HSEA 5L9MA 5TP9B 3A3UA 3H3GA 3MVYA 2VP1A 1FQEA 1MY0A 3PUYE 2OLBA 1N7XA 1FTLA 4G77A 4GL0A 4OENA 4TLLB 3I5OA 1WVJA 5EHMA 3O6GA 2HZLA 3BBRA 1N0TA 4G68A 4KYSA 3DLNA 5DYHA 2H4IA 2F34A 3OENA 3TQLA 2C5KT 4YKPA 2Y7IA 3M3LA 4FECA 3PPRA 1SVXB 2Y7KA 3R7XA 4ELOA 2RC8A 5DEXA 2DE3A 1Z7ME 1B05A 1LFIA 3MVXA 1Y1MA 2W7YA 2F5XA 4NMYA 2DXYA 3G3KA 3TMGA 1ZKEA 2HCAA 1XT8A 4HW8A 4X48A 2DYXA 4H0WA 1OMPA 5H8QB 3MAMA 4N13A 4FE8A 2ZYMA 4BDOA 1P1UA 2H5YA 1NH8A 2XTLA 3OO6A 3V83A 4XKPA 4OVJA 5AA4B 4IO2A 5CMKA 2MBGA 3GBBA 4I1DA 3FXDB 3RLFE 3M3KA 3KSJA 3D4CA 1FTJA 2Y7WA 3JZJA 3FVKA 1QJMA 2V3TA 1QUJA 5JTYA 4OMBA 4NF5B 3UK4A 4DIGA 2OJTA 4P11A 4OXVA 2PBWA 3IOTA
chains in the Genus database with same CATH superfamily
5CMBA 3SWHA 4QXBB 2UYFA 2KNDA 2K48A 4QRZA 3CQCB 1JEVA 5ABHA 1IMBA 4DXCA 5IKBA 4GOUA 4KD5A 3FHNA 2BG9E 5FTIA 3MZKB 2Z8FA 4KHZE 5A1LA 3PMVA 2KMFA 3ZT6A 4MLVA 4ECFA 4G61A 5K2XA 4YMAA 3OO8A 2H7OA 2H3RA 4JVCA 4PJLA 2KLFA 4WBNE 5K2YA 2QRXA 1TWYA 1N3XA 1N84A 2OWTA 2RCBA 4ISSA 1XDOA 1YYZA 2IDOB 5AQTB 3MK7C 3TAJA 4H9OC 4POXA 3T0JA 3L6HA 2BG9A 3ZJ2A 3FZHB 1JEUA 2E9XA 2XXHA 1GGGA 2M6BA 1RDZA 4MBPA 4QSDA 5DW8A 3BQLA 2RF1A 4LVQA 2Q89A 1UTHA 4X1KE 1FRPA 1MY2A 4N78D 4Q0CA 5FYMA 4N07A 2DWJA 4RXLA 3VU7H 3HPIA 5JDFA 4MLQA 4F39A 1SBPA 5DVJA 5AQVB 3AXJB 4EDPA 1FPLA 3C50A 3LSXA 3T96B 4JEHB 4H8IA 2I0CA 2REJA 4P9KA 1W09A 2HPJA 4HKAA 4J2CA 2UVHA 2XQ3A 3PV0E 3I6VA 1FW0A 2SPCA 1MQGA 5ET8A 4IO5A 3IORA 3CWZB 5FHOA 1UX5A 4NUVA 3SFEA 3UUNA 5ADXL 3MQ9A 4DR7T 4IIJE 2P2AA 2BZBA 5AQKB 3OJAA 3A8YC 1MG1A 4NWCA 5A5XB 4XBFB 1B58A 1NNPA 5FXXA 3RYDA 1II5A 4GF8A 2CBJA 3OEMA 4IE5A 2Q9QD 2FIXA 3JAFA 4U4SA 3RGLA 4IDZA 1ZBMA 3RNNA 3LDQB 4Q25A 3AXFA 2F6PA 2XAJB 3IX1A 4U22A 1FMVA 3I9WA 1OWAA 4QX7B 1XOCA 3A29A 5CBRA 3RYIE 3AEFA 1E7PA 4GFRA 3Q5XA 5KXJA 3AVRA 3UUMA 1QUIA 3SERA 1WRDA 3H7MA 3T8OA 2KWIB 2LSIA 4H5FA 4NWDA 2V7LA 3O28A 3VVEA 4YFSA 4YT0A 2ONKE 1T7SA 1PEBA 4QWNB 4ZEYA 5IZ3A 4HWHA 1M62A 2P3VA 4DMVA 4X64T 1PB9A 4A56A 4UABA 2RINA 3K4UA 4X8RA 3MKDA 4HS7A 4OVSA 4EUOA 2I6HA 3PPNA 4EXTA 5FXZA 2PTFA 5LGTB 4YTPA 2W4XA 1NV0A 5AQJB 2I4CA 2ABHA 5FBPA 3TLVA 4RY1A 1XMOT 1LAGE 4O3AA 1IMDA 2OX3A 1KZ8A 3AAEB 2UXAA 4MFRA 4Q5TA 4F22A 1ANFA 4P1EA 3C35A 3MA9A 2ZZVA 4GWOA 2CLYC 2OCUA 4R74A 5AQNB 4O4IE 3PE0A 5H8HA 4F6RC 5AA1A 4P1LA 2LOSA 5FY1A 4DR6T 4IO3A 3KOSA 2RC7A 1BR4A 2VKJA 4CI2B 2XM1A 2VK9A 1NNFA 4MBQA 2KQZA 4R2FA 4OA4A 3H6VA 1FPJA 4UV8B 5I58A 4HCYA 1K9ZA 2AIXA 4JSOA 1AOVA 1HSLA 2CA5A 1AL3A 1Z0PA 5JQGE 4NF5A 4F2QA 2CXDA 1GR2A 4JI3T 3KG2A 5EHSA 4R6YA 4GWWA 1FSAA 2P3NA 2X26A 4OYVA 2LRLA 4BJNA 3HR0A 1WODA 3N9MA 5JTGA 3FJ7A 3O1HA 3K6UA 3WI3A 1SD3A 4YSXA 4H65A 2A9UA 1UTBB 4CN6A 4PFYA 4PFIA 3E22E 5IAIA 1EH3A 2LKHA 2FJEA 3IK6B 4MFIA 1PDAA 1HX1B 4KR5A 4JBWF 5ET5A 1A8FA 1HG5A 2VB6A 1Y4TA 1MIWA 4C1UA 3R6UA 4FAJA 2YU1A 2C5IT 4Z7EA 4Z91A 2QS3A 2XXVA 3C9HA 3HHGA 4E0WA 4NF8B 3K6XA 3NOHA 1OQHA 2LHNA 3RTFB 4N91A 3P7IA 3CQXC 4WEPA 1A8EA 2CRBA 4AB6A 1T72A 2WBBA 2WYKA 4QX8B 4OHFA 2ALUA 4X66T 1D9VA 1I69A 3RT8A 3RQTA 2W00A 2ANJA 4OVTA 3RT6B 4I50E 3IFCA 2DWGA 3ONXA 2XXTA 4U31A 4NX1A 1CE2A 3AXJA 3RHWA 3MACA 3AE1A 5LBMA 4QH1A 3KVBA 3PUWF 2F97A 3U72A 3M3ZB 2QL3A 1FBPA 4YJ2E 5L3DB 3NZPA 3TYHA 4GK0E 4MLKA 1PBQA 3RYFE 2QRYA 3C4XA 3K2DA 2HN2A 4PBHA 2P9BA 2CXLA 2ZNSA 4DXBA 3TZAA 3BIHA 1VR5A 3FUZA 3R26A 5HAXA 1QVSA 1YD8G 4H63V 3USDA 3ONMA 5A5XA 3N5LA 2VHAA 4NF4A 4G68C 3LFMA 1A55A 4LF7T 2XXPA 1US5A 1SUMB 2WX9A 4YB6A 2WZIA 1R6ZA 2Y5LA 4QHQA 1IZ1A 4PF8A 1YAEA 4F2OA 5L9OA 3VVDA 2Y84A 1GTKA 2IMLA 3GMIA 3QC9A 2EHOD 5H6RB 4CZZB 5J2UE 3O9XA 2Y5KA 3T1BA 1XVXA 5KZTA 2OZZA 4OHNA 4Z8XA 1D9YA 5DTBA 2DE2A 3PUSA 3EF7A 5CRYA 3AB3B 3G3JA 1B4ZA 4HWFA 1Y4CA 4X9TA 5AA2D 4QXCB 1LFGA 3N6TA 4KCDA 2P0SA 4CXXA 3Q26A 4YICA 3UORA 5I2KA 4M1PA 4PJJA 4OESA 3VDFA 5BMVE 2N9DA 3LK3B 1LBVA 3V89B 3L6GA 2WM9A 3FZFB 3P4SA 1UX4A 4FIMA 3ZPOA 3KV4A 2WAUA 2XWVA 4G68B 1MNDA 5EYFA 3Q9DA 3U78A 2Q2CA 4LZ7A 4OFJA 2BJIA 4QXDA 4MHCA 1Q9DA 5H6QB 4JI7T 4HGAA 1OVTA 3DTOA 1NH7A 1UURA 4IDOA 3T93B 3C32A 4F1YA 3RTWB 4GX6A 3ONLC 3RC8A 4JB7A 2I0BA 1JW5A 3C51A 3F57A 1B7UA 2PT2A 4KFQA 2FJDA 5DEXB 2NW7A 4ZECA 3PUAA 1MPBA 3H6TA 4H8JA 4UVAB 1RDYA 3TTMA 2I49A 5CFBA 1JNFA 1USYH 1B40A 4PFBA 3HKDE 3QMFA 1IBLT 5FL1A 3KV6A 4JI5T 4GVOA 2ZYKA 4I55E 1W0AA 4GX3A 1FPEA 3TTKA 4YHJA 3AEEA 2OWZA 2DWHA 2V8SV 3L39A 5CA0E 2WB5A 5FL0A 2I48A 4OVPA 5IHYA 4LZ5A 5M2VA 2XM2A 2H98A 3RPLB 4O7IA 3GXAA 3JCFA 1XHYA 3KEIA 3LSLA 3FXQA 4DI3D 2Z6EA 5J16A 3S4UA 1NENA 2LEHA 3Q25A 3UU5A 2XSBA 2K9AA 5CB4E 4PQJA 3SEXA 3N9OA 4EOZB 4R75A 4HTGA 4XEQA 5HWYA 4YXDA 4CI3B 3M8UA 4NAPA 2HHMA 4I40A 4PP0A 4DUZT 2UXXB 4PJMA 3ETVA 1L0VA 5LOVE 2V6YB 3U3IA 1SW4A 1T98A 1ELJA 4QFNA 4LMJA 2WDVA 1ZTYA 4GIWA 2BVLA 3PU5A 2UXBT 4N15A 1D0XA 5HEUA 3SS1A 3B6QA 5JDNA 3CFZA 2HZKA 1N3WA 3VXBA 4PFTA 3OTOT 2A2FX 3N2KE 1YXRA 3SEWA 4O8SA 2NTXA 4BAYB 3ZC0A 3AEDA 