2XHEB

Crystal structure of the unc18-syntaxin 1 complex from monosiga brevicollis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
260
structure length
220
Chain Sequence
DRLSRLRQMAAENQPEPFMADFFNRVKRIRDNIEDIEQAIEQVAQLHTESLVAVSKEDRDRLNEKLQDTMARISALGNKIRADLKQIEKENKRAQQEGTFEDGTVSTDLRIRQSQHSSLSRKFVKVMTRYNDVQAENKRRYGENVARQCRVVEPSLSDDAIQKVIEHGNEIRDRHKDIQQLERSLLELHEMFTDMSTLVASQGEMIDRIEFSVEQSHNYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Exocytosis
molecule keywords UNC18
publication title Primordial Neurosecretory Apparatus Identified in the Choanoflagellate Monosiga Brevicollis.
pubmed doi rcsb
source organism Monosiga brevicollis
total genus 79
structure length 220
sequence length 260
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xheB01
4JEUB 3LG7A 1G73A 5M4YA 1EZ3A 1S94A 1FIOA 1HS7A 1BR0A 4JEHB 3C98B 1FEWA 2XHEB 4TX5A 5LG4A 2DNXA
chains in the Genus database with same CATH superfamily
2WBLA 1MIWA 2J62A 3SFDA 5EK3A 3AEGA 2YDQA 3VHLA 4HEAA 5H6QB 4J2CA 2WU5A 5EK4A 3O4XE 5FNVE 3K3QC 2V6YB 2YK0A 3ZMZB 4YSXA 4WZXA 4PFPA 2K3WA 4ILUA 2E9XC 3VU7H 4TX5A 4DV5T 2OLTA 4MALA 4X20E 5J1GA 2WQYA 3A5XA 4QKNA 4AKLA 1D1CA 1W0AA 3Q5DA 4I55E 4DR1T 3AE8A 3AEEA 4AQFC 3B13A 5L47A 4X65T 3ZMSB 3E22E 1T72A 4WW0A 2Z6EA 4ZZBA 3CQXC 4QX8B 4OHFA 3AA0B 2VWAA 2M6IA 1HX1B 5KXJA 4YLHA 5AQQB 4YHJA 2V6YA 3MACA 2F4VT 2D9DA 5ABHA 3VKGA 3P4PA 4HGAA 4Z90A 3C64A 3I9YA 2XAGB 1XZYA 1YQ3A 3KBTA 2PBIA 4DIDB 2E9XA 3R6NA 3ZKRA 3O1HA 1M62A 2VKOA 4TV9E 3NKZA 2DCFA 3LJCA 3V5UA 4BJMA 3JCFA 2DNXA 5AQPB 2UXXB 5GONE 4LFCT 4ILCA 4C90A 4AQFA 1G73A 3T1HT 4U31A 5FL0A 3AE5A 2J47A 2LKHA 4PJMA 2RPAA 4O8SA 2QVAA 2IDOB 1HG5A 5FVLA 3OVUA 3ZYKA 1NENA 5JRCB 4DMWA 5LP6E 5JQGE 3N9LA 4DVDA 4WBNE 4WBOA 5L4HA 2VKHA 2J4GA 2W00A 3IEEA 4EAHA 4ERRA 4ZZCA 1VCTA 2BZBA 3ZT5A 2D0TA 2L3LA 3NRYA 5IHYA 2W4XA 3HKBE 4TV8E 5EK2A 2DWKA 1KNRA 4IL9A 2WY2A 2IHR1 5JDQA 4OYKA 5FL1A 2W67A 3L8RA 1FMVA 2V7IA 2ZM8A 3ZN1B 2NW7A 2L9QA 3N2KE 3AAEB 2BVMA 3ZSTA 3KBUA 2ES0A 4H9QC 2WDRA 1AJ3A 3T1YT 4COFA 2CM0A 2KSRA 1QLBA 3AB3B 2HN1A 2NP9A 4KHPT 4CI3B 3EDVA 3N2GE 5FY0A 3RKGA 1FMWA 4LF5T 4XBFB 5DABA 4KUMB 2XM2A 4KHZF 5J0ZA 2JIWA 2XAHB 3BQIA 4HWIB 4LMLA 3DP7A 2SPCA 3W15B 2VURA 4X1KE 3EDUA 5M4YA 2IUBA 4HFCA 5L3CB 4GYRA 2VASA 4YFSA 3LFMA 5ABFB 2V7MA 1VOMA 3FBZA 3I0QA 1L0VA 3Q5EA 4DV3T 4HFIA 3SS1A 4AISA 2LEHA 2LSYA 3MA9A 2HN2A 4UELA 3RH3A 1HNWT 4PNIA 1Y64B 3O9XA 4DR3T 3BQKA 4I0UA 1B7TA 3AA1B 3PUQA 2CE7A 2ODUA 3UUXB 4LF7T 5JTGA 3ZJ1A 1XMOT 2XQ6A 3TLSA 3AVRA 4NXMT 4F6RC 1W9RA 5J2UE 4YSZA 1WLXA 3AEBA 3Q5XA 1OEDC 5JVDE 5AFUL 2ACXA 5CB4E 4U3CA 1OEDB 5LBQB 2XJ7A 2CHNA 1R8IA 2I59A 5AQVB 3UTKA 3N9MA 3HL6A 3ANWB 4G63A 2CWOA 4G2AA 3UQ7A 2H89A 5EZYE 2LLYA 3AEFA 3N5LA 4HFHA 4XAXB 5JR9B 2E2AA 3CMLA 2HPLA 2K9AA 3UFGA 3UUBA 5FKYA 1G8XA 3TLTA 4BA9A 3PUSA 3C4ZA 3WAJA 3NZPA 4GIWA 2CWYA 3MKDA 3G06A 4PK5A 4X1IE 4EEBA 3PUWF 1N34T 3KINB 3QNUA 2V5DA 1OEDA 5KMGP 2VQET 3GMIA 2WSSV 5JDFA 3PDYA 2KINB 2LRLA 2VL8A 4PK6A 3B5MA 2E5VA 1LVKA 2PJQA 1FIOA 2WS3A 3O1IA 1U5PA 3CX8B 3J9X1 2CXLA 5TAOA 4H9RC 4EEDA 4JI4T 2KLQA 4AKHA 4UEMA 4QXBB 3T8OA 4MLKA 5FXWA 1XWMA 3ZCIA 3AE9A 3ZLIA 2FJEA 3UU6A 5FY1A 3CWZB 5AQLB 2A2FX 2LHNA 1QSDA 5LJMA 4HFDA 3ZT7A 3GWHA 3PUVF 1XDOA 1LKXA 5JH7E 4MHCA 1D0XA 2XQ8A 2XM1A 1SUMB 5L2LA 5L3DB 2W61A 4KI0F 4H9NC 2DHRA 2XSAA 4I4TE 3P4QA 4QXHB 4AQGA 2V5CA 5HXEA 3ZJ2A 2LOPA 4PAGA 2W66A 2MAWA 3RI5A 2W0GA 3RRWA 3PV0F 5HXRA 4U33A 2D5UA 1E7PA 1CHUA 3ZMTB 2LSIA 2K48A 3LK2B 5ABGA 3GN5B 2BG9C 3KVAA 3JAEA 1HCIA 4NIQA 2W2UA 2MTQA 1I94T 2XTLA 3HKDE 3NBXX 1WR6A 3CKDA 4AKIA 4ISTA 4ZI3D 1MMNA 4DR5T 1UCUA 4P0AA 4U2ZA 3VRAA 4AIUA 2PFVA 4JEHB 4Z91A 2ZM0A 5LA6E 1YW0A 3FXEB 5DQVA 3ZMUB 4DR6T 4IT4A 2W62A 3HR0A 4A5XA 3FB2A 3KFWX 5LG3A 5KX5E 4PJJA 3P8CD 3VR8A 3L39A 1OWAA 3C50A 4KBMB 2D2SA 5HXCA 3QB5A 1IBLT 1FJGT 3RC8A 5HEHA 1IZNB 1KK7A 1HR0T 3RF1A 2PG8A 3ZEFB 4P1NA 2BG9A 4O4HE 5J2TE 2WMOA 4HWDA 2LT3A 3UU5A 2CLYB 4HFVA 4ZI2D 4H9PC 4OX9T 5FP3A 4WNKA 5H6RB 2BKNA 3KV4A 4EIWA 4LFAT 3HA4A 5DQWA 4DV2T 1M7KA 1SA0E 2WU2A 3CIRA 3P4SA 2DI4A 2WMNA 3MZKB 4ZS3A 2KZ7B 5A1LA 3QC9A 4OFZA 2C5IT 2V7JA 4PFOA 5FXVA 3N9NA 5C2TA 2BDEA 2YDSA 3RYIE 4AXPA 3I1AA 5LXTE 3N2OA 1D1BA 4JV5T 1IAPA 3AEDA 4IDOA 4UR9A 2UXNB 3U3IA 3H3MA 4OYJA 2RP4A 4GKJT 2XQ9A 5AQOB 2KT9A 2L8KA 2GK9A 4ZXLA 