2XHEB

Crystal structure of the unc18-syntaxin 1 complex from monosiga brevicollis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
260
structure length
220
Chain Sequence
DRLSRLRQMAAENQPEPFMADFFNRVKRIRDNIEDIEQAIEQVAQLHTESLVAVSKEDRDRLNEKLQDTMARISALGNKIRADLKQIEKENKRAQQEGTFEDGTVSTDLRIRQSQHSSLSRKFVKVMTRYNDVQAENKRRYGENVARQCRVVEPSLSDDAIQKVIEHGNEIRDRHKDIQQLERSLLELHEMFTDMSTLVASQGEMIDRIEFSVEQSHNYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNC18
publication title Primordial Neurosecretory Apparatus Identified in the Choanoflagellate Monosiga Brevicollis.
pubmed doi rcsb
source organism Monosiga brevicollis
molecule tags Exocytosis
total genus 79
structure length 220
sequence length 260
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xheB01
4JEUB 2DNXA 5LG4A 5M4YA 4JEHB 1BR0A 1HS7A 1FEWA 1G73A 3LG7A 1FIOA 1S94A 3C98B 2XHEB 4TX5A 1EZ3A
chains in the Genus database with same CATH superfamily
4AIUA 2V7KA 1N32T 1EZ3A 2CEAA 4HWHA 1KEYA 3O9XA 4ISTA 2H7VC 2KLQA 2LKHA 2RP4A 3C4XA 4JLEA 1HX1B 3ESLA 2K5BB 1L0VA 4DR1T 4QXBB 1V9DA 4XZCA 4K0UA 5FXZA 3AB3B 2L3LA 4ZI7E 3DP7A 3FZKB 4B3MT 1HTJF 1YW0A 2FJAA 4TX5A 3A5XA 5FXXA 4GKKT 4KHZF 3AE8A 2LJLA 3P50A 5A1LA 2YDQA 4P0BA 3AEFA 5ABFB 4IL9A 5FY7A 3GWHA 4AKGA 4KBMB 3VR9A 3N9OA 1ZV4X 2CE7A 3SFDA 1DU2A 4MBQA 2LSGA 2FBWA 2VQET 1OEDE 1WRDA 3F31A 2LRKA 2KSRA 3JCFA 5IHYA 4HWIB 4YFSA 3KBTA 5C8YE 4AQFC 3Q5EA 2WSSV 4U72A 1XWMA 3LDQB 1E2AA 2V6YA 1U5PA 1QLBA 4CZZB 4C91A 2WS3A 4HFBA 3J9X1 4B3RT 2W00A 3BQIA 4YTMA 1UUSA 3B13A 5AQHB 4JI0T 2DLRA 4NPPA 2FJEA 3AE9A 2LHNA 3PJAA 1G8XA 3X1DA 5AQNB 4IE4A 2BVLA 5LA6E 3C51A 1YD8G 5DQWA 3C64A 2XAGB 2X67A 3ONXA 1JNRA 1H7CA 4LMKA 2UXCT 4O4JE 5ABHA 4X62T 4QWNB 4QXHB 5JDNA 4TWFA 1MMGA 4P1NA 3M65A 2E5LT 3HKDE 4YJ3E 4ZEYA 2W2UA 3DJBA 1T8BA 2X9XA 5KDMC 3TLUA 4WW0A 3BQKA 2X51A 2XQAA 3VU7H 4F8HA 4O4IE 3P8CD 1HX8A 3CK6A 3KV4A 5LJNA 4CN6A 4GYSA 3SS1A 3RX6A 5FMNA 5JDHA 4YTPA 3AE3A 1IBKT 3VHLA 3CMLA 1ZOYA 2LM9A 2ACZA 2KZ7B 3ZN0B 2V8SV 5HEUA 2J62A 4YTNA 2BG9C 4DO0A 4IIJE 4X66T 3IF8B 4EGWA 2WDRA 4HE8A 3OBVE 4G63A 1HFAA 5LJMA 4CI1B 3PTRB 3KV9A 4I4TE 3PUXF 1YXRA 5FNVE 3E22E 1OEDA 4LF8T 4QX8B 3UUNA 4Z8XA 3ETUA 2V26A 3PURA 5F3JA 2NW7A 3Q5DA 4YSXA 3FB2A 3RYIE 1UK5A 3TKLB 5EK3A 3RC3A 1W0AA 3J7Yq 1MNDA 2WWUA 2VL8A 2WCAA 2CCQA 1JNZA 4X1IE 1FMVA 3ABVA 3OKQA 4OYKA 4IDPA 3MK7C 2JJ9A 3ZMSB 3CX6B 2ZMAA 4E7ZA 4EEBA 4EIWA 4GK5E 1MMAA 1M62A 2X0YA 3RHWA 3PV0F 2MPKA 2CBJA 2N1GA 3ZPOA 2NR4A 1UX5A 4LF6T 1LVFA 2VB6A 3AAIA 3FZHB 3VR8A 3CQXC 3GN5B 3IHRA 3PJAJ 3HKCE 2K9AA 3C4WA 2BKPA 3K3QC 3UT5E 1XMQT 3ONJA 5L4EA 3RQUA 4IHJE 2KXPB 3MXZA 4GOUA 4CI3B 2W61A 2W0GA 4HN9A 3E0ZA 2PFVA 1UX4A 4IE5A 4U74A 2XM1A 4JEHB 5LGNB 1U4QA 4N78D 4AQGA 5C2TA 3CKDA 3R84B 2D0TA 3ANWA 3F57A 2L9QA 4HFHA 3A8YC 1OXZA 1Y64B 4NUUA 4TZ4C 3JAFA 1Y01A 1HG2A 3P4WA 3MJXA 3LBXA 2BBJA 4MFRA 3HKEE 3AA1B 1NEKA 1SHZC 3JADA 3C50A 2X0LB 5HEOA 4HFDA 3K3OA 4NXNT 4AI6A 5LYJE 3RYCE 3Q5WA 3KBUA 1LRZA 4LFCT 4TWDA 2FJDA 1XNRT 2X68A 2CRBA 3TLVA 1KF6A 5LOVE 3I9YA 4TNWA 3TLSA 2HN1A 3AE2A 4X5TA 3BK9A 1G73A 3PUWF 3AXJA 3TLTA 2A2FX 4JEUB 4DV0T 3AEDA 4DV1T 2CA5A 2UU9T 2BG9E 3NBXX 2SPCA 4OK0A 5HXEA 3K8PC 5HXSA 2WZIA 5CJ5A 4PNIA 5JRCA 1NAFA 2JMHA 4U7IA 5HXRA 2LT3A 4E7SA 1OWAA 5HXCA 3RLFF 1J5WA 1YKEB 5J0ZA 4AQFA 4YSYA 2NW9A 2Q9QB 4YXDA 2MTQA 3I1AA 2BDEA 3NKZA 5DJQC 1D0ZA 2D9DA 2H3RA 4HTEA 3QNUA 5E0OA 4GKJT 1Z8UA 2D0UA 3L39A 3OYXA 4KX6A 5AQLB 4AKRB 4BJNA 2UXNB 2YINA 4IE0A 4CN1A 5LBMA 4ZI3D 1XDOA 3TLWA 4EZHA 2KNDA 3NZQA 3OPCA 3JAEA 1MNEA 5AQRB 1MMDA 1XDPA 2WMOA 4DR2T 4QHOA 4ILBA 4P09A 4B6XA 3I0QA 1N36T 3GMIA 5LP6E 4PW8A 2ZM6T 2J1DG 4WBOA 4V1Av 5BMVE 2B1EA 3O4XE 1ZHCA 3Q9DA 2CPTA 2W63A 2LLYA 2HPJA 4MALA 1X79A 4QXCB 2UXXB 4KP3C 5AQUB 5JQGE 4JI1T 2C5JA 1UGOA 4M1PA 3PUYF 1OEDB 2E9XB 4ZI2D 2Q9QD 2LM2A 4PFOA 1WLXA 2W66A 2EHOD 4TNVA 3RH3A 3RIUC 5J2TE 4B3TT 1KNPA 2XUEA 2X66A 3AEAA 4YSZA 4C90A 3CIRA 2BG9A 4HFCA 2VURA 5ADXL 4UEMA 3UU6A 2IC9A 3PUGA 1BR4A 4JI3T 5LBQB 1FJGT 5HWXA 1D0XA 4Z91A 4PK5A 3PUQA 4I0UA 2HHHT 3L09A 3EAMA 3OYZA 1W09A 2DHRA 3AA0B 4LFAT 3VKHA 2OLTA 4UV8B 2CWYA 2N2NA 2ODUA 5FL0A 3T1YT 3JC6D 4TN7B 1IJ6A 4X1KE 3P4PA 2LSJA 5LCYA 2LOPA 4Z90A 2WDVA 1D1AA 1YKHB 4L5GA 5KMGP 3AAAB 3AAEB 2ZLYA 2VL0A 5L3EB 1WR0A 2CXDA 4ASKA 4ISSA 4CQIA 4X64T 3QUJA 4CXYA 1O3XA 5LHHB 