2XHEB

Crystal structure of the unc18-syntaxin 1 complex from monosiga brevicollis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
260
structure length
220
Chain Sequence
b'DRLSRLRQMAAENQPEPFMADFFNRVKRIRDNIEDIEQAIEQVAQLHTESLVAVSKEDRDRLNEKLQDTMARISALGNKIRADLKQIEKENKRAQQEGTFEDGTVSTDLRIRQSQHSSLSRKFVKVMTRYNDVQAENKRRYGENVARQCRVVEPSLSDDAIQKVIEHGNEIRDRHKDIQQLERSLLELHEMFTDMSTLVASQGEMIDRIEFSVEQSHNYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNC18
publication title Primordial Neurosecretory Apparatus Identified in the Choanoflagellate Monosiga Brevicollis.
pubmed doi rcsb
source organism Monosiga brevicollis
molecule tags Exocytosis
total genus 79
structure length 220
sequence length 260
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xheB01
4TX5A 5LG4A 1BR0A 5M4YA 1S94A 1HS7A 3LG7A 4JEUB 1FIOA 1G73A 3C98B 1EZ3A 2DNXA 4JEHB 2XHEB 1FEWA
chains in the Genus database with same CATH superfamily
3Q5XA 3R6NA 3ZJ2A 1E2AA 3Q9DA 4UEMA 3VRAA 2WMNA 2LSYA 3I9WA 3LDQB 2D5UA 3P4PA 3AEDA 1G8XA 2D0TA 2DHRA 2IC9A 3AEBA 4JEHB 3UULA 5AQOB 3VKGA 5H6QB 5HCJA 4TWHA 5HXSA 3EHZA 2WMOA 2W4XA 3B13A 3PUGA 2M67A 2XY8B 4HWFA 3CX6B 4IIJE 1VCSA 2X0LB 5DQVA 5FXVA 3HR0A 2XJ7A 3UU3A 2BBHA 4QX8B 3ZC1A 4OYKA 4K0UA 3RIFA 3FZKB 3UU8A 3CX7B 2CLYC 4DV4T 1JNZA 3K3NA 3GN5B 4YTMA 3O9XA 2VKJA 3M3ZB 3CMLA 4PK5A 4PJMA 4EIWA 2BKOA 4HEAA 4HFDA 3P4SA 4DR7T 2LSJA 4AQGA 3ZN0B 4ZHQE 1J5WA 5LHHB 2EHOB 5LXTE 1Z0PA 2ES0A 2NWBA 2BKPA 3CPZA 5LJNA 3FXEB 1WFDA 5DABA 3UUMA 2CMRA 2W2UA 4EB6E 5A1LA 2B1EA 1T98A 4B3RT 4YSXA 1ZEEA 3SOLA 1T7SA 4PJLA 2DWKA 1CHUA 3NRYA 2LKGA 2VWAA 3FZMB 2IW5B 3RKGA 2ZM6T 2CCQA 3NBXX 1XWMA 1T72A 5FL0A 2K48A 4X62T 2C5KT 2N9DA 4JI5T 3MACA 4X1IE 4YHHT 5JDGA 1MNDA 5JR9C 4QKNA 4I43B 2M6BA 4JI2T 1YKHB 3CX8B 1Y64B 4TWFA 4BJMA 2CXFA 3SFDA 5ADXL 2VL0A 3ZEFB 1MIWA 4U74A 3UFEA 5EK4A 2W63A 5L3BB 4ZZBA 1L0VA 1E7PA 2YU1A 2BG9C 3VR9A 2XAGB 1IAPA 2V5CA 4TZ4C 2JQQA 2XHEB 2UXDT 5FNVE 2V7JA 4LF5T 2JPFA 1HG5A 2W61A 3RYCE 4IREA 3QUJA 2V7KA 5E0OA 5LP6E 2W67A 4O4HE 4F8HA 1XDOA 4PK6A 4H9PC 3OVUA 4XBFB 5AQKB 3ZSTA 4DR3T 4TNVA 3MZKB 1US7B 2LM2A 1T8BA 2SPCA 3K3OA 2CBIA 3BQLA 4BAYB 3P8CD 2QA7A 4EGWA 5L47A 1D1AA 1W0AA 3AA6B 3GN5A 2WM9A 1YQ4A 2LM9A 3RC3A 1X79A 2K5BB 2WP9A 4PNIA 3R84B 1JNRA 4MHCA 3F57A 4DR6T 2FJAA 2HN1A 2KINB 3OYXA 4ZI2C 1SA0E 5JDQA 1MMGA 1YW0A 4HE8A 2LSIA 2JQ9A 2W66A 4CN4A 2EHOD 3W15B 4IGUA 4IT4A 4CI1B 2EHOA 1O3XA 1IBMT 1OEDE 4AKLA 4YY3T 2NTXA 5FY0A 3ONJA 2YDQA 1VOMA 4H9QC 4IDNA 2CE7A 4CI3B 1E1HB 3ZCJA 3K1SA 4LFCT 3P50A 1OXZA 2Y48B 2XQAA 2RPAA 2RP4A 4IDZA 5CGMA 2K9AA 4AQFC 2MTQA 4TV8E 4UR9A 1WRDA 2HPLA 4EZHA 3AVSA 4DR2T 4OK0A 2IHR1 3KBUA 4PAGA 5LBMA 1YD8G 1W0BA 3C4ZA 3N9OA 4E7SA 4YTNA 2WB5A 3LK2B 4ZZCA 3LG7A 3AB3B 5J2TE 2DL1A 2V6YB 3UUBA 4EYUA 1WR0A 3F2EA 2LLYA 2UUAT 3PUVF 3ZMVB 3N2KE 4KBMB 1AJ3A 4GKJT 3PJAA 3D0TA 2ZM2A 4DUZT 3RLFF 2BS3A 3RX6A 4B3MT 3CQCB 1FIOA 2QYWA 4IE0A 1MNEA 5FKYA 1B7TA 1HNWT 4EYYR 4ANJA 1I94T 3AEFA 2UUBT 1G73A 4OHFA 3C50A 3SRZA 4OX9T 3T1HT 1QLBA 2RA1A 4O4IE 3VU7H 2X0YA 2XTLA 1XNRT 3BQIA 2V5DA 2ZM8A 2IC6A 5HEOA 4P1NA 5L3FB 4JI1T 4X1YE 2XAFB 1LRZA 4MBQA 3FZHB 4G63A 5AQMB 5F5WA 3QC9A 1HCIA 2X9XA 3AE9A 4I0UA 4UVBB 3WI3A 1W09A 4NXNT 5AQVB 5HXEA 2UUCT 2KWHA 3MXZA 5AQLB 2LT3A 3OKQA 2Q9QB 2HN2A 4ZI3D 1WCRA 4EOZB 4HFCA 2XM2A 4HTEA 2IAKA 4TWDA 2DLRA 1ZHCA 2OLTA 2ODVA 5J2UE 3AE8A 2VL8A 2LHRA 3Q5EA 2E9XB 2K3WA 4HN9A 4YJ2E 1SUMB 5HXCA 5HAXA 5C2TA 2ZM0A 5HEHA 2KMFA 3IF8B 1W9RA 4IE7A 4YFSA 3K3QC 3P7IA 2JQHA 1VRBA 2FUPA 3AE4A 4DNDA 1J1JA 1U5PA 1BR4A 2XQ6A 1MIYA 4WNKA 3HKBE 2YDSA 3ZJ1A 3PUQA 3QOFA 4X20E 2YKSA 2HH7A 3T8OA 2XQ8A 2IDOB 2WBLA 5HEJA 5LHIB 1CUNA 1KK7A 3UU5A 4HWIB 4Z90A 2JRKA 3ZN1B 4AIUA 3PDYA 1X9BA 4LMLA 3GMIA 2V6YA 4JBWF 4O8SA 5KDMC 1M62A 2V8SV 2AXDS 5TAOA 2MAWA 2QRXA 3NKZA 2E2AA 2XM1A 1UCUA 2WS3A 3QB5K 1WYBA 4KMCA 5DJQC 5EZYE 2KWIB 2WCAA 4JI7T 4A5XA 2EHOC 2CM0A 1IBKT 2WSSV 5KXJA 2X51A 1Y01A 5AQPB 3TLSA 3AAEB 1YQ3A 4H63H 3LK42 2CEAA 4JI6T 3N9QA 4TV9E 5AQSB 3GA8A 2C5JA 4IE5A 2GK9A 2BG9E 3MJXA 4H9SE 4L5GA 3N9PA 2VQFT 2Z6EA 3U78A 3FBZA 2LHNA 2NW7A 5FXXA 2J1DG 4XAXB 2BDEA 1HF8A 2L9QA 1FMWA 2XSAA 3DP7A 1ZP0A 3ZPOA 4UELA 4U2YA 3JADA 4UV8B 5L3EB 1KNPA 3TLUA 5LBQB 3RRCA 2WZHA 4IE6A 2L3LA 2Q9QD 3UT5E 2X66A 3AE7A 3F31A 2Q9QA 5HEGA 2WU5A 3I0OA 1SE7A 3O1IA 