1URGA 2BDEA 2HHHT 3MP6A 1IJ5A 1ZOYA 3HV1A 3IEEA 2E2AA 4JI6T 3B50A 3KGCA 5LHGB 4LUBA 3H37A 2D5UA 2BG9C 2YPNA 4KI0E 3U92A 4DCYA 2E9XC 4AISA 1MDP1 3MW0A 5CA1E 4KYDA 2XXRA 3MZ1A 4P0GA 4RK2A 5HEGA 3CK6A 5LA6E 5BR8T 4H9NC 4JV5T 4JI8T 3KSXA 4IT4A 4ELPA 4CN1A 2G29A 1IMAA 5F3JA 1B2HA 4LA9A 5HCMA 4BA9A 4R6KA 5AQHB 4YB7A 4EIWA 4TLMB 1JETA 1LB8A 3O6HA 2HPGA 2FNCA 2E5VA 4KP3C 4R9FA 1E2AA 2X67A 2PFYA 1FQBA 2BKOA 1S35A 2MOZA 4F1UA 3TUSA 5KMGP 1HCIA 5J0ZA 4ZS2A 5JR9B 4QHOA 3PUVE 5DVIA 3MJNA 3HI2A 3JV9A 4KYEA 3VV5A 3JYRA 1UTHB 2VD2A 4JI0T 1FQCA 1U5PA 1B3EA 5LHIB 3Q29A 1SI1A 4NPPA 3RQWA 3AAIA 4HFBA 2XAGB 4X62T 3K1MA 3FGSA 1PB7A 4B3TT 2G0UA 1SHZC 3P8CD 5LBQB 3UU3A 2HN1A 4GL8A 5L3EB 3IR1A 4AKLA 3V5SA 1ZV4X 1BP5A 1IITA 3ZSFA 2HQ0A 4IL9A 4ZXLA 3N94A 4YJ3E 1SW1A 2I4BA 2ZYNA 5JREA 2DLRA 4Z0IA 4KHZF 2BS3A 2H99A 4HFIA 1NV5A 1OQGA 5AFUL 2CZIA 3E3KA 3K1NA 3LK2B 1B3LA 4IHJE 4P0BA 4AS5A 4BDMA 2WQYA 5FP3A 2A5SA 2WS3A 2O1MA 2QVRA 2XX9A 3O2AA 3EVYA 1FCKA 4K3FA 1YKEB 3M3FA 4X1DA 1MQDA 2R6GE 4ZI3C 3T1HT 1IEJA 2VD3A 2KR0A 3ROJA 2QMXA 3FVNA 1L5TA 2ODVA 3S2VA 3EHZA 2XXQA 2H7VC 1OEDB 1Q1KA 4MEVA 3CHGA 4MAGA 3FV2A 3IBPA 2DOJA 3SFDA 2PFZA 5IZ3B 3S9NC 4Q8RA 4U2RA 2QPQA 3GZGA 3TQWA 3RPLA 2ZMAA 5L9SA 5BWJA 1W9RA 3PV0F 4DV2T 3ZLIA 4U72A 2X9XA 1N33T 4FATA 2XX7A 4CI1B 2AL5A 3ZN0B 1P99A 2NWBA 3MP8A 4H1XA 3OOAA 2ES0A 4TX5A 4Q30B 1K9YA 4O7MA 1HS7A 1EYJA 4OFOA 2LKGA 5EQ9A 3S9MC 1FMWA 1MXVA 3WAKA 1FPIA 2V6YA 4GKJT 4B3ST 2V7JA 2UUBT 3LG7A 2YDRA 4LF4T 1O64A 5H8HB 4GD5A 4AI6A 1LRZA 4OTEA 2NTYA 2NVUB 1FQDA 5I59B 4JVIA 2VGQA 2B3FA 4GOTA 3B57A 4DV5T 4I0UA 5T3JA 4I8CA 2B4MA 4WKMA 5I58B 2PMSA 1DPPA 4PAKA 4G4PA 4QSCA 4CXWA 2XQ9A 1ZHCA 4JWYA 1FPFA 5LHHB 2ZM2A 4G2AA 4U7YA 3PMWA 3EUHA 4TOZA 3TEPA 2XXXA 3B6WA 3UTKA 2AL4A 3FZMB 4LN5A 3PU8A 4EV6A 4GKKT 1FJGT 5HXRA 5HBCA 4U1OA 3VFJA 4EQ7A 3VKGA 1NV1A 3FVGA 4DBQA 4G8HA 4IY6A 2DS9A 2I6EA 4KPTA 3CG1A 4ZEBA 1XWMA 4IY5A 4F19A 2AE9A 3AA1B 2OA5A 1IIWA 4L17A 5HEOA 5L4EA 3MJXA 4NG7A 4YKKA 1LBBA 5CMMA 3ZKKA 1NMUA 2CWYA 4LP2B 2JMKA 1YPNA 1UK5A 1AJ3A 2GHAA 3RY3A 3DP7A 2ZZXA 4H6DA 2V3UA 3E79A 1MPDA 5KDTA 5JK4A 2O6AA 2XQ4A 2W66A 4UELA 1BIYA 4EZ4A 1M5CA 4OETA 1LGBC 3TTRA 5JR9A 2AXDS 5LTCA 3U65A 1MXXA 1B52A 2Y7PA 3TTNA 5ELVA 1MY3A 3MVWA 3OELA 2DWAA 2CEYA 1XNQT 1IXHA 3PTYA 4CQIA 3AE3A 3FXRA 4YMBA 1VCTA 5FHNA 1NEKA 4ISUA 2QFLA 2XASB 3ZMVB 5HWXA 2YU2A 1E1HB 1EZ3A 2VOZA 4ZEFA 4HWIB 2WDRA 5H8FA 5F5WA 3N6UA 2Q2AA 4TV9E 1SYIA 3EHTA 1FPGA 2V7KA 3OPCA 2QSXA 1LVKA 2UYEA 2ZMBA 3U1OA 2JJ9A 3RN8A 1OEDE 3EQ1A 3KBZA 4PCDA 3ESLA 3TLWA 4XXUA 1BTJA 3AECA 4ZI2C 4DV6T 2XXWA 4A5XA 2K24A 4L9IA 4NF4B 2H89A 1FBHA 4ZE9A 1S50A 1URSA 1MMDA 1MM7A 5FHMA 1B1XA 4U1ZA 3MBPA 5J1DA 4NHBA 3V5AA 4ANJA 1FBGA 4P09A 4DV1T 2NW9A 5CI5A 2GHBA 1MMAA 1X79A 3ODBA 4BDLA 4ZEDA 1B7ZA 1QKBA 5LOMA 4N8GA 3KOTA 2BJJX 2NWJA 1LCFA 1FTAA 4GX4A 1PBPA 1OEDA 3ETUA 3CFXA 3HCQA 1QULA 2BVMA 5LMNT 1RDXA 5I2KB 3TCHA 1BK4A 4E0XA 4L0RA 3QK6A 1YQ4A 1B5IA 1MXWA 3CQGB 3CKDA 5L47A 1ZMGA 3F2EA 4OVRA 2VWAA 4DR3T 3QUJA 4BJMA 1D4NA 1GV8A 4ZZEA 3KFMA 3TTLA 1UGOA 4MNPA 2Z8EA 2CM0A 3R84B 2X7PA 4ZDMA 4HFCA 4HFEA 1MXZA 4JI1T 2K3WA 2CCQA 2I3WA 3SEVA 4MH5A 3MZBA 3QAXA 2W61A 1HFAA 4I9DA 3HSTA 2XHDA 4JDFA 2BS4A 1N32T 3UUXB 5HXEA 1US4A 1KNZA 3E9XA 5I2NB 1D0YA 1UCUA 2CE7A 2RP4A 1KNRA 1OLAA 4GXSB 3RI5A 3UP9A 3V5UA 3OEKA 2JIWA 5A5LA 3HKBE 4I3YA 2CXFA 1WYCA 5I59A 4EGWA 1SW5A 2CHOA 4XIGQ 3P4WA 3T9HB 3FIRA 4HN9A 4NTLA 3O29A 3CSBA 4OVQA 1VSOA 4AXPA 3IF8B 4FORA 1B51A 4U2ZA 2H88A 2NUVA 1MMGA 2E1SA 5ICTA 1TXFA 5ET7A 1MM6A 2WBLA 4A97A 2Q8MA 4COFA 1JW4A 5JDMA 3W9VA 3CX6B 3LBXA 3FB2A 3BQKA 5HEHA 4M1VA 2N1GA 3QIMA 1NI9A 3VKHA 4UVCB 2I58A 2VVNA 4IDNA 4EF1A 3A5XA 1O3XA 1SPIA 2P1SA 2IHR1 1LBXA 3H3AA 2HAVA 2OWSA 4RA1A 4JWXA 5EK3A 1NUZA 1Y01A 4UEMA 2Z8DA 3OO9A 2D0UA 1WYBA 4HWDA 4MJOA 4GWZA 2ZM8A 2B4LA 4PK4A 2UU9T 1IUDA 4LF6T 3ECRA 4X04A 5FXVA 2Q9QB 4ONYA 3JAEA 1B9JA 5I3SA 4OZ9A 2GRVA 2FJBA 2DVCA 5I56A 4ASKA 1URDA 1G8XA 3FV1A 4HE0A 2MPKA 4GWXA 3WAFA 1FTKA 4ZHQE 2NOOA 3A09A 3N26A 4DV7T 3PD8A 3W15B 1MH3A 5I7IA 3AEAA 5F8PA 2FJAA 1MDQA 2WU5A 1O63A 3IOUA 2IIUA 1KFYA 2FA7A 3FBLA 3AA6B 4XTCQ 4EXKA 4ERRA 1N34T 4IO6A 4LF8T 4IO7A 1BR0A 3B8BA 4RNSA 4C0RA 2DVZA 1OXZA 5JDGA 3GWHA 1LFHA 2DDKA 4FEDA 1BR2A 1D9QA 2RKMA 4G8MA 2QS4A 1I94T 4NXNT 5AE4A 5M4YA 3RF1A 4ZEIA 1OIBA 4EXLA 2CZLA 3C98B 3DP8A 1S94A 3TODA 4DI4B 3TKDA 1JVYA 2F3BA 4JWOA 3THIA 4H45A 3Q5EA 3O1JA 1B4HA 3HFUA 4DMWA 4IE6A 3IAZA 5AQMB 5IGAA 2X0LB 1XZYA 3AA0B 3VR8A 1IMEA 2WMOA 1VRBA 4GYSA 3P50A 2CHNA 3KC1A 5C3JA 2XY8B 1FPDA 1ZLQA 4ZS9A 4TNWA 3MXZA 2YDQA 2WMNA 2XQ6A 2XSAA 3ZEFB 2XWIA 4C91A 2WWUA 5AQFB 3PMXA 4EEBA 2D3IA 3JADA 4KI0F 5LG3A 5LYJE 1KA1A 2H25A 2UUCT 4NE4A 3OD7A 5LP6E 5I84A 3F11A 3EN3A 3CR9A 3P4QA 3DELB 4AKGA 3ZYKA 1I6QA 3LC8A 3MUQA 5KDMC 1IBKT 1QGXA 3KFWX 1Z7NE 3UIFA 1H45A 2WKYA 1JNRA 3IB2A 2B65A 4X65T 