2XSAA 3VRAA 2E9XD 5GONE 2CXLA 1CHUA 4JBWF 4OX9T 4UF0B 2XM2A 3LBXB 5IUXA 1IAPA 4UXNB 4H9QC 4DBRA 5J1GA 2XZEA 2VKOA 1YQ3A 3M3ZB 2W62A 2JMKA 4IREA 4YHHT 3RKOA 5AQSB 1HS7A 5LHGB 4EEDA 5JDQA 1US7B 4ILCA 2XTLA 3SFEA 2MYSA 3LFMA 2XAJB 3UUXB 5JR9C 3B57A 4LF7T 4JI7T 5ETWA 4F6RC 5CA0E 4K0KT 4JI4T 3RF1A 5C3JA 5FP3A 4WZXA 4H9OC 3FXEB 4LMLA 4DV2T 5JRCB 1S94A 3K3NA 3UU4A 3MKDA 3ZMZB 4IDZA 5F8PA 3NWIA 3N5LA 2HPLA 3EHZA 1UURA 2V7MA 3T1HT 2WU5A 3VRBA 4ZS2A 4QH4A 2NP9A 3P7IA 2WWVA 4DR7T 2XQ4A 1IZNB 3FZLB 5LB7B 1HNWT 3FBZA 2JIWA 2LEHA 4ZI3C 4P0AA 5JDMA 4XAXB 2Y48B 3ZN1B 2IC6A 3MACA 4KI0F 4DR3T 2V5DA 4IE7A 4ZOLE 4ZHQE 3OTOT 2H88A 3ZCJA 2VK9A 4B3ST 4L9IA 4DBQA 5LG3A 2IIUA 2D2SA 3CWZB 2MBGA 2KMFA 3QK6A 4ANJA 4HWFA 4NXMT 4ZZCA 2JQ9A 5JDLA 3U78A 2FUPA 3FZFB 3KDSE 3U3IA 4Q25A 2CHNA 4TUYE 4UR9A 4EAHA 2A9UA 3AVRA 3HI2A 2XPKA 3N9NA 2XY8B 3P4QA 2V6XA 2X0HA 4IL4A 3QC9A 3P4SA 3UUBA 1ZKEA 1WR6A 3P4RA 2CHOA 2WDQA 2WM9A 5H6RB 3RC8A 3IBPA 4ZZBA 2C5IT 4ZI2C 4AKHA 2Q9QC 4AISA 5L3DB 4UVBB 2YDSA 3ZT7A 3N9LA 2EHOC 2WB5A 5HWYA 3ZMVB 3AE4A 4DNDA 3FBLA 4O4LE 4GIWA 2V7JA 4WYVA 2CLYB 3RGLA 2UUBT 2BBHA 4EYUA 4DR6T 2X9WA 4A97A 4YHJA 2WY2A 4BJMA 2BVMA 3WI3A 4H63H 1WCRA 2VQFT 2LE8A 4HFEA 5L3GB 3IEEA 1NWMX 5FY1A 3PUAA 3NVOA 3UTKA 4PJLA 1XNQT 3LK42 3ZT6A 5L3CB 1E7PA 4KUMB 2UXDT 4H9RC 4ILAA 3JC6C 4DMWA 4AKLA 5HAXA 5LMUT 4A56A 1E1HB 2NW8A 2LRLA 5FXVA 5JH7E 2B76A 1ZEEA 5HYAA 3ZJ1A 3PUSA 3CX7B 2V6YB 2XAQB 3GA8A 2P9BA 2PG8A 1D1BA 3LK3B 3RIUA 3AE7A 2XAFB 4EYYR 3LSVA 2YU1A 2UUCT 3RI5A 4MLKA 1OEDC 2E9XC 2X9YA 1QUUA 4NUVA 5HCJA 4U2YA 3UU3A 5TAOA 2F4VT 3PUVF 4BA9A 4HFVA 2VKDA 2XJ7A 2KWIB 4AKIA 4KMCA 5LG4A 1D1CA 1MIWA 5CGMA 2CXFA 2ES0A 4UVCB 2NTYA 3H37A 2Y6XA 5L3FB 3PUZF 2JRKA 2XSBA 3KFWX 4TV9E 1FMWA 1J1JA 3H3AA 3PU8A 3CQGB 3N9QA 2H89A 5L4HA 1HR0T 3ZYMA 4LMJA 4CI2B 4WBNE 4DR5T 2G0UA 1J5ET 3EDUA 2W4XA 3FHNA 1KNZA 2DWGA 1BR0A 1WYBA 4JI6T 4UELA 3NRYA 5JTGA 5DQVA 3LK2B 3QB5A 3KV5A 1VCSA 5FL1A 2LSKA 2E8IA 3RPUA 2DNXA 4O8SA 4PK4A 4TWHA 2IW5B 4JI5T 1SE7A 5AQIB 1XMOT 2M6BA 4QX7B 2LKGA 2NWBA 3CQCB 2OV9A 2V7LA 2WBLA 2C0SA 3N2KE 3EVYA 3QOFA 1HCIA 2LSIA 2CM0A 3FXDB 5JR9A 3GN5A 4OYJA 4MHCA 4G2AA 4COFA 2R6GF 2PBIA 4X1YE 3AECA 3ZMUB 3I9WA 3OVUA 1HNXT 4QH5A 2DWKA 4CXWA 4EZ4A 3MZKB 2WAUA 3E08A 5HEJA 4UIGA 5FY0A 1VOMA 1HF8A 2V5CA 3K1SA 2KINB 4CXXA 2BS4A 2K3WA 1IJ5A 4O2AE 4H9SE 1D0YA 1QSDA 3ONLC 3G06A 3AE5A 5LHIB 4PJJA 5JVDE 3R6NA 2WMNA 1I6ZA 4CN4A 3O1JA 3AEBA 4H63V 2BKNA 4DMVA 3RYHE 4OHFA 1IBLT 2L8KA 3O1IA 1WYCA 2XQ3A 3ZT5A 3NZPA 5FVLA 2YN6A 2LHRA 4X65T 3QB5K 4HKAA 5LNKA 1VCTA 2JQQA 2XQ6A 4J2CA 5IYZE 4UVAB 4NIQA 3RIFA 2JQHA 1R8IA 4EV6A 3PE0A 4PJMA 3SOLA 1ZP0A 2LSYA 1MIVA 2MOZA 3ANWB 1I94T 3KINB 3UUMA 3LJCA 2C5KT 2ZM8A 4HFIA 4EB6E 3UU5A 4U7YA 5F5WA 4DV4T 1BR1A 5ABGA 2CMRA 3RRCA 4PJNA 2HN2A 3D0TA 3HR0A 1S35A 2IHR1 3LG7A 2VWAA 4JYAT 4O4HE 3UQ4A 4U3CA 3WAJA 4ZS3A 5HEGA 2Q9QA 2KT9A 2LOSA 4HWDA 4BAYB 3RKGA 2ZM2A 4DV5T 2QA7A 2EHOA 3T8OA 2CWOA 4HGAA 2GK9A 3KV6A 1N34T 3CX8B 1BR2A 3UFEA 4IE6A 3C98B 5L3BB 4FJOA 5L47A 3UULA 2UXBT 2D5UA 2DI4A 5LXTE 2XHEB 3AXJB 2Y8DA 4YLHA 4IT4A 4JI2T 1KK7A 1MMNA 4I43B 3W15B 1FIOA 4JI8T 5AQQB 4PFPA 1T7SA 3MA9A 3N2GE 5AQPB 2IMLA 5AQOB 2BZBA 5HEHA 5CB4E 5JREA 5KXJA 5AQMB 4A98A 4H9NC 3ZC1A 3ZLIA 4DUZT 3N9PA 2CLYC 1HG5A 2I6HA 4QH1A 3AA7B 3B5MA 2NOXA 3PDYA 4LF9T 2BS3A 4KHPT 1YQ4A 5EK4A 4AQYT 2H7OA 2XQ9A 3FZMB 3N9MA 5BR8T 3ZYLA 3OJAA 3A7MA 3V5UA 4DV6T 5AQFB 5AQTB 3RQWA 4HWCA 5HXHA 2E9XA 3Q5XA 2YK0A 3Q2MA 5CA1E 3AEEA 4A5XA 3UQ7A 2PJQA 2VASA 5HCMA 2YDRA 2IDOB 3H3MA 2DL1A 2XQ7A 4YJ2E 2AXDS 2V7IA 1SA0E 4IDOA 4GYRA 5ABFA 2I59A 4JUYA 5AQKB 3N2OA 3WAKA 2ODVA 4ILUA 3UU8A 4H9PC 1CUNA 2KWHA 3ZMTB 2VVNA 1B7TA 2J47A 2J4GA 3EI0A 2I0MA 5DABA 3CVRA 2A3DA 4DR4T 5AQJB 3AVSA 2QRXA 4ADZA 2WU2A 2QYWA 2M67A 1FEWA 5FXWA 5FYMA 3RRWA 3RYFE 3SRZA 4L0RA 1UCUA 4DVDA 5FVKA 4FI5A 3EDVA 4YY3T 5JR9B 5AQVB 2N9DA 2PTFA 4DV3T 1KNRA 5LGUB 3ZKRA 2CBIA 1VRBA 2NTXA 1SUMB 1W9RA 2XQ5A 3ZCIA 4DIDB 4PAGA 4XBFB 3EABA 2E2AA 1X9BA 1N33T 2ACXA 3ETVA 4UV9B 4LF4T 5LGTB 3AE1A 5AQGB 2BG9B 5CFBA 2RPAA 3L8RA 2XQ8A 1WFDA 2YU2A 2YOEA 1IBMT 4ZXLA 2IAKA 2ZM0A 4UF0A 5ABEA 2DCFA 1M7KA 2JPFA 4OFZA 2FJBA 4GK0E 4JV5T 4TV8E 2K48A 2BKOA 2XASB 4U33A 3ZYKA 4WNKA 2BS2A 3ZC0A 5AFUL 3ZSSA 4AXPA 4LFBT 5LMNT 5EK2A 5IWAT 2VKHA 3VKGA 2WZHA 3HA4A 4YT0A 2QVAA 4IDNA 2W67A 3UFGA 4ERRA 3EUHA 1GQEA 1AJ3A 3RIAA 2QGSA 1T98A 3HL6A 3NRXA 1LKXA 4DUYT 2VVSA 4HEAA 2E5VA 4O2BE 2M6IA 1XZYA 4U31A 5JDFA 5JDGA 3ZSTA 2OA5A 1Z0PA 3SWHA 3PU3A 4DV7T 3IA3A 2VKJA 5FKYA 4X20E 4EOZB 3AE6A 4QKNA 2XAHB 2WQYA 2HH7A 2Z6EA 5L2LA 5J2UE 3ZEFB 4I55E 3AA6B 2A72A 3CPZA 2IUBA 2WP9A 2YEVC 5M4YA 1W0BA 2RA1A 3O1HA 1LVKA 2EHOB 3V5SA 2YKSA 3ZJ2A 4LF5T 2MAWA 4I50E 5H6QB 2K24A 2JQKA 5EZYE 4PK6A 4U2ZA 4IDQA 3KVAA 3HKBE 1HNZT 5KX5E 2UUAT 1T72A 3S4UA 2AE9A 3I0OA 3BQLA 3DTOA 3F2EA 4EXTA 3L3PA 1KFYA 3AEGA 2V1DB 2X9HA 3KVBA 1NENA 2XQYA 1MIYA 4IGUA 3C4ZA
