3S4UA

Crystal structure of open, unliganded e. coli phnd h157a
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
302
structure length
302
Chain Sequence
KALNFGIISTESQQNLKPQWTPFLQDMEKKLGVKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRANGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDLLAKRKDLTFGNGDPNSTSGFLVPGYYVFAKNNISASDFKRTVNAGAETNALAVANKQVDVATNNTENLDKLKTSAPEKLKELKVIWKSPLIPGDPIVWRKNLSETTKDKIYDFFMNYGKTPEEKAVLERLGWAPFRASSDLQLVPIRQLALFKEMQSVKDNKGLNEQDKLAKTTAIQAQLDDLDRLNNALSAMSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Escherichia coli Phosphonate Binding Protein PhnD and Rationally Optimized Phosphonate Biosensors.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords PhnD, subunit of alkylphosphonate ABC transporter
total genus 95
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2011-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12974 Phosphonate-bd ABC transporter, phosphonate, periplasmic substrate-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.90 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3s4uA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3s4uA02
1MRPA 4TLLB 1SW1A 3T9VA 1LFHA 3TUSA 2PT1A 3MQ9A 3MVWA 2G29A 5JTYB 1Q1KA 1B7UA 1PB9A 2O51A 2O84X 4G8NA 4PETA 4RJZA 3N94A 4EXLA 4PFUA 1OMPA 5LOMA 2Q2AA 4X1DA 3BFUA 4YKPA 4F39A 3IOTA 1IEJA 5KDTA 2C5JA 3E9XA 3FXQA 4O3CA 1UTHA 4EQBA 1B4HA 1QVSA 3RN8A 4U4SA 5A5XB 3OEKA 4M4GA 1EU8A 5FHOA 1LLSA 3PPRA 3MW0A 3RT8A 1AOVA 4XKPA 4AB5A 1A54A 2DSFA 1Q35A 2RC8A 1EH3A 3UORA 1ELJA 4R2FA 1DPEA 5HPQA 4OZ9A 2VD2A 2K48A 4PFTA 1WODA 4LUBA 4NF4A 2YJPA 1M5BA 3O6IA 3H4ZA 1I69A 1Y9UA 5EHMA 4PFYA 5EHSA 4XTCQ 2X9WA 3MPKA 1Y1ZA 5ICTA 3PUXE 1PC3A 4RK9A 5M2VA 4F1UA 3MZ9A 2XXIA 4C0RA 4JSDA 5I2KB 3FJ7A 4KYDA 1URGA 3T9XB 5L8DA 3V5AA 2DWJA 4F3PA 3TDJA 3TKDA 2REJA 4B6XA 1R6ZA 3PUWE 1QKBA 2PVUA 3IO4A 4QRZA 2F97A 2V3UA 3K4UA 3MPLA 3OEMA 3JYRA 2V84A 3LC8A 3FVGA 3TCGA 3DP4A 3FV2A 4KPTA 1XVXA 4BDNA 1I6QA 2DE4A 2QMXA 2ZYMA 4TQUQ 2V3QA 4ZECA 4XKNA 2I4CA 3PGFA 1WVJA 2F78A 2VGQA 4GD5A 1B3EA 2KLFA 5K2XA 4OFOA 2GH9A 2NWJA 3TYHA 3UA8A 1ZU0A 2DOJA 3F11A 3KGCA 3IB2A 3L3PA 2HCAA 3M8UA 3LUYA 4OWDA 3W15C 1D4NA 3GXAA 4OEVA 1UQWA 4OQOA 3MWBA 5FTHA 2HAUA 1VSOA 5H8NB 4N13A 2P2AA 4F22A 1IZ1A 1LSTA 2B3FA 4NEDA 4O3BA 4U4XA 2X7PA 1LGBC 1AH5A 3MP1A 5DVJA 4MLQA 4XIGQ 2MBGA 3QUJA 1LB8A 1KWHA 1ZTYA 2RF1A 2VHAA 3FD3A 4F18A 1MM6A 2QS1A 5IKBA 5DVIA 4NF5B 4R72A 1DOTA 3N6TA 3IAZA 1GV8A 3SEYA 1DTGA 3OD7A 4IO3A 3M3KA 1MPCA 4E0WA 4I9DA 1LAGE 2QMWA 4JWOA 1FTJA 3FZVA 1DSNA 1B0LA 2DXYA 4YKJA 5L9OA 1WDNA 5KDTB 3DM0A 1PB7A 1B52A 4RK2A 3R26A 5I59B 3FV1A 4ONYA 1OVBA 1XC1A 4OENA 2Y84A 3C9HA 2LAOA 3I3VA 3K2DA 1N84A 4H5GA 4H65A 2XX7A 3G7WA 4H0WA 1GR2A 3K0VA 3VLUA 3ZSFA 4FATA 3G3JA 1RYXA 2XXQA 2HEUA 2NOOA 3K00A 3KN7A 3FXUA 2DWAA 4YB5A 3K6WA 1MY3A 2GHBA 3QK6A 3PUZE 3CFLA 1RKMA 2PYYA 1N7XA 3KZGA 3M3LA 3GLBA 4ZEDA 1B40A 2UXAA 3IJOB 4RYAA 1ZIUA 5JK4A 2F36A 3T93B 1JVXA 3S9LC 4R9FA 4ZS9A 3O6GA 1MXVA 1JW5A 1OLAA 4KFQA 4DNDA 5AA1A 2Y7IA 4BDLA 4JWYA 1FTOA 3SEXA 3UN6A 1AMFA 1Y4CA 4GWOA 4ELOA 1DPPA 3K6UA 5I84A 4POWA 1RYOA 3PD8A 4EDPA 3G3IA 5CM6A 1B5IA 1LBCA 2OBGA 4G68A 1B1HA 4GQOA 3RQTA 2H98A 1Z7NE 3O28A 4F3GA 1MXUA 3LR1A 2RCAA 3EPEA 3THIA 4EF2A 1MDP1 1H76A 3TQWA 3T9HB 2Z8FA 4KI0E 2V93A 3CR9A 3N6UA 4QHQA 4RXLA 4FECA 1PBPA 4XKRA 3RTWB 1R9QA 4FEBA 1IJ5A 3HHGA 4YB7A 1A40A 3VVFA 3C36A 2DQVA 4YMBA 2DWHA 2H25A 4H1XA 4OERA 2IC6A 3GBBA 5TPAA 2I49A 2ALUA 3K1PA 1M5EA 2XX8A 1N0TA 1PBQA 4R6KA 2RC7A 1MPBA 4XKQA 3C32A 3U93A 4EUOA 3PUVE 4F1YA 2YPNA 1S7YA 4ZZAA 3FXDB 1NNTA 1M5CA 1URSA 2F6GA 2QL3A 3MAMA 4GF8A 4JWXA 1IXIA 4BDRA 2QRYA 3HPIA 2OK2A 4C1UA 5I2NB 5I56B 3MUQA 4F2QA 3JZJA 2O7UA 4R73A 1MXWA 1N3WA 2XD2A 3T9UA 3ZS6A 2ANJA 3PPPA 4KHZE 2QS4A 3D4GA 3IOVA 2X9YA 2XXTA 4QF9A 3H6TA 4AB6A 4KCCA 1JETA 1I6BA 2V3TA 2Y7WA 3C31A 3IB1A 3KOTA 4OETA 2P0SA 4X48A 4PE5B 4IO6A 4ND9A 1HSJA 1ZLQA 1B3HA 4EQ9A 2PMSA 3SDFA 1XS5A 3RLFE 3UK4A 1LB9A 3QIMA 4QFKA 4DE8A 2XX9A 4YB6A 1F9BA 2DE2A 1OQHA 4N07A 4OMBA 4NE4A 4L17A 1LBBA 3CSBA 2QSXA 1OQGA 2DP8A 1HSLA 3OO7A 4HTGA 1SI1A 5H8HA 4AQ4A 4EYYR 4F19A 3GZGA 5KCJA 1ATGA 1YAEA 1VFDA 2OWSA 1MQIA 4LZ8A 3RY3A 3U72A 1B46A 1YCJA 3B6TA 3KN8A 3CG3A 2WKYA 1B3GA 1LVFA 2XXPA 3O97A 5K2YA 4HCWA 4THIA 1MH3A 5KCJB 1POY1 5KZTA 3TEPA 2ABHA 3TKLB 2DWIA 4BDMA 3IR1A 5L9SA 2F35A 3H6UA 1FQDA 2OCUA 1GVCA 4R9GA 2ZYKA 1P99A 1QULA 1NMUA 3KG2A 5B7DA 2XD3A 3ILUB 2NXOA 4LA9A 4QSCA 5H8HB 2QS3A 1UTBA 4K3FA 4OYVA 3RT6B 3ILTB 4LP2B 1TT1A 4U1ZA 3TMGA 2Y7KA 2B65A 4GFRA 4LONB 1II5A 3SEUA 4F29A 3LBSA 3C33A 3E4RA 3GBAA 4FJPA 5DEXB 5H8SA 3TODA 4C1TA 1MXZA 2YLNA 3PV0E 5DVFA 3B6QA 3Q28A 2AYSA 5A5XA 3H3GA 1IQ7A 1LCFA 1P1WA 1Y3PA 5I57B 3CG1A 2R6GE 5DYHA 2F7CA 1QUKA 5TP9B 4IO7A 4BDOA 2VD3A 3SKPA 3VVDA 5F7VA 3R6UA 2QPQA 4NWCA 4H8IA 3CRBA 2ZYNA 3KEIA 3TQLA 3CKDA 2CMOA 2P1SA 3B7DA 3HV1A 5CBRA 1SI0A 3FGSA 4FIMA 2H4IA 2KWIB 3BBRA 3TTNA 1CE2A 1MQGA 2V25A 2H9BA 4R74A 3TZAA 2IC9A 1A55A 1POTA 1P1NA 4IO5A 2OLBA 4DXCA 3A3CA 3G3KA 3VXCA 1SQYA 2Z8EA 4DIGA 4ISUA 4G2ZA 1MH4A 2PBWA 2D21A 3TAJA 1MPDA 1B58A 5AE4A 3P7IA 3PU5A 4F1VA 1Y4TA 1IJ6A 1ZKBA 5H8FB 4DLDA 1PEBA 3MBPA 3ZKKA 2Q8JA 2DE3A 1P1QA 4IGRA 5BUUA 1D3KA 1ZBMA 5DEXA 1B0HA 4GXSB 1SBPA 1FCKA 2RCBA 1MY4A 3I6VA 4OFLA 1H3DA 1NH8A 3MVYA 4YKKA 2VOZA 1BIYA 1JEUA 2DVCA 1O63A 3KJTA 5TP9A 2O6AA 2W7YA 3EHUA 3HN0A 1B9JA 3FATA 3VFJA 1S50A 3S9NC 3D4CA 1DMBA 4FE8A 3Q27A 3FVOA 3TFLA 2F5XA 2F8DA 2ZMBA 3KOSA 4QFOA 4QSEA 2XXWA 1JW4A 3VV5A 3WAFA 4FAJA 4YKIA 2AIXA 4EXKA 1A7LA 1JW1A 1SW4A 2IA4A 4OEUA 1H7CA 1D9VA 4ZEFA 3UIFA 3V8XB 5AA4A 5ICQA 2ONRA 4NF8B 2GFEA 1B3FA 3SESA 4EF1A 1BTJA 3HO7A 5HM4B 2Q9TA 4PFWA 3DP8A 1USYE 2REGA 2UVGA 3BFTA 3KJ7A 4HCYA 1XHYA 4I62A 4OTEA 2R9JA 3RTFB 3IOWA 4R6HA 3U94A 4Z0IA 4G4PA 5IAIA 1USYH 3VLWA 1Y1MA 3PMWA 1PB8A 4RY1A 5I2NA 1JQFA 4JXIA 2NVUB 3Q29A 4F3SA 4QFNA 4DDDA 1LCTA 3MXZA 2XXXA 4CQIA 5B70A 1MM7A 1NNKA 2XXUA 4ELRA 4OESA 2ONKE 