1KF6A 2LSGA 3BK9A 4AISA 3PU3A 2NR4A 5JDNA 3CK6A 4DVDA 2A72A 4QH5A 5JH7E 3VHLA 4C90A 5BMVE 4KHZF 2KSRA 3ZKRA 3N9LA 3PUXF 3JAEA 3P4RA 2VKOA 5FY1A 5J1GA 2E9XA 1KNRA 3K8PC 4HFBA 4DR4T 3ANWB 5H6RB 5KX5E 1WLXA 4L0RA 2CLYB 4A97A 5LG4A 4OFZA 5HYAA 2QVAA 3C51A 3DJBA 3H3MA 4MALA 2LE8A 3AE3A 4KI0F 3MK7C 1NAFA 2VK9A 2XPKA 2CXLA 2V6XA 4CI2B 2XSBA 3RH3A 5JRCB 4E7ZA 5EK3A 5FXWA 3UU4A 2MYSA 4WBNE 4DO0A 4GIWA 2I59A 4UV9B 1N33T 2V7IA 4UF0B 2J4GA 3P4QA 4X65T 5F8PA 2BVMA 2FJEA 3O4XE 4YXDA 4KHPT 4YT0A 3X1DA 2CWYA 4ZI3C 2LOSA 1HR0T 4DV7T 3ZMTB 5AQIB 4QHOA 4CZZB 4DV3T 4XZCA 1FEWA 4U31A 4H9NC 4L9IA 5HXRA 3CQGB 3CQXC 4C91A 4IE4A 2XASB 4NIQA 4HWHA 4GYRA 4I55E 3KBTA 2ACXA 2XQ4A 2OV9A 3HA4A 4LFBT 3N2OA 1HNZT 4ISSA 3OYZA 3NWIA 4JI3T 5JR9B 2HHHT 3RGLA 4ZEYA 3ABVA 4I50E 5HWYA 3FHNA 3JC6D 1DU2A 4DUYT 2YINA 1SHZC 3FB2A 4QWNB 3ZMUB 2K24A 4TNWA 2NW8A 3IHRA 5AQRB 4CQIA 4JEUB 5AQGB 2D9DA 4ZS2A 4LFAT 3AA1B 1EZ3A 4MFRA 5LNKA 2N2NA 2MBGA 3ETVA 3A5XA 2V26A 5CA0E 3KINB 3CIRA 2X68A 4U7IA 4IHJE 3ZYKA 1KNZA 4V1Av 2JJ9A 3AA0B 4PW8A 2WAUA 2M6IA 4KP3C 2DWGA 3AAAB 5JTGA 1IZNB 5HEUA 4ILUA 3ANWA 3NVOA 4LF7T 1J5ET 5LB7B 4EZ4A 4ADZA 5FL1A 4JV5T 5IUXA 3PUWF 3PUYF 4TUYE 1LKXA 2E5VA 2BVLA 4H9OC 3CVRA 3RKOA 4P0BA 1HNXT 2UU9T 2PBIA 3ZT6A 3AE2A 3AAIA 5JRCA 3OJAA 1XMOT 4U2ZA 2E8IA 5ABEA 2FJDA 4X64T 4PFOA 3ZCIA 3S4UA 5AQHB 4DR5T 3TLTA 4UF0A 4CN6A 3KVBA 1N34T 4GK0E 3KDSE 5FVLA 5LG3A 2A2FX 4HFEA 3EI0A 5ABGA 2WWUA 3FZFB 5L3CB 2ZLYA 3ZYLA 3HKEE 5LGUB 2WY2A 3NRXA 4EEBA 2JMHA 3GWHA 5IHYA 5AQJB 3PU8A 2BBJA 2UXBT 1HFAA 3E08A 2H88A 2P9BA 1KFYA 2LEHA 3ONLC 4NPPA 3AVRA 4HGAA 2FBWA 4TX5A 3AA7B 4HFIA 5JR9A 2PG8A 1VCTA 4JLEA 1H7CA 4AKRB 4AKGA 5FP3A 3L3PA 5DQWA 4DBQA 4U3CA 2NTYA 2F4VT 3AECA 1I6ZA 2UXXB 3SWHA 3L39A 2KZ7B 4UVAB 2LJLA 4YLHA 3MKDA 4B3TT 1OWAA 1WR6A 1NEKA 5AQQB 4EAHA 2CXDA 2DNXA 1R8IA 2XQ9A 2A9UA 3U3IA 5FVKA 4ISTA 5KMGP 4NUUA 4UVCB 3PUZF 2KXPB 4AKHA 2YOEA 5LMNT 4KUMB 2WU2A 2BKNA 4DV0T 4CXXA 1IJ6A 5CA1E 2XQYA 3ZMZB 1OEDB 2IUBA 1FJGT 4IDQA 3C64A 2XAQB 2WDRA 3PUSA 2OA5A 4U72A 4X1KE 1WYCA 4YHJA 4YTPA 3A7MA 4ZI2D 4P0AA 4HKAA 3KFWX 4O4LE 2CHOA 4YSZA 2XUEA 1U4QA 2VASA 3RYHE 4AQYT 4GK5E 3OBVE 2PTFA 4J2CA 3N9NA 4DV2T 4M1PA 2NOXA 5F3JA 1YKEB 4LMKA 1UUSA 3UTKA 4MLKA 2A3DA 3PJAJ 3C4WA 2WWVA 2X0HA 2IIUA 3IBPA 4Q25A 4QXHB 3Q2MA 1S94A 3HI2A 4QXBB 3RQWA 2CWOA 4H63V 3WAKA 4LF4T 3EABA 2XZEA 3JAFA 4ASKA 3L09A 3AEEA 2MOZA 4QH1A 2YEVC 4AQFA 5JQGE 1D0YA 3FZLB 3EDVA 3WAJA 3MA9A 2YDRA 1ZOYA 5ABFB 3RC8A 5LGNB 3V5SA 2DI4A 4EXTA 2H89A 2R6GF 1MMAA 4WYVA 2JIWA 4PK4A 1HG2A 3G06A 3OPCA 3ZT5A 3KV9A 5LCYA 2VVNA 4IL4A 3LFMA 1IBLT 2WDQA 2VVSA 1UGOA 4FI5A 4O2AE 5FY7A 1V9DA 2KNDA 2X67A 1D0XA 5HWXA 5HXHA 2DCFA 1UX4A 3EUHA 3TLVA 3RIUA 2VQET 1UX5A 5CB4E 3ESLA 4COFA 4F6RC 5L4HA 4A56A 4O2BE 3OTOT 3HL6A 4CXYA 1HX1B 4K0KT 4JYAT 4Z91A 3HKCE 2E9XD 3H3AA 2XQ7A 4ERRA 5C3JA 4I4TE 4PJNA 3ZLIA 3KV4A 4PFPA 5C8YE 4CXWA 1S35A 4UIGA 2LOPA 2X9WA 2C5IT 2NW9A 5FMNA 4ZXLA 5LGTB 3RYFE 1OEDA 5LA6E 5LYJE 4O4JE 4Z8XA 3B5MA 4HWDA 5L3DB 3UQ4A 4NUVA 2I0MA 1NENA 4HFVA 5JDMA 3VKHA 4GOUA 1D0ZA 5J0ZA 3UFGA 4KX6A 2CRBA 3ZMSB 3KVAA 2UXNB 2JMKA 3J9X1 2WQYA 4DBRA 3B57A 2X9HA 5FYMA 1BR0A 2XAHB 3ZT7A 1XZYA 1LVFA 3M65A 4CN1A 1HTJF 3LSVA 4DIDB 4LF8T 2VB6A 4ZS3A 2BS2A 1KEYA 3E0ZA 4WW0A 2JQKA 4LMJA 2E5LT 2H3RA 2J47A 4QX7B 2H7OA 3EAMA 3O1HA 4X5TA 4HWCA 3VRBA 3RI5A 1XMQT 5IYZE 3NZPA 3ZSSA 2KLQA 5JDFA 3TKLB 1HX8A 5AQUB 3AEGA 1YXRA 3RYIE 5ABFA 2ODUA 5JDHA 3J7Yq 3V5UA 5L3GB 3A8YC 3IA3A 5LHGB 1BR2A 3I0QA 3VR8A 4DV5T 2V7LA 2BZBA 4TN7B 1MMDA 2FJBA 4LF6T 2C0SA 5EK2A 3AE6A 2Y8DA 5CJ5A 2BG9B 4NXMT 1ZV4X 5ETWA 1XDPA 1D1CA 2D0UA 2V7MA 2WZIA 4U33A 2UXCT 1IJ5A 1LVKA 2HPJA 3RPUA 3LJCA 5AQTB 2LKHA 4IL9A 1M7KA 3QB5A 4AXPA 2KT9A 5JDLA 2Y6XA 3Q5WA 1XNQT 3P4WA 2G0UA 2YU2A 3LBXB 4P09A 1GQEA 4ZOLE 3I1AA 4EV6A 5GONE 3T1YT 5FXZA 3PURA 4BJNA 2LSKA 3LK3B 3AXJB 2LRKA 3ONXA 2W62A 2MPKA 2QGSA 1QSDA 3C4XA 2XQ3A 4GYSA 4H9RC 4AKIA 3AE5A 4HFHA 4G2AA 5AQFB 2CPTA 3ZYMA 4OYJA 5L2LA 3KV6A 3ETUA 5AFUL 2YK0A 3SFEA 5L4EA 1UURA 3RHWA 2I6HA 4DV6T 4A98A 1D1BA 2LRLA 3C98B 4IDOA 2ACZA 3RF1A 2H7VC 2CA5A 5LOVE 4UXNB 1Z8UA 2N1GA 3TLWA 2WDVA 3RIUC 4DMWA 2Q9QC 4JI4T 2VURA 2AE9A 4DV1T 3RQUA 2XAJB 4ZI7E 4JI0T 4B6XA 4N78D 3O1JA 4BA9A 3PE0A 2PJQA 3RRWA 2W00A 4IDPA 5CFBA 2E9XC 4AI6A 4LF9T 2L8KA 3CWZB 5LJMA 5ABHA 1MIVA 3N5LA 5AQNB 4U7YA 3FXDB 3Q5DA 3JCFA 3BQKA 2VKDA 3PV0F 2J62A 4WZXA 4YSYA 3FBLA 4QH4A 3HKDE 2NP9A 4X66T 1N32T 5M4YA 1OEDC 4ILCA 5IWAT 3E22E 4ILAA 2IMLA 5HCMA 1UK5A 2CHNA 3QK6A 4YJ3E 3L8RA 3N9MA 2BG9A 5LMUT 2YN6A 3SS1A 3AEAA 3CKDA 1BR1A 3KV5A 1NWMX 4JI8T 1MMNA 2XQ5A 2W0GA 4WBOA 2ZMAA 1QUUA 2VKHA 2B76A 4FJOA 1N36T 3QNUA 4B3ST 3LBXA 3AE1A 4JUYA 1FMVA 3N2GE 4EEDA 3UUNA 3DTOA 4DMVA 2X9YA 4GKKT 4QXCB 5JREA 3AXJA 3RIAA 5BR8T 3UQ7A 4DR1T 3PTRB 2CBJA 1HS7A 1ZKEA 4ILBA 3UUXB 2D2SA 3UU6A 5JVDE 3EDUA 3NZQA 2V1DB 4PJJA 3EVYA 3JC6C 3ZC0A 2BS4A 2PFVA 3IEEA 3PUAA 3I9YA 3H37A