chains in the Genus database with same CATH topology
4DBQA 2X68A 4EB6E 2V7KA 5LOVE 3I9YA 2D2SA 1EZ3A 3CWZB 1BR1A 2CEAA 2MBGA 2CMRA 2KMFA 3O9XA 3RRCA 4PJNA 3QK6A 4ISTA 2H7VC 3D0TA 3HR0A 1S35A 4ANJA 2KLQA 5JDLA 3BK9A 1G73A 3LG7A 2VWAA 3U78A 2RP4A 3C4XA 2A2FX 4JEUB 4O4HE 2CA5A 3WAJA 4ZS3A 3KDSE 2Q9QA 2KT9A 2LOSA 3U3IA 4JLEA 4BAYB 3NBXX 4TUYE 3ESLA 2SPCA 4OK0A 5HXEA 3K8PC 4EAHA 3AVRA 5HXSA 3HI2A 3N9NA 2K5BB 4PNIA 2ZM2A 1V9DA 2QA7A 4QXBB 4XZCA 1NAFA 4K0UA 5JRCA 5FXZA 2JMHA 2EHOA 3AB3B 3T8OA 2CWOA 5HXRA 2L3LA 4HGAA 4ZI7E 2GK9A 3DP7A 2LT3A 3QC9A 3KV6A 1HTJF 4E7SA 1OWAA 1YW0A 3CX8B 1BR2A 3UFEA 4TX5A 5HXCA 1ZKEA 3A5XA 5FXXA 1WR6A 4IE6A 3C98B 2WM9A 4FJOA 5H6RB 5L3BB 2LJLA 3RC8A 3IBPA 3UULA 1YKEB 2D5UA 2DI4A 5A1LA 5LXTE 2XHEB 4P0BA 4AQFA 2C5IT 4ZI2C 2NW9A 5FY7A 4AKHA 3GWHA 2Y8DA 2Q9QB 2Q9QC 5L3DB 4UVBB 2MTQA 4AKGA 4KBMB 4YLHA 3I1AA 3N9OA 1ZV4X 2CE7A 2BDEA 3N9LA 5DJQC 1KK7A 1D0ZA 2H3RA 4HTEA 1MMNA 4I43B 5E0OA 2EHOC 3W15B 1FIOA 2D0UA 5HWYA 3OYXA 3ZMVB 4AKRB 4BJNA 4PFPA 2UXNB 2YINA 3MA9A 4IE0A 5LBMA 4ZI3D 3N2GE 4DNDA 4MBQA 3FBLA 4EZHA 2LSGA 2KNDA 4O4LE 3NZQA 4GIWA 1WRDA 3F31A 2BZBA 5CB4E 2V7JA 5JREA 4H9NC 5IHYA 1MNEA 4YFSA 3ZC1A 3KBTA 5C8YE 3ZLIA 3N9PA 2CLYC 2CLYB 1HG5A 1MMDA 4AQFC 4EYUA 2WSSV 2X9WA 4YHJA 3AA7B 4U72A 2NOXA 3PDYA 4BJMA 2BVMA 2WMOA 3WI3A 4QHOA 5EK4A 2H7OA 4H63H 1U5PA 3N9MA 2LE8A 4P09A 3OJAA 3ZYLA 4CZZB 4C91A 4B6XA 3I0QA 5L3GB 3IEEA 1NWMX 3J9X1 3V5UA 2W00A 3GMIA 5FY1A 3PUAA 3UTKA 4PJLA 3BQIA 5LP6E 3ZCJA 4PW8A 3B13A 3LK42 5HXHA 5L3CB 2E9XA 3Q5XA 5J1GA 4KUMB 2YK0A 4H9RC 2DLRA 2J1DG 3JC6C 4DMWA 4WBOA 3Q2MA 4V1Av 5HAXA 2LHNA 4AKLA 4A56A 5BMVE 1E1HB 2B1EA 3O4XE 5CA1E 1ZHCA 2NW8A 5FXVA 5JH7E 1G8XA 2PJQA 2VASA 3Q9DA 1ZEEA 5HYAA 3ZJ1A 2W63A 4IE4A 3PUSA 2HPJA 4MALA 1X79A 3CX7B 2BVLA 4YJ2E 2V7IA 2XAQB 3GA8A 4QXCB 1SA0E 2UXXB 5LA6E 2P9BA 2PG8A 1D1BA 3C51A 3LK3B 1YD8G 4GYRA 2I59A 4JUYA 2XAFB 4EYYR 5DQWA 3C64A 2XAGB 4KP3C 3N2OA 2YU1A 3WAKA 5JQGE 2X67A 2C5JA 2ODVA 4ILUA 4M1PA 4H9PC 1CUNA 2KWHA 3ZMTB 4MLKA 3ONXA 1H7CA 4O4JE 2E9XC 2E9XB 2X9YA 1B7TA 1QUUA 4NUVA 4QWNB 4ZI2D 4QXHB 5DABA 5JDNA 2Q9QD 1MMGA 4PFOA 3CVRA 5TAOA 2A3DA 3M65A 3HKDE 1WLXA 4BA9A 4YJ3E 3AVSA 4HFVA 3DJBA 2VKDA 2KWIB 4AKIA 4ADZA 4KMCA 2EHOD 5LG4A 2X9XA 2M67A 1FEWA 1D1CA 5FYMA 5FXWA 3RRWA 3RH3A 3RYFE 3SRZA 1MIWA 5KDMC 4WW0A 5J2TE 4L0RA 2CXFA 1UCUA 2ES0A 4DVDA 4UVCB 2XUEA 2X66A 2NTYA 3BQKA 2X51A 3EDVA 4FI5A 4C90A 3VU7H 3H37A 2Y6XA 4O4IE 5L3FB 3P8CD 5JR9B 2N9DA 5ADXL 1HX8A 5LGUB 2JRKA 4UEMA 3KV4A 5LJNA 4TV9E 3KFWX 1VRBA 2IC9A 3PUGA 4GYSA 1FMWA 2NTXA 3SS1A 1BR4A 3RX6A 5FMNA 5JDHA 3ZCIA 3H3AA 3PU8A 5LBQB 5HWXA 1D0XA 4PAGA 4XBFB 4PK5A 3PUQA 3VHLA 3CMLA 3CQGB 3L09A 2ACXA 2LM9A 3ETVA 3OYZA 2KZ7B 4UV9B 3N9QA 3ZN0B 2DHRA 3AA0B 5LGTB 3VKHA 4UV8B 3ZYMA 4CI2B 2CWYA 2N2NA 4WBNE 4DO0A 2ODUA 4IIJE 2G0UA 3EDUA 3JC6D 3IF8B 4TN7B 1IJ6A 2YU2A 4HE8A 3OBVE 4X1KE 2IAKA 3FHNA 1HFAA 2ZM0A 4G63A 4UF0A 5LJMA 1KNZA 2DWGA 2LSJA 4CI1B 3PTRB 5LCYA 2DCFA 1BR0A 2LOPA 1WYBA 2JPFA 3KV9A 4I4TE 1D1AA 1YKHB 4L5GA 5KMGP 4OFZA 3AAAB 3AAEB 2ZLYA 4UELA 5FNVE 3E22E 3NRYA 4GK0E 5L3EB 5DQVA 3LK2B 2CXDA 3KV5A 4TV8E 2LSKA 4ASKA 2K48A 2E8IA 4ISSA 4CQIA 2XASB 4QX8B 3ZYKA 3QUJA 4WNKA 4CXYA 3RPUA 3UUNA 2DNXA 4O8SA 1O3XA 4Z8XA 4PK4A 5LHHB 3ZC0A 2IW5B 3ETUA 5AFUL 4AXPA 2V26A 2E9XD 3PURA 5F3JA 5GONE 2CXLA 5EK2A 3VKGA 2VKHA 2NW7A 3HA4A 4QX7B 3FB2A 2NWBA 3RYIE 3TKLB 3CQCB 4UF0B 5EK3A 3RC3A 2V7LA 3LBXB 2WBLA 2C0SA 3N2KE 4ERRA 3EUHA 1IAPA 3EVYA 4H9QC 4UXNB 3J7Yq 1AJ3A 1HCIA 2LSIA 2QGSA 4DBRA 2CM0A 1MNDA 1T98A 2WWUA 2VKOA 3FXDB 3GN5A 3HL6A 2VL8A 3NRXA 4G2AA 4MHCA 4OYJA 2CCQA 1LKXA 4X1IE 1FMVA 3OKQA 2PBIA 4OYKA 4X1YE 5JR9A 4HEAA 3I9WA 3ZMUB 3MK7C 2JJ9A 2W62A 4O2BE 3ZMSB 3CX6B 2JMKA 