3RYCE 1ZKEA 2UXDT 2YINA 3F57A 2XY8B 4V1Av 3LK42 4O2AE 3ZN0B 1VCSA 3IBPA 1WFDA 2ZLYA 4DUZT 3L09A 2XUEA 3P7IA 1LRZA 3ESLA 4DMVA 1Z8UA 4IDPA 5AQHB 5JDLA 4ILBA 4LF4T 2ZM2A 2MPKA 1DU2A 4L0RA 3PURA 4AI6A 2ODVA 3RRCA 3N9QA 5IUXA 4QH1A 4GOUA 1W09A 2FJBA 4TWFA 1YXRA 3ZMVB 2N2NA 2CMRA 1O3XA 4DR4T 4JBWF 3EABA 2X0YA 3ONLC 4UVBB 1ZV4X 2YN6A 4HFBA 4DBRA 3IA3A 4ZEYA 1XDPA 5IYZE 2XAQB 1WYCA 3RPUA 4EZHA 1KEYA 4UVCB 2MYSA 5JRCA 1MNDA 3RHWA 5HXSA 2X0LB 3RQWA 2RA1A 3UT5E 3PU3A 4ZI3C 2G0UA 2YU2A 4H63H 5JREA 2CA5A 2QRXA 2OA5A 1HTJF 2HHHT 5AQKB 3S4UA 1UK5A 3RGLA 4ANJA 3OYXA 3ONJA 5CFBA 4NPPA 4I43B 4UF0B 4A97A 1MNEA 4U72A 1Z0PA 3PJAA 2WDVA 3A8YC 4PK4A 2JQKA 2NTXA 4QX7B 3RIFA 2V8SV 4JI1T 1J5WA 2ZM6T 3RYHE 4ZI2C 5HWYA 3UULA 4CXXA 2XQAA 3CX7B 1NAFA 2EHOB 4JI8T 1UX5A 4IE0A 3NZQA 4WYVA 2JRKA 4HWFA 2XHEB 3ZC1A 4IIJE 1HX8A 4IDQA 3FZKB 2DLRA 2A3DA 4B6XA 4UF0A 5HEJA 4JI0T 4DV0T 5ABFA 2C0SA 1D1AA 3AE3A 4DO0A 1SE7A 2BG9E 3F31A 5ABEA 1U4QA 4GK0E 5HEOA 1YKEB 3PUXF 3ZYMA 3UU8A 2K5BB 3KDSE 2V1DB 5JR9C 4MFRA 1MMGA 5LG4A 1UGOA 3AE4A 2XQYA 2FUPA 3P4RA 2X0HA 2N9DA 4JI5T 2JPFA 1UURA 3JC6D 5C8YE 3LG7A 4IE6A 3N9OA 3AE7A 3PJAJ 2IAKA 3LDQB 3OYZA 4B3ST 2WM9A 2AE9A 2V26A 4IE4A 3R84B 3GA8A 2VVSA 1KNZA 1VRBA 4DR2T 3P50A 4PJNA 1Y01A 4U2YA 4CN1A 4CI1B 3ANWA 1EZ3A 4PJLA 4O2BE 3EI0A 5JR9A 3RIAA 3BQLA 5AQSB 2IC6A 3B57A 2OV9A 1X9BA 2FBWA 3TLWA 1US7B 2KMFA 4B3TT 3AXJB 1I6ZA 3IF8B 1LVFA 5F3JA 5L4EA 2JMKA 1HS7A 2IMLA 1MMDA 3ETUA 3JAFA 5CA1E 2XQ5A 3ONXA 4JI2T 2C5KT 3C98B 3MXZA 4MBQA 3C4WA 2E8IA 4X1YE 5FMNA 3RIUC 3JADA 1W0BA 4X66T 2J1DG 4JI7T 4E7ZA 5C3JA 2A9UA 5AQNB 5LB7B 2CXFA 3LBXB 3EUHA 4FJOA 1WCRA 3LK3B 4JEUB 3UQ4A 4DR7T 2B1EA 5FVKA 2VL0A 2Q9QB 3D0TA 2X67A 1KF6A 5HCMA 3PUYF 2QYWA 3DTOA 3FZLB 3HKCE 4JI6T 1N36T 1D0YA 5E0OA 1ZOYA 4DBQA 3SFEA 2I0MA 5LGUB 5F5WA 1T7SA 3ZSSA 3FBLA 5CGMA 2CRBA 2LKGA 2H3RA 2WWUA 4H9SE 5L3GB 4H63V 1HNZT 4CN6A 4L9IA 3ZYLA 3RIUA 2WWVA 3ABVA 3MJXA 2Y48B 3UUMA 3AE1A 5IWAT 3UFEA 2H7OA 4EOZB 5JDNA 2X51A 4GKKT 4O4LE 2I6HA 4L5GA 2HH7A 3KV9A 2N1GA 3ZC0A 4HN9A 2MBGA 4FI5A 2MOZA 2LSGA 2BVLA 4GK5E 4DUYT 1BR4A 5L3EB 3I9WA 3RQUA 3ZPOA 3FXDB 4O4IE 5LHHB 1WR0A 4LMKA 2XPKA 3L3PA 4YJ3E 1WRDA 1IBMT 1S94A 5L3FB 2IC9A 2LOSA 1HFAA 3GN5A 4A98A 1MMAA 3JC6C 2CLYC 3AA6B 4OK0A 5LCYA 2YU1A 2Y8DA 5DJQC 2EHOD 4NXNT 4IDNA 3K3OA 4JUYA 3PUZF 1SHZC 2X9WA 4HTEA 1MIYA 5KDMC 2A72A 4JYAT 5FYMA 1ZEEA 5HYAA 2LM9A 2VKJA 3H3AA 5LMUT 5JDGA 2E9XB 4TZ4C 1E1HB 3MK7C 2DL1A 3CK6A 3DJBA 3E08A 4O4JE 4HE8A 5AQGB 3KVBA 2D0UA 2WZHA 3AE2A 4UIGA 1GQEA 3A7MA 1YQ4A 4EV6A 4IREA 4P0BA 4LF8T 4AQYT 2KWHA 4CXWA 4QH5A 2K24A 1MIVA 2UUAT 1OEDE 1V9DA 3M65A 1JNZA 5AQJB 2YKSA 5LNKA 4CZZB 3WI3A 3RLFF 3IHRA 5BMVE 5LJNA 3FZHB 2X66A 4CN4A 3VKHA 4HWCA 3PU8A 5HWXA 4ISSA 4YHHT 2UXCT 2WB5A 1HF8A 3QB5K 5HEUA 3RYFE 1J1JA 4BJNA 2CHOA 4Q25A 1FEWA 4N78D 3ZT6A 4EXTA 3OBVE 3EVYA 3F2EA 4HKAA 4CQIA 1YKHB 2IIUA 2VVNA 4A56A 1IBKT 1IJ5A 3LSVA 2YDRA 1XMQT 1S35A 1XNQT 2QGSA 4KX6A 4JLEA 3E0ZA 5FY7A 4GYSA 3UUNA 4M1PA 3AVSA 3HI2A 4YTPA 2VB6A 3EAMA 4X5TA 2HPJA 3P4WA 2QA7A 5BR8T 4X62T 4ZI7E 4QXCB 2LJLA 2ACZA 2XAFB 2JJ9A 1T98A 1UUSA 2JQHA 2X9HA 2BKPA 1ZP0A 2XZEA 2Y6XA 3CX6B 2KWIB 2H88A 3VRBA 2P9BA 2Q9QD 3QOFA 2KNDA 2BBJA 2CXDA 3HKEE 2WDQA 2JQQA 5LYJE 4UV8B 3U78A 1BR1A 4X64T 2XSBA 4DV4T 3PUAA 4DV1T 3PE0A 2CBIA 4PW8A 3FZFB 4LF9T 2FJAA 3AA7B 1OXZA 3UU4A 3NWIA 4JI3T 2WZIA 3CQCB 2CPTA 4QWNB 2EHOC 3H37A 1BR2A 3TLUA 4EZ4A 1IJ6A 4C91A 4LFBT 3QUJA 3CPZA 4TN7B 1HNXT 4TNWA 2UUCT 1UX4A 2FJDA 3C4XA 4YXDA 4YSYA 4F8HA 4HFEA 4ZS2A 4AKGA 2LM2A 2B76A 2AXDS 5LMNT 1X79A 3OKQA 3AECA 2CCQA 2CBJA 4QH4A 2UUBT 4UVAB 2XQ3A 2XAJB 3K1SA 4LMJA 5JDMA 2EHOA 4Z8XA 5LGNB 3BK9A 2V7LA 2WCAA 4P09A 3AAAB 2VKDA 5JDHA 3OTOT 3NRXA 2YOEA 2VK9A 4B3RT 3ETVA 4XZCA 2X9YA 2XQ7A 4YT0A 3K3NA 3KV6A 4UV9B 2H7VC 4H9OC 5LOVE 2BS4A 4ILAA 4B3MT 4UXNB 4U7YA 4BAYB 5CA0E 5F8PA 3N9PA 2E9XD 3M3ZB 5HXHA 3RX6A 2BKOA 4NUUA 3I0OA 4EGWA 2W63A 4IDZA 1KNPA 4IL4A 3SWHA 3J7Yq 4K0KT 3O1JA 4YY3T 2C5JA 3RC3A 5LBMA 4HWHA 4IGUA 2E5LT 3ZCJA 2WP9A 2IW5B 2LSKA 3TKLB 4QHOA 2NWBA 3UU3A 3V5SA 3AEAA 5LHGB 2XASB 3OJAA 4IHJE 1ZHCA 2PTFA 1KFYA 4TUYE 1D0ZA 4U7IA 3SRZA 3EHZA 5AQMB 1XNRT 3Q9DA 3CVRA 5AQIB 2UXBT 4TWDA 5HEGA 4DV7T 2LRKA 2YEVC 5AQRB 1CUNA 1N32T 2NW8A 3NVOA 4YJ2E 2V6XA 4IE5A 5FXZA 4ZOLE 4K0UA 2JQ9A 2ZMAA 1YD8G 5LGTB 2LHRA 1JNRA 5LHIB 1E2AA 4LF6T 2LSJA 4ADZA 2Q9QC 3AE6A 2X68A 4E7SA 3C51A 1HG2A 3FZMB 5HCJA 3AAIA 3AXJA 4TNVA 3PTRB 4I50E 2BS2A 2BS3A 2VQFT 4EB6E 4KP3C 3TLVA 4YTMA 1T8BA 2R6GF 3K8PC 2V7KA 4TWHA 5AQUB 2UU9T 2CEAA 4NUVA 5CJ5A 5ADXL 3LBXA 4DV6T 3RKOA 3CQGB 5HAXA 5AQTB 5FXXA 3Q2MA 2X9XA 3Q5WA 1J5ET 3SOLA 4KMCA 3QK6A 3KV5A 4ASKA 4YTNA 1H7CA 2Q9QA 5L3BB 2WAUA 4EYUA 3VR9A 3WAKA 2LE8A 2DWGA 3X1DA 5AQFB 1WYBA 1N33T 4DNDA 3OPCA 2KXPB 2BG9B 1NEKA 1NWMX 2M6BA 2BBHA 4AKRB 2JMHA 2M67A 4ZHQE 3FHNA 5ETWA 1QUUA 1BR0A 2NW9A 4U74A 2NOXA 2XQ4A 2NR4A 4CXYA 3PUGA 2NTYA 4EYYR 4CI2B 4IE7A