4KYSA 2R71A 3MJNA 4ZDMA 3Q26A 3T22A 1OVTA 3B6WA 1A8EA 2RKMA 3OENA 4H8JA 5AA2A 4X9TA 3S9EA 5ELVA 3G3FA 1P1OA 1B6HA 3MZBA 4RA1A 3VVEA 2C5IT 4H5FA 4TLMB 3U8QA 4JDFA 3USDA 4H6DA 3O6HA 3UGWA 2NUVA 1SW5A 3O9PA 4BLAA 1NNFA 4RPNA 2XXRA 4F3BA 1EZPA 4N6PA 3IK6B 5H8QA 3IOUA 2AL4A 2D5WA 3MVZA 4NF8A 2HZKA 3W9WA 3H03A 3UP9A 2GRVA 2Y7RA 5JEIA 4R6YA 5ITOA 3TTMA 3MVXA 4YU0A 2QS2A 1YPNA 2G0UA 1B7HA 2BJJX 4I1DA 5H8NA 2RC9A 3V89B 4Q5TA 2FYIA 3LSLA 3R7XA 1R9LA 2KWHA 1SD3A 1T0KA 2A5TA 3OELA 3OO9A 5CMBA 2I0BA 3MP8A 2ZNTA 1B05A 2ZNUA 4MH5A 2F34A 2ONSA 5I2KA 4ZEKA 1MG1A 4ZE9A 3SEVA 2C5KT 2F7BA 2O1MA 3QAXA 4IO2A 3ODBA 4MLVA 1R1NA 3RUMA 1N3XA 1FQEA 1US4A 3FXEB 3PD9A 4G77A 4LQ2A 2THIA 1QSDA 3H06B 2I48A 3LSWA 4IGTA 3MZ1A 1H44A 1UIUA 3IB0A 3KSXA 4P11A 1IXHA 4RNSA 2Q88A 2E0SA 2Q89A 3LSFB 1GTKA 3KBRA 1H43A 1OLCA 4P0GA 4U2RA 3T96B 3ECRA 1BP5A 1J1NA 3FIRA 3VXBA 4ESXA 3TTKA 4YMAA 2ZNSA 3M3FA 5EYFA 3HCQA 3VE1B 4H67A 4OFJA 3TELA 1IITA 5I56A 1L5TA 4IO4A 4G68C 5AA2D 3CI8A 4U23A 1EZOA 1M5FA 3OO8A 5DTBA 3EHSA 3SERA 1XOCA 1LAHE 2I58A 2Z8DA 2DYXA 1AL3A 3FVNA 4OXVA 2OJTA 5CMMA 3QUFA 4KYEA 4E0XA 2H99A 4WEDA 5TPAB 4YZZA 3IORA 3QYTA 4ELQA 3E13X 5HBCA 4JB7A 2VP1A 1B32A 1NKXA 1SYHA 2B3BA 4GIZA 5H8QB 4ZZEA 1HSEA 2FA7A 3TPAA 4NTLA 4GL0A 4MFIA 1B5HA 4OHNA 1SW2A 3T66A 3K1MA 3L6HA 2ZXTA 3EQ1A 3OSQA 3HHFA 4RPOA 3FJMA 4DZ1A 5ITPA 4O3AA 3Q25A 2G93A 1VE4A 4IB2A 4KR5A 5FHMA 1TWYA 5J1DA 1D9YA 2IEEA 5CMKA 1B51A 3KFMA 3W9VA 1B5JA 1H45A 3N5LA 5ISUA 2GHAA 2HZLA 2XXYA 1Y3NA 4NF6A 1CB6A 4R75A 1M5DA 4ZE8A 5L9MA 3CIJA 3K6XA 3RNNA 5CBSA 5I57A 1Y20A 2F7AA 3PPNA 1P1UA 3CVGA 4R2BA 3RGYA 2Y7PA 1FQAA 4ELPA 1SDXA 2Z22A 3PUYE 4IY5A 2ZYOA 4DCXA 5AA4B 1AIVA 3V83A 3HSTA 1QKAA 3K01A 2PX1A 3K6VA 5DT6A 1YTVA 5TU0A 4P0IA 2FNCA 1EZ9A 4U1OA 2A5SA 2I3VA 1LFIA 1Z7ME 4Q30B 1FTMA 4ZEBA 3S9MC 1FQBA 1B4ZA 1VR5A 1LAFE 1QW0A 3G3GA 3K1NA 4MF3A 1QJMA 4NF4B 4JBZA 1B2HA 1UIVA 2CZLA 2D3IA 3H7MA 1Z0PA 1ZJLA 4G68B 3SEWA 3EHTA 1IXCA 2I0CA 1MXXA 1QUIA 1NFTA 2X26A 3KSJA 4EQ7A 4KD5A 4UA8A 4U21A 4QSDA 5I59A 2F6PA 3ONMA 1N7WA 4DCYA 3U92A 4GL8A 2UVHA 1PDAA 4X1BA 5CRYA 1B3LA 3OXNA 2UVIA 2ESNA 4JSOA 3VLVA 3E3KA 5JTYA 4Q0CA 1FTKA 2HQ0A 4NMYA 3S2VA 3S4UA 1N04A 2I4BA 1UTBB 2RINA 1OIBA 2E1SA 3C4MA 3OSRA 4POXA 2H5YA 5FHNA 3ZKLA 5BWJA 5CMCA 1QUJA 2O7IA 1GGGA 5AA3A 3A3UA 5H8FA 3O2AA 4HW8A 3OOAA 2I6EA 3IL1B 1TFAA 4Z7EA 3QXMA 2UVJA 3FXRA 2AL5A 2OZZA 4G8HA 4WEPA 4F31B 1ZKEA 3RPWA 3O29A 3VDFA 2X9XA 1IUDA 3MP6A 2QJEA 4KCDA 2M8CA 4BDQA 4WKMA 4GOTA 4TOZA 1BKAA 1NH7A 1O64A 4YAHX 4LVQA 2X7QA 3FVKA 4GLIA 4LQ5A 1O7TA 2Q2CA 3C35A 4PQJA 1LAXA 2UYEA 4MBPA 2DS9A 3FUZA 1LRZA 4I8CA 5FTIA 4DXBA 1JEVA 3AXFA 1LFGA 1MQJA 4IY6A 4LATA 4LZ5A 4YICA 3G3HA 4FORA 4ECFA 1JNFA 1MQDA 1MXYA 3OO6A 3H6WA 3MC2A 4ESWA 1FTLA 3IX1A 1TFDA 5I58A 3PMXA 1XVYA 3CSGA 1US5A 3IO6A 3KN3A 1JVYA 2I3WA 3PPQA 2XHDA 4NF5A 1Y3QA 5I58B 2OWTA 1IXGA 3CFXA 4UACA 1I6AA 4NF6B 4NWDA 4FEDA 4XXUA 5F1QA 1NL5A 2XXHA 3H6VA 4U22A 3DLNA 1S9TA 3TCFA 3WAEA 4J2CA 3JV9A 1ZMGA 3PMVA 1SYIA 1TXFA 2HFBA 2Z23A 3LSXA 3DP6A 4HS7A 2A5TB 4PP0A 1FQCA 4G8MA 4GXAA 4OVJA 4QFLA 4DXUA 1N76A 1DTZA 1MY1A 1NNPA 1XT8A 4ZEIA 1ANFA 1MY2A 3C34A 4KQPA 2O1LA 1A8FA 1B7ZA 2HAVA 3FASA 3PPOA 5AA2B 2CA5A 1IIWA 3CFZA 1BLFA 3BKIB 1A99A 4LZ7A 5CC2A 1VFEA 1FW0A 2HXWA 3K02A 3TTRA 3OMBA 4GRKA 1MQHA 3QSLA 4Q8RA 1URDA 4GVOA 3CVRA 3FJGA 2XTLA 3N26A 1MS7A 2XXVA 1MY0A 1UTHB 1B1XA 2PT2A 4M1VA 4WXJA 3A09A 3TTLA 2DVZA 3DELB 4QFPA 2DXRA 1MDQA 2UYFA 3TCHA 1SVXB 4FI5A 3SETA 4L0RA 3EF7A 3L6GA 3O66A 5CI5A 3I5OA 3U1OA 3IJXB 2O69A 4F2OA 1FQFA 3EN3A 2O68A
chains in the Genus database with same CATH superfamily
1MRPA 1SW1A 3FBZA 3FZMB 2PT1A 3BIGA 5JTYB 2D5UA 2QFLA 2O51A 4RJZA 3ZC0A 5LOMA 3BFUA 4YKPA 3N9QA 5BR8T 3CX6B 2WWVA 4NIQA 1UTHA 1EYJA 4U4SA 4IDQA 3AA1B 4H9SE 3PPRA 3MW0A 2ZM0A 5JDLA 5AQTB 3I1AA 2RC8A 1ELJA 4PAGA 2CM0A 4PFTA 4N17A 1M5BA 2X9WA 4RK9A 5AQSB 4U2ZA 4O2AE 4C0RA 3T9XB 3FJ7A 5F24A 3UUXB 1NUWA 4CXXA 2DWJA 3TDJA 1R6ZA 3PUWE 2PVUA 2F97A 4HFEA 3JYRA 1YKHB 3RKOA 3RLFF 4DMWA 3Q9DA 1ZHCA 3N9LA 1FPJA 3DP4A 3ZYMA 2HHMA 2VPOA 2ZYMA 4TQUQ 4XKNA 2CLYC 3PURA 2VGQA 3UQ7A 2WY2A 2NWJA 2DOJA 5CB4E 3L3PA 2JQQA 1J1JA 3L09A 1UQWA 3MWBA 1VSOA 3MA9A 1G0IA 4NQ8A 4AS5A 4NEDA 4O3BA 3B57A 1AH5A 4B3TT 1LB8A 3B5MA 1ZTYA 1KWHA 3B13A 3PDYA 3ESLA 4JI2T 4HWIB 1GV8A 1NWMX 3LSVA 3RQUA 3VLUA 2QMWA 4GX4A 1FTJA 2DXYA 2BKOA 4CN1A 4FBPA 4GWXA 2DL1A 1T0KA 4HWFA 4H0WA 4B3MT 3ZSSA 3ZSFA 2DDKA 1RYXA 3ZSTA 2XXQA 3KN7A 3FXUA 2DWAA 3MZKB 3EDVA 2PFZA 5EK2A 3NBXX 3CFLA 1N7XA 3PUZE 3IJOB 2MPKA 3O6GA 1I94T 2Y7IA 4JWYA 3O1IA 3LK42 3U3IA 1AMFA 1FTOA 2BS3A 4PFPA 1RYOA 3PD8A 5CM6A 3MSTA 2D0TA 2MAWA 2LSKA 4AKHA 5LGUB 1MXUA 3WAJA 2RCAA 3THIA 1MDP1 4F6RC 5DQWA 2Z8FA 3Q5XA 5ADXL 1FPKA 1PBPA 3UFGA 4TZ4C 5L3CB 1IJ5A 4YB7A 3ZN1B 3EAMA 5IZZA 4YMBA 1WR6A 4EGWA 2IC6A 3HKEE 3K1PA 2J1DG 3MACA 3UQ4A 1M5EA 4ZS2A 2VASA 2WDVA 3U93A 2YPNA 1NNTA 2QL3A 2F6GA 1XWMA 1IXIA 2HPJA 1LBVA 4F2QA 3PU8A 3JZJA 1T8BA 1N3WA 2AE9A 5LJMA 3UU4A 2E9XB 4AB6A 3A5XA 3M65A 1JETA 2V3TA 4PE5B 4IO6A 4EQ9A 3B50A 4ISSA 1XS5A 4O4JE 1WFDA 4IIJE 2LM9A 3HKCE 2J4GA 2XWKA 4UVAB 3ZMTB 2YOEA 1MIWA 1ATGA 2OWSA 4LZ8A 2HXRA 3U72A 5L3EB 3ZMSB 2FHYA 5KCJB 3RPLA 4AKRB 3H37A 4AQFA 3TEPA 4PBQA 4HFBA 5EQAA 5DW8A 1LBYA 2XM2A 3IR1A 2F35A 3H6UA 5JDNA 1LEVA 2FJEA 2CBJA 2NXOA 4QSCA 1UTBA 1Q9DA 3ILTB 3RT6B 3TMGA 4GFRA 4XFEA 4HEAA 4NG7A 2DLRA 3LBSA 5EZYE 3TODA 2FBWA 3B6QA 1Y3PA 4GIWA 2E5VA 4PTKA 4X1KE 3CG1A 2F7CA 2FVZA 4O7MA 3VVDA 2HN1A 2ZYNA 4KP3C 4JI4T 3JC6C 3K8PC 2VT5A 2PCRA 3TZAA 4IO5A 1P1NA 1XNQT 4WBOA 2W63A 2Z8EA 2WBLA 1MNEA 5HEGA 4PF8A 2VL8A 2D21A 1LVKA 3PU5A 4P1NA 3W15B 5EYHA 1ZKBA 3R6NA 2CEXA 4DR1T 4V1Av 2Q8JA 5EYGA 4JI8T 1P1QA 3UULA 5BUUA 1ZBMA 5DEXA 1SBPA 4YKKA 3RYCE 2VOZA 2DVCA 2VKJA 3KJTA 2BVLA 2KSRA 3TLTA 3HN0A 3EHUA 5HXCA 2LOSA 3VFJA 3D0TA 4FE8A 4JBWF 1JP4A 3EABA 3CHGA 1JW1A 3V8XB 3K1SA 4ZEFA 3UIFA 5CA1E 5ICQA 2ONRA 4WZXA 4H9RC 2ZZVA 4DVDA 4EF1A 2YDQA 3FHNA 5HM4B 4PFWA 4I62A 5ET8A 