1YKHB 1MS7A 4IE0A 4U4XA 1LAXA 4GYRA 4F3GA 4OK0A 2DNXA 2XQYA 3Q28A 2GFEA 1IQ7A 1NUYA 3AVSA 5LMUT 4P1NA 4O94A 5KCJB 2DCFA 4P56A 5LDZA 4PAFA 2MYSA 1IAPA 4UF0A 2HXWA 2C5JA 4P8BA 4O3CA 5I2NA 3N9PA 2V6XA 2LM9A 3U8QA 1IJ6A 2K5BB 5FKYA 1RYOA 2LHRA 4ND9A 1KF6A 2ODUA 5C8YE 1NL5A 1EU8A 3BIGA 3QXMA 4FJOA 3PUVF 2F36A 4IGRA 3SETA 1M5FA 3PTRB 5IUXA 4N6KA 1XNRT 2ZNTA 3OO7A 2HXRA 3T22A 1IXCA 5J1GA 4PETA 3TPAA 1YTVA 3TLSA 5ABFA 3HKEE 3TKLB 4EYUA 3VRAA 3PUQA 4MX6A 3PPOA 3KV5A 2JQKA 4OQOA 3RQUA 4H63H 4F29A 4GK5E 3CPZA 1M7KA 3FVOA 2E9XD 2XA5A 3HKCE 3LSWA 4JSDA 1Y1ZA 4WNKA 2G93A 4PGNA 1D0ZA 3K8PC 2XQAA 2O7IA 4JI2T 3UU4A 2XWKA 2Y8DA 2V7IA 5AQGB 4DVDA 4LF5T 2VPNA 3Q2MA 3D4GA 5ABEA 4MNCA 1DTGA 5BUUA 2D9DA 2LSGA 1INPA 4PE3A 2VL8A 1MH4A 2L5VA 4NXMT 2Q9QA 2AYSA 1FPBA 3C34A 2R6GF 2HEUA 4K0KT 2W0GA 2XJ7A 4YKJA 4ESWA 4TZ4C 5AQPB 1LKXA 4LFAT 3FJGA 3LK42 4PFUA 2X9WA 2EHOB 4JXIA 5HXCA 4DXUA 1JNZA 3QNUA 4OEUA 2XXYA 4BDRA 1P1OA 4LMKA 2M6IA 5ESYA 4F3SA 2MTQA 3AEBA 3C4WA 1AH5A 3K3QC 1FQFA 3PD9A 5AA2B 2F35A 5JR9C 1WR0A 1SYHA 2XHEB 2QS1A 1MPCA 4ZOLE 5CMCA 2VL0A 2N2NA 5FNVE 3DP6A 1M5BA 4KXPA 2D2SA 3IL1B 3FZLB 2XZEA 2WCAA 3V8XB 4PAIA 3MVZA 4MIJA 4YKIA 1J1NA 3ZN1B 1N04A 3IB1A 3QYTA 4HCWA 4RK9A 2L8KA 2R9JA 2A3DA 2RA1A 3VHLA 2JRKA 2FVZA 2PYYA 4MNIA 4ZS3A 2HFBA 2JQHA 5H8NA 1HNWT 2R71A 2ZM0A 2PT1A 1QLBA 4YHHT 4WXJA 2BKNA 5EZYE 3UQ4A 3T9UA 4DDDA 4AQFA 5KDTB 4H5GA 3N2OA 2XD3A 3C33A 2V1DB 4E7ZA 2VKHA 4LFCT 4G2ZA 4AQYT 4THIA 2LJLA 5I57B 1QSDA 4R9GA 2O51A 3IO4A 1A54A 4O8MA 4ZI3D 4I43B 1S7YA 3VE1B 2UXNB 3VVFA 4ESXA 4LONB 2O7UA 4X1YE 4IREA 4O2BE 5L3FB 2JPFA 4ZZBA 3QOFA 1CUNA 2UXCT 2IW5B 3J7Yq 1HSJA 3K6WA 4RYAA 4ZZAA 2FHYA 2WDQA 5FVKA 1IZNB 3D1RA 4KCCA 3K6VA 1OEDC 3FJMA 4F31B 3KBUA 5H8FB 4ILBA 1FIOA 2B3BA 1A99A 1MIYA 3L3PA 3AAAB 3AE2A 3DJBA 1B32A 5FMNA 1FBEA 1MY1A 4PE5B 1LBCA 1PB8A 1KK7A 3IOVA 2IUBA 3U94A 4K0UA 4C1TA 5HPQA 2ACXA 5KCJA 5JH7E 3AE5A 4IB2A 1Y64B 2THIA 5AQUB 1DSNA 1YCJA 1AMFA 3RRCA 3SEYA 4EAHA 4DR4T 1LAHE 2JQ9A 4OERA 5JRCB 3EKIA 1D3KA 3ISPA 1NFTA 4HFDA 2ONRA 2X66A 2V25A 3B5MA 1MY4A 1UQWA 5JDHA 2WYPA 3UFGA 4NGUA 5DQWA 2ZM6T 2QYWA 4OFLA 3QB5A 2CEXA 5AQRB 2GH9A 3N2GE 4PNIA 4X20E 1R9LA 4ILAA 3P4PA 2LAOA 5EQAA 1XI6A 4G63A 1B0LA 4EB6E 2Y7RA 4EQBA 1JW1A 4HE2A 3LR1A 3HO7A 3RRWA 1JQFA 4PW8A 3KN7A 2A72A 2NR4A 3PPQA 4NEDA 3O66A 4PDHA 4IGUA 2KWHA 1I6BA 1IXIA 1FTOA 4PFOA 3IO6A 4LATA 3NKZA 3TLUA 4WEDA 3RPUA 2Z23A 3UN6A 3CSGA 5LGNB 4H9SE 1SI0A 2F6GA 1SDXA 4RPNA 4GWUA 2CMOA 3LUYA 2ZXTA 3T1YT 4E7SA 4R73A 3KBRA 4JVDA 5IM2A 3AE6A 1EYKA 4QFOA 2M8CA 2YKSA 3PGFA 4QFLA 5AQQB 4AKIA 1XMQT 2W67A 3HN0A 1EZOA 4V1Av 5CJ5A 4GQOA 2VKOA 1H44A 5IYZE 4X1IE 4YZZA 2KXPB 5L3GB 2VURA 2EHOA 1B6HA 1VFDA 3K00A 3GA8A 1U4QA 4OYKA 1EZPA 3PPPA 5H8SA 3W9WA 3BFUA 1LSTA 4ILCA 1MXYA 3KZGA 4JLEA 4TWFA 4AQGA 1BKAA 1FTMA 1LBZA 1KNPA 3G06A 2XXIA 3C31A 4OANA 5AA2A 3S9EA 3KJ7A 3T9VA 4UXNB 3CI8A 3LBXB 4GLIA 4F18A 4MALA 3UA8A 3GBAA 2X0YA 3UQ7A 1NV6A 2DI4A 2FBPA 1A40A 1G73A 3SESA 1D1AA 4IE7A 2I3VA 3RYHE 4H9QC 3K3OA 3QB5K 3PJAA 4PFPA 3QSLA 2DP8A 2QVUA 2Z22A 3OYZA 5LB7B 4FEBA 3PURA 4TWDA 4N81A 1HNZT 4RPOA 1YXIA 1QUKA 2LE8A 3FXEB 3LBSA 4OWDA 1FBCA 5B7DA 4X5TA 2BBHA 3LSVA 2E0SA 2WWVA 1B1HA 2X9HA 2ZNUA 4NF6B 4R6HA 3GLBA 2V5DA 4H9PC 1TT1A 1IXGA 3ILTB 5DVFA 2XXUA 4QFKA 3TELA 4ZI2D 5J2TE 3K01A 5I56B 1R8IA 3AE4A 1VE4A 4KMCA 2VQFT 5LGUB 4U23A 4YU0A 2W63A 2UVIA 4N4UA 5LJNA 4XKRA 4P0AA 5I57A 3RIFA 3O6IA 1ZKBA 4ZI7E 2V4CA 1VFEA 5ICQA 3L09A 3PUZE 3RC3A 5FY0A 5DJQC 3O97A 1NUWA 1POY1 2V7MA 4NIQA 2ONSA 2LOPA 3ZSSA 3UU8A 3PDYA 4HFVA 2J47A 2PCRA 4P0IA 4DLDA 1QUUA 4ELRA 3RKOA 1FJ9A 3H6UA 3KVAA 2DWIA 2DQVA 5GONE 3HHFA 3JC6C 4AB5A 1WR6A 3VR9A 4JUYA 4TQUQ 3NZQA 2WZHA 2IA4A 1NV3A 2HAUA 5CC2A 2ZYOA 3OBVE 3IFAA 1YQ3A 3FZKB 2RCAA 2F7AA 5TP9A 2QGSA 2YK0A 4JBZA 4KX6A 1JVXA 1DCUA 4DV0T 1TFAA 2Q74A 3N9LA 5HXSA 2YEVC 2E8IA 4UACA 2LT3A 4LFBT 2CZHA 4GBWA 2OBGA 3X1DA 4LQ2A 3ONJA 4PAGA 2D5WA 4H67A 2REGA 1GVCA 3LJCA 3RIAA 3B13A 4IO4A 1DOTA 4XZCA 3WAJA 4UV9B 2VPOA 3G3FA 3IA3A 5JRCA 2W2UA 3EABA 1P1WA 3CFLA 3FXUA 5CM6A 4U7IA 3J9X1 1NKXA 3ILUB 2O84X 2BS2A 3AEGA 1POTA 3E4RA 2O69A 4ADZA 5LNKA 3C64A 2D21A 2ESNA 5IZZA 4C90A 2F7CA 3EHUA 1SQYA 2O1LA 2HH7A 4NQ8A 1DTZA 3ZMUB 1AWBA 5TPAB 1MIVA 3KJTA 2LSKA 3AE8A 5L3BB 4QFPA 3RGYA 2XX8A 4YTMA 5LXTE 1V9DA 1SW2A 3WAEA 3UULA 2V3QA 3Q27A 2ZZWA 4PK5A 3RIUA 4KQPA 5ABGA 1Y9UA 4GWYA 2QJEA 5HEJA 2C0SA 3PJAJ 2KSRA 2V93A 3SEUA 2W62A 4YSYA 1VCSA 1N7WA 4OYJA 3FATA 1I6ZA 4ILUA 3EAMA 4TUYE 3O4XE 4GIZA 5ET6A 1I6AA 4YTNA 5KX5E 3U93A 2CEAA 3PUXE 4UF0B 2PFVA 4YB5A 4HWCA 4TNVA 1F9BA 5H8QA 2F8DA 4AS4A 3G3HA 2VKDA 2UVGA 4KBMB 5DT6A 2H9BA 3OSQA 3ANWB 1XDPA 1MRPA 4DR5T 5ITPA 1A7LA 1LCTA 1O7TA 1X9BA 1FEWA 4ZEKA 2Q9QC 1Z8UA 3S9LC 1H43A 5HM4B 1T8BA 2VASA 2DE4A 5TAOA 3SDFA 5AA4A 3VLVA 5TU0A 5ABFB 4U2YA 5L4HA 1FQAA 2XXKA 4YAHX 4FJPA 4G8NA 5AA3A 