chains in the Genus database with same CATH topology
4CQIA 2WBLA 1YKHB 2A2FX 1MIWA 2LHNA 2DLRA 2A3DA 5EK3A 4B6XA 4A56A 1QSDA 4UF0A 5LJMA 1IJ5A 4HEAA 3VHLA 5H6QB 4J2CA 1S35A 5EK4A 3O4XE 5FNVE 2QGSA 3GWHA 4JLEA 3K3QC 2C0SA 1D1AA 2YK0A 1LKXA 4DO0A 5JH7E 3F31A 3E0ZA 5FY7A 3ZMZB 4MHCA 1D0XA 4PFPA 1U4QA 4GYSA 4ILUA 4GK0E 2E9XC 3VU7H 4TX5A 4MALA 3UUNA 4M1PA 1YKEB 4X20E 5J1GA 3A5XA 3AVSA 3HI2A 3ZYMA 4QKNA 2K5BB 3KDSE 4AKLA 2V1DB 2VB6A 5L2LA 1D1CA 2HPJA 5L3DB 5JR9C 2QA7A 2W61A 4MFRA 1MMGA 4I55E 5LG4A 2XQYA 4H9NC 2DHRA 4ZI7E 4I4TE 4AQFC 3B13A 2N9DA 2JPFA 4QXCB 2LJLA 4QXHB 3JC6D 5C8YE 4AQGA 5HXEA 3LG7A 3ZMSB 3E22E 4WW0A 2XAFB 2Z6EA 2JJ9A 3ZJ2A 1T98A 2LOPA 3CQXC 4PAGA 2X9HA 4IE6A 3N9OA 4QX8B 2Y6XA 2IAKA 3CX6B 2KWIB 2VWAA 3AA0B 4OHFA 4YLHA 3OYZA 2W0GA 2P9BA 2Q9QD 3RRWA 2WM9A 5HXRA 4YHJA 2KNDA 2CXDA 2V26A 3MACA 4IE4A 3HKEE 3R84B 2JQQA 3GA8A 2D5UA 5LYJE 3VKGA 1KNZA 4UV8B 4HGAA 3U78A 1VRBA 3C64A 1BR1A 3ZMTB 3I9YA 2XAGB 3PUAA 2LSIA 2K48A 3KBTA 3LK2B 4PJNA 2PBIA 3GN5B 3PE0A 4PW8A 3KVAA 4CI1B 2E9XA 3ANWA 3R6NA 3O1HA 1EZ3A 2VKOA 1HCIA 3AA7B 4TV9E 4PJLA 2DCFA 1OXZA 3LJCA 4O2BE 3V5UA 2MTQA 4BJMA 5JR9A 3CQCB 3BQLA 2XTLA 3HKDE 2DNXA 2IC6A 2EHOC 3B57A 3H37A 3NBXX 1BR2A 2UXXB 1WR6A 4QWNB 5GONE 4EZ4A 1IJ6A 3CKDA 4C91A 4AKIA 4ISTA 4ZI3D 1MMNA 4C90A 4AQFA 1UCUA 4P0AA 1G73A 1US7B 2PFVA 2KMFA 3QUJA 3CPZA 3IF8B 1LVFA 4JEHB 4PJMA 4TN7B 5F3JA 2ZM0A 5LA6E 1YW0A 2JMKA 3FXEB 5DQVA 3ZMUB 4O8SA 1HS7A 2W62A 1MMDA 3HR0A 3ETUA 3FB2A 3KFWX 5CA1E 3ONXA 1HG5A 2C5KT 3C98B 5KX5E 4PJJA 3MXZA 4MBQA 3ZYKA 1UX4A 3P8CD 5JRCB 4DMWA 3C4WA 2E8IA 3C4XA 4X1YE 5FMNA 5LP6E 5JQGE 3N9LA 1OWAA 3C50A 4KBMB 4DVDA 4WBNE 2D2SA 5HXCA 4ZS2A 4WBOA 3RC8A 4AKGA 2VKHA 2J1DG 1IZNB 1KK7A 4E7ZA 2PG8A 2W00A 3ZEFB 3IEEA 4EAHA 2CXFA 4ERRA 3LBXB 2BZBA 1X79A 3EUHA 3OKQA 4FJOA 4O4HE 5J2TE 2D0TA 2WMOA 2L3LA 2CCQA 2LT3A 3LK3B 3NRYA 5IHYA 4JEUB 3HKBE 4TV8E 2CLYB 4HFVA 4ZI2D 4H9PC 4UVAB 5EK2A 2DWKA 2XAJB 5JDMA 2EHOA 5FP3A 4WNKA 2B1EA 4Z8XA 5H6RB 5LGNB 2Q9QB 3BK9A 5JDQA 2V7LA 3KV4A 3D0TA 4OYKA 4P09A 2X67A 3AAAB 4EIWA 2VKDA 5JDHA 3DTOA 3HA4A 5DQWA 1FMVA 2V7IA 2ZM8A 3ZN1B 3NRXA 1SA0E 2NW7A 3HKCE 2L9QA 3N2KE 3AAEB 2BVMA 1D0YA 5E0OA 4DBQA 3KBUA 2VK9A 2ES0A 3ETVA 4XZCA 2DI4A 4H9QC 1AJ3A 2X9YA 2WMNA 3K3NA 3MZKB 5LGUB 4ZS3A 3KV6A 2KZ7B 4UV9B 2CM0A 3FBLA 2H7VC 4H9OC 5LOVE 2H3RA 2WWUA 4H9SE 5A1LA 3QC9A 4OFZA 4UXNB 3AB3B 2C5IT 5L3GB 2V7JA 4PFOA 2NP9A 4BAYB 5FXVA 3N9NA 4H63V 5CA0E 5F8PA 4L9IA 3ZYLA 4CI3B 3EDVA 3N2GE 5FY0A 3N9PA 2E9XD 2BDEA 1FMWA 3RYIE 4AXPA 5HXHA 3RX6A 3MJXA 2Y48B 4NUUA 3I0OA 2W63A 3UUMA 3I1AA 5LXTE 4XBFB 4IDZA 5DABA 3UFEA 4KUMB 2H7OA 4EOZB 3N2OA 1D1BA 3SWHA 2XAHB 5JDNA 3J7Yq 1IAPA 2X51A 3O1JA 4O4LE 2C5JA 3RC3A 4L5GA 5LBMA 3BQIA 2HH7A 2UXNB 3KV9A 3U3IA 4IGUA 4OYJA 2N1GA 2RP4A 3DP7A 2SPCA 3W15B 3ZCJA 3ZC0A 4HN9A 2MBGA 4X1KE 3EDUA 5M4YA 2IW5B 2LSKA 2KT9A 2L8KA 2GK9A 2MOZA 4FI5A 4GYRA 1ZKEA 2VASA 3RYCE 5L3CB 2YINA 3F57A 4YFSA 2LSGA 3LFMA 3TKLB 4QHOA 2BVLA 2NWBA 4GK5E 3V5SA 2V7MA 1VOMA 3FBZA 4V1Av 3I0QA 5LHGB 3LK42 2XASB 4O2AE 1BR4A 3OJAA 4IHJE 1ZHCA 5L3EB 3ZN0B 3I9WA 3ZPOA 3IBPA 4TUYE 3SS1A 1D0ZA 3SRZA 2LEHA 3FXDB 4O4IE 2LSYA 2ZLYA 3MA9A 3L09A 4UELA 3RH3A 3Q9DA 2XUEA 5LHHB 3CVRA 3P7IA 1LRZA 3ESLA 3L3PA 4YJ3E 2YEVC 1WRDA 4PNIA 1Y64B 1S94A 3O9XA 4DMVA 1CUNA 5L3FB 2NW8A 2IC9A 3BQKA 1B7TA 4YJ2E 2LOSA 3AA1B 1HFAA 3GN5A 5JDLA 1MMAA 3PUQA 4IE5A 2ZM2A 5FXZA 2CE7A 4ZOLE 3JC6C 2ODUA 4K0UA 3UUXB 2ZMAA 1YD8G 4L0RA 5LGTB 3ZJ1A 3AVRA 3PURA 2LHRA 4AI6A 2CLYC 3AA6B 4OK0A 2ODVA 3RRCA 4F6RC 5LHIB 5LCYA 2YU1A 3N9QA 2Y8DA 5DJQC 5J2UE 1WLXA 2LSJA 4GOUA 3ZMVB 2EHOD 4ADZA 3Q5XA 2N2NA 2CMRA 2Q9QC 5JVDE 3K3OA 4JUYA 2X68A 4E7SA 1O3XA 5AFUL 3C51A 1SHZC 2X9WA 4HTEA 1MIYA 1HG2A 2ACXA 