2ZMAA 4E7ZA 5JDFA 3RKOA 5JDGA 4EIWA 4GK5E 1MMAA 2DWKA 1HS7A 4CXWA 4EZ4A 3MZKB 2WAUA 5LHGB 2N1GA 3E08A 3ZPOA 1UX5A 5JDQA 2OA5A 1US7B 1LVFA 2VB6A 1Z0PA 3SWHA 3PU3A 3AAIA 4UIGA 5FY0A 1VOMA 1HF8A 2VKJA 2XTLA 2KINB 4CXXA 4X20E 4EOZB 3CQXC 2MYSA 3LFMA 4QKNA 2XAJB 3UUXB 5JR9C 2XAHB 3GN5B 3B57A 3IHRA 2HH7A 3HKCE 1IJ5A 4O2AE 2Z6EA 5L2LA 5J2UE 4H9SE 1D0YA 5ETWA 1QSDA 4F6RC 2K9AA 5CA0E 3ZEFB 3C4WA 4I55E 3UT5E 3K3QC 3AA6B 2A72A 4IHJE 5FP3A 3CPZA 2KXPB 3MXZA 3FXEB 4H9OC 4GOUA 4CI3B 2YEVC 5LHIB 4PJJA 5M4YA 5JVDE 2W61A 3R6NA 2RA1A 2W0GA 5JRCB 1S94A 3O1HA 2WMNA 3K3NA 4HN9A 3E0ZA 3O1JA 4H63V 2PFVA 1LVKA 2EHOB 1UX4A 4IE5A 3V5SA 3MKDA 4DMVA 3RYHE 3ZMZB 4U74A 4IDZA 5F8PA 4JEHB 5LGNB 1U4QA 4OHFA 3N5LA 2HPLA 4N78D 4AQGA 2L8KA 3O1IA 1WYCA 3CKDA 3R84B 2D0TA 2V7MA 3ANWA 3F57A 2L9QA 3ZJ2A 1OXZA 1Y64B 4I50E 4NUUA 4TZ4C 4ZS2A 5H6QB 2K24A 3NZPA 2NP9A 1HG2A 3P7IA 5EZYE 3MJXA 2LHRA 3LBXA 4PK6A 4MFRA 3KVAA 3HKBE 3HKEE 3AA1B 1IZNB 4HKAA 1SHZC 5KX5E 5LNKA 3FBZA 2LEHA 4ZI3C 4P0AA 2JQQA 4J2CA 3C50A 2X0LB 5JDMA 5IYZE 3S4UA 3K3OA 4XAXB 4UVAB 3I0OA 2Y48B 3ZN1B 2IC6A 4AI6A 3BQLA 3DTOA 3F2EA 3MACA 4EXTA 3L3PA 5LYJE 3RYCE 3PE0A 4PJMA 2V1DB 3SOLA 4IE7A 2X9HA 3Q5WA 3KBUA 3KVBA 2LSYA 4ZOLE 2XQYA 1MIVA 4ZHQE 2MOZA 1MIYA 3ANWB 4IGUA 3KINB 3UUMA 1LRZA 3LJCA 2C5KT 2ZM8A 2VK9A 3C4ZA 4L9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEU B;  2DNX A;  5LG4 A;  5M4Y A;  4JEH B;  1BR0 A;  1HS7 A;  1FEW A;  1G73 A;  3LG7 A;  1FIO A;  1S94 A;  3C98 B;  2XHE B;  4TX5 A;  1EZ3 A; 
#chains in the Genus database with same CATH topology
 4AIU A;  2V7K A;  1N32 T;  1EZ3 A;  2CEA A;  4HWH A;  1KEY A;  3O9X A;  4IST A;  2H7V C;  2KLQ A;  2LKH A;  2RP4 A;  3C4X A;  4JLE A;  1HX1 B;  3ESL A;  2K5B B;  1L0V A;  4DR1 T;  4QXB B;  1V9D A;  4XZC A;  4K0U A;  5FXZ A;  3AB3 B;  2L3L A;  4ZI7 E;  3DP7 A;  3FZK B;  4B3M T;  1HTJ F;  1YW0 A;  2FJA A;  4TX5 A;  3A5X A;  5FXX A;  4GKK T;  4KHZ F;  3AE8 A;  2LJL A;  3P50 A;  5A1L A;  2YDQ A;  4P0B A;  3AEF A;  5ABF B;  4IL9 A;  5FY7 A;  3GWH A;  4AKG A;  4KBM B;  3VR9 A;  3N9O A;  1ZV4 X;  2CE7 A;  3SFD A;  1DU2 A;  4MBQ A;  2LSG A;  2FBW A;  2VQE T;  1OED E;  1WRD A;  3F31 A;  2LRK A;  2KSR A;  3JCF A;  5IHY A;  4HWI B;  4YFS A;  3KBT A;  5C8Y E;  4AQF C;  3Q5E A;  2WSS V;  4U72 A;  1XWM A;  3LDQ B;  1E2A A;  2V6Y A;  1U5P A;  1QLB A;  4CZZ B;  4C91 A;  2WS3 A;  4HFB A;  3J9X 1;  4B3R T;  2W00 A;  3BQI A;  4YTM A;  1UUS A;  3B13 A;  5AQH B;  4JI0 T;  2DLR A;  4NPP A;  2FJE A;  3AE9 A;  2LHN A;  3PJA A;  1G8X A;  3X1D A;  5AQN B;  4IE4 A;  2BVL A;  5LA6 E;  3C51 A;  1YD8 G;  5DQW A;  3C64 A;  2XAG B;  2X67 A;  3ONX A;  1JNR A;  1H7C A;  4LMK A;  2UXC T;  4O4J E;  5ABH A;  4X62 T;  4QWN B;  4QXH B;  5JDN A;  4TWF A;  1MMG A;  4P1N A;  3M65 A;  2E5L T;  3HKD E;  4YJ3 E;  4ZEY A;  2W2U A;  3DJB A;  1T8B A;  2X9X A;  5KDM C;  3TLU A;  4WW0 A;  3BQK A;  2X51 A;  2XQA A;  3VU7 H;  4F8H A;  4O4I E;  3P8C D;  1HX8 A;  3CK6 A;  3KV4 A;  5LJN A;  4CN6 A;  4GYS A;  3SS1 A;  3RX6 A;  5FMN A;  5JDH A;  4YTP A;  3AE3 A;  1IBK T;  3VHL A;  3CML A;  1ZOY A;  2LM9 A;  2ACZ A;  2KZ7 B;  3ZN0 B;  2V8S V;  5HEU A;  2J62 A;  4YTN A;  2BG9 C;  4DO0 A;  4IIJ E;  4X66 T;  3IF8 B;  4EGW A;  2WDR A;  4HE8 A;  3OBV E;  4G63 A;  1HFA A;  5LJM A;  4CI1 B;  3PTR B;  3KV9 A;  4I4T E;  3PUX F;  1YXR A;  5FNV E;  3E22 E;  1OED A;  4LF8 T;  4QX8 B;  3UUN A;  4Z8X A;  3ETU A;  2V26 A;  3PUR A;  5F3J A;  2NW7 A;  3Q5D A;  4YSX A;  3FB2 A;  3RYI E;  1UK5 A;  3TKL B;  5EK3 A;  3RC3 A;  1W0A A;  3J7Y q;  1MND A;  2WWU A;  2VL8 A;  2WCA A;  2CCQ A;  1JNZ A;  4X1I E;  1FMV A;  3ABV A;  3OKQ A;  4OYK A;  4IDP A;  3MK7 C;  2JJ9 A;  3ZMS B;  3CX6 B;  2ZMA A;  4E7Z A;  4EEB A;  4EIW A;  4GK5 E;  1MMA A;  1M62 A;  2X0Y A;  3RHW A;  3PV0 F;  2MPK A;  2CBJ A;  2N1G A;  3ZPO A;  2NR4 A;  1UX5 A;  4LF6 T;  1LVF A;  2VB6 A;  3AAI A;  3FZH B;  3VR8 A;  3CQX C;  3GN5 B;  3IHR A;  3PJA J;  3HKC E;  2K9A A;  3C4W A;  2BKP A;  3K3Q C;  3UT5 E;  1XMQ T;  3ONJ A;  5L4E A;  3RQU A;  4IHJ E;  2KXP B;  3MXZ A;  4GOU A;  4CI3 B;  2W61 A;  2W0G A;  4HN9 A;  3E0Z A;  2PFV A;  1UX4 A;  4IE5 A;  4U74 A;  2XM1 A;  4JEH B;  5LGN B;  1U4Q A;  4N78 D;  4AQG A;  5C2T A;  3CKD A;  3R84 B;  2D0T A;  3ANW A;  3F57 A;  2L9Q