chains in the Genus database with same CATH topology
3Q5XA 3R6NA 3ZJ2A 2LOPA 4CQIA 3Q9DA 2X9WA 4JEUB 2C5IT 4UEMA 2NW9A 2WMNA 4ZS2A 2RA1A 2LSYA 5FMNA 4O4IE 3VU7H 2XTLA 3AA1B 3I9WA 2D5UA 1EZ3A 4MFRA 5LNKA 2N2NA 3BQIA 5LGTB 2ZM8A 2MBGA 2IC6A 1G8XA 3ETVA 3RYFE 2D0TA 2DHRA 3A5XA 5L3FB 2IC9A 2V26A 5LA6E 4X1YE 5LYJE 5CA0E 2XAFB 4O4JE 3UULA 4JEHB 3VKGA 4Z8XA 3KINB 1LRZA 5H6QB 2X68A 4MBQA 5L3DB 4G63A 4IHJE 3QC9A 3ZYKA 1HCIA 4NUVA 5HXSA 2WMOA 2X9XA 1KNZA 4V1Av 4HFVA 2JJ9A 3B13A 4UVBB 5JDMA 3AA0B 3VKHA 3PUGA 3WI3A 4PW8A 2M67A 2WAUA 3CX6B 4GOUA 4KP3C 2DWGA 4IIJE 1D0ZA 3AAAB 2X0LB 5HXEA 1IZNB 5DQVA 5FXVA 3HR0A 3ZMSB 2KWHA 3MXZA 4ILUA 2LT3A 4QX8B 3ZC1A 3KVAA 3ANWA 3OKQA 2Q9QB 2UXNB 4OYKA 4ZI3D 4EOZB 2JMKA 4K0UA 4EZ4A 4ADZA 3J9X1 4DBRA 4HTEA 3B57A 2IAKA 3CX7B 2CLYC 2X9HA 5FYMA 3K3NA 3GN5B 1BR0A 3O9XA 2DLRA 2XAHB 1ZHCA 2VKJA 1LVFA 2ODVA 5J2UE 3M65A 2VL8A 3CMLA 4PK5A 1HTJF 4PJMA 4TUYE 1LKXA 4EIWA 2LHRA 2BVLA 4H9OC 4HEAA 3CVRA 3RKOA 2E9XB 2VB6A 4HN9A 2LSJA 4ZS3A 4P0BA 4YJ2E 4AQGA 3E0ZA 4WW0A 2PBIA 5HXCA 3ZN0B 5HAXA 3AAIA 5JRCA 2ZM0A 2H3RA 2KMFA 4ZHQE 3OJAA 4QX7B 2E8IA 2H7OA 3IF8B 3O1HA 5LHHB 4IE7A 2EHOB 4YFSA 3K3QC 3P7IA 4PFOA 1VRBA 5LXTE 5IYZE 3ZCIA 3NZPA 3S4UA 1Z0PA 2ES0A 2NWBA 4DNDA 2KLQA 5JDFA 3CPZA 5LJNA 1U5PA 3FXEB 1BR4A 4UF0A 3TKLB 3KVBA 1HX8A 1MIYA 5DABA 4WNKA 3HKBE 4GK0E 3KDSE 3UUMA 2CMRA 3ZJ1A 3PUQA 2A2FX 4X20E 3RYIE 4EB6E 5A1LA 2B1EA 2ODUA 5JDHA 2HH7A 1T98A 3J7Yq 3T8OA 3V5UA 2WWUA 5L3CB 2ZLYA 5L3GB 2WBLA 5LHIB 5LHGB 1BR2A 3I0QA 1ZEEA 3SOLA 3ZYLA 1CUNA 3HKEE 5LGUB 2V7LA 1KK7A 4PJLA 2BZBA 4TN7B 2DWKA 1MMDA 3NRXA 3NRYA 2JRKA 3ZN1B 2C0SA 3PDYA 5EK2A 2VWAA 2Y8DA 2IW5B 2JMHA 3GMIA 3GWHA 2CCQA 1ZV4X 5ETWA 5IHYA 3NBXX 4O8SA 3PU8A 1D1CA 5KDMC 2D0UA 2V7MA 1HFAA 3E08A 2P9BA 5TAOA 1IJ5A 1LVKA 2HPJA 3RPUA 3LJCA 2LEHA 1UCUA 2K48A 3AVRA 1WYBA 4KMCA 4HGAA 5DJQC 2C5KT 5EZYE 2N9DA 4AXPA 2KT9A 2KWIB 4TX5A 5JDLA 3AA7B 3MACA 4X1IE 5JR9A 2Y6XA 2PG8A 2EHOC 2CM0A 3Q5WA 5JDGA 1MNDA 2WSSV 2G0UA 4JLEA 5JR9C 2X51A 2YU2A 1H7CA 4QKNA 3LBXB 4I43B 4AKRB 1YKHB 3CX8B 4AKGA 5FP3A 3L3PA 4P09A 1Y64B 4ZOLE 4BJMA 5DQWA 4DBQA 2CXFA 2NTYA 3AAEB 5ADXL 3I1AA 4H63H 5GONE 3LK42 2CEAA 3N9QA 3ZEFB 1MIWA 4TV9E 2UXXB 5FXZA 3SWHA 3PURA 4U74A 4BJNA 3GA8A 2KZ7B 4UVAB 3UFEA 2C5JA 4IE5A 2GK9A 2LJLA 4YLHA 3MKDA 5EK4A 2LSKA 3MJXA 2W63A 5L3BB 3LK3B 4H9SE 1OWAA 1WR6A 4L5GA 3N9PA 3ONXA 4EAHA 2W62A 2CXDA 2YU1A 2QGSA 2DNXA 2Z6EA 1QSDA 3U78A 3FBZA 2LHNA 2NW7A 5FXXA 3C4XA 4GYSA 4H9RC 4AKIA 2XAGB 2J1DG 1IAPA 4TZ4C 4XAXB 2JQQA 2XHEB 3U3IA 5FNVE 2V7JA 2BDEA 1HF8A 2L9QA 2JPFA 4G2AA 1HG5A 2W61A 3RYCE 1FMWA 4ISTA 3ZYMA 5KMGP 4NUUA 4OYJA 5L2LA 3KV6A 3ETUA 3DP7A 4UVCB 5AFUL 3ZPOA 4UELA 3QUJA 2YK0A 2KXPB 2V7KA 5E0OA 5LP6E 4UV8B 4AKHA 4O4HE 5L3EB 4KUMB 4CXXA 1IJ6A 4PK6A 4H9PC 5CA1E 5LBQB 2XQYA 3RRCA 1D1BA 3C98B 4IE6A 4XBFB 2L3LA 3ZMZB 2Q9QD 3UT5E 2H7VC 2X66A 2CA5A 3MZKB 1US7B 3F31A 2SPCA 2Q9QA 3K3OA 5LOVE 4UXNB 3I0OA 3BQLA 4BAYB 3P8CD 3O1IA 2N1GA 2QA7A 3C64A 2LSGA 3BK9A 1D1AA 2XAQB 5JDNA 3PU3A 2Q9QC 4DMWA 3PUSA 2OA5A 4DVDA 4U72A 2A72A 3AA6B 3GN5A 2WM9A 4X1KE 5JH7E 1WYCA 4YHJA 3VHLA 4C90A 2LM9A 5BMVE 3RC3A 1X79A 2K5BB 3N9LA 2XAJB 4OHFA 4PNIA 3R84B 4ZI7E 4ZI2D 4P0AA 4HKAA 2VKOA 4MHCA 3KFWX 5FY1A 4N78D 4B6XA 3O1JA 3F57A 5J1GA 4O4LE 2E9XA 4BA9A 3PE0A 2PJQA 2XUEA 3K8PC 3RRWA 1U4QA 2VASA 2W00A 3RYHE 2KINB 3ANWB 3OYXA 1WLXA 5H6RB 4ZI2C 5KX5E 2E9XC 4L0RA 1SA0E 4GK5E 3OBVE 2CLYB 4J2CA 5JDQA 3N9NA 4AI6A 1MMGA 4M1PA 5LG4A 2L8KA 2NOXA 3CWZB 5LJMA 1YW0A 4HE8A 2LSIA 4OFZA 5F3JA 1YKEB 5HYAA 2EHOD 3W15B 1MIVA 3N5LA 4IGUA 4CI1B 3UTKA 3FXDB 2EHOA 4MLKA 1O3XA 3C51A 2A3DA 3DJBA 3BQKA 2VKDA 3C4WA 4AKLA 4MALA 2LE8A 2NTXA 5FY0A 3IBPA 3MK7C 3FBLA 4QXHB 3HKDE 1NAFA 2NP9A 2VK9A 