1B7TA 4NX1A 3AVSA 2Y48B 3PV0F 3UU3A 4JXIA 2NVUB 2I59A 3Q29A 4HE0A 4QFNA 4F3SA 3NOHA 1QLBA 4QH1A 2XXUA 1NNKA 4P9KA 4KYSA 3Q26A 1NENA 1OVTA 5LOVE 3UUBA 3FB2A 3OENA 5AA2A 1VRBA 4ZZCA 1SPIA 3PUAA 4GX6A 4H5FA 2XQ7A 4BLAA 4H6DA 3O9PA 1YYZA 2XXRA 4ASKA 3IK6B 3IOUA 2AL4A 2D5WA 3MVZA 2HZKA 2CWOA 5ITOA 4YU0A 3GMIA 5H8NA 2RC9A 4JEUB 2KWHA 3TLSA 2BJIA 1SD3A 2A5TA 2P3VA 5J2UE 2V7MA 2I0BA 1B05A 2XAHB 4MH5A 3JAEA 1KA0A 3EHZA 1FBDA 5JDQA 4ZS3A 5AQFB 4DV3T 3FXBA 5AQIB 3PUGA 1N3XA 1CUNA 2H89A 4U22A 4MALA 3SS1A 5HWXA 2I48A 2THIA 4YSXA 3LSWA 3MZ1A 4IGTA 1G8XA 3IB0A 4PAFA 5JDHA 1FBGA 4U2RA 3AE6A 4IT4A 3VR8A 3RYDA 3FIRA 1JNZA 4XZCA 3DP7A 1XMQT 4MNIA 4OFJA 2KQZA 5AQHB 4IO4A 4BAYB 4DBQA 4AKGA 4H45A 4PE3A 4U23A 4LF9T 4PK5A 3OO8A 3SERA 1XOCA 5HEHA 4ZI3C 2DYXA 3QUFA 1VCTA 2XAQB 4KYEA 2H99A 3SZPA 5LXTE 2Y5KA 5TPAB 4YSYA 1UCUA 4ELQA 4X66T 2W00A 1B32A 1SYHA 4PFIA 4N6KA 1HSEA 3TPAA 4NTLA 2JPFA 2KZ7B 1KA1A 4QHOA 5H8NB 4RPOA 2UXDT 4DZ1A 5ITPA 4IB2A 4KR5A 1YZ0A 3AEFA 1B51A 3W9VA 3OVUA 5JH7E 2IHR1 2GHAA 4ZE8A 5CBSA 1MMNA 3CIJA 4HWHA 2F7AA 4AISA 3I9WA 4G2AA 3ZYLA 2RA1A 4L5GA 2Z22A 4M1PA 1AIVA 3HSTA 3CMLA 3M3ZB 2CCQA 4WW0A 1YTVA 2FNCA 3S9MC 3ROJA 2W66A 1QW0A 1HX8A 4MF3A 4IR8A 5AQMB 1B2HA 3H7MA 3IHRA 1LBXA 1IXCA 1MXXA 2OLTA 2XJ7A 5AQRB 3ZCJA 1NFTA 2X26A 5HXRA 2Q9QD 3KSJA 3LG7A 5I59A 4JUYA 4GWUA 1N7WA 5FBPA 4LMJA 4CI2B 1NAFA 3N9MA 4H9QC 1KZ8A 3WAKA 1B3LA 2WEFA 4ZEYA 3NZQA 2BS2A 3S4UA 2I4BA 2FJDA 3RRWA 4PAKA 1OIBA 3C4MA 4POXA 3ZKLA 5CMCA 1GGGA 3PJAA 1OWAA 2XM1A 1FJGT 3VKGA 2R8TA 2I6EA 3N2OA 4O8MA 2JIWA 1FMWA 2OZZA 1IUDA 3PE0A 3CPZA 2QJEA 4KCDA 4BDQA 4TOZA 3C64A 3TLVA 4PQJA 4MBQA 5I3SA 4MJOA 5JRCB 4HE1A 2DS9A 3FUZA 1LRZA 4DXBA 4N91A 2L3LA 4LZ5A 4YICA 3G3HA 3RHWA 1JNFA 1MXYA 4DO0A 2LEHA 1FTLA 1NUYA 5ABGA 5I58A 4H63H 3CFXA 4X8RA 2Z6EA 4FEDA 3AAAB 3FBPA 3H6VA 4J2CA 4PCDA 3PMVA 2HFBA 4UF0A 3DP6A 4QX7B 4PP0A 4GXAA 5LYJE 1NV4A 1NNPA 2CBIA 3O1HA 4KQPA 1A8FA 2HAVA 5AA2B 1A99A 2PTFA 1VFEA 2HXWA 3K02A 3TTRA 3OMBA 4GRKA 3QSLA 2D0UA 3JAFA 3FJGA 3N26A 2PT2A 2V5CA 4M1VA 3DELB 1MDQA 2OWZA 1SVXB 2LKHA 5AQUB 5JDMA 3LBXB 3L6GA 3O66A 3U1OA 1FPGA 3IJXB 2O69A 1W09A 4F2OA 1FQFA 4GBWA 3EN3A 3F31A 5LBQB 5ESYA 2G29A 3E78A 4EXLA 4PETA 4CZZB 2FIXA 5HYAA 2WM9A 4X1DA 3SRZA 1IEJA 5LBMA 3E9XA 1MIYA 4WYVA 4I55E 3QNUA 3ZEFB 4EQBA 1B4HA 3RN8A 1LKXA 5FHOA 4IDOA 3J9X1 3RT8A 2DSFA 1N36T 2MKZA 2WQYA 4MHCA 3MK7C 1DPEA 1T7SA 1RDZA 2M6IA 2PBIA 2VD2A 2K48A 4H9NC 4LUBA 4PGPA 3L39A 1CNQA 3H4ZA 1Y9UA 5EHMA 5EHSA 2C0SA 1X79A 1N33T 3MZ9A 4GWYA 5I2KB 4N78D 4KYDA 5L4EA 5L8DA 4GX3A 3TKDA 2HN2A 4B6XA 2MOZA 3UUNA 3IO4A 3IFCA 4QRZA 4UABA 3TCGA 3FVGA 3HFUA 2XQYA 1XVXA 3LBXA 4BDNA 4HWDA 2V3QA 3LUZA 2I4CA 1HFAA 3PGFA 5EQ8A 2F78A 3ANWA 4IE0A 1B3EA 3UU6A 4OFOA 2GH9A 2KNDA 3F11A 3KGCA 3IB2A 3M8UA 4OWDA 4QKNA 4OQOA 3BQLA 2HAUA 4I50E 5H6QB 1LSTA 4U4XA 1U4QA 1NV7A 2NWBA 4XIGQ 3A8YC 4F18A 2V5DA 2RF1A 3ZMUB 1MM6A 2KXPB 5IKBA 4R72A 1DOTA 2WBDA 3IAZA 4U31A 1DTGA 3OD7A 1NI9A 1JNRA 4E0WA 3V5SA 5L9OA 2DNXA 3EVYA 5TAOA 1PB7A 3DM0A 5I59B 1OVBA 3MKDA 2W62A 2Y84A 2LAOA 3I3VA 1IBMT 1N84A 3G7WA 1GR2A 3K0VA 4FATA 3K00A 2HEUA 2GHBA 2PYYA 1YXRA 3VU7H 2F36A 1JVXA 4OVQA 5A5LA 1MXVA 4YTPA 4DNDA 3UN6A 1Y4CA 4C90A 3K6UA 5LGTB 3GN5B 4MMPA 4KXPA 3G3IA 1LBCA 2OBGA 4G68A 4OX9T 4I43B 4GQOA 1HNZT 3O28A 1VDWA 4F3GA 4EF2A 3TQWA 2JMKA 2NW8A 2W0GA 1KNRA 2V93A 4CN6A 3CR9A 3RTWB 4FECA 2V4CA 2Q8MA 2WMNA 4HFIA 1R9QA 3HHGA 1A40A 3A7MA 4P0AA 2BG9C 2H25A 4H1XA 4OERA 5TPAA 2I49A 2ALUA 3ZMZB 4A56A 1ZEEA 5J16A 3PU3A 4EUOA 3PUVE 3F2EA 4BDRA 1ZV4X 5I2NB 4K0UA 4PJNA 2V7JA 4OVTA 2Q9QA 3HI2A 2UUCT 4R73A 2L8KA 3SWHA 4QXCB 3VRBA 2ANJA 4QF9A 2VKHA 2XXTA 1KEYA 1I6BA 4KX6A 2Y7WA 3P4WA 3QMFA 4ND9A 1HSJA 1B3HA 3T1HT 2IUBA 3UK4A 2BKNA 3RLFE 1LB9A 2DHRA 1UUSA 2XQ6A 1OQHA 2WZHA 4OMBA 3VHLA 4NE4A 5LTCA 1LBBA 1G73A 3CSBA 5AQQB 1OQGA 2DP8A 3OO7A 1SI1A 2EHOB 5KCJA 1YAEA 1VFDA 1MQIA 1YCJA 2WU5A 1B3GA 2XXPA 4HCWA 4IREA 1MH3A 4THIA 1POY1 3RX6A 3MYUA 2ABHA 3E0ZA 5F5WA 4TV8E 3O9XA 2LSJA 2XSBA 5L9SA 3UU5A 3TLUA 2OCUA 3O1JA 4R9GA 4UV8B 5EQ9A 1FPLA 3C98B 2ZYKA 1QULA 4JLEA 5B7DA 4P1LA 3HL6A 2QVRA 3ZYKA 4U1ZA 2Y7KA 2B65A 4LONB 1J5ET 3C33A 1D9QA 4FJPA 5H8SA 5A5XA 1YQ4A 3Q28A 5HEJA 1K9ZA 2WYPA 5FXVA 5ET7A 4BA9A 2BG9A 5DYHA 2FJAA 4IO7A 4NUUA 5F7VA 3CRBA 3ZT5A 2QA7A 3B7DA 3KFWX 4FIMA 2H4IA 3TTNA 2IC9A 2UUAT 1SQYA 4OA4A 1L0VA 1M7KA 3CQGB 3TAJA 1MPDA 1B58A 4ILCA 3T1BA 2BG9B 2Q74A 4OYJA 1IJ6A 5H8FB 1UX4A 2F3DA 4DLDA 5CA0E 4PFRA 2V6YB 2W67A 3DTOA 3NVOA 4MCOA 2XQ3A 3FZFB 4OFLA 3AE1A 2CZIA 1SHZC 5TP9A 1O63A 3KV4A 2O6AA 1DMBA 4ZHQE 5L3BB 3FVOA 2F5XA 2F8DA 4HE8A 1DU2A 3OJAA 1AJ3A 2XXWA 3WAFA 4O4HE 2QYWA 1FTAA 5AA4A 4I3EA 2JJ9A 3SESA 1BTJA 2SPCA 5J1GA 2Q9TA 2VVSA 4LN5A 1USYE 1KNZA 2REGA 4HCYA 4LFAT 1XHYA 1WCRA 2R9JA 2WDRA 4ZI3D 4G4PA 1USYH 4P3LA 2V6YA 3N9NA 1PB8A 4UXNB 4XAXB 1JQFA 2UXNB 3P4RA 1LCTA 1IMDA 5B70A 2R6GF 4ELRA 4DBRA 3CX8B 1MNDA 4PBHA 4OHFA 4H8JA 1FPDA 1FSAA 2ZZWA 4O7IA 4PK4A 1P1OA 1B6HA 3MZBA 2C5IT 4X62T 4PC9A 3O6HA 5FYMA 1BK4A 4JI5T 3PTYA 5H8QA 1DK4A 2OV9A 2GRVA 2Y7RA 5JEIA 3MVXA 2QS2A 4KHZF 1B7HA 4U3CA 4I1DA 3GA8A 4Q5TA 4KI0F 4QH5A 2ZM2A 3AE8A 3MP8A 4I4TE 4AKLA 5I2KA 3RYHE 4IE6A 2QVAA 4BJMA 2F7BA 4IO2A 3ODBA 4H9OC 3AE4A 1R1NA 2CPTA 4O94A 2X51A 4P09A 1US4A 1QSDA 2QGSA 3H06B 1H44A 1UIUA 4P11A 1IXHA 1I6ZA 5ET6A 2E0SA 1H43A 4P0GA 3ECRA 1BP5A 3ZLIA 3TTKA 3M3FA 4BJNA 1KFYA 2VPNA 1R8IA 2LE8A 3RQWA 3TELA 5I56A 3CI8A 1K9YA 4PDDA 4UV9B 5L2LA 2I58A 4NAPA 4OXVA 1AL3A 2OJTA 4H9PC 2JQHA 4WEDA 4YZZA 3P4PA 3IORA 4ZZEA 1NKXA 2B3BA 2FA7A 5H6RB 4GL0A 4MFIA 5ABFA 4OHNA 2XWVA 4NN3A 3EQ1A 4DV0T 5LCYA 4HFDA 3Q25A 2G93A 5J1DA 5EK3A 1TWYA 1D9YA 1B5JA 2Y8DA 3KBZA 1Y3NA 5I57A 5IHYA 1Y20A 5FNVE 3RGYA 2ZLYA 2Y7PA 1FQAA 5FXWA 4U72A 5AA4B 3KV9A 3K01A 3K6VA 4P0IA 5EK4A 1HS7A 2A5SA 3SOLA 4Q30B 4DR6T 1FTMA 4COFA 5FMNA 4DR7T 3G3GA 2CZLA 2D3IA 3T1YT 4G68B 3SEWA 1ZJLA 5C3JA 3EHTA 2VQET 5IUXA 4KD5A 3X1DA 5LDZA 4GL8A 2UVHA 1PDAA 2RP4A 4X1BA 1W9RA 3PUZF 4TNWA 1FJ6A 