A;  4HFH A;  3A8Y C;  1OXZ A;  1Y64 B;  4NUU A;  4TZ4 C;  3JAF A;  1Y01 A;  1HG2 A;  3P4W A;  3MJX A;  3LBX A;  2BBJ A;  4MFR A;  3HKE E;  3AA1 B;  1NEK A;  1SHZ C;  3JAD A;  3C50 A;  2X0L B;  5HEO A;  4HFD A;  3K3O A;  4NXN T;  4AI6 A;  5LYJ E;  3RYC E;  3Q5W A;  3KBU A;  1LRZ A;  4LFC T;  4TWD A;  2FJD A;  1XNR T;  2X68 A;  2CRB A;  3TLV A;  1KF6 A;  5LOV E;  3I9Y A;  4TNW A;  3TLS A;  2HN1 A;  3AE2 A;  4X5T A;  3BK9 A;  1G73 A;  3PUW F;  3AXJ A;  3TLT A;  2A2F X;  4JEU B;  4DV0 T;  3AED A;  4DV1 T;  2CA5 A;  2UU9 T;  2BG9 E;  3NBX X;  2SPC A;  4OK0 A;  5HXE A;  3K8P C;  5HXS A;  2WZI A;  5CJ5 A;  4PNI A;  5JRC A;  1NAF A;  2JMH A;  4U7I A;  5HXR A;  2LT3 A;  4E7S A;  1OWA A;  5HXC A;  3RLF F;  1J5W A;  1YKE B;  5J0Z A;  4AQF A;  4YSY A;  2NW9 A;  2Q9Q B;  4YXD A;  2MTQ A;  3I1A A;  2BDE A;  3NKZ A;  5DJQ C;  1D0Z A;  2D9D A;  2H3R A;  4HTE A;  3QNU A;  5E0O A;  4GKJ T;  1Z8U A;  2D0U A;  3L39 A;  3OYX A;  4KX6 A;  5AQL B;  4AKR B;  4BJN A;  2UXN B;  2YIN A;  4IE0 A;  4CN1 A;  5LBM A;  4ZI3 D;  1XDO A;  3TLW A;  4EZH A;  2KND A;  3NZQ A;  3OPC A;  3JAE A;  1MNE A;  5AQR B;  1MMD A;  1XDP A;  2WMO A;  4DR2 T;  4QHO A;  4ILB A;  4P09 A;  4B6X A;  3I0Q A;  1N36 T;  3GMI A;  5LP6 E;  4PW8 A;  2ZM6 T;  2J1D G;  4WBO A;  4V1A v;  5BMV E;  2B1E A;  3O4X E;  1ZHC A;  3Q9D A;  2CPT A;  2W63 A;  2LLY A;  2HPJ A;  4MAL A;  1X79 A;  4QXC B;  2UXX B;  4KP3 C;  5AQU B;  5JQG E;  4JI1 T;  2C5J A;  1UGO A;  4M1P A;  3PUY F;  1OED B;  2E9X B;  4ZI2 D;  2Q9Q D;  2LM2 A;  4PFO A;  1WLX A;  2W66 A;  2EHO D;  4TNV A;  3RH3 A;  3RIU C;  5J2T E;  4B3T T;  1KNP A;  2XUE A;  2X66 A;  3AEA A;  4YSZ A;  4C90 A;  3CIR A;  2BG9 A;  4HFC A;  2VUR A;  5ADX L;  4UEM A;  3UU6 A;  2IC9 A;  3PUG A;  1BR4 A;  4JI3 T;  5LBQ B;  1FJG T;  5HWX A;  1D0X A;  4Z91 A;  4PK5 A;  3PUQ A;  4I0U A;  2HHH T;  3L09 A;  3EAM A;  3OYZ A;  1W09 A;  2DHR A;  3AA0 B;  4LFA T;  3VKH A;  2OLT A;  4UV8 B;  2CWY A;  2N2N A;  2ODU A;  5FL0 A;  3T1Y T;  3JC6 D;  4TN7 B;  1IJ6 A;  4X1K E;  3P4P A;  2LSJ A;  5LCY A;  2LOP A;  4Z90 A;  2WDV A;  1D1A A;  1YKH B;  4L5G A;  5KMG P;  3AAA B;  3AAE B;  2ZLY A;  2VL0 A;  5L3E B;  1WR0 A;  2CXD A;  4ASK A;  4ISS A;  4CQI A;  4X64 T;  3QUJ A;  4CXY A;  1O3X A;  5LHH B;  2XSA A;  3VRA A;  2E9X D;  5GON E;  2CXL A;  1CHU A;  4JBW F;  4OX9 T;  4UF0 B;  2XM2 A;  3LBX B;  5IUX A;  1IAP A;  4UXN B;  4H9Q C;  4DBR A;  5J1G A;  2XZE A;  2VKO A;  1YQ3 A;  3M3Z B;  2W62 A;  2JMK A;  4IRE A;  4YHH T;  3RKO A;  5AQS B;  1HS7 A;  5LHG B;  4EED A;  5JDQ A;  1US7 B;  4ILC A;  2XTL A;  3SFE A;  2MYS A;  3LFM A;  2XAJ B;  3UUX B;  5JR9 C;  3B57 A;  4LF7 T;  4JI7 T;  5ETW A;  4F6R C;  5CA0 E;  4K0K T;  4JI4 T;  3RF1 A;  5C3J A;  5FP3 A;  4WZX A;  4H9O C;  3FXE B;  4LML A;  4DV2 T;  5JRC B;  1S94 A;  3K3N A;  3UU4 A;  3MKD A;  3ZMZ B;  4IDZ A;  5F8P A;  3NWI A;  3N5L A;  2HPL A;  3EHZ A;  1UUR A;  2V7M A;  3T1H T;  2WU5 A;  3VRB A;  4ZS2 A;  4QH4 A;  2NP9 A;  3P7I A;  2WWV A;  4DR7 T;  2XQ4 A;  1IZN B;  3FZL B;  5LB7 B;  1HNW T;  3FBZ A;  2JIW A;  2LEH A;  4ZI3 C;  4P0A A;  5JDM A;  4XAX B;  2Y48 B;  3ZN1 B;  2IC6 A;  3MAC A;  4KI0 F;  4DR3 T;  2V5D A;  4IE7 A;  4ZOL E;  4ZHQ E;  3OTO T;  2H88 A;  3ZCJ A;  2VK9 A;  4B3S T;  4L9I A;  4DBQ A;  5LG3 A;  2IIU A;  2D2S A;  3CWZ B;  2MBG A;  2KMF A;  3QK6 A;  4ANJ A;  4HWF A;  4NXM T;  4ZZC A;  2JQ9 A;  5JDL A;  3U78 A;  2FUP A;  3FZF B;  3KDS E;  3U3I A;  4Q25 A;  2CHN A;  4TUY E;  4UR9 A;  4EAH A;  2A9U A;  3AVR A;  3HI2 A;  2XPK A;  3N9N A;  2XY8 B;  3P4Q A;  2V6X A;  2X0H A;  4IL4 A;  3QC9 A;  3P4S A;  3UUB A;  1ZKE A;  1WR6 A;  3P4R A;  2CHO A;  2WDQ A;  2WM9 A;  5H6R B;  3RC8 A;  3IBP A;  4ZZB A;  2C5I T;  4ZI2 C;  4AKH A;  2Q9Q C;  4AIS A;  5L3D B;  4UVB B;  2YDS A;  3ZT7 A;  3N9L A;  2EHO C;  2WB5 A;  5HWY A;  3ZMV B;  3AE4 A;  4DND A;  3FBL A;  4O4L E;  4GIW A;  2V7J A;  4WYV A;  2CLY B;  3RGL A;  2UUB T;  2BBH A;  4EYU A;  4DR6 T;  2X9W A;  4A97 A;  4YHJ A;  2WY2 A;  4BJM A;  2BVM A;  3WI3 A;  4H63 H;  1WCR A;  2VQF T;  2LE8 A;  4HFE A;  5L3G B;  3IEE A;  1NWM X;  5FY1 A;  3PUA A;  3NVO A;  3UTK A;  4PJL A;  1XNQ T;  3LK4 2;  3ZT6 A;  5L3C B;  1E7P A;  4KUM B;  2UXD T;  4H9R C;  4ILA A;  3JC6 C;  4DMW A;  