3Q2MA 1VOMA 5M4YA 1S94A 4H9QC 2CXLA 3HI2A 4QXBB 3E22E 2CWOA 4H63V 4CI2B 3WAKA 2CE7A 4CI3B 3RH3A 5JRCB 1E1HB 3ZCJA 4ASKA 4E7ZA 3L09A 5EK3A 5FXWA 1OXZA 2MYSA 2Y48B 2MOZA 4WBNE 4DO0A 2YEVC 3QK6A 4GIWA 2RP4A 4YJ3E 4AQFA 2I59A 4IDZA 4UV9B 5JQGE 3N9MA 2V7IA 1D0YA 2K9AA 3EDVA 4UF0B 4AQFC 2MTQA 3WAJA 3MA9A 4TV8E 3SS1A 1WRDA 3CKDA 1BR1A 3RC8A 5F8PA 2BVMA 3O4XE 3V5SA 5LGNB 2HPLA 4EZHA 3KV5A 3AVSA 2DI4A 4OK0A 4EXTA 1NWMX 1MMNA 2CWYA 3KBUA 1MMAA 4WBOA 2W0GA 4PAGA 2LOSA 4ZI3C 4PK4A 2ZMAA 5LBMA 1HG2A 3ZMTB 1QUUA 1YD8G 3C4ZA 3KV9A 4QHOA 3N9OA 5LCYA 4E7SA 2VKHA 3I9YA 4CZZB 3LFMA 4XZCA 3LK2B 4FJOA 3LG7A 1FEWA 3AB3B 4FI5A 5J2TE 4H9NC 4O2AE 3LBXA 4EYUA 4L9IA 5FY7A 4JUYA 5HXRA 3CQGB 1FMVA 3CQXC 3F2EA 4C91A 1V9DA 2KNDA 2X67A 1D0XA 5HWXA 4IE4A 5HXHA 2XASB 2DCFA 3ZMVB 1UX4A 3N2GE 3EUHA 3UUNA 4GYRA 3N2KE 1UX5A 4KBMB 5CB4E 1AJ3A 3ESLA 4I55E 3KBTA 2ACXA 3DTOA 4DMVA 3HA4A 4F6RC 2X9YA 3D0TA 3N2OA 4QXCB 4ISSA 3OYZA 4A56A 4O2BE 2ZM2A 5JR9B 5JREA 3HL6A 4CXYA 4I50E 3PTRB 3RX6A 5HWYA 3HKCE 3CQCB 1HS7A 3FHNA 1ZKEA 2E9XD 3JC6D 3UUXB 2D2SA 1FIOA 4IE0A 1MNEA 3H3AA 2YINA 4ERRA 5JVDE 1SHZC 3EDUA 3FB2A 1B7TA 3NZQA 4I4TE 4PJNA 2V1DB 3ZLIA 4PJJA 3KV4A 4QWNB 4PFPA 4EYYR 5C8YE 3EVYA 4ANJA 3ZMUB 3JC6C 2K24A 3ZC0A 4CXWA 1S35A 2PFVA 2NW8A 4UIGA 3IEEA 1G73A 3PUAA 3IHRA 3C50A 3SRZA 3H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TX5 A;  5LG4 A;  1BR0 A;  5M4Y A;  1S94 A;  1HS7 A;  3LG7 A;  4JEU B;  1FIO A;  1G73 A;  3C98 B;  1EZ3 A;  2DNX A;  4JEH B;  2XHE B;  1FEW A; 
#chains in the Genus database with same CATH topology
 3Q5X A;  3R6N A;  3ZJ2 A;  1E2A A;  3Q9D A;  4UEM A;  3VRA A;  2WMN A;  2LSY A;  3I9W A;  3LDQ B;  2D5U A;  3P4P A;  3AED A;  1G8X A;  2D0T A;  2DHR A;  2IC9 A;  3AEB A;  4JEH B;  3UUL A;  5AQO B;  3VKG A;  5H6Q B;  5HCJ A;  4TWH A;  5HXS A;  3EHZ A;  2WMO A;  2W4X A;  3B13 A;  3PUG A;  2M67 A;  2XY8 B;  4HWF A;  3CX6 B;  4IIJ E;  1VCS A;  2X0L B;  5DQV A;  5FXV A;  3HR0 A;  2XJ7 A;  3UU3 A;  2BBH A;  4QX8 B;  3ZC1 A;  4OYK A;  4K0U A;  3RIF A;  3FZK B;  3UU8 A;  3CX7 B;  2CLY C;  4DV4 T;  1JNZ A;  3K3N A;  3GN5 B;  4YTM A;  3O9X A;  2VKJ A;  3M3Z B;  3CML A;  4PK5 A;  4PJM A;  4EIW A;  2BKO A;  4HEA A;  4HFD A;  3P4S A;  4DR7 T;  2LSJ A;  4AQG A;  3ZN0 B;  4ZHQ E;  1J5W A;  5LHH B;  2EHO B;  5LXT E;  1Z0P A;  2ES0 A;  2NWB A;  2BKP A;  3CPZ A;  5LJN A;  3FXE B;  1WFD A;  5DAB A;  3UUM A;  2CMR A;  2W2U A;  4EB6 E;  5A1L A;  2B1E A;  1T98 A;  4B3R T;  4YSX A;  1ZEE A;  3SOL A;  1T7S A;  4PJL A;  2DWK A;  1CHU A;  3NRY A;  2LKG A;  2VWA A;  3FZM B;  2IW5 B;  3RKG A;  2ZM6 T;  2CCQ A;  3NBX X;  1XWM A;  1T72 A;  5FL0 A;  2K48 A;  4X62 T;  2C5K T;  2N9D A;  4JI5 T;  3MAC A;  4X1I E;  4YHH T;  5JDG A;  1MND A;  5JR9 C;  4QKN A;  4I43 B;  2M6B A;  4JI2 T;  1YKH B;  3CX8 B;  1Y64 B;  4TWF A;  4BJM A;  2CXF A;  3SFD A;  5ADX L;  2VL0 A;  3ZEF B;  1MIW A;  4U74 A;  3UFE A;  5EK4 A;  2W63 A;  5L3B B;  4ZZB A;  1L0V A;  1E7P A;  2YU1 A;  2BG9 C;  3VR9 A;  2XAG B;  1IAP A;  2V5C A;  4TZ4 C;  2JQQ A;  2XHE B;  2UXD T;  5FNV E;  2V7J A;  4LF5 T;  2JPF A;  1HG5 A;  2W61 A;  3RYC E;  4IRE A;  3QUJ A;  2V7K A;  5E0O A;  5LP6 E;  2W67 A;  4O4H E;  4F8H A;  1XDO A;  4PK6 A;  4H9P C;  3OVU A;  4XBF B;  5AQK B;  3ZST A;  4DR3 T;  4TNV A;  3MZK B;  1US7 B;  2LM2 A;  1T8B A;  2SPC A;  3K3O A;  2CBI A;  3BQL A;  4BAY B;  3P8C D;  2QA7 A;  4EGW A;  5L47 A;  1D1A A;  1W0A A;  3AA6 B;  3GN5 A;  2WM9 A;  1YQ4 A;  2LM9 A;  3RC3 A;  1X79 A;  2K5B B;  2WP9 A;  4PNI A;  3R84 B;  1JNR A;  4MHC A;  3F57 A;  4DR6 T;  2FJA A;  2HN1 A;  2KIN B;  3OYX A;  4ZI2 C;  1SA0 E;  5JDQ A;  1MMG A;  1YW0 A;  4HE8 A;  2LSI A;  2JQ9 A;  2W66 A;  4CN4 A;  2EHO D;  3W15 B;  4IGU A;  4IT4 A;  4CI1 B;  2EHO A;  1O3X A;  1IBM T;  1OED E;  4AKL A;  4YY3 T;  2NTX A;  5FY0 A;  3ONJ A;  2YDQ A;  1VOM A;  4H9Q C;  4IDN A;  2CE7 A;  4CI3 B;  1E1H B;  3ZCJ A;  3K1S A;  4LFC T;  3P50 A;  1OXZ A;  2Y48 B;  2XQA A;  2RPA A;  2RP4 A;  4IDZ A;  5CGM A;  2K9A A;  4AQF C;  2MTQ A;  4TV8 E;  4UR9 A;  1WRD A;  2HPL A;  4EZH A;  3AVS A;  4DR2 T;  4OK0 A;  2IHR 1;  3KBU A;  4PAG A;  5LBM A;  1YD8 G;  1W0B A;  3C4Z A;  3N9O A;  4E7S A;  4YTN A;  2WB5 A;  3LK2 B;  4ZZC A;  3LG7 A;  3AB3 B;  5J2T E;  2DL1 A;  2V6Y B;  