4U33A 4YHHT 2HQ0A 3AE9A 4OK0A 2RINA 2XASB 2YDSA 5BWJA 5A1LA 5LHGB 4WNKA 3A3UA 2H88A 3OOAA 3AE5A 3JCFA 4JVCA 2B4LA 2ACZA 3QXMA 5IWAT 1WR0A 3BK9A 4H63V 2AL5A 2X0YA 4G8HA 4DUYT 2KT9A 3O29A 1QUUA 3HKBE 4WKMA 3C4XA 4YSZA 3U78A 2XQ4A 5FKYA 2VKDA 5FTIA 1LFGA 1MQJA 4Z8XA 4GYRA 1NV3A 4LATA 2ZZXA 3OO6A 2FJBA 4ESWA 3EDUA 3IX1A 3C51A 3ZJ2A 5KXJA 2P9BA 4JVDA 3IO6A 2I3WA 3PPQA 5AQNB 4U2YA 2LOPA 1Y3QA 3H3AA 1UGOA 1IXGA 1NV6A 1I6AA 4XXUA 3AECA 1NL5A 4KBMB 2XXHA 1V9DA 3DLNA 1BR1A 3WAEA 5JTYA 1ZMGA 2Z23A 1FQCA 1Y01A 4IE7A 1BR0A 3AEDA 1ANFA 4EZ4A 1MY2A 1B7ZA 4U7YA 3CFZA 1FPIA 1FW0A 2XSAA 4GVOA 3CVRA 2F4VT 1SA0E 2XTLA 2XXVA 1MY0A 2L5VA 2N9DA 3A09A 3LV0A 1S35A 2LLYA 2DVZA 2I6HA 2M67A 2DXRA 2CXDA 3EF7A 5CI5A 2YKSA 1XNRT 4TUYE 4JYAT 2O68A 4TLLB 3AA6B 4DR4T 3MQ9A 4TN7B 1B7UA 1W0AA 1PB9A 1XDOA 3N94A 1OMPA 4N8YA 2Q2AA 3L8RA 4F39A 4YT0A 1IMBA 3FXQA 3PUVF 4O3CA 1W0BA 2UXXB 1QVSA 3OEKA 1AOVA 4XKPA 4AB5A 1Q35A 3UORA 5HPQA 4IGUA 5AQPB 4KUMB 2MTQA 2YJPA 1N32T 3O6IA 3N9PA 4PFYA 5ET5A 3Q5DA 1Y1ZA 3MPKA 3PUXE 3K3QC 4F1UA 2XQ9A 5KX5E 2XHEB 3V5AA 5JDGA 2REJA 2PFVA 4IL4A 3AE7A 3IA3A 1LFHA 2QRXA 3RI5A 5ABFB 2V84A 4LF8T 3I9YA 2YEVC 4KPTA 4F8HA 2DE4A 4ZECA 2N1GA 3NKZA 4B3ST 4OVRA 2V7IA 3RPLB 2KLFA 5K2XA 3TYHA 2XAGB 1D1AA 3GXAA 2CEAA 1D0XA 4N13A 2P2AA 4F22A 1IMEA 2X7PA 4MX6A 2LHRA 2BS4A 4MLQA 2MBGA 5DVJA 2VHAA 3ZN0B 5L47A 2QS1A 5HXSA 4NF5B 4TWDA 4P47A 3N6TA 3SEYA 1NV5A 2YK0A 3M3KA 1MPCA 4JWOA 4TWHA 4YKJA 5KDTB 1B52A 3R26A 3FV1A 4ONYA 4OENA 3G06A 1E7PA 2XX7A 3G3JA 4EZHA 2NOOA 2F3BA 4YB5A 3ONJA 3K6WA 4OEVA 3QK6A 4ZEDA 1UK5A 3C50A 4RYAA 5JK4A 3AE2A 5FY7A 1IMCA 1ZIUA 3S9LC 4R9FA 4OVPA 1JW5A 4BDLA 3SEXA 4U74A 4ELOA 5IZ1A 5I84A 4POWA 5GONE 1B5IA 2L9QA 3N2GE 4EEBA 4A97A 3RQTA 1Z7NE 3LR1A 2DI4A 3AXJB 2UUBT 4O2BE 1FIOA 4QXBB 3LK2B 4ZI2D 2WDQA 3N6UA 4RXLA 4XKRA 3RC8A 4FEBA 3VVFA 3C36A 2DQVA 3AVRA 2DWHA 2NR4A 2I0MA 3O4XE 3GBBA 1HX1B 2LRLA 1N0TA 1PBQA 4JI7T 1MPBA 4XKQA 3C32A 1YD8G 1S7YA 4IE4A 1URSA 3AA0B 4AXPA 4X65T 2UXCT 1M5CA 4GF8A 4JWXA 4AI6A 3HPIA 4X5TA 3MUQA 3PUSA 3T9UA 4KHZE 3D4GA 2WCAA 3H6TA 2QVUA 4LFCT 4N15A 4OETA 3C31A 3IB1A 3PUQA 4X48A 3KDSE 1U5PA 4NXMT 3OBVE 1ZLQA 2PMSA 3SDFA 3CIRA 5JR9A 4QFKA 4YB6A 1F9BA 4A98A 4AQ4A 1HSLA 4HTGA 4EYYR 3IEEA 3GYYA 3GZGA 4JI0T 4DI4B 1B46A 2WS3A 3B6TA 3CG3A 1LVFA 5K2YA 5LMUT 1NV2A 4UELA 1SUMB 3BQIA 3TKLB 4BDMA 3LK3B 5JRCA 2LSYA 3NRXA 1P99A 2BBJA 3KG2A 3ILUB 3OYXA 2VB6A 4K3FA 4OYVA 4DV7T 4LP2B 3VRAA 2YINA 4NXNT 4Z90A 5I7IA 4AIUA 3E4RA 5DEXB 4C1TA 1MXZA 5AQGB 3AEEA 2YLNA 2X9HA 4ZOLE 3H3GA 1LCFA 1INPA 1P1WA 5I57B 2K3WA 2R6GE 1QUKA 4A5XA 2VD3A 4JVIA 2HHHT 2FUPA 2QPQA 4H8IA 3KEIA 3TQLA 3CKDA 2CMOA 2P1SA 4MEVA 1NEKA 1SI0A 2KWIB 3UFEA 3BBRA 1CE2A 1NV0A 2V25A 5L3GB 4AQYT 2QVVA 3OTOT 3A3CA 4MFRA 3VXCA 4DIGA 1FJ9A 1Y64B 2WB5A 4PK6A 5AE4A 4DMVA 3P7IA 4MNCA 1FEWA 3MBPA 3ZKKA 2VVNA 3AEAA 3LJCA 3Q5EA 3RF1A 1B0HA 2CWYA 2RPAA 1H3DA 4N4UA 4X04A 1BIYA 1FBCA 2N2NA 4O8SA 2W7YA 1B9JA 3FATA 3S9NC 1S50A 1US7B 4IDNA 3Q27A 3EUHA 4YHJA 2DWKA 3ONXA 4QSEA 4FAJA 4GWZA 4CI1B 1FPBA 4EXKA 1A7LA 2IA4A 1H7CA 3VR9A 4NF8B 2GFEA 3HO7A 1IAPA 5FP3A 5FXXA 3DP8A 2W61A 2UVGA 1WRDA 3BFTA 3HA4A 3TLWA 4MIJA 3RTFB 4R6HA 1FBPA 5IAIA 3NRYA 3VLWA 3PUWF 1Y1MA 3PMWA 5I2NA 1OEDC 4PAIA 3MXZA 1D0YA 2XXKA 1MM7A 3PTRB 1XI6A 2ONKE 4ZDMA 2XWOA 4N6DA 3B6WA 1A8EA 5J2TE 4XBFB 4PJLA 3S9EA 5FY1A 5ELVA 3VVEA 4DUZT 3U8QA 1T98A 3UGWA 3ZT7A 3P4SA 4F3BA 1FRPA 3BIHA 1LBZA 2IW5B 4NHBA 4NF8A 1XMOT 4JI3T 2VWAA 3RGLA 2WBBA 4R6YA 2LHNA 3TTMA 4F1YA 4JI6T 2G0UA 2BJJX 3KC0A 2PJQA 2FYIA 3LSLA 1R9LA 3QB5K 5LG3A 2BKPA 2BZBA 2IAKA 3OO9A 4DV5T 2M6BA 4PW8A 5DQVA 2EHOC 4LF4T 1ZP0A 2ZNUA 2ONSA 4ZE9A 2XA5A 3QAXA 5AQOB 4IHJE 3FXEB 3PD9A 4I3YA 4LQ2A 4F31B 4AKIA 3KSXA 2JJKA 4RNSA 5LNKA 2K5BB 2OA5A 3T96B 3KBRA 1OLCA 1J5WA 2V7KA 4YMAA 3SFDA 5EYFA 4HFCA 1IITA 1G0HA 5L3FB 4MNPA 4PDHA 3EHSA 1LAHE 4I0UA 3ZKRA 5JTGA 3QYTA 5HBCA 4GIZA 3U65A 2X0HA 1RDXA 5LJNA 4B3RT 1BR4A 2BVMA 1SW2A 3K1MA 3L6HA 3OSQA 2CMRA 4X1YE 3HHFA 3KV6A 3FJMA 4O3AA 1MMAA 1VE4A 2X67A 1IMFA 2IEEA 1HF8A 3KFMA 2YDRA 3JADA 3N5LA 5F3JA 1FPFA 2HZLA 3RRCA 1CB6A 5L9MA 1MMDA 1P1UA 3CVGA 2Y6XA 2V26A 4ELPA 1SDXA 3PUYE 5AQJB 2ZYOA 3I0OA 3V83A 1QKAA 4HWCA 5JVDE 1EZ9A 2I3VA 1Z7ME 1FQBA 2D9DA 3K1NA 1QJMA 1UIVA 1X9BA 2XQ8A 3UT5E 5BMVE 2WX9A 3ZMVB 5JQGE 4EQ7A 4AS4A 2ZMAA 2F6PA 2Y5LA 2JQ9A 3KBTA 2NOXA 4GWWA 2NTXA 1FBFA 4UVBB 5CRYA 2UVIA 5AFUL 5AQKB 3OKQA 3MJXA 3VLVA 4AQFC 4Q0CA 1FTKA 4NMYA 5DABA 5ABEA 2WP9A 2D2SA 4ILUA 3RIUC 3OSRA 4HFVA 2H5YA 1QUJA 4HXVA 3CQXC 1VOMA 5IZ3B 4GKJT 3O2AA 4HW8A 3E08A 4DR2T 2P3NA 3IL1B 2UVJA 4WEPA 4ANJA 1ZKEA 3ZCIA 5CJ5A 2XQAA 2X9XA 3VDFA 3MP6A 1FPEA 2M8CA 1BKAA 4YAHX 4LVQA 3FVKA 4GLIA 4LQ5A 2VQFT 2X66A 3QC9A 1OEDA 3P4QA 2Q2CA 3C35A 1ZOYA 4YY3T 1LAXA 2K24A 4UF0B 5KMGP 3RPUA 1OXZA 5J0ZA 2PG8A 3AXFA 1MMGA 2BDEA 4FORA 3CQCB 4ECFA 4NGUA 3LFMA 4HE2A 3ONLC 3CSGA 4OFZA 3FZHB 4ILAA 1JVYA 4EXTA 2B76A 4UACA 4NF6B 4NWDA 1OEDE 3KV5A 3RIFA 3TCFA 1TXFA 1IBLT 2PFYA 5FVLA 4OVJA 3T8OA 3C4ZA 3RH3A 1HNXT 1MY1A 2E8IA 2A2FX 4ZEIA 3BQKA 3C34A 4MLKA 3PPOA 1IIWA 4LMKA 4LZ7A 4OANA 2LRKA 3CWZB 4XEQA 4Q8RA 2KR0A 1DCUA 4HGAA 4WXJA 4CI3B 4DV1T 3Q2MA 4PNIA 5HEUA 3TCHA 2HH7A 1GQEA 4LFBT 3WI3A 4L0RA 2ODUA 2CHNA 4IE5A 4P56A 3T9VA 3TUSA 3MVWA 1Q1KA 2O84X 4G8NA 4PFUA 5L3DB 3IOTA 5KDTA 2C5JA 5KDMC 2E9XD 3AE3A 2CZHA 2WWUA 4UR9A 1KK7A 4M4GA 1EU8A 1LLSA 5LA6E 4P1EA 1A54A 1EH3A 4R2FA 4OZ9A 2LSGA 1WODA 4NF4A 4PF6A 4QBAA 4ZI7E 1I69A 2ZM6T 3F57A 2WAUA 4XTCQ 5ICTA 1PC3A 1UURA 5M2VA 2IMLA 2XXIA 4DR5T 2J62A 4JSDA 1URGA 3RC3A 4CXYA 3H3MA 4F3PA 3B8BA 5AQLB 1QKBA 4QWNB 3MPLA 2V3UA 3K4UA 3OEMA 3LC8A 2WSSV 3FV2A 2E2AA 1I6QA 2QMXA 1YW0A 5HEOA 1WVJA 4GD5A 5HXEA 3UA8A 1LBWA 1ZU0A 4JV5T 2HCAA 3LUYA 3W15C 1D4NA 5FTHA 5HAXA 2E5LT 4QXDA 3AA7B 1IZ1A 2B3FA 1LGBC 3MP1A 4L9IA 3VE1B 3FD3A 3QUJA 2XAJB 3IFAA 2JRKA 5LHHB 5DVIA 4X20E 2B1EA 4IO3A 1YKEB 1WYCA 2XQ5A 1EYKA 1LAGE 4I9DA 3FZVA 1DSNA 1B0LA 3K3OA 1WDNA 4RK2A 4YXDA 3A29A 1XC1A 4X1IE 5IYZE 3C9HA 