5CB4E 5KDMC 3AAIA 4UVBB 5LBQB 1ZV4X 2A72A 5FYMA 3PTRB 1ZEEA 4I50E 5HYAA 2LM9A 2VKJA 2I59A 4EB6E 4DBRA 3UTKA 3H3AA 5JDGA 3N9MA 3HL6A 2E9XB 3ANWB 4G63A 5IYZE 4TZ4C 1E1HB 4KP3C 2XAQB 1WYCA 2CWOA 3MK7C 4G2AA 3RPUA 4EZHA 3DJBA 4UVCB 5EZYE 2MYSA 5JRCA 3N5LA 3K8PC 1MNDA 3E08A 2V7KA 4O4JE 4HE8A 4XAXB 5JR9B 5HXSA 3CMLA 2X0LB 3KVBA 2RA1A 2D0UA 2HPLA 2K9AA 4UIGA 1G8XA 3UT5E 2CEAA 3PU3A 4NUVA 4ZI3C 4BA9A 5ADXL 2G0UA 3PUSA 3C4ZA 3LBXA 3WAJA 3NZPA 2YU2A 3RKOA 4GIWA 3CQGB 2CWYA 4H63H 5JREA 5HAXA 4P0BA 3MKDA 5FXXA 3Q2MA 2CA5A 2X9XA 2KWHA 4CXWA 4PK5A 2K24A 1MIVA 4X1IE 2OA5A 1HTJF 3Q5WA 3S4UA 1V9DA 3M65A 3SOLA 4KMCA 3QK6A 3KINB 3OYXA 3KV5A 4ASKA 4ANJA 1H7CA 5LNKA 2Q9QA 5KMGP 5L3BB 3GMIA 4CZZB 2WSSV 3WI3A 2WAUA 4I43B 5JDFA 3PDYA 3IHRA 5BMVE 5LJNA 4UF0B 2KINB 4EYUA 1MNEA 3WAKA 2LE8A 2X66A 2VL8A 2DWGA 1WYBA 4PK6A 3PU8A 1Z0PA 4U72A 3VKHA 4PK4A 2NTXA 4DNDA 4QX7B 1LVKA 2PJQA 1FIOA 5HWXA 2KXPB 3O1IA 1U5PA 3CX8B 4ISSA 2CXLA 5TAOA 4H9RC 3J9X1 1NWMX 2KLQA 4AKHA 4UEMA 4QXBB 3T8OA 4AKRB 1HF8A 3RYHE 2JMHA 2M67A 4ZHQE 4ZI2C 5HWYA 3UULA 4MLKA 3RYFE 4CXXA 5FXWA 3CX7B 3FHNA 4BJNA 1NAFA 5ETWA 2EHOB 3ZCIA 1QUUA 1BR0A 1FEWA 3ZLIA 2NW9A 4U74A 4N78D 2NOXA 1UX5A 4EXTA 3OBVE 3NZQA 4IE0A 4CXYA 3EVYA 2JRKA 2XHEB 5FY1A 3CWZB 3PUGA 3F2EA 2NTYA 3ZC1A 4HKAA 4EYYR 4IIJE 4CI2B 1HX8A 4IE7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEU B;  3LG7 A;  1G73 A;  5M4Y A;  1EZ3 A;  1S94 A;  1FIO A;  1HS7 A;  1BR0 A;  4JEH B;  3C98 B;  1FEW A;  2XHE B;  4TX5 A;  5LG4 A;  2DNX A; 
#chains in the Genus database with same CATH topology
 2WBL A;  1MIW A;  2J62 A;  3SFD A;  5EK3 A;  3AEG A;  2YDQ A;  3VHL A;  4HEA A;  5H6Q B;  4J2C A;  2WU5 A;  5EK4 A;  3O4X E;  5FNV E;  3K3Q C;  2V6Y B;  2YK0 A;  3ZMZ B;  4YSX A;  4WZX A;  4PFP A;  2K3W A;  4ILU A;  2E9X C;  3VU7 H;  4TX5 A;  4DV5 T;  2OLT A;  4MAL A;  4X20 E;  5J1G A;  2WQY A;  3A5X A;  4QKN A;  4AKL A;  1D1C A;  1W0A A;  3Q5D A;  4I55 E;  4DR1 T;  3AE8 A;  3AEE A;  4AQF C;  3B13 A;  5L47 A;  4X65 T;  3ZMS B;  3E22 E;  1T72 A;  4WW0 A;  2Z6E A;  4ZZB A;  3CQX C;  4QX8 B;  4OHF A;  3AA0 B;  2VWA A;  2M6I A;  1HX1 B;  5KXJ A;  4YLH A;  5AQQ B;  4YHJ A;  2V6Y A;  3MAC A;  2F4V T;  2D9D A;  5ABH A;  3VKG A;  3P4P A;  4HGA A;  4Z90 A;  3C64 A;  3I9Y A;  2XAG B;  1XZY A;  1YQ3 A;  3KBT A;  2PBI A;  4DID B;  2E9X A;  3R6N A;  3ZKR A;  3O1H A;  1M62 A;  2VKO A;  4TV9 E;  3NKZ A;  2DCF A;  3LJC A;  3V5U A;  4BJM A;  3JCF A;  2DNX A;  5AQP B;  2UXX B;  5GON E;  4LFC T;  4ILC A;  4C90 A;  4AQF A;  1G73 A;  3T1H T;  4U31 A;  5FL0 A;  3AE5 A;  2J47 A;  2LKH A;  4PJM A;  2RPA A;  4O8S A;  2QVA A;  2IDO B;  1HG5 A;  5FVL A;  3OVU A;  3ZYK A;  1NEN A;  5JRC B;  4DMW A;  5LP6 E;  5JQG E;  3N9L A;  4DVD A;  4WBN E;  4WBO A;  5L4H A;  2VKH A;  2J4G A;  2W00 A;  3IEE A;  4EAH A;  4ERR A;  4ZZC A;  1VCT A;  2BZB A;  3ZT5 A;  2D0T A;  2L3L A;  3NRY A;  5IHY A;  2W4X A;  3HKB E;  4TV8 E;  5EK2 A;  2DWK A;  1KNR A;  4IL9 A;  2WY2 A;  2IHR 1;  5JDQ A;  4OYK A;  5FL1 A;  2W67 A;  3L8R A;  1FMV A;  2V7I A;  2ZM8 A;  3ZN1 B;  2NW7 A;  2L9Q A;  3N2K E;  3AAE B;  2BVM A;  3ZST A;  3KBU A;  2ES0 A;  4H9Q C;  2WDR A;  1AJ3 A;  3T1Y T;  4COF A;  2CM0 A;  2KSR A;  1QLB A;  3AB3 B;  2HN1 A;  2NP9 A;  4KHP T;  4CI3 B;  3EDV A;  3N2G E;  5FY0 A;  3RKG A;  1FMW A;  4LF5 T;  4XBF B;  5DAB A;  4KUM B;  2XM2 A;  4KHZ F;  5J0Z A;  2JIW A;  2XAH B;  3BQI A;  4HWI B;  4LML A;  3DP7 A;  2SPC A;  3W15 B;  2VUR A;  4X1K E;  3EDU A;  5M4Y A;  2IUB A;  4HFC A;  5L3C B;  4GYR A;  2VAS A;  4YFS A;  3LFM A;  5ABF B;  2V7M A;  1VOM A;  3FBZ A;  3I0Q A;  1L0V A;  3Q5E A;  4DV3 T;  4HFI A;  3SS1 A;  4AIS A;  2LEH A;  2LSY A;  3MA9 A;  2HN2 A;  4UEL A;  3RH3 A;  1HNW T;  4PNI A;  1Y64 B;  3O9X A;  4DR3 T;  3BQK A;  4I0U A;  1B7T A;  3AA1 B;  3PUQ A;  2CE7 A;  2ODU A;  3UUX B;  4LF7 T;  5JTG A;  3ZJ1 A;  1XMO T;  2XQ6 A;  3TLS A;  3AVR A;  4NXM T;  4F6R C;  1W9R A;  5J2U E;  4YSZ A;  1WLX A;  3AEB A;  3Q5X A;  1OED C;  5JVD E;  5AFU L;  2ACX A;  5CB4 E;  4U3C A;  1OED B;  5LBQ B;  2XJ7 A;  2CHN A;  1R8I A;  2I59 A;  5AQV B;  3UTK A;  3N9M A;  3HL6 A;  3ANW B;  4G63 A;  2CWO A;  4G2A A;  3UQ7 A;  2H89 A;  5EZY E;  2LLY A;  3AEF A;  3N5L A;  4HFH A;  4XAX B;  5JR9 B;  2E2A A;  3CML A;  