3UUB A;  4EYU A;  1WR0 A;  3F2E A;  2LLY A;  2UUA T;  3PUV F;  3ZMV B;  3N2K E;  4KBM B;  1AJ3 A;  4GKJ T;  3PJA A;  3D0T A;  2ZM2 A;  4DUZ T;  3RLF F;  2BS3 A;  3RX6 A;  4B3M T;  3CQC B;  1FIO A;  2QYW A;  4IE0 A;  1MNE A;  5FKY A;  1B7T A;  1HNW T;  4EYY R;  4ANJ A;  1I94 T;  3AEF A;  2UUB T;  1G73 A;  4OHF A;  3C50 A;  3SRZ A;  4OX9 T;  3T1H T;  1QLB A;  2RA1 A;  4O4I E;  3VU7 H;  2X0Y A;  2XTL A;  1XNR T;  3BQI A;  2V5D A;  2ZM8 A;  2IC6 A;  5HEO A;  4P1N A;  5L3F B;  4JI1 T;  4X1Y E;  2XAF B;  1LRZ A;  4MBQ A;  3FZH B;  4G63 A;  5AQM B;  5F5W A;  3QC9 A;  1HCI A;  2X9X A;  3AE9 A;  4I0U A;  4UVB B;  3WI3 A;  1W09 A;  4NXN T;  5AQV B;  5HXE A;  2UUC T;  2KWH A;  3MXZ A;  5AQL B;  2LT3 A;  3OKQ A;  2Q9Q B;  2HN2 A;  4ZI3 D;  1WCR A;  4EOZ B;  4HFC A;  2XM2 A;  4HTE A;  2IAK A;  4TWD A;  2DLR A;  1ZHC A;  2OLT A;  2ODV A;  5J2U E;  3AE8 A;  2VL8 A;  2LHR A;  3Q5E A;  2E9X B;  2K3W A;  4HN9 A;  4YJ2 E;  1SUM B;  5HXC A;  5HAX A;  5C2T A;  2ZM0 A;  5HEH A;  2KMF A;  3IF8 B;  1W9R A;  4IE7 A;  4YFS A;  3K3Q C;  3P7I A;  2JQH A;  1VRB A;  2FUP A;  3AE4 A;  4DND A;  1J1J A;  1U5P A;  1BR4 A;  2XQ6 A;  1MIY A;  4WNK A;  3HKB E;  2YDS A;  3ZJ1 A;  3PUQ A;  3QOF A;  4X20 E;  2YKS A;  2HH7 A;  3T8O A;  2XQ8 A;  2IDO B;  2WBL A;  5HEJ A;  5LHI B;  1CUN A;  1KK7 A;  3UU5 A;  4HWI B;  4Z90 A;  2JRK A;  3ZN1 B;  4AIU A;  3PDY A;  1X9B A;  4LML A;  3GMI A;  2V6Y A;  4JBW F;  4O8S A;  5KDM C;  1M62 A;  2V8S V;  2AXD S;  5TAO A;  2MAW A;  2QRX A;  3NKZ A;  2E2A A;  2XM1 A;  1UCU A;  2WS3 A;  3QB5 K;  1WYB A;  4KMC A;  5DJQ C;  5EZY E;  2KWI B;  2WCA A;  4JI7 T;  4A5X A;  2EHO C;  2CM0 A;  1IBK T;  2WSS V;  5KXJ A;  2X51 A;  1Y01 A;  5AQP B;  3TLS A;  3AAE B;  1YQ3 A;  4H63 H;  3LK4 2;  2CEA A;  4JI6 T;  3N9Q A;  4TV9 E;  5AQS B;  3GA8 A;  2C5J A;  4IE5 A;  2GK9 A;  2BG9 E;  3MJX A;  4H9S E;  4L5G A;  3N9P A;  2VQF T;  2Z6E A;  3U78 A;  3FBZ A;  2LHN A;  2NW7 A;  5FXX A;  2J1D G;  4XAX B;  2BDE A;  1HF8 A;  2L9Q A;  1FMW A;  2XSA A;  3DP7 A;  1ZP0 A;  3ZPO A;  4UEL A;  4U2Y A;  3JAD A;  4UV8 B;  5L3E B;  1KNP A;  3TLU A;  5LBQ B;  3RRC A;  2WZH A;  4IE6 A;  2L3L A;  2Q9Q D;  3UT5 E;  2X66 A;  3AE7 A;  3F31 A;  2Q9Q A;  5HEG A;  2WU5 A;  3I0O A;  1SE7 A;  3O1I A;  1KF6 A;  2LSG A;  3BK9 A;  4AIS A;  3PU3 A;  2NR4 A;  5JDN A;  3CK6 A;  4DVD A;  2A72 A;  4QH5 A;  5JH7 E;  3VHL A;  4C90 A;  5BMV E;  4KHZ F;  2KSR A;  3ZKR A;  3N9L A;  3PUX F;  3JAE A;  3P4R A;  2VKO A;  5FY1 A;  5J1G A;  2E9X A;  1KNR A;  3K8P C;  4HFB A;  4DR4 T;  3ANW B;  5H6R B;  5KX5 E;  1WLX A;  4L0R A;  2CLY B;  4A97 A;  5LG4 A;  4OFZ A;  5HYA A;  2QVA A;  3C51 A;  3DJB A;  3H3M A;  4MAL A;  2LE8 A;  3AE3 A;  4KI0 F;  3MK7 C;  1NAF A;  2VK9 A;  2XPK A;  2CXL A;  2V6X A;  4CI2 B;  2XSB A;  3RH3 A;  5JRC B;  4E7Z A;  5EK3 A;  5FXW A;  3UU4 A;  2MYS A;  4WBN E;  4DO0 A;  4GIW A;  2I59 A;  4UV9 B;  1N33 T;  2V7I A;  4UF0 B;  2J4G A;  3P4Q A;  4X65 T;  5F8P A;  2BVM A;  2FJE A;  3O4X E;  4YXD A;  4KHP T;  4YT0 A;  3X1D A;  2CWY A;  4ZI3 C;  2LOS A;  1HR0 T;  4DV7 T;  3ZMT B;  5AQI B;  4QHO A;  4CZZ B;  4DV3 T;  4XZC A;  1FEW A;  4U31 A;  4H9N C;  4L9I A;  5HXR A;  3CQG B;  3CQX C;  4C91 A;  4IE4 A;  2XAS B;  4NIQ A;  4HWH A;  4GYR A;  4I55 E;  3KBT A;  2ACX A;  2XQ4 A;  2OV9 A;  3HA4 A;  4LFB T;  3N2O A;  1HNZ T;  4ISS A;  3OYZ A;  3NWI A;  4JI3 T;  5JR9 B;  2HHH T;  3RGL A;  4ZEY A;  3ABV A;  4I50 E;  5HWY A;  3FHN A;  3JC6 D;  1DU2 A;  4DUY T;  2YIN A;  1SHZ C;  3FB2 A;  4QWN B;  3ZMU B;  2K24 A;  4TNW A;  2NW8 A;  3IHR A;  5AQR B;  4CQI A;  4JEU B;  5AQG B;  2D9D A;  4ZS2 A;  4LFA T;  3AA1 B;  1EZ3 A;  4MFR A;  5LNK A;  2N2N A;  2MBG A;  3ETV A;  3A5X A;  2V26 A;  5CA0 E;  3KIN B;  3CIR A;  2X68 A;  4U7I A;  4IHJ E;  3ZYK A;  1KNZ A;  4V1A v;  2JJ9 A;  3AA0 B;  4PW8 A;  2WAU A;  2M6I A;  4KP3 C;  2DWG A;  3AAA B;  5JTG A;  1IZN B;  5HEU A;  4ILU A;  3ANW A;  3NVO A;  4LF7 T;  1J5E T;  5LB7 B;  4EZ4 A;  4ADZ A;  5FL1 A;  4JV5 T;  5IUX A;  3PUW F;  3PUY F;  4TUY E;  1LKX A;  2E5V A;  2BVL A;  4H9O C;  3CVR A;  3RKO A;  4P0B A;  1HNX T;  2UU9 T;  2PBI A;  3ZT6 A;  3AE2 A;  3AAI A;  5JRC A;  3OJA A;  1XMO T;  4U2Z A;  2E8I A;  5ABE A;  2FJD A;  4X64 T;  4PFO A;  3ZCI A;  3S4U A;  