3K2DA 4H5GA 4H65A 3AAIA 5DVFA 3VXBA 2A9UA 1MY3A 5A5XB 1RKMA 2KMFA 3KZGA 3M3LA 3GLBA 1B40A 2UXAA 3HKDE 4E7SA 3T93B 4IL9A 5FL1A 1O3XA 4ZS9A 1OLAA 4KFQA 2OX3A 1S94A 2B4MA 5AA1A 3IF8B 4GWOA 1DPPA 3RKGA 4OVSA 4EDPA 5JREA 1B1HA 1FBEA 3C4WA 1HG5A 2EHOA 2H98A 3EPEA 5AQVB 1H76A 5FL0A 3T9HB 1HG2A 4KI0E 4HTEA 4QHQA 1T72A 3J7Yq 2IIUA 4GK5E 4EYUA 2ODVA 4R6KA 2XX8A 3ZJ1A 2RC7A 1N34T 2CHOA 5HCJA 5C8YE 1D0ZA 2IDOB 3KVBA 1IMAA 3FXDB 4ZZAA 3MAMA 4C1UA 2QRYA 2OK2A 5I56B 4ADZA 2YN6A 2WU2A 4DV2T 2O7UA 1MXWA 2XD2A 3PUXF 3ZS6A 1NUZA 5FVKA 2QS4A 3IOVA 3PPPA 2X9YA 4DDDA 4ERRA 4KCCA 4YJ2E 2VL0A 3KOTA 5I5PA 2P0SA 3R84B 2XWIA 1EZ3A 4ZI2C 2UU9T 4YLHA 4DE8A 3QIMA 4GYSA 4U7IA 3KVAA 2DE2A 2XX9A 4N07A 4L17A 3ANWB 2E9XC 2QSXA 2H3RA 3NZPA 5H8HA 4F19A 2NW9A 3RY3A 3E79A 5HWYA 3KN8A 1IZNB 2WKYA 3O97A 4ILBA 1QGXA 1FMVA 1NV1A 4QXHB 4MAGA 5IGAA 5KZTA 4H46A 4PFBA 1YXIA 2BG9E 3QOFA 2DWIA 4DIDB 3RIAA 1FQDA 1GVCA 4TX5A 1MIVA 1NMUA 2XD3A 5H8HB 3ZT6A 1HNWT 4LA9A 2QS3A 1CHUA 2VK9A 5ABHA 4EEDA 1TT1A 4F29A 4YTNA 3SEUA 1II5A 3FZLB 5LHIB 5CC2A 3GBAA 4GBVA 4ISTA 3PV0E 2YU2A 2WYKA 2AYSA 1IQ7A 1OEDB 2JMHA 3UUMA 2KINB 3N9OA 2ACXA 4GKKT 5TP9B 4BDOA 3V5UA 4UEMA 3SKPA 3FZKB 3R6UA 4NWCA 2WZIA 4UIGA 2LJLA 3HV1A 5CBRA 3FGSA 1MQGA 2CRBA 2H9BA 4R74A 1A55A 3ZPOA 1POTA 4DXCA 2OLBA 4O4IE 4CXWA 3G3KA 4OYKA 4ISUA 5ETWA 4G2ZA 1MH4A 2PBWA 2CE7A 2X68A 1HCIA 2WMOA 4F1VA 1Y4TA 1PEBA 2BBHA 2LKGA 4PJMA 2DE3A 1HR0T 2XPKA 2AXDS 4IGRA 1D3KA 4P8BA 4EB6E 4GXSB 1FCKA 2RCBA 1MY4A 3CX7B 3I6VA 1NH8A 3MVYA 2XZEA 4JI1T 1JEUA 3T0JA 4K0KT 2CEYA 2GQ1A 3AAEB 4NPPA 5IZ3A 3D4CA 3FBLA 3GWHA 3TFLA 1AWBA 2ZMBA 3KOSA 4QFOA 2W2UA 1JW4A 2NW7A 3VV5A 3E22E 4YKIA 2AIXA 1SW4A 4OEUA 4KMCA 1D9VA 1B3FA 4O4LE 1IBKT 3EKIA 4C91A 4OTEA 3KJ7A 2FIEA 3U92A 2DCFA 3IOWA 5FY0A 3U94A 4Z0IA 5DJQC 2V6XA 2V7LA 1XDPA 4RY1A 2KLQA 2XXXA 4CQIA 4OESA 4G61A 2R71A 3MJNA 3T22A 2XAFB 5LGNB 2RKMA 1D1CA 4X9TA 4G63A 4IDZA 5CGMA 5JDFA 5HXHA 3CK6A 3G3FA 5M4YA 4RA1A 2CLYB 4TLMB 3USDA 4JDFA 2NUVA 1SW5A 4HKAA 1NNFA 4RPNA 1EZPA 4N6PA 3PUYF 2XY8B 3H03A 3UP9A 3W9WA 3PJAJ 4EV6A 1YPNA 2ES0A 3V89B 4NUVA 3R7XA 4LF5T 4GK0E 2FBPA 4I40A 3OELA 4TWFA 4LF6T 5CMBA 1BR2A 4X64T 2ZNTA 2F34A 4YTMA 4ZEKA 1MG1A 2C5KT 2K9AA 4EOZB 2O1MA 1M62A 3VKHA 1KF6A 3ETUA 5JR9B 4MLVA 2LM2A 3RUMA 1EYIA 1FQEA 2CXLA 4G77A 3SEVA 2LT3A 3RYFE 1HTJF 2DWGA 2Q88A 2Q89A 4YFSA 1GTKA 3LSFB 3AEBA 4GWSA 4UVCB 5EQ7A 4ESXA 2XUEA 1J1NA 3AXJA 2ZNSA 3OYZA 2A72A 3HCQA 4H67A 1L5TA 4G68C 3DJBA 5AA2D 5LG4A 1EZOA 3ZC1A 1M5FA 1E2AA 3SFEA 5DTBA 2Z8DA 3FVNA 5CMMA 5JR9C 2W4XA 4E0XA 5FXZA 3KBUA 5CFBA 3E13X 4JB7A 2VP1A 5H8QB 1B5HA 3T66A 3RYIE 2ZXTA 3KINB 4GOUA 3OPCA 2CZKA 5LB7B 5FHMA 3JC6D 1E1HB 5CMKA 1H45A 5ISUA 1D1BA 2CXFA 2XXYA 4NF6A 4QX8B 1M5DA 4R75A 3K6XA 2Q9QC 2UXBT 3RNNA 1SE7A 3LDQB 3GN5A 3PPNA 1WLXA 4P0BA 4R2BA 4Q25A 4IY5A 4DCXA 4YJ3E 4ZZBA 5TU0A 2X0LB 5DT6A 2PX1A 4DV6T 2NTYA 4U1OA 4KHPT 1LFIA 3I0QA 4ZEBA 1B4ZA 1VR5A 1LAFE 1XZYA 4NF4B 4JBZA 3IBPA 4FJOA 1Z0PA 2I0CA 1QUIA 4IDPA 3ABVA 3AEGA 3QB5A 4QSDA 4U21A 3ONMA 4UA8A 5IM2A 4DCYA 2LSIA 4MHFA 1Z8UA 4N81A 3OXNA 3D1RA 2ESNA 3EI0A 4JSOA 1NUXA 4EIWA 4LF7T 3P8CD 3E3KA 3S2VA 2H7VC 2A3DA 4N8GA 1N04A 4Z91A 1UTBB 3N2KE 4ZXLA 2E1SA 4AQGA 5FHNA 2JQKA 4DV4T 2O7IA 4NF0A 5AA3A 4EAHA 5H8FA 5HCMA 2Q9QB 5F8PA 4XF5A 4DI3D 4PGNA 2YU1A 3UTKA 1TFAA 4Z7EA 5L4HA 3FXRA 1WYBA 2V1DB 3RPWA 4GOTA 1NH7A 1UX5A 2NP9A 1O64A 2X7QA 3KC1A 1O7TA 2UYEA 4MBPA 5LMNT 4I8CA 4PJJA 2V8SV 1JEVA 4IY6A 4E7ZA 2ZM8A 3RIUA 1KNPA 4HN9A 2VURA 1MQDA 3UU8A 2HPLA 1RDYA 3H6WA 3AB3B 3MC2A 4JEHB 3ETVA 1DBZA 1TFDA 3K3NA 4WBNE 3PMXA 1XVYA 3NWIA 3P50A 2MYSA 1VCSA 1US5A 3KN3A 2XHDA 4NF5A 5I58B 2OWTA 2VKOA 5F1QA 2E9XA 1S9TA 3HR0A 1FBHA 3JV9A 1SYIA 3LSXA 4QH4A 2HPGA 4HS7A 5C2TA 2A5TB 4G8MA 4QFLA 5LP6E 4DXUA 1N76A 4CN4A 1DTZA 5E0OA 1XT8A 2H7OA 3Q5WA 2O1LA 3FASA 3ISPA 2CA5A 4TV9E 1YQ3A 1BLFA 3BKIB 5T3JA 4TNVA 4HFHA 2J47A 2GK9A 1MQHA 1URDA 1MS7A 1UTHB 1B1XA 3TTLA 4QFPA 2UYFA 2EHOD 4FI5A 3SETA 4DR3T 3I5OA 4LMLA 4PFOA
chains in the Genus database with same CATH topology
1MRPA 1SW1A 3FBZA 2PT1A 5JTYB 2D5UA 2O51A 4RJZA 3ZC0A 5LOMA 3BFUA 4YKPA 3N9QA 3CX6B 1UTHA 4U4SA 3AA1B 4H9SE 3PPRA 3MW0A 2ZM0A 5JDLA 3I1AA 2RC8A 1ELJA 4PAGA 2CM0A 4PFTA 1M5BA 2X9WA 4RK9A 4O2AE 4C0RA 3T9XB 3FJ7A 3UUXB 4CXXA 2DWJA 3TDJA 1R6ZA 3PUWE 2PVUA 2F97A 3JYRA 1YKHB 3RKOA 4DMWA 3Q9DA 1ZHCA 3N9LA 3DP4A 3ZYMA 2ZYMA 4TQUQ 4XKNA 2CLYC 3PURA 2VGQA 2NWJA 2DOJA 5CB4E 3L3PA 2JQQA 3L09A 1UQWA 3MWBA 1VSOA 3MA9A 4NEDA 4O3BA 3B57A 1AH5A 1LB8A 1ZTYA 1KWHA 3B13A 3PDYA 3ESLA 1GV8A 1NWMX 3VLUA 2QMWA 1FTJA 2DXYA 1T0KA 4H0WA 3ZSFA 1RYXA 2XXQA 3KN7A 3FXUA 2DWAA 3MZKB 3EDVA 3PUZE 5EK2A 3NBXX 3CFLA 1N7XA 3IJOB 3O6GA 2Y7IA 4JWYA 3O1IA 3LK42 3U3IA 1AMFA 1FTOA 4PFPA 1RYOA 3PD8A 5CM6A 2D0TA 2LSKA 4AKHA 5LGUB 1MXUA 3WAJA 2RCAA 3THIA 1MDP1 4F6RC 5DQWA 2Z8FA 3Q5XA 5ADXL 1PBPA 5L3CB 4TZ4C 1IJ5A 4YB7A 3ZN1B 4YMBA 1WR6A 2IC6A 3HKEE 3K1PA 2J1DG 3MACA 1M5EA 4ZS2A 2VASA 3U93A 2YPNA 2QL3A 1NNTA 2F6GA 1IXIA 2HPJA 4F2QA 3PU8A 3JZJA 1N3WA 5LJMA 2E9XB 4AB6A 3A5XA 3M65A 1JETA 2V3TA 4PE5B 4IO6A 4EQ9A 4ISSA 1XS5A 4O4JE 4IIJE 2LM9A 3HKCE 4UVAB 3ZMTB 1MIWA 1ATGA 2OWSA 4LZ8A 3U72A 5L3EB 3ZMSB 5KCJB 4AKRB 3H37A 4AQFA 3TEPA 3IR1A 2F35A 3H6UA 5JDNA 2NXOA 4QSCA 1UTBA 3RT6B 3ILTB 3TMGA 4GFRA 4HEAA 2DLRA 3LBSA 5EZYE 3TODA 3B6QA 1Y3PA 4GIWA 4X1KE 3CG1A 2F7CA 3VVDA 2ZYNA 4KP3C 3JC6C 3K8PC 3TZAA 4IO5A 1P1NA 4WBOA 2W63A 2Z8EA 2WBLA 1MNEA 2VL8A 2D21A 1LVKA 3PU5A 3W15B 1ZKBA 3R6NA 4V1Av 2Q8JA 1P1QA 3UULA 5BUUA 1ZBMA 5DEXA 1SBPA 4YKKA 3RYCE 2VOZA 2DVCA 2VKJA 3KJTA 2BVLA 3HN0A 3EHUA 5HXCA 2LOSA 3VFJA 3D0TA 4FE8A 1JW1A 3V8XB 3UIFA 4ZEFA 5CA1E 5ICQA 2ONRA 4H9RC 4EF1A 4DVDA 3FHNA 5HM4B 4PFWA 4I62A 1B7TA 3AVSA 2Y48B 4JXIA 2NVUB 2I59A 3Q29A 4F3SA 4QFNA 2XXUA 1NNKA 4KYSA 3Q26A 1OVTA 5LOVE 3FB2A 3OENA 5AA2A 1VRBA 3PUAA 4H5FA 4BLAA 4H6DA 3O9PA 2XXRA 4ASKA 3IK6B 3IOUA 2AL4A 2D5WA 3MVZA 2HZKA 2CWOA 5ITOA 4YU0A 3GMIA 5H8NA 2RC9A 4JEUB 2KWHA 1SD3A 2A5TA 5J2UE 2V7MA 