4PTKA 3SRZA 5F7VA 1US7B 1R1NA 3TCFA 2PX1A 4HE8A 1DBZA 4LZ8A 4XAXB 3W15C 2DXRA 3AE9A 4DR2T 1KWHA 1B46A 1LBWA 3E13X 3K1PA 5EQ8A 3SZPA 3ZKLA 1N76A 5EYGA 3KN8A 2YJPA 2XUEA 5FY7A 4OEVA 4BDQA 3UU6A 3ZJ1A 1H7CA 4AQ4A 4BLAA 4GBVA 3DP4A 1FJ6A 5F24A 3UT5E 3QUFA 4JYAT 1FBDA 2L9QA 2XAHB 3MZ9A 4KHPT 1R9QA 3KV9A 2DL1A 2IC9A 1ZJLA 1NAFA 5DQVA 4NF6A 2X0HA 3C4MA 3MP1A 1Q35A 1UUSA 3B7DA 1NV2A 2F3DA 1LEVA 4MF3A 1DMBA 3H4ZA 1CB6A 2CLYB 3E08A 4CXYA 1UIUA 2UXDT 1M5EA 3ABVA 5ETWA 2HPLA 1VDWA 5ITOA 2XD2A 1ZU0A 3NBXX 4AQFC 4I4TE 3BQIA 2RPAA 1D1BA 2DSFA 4YLHA 4O4LE 2YLNA 2PBIA 2GQ1A 3M65A 4N6DA 3H03A 1OLCA 2UVJA 4N6PA 1Y3PA 3MC2A 2CZKA 2Y6XA 2IC6A 3PUGA 3A3CA 2L3LA 3G7WA 3I3VA 3RPWA 5IWAT 2OK2A 3LUZA 4R2BA 1MMNA 3ZS6A 4GWSA 3VXCA 5EK2A 4LF9T 4B6XA 3H06B 5HXHA 3PU3A 2X68A 1YW0A 2NOXA 4N17A 5H8NB 3G3IA 4DE8A 1OVBA 3P4RA 3UGWA 2X7QA 5L8DA 1NV4A 4EF2A 2NXOA 3VLWA 4R72A 3I0QA 2YOEA 1T0KA 3N9NA 1P1QA 3VLUA 4F1VA 4YY3T 1H76A 1ATGA 3EDUA 3FD3A 3MPKA 4HE1A 1XC1A 2WY2A 4LMLA 4QH4A 3UFEA 2A5TB 4GRKA 4PF6A 2V5CA 3N9QA 3CIJA 5L2LA 2X9YA 2BBJA 2FYIA 4AKRB 2X51A 3IB0A 5TPAA 4LQ5A 3H3MA 4XFEA 4ZZCA 2Q9TA 3R6NA 1NWMX 3NWIA 2VQET 2LSJA 3LSFB 2KLQA 3MWBA 2V26A 4EYYR 4UA8A 3ZCJA 1MQJA 2WP9A 1SA0E 2JQQA 1KEYA 4POWA 5LJMA 1UIVA 3EDVA 3BKIB 2ACZA 2QA7A 1FBFA 4ISTA 3CMLA 1WDNA 2QMWA 3K02A 5HYAA 1NNKA 2PVUA 1BR1A 4FI5A 2KT9A 3ZMZB 2B1EA 1B7HA 1CHUA 2KINB 2OLTA 1M5DA 5B70A 3OXNA 1HNXT 5FTHA 5ISUA 3IJOB 4EEDA 4QF9A 4X1BA 5EYHA 3ZT7A 1USYE 3E78A 2DWKA 3ANWA 5C2TA 3NRYA 4EZHA 4Z90A 2MAWA 1LAFE 1Y3QA 3CVGA 1RYXA 3H6WA 4PFWA 1EZ9A 2Q88A 3T66A 2I0MA 4XKQA 3ZCIA 1LLSA 2V84A 4P3LA 4PGPA 4F8HA 4XKNA 3BK9A 4DBRA 4DZ1A 2B76A 3BFTA 4M4GA 3O9PA 3TCGA 4OFZA 4WBOA 2EHOC 4KUMB 1LB9A 4IR8A 2XAQB 2YN6A 4GXAA 5CGMA 4I62A 4O3BA 1W0BA 1BLFA 4TN7B 1IMFA 2FBWA 1B0HA 2F78A 4N8YA 4RJZA 3D0TA 2CPTA 3NVOA 2WEFA 3G3GA 1MNEA 4WZXA 1B3FA 1TFDA 4UIGA 3ZYMA 2J4GA 2LSYA 4DCXA 3CG3A 4ELQA 1HF8A 3TFLA 2DHRA 1J5ET 3PUYF 5AQLB 3DM0A 2O68A 1J1JA 2J1DG 3OSRA 3MPLA 3FASA 4PDDA 1ZEEA 4QSEA 4U33A 4EQ9A 4WYVA 2QS2A 4U21A 3CX8B 4B3RT 1P1NA 2XQ7A 2XQ8A 1WCRA 2RC9A 3PUWE 3C36A 1S9TA 1UTBA 2VT5A 1Y3NA 3MSTA 3OMBA 1B5JA 3AA7B 1JP4A 3SKPA 5EK4A 2GK9A 1WFDA 1XS5A 1AIVA 2J62A 1HR0T 1G0HA 4HFHA 2VVSA 4MCOA 1HTJF 5E0OA 4TV8E 2IEEA 4F3BA 3FBZA 4DNDA 4FBPA 4XF5A 3FZVA 3EPEA 4BDNA 3IOWA 1NNTA 2WBDA 4B3MT 2F7BA 1LVFA 1MQHA 5IZ1A 3KINB 3RUMA 2LM2A 3VRBA 3HL6A 1H3DA 4F3PA 4NF8A 4L5GA 3KN3A 4HXVA 3O1IA 5AQSB 1B5HA 4IGTA 5CBSA 5JTYB 3GN5B 1QW0A 1RKMA 5JDLA 4QXHB 3B6TA 1PC3A 1FPKA 1HX8A 5LCYA 2QVVA 3TDJA 1B3HA 5JEIA 2YINA 3A7MA 3HA4A 5L3CB 3CRBA 1SE7A 1Y20A 3I9YA 3E0ZA 1MQIA 1LBYA 2Q8JA 4HEAA 3T9XB 3KBTA 3IJXB 1MXUA 1ZIUA 2LRKA 4HTEA 1DK4A 3ZMSB 2R8TA 4IE4A 1B3GA 2OV9A 2WU2A 3CVRA 4IDQA 5JDQA 2LLYA 2A5TA 3ZKRA 3RLFF 1EYIA 4P47A 3ZYLA 4U74A 4MHFA 3K3NA 1XVYA 3ZSTA 3CX7B 3Q5DA 2XWOA 1NV7A 1QKAA 1DPEA 5F1QA 4ZE8A 2BG9B 2WSSV 4YSZA 2E9XB 3K0VA 3EHSA 5EQ7A 4I3EA 3RYCE 1HSEA 5L9MA 4H9RC 3FBPA 1IBMT 5TP9B 3RKGA 2JJKA 3IHRA 2MKZA 3A3UA 3H3GA 3RIUC 3MVYA 2VP1A 1FQEA 2PG8A 1MY0A 2FUPA 4PJNA 3PUYE 3CIRA 1ZP0A 2OLBA 1N7XA 1FTLA 4DIDB 4G77A 4GL0A 4QH5A 4OENA 5JVDE 4TLLB 3I5OA 3RH3A 1WVJA 5EHMA 3O6GA 1YZ0A 3RX6A 3UUBA 4U3CA 2HZLA 4QBAA 3Q5WA 3BBRA 1N0TA 4G68A 3F31A 4DUYT 3ZT5A 4KYSA 3EI0A 3PUZF 3DLNA 5DYHA 2H4IA 2F34A 3OENA 2XAFB 1D1CA 3TQLA 2C5KT 2PJQA 4YKPA 2Y7IA 3M3LA 4FECA 4PC9A 4NF0A 1VOMA 3PPRA 1SVXB 4IL4A 4QKNA 2Y7KA 3R7XA 4ELOA 5FXWA 2XPKA 3ZC1A 5AQIB 3OVUA 2RC8A 2ZLYA 3KC0A 5DEXA 2M67A 3SOLA 2YDSA 2DE3A 1Z7ME 1B05A 1LFIA 3MVXA 1CNQA 1KA0A 1Y1MA 2W7YA 4JI4T 2F5XA 4NMYA 3OKQA 2DXYA 3G3KA 2UUAT 4DR1T 3AE7A 1ZKEA 3TMGA 4PBQA 4PK6A 4TWHA 3GYYA 3TLTA 2HCAA 1XT8A 4HW8A 5AQOB 2BKPA 4CN4A 4X48A 4O2AE 2DYXA 4H0WA 1G0IA 1OMPA 4A98A 2FIEA 1N36T 5H8QB 4DO0A 2CMRA 3MAMA 4N13A 5DABA 2CWOA 2CBIA 3K1SA 4FE8A 4DV3T 2ZYMA 3I0OA 1IMCA 4AIUA 3KDSE 4OX9T 4BDOA 1P1UA 3FXBA 2NW8A 2H5YA 2F4VT 4IDPA 1NH8A 2XTLA 3OO6A 3V83A 4XKPA 4OVJA 1GQEA 5FVLA 3ZMTB 5AA4B 1J5WA 4IO2A 4UVBB 5CMKA 2D0TA 2MBGA 2XQ5A 3GBBA 3L8RA 3FXDB 3C4ZA 3OYXA 4JEUB 4O4HE 3KSJA 3M3KA 3D4CA 4I1DA 3RLFE 4NN3A 3I1AA 5HCJA 1WLXA 1FTJA 1NUXA 2Y7WA 3JZJA 5I5PA 2KZ7B 3FVKA 2QVAA 1QJMA 1DU2A 4H46A 2V3TA 1QUJA 3LV0A 5JTYA 3JC6D 3NRXA 4NF5B 4UR9A 4OMBA 4WW0A 3UK4A 4DIGA 4MMPA 2E5LT 3MYUA 4PFRA 4NUUA 3GN5A 1B7TA 2Y48B 4O4JE 3PUXF 2OJTA 2JMHA 4AKHA 4P11A 2IAKA 4OXVA 5LG4A 2NP9A 4DV4T 1HG2A 2PBWA 3IOTA 2I59A
chains in the Genus database with same CATH topology