4AKL A;  5HAX A;  5LMU T;  4A56 A;  1E1H B;  2NW8 A;  2LRL A;  5FXV A;  5JH7 E;  2B76 A;  1ZEE A;  5HYA A;  3ZJ1 A;  3PUS A;  3CX7 B;  2V6Y B;  2XAQ B;  3GA8 A;  2P9B A;  2PG8 A;  1D1B A;  3LK3 B;  3RIU A;  3AE7 A;  2XAF B;  4EYY R;  3LSV A;  2YU1 A;  2UUC T;  3RI5 A;  4MLK A;  1OED C;  2E9X C;  2X9Y A;  1QUU A;  4NUV A;  5HCJ A;  4U2Y A;  3UU3 A;  5TAO A;  2F4V T;  3PUV F;  4BA9 A;  4HFV A;  2VKD A;  2XJ7 A;  2KWI B;  4AKI A;  4KMC A;  5LG4 A;  1D1C A;  1MIW A;  5CGM A;  2CXF A;  2ES0 A;  4UVC B;  2NTY A;  3H37 A;  2Y6X A;  5L3F B;  3PUZ F;  2JRK A;  2XSB A;  3KFW X;  4TV9 E;  1FMW A;  1J1J A;  3H3A A;  3PU8 A;  3CQG B;  3N9Q A;  2H89 A;  5L4H A;  1HR0 T;  3ZYM A;  4LMJ A;  4CI2 B;  4WBN E;  4DR5 T;  2G0U A;  1J5E T;  3EDU A;  2W4X A;  3FHN A;  1KNZ A;  2DWG A;  1BR0 A;  1WYB A;  4JI6 T;  4UEL A;  3NRY A;  5JTG A;  5DQV A;  3LK2 B;  3QB5 A;  3KV5 A;  1VCS A;  5FL1 A;  2LSK A;  2E8I A;  3RPU A;  2DNX A;  4O8S A;  4PK4 A;  4TWH A;  2IW5 B;  4JI5 T;  1SE7 A;  5AQI B;  1XMO T;  2M6B A;  4QX7 B;  2LKG A;  2NWB A;  3CQC B;  2OV9 A;  2V7L A;  2WBL A;  2C0S A;  3N2K E;  3EVY A;  3QOF A;  1HCI A;  2LSI A;  2CM0 A;  3FXD B;  5JR9 A;  3GN5 A;  4OYJ A;  4MHC A;  4G2A A;  4COF A;  2R6G F;  2PBI A;  4X1Y E;  3AEC A;  3ZMU B;  3I9W A;  3OVU A;  1HNX T;  4QH5 A;  2DWK A;  4CXW A;  4EZ4 A;  3MZK B;  2WAU A;  3E08 A;  5HEJ A;  4UIG A;  5FY0 A;  1VOM A;  1HF8 A;  2V5C A;  3K1S A;  2KIN B;  4CXX A;  2BS4 A;  2K3W A;  1IJ5 A;  4O2A E;  4H9S E;  1D0Y A;  1QSD A;  3ONL C;  3G06 A;  3AE5 A;  5LHI B;  4PJJ A;  5JVD E;  3R6N A;  2WMN A;  1I6Z A;  4CN4 A;  3O1J A;  3AEB A;  4H63 V;  2BKN A;  4DMV A;  3RYH E;  4OHF A;  1IBL T;  2L8K A;  3O1I A;  1WYC A;  2XQ3 A;  3ZT5 A;  3NZP A;  5FVL A;  2YN6 A;  2LHR A;  4X65 T;  3QB5 K;  4HKA A;  5LNK A;  1VCT A;  2JQQ A;  2XQ6 A;  4J2C A;  5IYZ E;  4UVA B;  4NIQ A;  3RIF A;  2JQH A;  1R8I A;  4EV6 A;  3PE0 A;  4PJM A;  3SOL A;  1ZP0 A;  2LSY A;  1MIV A;  2MOZ A;  3ANW B;  1I94 T;  3KIN B;  3UUM A;  3LJC A;  2C5K T;  2ZM8 A;  4HFI A;  4EB6 E;  3UU5 A;  4U7Y A;  5F5W A;  4DV4 T;  1BR1 A;  5ABG A;  2CMR A;  3RRC A;  4PJN A;  2HN2 A;  3D0T A;  3HR0 A;  1S35 A;  2IHR 1;  3LG7 A;  2VWA A;  4JYA T;  4O4H E;  3UQ4 A;  4U3C A;  3WAJ A;  4ZS3 A;  5HEG A;  2Q9Q A;  2KT9 A;  2LOS A;  4HWD A;  4BAY B;  3RKG A;  2ZM2 A;  4DV5 T;  2QA7 A;  2EHO A;  3T8O A;  2CWO A;  4HGA A;  2GK9 A;  3KV6 A;  1N34 T;  3CX8 B;  1BR2 A;  3UFE A;  4IE6 A;  3C98 B;  5L3B B;  4FJO A;  5L47 A;  3UUL A;  2UXB T;  2D5U A;  2DI4 A;  5LXT E;  2XHE B;  3AXJ B;  2Y8D A;  4YLH A;  4IT4 A;  4JI2 T;  1KK7 A;  1MMN A;  4I43 B;  3W15 B;  1FIO A;  4JI8 T;  5AQQ B;  4PFP A;  1T7S A;  3MA9 A;  3N2G E;  5AQP B;  2IML A;  5AQO B;  2BZB A;  5HEH A;  5CB4 E;  5JRE A;  5KXJ A;  5AQM B;  4A98 A;  4H9N C;  3ZC1 A;  3ZLI A;  4DUZ T;  3N9P A;  2CLY C;  1HG5 A;  2I6H A;  4QH1 A;  3AA7 B;  3B5M A;  2NOX A;  3PDY A;  4LF9 T;  2BS3 A;  4KHP T;  1YQ4 A;  5EK4 A;  4AQY T;  2H7O A;  2XQ9 A;  3FZM B;  3N9M A;  5BR8 T;  3ZYL A;  3OJA A;  3A7M A;  3V5U A;  4DV6 T;  5AQF B;  5AQT B;  3RQW A;  4HWC A;  5HXH A;  2E9X A;  3Q5X A;  2YK0 A;  3Q2M A;  5CA1 E;  3AEE A;  4A5X A;  3UQ7 A;  2PJQ A;  2VAS A;  5HCM A;  2YDR A;  2IDO B;  3H3M A;  2DL1 A;  2XQ7 A;  4YJ2 E;  2AXD S;  2V7I A;  1SA0 E;  4IDO A;  4GYR A;  5ABF A;  2I59 A;  4JUY A;  5AQK B;  3N2O A;  3WAK A;  2ODV A;  4ILU A;  3UU8 A;  4H9P C;  1CUN A;  2KWH A;  3ZMT B;  2VVN A;  1B7T A;  2J47 A;  2J4G A;  3EI0 A;  2I0M A;  5DAB A;  3CVR A;  2A3D A;  4DR4 T;  5AQJ B;  3AVS A;  2QRX A;  4ADZ A;  2WU2 A;  2QYW A;  2M67 A;  1FEW A;  5FXW A;  5FYM A;  3RRW A;  3RYF E;  3SRZ A;  4L0R A;  1UCU A;  4DVD A;  5FVK A;  4FI5 A;  3EDV A;  4YY3 T;  5JR9 B;  5AQV B;  2N9D A;  2PTF A;  4DV3 T;  1KNR A;  5LGU B;  3ZKR A;  2CBI A;  1VRB A;  2NTX A;  1SUM B;  1W9R A;  2XQ5 A;  3ZCI A;  4DID B;  4PAG A;  4XBF B;  3EAB A;  2E2A A;  1X9B A;  1N33 T;  2ACX A;  3ETV A;  4UV9 B;  4LF4 T;  5LGT B;  3AE1 A;  5AQG B;  2BG9 B;  5CFB A;  2RPA A;  3L8R A;  2XQ8 A;  1WFD A;  2YU2 A;  2YOE A;  1IBM T;  4ZXL A;  2IAK A;  2ZM0 A;  4UF0 A;  5ABE A;  2DCF A;  1M7K A;  2JPF A;  4OFZ A;  2FJB A;  4GK0 E;  4JV5 T;  4TV8 E;  2K48 A;  2BKO A;  2XAS B;  4U33 A;  3ZYK A;  4WNK