2I0BA 1B05A 2XAHB 4MH5A 5JDQA 4ZS3A 3PUGA 1N3XA 1CUNA 4U22A 4MALA 3SS1A 5HWXA 2I48A 2THIA 3LSWA 3MZ1A 4IGTA 1G8XA 3IB0A 5JDHA 4U2RA 3FIRA 4XZCA 3DP7A 4OFJA 4IO4A 4BAYB 4DBQA 4AKGA 4U23A 4PK5A 3OO8A 3SERA 1XOCA 4ZI3C 2DYXA 3QUFA 2XAQB 4KYEA 2H99A 5LXTE 5TPAB 1UCUA 4ELQA 2W00A 1B32A 1SYHA 1HSEA 3TPAA 4NTLA 2JPFA 2KZ7B 4QHOA 5H8NB 4RPOA 4DZ1A 5ITPA 4IB2A 4KR5A 1B51A 3W9VA 5JH7E 2GHAA 4ZE8A 5CBSA 1MMNA 3CIJA 2F7AA 3I9WA 4G2AA 3ZYLA 2RA1A 4L5GA 2Z22A 4M1PA 1AIVA 3HSTA 3CMLA 4WW0A 2CCQA 1YTVA 2FNCA 3S9MC 1QW0A 1HX8A 4MF3A 1B2HA 3H7MA 3IHRA 1IXCA 1MXXA 3ZCJA 1NFTA 2X26A 3KSJA 5HXRA 2Q9QD 3LG7A 5I59A 4JUYA 1N7WA 4CI2B 1NAFA 3N9MA 4H9QC 3WAKA 1B3LA 3NZQA 3S4UA 2I4BA 3RRWA 1OIBA 3C4MA 4POXA 3ZKLA 5CMCA 1GGGA 1OWAA 3VKGA 2I6EA 3N2OA 1FMWA 2OZZA 1IUDA 3PE0A 3CPZA 2QJEA 4KCDA 4BDQA 4TOZA 3C64A 4PQJA 4MBQA 5JRCB 2DS9A 3FUZA 1LRZA 4DXBA 2L3LA 4LZ5A 4YICA 3G3HA 1JNFA 1MXYA 4DO0A 2LEHA 1FTLA 5I58A 4H63H 3CFXA 2Z6EA 4FEDA 3AAAB 3H6VA 4J2CA 3PMVA 2HFBA 4UF0A 3DP6A 4QX7B 4PP0A 4GXAA 5LYJE 1NNPA 3O1HA 4KQPA 1A8FA 2HAVA 5AA2B 1A99A 1VFEA 2HXWA 3K02A 3TTRA 3OMBA 4GRKA 3QSLA 2D0UA 3FJGA 3N26A 2PT2A 4M1VA 3DELB 1MDQA 1SVXB 5JDMA 3LBXB 3L6GA 3O66A 3U1OA 3IJXB 2O69A 4F2OA 1FQFA 3EN3A 3F31A 5LBQB 2G29A 4EXLA 4PETA 4CZZB 5HYAA 2WM9A 4X1DA 3SRZA 1IEJA 5LBMA 3E9XA 1MIYA 4I55E 3ZEFB 4EQBA 1B4HA 3RN8A 1LKXA 5FHOA 3J9X1 3RT8A 2DSFA 4MHCA 3MK7C 1DPEA 2VD2A 2PBIA 2K48A 4H9NC 4LUBA 3H4ZA 5EHMA 1Y9UA 5EHSA 2C0SA 1X79A 3MZ9A 5I2KB 4N78D 4KYDA 5L8DA 3TKDA 4B6XA 2MOZA 3UUNA 3IO4A 4QRZA 3TCGA 3FVGA 2XQYA 1XVXA 3LBXA 4BDNA 2V3QA 2I4CA 1HFAA 3PGFA 2F78A 3ANWA 4IE0A 1B3EA 4OFOA 2GH9A 2KNDA 3F11A 3KGCA 3IB2A 3M8UA 4OWDA 4QKNA 4OQOA 3BQLA 2HAUA 4I50E 5H6QB 1LSTA 4U4XA 1U4QA 2NWBA 4XIGQ 4F18A 2RF1A 3ZMUB 1MM6A 2KXPB 5IKBA 4R72A 1DOTA 3IAZA 1DTGA 3OD7A 4E0WA 3V5SA 5L9OA 2DNXA 3EVYA 5TAOA 1PB7A 3DM0A 5I59B 1OVBA 3MKDA 2W62A 2Y84A 2LAOA 3I3VA 1N84A 3G7WA 1GR2A 3K0VA 4FATA 3K00A 2HEUA 2GHBA 2PYYA 3VU7H 2F36A 1JVXA 1MXVA 4DNDA 3UN6A 1Y4CA 4C90A 3K6UA 5LGTB 3GN5B 3G3IA 1LBCA 2OBGA 4G68A 4I43B 4GQOA 3O28A 4F3GA 4EF2A 3TQWA 2JMKA 2NW8A 2W0GA 2V93A 3CR9A 3RTWB 4FECA 2WMNA 1R9QA 3HHGA 1A40A 4P0AA 2H25A 4H1XA 4OERA 5TPAA 2I49A 2ALUA 3ZMZB 4A56A 1ZEEA 3PU3A 4EUOA 3PUVE 3F2EA 4BDRA 1ZV4X 5I2NB 4K0UA 4PJNA 2V7JA 2Q9QA 3HI2A 4R73A 2L8KA 3SWHA 4QXCB 2ANJA 4QF9A 2VKHA 2XXTA 1I6BA 2Y7WA 4ND9A 1HSJA 1B3HA 3UK4A 3RLFE 1LB9A 2DHRA 1OQHA 4OMBA 3VHLA 4NE4A 1LBBA 1G73A 3CSBA 1OQGA 2DP8A 3OO7A 1SI1A 2EHOB 5KCJA 1YAEA 1VFDA 1MQIA 1YCJA 1B3GA 2XXPA 4HCWA 4THIA 1MH3A 1POY1 3RX6A 2ABHA 3E0ZA 4TV8E 3O9XA 2LSJA 5L9SA 2OCUA 3O1JA 4R9GA 4UV8B 3C98B 2ZYKA 1QULA 4JLEA 5B7DA 3HL6A 3ZYKA 4U1ZA 2Y7KA 2B65A 4LONB 3C33A 4FJPA 5H8SA 5A5XA 3Q28A 5FXVA 4BA9A 5DYHA 4IO7A 4NUUA 5F7VA 3CRBA 2QA7A 3B7DA 3KFWX 4FIMA 2H4IA 3TTNA 2IC9A 1SQYA 3CQGB 3TAJA 1MPDA 1B58A 4OYJA 1IJ6A 5H8FB 1UX4A 4DLDA 5CA0E 3DTOA 4OFLA 1SHZC 5TP9A 1O63A 3KV4A 2O6AA 1DMBA 4ZHQE 5L3BB 3FVOA 2F5XA 2F8DA 4HE8A 3OJAA 1AJ3A 2XXWA 3WAFA 4O4HE 5AA4A 2JJ9A 3SESA 1BTJA 2SPCA 5J1GA 2Q9TA 1USYE 1KNZA 2REGA 4HCYA 1XHYA 2R9JA 4ZI3D 4G4PA 1USYH 3N9NA 1PB8A 4UXNB 4XAXB 1JQFA 2UXNB 1LCTA 5B70A 4ELRA 4DBRA 3CX8B 1MNDA 4OHFA 4H8JA 4PK4A 1P1OA 1B6HA 3MZBA 2C5IT 3O6HA 5FYMA 5H8QA 2GRVA 2Y7RA 5JEIA 3MVXA 2QS2A 1B7HA 4I1DA 3GA8A 4Q5TA 2ZM2A 3MP8A 4I4TE 4AKLA 5I2KA 3RYHE 4IE6A 4BJMA 2F7BA 4IO2A 3ODBA 4H9OC 1R1NA 2X51A 4P09A 1US4A 1QSDA 2QGSA 3H06B 1H44A 1UIUA 4P11A 1IXHA 2E0SA 1H43A 4P0GA 3ECRA 1BP5A 3ZLIA 3TTKA 3M3FA 4BJNA 3TELA 2LE8A 5I56A 3CI8A 4UV9B 5L2LA 2I58A 4OXVA 1AL3A 2OJTA 4H9PC 4WEDA 4YZZA 3IORA 4ZZEA 1NKXA 2B3BA 2FA7A 5H6RB 4GL0A 4MFIA 4OHNA 3EQ1A 5LCYA 3Q25A 2G93A 5J1DA 5EK3A 1TWYA 1D9YA 1B5JA 2Y8DA 1Y3NA 5I57A 5IHYA 1Y20A 5FNVE 3RGYA 2ZLYA 2Y7PA 1FQAA 5FXWA 4U72A 5AA4B 3KV9A 3K01A 3K6VA 4P0IA 5EK4A 1HS7A 2A5SA 3SOLA 4Q30B 1FTMA 5FMNA 3G3GA 2CZLA 2D3IA 3SEWA 4G68B 1ZJLA 3EHTA 4KD5A 4GL8A 2UVHA 1PDAA 2RP4A 4X1BA 2HQ0A 4OK0A 2RINA 2XASB 5BWJA 5A1LA 5LHGB 4WNKA 3A3UA 3OOAA 3QXMA 3BK9A 4H63V 2AL5A 4G8HA 2KT9A 3O29A 1QUUA 3HKBE 4WKMA 3C4XA 3U78A 5FTIA 2VKDA 1LFGA 1MQJA 4Z8XA 4GYRA 4LATA 3OO6A 4ESWA 3EDUA 3IX1A 3C51A 3ZJ2A 2P9BA 3IO6A 2I3WA 3PPQA 2LOPA 1Y3QA 3H3AA 1IXGA 1I6AA 4XXUA 1NL5A 4KBMB 2XXHA 1V9DA 3DLNA 1BR1A 3WAEA 5JTYA 1ZMGA 2Z23A 1FQCA 4IE7A 1BR0A 1ANFA 4EZ4A 1MY2A 1B7ZA 3CFZA 1FW0A 4GVOA 3CVRA 1SA0E 2XTLA 2XXVA 1MY0A 2N9DA 3A09A 1S35A 2DVZA 2M67A 2DXRA 2CXDA 3EF7A 5CI5A 4TUYE 2O68A 4TLLB 3AA6B 3MQ9A 4TN7B 1B7UA 1PB9A 3N94A 1OMPA 2Q2AA 4F39A 3FXQA 4O3CA 2UXXB 1QVSA 3OEKA 1AOVA 4XKPA 4AB5A 1Q35A 3UORA 5HPQA 4IGUA 4KUMB 2MTQA 2YJPA 3O6IA 3N9PA 4PFYA 3MPKA 1Y1ZA 3PUXE 3K3QC 4F1UA 5KX5E 2XHEB 3V5AA 5JDGA 2REJA 2PFVA 1LFHA 2V84A 3I9YA 2YEVC 4KPTA 2DE4A 4ZECA 2N1GA 2V7IA 2KLFA 5K2XA 3TYHA 2XAGB 1D1AA 3GXAA 2CEAA 1D0XA 4N13A 2P2AA 4F22A 2X7PA 2LHRA 4MLQA 5DVJA 2MBGA 2VHAA 3ZN0B 2QS1A 5HXSA 4NF5B 3SEYA 3N6TA 2YK0A 3M3KA 1MPCA 4JWOA 4YKJA 5KDTB 1B52A 3R26A 3FV1A 4ONYA 4OENA 2XX7A 3G3JA 4EZHA 2NOOA 4YB5A 3K6WA 4OEVA 3QK6A 4ZEDA 3C50A 4RYAA 5JK4A 5FY7A 1ZIUA 3S9LC 4R9FA 1JW5A 4BDLA 3SEXA 4U74A 4ELOA 5I84A 4POWA 5GONE 1B5IA 2L9QA 3N2GE 3RQTA 1Z7NE 3LR1A 2DI4A 4O2BE 1FIOA 4QXBB 3LK2B 4ZI2D 3N6UA 4RXLA 4XKRA 3RC8A 4FEBA 3VVFA 3C36A 2DQVA 3AVRA 2DWHA 3O4XE 3GBBA 1N0TA 1PBQA 1MPBA 4XKQA 3C32A 1YD8G 1S7YA 4IE4A 1URSA 3AA0B 4AXPA 1M5CA 4GF8A 4JWXA 4AI6A 3HPIA 3MUQA 3PUSA 3T9UA 4KHZE 3D4GA 3H6TA 4OETA 3C31A 3IB1A 3PUQA 4X48A 3KDSE 1U5PA 3OBVE 1ZLQA 2PMSA 3SDFA 5JR9A 4QFKA 4YB6A 1F9BA 4AQ4A 1HSLA 4HTGA 4EYYR 3IEEA 3GZGA 1B46A 3B6TA 3CG3A 1LVFA 5K2YA 4UELA 3BQIA 3TKLB 4BDMA 3LK3B 5JRCA 2LSYA 3NRXA 1P99A 3KG2A 3ILUB 3OYXA 2VB6A 4K3FA 4OYVA 4LP2B 2YINA 3E4RA 5DEXB 4C1TA 1MXZA 2YLNA 2X9HA 4ZOLE 3H3GA 1LCFA 1P1WA 5I57B 2R6GE 1QUKA 2VD3A 2QPQA 4H8IA 3KEIA 3TQLA 3CKDA 2CMOA 2P1SA 1SI0A 2KWIB 3UFEA 3BBRA 1CE2A 2V25A 5L3GB 3A3CA 4MFRA 3VXCA 4DIGA 1Y64B 4PK6A 5AE4A 4DMVA 3P7IA 1FEWA 3MBPA 3ZKKA 3LJCA 1B0HA 2CWYA 