2HPL A;  2K9A A;  3UFG A;  3UUB A;  5FKY A;  1G8X A;  3TLT A;  4BA9 A;  3PUS A;  3C4Z A;  3WAJ A;  3NZP A;  4GIW A;  2CWY A;  3MKD A;  3G06 A;  4PK5 A;  4X1I E;  4EEB A;  3PUW F;  1N34 T;  3KIN B;  3QNU A;  2V5D A;  1OED A;  5KMG P;  2VQE T;  3GMI A;  2WSS V;  5JDF A;  3PDY A;  2KIN B;  2LRL A;  2VL8 A;  4PK6 A;  3B5M A;  2E5V A;  1LVK A;  2PJQ A;  1FIO A;  2WS3 A;  3O1I A;  1U5P A;  3CX8 B;  3J9X 1;  2CXL A;  5TAO A;  4H9R C;  4EED A;  4JI4 T;  2KLQ A;  4AKH A;  4UEM A;  4QXB B;  3T8O A;  4MLK A;  5FXW A;  1XWM A;  3ZCI A;  3AE9 A;  3ZLI A;  2FJE A;  3UU6 A;  5FY1 A;  3CWZ B;  5AQL B;  2A2F X;  2LHN A;  1QSD A;  5LJM A;  4HFD A;  3ZT7 A;  3GWH A;  3PUV F;  1XDO A;  1LKX A;  5JH7 E;  4MHC A;  1D0X A;  2XQ8 A;  2XM1 A;  1SUM B;  5L2L A;  5L3D B;  2W61 A;  4KI0 F;  4H9N C;  2DHR A;  2XSA A;  4I4T E;  3P4Q A;  4QXH B;  4AQG A;  2V5C A;  5HXE A;  3ZJ2 A;  2LOP A;  4PAG A;  2W66 A;  2MAW A;  3RI5 A;  2W0G A;  3RRW A;  3PV0 F;  5HXR A;  4U33 A;  2D5U A;  1E7P A;  1CHU A;  3ZMT B;  2LSI A;  2K48 A;  3LK2 B;  5ABG A;  3GN5 B;  2BG9 C;  3KVA A;  3JAE A;  1HCI A;  4NIQ A;  2W2U A;  2MTQ A;  1I94 T;  2XTL A;  3HKD E;  3NBX X;  1WR6 A;  3CKD A;  4AKI A;  4IST A;  4ZI3 D;  1MMN A;  4DR5 T;  1UCU A;  4P0A A;  4U2Z A;  3VRA A;  4AIU A;  2PFV A;  4JEH B;  4Z91 A;  2ZM0 A;  5LA6 E;  1YW0 A;  3FXE B;  5DQV A;  3ZMU B;  4DR6 T;  4IT4 A;  2W62 A;  3HR0 A;  4A5X A;  3FB2 A;  3KFW X;  5LG3 A;  5KX5 E;  4PJJ A;  3P8C D;  3VR8 A;  3L39 A;  1OWA A;  3C50 A;  4KBM B;  2D2S A;  5HXC A;  3QB5 A;  1IBL T;  1FJG T;  3RC8 A;  5HEH A;  1IZN B;  1KK7 A;  1HR0 T;  3RF1 A;  2PG8 A;  3ZEF B;  4P1N A;  2BG9 A;  4O4H E;  5J2T E;  2WMO A;  4HWD A;  2LT3 A;  3UU5 A;  2CLY B;  4HFV A;  4ZI2 D;  4H9P C;  4OX9 T;  5FP3 A;  4WNK A;  5H6R B;  2BKN A;  3KV4 A;  4EIW A;  4LFA T;  3HA4 A;  5DQW A;  4DV2 T;  1M7K A;  1SA0 E;  2WU2 A;  3CIR A;  3P4S A;  2DI4 A;  2WMN A;  3MZK B;  4ZS3 A;  2KZ7 B;  5A1L A;  3QC9 A;  4OFZ A;  2C5I T;  2V7J A;  4PFO A;  5FXV A;  3N9N A;  5C2T A;  2BDE A;  2YDS A;  3RYI E;  4AXP A;  3I1A A;  5LXT E;  3N2O A;  1D1B A;  4JV5 T;  1IAP A;  3AED A;  4IDO A;  4UR9 A;  2UXN B;  3U3I A;  3H3M A;  4OYJ A;  2RP4 A;  4GKJ T;  2XQ9 A;  5AQO B;  2KT9 A;  2L8K A;  2GK9 A;  4ZXL A;  3RYC E;  1ZKE A;  2UXD T;  2YIN A;  3F57 A;  2XY8 B;  4V1A v;  3LK4 2;  4O2A E;  3ZN0 B;  1VCS A;  3IBP A;  1WFD A;  2ZLY A;  4DUZ T;  3L09 A;  2XUE A;  3P7I A;  1LRZ A;  3ESL A;  4DMV A;  1Z8U A;  4IDP A;  5AQH B;  5JDL A;  4ILB A;  4LF4 T;  2ZM2 A;  2MPK A;  1DU2 A;  4L0R A;  3PUR A;  4AI6 A;  2ODV A;  3RRC A;  3N9Q A;  5IUX A;  4QH1 A;  4GOU A;  1W09 A;  2FJB A;  4TWF A;  1YXR A;  3ZMV B;  2N2N A;  2CMR A;  1O3X A;  4DR4 T;  4JBW F;  3EAB A;  2X0Y A;  3ONL C;  4UVB B;  1ZV4 X;  2YN6 A;  4HFB A;  4DBR A;  3IA3 A;  4ZEY A;  1XDP A;  5IYZ E;  2XAQ B;  1WYC A;  3RPU A;  4EZH A;  1KEY A;  4UVC B;  2MYS A;  5JRC A;  1MND A;  3RHW A;  5HXS A;  2X0L B;  3RQW A;  2RA1 A;  3UT5 E;  3PU3 A;  4ZI3 C;  2G0U A;  2YU2 A;  4H63 H;  5JRE A;  2CA5 A;  2QRX A;  2OA5 A;  1HTJ F;  2HHH T;  5AQK B;  3S4U A;  1UK5 A;  3RGL A;  4ANJ A;  3OYX A;  3ONJ A;  5CFB A;  4NPP A;  4I43 B;  4UF0 B;  4A97 A;  1MNE A;  4U72 A;  1Z0P A;  3PJA A;  2WDV A;  3A8Y C;  4PK4 A;  2JQK A;  2NTX A;  4QX7 B;  3RIF A;  2V8S V;  4JI1 T;  1J5W A;  2ZM6 T;  3RYH E;  4ZI2 C;  5HWY A;  3UUL A;  4CXX A;  2XQA A;  3CX7 B;  1NAF A;  2EHO B;  4JI8 T;  1UX5 A;  4IE0 A;  3NZQ A;  4WYV A;  2JRK A;  4HWF A;  2XHE B;  3ZC1 A;  4IIJ E;  1HX8 A;  4IDQ A;  3FZK B;  2DLR A;  2A3D A;  4B6X A;  4UF0 A;  5HEJ A;  4JI0 T;  4DV0 T;  5ABF A;  2C0S A;  1D1A A;  3AE3 A;  4DO0 A;  1SE7 A;  2BG9 E;  3F31 A;  5ABE A;  1U4Q A;  4GK0 E;  5HEO A;  1YKE B;  3PUX F;  3ZYM A;  3UU8 A;  2K5B B;  3KDS E;  2V1D B;  5JR9 C;  4MFR A;  1MMG A;  5LG4 A;  1UGO A;  3AE4 A;  2XQY A;  2FUP A;  3P4R A;  2X0H A;  2N9D A;  4JI5 T;  2JPF A;  1UUR A;  3JC6 D;  5C8Y E;  3LG7 A;  4IE6 A;  3N9O A;  3AE7 A;  3PJA J;  2IAK A;  3LDQ B;  3OYZ A;  4B3S T;  2WM9 A;  2AE9 A;  2V26 A;  4IE4 A;  3R84 B;  3GA8 A;  2VVS A;  1KNZ A;  1VRB A;  4DR2 T;  3P50 A;  4PJN A;  1Y01 A;  4U2Y A;  4CN1 A;  4CI1 B;  3ANW A;  1EZ3 A;  4PJL A;  4O2B E;  3EI0 A;  5JR9 A;  3RIA A;  3BQL A;  5AQS B;  2IC6 A;  