5CMBA 3SWHA 4QXBB 2UYFA 2KNDA 2K48A 4QRZA 3CQCB 1JEVA 4DXCA 5IKBA 4GOUA 4KD5A 3FHNA 5FTIA 3MZKB 2Z8FA 4KHZE 5A1LA 3PMVA 2KMFA 4MLVA 4ECFA 5K2XA 4YMAA 3OO8A 2H7OA 2H3RA 4PJLA 2KLFA 4WBNE 5K2YA 1TWYA 1N3XA 1N84A 2OWTA 2RCBA 4ISSA 3MK7C 3TAJA 4H9OC 4POXA 3L6HA 3ZJ2A 2XXHA 1JEUA 2E9XA 1GGGA 4QSDA 4MBPA 3BQLA 2RF1A 4LVQA 2Q89A 1UTHA 4X1KE 1MY2A 4Q0CA 4N78D 5FYMA 4N07A 2DWJA 4RXLA 3VU7H 3HPIA 5JDFA 4MLQA 4F39A 1SBPA 5DVJA 4EDPA 3C50A 3LSXA 3T96B 4JEHB 4H8IA 2I0CA 2REJA 2HPJA 4HKAA 4J2CA 2UVHA 3PV0E 3I6VA 1FW0A 2SPCA 1MQGA 4IO5A 3IORA 3CWZB 5FHOA 1UX5A 4NUVA 3MQ9A 3UUNA 5ADXL 4IIJE 2P2AA 2BZBA 3OJAA 1MG1A 4NWCA 5A5XB 4XBFB 1B58A 1NNPA 5FXXA 1II5A 4GF8A 3OEMA 4IE5A 2Q9QD 4U4SA 4IDZA 1ZBMA 3RNNA 3AXFA 2F6PA 2XAJB 3IX1A 4U22A 1FMVA 3I9WA 1OWAA 4QX7B 1XOCA 5CBRA 3RYIE 4GFRA 3Q5XA 1QUIA 3AVRA 3UUMA 3SERA 1WRDA 3H7MA 3T8OA 2KWIB 2LSIA 4H5FA 4NWDA 2V7LA 3O28A 3VVEA 4YFSA 2ONKE 1PEBA 4QWNB 4DMVA 1PB9A 4A56A 2RINA 3K4UA 3MKDA 4HS7A 4EUOA 3PPNA 4EXTA 5FXZA 5LGTB 2I4CA 2ABHA 4RY1A 1LAGE 4O3AA 3AAEB 2UXAA 4MFRA 4Q5TA 4F22A 1ANFA 3C35A 3MA9A 4GWOA 2CLYC 2OCUA 4R74A 4O4IE 3PE0A 5H8HA 4F6RC 5AA1A 2LOSA 5FY1A 4IO3A 3KOSA 2RC7A 1BR4A 2VKJA 4CI2B 1NNFA 2VK9A 4MBQA 4R2FA 3H6VA 4UV8B 5I58A 4HCYA 2AIXA 4JSOA 1AOVA 1HSLA 2CA5A 1AL3A 1Z0PA 5JQGE 4NF5A 4F2QA 2CXDA 1GR2A 3KG2A 5EHSA 4R6YA 2X26A 4OYVA 4BJNA 3HR0A 1WODA 3N9MA 3FJ7A 3O1HA 3K6UA 3WI3A 1SD3A 4H65A 1UTBB 4PFYA 3E22E 5IAIA 1EH3A 3IK6B 4MFIA 1PDAA 4KR5A 1A8FA 1HG5A 2VB6A 1Y4TA 1MIWA 4C1UA 3R6UA 4FAJA 2YU1A 2C5IT 4Z7EA 2QS3A 2XXVA 3C9HA 3HHGA 4E0WA 4NF8B 3K6XA 1OQHA 2LHNA 3RTFB 3P7IA 3CQXC 4WEPA 1A8EA 4AB6A 4QX8B 4OHFA 2ALUA 1D9VA 1I69A 3RT8A 3RQTA 2W00A 2ANJA 3RT6B 4I50E 2DWGA 3ONXA 2XXTA 1CE2A 3MACA 5LBMA 3KVBA 2F97A 3U72A 2QL3A 4YJ2E 5L3DB 3NZPA 3TYHA 4GK0E 4MLKA 1PBQA 3RYFE 2QRYA 3C4XA 3K2DA 2P9BA 2CXLA 2ZNSA 4DXBA 3TZAA 1VR5A 3FUZA 3R26A 5HAXA 1QVSA 1YD8G 4H63V 3USDA 3ONMA 5A5XA 3N5LA 2VHAA 4NF4A 4G68C 3LFMA 1A55A 2XXPA 1US5A 4YB6A 1R6ZA 4QHQA 1IZ1A 1YAEA 4F2OA 5L9OA 3VVDA 2Y84A 1GTKA 3GMIA 3QC9A 2EHOD 5H6RB 4CZZB 5J2UE 3O9XA 1XVXA 5KZTA 2OZZA 4OHNA 4Z8XA 1D9YA 5DTBA 2DE2A 3PUSA 3EF7A 5CRYA 3AB3B 3G3JA 1B4ZA 1Y4CA 4X9TA 5AA2D 4QXCB 1LFGA 3N6TA 4KCDA 2P0SA 4CXXA 3Q26A 4YICA 3UORA 5I2KA 4M1PA 4PJJA 4OESA 3VDFA 5BMVE 2N9DA 3LK3B 3V89B 3L6GA 2WM9A 1UX4A 4FIMA 3ZPOA 3KV4A 2WAUA 4G68B 1MNDA 5EYFA 3Q9DA 3U78A 2Q2CA 4LZ7A 4OFJA 4MHCA 5H6QB 4HGAA 1OVTA 3DTOA 1NH7A 3T93B 3C32A 4F1YA 3RTWB 3RC8A 4JB7A 2I0BA 1JW5A 3C51A 3F57A 1B7UA 2PT2A 4KFQA 5DEXB 2NW7A 4ZECA 3PUAA 1MPBA 3H6TA 4H8JA 4UVAB 3TTMA 2I49A 1JNFA 1USYH 1B40A 3HKDE 4GVOA 3KV6A 2ZYKA 4I55E 3TTKA 4YHJA 2DWHA 5CA0E 2I48A 5IHYA 4LZ5A 5M2VA 2H98A 3GXAA 1XHYA 3KEIA 3LSLA 3FXQA 2Z6EA 3S4UA 2LEHA 3Q25A 2K9AA 5CB4E 4PQJA 3SEXA 3N9OA 4EOZB 4R75A 4HTGA 5HWYA 4CI3B 3M8UA 4PP0A 2UXXB 4PJMA 3ETVA 5LOVE 3U3IA 1SW4A 1T98A 1ELJA 4QFNA 1ZTYA 4GIWA 2BVLA 3PU5A 1D0XA 3SS1A 3B6QA 5JDNA 3CFZA 2HZKA 1N3WA 3VXBA 4PFTA 2A2FX 3N2KE 3SEWA 4O8SA 2NTXA 4BAYB 3ZC0A 1URGA 2BDEA 3MP6A 1IJ5A 3HV1A 3IEEA 3KGCA 5LHGB 4LUBA 3H37A 2D5UA 2YPNA 4KI0E 3U92A 4DCYA 2E9XC 1MDP1 3MW0A 5CA1E 4KYDA 2XXRA 3MZ1A 4P0GA 4RK2A 5LA6E 4H9NC 3KSXA 4ELPA 2G29A 5F3JA 1B2HA 4LA9A 4BA9A 4R6KA 4YB7A 4EIWA 4TLMB 1JETA 1LB8A 3O6HA 2FNCA 4KP3C 4R9FA 2X67A 1FQBA 1S35A 2MOZA 4F1UA 3TUSA 5KMGP 1HCIA 4ZS2A 5JR9B 4QHOA 3PUVE 5DVIA 3MJNA 3HI2A 3JV9A 4KYEA 3VV5A 3JYRA 1UTHB 2VD2A 1FQCA 1U5PA 1B3EA 5LHIB 3Q29A 1SI1A 3AAIA 2XAGB 3K1MA 3FGSA 1PB7A 2G0UA 1SHZC 3P8CD 5LBQB 4GL8A 5L3EB 3IR1A 4AKLA 3V5SA 1ZV4X 1BP5A 1IITA 3ZSFA 2HQ0A 3N94A 4YJ3E 1SW1A 2I4BA 2ZYNA 5JREA 2DLRA 4Z0IA 2H99A 1OQGA 5AFUL 3E3KA 3K1NA 3LK2B 1B3LA 4IHJE 4P0BA 4BDMA 5FP3A 2A5SA 2O1MA 2XX9A 3O2AA 3EVYA 1FCKA 4K3FA 1YKEB 3M3FA 4X1DA 1MQDA 2R6GE 4ZI3C 1IEJA 2VD3A 2QMXA 3FVNA 1L5TA 2ODVA 3S2VA 2XXQA 2H7VC 1Q1KA 3FV2A 3IBPA 2DOJA 3S9NC 4Q8RA 4U2RA 2QPQA 3GZGA 3TQWA 2ZMAA 5L9SA 5BWJA 3ZLIA 4U72A 2X9XA 4FATA 2XX7A 4CI1B 2AL5A 3ZN0B 1P99A 2NWBA 3MP8A 4H1XA 3OOAA 2ES0A 4TX5A 4Q30B 1HS7A 4OFOA 3S9MC 1FMWA 1MXVA 3WAKA 2V7JA 3LG7A 1O64A 5H8HB 4GD5A 4AI6A 1LRZA 4OTEA 2NTYA 2NVUB 1FQDA 5I59B 2VGQA 2B3FA 4GOTA 3B57A 4I8CA 4WKMA 5I58B 2PMSA 1DPPA 4G4PA 4QSCA 4CXWA 1ZHCA 4JWYA 5LHHB 2ZM2A 4G2AA 3PMWA 3EUHA 4TOZA 3TEPA 2XXXA 3B6WA 3UTKA 2AL4A 3PU8A 5HXRA 5HBCA 4U1OA 3VFJA 4EQ7A 3VKGA 3FVGA 4DBQA 4G8HA 4IY6A 2DS9A 2I6EA 4KPTA 3CG1A 4ZEBA 4IY5A 4F19A 3AA1B 2OA5A 1IIWA 4L17A 3MJXA 4YKKA 1LBBA 5CMMA 3ZKKA 1NMUA 2CWYA 4LP2B 2JMKA 1YPNA 1AJ3A 2GHAA 3RY3A 3DP7A 4H6DA 2V3UA 5KDTA 1MPDA 5JK4A 2O6AA 4UELA 1BIYA 4EZ4A 1M5CA 4OETA 1LGBC 3TTRA 5JR9A 1MXXA 1B52A 2Y7PA 3TTNA 5ELVA 1MY3A 3MVWA 3OELA 2DWAA 1IXHA 4CQIA 3FXRA 4YMBA 5FHNA 4ISUA 2XASB 3ZMVB 5HWXA 2YU2A 1E1HB 1EZ3A 2VOZA 4ZEFA 5H8FA 3N6UA 2Q2AA 4TV9E 1SYIA 3EHTA 2V7KA 2QSXA 1LVKA 2UYEA 2ZMBA 3U1OA 2JJ9A 3RN8A 3EQ1A 3ESLA 4XXUA 1BTJA 4ZI2C 2XXWA 2K24A 4L9IA 4NF4B 4ZE9A 1S50A 1URSA 1MMDA 1MM7A 5FHMA 1B1XA 4U1ZA 3MBPA 5J1DA 3V5AA 4ANJA 4P09A 2NW9A 5CI5A 2GHBA 1MMAA 1X79A 3ODBA 4BDLA 4ZEDA 1B7ZA 1QKBA 5LOMA 3KOTA 2BJJX 2NWJA 1LCFA 1PBPA 3ETUA 3CFXA 3HCQA 1QULA 2BVMA 3TCHA 5I2KB 4E0XA 4L0RA 3QK6A 1B5IA 1MXWA 3CQGB 3CKDA 1ZMGA 3F2EA 2VWAA 3QUJA 4BJMA 1D4NA 1GV8A 4ZZEA 