2XHEB

Crystal structure of the unc18-syntaxin 1 complex from monosiga brevicollis
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
260
structure length
220
Chain Sequence
b'DRLSRLRQMAAENQPEPFMADFFNRVKRIRDNIEDIEQAIEQVAQLHTESLVAVSKEDRDRLNEKLQDTMARISALGNKIRADLKQIEKENKRAQQEGTFEDGTVSTDLRIRQSQHSSLSRKFVKVMTRYNDVQAENKRRYGENVARQCRVVEPSLSDDAIQKVIEHGNEIRDRHKDIQQLERSLLELHEMFTDMSTLVASQGEMIDRIEFSVEQSHNYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNC18
molecule tags Exocytosis
source organism Monosiga brevicollis
publication title Primordial Neurosecretory Apparatus Identified in the Choanoflagellate Monosiga Brevicollis.
pubmed doi rcsb
total genus 79
structure length 220
sequence length 260
ec nomenclature
pdb deposition date 2010-06-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00804 Syntaxin Syntaxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.70 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2xheB01
4JEHB 5LG4A 5M4YA 1G73A 1FIOA 1FEWA 1S94A 2DNXA 3LG7A 1HS7A 1BR0A 4TX5A 1EZ3A 4JEUB 2XHEB 3C98B
chains in the Genus database with same CATH superfamily
2WP9A 2E5LT 4YSXA 2NTYA 1XDPA 2RP4A 4HTEA 4V1Av 4JI8T 2XAGB 2B1EA 4HFBA 2JQKA 3N2KE 5HAXA 5LJMA 1T72A 5ABFB 2VKOA 2XQYA 2XQ8A 3P7IA 4G2AA 3RH3A 3LFMA 4HWHA 1IJ5A 3ANWA 5JR9A 1VOMA 4CI1B 2LKHA 3EDVA 2YEVC 1XNQT 3NZPA 2CRBA 5ABGA 2Z6EA 5JDLA 4DUZT 3C51A 1FJGT 4QX7B 5F3JA 3SFDA 5JRCA 3K8PC 2V5DA 3K3NA 4Z91A 4OYJA 2QA7A 5J0ZA 4PJLA 4X5TA 1N33T 1YKHB 1GQEA 3K3OA 5AQFB 4DR3T 4KHPT 4DV7T 2NWBA 2UU9T 1SA0E 1BR4A 2BKPA 2ZLYA 5LBQB 4EOZB 5L4EA 2XM2A 4YHJA 3AEEA 2BG9C 4QKNA 3JADA 1SHZC 4WBOA 3CX6B 3AEDA 3OJAA 2F4VT 2JIWA 3R84B 2XAJB 4OK0A 1ZKEA 1OEDC 2V26A 5LG4A 1OWAA 3ZYKA 2X0LB 3FBLA 3N9OA 1J5ET 3KINB 2ES0A 3AAIA 4X66T 2V7JA 4PNIA 3TLWA 3T1HT 4JUYA 3PU3A 5HCJA 3UU3A 2LSJA 2VWAA 3Q5DA 3S4UA 2E8IA 2WAUA 5L3GB 5DABA 5HXSA 4UVCB 4HWCA 1KNZA 2I0MA 1D1CA 4KMCA 2D0UA 4I55E 4JI2T 3BQLA 3UU8A 1EZ3A 5LGNB 4UF0B 2LJLA 2YU1A 4QWNB 5EK2A 1E7PA 3FZKB 3KV4A 3Q5WA 4WZXA 2H3RA 2V5CA 4IDPA 3AA6B 3N5LA 5FL0A 4UV8B 4ANJA 2L8KA 3LBXA 1MIYA 4DUYT 2W67A 2P9BA 2C0SA 5JH7E 2KINB 4JLEA 5ABHA 2IHR1 2AE9A 2OV9A 3CX8B 3TLUA 