3B57 A;  2OV9 A;  1X9B A;  2FBW A;  3TLW A;  1US7 B;  2KMF A;  4B3T T;  3AXJ B;  1I6Z A;  3IF8 B;  1LVF A;  5F3J A;  5L4E A;  2JMK A;  1HS7 A;  2IML A;  1MMD A;  3ETU A;  3JAF A;  5CA1 E;  2XQ5 A;  3ONX A;  4JI2 T;  2C5K T;  3C98 B;  3MXZ A;  4MBQ A;  3C4W A;  2E8I A;  4X1Y E;  5FMN A;  3RIU C;  3JAD A;  1W0B A;  4X66 T;  2J1D G;  4JI7 T;  4E7Z A;  5C3J A;  2A9U A;  5AQN B;  5LB7 B;  2CXF A;  3LBX B;  3EUH A;  4FJO A;  1WCR A;  3LK3 B;  4JEU B;  3UQ4 A;  4DR7 T;  2B1E A;  5FVK A;  2VL0 A;  2Q9Q B;  3D0T A;  2X67 A;  1KF6 A;  5HCM A;  3PUY F;  2QYW A;  3DTO A;  3FZL B;  3HKC E;  4JI6 T;  1N36 T;  1D0Y A;  5E0O A;  1ZOY A;  4DBQ A;  3SFE A;  2I0M A;  5LGU B;  5F5W A;  1T7S A;  3ZSS A;  3FBL A;  5CGM A;  2CRB A;  2LKG A;  2H3R A;  2WWU A;  4H9S E;  5L3G B;  4H63 V;  1HNZ T;  4CN6 A;  4L9I A;  3ZYL A;  3RIU A;  2WWV A;  3ABV A;  3MJX A;  2Y48 B;  3UUM A;  3AE1 A;  5IWA T;  3UFE A;  2H7O A;  4EOZ B;  5JDN A;  2X51 A;  4GKK T;  4O4L E;  2I6H A;  4L5G A;  2HH7 A;  3KV9 A;  2N1G A;  3ZC0 A;  4HN9 A;  2MBG A;  4FI5 A;  2MOZ A;  2LSG A;  2BVL A;  4GK5 E;  4DUY T;  1BR4 A;  5L3E B;  3I9W A;  3RQU A;  3ZPO A;  3FXD B;  4O4I E;  5LHH B;  1WR0 A;  4LMK A;  2XPK A;  3L3P A;  4YJ3 E;  1WRD A;  1IBM T;  1S94 A;  5L3F B;  2IC9 A;  2LOS A;  1HFA A;  3GN5 A;  4A98 A;  1MMA A;  3JC6 C;  2CLY C;  3AA6 B;  4OK0 A;  5LCY A;  2YU1 A;  2Y8D A;  5DJQ C;  2EHO D;  4NXN T;  4IDN A;  3K3O A;  4JUY A;  3PUZ F;  1SHZ C;  2X9W A;  4HTE A;  1MIY A;  5KDM C;  2A72 A;  4JYA T;  5FYM A;  1ZEE A;  5HYA A;  2LM9 A;  2VKJ A;  3H3A A;  5LMU T;  5JDG A;  2E9X B;  4TZ4 C;  1E1H B;  3MK7 C;  2DL1 A;  3CK6 A;  3DJB A;  3E08 A;  4O4J E;  4HE8 A;  5AQG B;  3KVB A;  2D0U A;  2WZH A;  3AE2 A;  4UIG A;  1GQE A;  3A7M A;  1YQ4 A;  4EV6 A;  4IRE A;  4P0B A;  4LF8 T;  4AQY T;  2KWH A;  4CXW A;  4QH5 A;  2K24 A;  1MIV A;  2UUA T;  1OED E;  1V9D A;  3M65 A;  1JNZ A;  5AQJ B;  2YKS A;  5LNK A;  4CZZ B;  3WI3 A;  3RLF F;  3IHR A;  5BMV E;  5LJN A;  3FZH B;  2X66 A;  4CN4 A;  3VKH A;  4HWC A;  3PU8 A;  5HWX A;  4ISS A;  4YHH T;  2UXC T;  2WB5 A;  1HF8 A;  3QB5 K;  5HEU A;  3RYF E;  1J1J A;  4BJN A;  2CHO A;  4Q25 A;  1FEW A;  4N78 D;  3ZT6 A;  4EXT A;  3OBV E;  3EVY A;  3F2E A;  4HKA A;  4CQI A;  1YKH B;  2IIU A;  2VVN A;  4A56 A;  1IBK T;  1IJ5 A;  3LSV A;  2YDR A;  1XMQ T;  1S35 A;  1XNQ T;  2QGS A;  4KX6 A;  4JLE A;  3E0Z A;  5FY7 A;  4GYS A;  3UUN A;  4M1P A;  3AVS A;  3HI2 A;  4YTP A;  2VB6 A;  3EAM A;  4X5T A;  2HPJ A;  3P4W A;  2QA7 A;  5BR8 T;  4X62 T;  4ZI7 E;  4QXC B;  2LJL A;  2ACZ A;  2XAF B;  2JJ9 A;  1T98 A;  1UUS A;  2JQH A;  2X9H A;  2BKP A;  1ZP0 A;  2XZE A;  2Y6X A;  3CX6 B;  2KWI B;  2H88 A;  3VRB A;  2P9B A;  2Q9Q D;  3QOF A;  2KND A;  2BBJ A;  2CXD A;  3HKE E;  2WDQ A;  2JQQ A;  5LYJ E;  4UV8 B;  3U78 A;  1BR1 A;  4X64 T;  2XSB A;  4DV4 T;  3PUA A;  4DV1 T;  3PE0 A;  2CBI A;  4PW8 A;  3FZF B;  4LF9 T;  2FJA A;  3AA7 B;  1OXZ A;  3UU4 A;  3NWI A;  4JI3 T;  2WZI A;  3CQC B;  2CPT A;  4QWN B;  2EHO C;  3H37 A;  1BR2 A;  3TLU A;  4EZ4 A;  1IJ6 A;  4C91 A;  4LFB T;  3QUJ A;  3CPZ A;  4TN7 B;  1HNX T;  4TNW A;  2UUC T;  1UX4 A;  2FJD A;  3C4X A;  4YXD A;  4YSY A;  4F8H A;  4HFE A;  4ZS2 A;  4AKG A;  2LM2 A;  2B76 A;  2AXD S;  5LMN T;  1X79 A;  3OKQ A;  3AEC A;  2CCQ A;  2CBJ A;  4QH4 A;  2UUB T;  4UVA B;  2XQ3 A;  2XAJ B;  3K1S A;  4LMJ A;  5JDM A;  2EHO A;  4Z8X A;  5LGN B;  3BK9 A;  2V7L A;  2WCA A;  4P09 A;  3AAA B;  2VKD A;  5JDH A;  3OTO T;  3NRX A;  2YOE A;  2VK9 A;  4B3R T;  3ETV A;  4XZC A;  2X9Y A;  2XQ7 A;  4YT0 A;  3K3N A;  3KV6 A;  4UV9 B;  2H7V C;  4H9O C;  5LOV E;  2BS4 A;  4ILA A;  4B3M T;  4UXN B;  4U7Y A;  4BAY B;  5CA0 E;  5F8P A;  3N9P A;  2E9X D;  3M3Z B;  5HXH A;  3RX6 A;  2BKO A;  4NUU A;  3I0O A;  4EGW A;  2W63 A;  4IDZ A;  1KNP A;  4IL4 A;  3SWH A;  3J7Y q;  4K0K T;  3O1J A;  4YY3 T;  2C5J A;  3RC3 A;  5LBM A;  4HWH A;  4IGU A;  2E5L T;  3ZCJ A;  2WP9 A;  2IW5 B;  2LSK A;  3TKL B;  4QHO A;  2NWB A;  3UU3 A;  3V5S A;  3AEA A;  5LHG B;  2XAS B;  3OJA A;  4IHJ E;  1ZHC A;  2PTF A;  1KFY A;  4TUY E;  1D0Z A;  4U7I A;  3SRZ A;  3EHZ A;  5AQM B;  1XNR T;  3Q9D A;  3CVR A;  5AQI B;  2UXB T;  4TWD A;  5HEG A;  4DV7 T;  2LRK A;  2YEV C;  5AQR B;  1CUN