3KFMA 3TTLA 2Z8EA 2CM0A 3R84B 2X7PA 4ZDMA 1MXZA 2CCQA 2I3WA 3SEVA 4MH5A 3MZBA 3QAXA 2W61A 1HFAA 4I9DA 3HSTA 2XHDA 4JDFA 1US4A 3UUXB 5HXEA 1KNZA 3E9XA 5I2NB 1D0YA 1UCUA 2CE7A 2RP4A 1OLAA 4GXSB 3UP9A 3V5UA 3OEKA 3HKBE 2CXFA 1WYCA 5I59A 1SW5A 4XIGQ 3T9HB 3FIRA 4HN9A 4NTLA 3O29A 3CSBA 1VSOA 4AXPA 3IF8B 4FORA 1B51A 2NUVA 1MMGA 2E1SA 5ICTA 1TXFA 1MM6A 2WBLA 1JW4A 5JDMA 3W9VA 3CX6B 3LBXA 3FB2A 3BQKA 4M1VA 2N1GA 3QIMA 3VKHA 4UVCB 2I58A 4EF1A 3A5XA 1O3XA 2P1SA 3H3AA 2HAVA 2OWSA 4RA1A 4JWXA 5EK3A 4UEMA 2Z8DA 3OO9A 2D0UA 1WYBA 2ZM8A 4PK4A 1IUDA 3ECRA 5FXVA 2Q9QB 4ONYA 1B9JA 4OZ9A 2GRVA 2DVCA 5I56A 4ASKA 1URDA 1G8XA 3FV1A 3WAFA 1FTKA 4ZHQE 2NOOA 3A09A 3N26A 3PD8A 3W15B 1MH3A 5F8PA 1MDQA 1O63A 3IOUA 2FA7A 3FBLA 3AA6B 4XTCQ 4EXKA 4ERRA 4IO6A 4IO7A 1BR0A 4RNSA 4C0RA 2DVZA 1OXZA 5JDGA 3GWHA 1LFHA 4FEDA 1BR2A 2RKMA 4G8MA 2QS4A 5AE4A 5M4YA 4ZEIA 1OIBA 4EXLA 2CZLA 3C98B 3DP8A 1S94A 3TODA 3TKDA 1JVYA 4JWOA 3THIA 3O1JA 1B4HA 4DMWA 4IE6A 3IAZA 2X0LB 3AA0B 2WMOA 1VRBA 4GYSA 1ZLQA 4ZS9A 3MXZA 2WMNA 3ZEFB 4C91A 2WWUA 3PMXA 2D3IA 5LYJE 2H25A 4NE4A 5I84A 3OD7A 5LP6E 3F11A 3EN3A 3CR9A 3DELB 4AKGA 3ZYKA 1I6QA 3LC8A 3MUQA 5KDMC 3KFWX 1Z7NE 3UIFA 1H45A 2WKYA 3IB2A 2B65A 1YKHB 1MS7A 4IE0A 4U4XA 1LAXA 4GYRA 4F3GA 4OK0A 2DNXA 2XQYA 3Q28A 2GFEA 1IQ7A 3AVSA 5KCJB 2DCFA 2MYSA 1IAPA 4UF0A 2HXWA 2C5JA 4O3CA 5I2NA 3N9PA 2LM9A 3U8QA 1IJ6A 2K5BB 1RYOA 2LHRA 4ND9A 2ODUA 5C8YE 1NL5A 3QXMA 1EU8A 4FJOA 2F36A 4IGRA 3SETA 1M5FA 3PTRB 2ZNTA 3T22A 3OO7A 1IXCA 5J1GA 4PETA 3TPAA 1YTVA 3HKEE 3TKLB 4EYUA 3PUQA 3PPOA 3KV5A 4OQOA 4H63H 4F29A 4GK5E 3CPZA 3FVOA 2E9XD 3LSWA 3HKCE 4JSDA 1Y1ZA 4WNKA 2G93A 1D0ZA 3K8PC 2O7IA 2Y8DA 2V7IA 4DVDA 3Q2MA 3D4GA 1DTGA 5BUUA 2LSGA 2VL8A 1MH4A 2Q9QA 2AYSA 3C34A 2HEUA 2W0GA 4YKJA 4ESWA 4TZ4C 3FJGA 1LKXA 4PFUA 3LK42 2X9WA 2EHOB 4JXIA 5HXCA 4DXUA 4OEUA 2XXYA 4BDRA 1P1OA 4F3SA 2MTQA 3C4WA 1AH5A 3K3QC 1FQFA 3PD9A 5AA2B 2F35A 5JR9C 1SYHA 2XHEB 2QS1A 1MPCA 4ZOLE 5CMCA 2N2NA 5FNVE 3DP6A 1M5BA 2D2SA 3IL1B 3V8XB 3MVZA 4YKIA 1J1NA 3ZN1B 1N04A 3IB1A 3QYTA 4HCWA 4RK9A 2L8KA 2R9JA 2A3DA 2RA1A 3VHLA 2JRKA 2PYYA 4ZS3A 2HFBA 5H8NA 2R71A 2ZM0A 2PT1A 4WXJA 5EZYE 3T9UA 4DDDA 4AQFA 5KDTB 4H5GA 3N2OA 2XD3A 3C33A 2V1DB 4E7ZA 2VKHA 4G2ZA 4THIA 2LJLA 5I57B 1QSDA 4R9GA 2O51A 3IO4A 1A54A 4ZI3D 4I43B 1S7YA 3VE1B 2UXNB 3VVFA 4ESXA 4LONB 2O7UA 4X1YE 4O2BE 5L3FB 2JPFA 1CUNA 3K6WA 2IW5B 3J7Yq 1HSJA 4RYAA 4ZZAA 1IZNB 4KCCA 3K6VA 3FJMA 4F31B 3KBUA 5H8FB 1FIOA 2B3BA 1A99A 1MIYA 3L3PA 3AAAB 3DJBA 1B32A 5FMNA 1MY1A 4PE5B 1LBCA 1PB8A 1KK7A 3IOVA 3U94A 4C1TA 4K0UA 5HPQA 5KCJA 2ACXA 5JH7E 4IB2A 1Y64B 2THIA 1DSNA 1YCJA 1AMFA 3RRCA 3SEYA 4EAHA 1LAHE 4OERA 5JRCB 1D3KA 1NFTA 2ONRA 2X66A 2V25A 1MY4A 1UQWA 5JDHA 5DQWA 4OFLA 2GH9A 3N2GE 4PNIA 4X20E 1R9LA 2LAOA 4G63A 1B0LA 4EB6E 2Y7RA 4EQBA 1JW1A 3LR1A 3HO7A 3RRWA 1JQFA 4PW8A 3KN7A 2A72A 3PPQA 4NEDA 3O66A 4IGUA 2KWHA 1I6BA 1IXIA 1FTOA 4PFOA 3IO6A 4LATA 4WEDA 3RPUA 2Z23A 3UN6A 3CSGA 5LGNB 4H9SE 1SI0A 2F6GA 1SDXA 4RPNA 2CMOA 3LUYA 2ZXTA 4R73A 4E7SA 3KBRA 4QFOA 2M8CA 3PGFA 4QFLA 4AKIA 1EZOA 3HN0A 4V1Av 4GQOA 2VKOA 1H44A 5IYZE 4X1IE 4YZZA 2KXPB 5L3GB 2EHOA 1B6HA 1VFDA 3K00A 3GA8A 1U4QA 4OYKA 1EZPA 3PPPA 5H8SA 3W9WA 3BFUA 1LSTA 1MXYA 3KZGA 4JLEA 4AQGA 1BKAA 1FTMA 3C31A 2XXIA 5AA2A 3S9EA 3KJ7A 3T9VA 4UXNB 3CI8A 3LBXB 4GLIA 4F18A 4MALA 3UA8A 3GBAA 2DI4A 1A40A 1G73A 3SESA 1D1AA 4IE7A 2I3VA 3RYHE 4H9QC 3K3OA 4PFPA 3QSLA 2DP8A 2Z22A 3OYZA 4FEBA 3PURA 4RPOA 1QUKA 2LE8A 3FXEB 3LBSA 4OWDA 5B7DA 2E0SA 4R6HA 1B1HA 2X9HA 2ZNUA 4NF6B 3GLBA 4H9PC 1TT1A 1IXGA 3ILTB 5DVFA 2XXUA 4QFKA 3TELA 4ZI2D 5J2TE 3K01A 5I56B 1VE4A 4KMCA 5LGUB 4U23A 4YU0A 2W63A 2UVIA 5LJNA 4XKRA 4P0AA 5I57A 3O6IA 1ZKBA 4ZI7E 1VFEA 5ICQA 3L09A 3PUZE 3RC3A 5FY0A 5DJQC 3O97A 1POY1 2V7MA 2ONSA 2LOPA 3PDYA 4HFVA 4P0IA 4DLDA 1QUUA 4ELRA 3RKOA 3H6UA 3KVAA 2DWIA 2DQVA 5GONE 3HHFA 3JC6C 4AB5A 1WR6A 4JUYA 4TQUQ 3NZQA 2IA4A 2HAUA 5CC2A 2ZYOA 3OBVE 2RCAA 2F7AA 5TP9A 2QGSA 2YK0A 4JBZA 1JVXA 1TFAA 3N9LA 5HXSA 2YEVC 2E8IA 4UACA 2LT3A 2OBGA 4LQ2A 4PAGA 2D5WA 4H67A 1GVCA 2REGA 3LJCA 3B13A 4IO4A 1DOTA 4XZCA 3WAJA 4UV9B 3G3FA 5JRCA 1P1WA 3CFLA 3FXUA 5CM6A 3J9X1 1NKXA 3ILUB 2O84X 3E4RA 1POTA 2O69A 4ADZA 5LNKA 3C64A 2D21A 2ESNA 4C90A 2F7CA 3EHUA 1SQYA 2O1LA 2HH7A 1DTZA 3ZMUB 5TPAB 1MIVA 3KJTA 2LSKA 5L3BB 4QFPA 3RGYA 2XX8A 5LXTE 1SW2A 1V9DA 3WAEA 3UULA 2V3QA 3Q27A 4PK5A 4KQPA 1Y9UA 2QJEA 2C0SA 2V93A 3SEUA 2W62A 1N7WA 4OYJA 3FATA 4ILUA 4TUYE 3O4XE 4GIZA 1I6AA 5KX5E 3U93A 2CEAA 3PUXE 4UF0B 2PFVA 4YB5A 1F9BA 5H8QA 2F8DA 3G3HA 2VKDA 2UVGA 4KBMB 5DT6A 2H9BA 3OSQA 3ANWB 1MRPA 5ITPA 1A7LA 1LCTA 1O7TA 1FEWA 4ZEKA 2Q9QC 3S9LC 1H43A 5HM4B 2VASA 2DE4A 5TAOA 3SDFA 5AA4A 3VLVA 5TU0A 1FQAA 4YAHX 4FJPA 4G8NA 5AA3A 3SRZA 5F7VA 1US7B 1R1NA 3TCFA 2PX1A 4HE8A 4LZ8A 4XAXB 3W15C 2DXRA 1KWHA 1B46A 3K1PA 3E13X 3ZKLA 1N76A 3KN8A 2YJPA 