5AQH B;  4DR5 T;  3TLT A;  4UF0 A;  4CN6 A;  3KVB A;  1N34 T;  4GK0 E;  3KDS E;  5FVL A;  5LG3 A;  2A2F X;  4HFE A;  3EI0 A;  5ABG A;  2WWU A;  3FZF B;  5L3C B;  2ZLY A;  3ZYL A;  3HKE E;  5LGU B;  2WY2 A;  3NRX A;  4EEB A;  2JMH A;  3GWH A;  5IHY A;  5AQJ B;  3PU8 A;  2BBJ A;  2UXB T;  1HFA A;  3E08 A;  2H88 A;  2P9B A;  1KFY A;  2LEH A;  3ONL C;  4NPP A;  3AVR A;  4HGA A;  2FBW A;  4TX5 A;  3AA7 B;  4HFI A;  5JR9 A;  2PG8 A;  1VCT A;  4JLE A;  1H7C A;  4AKR B;  4AKG A;  5FP3 A;  3L3P A;  5DQW A;  4DBQ A;  4U3C A;  2NTY A;  2F4V T;  3AEC A;  1I6Z A;  2UXX B;  3SWH A;  3L39 A;  2KZ7 B;  4UVA B;  2LJL A;  4YLH A;  3MKD A;  4B3T T;  1OWA A;  1WR6 A;  1NEK A;  5AQQ B;  4EAH A;  2CXD A;  2DNX A;  1R8I A;  2XQ9 A;  2A9U A;  3U3I A;  5FVK A;  4IST A;  5KMG P;  4NUU A;  4UVC B;  3PUZ F;  2KXP B;  4AKH A;  2YOE A;  5LMN T;  4KUM B;  2WU2 A;  2BKN A;  4DV0 T;  4CXX A;  1IJ6 A;  5CA1 E;  2XQY A;  3ZMZ B;  1OED B;  2IUB A;  1FJG T;  4IDQ A;  3C64 A;  2XAQ B;  2WDR A;  3PUS A;  2OA5 A;  4U72 A;  4X1K E;  1WYC A;  4YHJ A;  4YTP A;  3A7M A;  4ZI2 D;  4P0A A;  4HKA A;  3KFW X;  4O4L E;  2CHO A;  4YSZ A;  2XUE A;  1U4Q A;  2VAS A;  3RYH E;  4AQY T;  4GK5 E;  3OBV E;  2PTF A;  4J2C A;  3N9N A;  4DV2 T;  4M1P A;  2NOX A;  5F3J A;  1YKE B;  4LMK A;  1UUS A;  3UTK A;  4MLK A;  2A3D A;  3PJA J;  3C4W A;  2WWV A;  2X0H A;  2IIU A;  3IBP A;  4Q25 A;  4QXH B;  3Q2M A;  1S94 A;  3HI2 A;  4QXB B;  3RQW A;  2CWO A;  4H63 V;  3WAK A;  4LF4 T;  3EAB A;  2XZE A;  3JAF A;  4ASK A;  3L09 A;  3AEE A;  2MOZ A;  4QH1 A;  2YEV C;  4AQF A;  5JQG E;  1D0Y A;  3FZL B;  3EDV A;  3WAJ A;  3MA9 A;  2YDR A;  1ZOY A;  5ABF B;  3RC8 A;  5LGN B;  3V5S A;  2DI4 A;  4EXT A;  2H89 A;  2R6G F;  1MMA A;  4WYV A;  2JIW A;  4PK4 A;  1HG2 A;  3G06 A;  3OPC A;  3ZT5 A;  3KV9 A;  5LCY A;  2VVN A;  4IL4 A;  3LFM A;  1IBL T;  2WDQ A;  2VVS A;  1UGO A;  4FI5 A;  4O2A E;  5FY7 A;  1V9D A;  2KND A;  2X67 A;  1D0X A;  5HWX A;  5HXH A;  2DCF A;  1UX4 A;  3EUH A;  3TLV A;  3RIU A;  2VQE T;  1UX5 A;  5CB4 E;  3ESL A;  4COF A;  4F6R C;  5L4H A;  4A56 A;  4O2B E;  3OTO T;  3HL6 A;  4CXY A;  1HX1 B;  4K0K T;  4JYA T;  4Z91 A;  3HKC E;  2E9X D;  3H3A A;  2XQ7 A;  4ERR A;  5C3J A;  4I4T E;  4PJN A;  3ZLI A;  3KV4 A;  4PFP A;  5C8Y E;  4CXW A;  1S35 A;  4UIG A;  2LOP A;  2X9W A;  2C5I T;  2NW9 A;  5FMN A;  4ZXL A;  5LGT B;  3RYF E;  1OED A;  5LA6 E;  5LYJ E;  4O4J E;  4Z8X A;  3B5M A;  4HWD A;  5L3D B;  3UQ4 A;  4NUV A;  2I0M A;  1NEN A;  4HFV A;  5JDM A;  3VKH A;  4GOU A;  1D0Z A;  5J0Z A;  3UFG A;  4KX6 A;  2CRB A;  3ZMS B;  3KVA A;  2UXN B;  2JMK A;  3J9X 1;  2WQY A;  4DBR A;  3B57 A;  2X9H A;  5FYM A;  1BR0 A;  2XAH B;  3ZT7 A;  1XZY A;  1LVF A;  3M65 A;  4CN1 A;  1HTJ F;  3LSV A;  4DID B;  4LF8 T;  2VB6 A;  4ZS3 A;  2BS2 A;  1KEY A;  3E0Z A;  4WW0 A;  2JQK A;  4LMJ A;  2E5L T;  2H3R A;  2J47 A;  4QX7 B;  2H7O A;  3EAM A;  3O1H A;  4X5T A;  4HWC A;  3VRB A;  3RI5 A;  1XMQ T;  5IYZ E;  3NZP A;  3ZSS A;  2KLQ A;  5JDF A;  3TKL B;  1HX8 A;  5AQU B;  3AEG A;  1YXR A;  3RYI E;  5ABF A;  2ODU A;  5JDH A;  3J7Y q;  3V5U A;  5L3G B;  3A8Y C;  3IA3 A;  5LHG B;  1BR2 A;  3I0Q A;  3VR8 A;  4DV5 T;  2V7L A;  2BZB A;  4TN7 B;  1MMD A;  2FJB A;  4LF6 T;  2C0S A;  5EK2 A;  3AE6 A;  2Y8D A;  5CJ5 A;  2BG9 B;  4NXM T;  1ZV4 X;  5ETW A;  1XDP A;  1D1C A;  2D0U A;  2V7M A;  2WZI A;  4U33 A;  2UXC T;  1IJ5 A;  1LVK A;  2HPJ A;  3RPU A;  3LJC A;  5AQT B;  2LKH A;  4IL9 A;  1M7K A;  3QB5 A;  4AXP A;  2KT9 A;  5JDL A;  2Y6X A;  3Q5W A;  1XNQ T;  3P4W A;  2G0U A;  2YU2 A;  3LBX B;  4P09 A;  1GQE A;  4ZOL E;  3I1A A;  4EV6 A;  5GON E;  3T1Y T;  5FXZ A;  3PUR A;  4BJN A;  2LSK A;  3LK3 B;  3AXJ B;  2LRK A;  3ONX A;  2W62 A;  2MPK A;  2QGS A;  1QSD A;  3C4X A;  2XQ3 A;  4GYS A;  4H9R C;  4AKI A;  3AE5 A;  4HFH A;  4G2A A;  5AQF B;  2CPT A;  3ZYM A;  4OYJ A;  5L2L A;  3KV6 A;  3ETU A;  5AFU L;  2YK0 A;  3SFE A;  5L4E A;  1UUR A;  3RHW A;  2I6H A;  4DV6 T;  4A98 A;  1D1B A;  2LRL A;  3C98 B;  4IDO A;  2ACZ A;  3RF1 A;  2H7V C;  2CA5 A;  5LOV E;  4UXN B;  1Z8U A;  2N1G A;  3TLW A;  2WDV A;  3RIU C;  4DMW A;  2Q9Q C;  4JI4 T;  2VUR A;  2AE9 A;  4DV1 T;  3RQU A;  2XAJ B;  4ZI7 E;  4JI0 T;  4B6X A;  4N78 D;  3O1J A;  4BA9 