1H3DA 1BIYA 2N2NA 4O8SA 2W7YA 3FATA 1B9JA 3S9NC 1S50A 1US7B 3Q27A 3EUHA 4YHJA 2DWKA 3ONXA 4QSEA 4FAJA 4CI1B 4EXKA 1A7LA 2IA4A 1H7CA 4NF8B 2GFEA 3HO7A 1IAPA 5FP3A 5FXXA 3DP8A 2W61A 2UVGA 1WRDA 3BFTA 3HA4A 3RTFB 4R6HA 5IAIA 3NRYA 3VLWA 1Y1MA 3PMWA 5I2NA 3MXZA 1D0YA 1MM7A 3PTRB 2ONKE 4ZDMA 3B6WA 1A8EA 5J2TE 4XBFB 4PJLA 3S9EA 5FY1A 5ELVA 3VVEA 3U8QA 1T98A 3UGWA 4F3BA 2IW5B 4NF8A 2VWAA 4R6YA 2LHNA 3TTMA 4F1YA 2BJJX 2G0UA 2PJQA 2FYIA 3LSLA 1R9LA 2BZBA 2IAKA 3OO9A 4PW8A 5DQVA 2EHOC 2ZNUA 2ONSA 4ZE9A 3QAXA 4IHJE 3FXEB 3PD9A 4F31B 4LQ2A 4AKIA 3KSXA 4RNSA 5LNKA 2K5BB 2OA5A 3T96B 3KBRA 1OLCA 2V7KA 4YMAA 5EYFA 1IITA 5L3FB 3EHSA 1LAHE 3QYTA 5HBCA 4GIZA 5LJNA 1BR4A 2BVMA 1SW2A 3K1MA 3L6HA 3OSQA 2CMRA 4X1YE 3HHFA 3KV6A 3FJMA 4O3AA 1MMAA 1VE4A 2X67A 2IEEA 1HF8A 3KFMA 3N5LA 5F3JA 2HZLA 3RRCA 1CB6A 5L9MA 1MMDA 1P1UA 3CVGA 2Y6XA 2V26A 4ELPA 1SDXA 3PUYE 2ZYOA 3I0OA 3V83A 1QKAA 5JVDE 1EZ9A 2I3VA 1Z7ME 1FQBA 3K1NA 1QJMA 1UIVA 5BMVE 3UT5E 3ZMVB 5JQGE 4EQ7A 2ZMAA 2F6PA 3KBTA 2NOXA 2NTXA 4UVBB 5CRYA 2UVIA 5AFUL 3OKQA 3MJXA 3VLVA 4AQFC 4Q0CA 1FTKA 4NMYA 5DABA 2D2SA 4ILUA 3OSRA 4HFVA 2H5YA 1QUJA 3CQXC 1VOMA 3O2AA 4HW8A 3E08A 3IL1B 2UVJA 4WEPA 4ANJA 1ZKEA 3ZCIA 3VDFA 2X9XA 3MP6A 2M8CA 1BKAA 4YAHX 4LVQA 3FVKA 4GLIA 4LQ5A 2X66A 3QC9A 2Q2CA 3C35A 1LAXA 2K24A 4UF0B 5KMGP 3RPUA 1OXZA 3AXFA 2PG8A 1MMGA 2BDEA 4FORA 3CQCB 4ECFA 3LFMA 3CSGA 4OFZA 1JVYA 4EXTA 4UACA 4NF6B 4NWDA 3KV5A 3TCFA 1TXFA 4OVJA 3T8OA 3C4ZA 3RH3A 1MY1A 2E8IA 2A2FX 4ZEIA 3C34A 3BQKA 4MLKA 3PPOA 1IIWA 4LZ7A 3CWZB 4Q8RA 4HGAA 4WXJA 4CI3B 3Q2MA 4PNIA 3TCHA 2HH7A 3WI3A 4L0RA 2ODUA 4IE5A 3T9VA 3TUSA 3MVWA 1Q1KA 2O84X 4G8NA 4PFUA 5L3DB 3IOTA 5KDTA 2C5JA 5KDMC 2E9XD 2WWUA 1KK7A 4M4GA 1EU8A 1LLSA 5LA6E 1A54A 1EH3A 4R2FA 4OZ9A 2LSGA 1WODA 4NF4A 4ZI7E 1I69A 3F57A 2WAUA 4XTCQ 5ICTA 1PC3A 5M2VA 2XXIA 4JSDA 1URGA 3RC3A 4CXYA 4F3PA 1QKBA 4QWNB 3MPLA 2V3UA 3K4UA 3OEMA 3LC8A 2WSSV 3FV2A 1I6QA 2QMXA 1YW0A 1WVJA 4GD5A 5HXEA 3UA8A 1ZU0A 2HCAA 3LUYA 3W15C 1D4NA 5FTHA 5HAXA 3AA7B 1IZ1A 2B3FA 1LGBC 3MP1A 4L9IA 3VE1B 3FD3A 3QUJA 2XAJB 2JRKA 5LHHB 5DVIA 4X20E 2B1EA 4IO3A 1YKEB 1WYCA 4I9DA 1LAGE 3FZVA 1DSNA 1B0LA 3K3OA 1WDNA 4RK2A 1XC1A 4X1IE 5IYZE 3C9HA 3K2DA 4H5GA 4H65A 3AAIA 5DVFA 3VXBA 1MY3A 5A5XB 1RKMA 2KMFA 3KZGA 3M3LA 3GLBA 1B40A 2UXAA 3HKDE 4E7SA 3T93B 1O3XA 4ZS9A 1OLAA 4KFQA 1S94A 5AA1A 3IF8B 4GWOA 1DPPA 4EDPA 5JREA 1B1HA 3C4WA 1HG5A 2EHOA 2H98A 3EPEA 1H76A 3T9HB 1HG2A 4KI0E 4HTEA 4QHQA 3J7Yq 4GK5E 4EYUA 2ODVA 4R6KA 2XX8A 3ZJ1A 2RC7A 5C8YE 1D0ZA 3KVBA 4ZZAA 3FXDB 3MAMA 4C1UA 2QRYA 2OK2A 5I56B 4ADZA 2O7UA 1MXWA 2XD2A 3ZS6A 3PPPA 4DDDA 2QS4A 3IOVA 2X9YA 4ERRA 4KCCA 4YJ2E 3KOTA 2P0SA 3R84B 1EZ3A 4ZI2C 4YLHA 4DE8A 3QIMA 4GYSA 2XX9A 3KVAA 2DE2A 4N07A 4L17A 3ANWB 2E9XC 2QSXA 2H3RA 3NZPA 5H8HA 4F19A 2NW9A 3RY3A 5HWYA 3KN8A 1IZNB 2WKYA 3O97A 1FMVA 4QXHB 5KZTA 2DWIA 1FQDA 1GVCA 4TX5A 1MIVA 1NMUA 2XD3A 5H8HB 4LA9A 2QS3A 2VK9A 1TT1A 4F29A 3SEUA 1II5A 5LHIB 5CC2A 3GBAA 4ISTA 3PV0E 2YU2A 2AYSA 1IQ7A 2JMHA 3UUMA 2KINB 3N9OA 2ACXA 5TP9B 4BDOA 3V5UA 4UEMA 3SKPA 3R6UA 4NWCA 4UIGA 2LJLA 3HV1A 5CBRA 3FGSA 1MQGA 2H9BA 4R74A 1A55A 3ZPOA 1POTA 4DXCA 2OLBA 4O4IE 4CXWA 3G3KA 4OYKA 4ISUA 5ETWA 4G2ZA 1MH4A 2PBWA 2CE7A 2X68A 1HCIA 2WMOA 4F1VA 1Y4TA 1PEBA 4PJMA 2DE3A 4IGRA 1D3KA 4EB6E 4GXSB 1FCKA 2RCBA 1MY4A 3CX7B 3I6VA 1NH8A 3MVYA 1JEUA 3AAEB 3D4CA 3FBLA 3GWHA 3TFLA 2ZMBA 3KOSA 4QFOA 1JW4A 2NW7A 3VV5A 3E22E 4YKIA 2AIXA 1SW4A 4OEUA 4KMCA 1D9VA 1B3FA 4O4LE 4C91A 4OTEA 3KJ7A 3U92A 2DCFA 3IOWA 5FY0A 3U94A 4Z0IA 5DJQC 2V7LA 4RY1A 2KLQA 2XXXA 4CQIA 4OESA 2R71A 3MJNA 3T22A 2XAFB 5LGNB 2RKMA 1D1CA 4X9TA 4G63A 4IDZA 5HXHA 5JDFA 3G3FA 5M4YA 4RA1A 2CLYB 4TLMB 3USDA 4JDFA 2NUVA 1SW5A 4HKAA 1NNFA 4RPNA 1EZPA 4N6PA 3W9WA 3H03A 3UP9A 1YPNA 2ES0A 3V89B 4NUVA 3R7XA 4GK0E 3OELA 5CMBA 1BR2A 2ZNTA 2F34A 4ZEKA 1MG1A 2C5KT 2K9AA 4EOZB 2O1MA 3VKHA 3ETUA 5JR9B 4MLVA 3RUMA 1FQEA 2CXLA 4G77A 3SEVA 2LT3A 3RYFE 1HTJF 2DWGA 2Q88A 2Q89A 4YFSA 1GTKA 3LSFB 4UVCB 4ESXA 2XUEA 1J1NA 2ZNSA 3OYZA 2A72A 3HCQA 4H67A 1L5TA 4G68C 3DJBA 5AA2D 5LG4A 1EZOA 3ZC1A 1M5FA 5DTBA 2Z8DA 3FVNA 5CMMA 5JR9C 4E0XA 5FXZA 3KBUA 3E13X 4JB7A 2VP1A 5H8QB 1B5HA 3T66A 3RYIE 2ZXTA 3KINB 4GOUA 5FHMA 3JC6D 1E1HB 5CMKA 1H45A 5ISUA 1D1BA 2CXFA 2XXYA 4NF6A 4QX8B 1M5DA 4R75A 3K6XA 2Q9QC 3RNNA 3GN5A 3PPNA 1WLXA 4P0BA 4R2BA 4IY5A 4DCXA 4YJ3E 5TU0A 2X0LB 5DT6A 2PX1A 2NTYA 4U1OA 1LFIA 3I0QA 4ZEBA 1B4ZA 1VR5A 1LAFE 4NF4B 4JBZA 3IBPA 4FJOA 1Z0PA 2I0CA 1QUIA 4UA8A 4U21A 4QSDA 3ONMA 4DCYA 2LSIA 3OXNA 2ESNA 4JSOA 4EIWA 3E3KA 3P8CD 3S2VA 2H7VC 2A3DA 1N04A 1UTBB 3N2KE 2E1SA 4AQGA 5FHNA 2O7IA 5AA3A 4EAHA 5H8FA 2Q9QB 5F8PA 2YU1A 3UTKA 1TFAA 4Z7EA 3FXRA 1WYBA 2V1DB 3RPWA 4GOTA 1NH7A 1UX5A 2NP9A 1O64A 2X7QA 1O7TA 2UYEA 4MBPA 4I8CA 4PJJA 1JEVA 4IY6A 4E7ZA 2ZM8A 4HN9A 1MQDA 2HPLA 3H6WA 3MC2A 3AB3B 4JEHB 3ETVA 1TFDA 3K3NA 4WBNE 3PMXA 1XVYA 1US5A 2MYSA 3KN3A 2XHDA 4NF5A 5I58B 2OWTA 2VKOA 5F1QA 2E9XA 1S9TA 3HR0A 3JV9A 1SYIA 3LSXA 4HS7A 2A5TB 4G8MA 4QFLA 5LP6E 4DXUA 1N76A 1DTZA 5E0OA 1XT8A 2H7OA 3Q5WA 2O1LA 3FASA 2CA5A 4TV9E 1BLFA 3BKIB 2GK9A 1MQHA 1URDA 1MS7A 1UTHB 1B1XA 3TTLA 4QFPA 2UYFA 2EHOD 4FI5A 3SETA 3I5OA 4PFOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MRP A;  4TLL B;  1SW1 A;  3T9V A;  1LFH A;  3TUS A;  2PT1 A;  3MQ9 A;  3MVW A;  2G29 A;  5JTY B;  1Q1K A;  1B7U A;  1PB9 A;  2O51 A;  2O84 X;  4G8N A;  4PET A;  4RJZ A;  3N94 A;  4EXL A;  4PFU A;  1OMP A;  5LOM A;  2Q2A A;  4X1D A;  3BFU A;  4YKP A;  4F39 A;  3IOT A;  1IEJ A;  5KDT A;  2C5J A;  3E9X A;  3FXQ A;  4O3C A;  1UTH A;  4EQB A;  1B4H A;  1QVS A;  3RN8 A;  4U4S A;  5A5X B;  3OEK A;  4M4G A;  1EU8 A;  5FHO A;  1LLS A;  3PPR A;  3MW0 A;  3RT8 A;  1AOV A;  4XKP A;  4AB5 A;  1A54 A;  2DSF A;  1Q35 A;  2RC8 A;  1EH3 A;  3UOR A;  1ELJ A;  4R2F A;  1DPE A;  5HPQ A;  4OZ9 A;  2VD2 A;  2K48 A;  4PFT A;  1WOD A;  4LUB A;  4NF4 A;  2YJP A;  1M5B A;  3O6I A;  3H4Z A;  1I69 A;  1Y9U A;  5EHM