2XUEA 5FY7A 4OEVA 4BDQA 3ZJ1A 1H7CA 4AQ4A 4BLAA 3DP4A 3UT5E 3QUFA 2L9QA 2XAHB 3MZ9A 1R9QA 3KV9A 2IC9A 1ZJLA 1NAFA 5DQVA 4NF6A 3C4MA 3MP1A 1Q35A 3B7DA 4MF3A 1DMBA 3H4ZA 1CB6A 2CLYB 3E08A 4CXYA 1UIUA 1M5EA 5ETWA 2HPLA 5ITOA 2XD2A 1ZU0A 3NBXX 4AQFC 4I4TE 3BQIA 1D1BA 2DSFA 4YLHA 4O4LE 2YLNA 2PBIA 3M65A 3H03A 1OLCA 2UVJA 4N6PA 1Y3PA 3MC2A 2Y6XA 2IC6A 3PUGA 3A3CA 2L3LA 3G7WA 3I3VA 3RPWA 2OK2A 4R2BA 1MMNA 3ZS6A 3VXCA 5EK2A 4B6XA 3H06B 5HXHA 3PU3A 2X68A 1YW0A 2NOXA 5H8NB 3G3IA 4DE8A 1OVBA 3UGWA 2X7QA 5L8DA 4EF2A 2NXOA 3VLWA 4R72A 3I0QA 1T0KA 3N9NA 1P1QA 3VLUA 4F1VA 1H76A 1ATGA 3EDUA 3FD3A 3MPKA 1XC1A 3UFEA 2A5TB 4GRKA 3N9QA 3CIJA 5L2LA 2X9YA 2FYIA 4AKRB 2X51A 3IB0A 5TPAA 4LQ5A 2Q9TA 3R6NA 1NWMX 2LSJA 3LSFB 2KLQA 3MWBA 2V26A 4EYYR 4UA8A 3ZCJA 1MQJA 1SA0E 2JQQA 4POWA 5LJMA 1UIVA 3EDVA 3BKIB 2QA7A 4ISTA 3CMLA 1WDNA 2QMWA 3K02A 5HYAA 1NNKA 2PVUA 1BR1A 4FI5A 2KT9A 3ZMZB 2B1EA 1B7HA 2KINB 1M5DA 5B70A 3OXNA 5FTHA 5ISUA 3IJOB 4X1BA 4QF9A 1USYE 2DWKA 3ANWA 3NRYA 4EZHA 1LAFE 1Y3QA 3CVGA 1RYXA 3H6WA 4PFWA 1EZ9A 2Q88A 3T66A 4XKQA 3ZCIA 1LLSA 2V84A 4XKNA 3BK9A 4DBRA 4DZ1A 3BFTA 4M4GA 3O9PA 3TCGA 4OFZA 4WBOA 2EHOC 4KUMB 1LB9A 2XAQB 4GXAA 4O3BA 4I62A 1BLFA 4TN7B 1B0HA 2F78A 4RJZA 3D0TA 3G3GA 1MNEA 1B3FA 1TFDA 4UIGA 3ZYMA 2LSYA 4DCXA 3CG3A 4ELQA 1HF8A 3TFLA 2DHRA 3DM0A 2O68A 2J1DG 3OSRA 3MPLA 3FASA 1ZEEA 4QSEA 4EQ9A 2QS2A 4U21A 3CX8B 1P1NA 2RC9A 3PUWE 3C36A 1S9TA 1UTBA 3OMBA 1Y3NA 1B5JA 3AA7B 3SKPA 5EK4A 2GK9A 1XS5A 1AIVA 1HTJF 5E0OA 4TV8E 2IEEA 4F3BA 3FBZA 4DNDA 3FZVA 3EPEA 4BDNA 3IOWA 1NNTA 2F7BA 1LVFA 1MQHA 3KINB 3RUMA 3HL6A 1H3DA 4F3PA 4NF8A 4L5GA 3KN3A 3O1IA 1B5HA 4IGTA 5CBSA 5JTYB 3GN5B 1QW0A 1RKMA 5JDLA 4QXHB 3B6TA 1PC3A 1HX8A 5LCYA 3TDJA 1B3HA 5JEIA 2YINA 3HA4A 5L3CB 3CRBA 1Y20A 3I9YA 3E0ZA 1MQIA 2Q8JA 4HEAA 3T9XB 3KBTA 3IJXB 1MXUA 1ZIUA 4HTEA 3ZMSB 4IE4A 1B3GA 3CVRA 5JDQA 2A5TA 3ZYLA 4U74A 3K3NA 1XVYA 3CX7B 1QKAA 1DPEA 5F1QA 4ZE8A 2WSSV 2E9XB 3K0VA 3EHSA 3RYCE 1HSEA 5L9MA 4H9RC 5TP9B 3IHRA 3A3UA 3H3GA 3MVYA 2VP1A 1FQEA 2PG8A 1MY0A 4PJNA 3PUYE 2OLBA 1N7XA 1FTLA 4G77A 4GL0A 4OENA 5JVDE 4TLLB 3I5OA 3RH3A 1WVJA 5EHMA 3O6GA 3RX6A 2HZLA 3Q5WA 3BBRA 1N0TA 4G68A 3F31A 4KYSA 3DLNA 5DYHA 2H4IA 2F34A 3OENA 2XAFB 1D1CA 3TQLA 2C5KT 2PJQA 4YKPA 2Y7IA 3M3LA 4FECA 1VOMA 3PPRA 1SVXB 4QKNA 2Y7KA 3R7XA 4ELOA 5FXWA 3ZC1A 2RC8A 2ZLYA 5DEXA 2M67A 3SOLA 2DE3A 1Z7ME 1B05A 1LFIA 3MVXA 1Y1MA 2W7YA 2F5XA 4NMYA 3OKQA 2DXYA 3G3KA 3TMGA 1ZKEA 4PK6A 2HCAA 1XT8A 4HW8A 4X48A 4O2AE 2DYXA 4H0WA 1OMPA 5H8QB 4DO0A 2CMRA 3MAMA 4N13A 5DABA 2CWOA 4FE8A 2ZYMA 3I0OA 3KDSE 4BDOA 1P1UA 2NW8A 2H5YA 1NH8A 2XTLA 3OO6A 3V83A 4XKPA 4OVJA 3ZMTB 5AA4B 4IO2A 4UVBB 5CMKA 2D0TA 2MBGA 3GBBA 4O4HE 3FXDB 3C4ZA 3OYXA 4JEUB 3KSJA 3M3KA 4I1DA 3D4CA 3RLFE 3I1AA 1WLXA 1FTJA 2Y7WA 3JZJA 2KZ7B 3FVKA 1QJMA 2V3TA 1QUJA 5JTYA 3JC6D 3NRXA 4NF5B 4OMBA 3UK4A 4WW0A 4DIGA 4NUUA 3GN5A 1B7TA 2Y48B 4O4JE 2OJTA 2JMHA 4AKHA 4P11A 2IAKA 4OXVA 5LG4A 2NP9A 1HG2A 2PBWA 3IOTA 2I59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMB A;  2UYF A;  2K48 A;  4QRZ A;  1JEV A;  4DXC A;  5IKB A;  4KD5 A;  5FTI A;  2Z8F A;  4KHZ E;  3PMV A;  4MLV A;  4ECF A;  5K2X A;  4YMA A;  3OO8 A;  2KLF A;  5K2Y A;  1TWY A;  1N3X A;  1N84 A;  2OWT A;  2RCB A;  3TAJ A;  4POX A;  3L6H A;  2XXH A;  1JEU A;  1GGG A;  4QSD A;  4MBP A;  4LVQ A;  2RF1 A;  2Q89 A;  1UTH A;  1MY2 A;  4Q0C A;  4N07 A;  2DWJ A;  4RXL A;  3HPI A;  4MLQ A;  4F39 A;  1SBP A;  5DVJ A;  4EDP A;  3LSX A;  3T96 B;  4H8I A;  2I0C A;  2REJ A;  4J2C A;  3PV0 E;  2UVH A;  3I6V A;  1FW0 A;  1MQG A;  4IO5 A;  3IOR A;  5FHO A;  3MQ9 A;  2P2A A;  1MG1 A;  4NWC A;  5A5X B;  1B58 A;  1NNP A;  1II5 A;  4GF8 A;  3OEM A;  4U4S A;  1ZBM A;  3RNN A;  3AXF A;  2F6P A;  3IX1 A;  4U22 A;  1XOC A;  5CBR A;  4GFR A;  1QUI A;  3SER A;  3H7M A;  2KWI B;  4H5F A;  4NWD A;  3O28 A;  3VVE A;  2ONK E;  1PEB A;  1PB9 A;  2RIN A;  3K4U A;  4HS7 A;  4EUO A;  3PPN A;  2I4C A;  2ABH A;  4RY1 A;  1LAG E;  4O3A A;  2UXA A;  4Q5T A;  4F22 A;  1ANF A;  3C35 A;  4GWO A;  2OCU A;  4R74 A;  5H8H A;  5AA1 A;  4IO3 A;  3KOS A;  2RC7 A;  1NNF A;  4R2F A;  3H6V A;  5I58 A;  4HCY A;  2AIX A;  4JSO A;  1AOV A;  1HSL A;  2CA5 A;  1AL3 A;  1Z0P A;  4NF5 A;  4F2Q A;  1GR2 A;  3KG2 A;  5EHS A;  4R6Y A;  2X26 A;  4OYV A;  1WOD A;  3FJ7 A;  3K6U A;  1SD3 A;  4H65 A;  1UTB B;  4PFY A;  5IAI A;  1EH3 A;  3IK6 B;  4MFI A;  1PDA A;  4KR5 A;  1A8F A;  1Y4T A;  4C1U A;  3R6U A;  4FAJ A;  4Z7E A;  2C5I T;  2QS3 A;  2XXV A;  3C9H A;  3HHG A;  4E0W A;  4NF8 B;  3K6X A;  1OQH A;  3RTF B;  3P7I A;  4WEP A;  1A8E A;  4AB6 A;  2ALU A;  1I69 A;  1D9V A;  3RT8 A;  3RQT A;  2ANJ A;  3RT6 B;  2XXT A;  1CE2 A;  2F97 A;  3U72 A;  2QL3 A;  3TYH A;  1PBQ A;  2QRY A;  3K2D A;  2ZNS A;  4DXB A;  3TZA A;  1VR5 A;  3FUZ A;  3R26 A;  1QVS A;  