A;  1N32 T;  2NW8 A;  3NVO A;  4YJ2 E;  2V6X A;  4IE5 A;  5FXZ A;  4ZOL E;  4K0U A;  2JQ9 A;  2ZMA A;  1YD8 G;  5LGT B;  2LHR A;  1JNR A;  5LHI B;  1E2A A;  4LF6 T;  2LSJ A;  4ADZ A;  2Q9Q C;  3AE6 A;  2X68 A;  4E7S A;  3C51 A;  1HG2 A;  3FZM B;  5HCJ A;  3AAI A;  3AXJ A;  4TNV A;  3PTR B;  4I50 E;  2BS2 A;  2BS3 A;  2VQF T;  4EB6 E;  4KP3 C;  3TLV A;  4YTM A;  1T8B A;  2R6G F;  3K8P C;  2V7K A;  4TWH A;  5AQU B;  2UU9 T;  2CEA A;  4NUV A;  5CJ5 A;  5ADX L;  3LBX A;  4DV6 T;  3RKO A;  3CQG B;  5HAX A;  5AQT B;  5FXX A;  3Q2M A;  2X9X A;  3Q5W A;  1J5E T;  3SOL A;  4KMC A;  3QK6 A;  3KV5 A;  4ASK A;  4YTN A;  1H7C A;  2Q9Q A;  5L3B B;  2WAU A;  4EYU A;  3VR9 A;  3WAK A;  2LE8 A;  2DWG A;  3X1D A;  5AQF B;  1WYB A;  1N33 T;  4DND A;  3OPC A;  2KXP B;  2BG9 B;  1NEK A;  1NWM X;  2M6B A;  2BBH A;  4AKR B;  2JMH A;  2M67 A;  4ZHQ E;  3FHN A;  5ETW A;  1QUU A;  1BR0 A;  2NW9 A;  4U74 A;  2NOX A;  2XQ4 A;  2NR4 A;  4CXY A;  3PUG A;  2NTY A;  4EYY R;  4CI2 B;  4IE7 A; 
#chains in the Genus database with same CATH homology
 4CQI A;  2WBL A;  1YKH B;  2A2F X;  1MIW A;  2LHN A;  2DLR A;  2A3D A;  5EK3 A;  4B6X A;  4A56 A;  1QSD A;  4UF0 A;  5LJM A;  1IJ5 A;  4HEA A;  3VHL A;  5H6Q B;  4J2C A;  1S35 A;  5EK4 A;  3O4X E;  5FNV E;  2QGS A;  3GWH A;  4JLE A;  3K3Q C;  2C0S A;  1D1A A;  2YK0 A;  1LKX A;  4DO0 A;  5JH7 E;  3F31 A;  3E0Z A;  5FY7 A;  3ZMZ B;  4MHC A;  1D0X A;  4PFP A;  1U4Q A;  4GYS A;  4ILU A;  4GK0 E;  2E9X C;  3VU7 H;  4TX5 A;  4MAL A;  3UUN A;  4M1P A;  1YKE B;  4X20 E;  5J1G A;  3A5X A;  3AVS A;  3HI2 A;  3ZYM A;  4QKN A;  2K5B B;  3KDS E;  4AKL A;  2V1D B;  2VB6 A;  5L2L A;  1D1C A;  2HPJ A;  5L3D B;  5JR9 C;  2QA7 A;  2W61 A;  4MFR A;  1MMG A;  4I55 E;  5LG4 A;  2XQY A;  4H9N C;  2DHR A;  4ZI7 E;  4I4T E;  4AQF C;  3B13 A;  2N9D A;  2JPF A;  4QXC B;  2LJL A;  4QXH B;  3JC6 D;  5C8Y E;  4AQG A;  5HXE A;  3LG7 A;  3ZMS B;  3E22 E;  4WW0 A;  2XAF B;  2Z6E A;  2JJ9 A;  3ZJ2 A;  1T98 A;  2LOP A;  3CQX C;  4PAG A;  2X9H A;  4IE6 A;  3N9O A;  4QX8 B;  2Y6X A;  2IAK A;  3CX6 B;  2KWI B;  2VWA A;  3AA0 B;  4OHF A;  4YLH A;  3OYZ A;  2W0G A;  2P9B A;  2Q9Q D;  3RRW A;  2WM9 A;  5HXR A;  4YHJ A;  2KND A;  2CXD A;  2V26 A;  3MAC A;  4IE4 A;  3HKE E;  3R84 B;  2JQQ A;  3GA8 A;  2D5U A;  5LYJ E;  3VKG A;  1KNZ A;  4UV8 B;  4HGA A;  3U78 A;  1VRB A;  3C64 A;  1BR1 A;  3ZMT B;  3I9Y A;  2XAG B;  3PUA A;  2LSI A;  2K48 A;  3KBT A;  3LK2 B;  4PJN A;  2PBI A;  3GN5 B;  3PE0 A;  4PW8 A;  3KVA A;  4CI1 B;  2E9X A;  3ANW A;  3R6N A;  3O1H A;  1EZ3 A;  2VKO A;  1HCI A;  3AA7 B;  4TV9 E;  4PJL A;  2DCF A;  1OXZ A;  3LJC A;  4O2B E;  3V5U A;  2MTQ A;  4BJM A;  5JR9 A;  3CQC B;  3BQL A;  2XTL A;  3HKD E;  2DNX A;  2IC6 A;  2EHO C;  3B57 A;  3H37 A;  3NBX X;  1BR2 A;  2UXX B;  1WR6 A;  4QWN B;  5GON E;  4EZ4 A;  1IJ6 A;  3CKD A;  4C91 A;  4AKI A;  4IST A;  4ZI3 D;  1MMN A;  4C90 A;  4AQF A;  1UCU A;  4P0A A;  1G73 A;  1US7 B;  2PFV A;  2KMF A;  3QUJ A;  3CPZ A;  3IF8 B;  1LVF A;  4JEH B;  4PJM A;  4TN7 B;  5F3J A;  2ZM0 A;  5LA6 E;  1YW0 A;  2JMK A;  3FXE B;  5DQV A;  3ZMU B;  4O8S A;  1HS7 A;  2W62 A;  1MMD A;  3HR0 A;  3ETU A;  3FB2 A;  3KFW X;  5CA1 E;  3ONX A;  1HG5 A;  2C5K T;  3C98 B;  5KX5 E;  4PJJ A;  3MXZ A;  4MBQ A;  3ZYK A;  1UX4 A;  3P8C D;  5JRC B;  4DMW A;  3C4W A;  2E8I A;  3C4X A;  4X1Y E;  5FMN A;  5LP6 E;  5JQG E;  3N9L A;  1OWA A;  3C50 A;  4KBM B;  4DVD A;  4WBN E;  2D2S A;  5HXC A;  4ZS2 A;  4WBO A;  3RC8 A;  4AKG A;  2VKH A;  2J1D G;  1IZN B;  1KK7 A;  4E7Z A;  2PG8 A;  2W00 A;  3ZEF B;  3IEE A;  4EAH A;  2CXF A;  4ERR A;  3LBX B;  2BZB A;  1X79 A;  3EUH A;  3OKQ A;  4FJO A;  4O4H E;  5J2T E;  2D0T A;  2WMO A;  2L3L A;  2CCQ A;  2LT3 A;  3LK3 B;  3NRY A;  5IHY A;  4JEU B;  3HKB E;  4TV8 E;  2CLY B;  4HFV A;  4ZI2 D;  4H9P C;  4UVA B;  5EK2 A;  2DWK A;  2XAJ B;  5JDM A;  2EHO A;  5FP3 A;  4WNK A;  2B1E A;  4Z8X A;  5H6R B;  5LGN B;  2Q9Q B;  3BK9 A;  5JDQ A;  2V7L A;  3KV4 A;  3D0T A;  4OYK A;  4P09 A;  2X67 A;  3AAA B;  4EIW A;  2VKD A;  5JDH A;  3DTO A;  3HA4 A;  5DQW A;  1FMV A;  2V7I A;  2ZM8 A;  3ZN1 B;  3NRX A;  1SA0 E;  2NW7 A;  3HKC E;  2L9Q A;  3N2K E;  3AAE B;  2BVM A;  1D0Y A;  5E0O A;  4DBQ A;  3KBU A;  2VK9 A;  