A;  2BS2 A;  3ZC0 A;  5AFU L;  3ZSS A;  4AXP A;  4LFB T;  5LMN T;  5EK2 A;  5IWA T;  2VKH A;  3VKG A;  2WZH A;  3HA4 A;  4YT0 A;  2QVA A;  4IDN A;  2W67 A;  3UFG A;  4ERR A;  3EUH A;  1GQE A;  1AJ3 A;  3RIA A;  2QGS A;  1T98 A;  3HL6 A;  3NRX A;  1LKX A;  4DUY T;  2VVS A;  4HEA A;  2E5V A;  4O2B E;  2M6I A;  1XZY A;  4U31 A;  5JDF A;  5JDG A;  3ZST A;  2OA5 A;  1Z0P A;  3SWH A;  3PU3 A;  4DV7 T;  3IA3 A;  2VKJ A;  5FKY A;  4X20 E;  4EOZ B;  3AE6 A;  4QKN A;  2XAH B;  2WQY A;  2HH7 A;  2Z6E A;  5L2L A;  5J2U E;  3ZEF B;  4I55 E;  3AA6 B;  2A72 A;  3CPZ A;  2IUB A;  2WP9 A;  2YEV C;  5M4Y A;  1W0B A;  2RA1 A;  3O1H A;  1LVK A;  2EHO B;  3V5S A;  2YKS A;  3ZJ2 A;  4LF5 T;  2MAW A;  4I50 E;  5H6Q B;  2K24 A;  2JQK A;  5EZY E;  4PK6 A;  4U2Z A;  4IDQ A;  3KVA A;  3HKB E;  1HNZ T;  5KX5 E;  2UUA T;  1T72 A;  3S4U A;  2AE9 A;  3I0O A;  3BQL A;  3DTO A;  3F2E A;  4EXT A;  3L3P A;  1KFY A;  3AEG A;  2V1D B;  2X9H A;  3KVB A;  1NEN A;  2XQY A;  1MIY A;  4IGU A;  3C4Z A; 
#chains in the Genus database with same CATH homology
 4DBQ A;  2X68 A;  4EB6 E;  2V7K A;  5LOV E;  3I9Y A;  2D2S A;  1EZ3 A;  3CWZ B;  1BR1 A;  2CEA A;  2MBG A;  2CMR A;  2KMF A;  3O9X A;  3RRC A;  4PJN A;  3QK6 A;  4IST A;  2H7V C;  3D0T A;  3HR0 A;  1S35 A;  4ANJ A;  2KLQ A;  5JDL A;  3BK9 A;  1G73 A;  3LG7 A;  2VWA A;  3U78 A;  2RP4 A;  3C4X A;  2A2F X;  4JEU B;  4O4H E;  2CA5 A;  3WAJ A;  4ZS3 A;  3KDS E;  2Q9Q A;  2KT9 A;  2LOS A;  3U3I A;  4JLE A;  4BAY B;  3NBX X;  4TUY E;  3ESL A;  2SPC A;  4OK0 A;  5HXE A;  3K8P C;  4EAH A;  3AVR A;  5HXS A;  3HI2 A;  3N9N A;  2K5B B;  4PNI A;  2ZM2 A;  1V9D A;  2QA7 A;  4QXB B;  4XZC A;  1NAF A;  4K0U A;  5JRC A;  5FXZ A;  2JMH A;  2EHO A;  3AB3 B;  3T8O A;  2CWO A;  5HXR A;  2L3L A;  4HGA A;  4ZI7 E;  2GK9 A;  3DP7 A;  2LT3 A;  3QC9 A;  3KV6 A;  1HTJ F;  4E7S A;  1OWA A;  1YW0 A;  3CX8 B;  1BR2 A;  3UFE A;  4TX5 A;  5HXC A;  1ZKE A;  3A5X A;  5FXX A;  1WR6 A;  4IE6 A;  3C98 B;  2WM9 A;  4FJO A;  5H6R B;  5L3B B;  2LJL A;  3RC8 A;  3IBP A;  3UUL A;  1YKE B;  2D5U A;  2DI4 A;  5A1L A;  5LXT E;  2XHE B;  4P0B A;  4AQF A;  2C5I T;  4ZI2 C;  2NW9 A;  5FY7 A;  4AKH A;  3GWH A;  2Y8D A;  2Q9Q B;  2Q9Q C;  5L3D B;  4UVB B;  2MTQ A;  4AKG A;  4KBM B;  4YLH A;  3I1A A;  3N9O A;  1ZV4 X;  2CE7 A;  2BDE A;  3N9L A;  5DJQ C;  1KK7 A;  1D0Z A;  2H3R A;  4HTE A;  1MMN A;  4I43 B;  5E0O A;  2EHO C;  3W15 B;  1FIO A;  2D0U A;  5HWY A;  3OYX A;  3ZMV B;  4AKR B;  4BJN A;  4PFP A;  2UXN B;  2YIN A;  3MA9 A;  4IE0 A;  5LBM A;  4ZI3 D;  3N2G E;  4DND A;  4MBQ A;  3FBL A;  4EZH A;  2LSG A;  2KND A;  4O4L E;  3NZQ A;  4GIW A;  1WRD A;  3F31 A;  2BZB A;  5CB4 E;  2V7J A;  5JRE A;  4H9N C;  5IHY A;  1MNE A;  4YFS A;  3ZC1 A;  3KBT A;  5C8Y E;  3ZLI A;  3N9P A;  2CLY C;  2CLY B;  1HG5 A;  1MMD A;  4AQF C;  4EYU A;  2WSS V;  2X9W A;  4YHJ A;  3AA7 B;  4U72 A;  2NOX A;  3PDY A;  4BJM A;  2BVM A;  2WMO A;  3WI3 A;  4QHO A;  5EK4 A;  2H7O A;  4H63 H;  1U5P A;  3N9M A;  2LE8 A;  4P09 A;  3OJA A;  3ZYL A;  4CZZ B;  4C91 A;  4B6X A;  3I0Q A;  5L3G B;  3IEE A;  1NWM X;  3J9X 1;  3V5U A;  2W00 A;  3GMI A;  5FY1 A;  3PUA A;  3UTK A;  4PJL A;  3BQI A;  5LP6 E;  3ZCJ A;  4PW8 A;  3B13 A;  3LK4 2;  5HXH A;  5L3C B;  2E9X A;  3Q5X A;  5J1G A;  4KUM B;  2YK0 A;  4H9R C;  2DLR A;  2J1D G;  3JC6 C;  4DMW A;  4WBO A;  3Q2M A;  4V1A v;  5HAX A;  2LHN A;  4AKL A;  4A56 A;  5BMV E;  1E1H B;  2B1E A;  3O4X E;  5CA1 E;  1ZHC A;  2NW8 A;  5FXV A;  5JH7 E;  1G8X A;  2PJQ A;  2VAS A;  3Q9D A;  1ZEE A;  5HYA A;  3ZJ1 A;  2W63 A;  4IE4 A;  3PUS A;  2HPJ A;  4MAL A;  1X79 A;  3CX7 B;  2BVL A;  4YJ2 E;  2V7I A;  2XAQ B;  3GA8 A;  4QXC B;  1SA0 E;  2UXX B;  5LA6 E;  2P9B A;  2PG8 A;  1D1B A;  3C51 A;  3LK3 B;  1YD8 G;  4GYR A;  2I59 A;  4JUY A;  2XAF B;  4EYY R;  5DQW A;  3C64 A;  2XAG B;  4KP3 C;  3N2O A;  2YU1 A;  3WAK A;  5JQG E;  2X67 A;  2C5J A;  2ODV A;  4ILU A;  4M1P A;  4H9P C;  1CUN A;  2KWH A;  3ZMT B;  4MLK A;  3ONX A;  1H7C A;  4O4J E;  2E9X C;  2E9X B;  2X9Y A;  1B7T A;  1QUU A;  4NUV A;  4QWN B;  4ZI2 D;  4QXH B;  5DAB A;  5JDN A;  2Q9Q D;  1MMG A;  4PFO A;  3CVR A;  5TAO A;  2A3D A;  3M65 A;  3HKD E;  1WLX A;  4BA9 A;  4YJ3 E;  3AVS A;  4HFV A;  3DJB A;  2VKD A;  