3USD A;  3ONM A;  5A5X A;  3N5L A;  2VHA A;  4NF4 A;  4G68 C;  1A55 A;  2XXP A;  1US5 A;  4YB6 A;  1R6Z A;  4QHQ A;  1IZ1 A;  1YAE A;  4F2O A;  5L9O A;  3VVD A;  2Y84 A;  1GTK A;  1XVX A;  5KZT A;  2OZZ A;  4OHN A;  5DTB A;  1D9Y A;  2DE2 A;  3EF7 A;  5CRY A;  3G3J A;  1B4Z A;  1Y4C A;  4X9T A;  5AA2 D;  1LFG A;  3N6T A;  4KCD A;  2P0S A;  3Q26 A;  4YIC A;  3UOR A;  5I2K A;  4OES A;  3VDF A;  3V89 B;  3L6G A;  4FIM A;  4G68 B;  5EYF A;  2Q2C A;  4LZ7 A;  4OFJ A;  1OVT A;  1NH7 A;  3T93 B;  3C32 A;  4F1Y A;  3RTW B;  4JB7 A;  2I0B A;  1JW5 A;  1B7U A;  2PT2 A;  4KFQ A;  5DEX B;  4ZEC A;  1MPB A;  3H6T A;  4H8J A;  3TTM A;  2I49 A;  1JNF A;  1USY H;  1B40 A;  4GVO A;  2ZYK A;  3TTK A;  2DWH A;  2I48 A;  5M2V A;  4LZ5 A;  2H98 A;  3GXA A;  1XHY A;  3KEI A;  3LSL A;  3FXQ A;  3S4U A;  3Q25 A;  4PQJ A;  3SEX A;  4R75 A;  4HTG A;  3M8U A;  4PP0 A;  1SW4 A;  1ELJ A;  4QFN A;  1ZTY A;  3PU5 A;  3B6Q A;  3CFZ A;  2HZK A;  1N3W A;  3VXB A;  4PFT A;  3SEW A;  1URG A;  3MP6 A;  1IJ5 A;  3HV1 A;  3KGC A;  4LUB A;  2YPN A;  4KI0 E;  3U92 A;  4DCY A;  1MDP 1;  3MW0 A;  4KYD A;  2XXR A;  3MZ1 A;  4P0G A;  4RK2 A;  3KSX A;  4ELP A;  2G29 A;  1B2H A;  4LA9 A;  4R6K A;  4YB7 A;  4TLM B;  1JET A;  1LB8 A;  3O6H A;  2FNC A;  4R9F A;  1FQB A;  4F1U A;  3TUS A;  3PUV E;  5DVI A;  3MJN A;  3JV9 A;  4KYE A;  3VV5 A;  3JYR A;  1UTH B;  2VD2 A;  1FQC A;  1B3E A;  3Q29 A;  1SI1 A;  3K1M A;  3FGS A;  1PB7 A;  2G0U A;  4GL8 A;  3IR1 A;  1BP5 A;  1IIT A;  3ZSF A;  2HQ0 A;  3N94 A;  1SW1 A;  2I4B A;  2ZYN A;  4Z0I A;  2H99 A;  1OQG A;  3E3K A;  3K1N A;  1B3L A;  4BDM A;  2A5S A;  2O1M A;  2XX9 A;  3O2A A;  1FCK A;  4K3F A;  3M3F A;  4X1D A;  1MQD A;  2R6G E;  1IEJ A;  2VD3 A;  2QMX A;  3FVN A;  1L5T A;  3S2V A;  2XXQ A;  1Q1K A;  3FV2 A;  2DOJ A;  3S9N C;  4Q8R A;  4U2R A;  2QPQ A;  3GZG A;  3TQW A;  5L9S A;  5BWJ A;  2X9X A;  4FAT A;  2XX7 A;  2AL5 A;  1P99 A;  3MP8 A;  4H1X A;  3OOA A;  4Q30 B;  4OFO A;  3S9M C;  1MXV A;  1O64 A;  5H8H B;  4GD5 A;  2NVU B;  1LRZ A;  4OTE A;  1FQD A;  5I59 B;  2VGQ A;  2B3F A;  4GOT A;  4I8C A;  4WKM A;  5I58 B;  2PMS A;  1DPP A;  4G4P A;  4QSC A;  4JWY A;  3PMW A;  4TOZ A;  3TEP A;  2XXX A;  3B6W A;  2AL4 A;  5HBC A;  4U1O A;  3VFJ A;  4EQ7 A;  3FVG A;  4G8H A;  4IY6 A;  2DS9 A;  2I6E A;  4KPT A;  3CG1 A;  4ZEB A;  4IY5 A;  4F19 A;  1IIW A;  4L17 A;  4YKK A;  1LBB A;  5CMM A;  3ZKK A;  1NMU A;  4LP2 B;  1YPN A;  2GHA A;  3RY3 A;  4H6D A;  2V3U A;  5KDT A;  1MPD A;  5JK4 A;  2O6A A;  1BIY A;  1M5C A;  4OET A;  1LGB C;  3TTR A;  1MXX A;  1B52 A;  2Y7P A;  3TTN A;  5ELV A;  1MY3 A;  3MVW A;  3OEL A;  2DWA A;  1IXH A;  4CQI A;  3FXR A;  4YMB A;  5FHN A;  4ISU A;  2VOZ A;  4ZEF A;  5H8F A;  3N6U A;  2Q2A A;  1SYI A;  3EHT A;  2QSX A;  2UYE A;  2ZMB A;  3U1O A;  3RN8 A;  3EQ1 A;  4XXU A;  1BTJ A;  2XXW A;  4NF4 B;  4ZE9 A;  1S50 A;  1URS A;  1MM7 A;  5FHM A;  1B1X A;  4U1Z A;  3MBP A;  5J1D A;  3V5A A;  5CI5 A;  2GHB A;  4BDL A;  3ODB A;  4ZED A;  1B7Z A;  1QKB A;  5LOM A;  3KOT A;  2BJJ X;  2NWJ A;  1LCF A;  1PBP A;  3CFX A;  3HCQ A;  1QUL A;  3TCH A;  5I2K B;  4E0X A;  4L0R A;  3QK6 A;  1B5I A;  1MXW A;  3CKD A;  1ZMG A;  3QUJ A;  1GV8 A;  1D4N A;  4ZZE A;  3KFM A;  3TTL A;  2Z8E A;  2X7P A;  4ZDM A;  1MXZ A;  2I3W A;  3SEV A;  4MH5 A;  3MZB A;  3QAX A;  4I9D A;  3HST A;  2XHD A;  4JDF A;  1US4 A;  3E9X A;  5I2N B;  1OLA A;  4GXS B;  3UP9 A;  3OEK A;  5I59 A;  1SW5 A;  4XIG Q;  3T9H B;  3FIR A;  4NTL A;  3O29 A;  3CSB A;  1VSO A;  4FOR A;  1B51 A;  2NUV A;  2E1S A;  5ICT A;  1TXF A;  1MM6 A;  1JW4 A;  3W9V A;  4M1V A;  3QIM A;  2I58 A;  4EF1 A;  2P1S A;  2HAV A;  2OWS A;  4RA1 A;  4JWX A;  2Z8D A;  3OO9 A;  1IUD A;  3ECR A;  4ONY A;  1B9J A;  4OZ9 A;  2GRV A;  2DVC A;  5I56 A;  1URD A;  3FV1 A;  3WAF A;  1FTK A;  3N26 A;  2NOO A;  3A09 A;  3PD8 A;  1MH3 A;  1MDQ A;  1O63 A;  3IOU A;  2FA7 A;  4XTC Q;  4EXK A;  4IO6 A;  4IO7 A;  4RNS A;  4C0R A;  2DVZ A;  1LFH A;  4FED A;  2RKM A;  4G8M A;  2QS4 A;  5AE4 A;  4ZEI A;  1OIB A;  4EXL A;  2CZL A;  3DP8 A;  3TOD A;  3TKD A;  1JVY A;  4JWO A;  3THI A;  1B4H A;  3IAZ A;  1ZLQ A;  4ZS9 A;  3MXZ A;  3PMX A;  2D3I A;  2H25 A;  4NE4 A;  5I84 A;  3OD7 A;  3F11 A;  3EN3 A;  3CR9 A;  3DEL B;  3LC8 A;  1I6Q A;  3MUQ A;  1Z7N E;  3UIF A;  1H45 A;  2WKY A;  3IB2 A;  2B65 A;  1MS7 A;  4U4X A;  1LAX A;  4F3G A;  3Q28 A;  2GFE A;  1IQ7 A;  5KCJ B;  2HXW A;  2C5J A;  4O3C A;  5I2N A;  3U8Q A;  1IJ6 A;  1RYO A;  4ND9 A;  1NL5 A;  3QXM A;  1EU8 A;  2F36 A;  4IGR A;  3SET A;  1M5F A;  2ZNT A;  3T22 A;  3OO7 A;  1IXC A;  4PET A;  3TPA A;  1YTV A;  3TKL B;  3PPO A;  4OQO A;  4F29 A;  3FVO A;  3LSW A;  4JSD A;  1Y1Z A;  2G93 A;  2O7I A;  3D4G A;  1DTG A;  5BUU A;  1MH4 A;  2AYS A;  3C34 A;  2HEU A;  4