A;  4PFY A;  5EHS A;  4XTC Q;  2X9W A;  3MPK A;  1Y1Z A;  5ICT A;  3PUX E;  1PC3 A;  4RK9 A;  5M2V A;  4F1U A;  3MZ9 A;  2XXI A;  4C0R A;  4JSD A;  5I2K B;  3FJ7 A;  4KYD A;  1URG A;  3T9X B;  5L8D A;  3V5A A;  2DWJ A;  4F3P A;  3TDJ A;  3TKD A;  2REJ A;  4B6X A;  1R6Z A;  3PUW E;  1QKB A;  2PVU A;  3IO4 A;  4QRZ A;  2F97 A;  2V3U A;  3K4U A;  3MPL A;  3OEM A;  3JYR A;  2V84 A;  3LC8 A;  3FVG A;  3TCG A;  3DP4 A;  3FV2 A;  4KPT A;  1XVX A;  4BDN A;  1I6Q A;  2DE4 A;  2QMX A;  2ZYM A;  4TQU Q;  2V3Q A;  4ZEC A;  4XKN A;  2I4C A;  3PGF A;  1WVJ A;  2F78 A;  2VGQ A;  4GD5 A;  1B3E A;  2KLF A;  5K2X A;  4OFO A;  2GH9 A;  2NWJ A;  3TYH A;  3UA8 A;  1ZU0 A;  2DOJ A;  3F11 A;  3KGC A;  3IB2 A;  3L3P A;  2HCA A;  3M8U A;  3LUY A;  4OWD A;  3W15 C;  1D4N A;  3GXA A;  4OEV A;  1UQW A;  4OQO A;  3MWB A;  5FTH A;  2HAU A;  1VSO A;  5H8N B;  4N13 A;  2P2A A;  4F22 A;  1IZ1 A;  1LST A;  2B3F A;  4NED A;  4O3B A;  4U4X A;  2X7P A;  1LGB C;  1AH5 A;  3MP1 A;  5DVJ A;  4MLQ A;  4XIG Q;  2MBG A;  3QUJ A;  1LB8 A;  1KWH A;  1ZTY A;  2RF1 A;  2VHA A;  3FD3 A;  4F18 A;  1MM6 A;  2QS1 A;  5IKB A;  5DVI A;  4NF5 B;  4R72 A;  1DOT A;  3N6T A;  3IAZ A;  1GV8 A;  3SEY A;  1DTG A;  3OD7 A;  4IO3 A;  3M3K A;  1MPC A;  4E0W A;  4I9D A;  1LAG E;  2QMW A;  4JWO A;  1FTJ A;  3FZV A;  1DSN A;  1B0L A;  2DXY A;  4YKJ A;  5L9O A;  1WDN A;  5KDT B;  3DM0 A;  1PB7 A;  1B52 A;  4RK2 A;  3R26 A;  5I59 B;  3FV1 A;  4ONY A;  1OVB A;  1XC1 A;  4OEN A;  2Y84 A;  3C9H A;  2LAO A;  3I3V A;  3K2D A;  1N84 A;  4H5G A;  4H65 A;  2XX7 A;  3G7W A;  4H0W A;  1GR2 A;  3K0V A;  3VLU A;  3ZSF A;  4FAT A;  3G3J A;  1RYX A;  2XXQ A;  2HEU A;  2NOO A;  3K00 A;  3KN7 A;  3FXU A;  2DWA A;  4YB5 A;  3K6W A;  1MY3 A;  2GHB A;  3QK6 A;  3PUZ E;  3CFL A;  1RKM A;  2PYY A;  1N7X A;  3KZG A;  3M3L A;  3GLB A;  4ZED A;  1B40 A;  2UXA A;  3IJO B;  4RYA A;  1ZIU A;  5JK4 A;  2F36 A;  3T93 B;  1JVX A;  3S9L C;  4R9F A;  4ZS9 A;  3O6G A;  1MXV A;  1JW5 A;  1OLA A;  4KFQ A;  4DND A;  5AA1 A;  2Y7I A;  4BDL A;  4JWY A;  1FTO A;  3SEX A;  3UN6 A;  1AMF A;  1Y4C A;  4GWO A;  4ELO A;  1DPP A;  3K6U A;  5I84 A;  4POW A;  1RYO A;  3PD8 A;  4EDP A;  3G3I A;  5CM6 A;  1B5I A;  1LBC A;  2OBG A;  4G68 A;  1B1H A;  4GQO A;  3RQT A;  2H98 A;  1Z7N E;  3O28 A;  4F3G A;  1MXU A;  3LR1 A;  2RCA A;  3EPE A;  3THI A;  4EF2 A;  1MDP 1;  1H76 A;  3TQW A;  3T9H B;  2Z8F A;  4KI0 E;  2V93 A;  3CR9 A;  3N6U A;  4QHQ A;  4RXL A;  4FEC A;  1PBP A;  4XKR A;  3RTW B;  1R9Q A;  4FEB A;  1IJ5 A;  3HHG A;  4YB7 A;  1A40 A;  3VVF A;  3C36 A;  2DQV A;  4YMB A;  2DWH A;  2H25 A;  4H1X A;  4OER A;  2IC6 A;  3GBB A;  5TPA A;  2I49 A;  2ALU A;  3K1P A;  1M5E A;  2XX8 A;  1N0T A;  1PBQ A;  4R6K A;  2RC7 A;  1MPB A;  4XKQ A;  3C32 A;  3U93 A;  4EUO A;  3PUV E;  4F1Y A;  2YPN A;  1S7Y A;  4ZZA A;  3FXD B;  1NNT A;  1M5C A;  1URS A;  2F6G A;  2QL3 A;  3MAM A;  4GF8 A;  4JWX A;  1IXI A;  4BDR A;  2QRY A;  3HPI A;  2OK2 A;  4C1U A;  5I2N B;  5I56 B;  3MUQ A;  4F2Q A;  3JZJ A;  2O7U A;  4R73 A;  1MXW A;  1N3W A;  2XD2 A;  3T9U A;  3ZS6 A;  2ANJ A;  3PPP A;  4KHZ E;  2QS4 A;  3D4G A;  3IOV A;  2X9Y A;  2XXT A;  4QF9 A;  3H6T A;  4AB6 A;  4KCC A;  1JET A;  1I6B A;  2V3T A;  2Y7W A;  3C31 A;  3IB1 A;  3KOT A;  4OET A;  2P0S A;  4X48 A;  4PE5 B;  4IO6 A;  4ND9 A;  1HSJ A;  1ZLQ A;  1B3H A;  4EQ9 A;  2PMS A;  3SDF A;  1XS5 A;  3RLF E;  3UK4 A;  1LB9 A;  3QIM A;  4QFK A;  4DE8 A;  2XX9 A;  4YB6 A;  1F9B A;  2DE2 A;  1OQH A;  4N07 A;  4OMB A;  4NE4 A;  4L17 A;  1LBB A;  3CSB A;  2QSX A;  1OQG A;  2DP8 A;  1HSL A;  3OO7 A;  4HTG A;  1SI1 A;  5H8H A;  4AQ4 A;  4EYY R;  4F19 A;  3GZG A;  5KCJ A;  1ATG A;  1YAE A;  1VFD A;  2OWS A;  1MQI A;  4LZ8 A;  3RY3 A;  3U72 A;  1B46 A;  1YCJ A;  3B6T A;  3KN8 A;  3CG3 A;  2WKY A;  1B3G A;  1LVF A;  2XXP A;  3O97 A;  5K2Y A;  4HCW A;  4THI A;  1MH3 A;  5KCJ B;  1POY 1;  5KZT A;  3TEP A;  2ABH A;  3TKL B;  2DWI A;  4BDM A;  3IR1 A;  5L9S A;  2F35 A;  3H6U A;  1FQD A;  2OCU A;  1GVC A;  4R9G A;  2ZYK A;  1P99 A;  1QUL A;  1NMU A;  3KG2 A;  5B7D A;  2XD3 A;  3ILU B;  2NXO A;  4LA9 A;  4QSC A;  5H8H B;  2QS3 A;  1UTB A;  4K3F A;  4OYV A;  3RT6 B;  3ILT B;  4LP2 B;  1TT1 A;  4U1Z A;  3TMG A;  2Y7K A;  2B65 A;  4GFR A;  4LON B;  1II5 A;  3SEU A;  4F29 A;  3LBS A;  3C33 A;  3E4R A;  3GBA A;  4FJP A;  5DEX B;  5H8S A;  3TOD A;  4C1T A;  1MXZ A;  2YLN A;  3PV0 E;  5DVF A;  3B6Q A;  3Q28 A;  2AYS A;  5A5X A;  3H3G A;  1IQ7 A;  1LCF A;  1P1W A;  1Y3P A;  5I57 B;  3CG1 A;  2R6G E;  5DYH A;  2F7C A;  1QUK A;  5TP9 B;  4IO7 A;  4BDO A;  2VD3 A;  3SKP A;  3VVD A;  5F7V A;  3R6U A;  2QPQ A;  4NWC A;  4H8I A;  3CRB A;  2ZYN A;  3KEI A;  3TQL A;  3CKD A;  2CMO A;  2P1S A;  3B7D A;  3HV1 A;  5CBR A;  1SI0 A;  3FGS A;  4FIM A;  2H4I A;  2KWI B;  3BBR A;  3TTN A;  1CE2 A;  1MQG A;  2V25 A;  2H9B A;  4R74 A;  3TZA A;  2IC9 A;  1A55 A;  1POT A;  1P1N A;  4IO5 A;  2OLB A;  4DXC A;  3A3C A;  3G3K A;  3VXC A;  1SQY A;  2Z8E A;  4DIG A;  4ISU A;  4G2Z A;  1MH4 A;  2PBW A;  2D21 A;  3TAJ A;  1MPD A;  1B58 A;  5AE4 A;  3P7I A;  3PU5 A;  4F1V A;  1Y4T A;  1IJ6 A;  1ZKB A;  5H8F B;  4DLD A;  1PEB A;  3MBP A;  3ZKK A;  2Q8J A;  2DE3 A;  1P1Q A;  4IGR A;  5BUU A;  1D3K A;  1ZBM A;  5DEX A;  1B0H A;  4GXS B;  1SBP A;  1FCK A;  2RCB A;  1MY4 A;  3I6V A;  4OFL A;  1H3D A;  1NH8 A;  3MVY A;  4YKK A;  2VOZ A;  1BIY A;  1JEU A;  2DVC A;  1O63 A;  3KJT A;  5TP9 A;  2O6A A;  2W7Y A;  3EHU A;  3HN0 A;  1B9J A;  3FAT A;  3VFJ A;  1S50 A;  3S9N C;  3D4C A;  1DMB A;  4FE8 A;  3Q27 A;  3FVO A;  3TFL A;  2F5X A;  2F8D A;  2ZMB A;  3KOS A;  4QFO A;  4QSE A;  2XXW A;  1JW4 A;  3VV5 A;  3WAF A;  4FAJ A;  4YKI A;  2AIX A;  4EXK A;  1A7L A;  1JW1 A;  1SW4 A;  2IA4 A;  4OEU A;  1H7C A;  1D9V A;  4ZEF A;  3UIF A;  3V8X B;  5AA4 A;  5ICQ A;  2ONR A;  4NF8 B;  2GFE A;  1B3F A;  3SES A;  4EF1