2KWI B;  4AKI A;  4ADZ A;  4KMC A;  2EHO D;  5LG4 A;  2X9X A;  2M67 A;  1FEW A;  1D1C A;  5FYM A;  5FXW A;  3RRW A;  3RH3 A;  3RYF E;  3SRZ A;  1MIW A;  5KDM C;  4WW0 A;  5J2T E;  4L0R A;  2CXF A;  1UCU A;  2ES0 A;  4DVD A;  4UVC B;  2XUE A;  2X66 A;  2NTY A;  3BQK A;  2X51 A;  3EDV A;  4FI5 A;  4C90 A;  3VU7 H;  3H37 A;  2Y6X A;  4O4I E;  5L3F B;  3P8C D;  5JR9 B;  2N9D A;  5ADX L;  1HX8 A;  5LGU B;  2JRK A;  4UEM A;  3KV4 A;  5LJN A;  4TV9 E;  3KFW X;  1VRB A;  2IC9 A;  3PUG A;  4GYS A;  1FMW A;  2NTX A;  3SS1 A;  1BR4 A;  3RX6 A;  5FMN A;  5JDH A;  3ZCI A;  3H3A A;  3PU8 A;  5LBQ B;  5HWX A;  1D0X A;  4PAG A;  4XBF B;  4PK5 A;  3PUQ A;  3VHL A;  3CML A;  3CQG B;  3L09 A;  2ACX A;  2LM9 A;  3ETV A;  3OYZ A;  2KZ7 B;  4UV9 B;  3N9Q A;  3ZN0 B;  2DHR A;  3AA0 B;  5LGT B;  3VKH A;  4UV8 B;  3ZYM A;  4CI2 B;  2CWY A;  2N2N A;  4WBN E;  4DO0 A;  2ODU A;  4IIJ E;  2G0U A;  3EDU A;  3JC6 D;  3IF8 B;  4TN7 B;  1IJ6 A;  2YU2 A;  4HE8 A;  3OBV E;  4X1K E;  2IAK A;  3FHN A;  1HFA A;  2ZM0 A;  4G63 A;  4UF0 A;  5LJM A;  1KNZ A;  2DWG A;  2LSJ A;  4CI1 B;  3PTR B;  5LCY A;  2DCF A;  1BR0 A;  2LOP A;  1WYB A;  2JPF A;  3KV9 A;  4I4T E;  1D1A A;  1YKH B;  4L5G A;  5KMG P;  4OFZ A;  3AAA B;  3AAE B;  2ZLY A;  4UEL A;  5FNV E;  3E22 E;  3NRY A;  4GK0 E;  5L3E B;  5DQV A;  3LK2 B;  2CXD A;  3KV5 A;  4TV8 E;  2LSK A;  4ASK A;  2K48 A;  2E8I A;  4ISS A;  4CQI A;  2XAS B;  4QX8 B;  3ZYK A;  3QUJ A;  4WNK A;  4CXY A;  3RPU A;  3UUN A;  2DNX A;  4O8S A;  1O3X A;  4Z8X A;  4PK4 A;  5LHH B;  3ZC0 A;  2IW5 B;  3ETU A;  5AFU L;  4AXP A;  2V26 A;  2E9X D;  3PUR A;  5F3J A;  5GON E;  2CXL A;  5EK2 A;  3VKG A;  2VKH A;  2NW7 A;  3HA4 A;  4QX7 B;  3FB2 A;  2NWB A;  3RYI E;  3TKL B;  3CQC B;  4UF0 B;  5EK3 A;  3RC3 A;  2V7L A;  3LBX B;  2WBL A;  2C0S A;  3N2K E;  4ERR A;  3EUH A;  1IAP A;  3EVY A;  4H9Q C;  4UXN B;  3J7Y q;  1AJ3 A;  1HCI A;  2LSI A;  2QGS A;  4DBR A;  2CM0 A;  1MND A;  1T98 A;  2WWU A;  2VKO A;  3FXD B;  3GN5 A;  3HL6 A;  2VL8 A;  3NRX A;  4G2A A;  4MHC A;  4OYJ A;  2CCQ A;  1LKX A;  4X1I E;  1FMV A;  3OKQ A;  2PBI A;  4OYK A;  4X1Y E;  5JR9 A;  4HEA A;  3I9W A;  3ZMU B;  3MK7 C;  2JJ9 A;  2W62 A;  4O2B E;  3ZMS B;  3CX6 B;  2JMK A;  2ZMA A;  4E7Z A;  5JDF A;  3RKO A;  5JDG A;  4EIW A;  4GK5 E;  1MMA A;  2DWK A;  1HS7 A;  4CXW A;  4EZ4 A;  3MZK B;  2WAU A;  5LHG B;  2N1G A;  3E08 A;  3ZPO A;  1UX5 A;  5JDQ A;  2OA5 A;  1US7 B;  1LVF A;  2VB6 A;  1Z0P A;  3SWH A;  3PU3 A;  3AAI A;  4UIG A;  5FY0 A;  1VOM A;  1HF8 A;  2VKJ A;  2XTL A;  2KIN B;  4CXX A;  4X20 E;  4EOZ B;  3CQX C;  2MYS A;  3LFM A;  4QKN A;  2XAJ B;  3UUX B;  5JR9 C;  2XAH B;  3GN5 B;  3B57 A;  3IHR A;  2HH7 A;  3HKC E;  1IJ5 A;  4O2A E;  2Z6E A;  5L2L A;  5J2U E;  4H9S E;  1D0Y A;  5ETW A;  1QSD A;  4F6R C;  2K9A A;  5CA0 E;  3ZEF B;  3C4W A;  4I55 E;  3UT5 E;  3K3Q C;  3AA6 B;  2A72 A;  4IHJ E;  5FP3 A;  3CPZ A;  2KXP B;  3MXZ A;  3FXE B;  4H9O C;  4GOU A;  4CI3 B;  2YEV C;  5LHI B;  4PJJ A;  5M4Y A;  5JVD E;  2W61 A;  3R6N A;  2RA1 A;  2W0G A;  5JRC B;  1S94 A;  3O1H A;  2WMN A;  3K3N A;  4HN9 A;  3E0Z A;  3O1J A;  4H63 V;  2PFV A;  1LVK A;  2EHO B;  1UX4 A;  4IE5 A;  3V5S A;  3MKD A;  4DMV A;  3RYH E;  3ZMZ B;  4U74 A;  4IDZ A;  5F8P A;  4JEH B;  5LGN B;  1U4Q A;  4OHF A;  3N5L A;  2HPL A;  4N78 D;  4AQG A;  2L8K A;  3O1I A;  1WYC A;  3CKD A;  3R84 B;  2D0T A;  2V7M A;  3ANW A;  3F57 A;  2L9Q A;  3ZJ2 A;  1OXZ A;  1Y64 B;  4I50 E;  4NUU A;  4TZ4 C;  4ZS2 A;  5H6Q B;  2K24 A;  3NZP A;  2NP9 A;  1HG2 A;  3P7I A;  5EZY E;  3MJX A;  2LHR A;  3LBX A;  4PK6 A;  4MFR A;  3KVA A;  3HKB E;  3HKE E;  3AA1 B;  1IZN B;  4HKA A;  1SHZ C;  5KX5 E;  5LNK A;  3FBZ A;  2LEH A;  4ZI3 C;  4P0A A;  2JQQ A;  4J2C A;  3C50 A;  2X0L B;  5JDM A;  5IYZ E;  3S4U A;  3K3O A;  4XAX B;  4UVA B;  3I0O A;  2Y48 B;  3ZN1 B;  2IC6 A;  4AI6 A;  3BQL A;  3DTO A;  3F2E A;  3MAC A;  4EXT A;  3L3P A;  5LYJ E;  3RYC E;  3PE0 A;  4PJM A;  2V1D B;  3SOL A;  4IE7 A;  2X9H A;  3Q5W A;  3KBU A;  3KVB A;  2LSY A;  4ZOL E;  2XQY A;  1MIV A;  4ZHQ E;  2MOZ A;  1MIY A;  3ANW B;  4IGU A;  3KIN B;  3UUM A;  1LRZ A;  3LJC A;  2C5K T;  2ZM8 A;  2VK9 A;  3C4Z A;  4L9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...