A;  3PE0 A;  2PJQ A;  3RRW A;  2W00 A;  4IDP A;  5CFB A;  2E9X C;  4AI6 A;  4LF9 T;  2L8K A;  3CWZ B;  5LJM A;  5ABH A;  1MIV A;  3N5L A;  5AQN B;  4U7Y A;  3FXD B;  3Q5D A;  3JCF A;  3BQK A;  2VKD A;  3PV0 F;  2J62 A;  4WZX A;  4YSY A;  3FBL A;  4QH4 A;  3HKD E;  2NP9 A;  4X66 T;  1N32 T;  5M4Y A;  1OED C;  4ILC A;  5IWA T;  3E22 E;  4ILA A;  2IML A;  5HCM A;  1UK5 A;  2CHN A;  3QK6 A;  4YJ3 E;  3L8R A;  3N9M A;  2BG9 A;  5LMU T;  2YN6 A;  3SS1 A;  3AEA A;  3CKD A;  1BR1 A;  3KV5 A;  1NWM X;  4JI8 T;  1MMN A;  2XQ5 A;  2W0G A;  4WBO A;  2ZMA A;  1QUU A;  2VKH A;  2B76 A;  4FJO A;  1N36 T;  3QNU A;  4B3S T;  3LBX A;  3AE1 A;  4JUY A;  1FMV A;  3N2G E;  4EED A;  3UUN A;  3DTO A;  4DMV A;  2X9Y A;  4GKK T;  4QXC B;  5JRE A;  3AXJ A;  3RIA A;  5BR8 T;  3UQ7 A;  4DR1 T;  3PTR B;  2CBJ A;  1HS7 A;  1ZKE A;  4ILB A;  3UUX B;  2D2S A;  3UU6 A;  5JVD E;  3EDU A;  3NZQ A;  2V1D B;  4PJJ A;  3EVY A;  3JC6 C;  3ZC0 A;  2BS4 A;  2PFV A;  3IEE A;  3PUA A;  3I9Y A;  3H37 A; 
#chains in the Genus database with same CATH homology
 3Q5X A;  3R6N A;  3ZJ2 A;  2LOP A;  4CQI A;  3Q9D A;  2X9W A;  4JEU B;  2C5I T;  4UEM A;  2NW9 A;  2WMN A;  4ZS2 A;  2RA1 A;  2LSY A;  5FMN A;  4O4I E;  3VU7 H;  2XTL A;  3AA1 B;  3I9W A;  2D5U A;  1EZ3 A;  4MFR A;  5LNK A;  2N2N A;  3BQI A;  5LGT B;  2ZM8 A;  2MBG A;  2IC6 A;  1G8X A;  3ETV A;  3RYF E;  2D0T A;  2DHR A;  3A5X A;  5L3F B;  2IC9 A;  2V26 A;  5LA6 E;  4X1Y E;  5LYJ E;  5CA0 E;  2XAF B;  4O4J E;  3UUL A;  4JEH B;  3VKG A;  4Z8X A;  3KIN B;  1LRZ A;  5H6Q B;  2X68 A;  4MBQ A;  5L3D B;  4G63 A;  4IHJ E;  3QC9 A;  3ZYK A;  1HCI A;  4NUV A;  5HXS A;  2WMO A;  2X9X A;  1KNZ A;  4V1A v;  4HFV A;  2JJ9 A;  3B13 A;  4UVB B;  5JDM A;  3AA0 B;  3VKH A;  3PUG A;  3WI3 A;  4PW8 A;  2M67 A;  2WAU A;  3CX6 B;  4GOU A;  4KP3 C;  2DWG A;  4IIJ E;  1D0Z A;  3AAA B;  2X0L B;  5HXE A;  1IZN B;  5DQV A;  5FXV A;  3HR0 A;  3ZMS B;  2KWH A;  3MXZ A;  4ILU A;  2LT3 A;  4QX8 B;  3ZC1 A;  3KVA A;  3ANW A;  3OKQ A;  2Q9Q B;  2UXN B;  4OYK A;  4ZI3 D;  4EOZ B;  2JMK A;  4K0U A;  4EZ4 A;  4ADZ A;  3J9X 1;  4DBR A;  4HTE A;  3B57 A;  2IAK A;  3CX7 B;  2CLY C;  2X9H A;  5FYM A;  3K3N A;  3GN5 B;  1BR0 A;  3O9X A;  2DLR A;  2XAH B;  1ZHC A;  2VKJ A;  1LVF A;  2ODV A;  5J2U E;  3M65 A;  2VL8 A;  3CML A;  4PK5 A;  1HTJ F;  4PJM A;  4TUY E;  1LKX A;  4EIW A;  2LHR A;  2BVL A;  4H9O C;  4HEA A;  3CVR A;  3RKO A;  2E9X B;  2VB6 A;  4HN9 A;  2LSJ A;  4ZS3 A;  4P0B A;  4YJ2 E;  4AQG A;  3E0Z A;  4WW0 A;  2PBI A;  5HXC A;  3ZN0 B;  5HAX A;  3AAI A;  5JRC A;  2ZM0 A;  2H3R A;  2KMF A;  4ZHQ E;  3OJA A;  4QX7 B;  2E8I A;  2H7O A;  3IF8 B;  3O1H A;  5LHH B;  4IE7 A;  2EHO B;  4YFS A;  3K3Q C;  3P7I A;  4PFO A;  1VRB A;  5LXT E;  5IYZ E;  3ZCI A;  3NZP A;  3S4U A;  1Z0P A;  2ES0 A;  2NWB A;  4DND A;  2KLQ A;  5JDF A;  3CPZ A;  5LJN A;  1U5P A;  3FXE B;  1BR4 A;  4UF0 A;  3TKL B;  3KVB A;  1HX8 A;  1MIY A;  5DAB A;  4WNK A;  3HKB E;  4GK0 E;  3KDS E;  3UUM A;  2CMR A;  3ZJ1 A;  3PUQ A;  2A2F X;  4X20 E;  3RYI E;  4EB6 E;  5A1L A;  2B1E A;  2ODU A;  5JDH A;  2HH7 A;  1T98 A;  3J7Y q;  3T8O A;  3V5U A;  2WWU A;  5L3C B;  2ZLY A;  5L3G B;  2WBL A;  5LHI B;  5LHG B;  1BR2 A;  3I0Q A;  1ZEE A;  3SOL A;  3ZYL A;  1CUN A;  3HKE E;  5LGU B;  2V7L A;  1KK7 A;  4PJL A;  2BZB A;  4TN7 B;  2DWK A;  1MMD A;  3NRX A;  3NRY A;  2JRK A;  3ZN1 B;  2C0S A;  3PDY A;  5EK2 A;  2VWA A;  2Y8D A;  2IW5 B;  2JMH A;  3GMI A;  3GWH A;  2CCQ A;  1ZV4 X;  5ETW A;  5IHY A;  3NBX X;  4O8S A;  3PU8 A;  1D1C A;  5KDM C;  2D0U A;  2V7M A;  1HFA A;  3E08 A;  2P9B A;  5TAO A;  1IJ5 A;  1LVK A;  2HPJ A;  3RPU A;  3LJC A;  2LEH A;  1UCU A;  2K48 A;  3AVR A;  1WYB A;  4KMC A;  4HGA A;  5DJQ C;  2C5K T;  5EZY E;  2N9D A;  4AXP A;  2KT9 A;  2KWI B;  4TX5 A;  5JDL A;  3AA7 B;  3MAC A;  4X1I E;  5JR9 A;  2Y6X A;  2PG8 A;  2EHO C;  2CM0 A;  3Q5W A;  5JDG A;  1MND A;  2WSS V;  2G0U A;  4JLE A;  5JR9 C;  2X51 A;  2YU2 A;  1H7C A;  4QKN A;  3LBX B;  4I43 B;  4AKR B;  1YKH B;  3CX8 B;  4AKG A;  5FP3 A;  3L3P A;  4P09 A;  1Y64 B;  4ZOL E;  4BJM A;  5DQW A;  4DBQ A;  2CXF A;  2NTY A;  3AAE B;  5ADX L;  3I1A A;  4H63 H;  5GON E;  3LK4 2;  2CEA A;  3N9Q A;  3ZEF B;  1MIW A;  4TV9 E;  2UXX B;  