2ES0 A;  3ETV A;  4XZC A;  2DI4 A;  4H9Q C;  1AJ3 A;  2X9Y A;  2WMN A;  3K3N A;  3MZK B;  5LGU B;  4ZS3 A;  3KV6 A;  2KZ7 B;  4UV9 B;  2CM0 A;  3FBL A;  2H7V C;  4H9O C;  5LOV E;  2H3R A;  2WWU A;  4H9S E;  5A1L A;  3QC9 A;  4OFZ A;  4UXN B;  3AB3 B;  2C5I T;  5L3G B;  2V7J A;  4PFO A;  2NP9 A;  4BAY B;  5FXV A;  3N9N A;  4H63 V;  5CA0 E;  5F8P A;  4L9I A;  3ZYL A;  4CI3 B;  3EDV A;  3N2G E;  5FY0 A;  3N9P A;  2E9X D;  2BDE A;  1FMW A;  3RYI E;  4AXP A;  5HXH A;  3RX6 A;  3MJX A;  2Y48 B;  4NUU A;  3I0O A;  2W63 A;  3UUM A;  3I1A A;  5LXT E;  4XBF B;  4IDZ A;  5DAB A;  3UFE A;  4KUM B;  2H7O A;  4EOZ B;  3N2O A;  1D1B A;  3SWH A;  2XAH B;  5JDN A;  3J7Y q;  1IAP A;  2X51 A;  3O1J A;  4O4L E;  2C5J A;  3RC3 A;  4L5G A;  5LBM A;  3BQI A;  2HH7 A;  2UXN B;  3KV9 A;  3U3I A;  4IGU A;  4OYJ A;  2N1G A;  2RP4 A;  3DP7 A;  2SPC A;  3W15 B;  3ZCJ A;  3ZC0 A;  4HN9 A;  2MBG A;  4X1K E;  3EDU A;  5M4Y A;  2IW5 B;  2LSK A;  2KT9 A;  2L8K A;  2GK9 A;  2MOZ A;  4FI5 A;  4GYR A;  1ZKE A;  2VAS A;  3RYC E;  5L3C B;  2YIN A;  3F57 A;  4YFS A;  2LSG A;  3LFM A;  3TKL B;  4QHO A;  2BVL A;  2NWB A;  4GK5 E;  3V5S A;  2V7M A;  1VOM A;  3FBZ A;  4V1A v;  3I0Q A;  5LHG B;  3LK4 2;  2XAS B;  4O2A E;  1BR4 A;  3OJA A;  4IHJ E;  1ZHC A;  5L3E B;  3ZN0 B;  3I9W A;  3ZPO A;  3IBP A;  4TUY E;  3SS1 A;  1D0Z A;  3SRZ A;  2LEH A;  3FXD B;  4O4I E;  2LSY A;  2ZLY A;  3MA9 A;  3L09 A;  4UEL A;  3RH3 A;  3Q9D A;  2XUE A;  5LHH B;  3CVR A;  3P7I A;  1LRZ A;  3ESL A;  3L3P A;  4YJ3 E;  2YEV C;  1WRD A;  4PNI A;  1Y64 B;  1S94 A;  3O9X A;  4DMV A;  1CUN A;  5L3F B;  2NW8 A;  2IC9 A;  3BQK A;  1B7T A;  4YJ2 E;  2LOS A;  3AA1 B;  1HFA A;  3GN5 A;  5JDL A;  1MMA A;  3PUQ A;  4IE5 A;  2ZM2 A;  5FXZ A;  2CE7 A;  4ZOL E;  3JC6 C;  2ODU A;  4K0U A;  3UUX B;  2ZMA A;  1YD8 G;  4L0R A;  5LGT B;  3ZJ1 A;  3AVR A;  3PUR A;  2LHR A;  4AI6 A;  2CLY C;  3AA6 B;  4OK0 A;  2ODV A;  3RRC A;  4F6R C;  5LHI B;  5LCY A;  2YU1 A;  3N9Q A;  2Y8D A;  5DJQ C;  5J2U E;  1WLX A;  2LSJ A;  4GOU A;  3ZMV B;  2EHO D;  4ADZ A;  3Q5X A;  2N2N A;  2CMR A;  2Q9Q C;  5JVD E;  3K3O A;  4JUY A;  2X68 A;  4E7S A;  1O3X A;  5AFU L;  3C51 A;  1SHZ C;  2X9W A;  4HTE A;  1MIY A;  1HG2 A;  2ACX A;  5CB4 E;  5KDM C;  3AAI A;  4UVB B;  5LBQ B;  1ZV4 X;  2A72 A;  5FYM A;  3PTR B;  1ZEE A;  4I50 E;  5HYA A;  2LM9 A;  2VKJ A;  2I59 A;  4EB6 E;  4DBR A;  3UTK A;  3H3A A;  5JDG A;  3N9M A;  3HL6 A;  2E9X B;  3ANW B;  4G63 A;  5IYZ E;  4TZ4 C;  1E1H B;  4KP3 C;  2XAQ B;  1WYC A;  2CWO A;  3MK7 C;  4G2A A;  3RPU A;  4EZH A;  3DJB A;  4UVC B;  5EZY E;  2MYS A;  5JRC A;  3N5L A;  3K8P C;  1MND A;  3E08 A;  2V7K A;  4O4J E;  4HE8 A;  4XAX B;  5JR9 B;  5HXS A;  3CML A;  2X0L B;  3KVB A;  2RA1 A;  2D0U A;  2HPL A;  2K9A A;  4UIG A;  1G8X A;  3UT5 E;  2CEA A;  3PU3 A;  4NUV A;  4ZI3 C;  4BA9 A;  5ADX L;  2G0U A;  3PUS A;  3C4Z A;  3LBX A;  3WAJ A;  3NZP A;  2YU2 A;  3RKO A;  4GIW A;  3CQG B;  2CWY A;  4H63 H;  5JRE A;  5HAX A;  4P0B A;  3MKD A;  5FXX A;  3Q2M A;  2CA5 A;  2X9X A;  2KWH A;  4CXW A;  4PK5 A;  2K24 A;  1MIV A;  4X1I E;  2OA5 A;  1HTJ F;  3Q5W A;  3S4U A;  1V9D A;  3M65 A;  3SOL A;  4KMC A;  3QK6 A;  3KIN B;  3OYX A;  3KV5 A;  4ASK A;  4ANJ A;  1H7C A;  5LNK A;  2Q9Q A;  5KMG P;  5L3B B;  3GMI A;  4CZZ B;  2WSS V;  3WI3 A;  2WAU A;  4I43 B;  5JDF A;  3PDY A;  3IHR A;  5BMV E;  5LJN A;  4UF0 B;  2KIN B;  4EYU A;  1MNE A;  3WAK A;  2LE8 A;  2X66 A;  2VL8 A;  2DWG A;  1WYB A;  4PK6 A;  3PU8 A;  1Z0P A;  4U72 A;  3VKH A;  4PK4 A;  2NTX A;  4DND A;  4QX7 B;  1LVK A;  2PJQ A;  1FIO A;  5HWX A;  2KXP B;  3O1I A;  1U5P A;  3CX8 B;  4ISS A;  2CXL A;  5TAO A;  4H9R C;  3J9X 1;  1NWM X;  2KLQ A;  4AKH A;  4UEM A;  4QXB B;  3T8O A;  4AKR B;  1HF8 A;  3RYH E;  2JMH A;  2M67 A;  4ZHQ E;  4ZI2 C;  5HWY A;  3UUL A;  4MLK A;  3RYF E;  4CXX A;  5FXW A;  3CX7 B;  3FHN A;  4BJN A;  1NAF A;  5ETW A;  2EHO B;  3ZCI A;  1QUU A;  1BR0 A;  1FEW A;  3ZLI A;  2NW9 A;  4U74 A;  4N78 D;  2NOX A;  1UX5 A;  4EXT A;  3OBV E;  3NZQ A;  4IE0 A;  4CXY A;  3EVY A;  2JRK A;  2XHE B;  5FY1 A;  3CWZ B;  3PUG A;  3F2E A;  2NTY A;  3ZC1 A;  4HKA A;  4EYY R;  4IIJ E;  4CI2 B;  1HX8 A;  4IE7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...