5FXZ A;  3SWH A;  3PUR A;  4U74 A;  4BJN A;  3GA8 A;  2KZ7 B;  4UVA B;  3UFE A;  2C5J A;  4IE5 A;  2GK9 A;  2LJL A;  4YLH A;  3MKD A;  5EK4 A;  2LSK A;  3MJX A;  2W63 A;  5L3B B;  3LK3 B;  4H9S E;  1OWA A;  1WR6 A;  4L5G A;  3N9P A;  3ONX A;  4EAH A;  2W62 A;  2CXD A;  2YU1 A;  2QGS A;  2DNX A;  2Z6E A;  1QSD A;  3U78 A;  3FBZ A;  2LHN A;  2NW7 A;  5FXX A;  3C4X A;  4GYS A;  4H9R C;  4AKI A;  2XAG B;  2J1D G;  1IAP A;  4TZ4 C;  4XAX B;  2JQQ A;  2XHE B;  3U3I A;  5FNV E;  2V7J A;  2BDE A;  1HF8 A;  2L9Q A;  2JPF A;  4G2A A;  1HG5 A;  2W61 A;  3RYC E;  1FMW A;  4IST A;  3ZYM A;  5KMG P;  4NUU A;  4OYJ A;  5L2L A;  3KV6 A;  3ETU A;  3DP7 A;  4UVC B;  5AFU L;  3ZPO A;  4UEL A;  3QUJ A;  2YK0 A;  2KXP B;  2V7K A;  5E0O A;  5LP6 E;  4UV8 B;  4AKH A;  4O4H E;  5L3E B;  4KUM B;  4CXX A;  1IJ6 A;  4PK6 A;  4H9P C;  5CA1 E;  5LBQ B;  2XQY A;  3RRC A;  1D1B A;  3C98 B;  4IE6 A;  4XBF B;  2L3L A;  3ZMZ B;  2Q9Q D;  3UT5 E;  2H7V C;  2X66 A;  2CA5 A;  3MZK B;  1US7 B;  3F31 A;  2SPC A;  2Q9Q A;  3K3O A;  5LOV E;  4UXN B;  3I0O A;  3BQL A;  4BAY B;  3P8C D;  3O1I A;  2N1G A;  2QA7 A;  3C64 A;  2LSG A;  3BK9 A;  1D1A A;  2XAQ B;  5JDN A;  3PU3 A;  2Q9Q C;  4DMW A;  3PUS A;  2OA5 A;  4DVD A;  4U72 A;  2A72 A;  3AA6 B;  3GN5 A;  2WM9 A;  4X1K E;  5JH7 E;  1WYC A;  4YHJ A;  3VHL A;  4C90 A;  2LM9 A;  5BMV E;  3RC3 A;  1X79 A;  2K5B B;  3N9L A;  2XAJ B;  4OHF A;  4PNI A;  3R84 B;  4ZI7 E;  4ZI2 D;  4P0A A;  4HKA A;  2VKO A;  4MHC A;  3KFW X;  5FY1 A;  4N78 D;  4B6X A;  3O1J A;  3F57 A;  5J1G A;  4O4L E;  2E9X A;  4BA9 A;  3PE0 A;  2PJQ A;  2XUE A;  3K8P C;  3RRW A;  1U4Q A;  2VAS A;  2W00 A;  3RYH E;  2KIN B;  3ANW B;  3OYX A;  1WLX A;  5H6R B;  4ZI2 C;  5KX5 E;  2E9X C;  4L0R A;  1SA0 E;  4GK5 E;  3OBV E;  2CLY B;  4J2C A;  5JDQ A;  3N9N A;  4AI6 A;  1MMG A;  4M1P A;  5LG4 A;  2L8K A;  2NOX A;  3CWZ B;  5LJM A;  1YW0 A;  4HE8 A;  2LSI A;  4OFZ A;  5F3J A;  1YKE B;  5HYA A;  2EHO D;  3W15 B;  1MIV A;  3N5L A;  4IGU A;  4CI1 B;  3UTK A;  3FXD B;  2EHO A;  4MLK A;  1O3X A;  3C51 A;  2A3D A;  3DJB A;  3BQK A;  2VKD A;  3C4W A;  4AKL A;  4MAL A;  2LE8 A;  2NTX A;  5FY0 A;  3IBP A;  3MK7 C;  3FBL A;  4QXH B;  3HKD E;  1NAF A;  2NP9 A;  2VK9 A;  3Q2M A;  1VOM A;  5M4Y A;  1S94 A;  4H9Q C;  2CXL A;  3HI2 A;  4QXB B;  3E22 E;  2CWO A;  4H63 V;  4CI2 B;  3WAK A;  2CE7 A;  4CI3 B;  3RH3 A;  5JRC B;  1E1H B;  3ZCJ A;  4ASK A;  4E7Z A;  3L09 A;  5EK3 A;  5FXW A;  1OXZ A;  2MYS A;  2Y48 B;  2MOZ A;  4WBN E;  4DO0 A;  2YEV C;  3QK6 A;  4GIW A;  2RP4 A;  4YJ3 E;  4AQF A;  2I59 A;  4IDZ A;  4UV9 B;  5JQG E;  3N9M A;  2V7I A;  1D0Y A;  2K9A A;  3EDV A;  4UF0 B;  4AQF C;  2MTQ A;  3WAJ A;  3MA9 A;  4TV8 E;  3SS1 A;  1WRD A;  3CKD A;  1BR1 A;  3RC8 A;  5F8P A;  2BVM A;  3O4X E;  3V5S A;  5LGN B;  2HPL A;  4EZH A;  3KV5 A;  3AVS A;  2DI4 A;  4OK0 A;  4EXT A;  1NWM X;  1MMN A;  2CWY A;  3KBU A;  1MMA A;  4WBO A;  2W0G A;  4PAG A;  2LOS A;  4ZI3 C;  4PK4 A;  2ZMA A;  5LBM A;  1HG2 A;  3ZMT B;  1QUU A;  1YD8 G;  3C4Z A;  3KV9 A;  4QHO A;  3N9O A;  5LCY A;  4E7S A;  2VKH A;  3I9Y A;  4CZZ B;  3LFM A;  4XZC A;  3LK2 B;  4FJO A;  3LG7 A;  1FEW A;  3AB3 B;  4FI5 A;  5J2T E;  4H9N C;  4O2A E;  3LBX A;  4EYU A;  4L9I A;  5FY7 A;  4JUY A;  5HXR A;  3CQG B;  1FMV A;  3CQX C;  3F2E A;  4C91 A;  1V9D A;  2KND A;  2X67 A;  1D0X A;  5HWX A;  4IE4 A;  5HXH A;  2XAS B;  2DCF A;  3ZMV B;  1UX4 A;  3N2G E;  3EUH A;  3UUN A;  4GYR A;  3N2K E;  1UX5 A;  4KBM B;  5CB4 E;  1AJ3 A;  3ESL A;  4I55 E;  3KBT A;  2ACX A;  3DTO A;  4DMV A;  3HA4 A;  4F6R C;  2X9Y A;  3D0T A;  3N2O A;  4QXC B;  4ISS A;  3OYZ A;  4A56 A;  4O2B E;  2ZM2 A;  5JR9 B;  5JRE A;  3HL6 A;  4CXY A;  4I50 E;  3PTR B;  3RX6 A;  5HWY A;  3HKC E;  3CQC B;  1HS7 A;  3FHN A;  1ZKE A;  2E9X D;  3JC6 D;  3UUX B;  2D2S A;  1FIO A;  4IE0 A;  1MNE A;  3H3A A;  2YIN A;  4ERR A;  5JVD E;  1SHZ C;  3EDU A;  3FB2 A;  1B7T A;  3NZQ A;  4I4T E;  4PJN A;  2V1D B;  3ZLI A;  4PJJ A;  3KV4 A;  4QWN B;  4PFP A;  4EYY R;  5C8Y E;  3EVY A;  4ANJ A;  3ZMU B;  3JC6 C;  2K24 A;  3ZC0 A;  4CXW A;  1S35 A;  2PFV A;  2NW8 A;  4UIG A;  3IEE A;  1G73 A;  3PUA A;  3IHR A;  3C50 A;  3SRZ A;  3H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...