2XSBA 5JDMA 1ZV4X 1AJ3A 2X68A 2KWIB 2X9XA 3O1JA 4GK0E 4TWDA 3AAAB 1I94T 3I1AA 4AKHA 4G63A 2YK0A 1D1BA 4L5GA 3ANWB 5JR9B 5KX5E 2CPTA 3WAJA 2HH7A 3L09A 3FZHB 4B6XA 4DV6T 1OEDE 3A7MA 4EGWA 3IEEA 3O1IA 1LRZA 3EAMA 1HX1B 1U4QA 4KX6A 5AQMB 3HKBE 2VB6A 3LDQB 1MMAA 3PUAA 5HXCA 1YXRA 2SPCA 2BVLA 5JTGA 4EXTA 2PFVA 5FVLA 4MBQA 4PFOA 5HEJA 4O2BE 5DQWA 4IE7A 1KNPA 2WU5A 4IE6A 4LMJA 3EHZA 3ZT7A 4HGAA 2YOEA 4IE0A 1UGOA 2MBGA 2A72A 2CLYC 2NR4A 2VL0A 3EABA 4YLHA 5FXXA 4YXDA 4B3MT 3MJXA 5LJNA 4LF7T 5LHIB 2JQQA 4X65T 4B3ST 2E9XA 2DI4A 3CKDA 4ZHQE 4CQIA 3VU7H 2FJEA 5FP3A 4K0KT 2NP9A 4H9RC 4PK5A 5AQJB 2NTXA 2LM9A 4IDZA 3ZT5A 4AQGA 3KVBA 5CB4E 5KDMC 3AE6A 2RPAA 3EDUA 1WRDA 2LRLA 1WFDA 1ZOYA 3NRXA 3QOFA 1UK5A 3Q5XA 4O2AE 3H3MA 4QXHB 3JC6D 3VRBA 1XMOT 4IIJE 4NUUA 1N32T 2ACXA 2JQHA 3GWHA 4CXWA 4GOUA 5LP6E 3AE3A 4DMWA 4QHOA 5LHGB 2VQET 3T1YT 4U33A 4GKJT 4BJMA 4JI7T 5BMVE 2WDRA 5FMNA 4CXXA 2HHHT 3IBPA 4LF8T 5JQGE 2CBJA 5JREA 4DV5T 2QRXA 2K9AA 1WR6A 2YDQA 5ADXL 2LT3A 3I0QA 2L3LA 4KHZF 2XPKA 4COFA 3CQGB 4ZI2C 3FZLB 4JI4T 4XBFB 2YKSA 3C4XA 2UXXB 2Q9QB 2V6YB 3K1SA 4TWHA 4OX9T 1UX5A 2WY2A 3FB2A 3N9LA 2Q9QD 3PURA 4I0UA 5F5WA 1T7SA 5H6RB 2CLYB 4LMLA 3VHLA 2XAHB 2XZEA 3AA0B 3PV0F 3E0ZA 4YJ3E 4EZHA 4IL9A 4YSZA 1S35A 2WMNA 4O4IE 1HG2A 4AI6A 5TAOA 2CHNA 1CUNA 2CCQA 3CWZB 4LFAT 2K24A 3BQKA 3FBZA 4AISA 5IUXA 1XMQT 1J5WA 2YDSA 3QK6A 4GIWA 4Q25A 5HWYA 3TLVA 4CN4A 5JVDE 4DR1T 4H9OC 2DNXA 3AE4A 4UV9B 4BA9A 2B76A 2JQ9A 3GN5B 2EHOC 4TNWA 4DV1T 4ISTA 1MNEA 1YKEB 2CEAA 2X9WA 1IBLT 4PJNA 3G06A 2XQ3A 3EVYA 5J1GA 2W62A 4ZI3D 3OYZA 4DR6T 3K3QC 3H3AA 2WZHA 2BG9B 4F8HA 4Z8XA 3KBTA 4TZ4C 4PFPA 3UFGA 4WW0A 4NPPA 2E9XC 2VKDA 3P50A 3J9X1 5KXJA 4JI3T 1NWMX 2BG9E 3LK42 4DV2T 3ESLA 2A2FX 3FXDB 3ZMUB 2BDEA 2WZIA 2H7VC 4ILCA 4YTMA 3B13A 2XTLA 2HPLA 3AEFA 2XSAA 3QB5K 4IDNA 5L3CB 4AKLA 4AQFC 4DV0T 4JI5T 4X1KE 5FNVE 3NKZA 5IHYA 2G0UA 2C5JA 3UUXB 2BBJA 1WLXA 2LKGA 1UCUA 2XASB 3F31A 4IE5A 2E9XD 4KBMB 4OHFA 3AECA 4WYVA 5A1LA 4YJ2E 1J1JA 1M7KA 4CN6A 3F57A 2V1DB 3J7Yq 2Y8DA 5FYMA 3IA3A 4UVAB 4XAXB 1HFAA 3AE7A 3AEAA 4DO0A 5CGMA 2PBIA 1W9RA 2WQYA 3RIUC 4NIQA 1XNRT 2KWHA 4TWFA 4TUYE 1KK7A 2DCFA 1JNZA 2M67A 2XQ4A 4WBNE 4ZI7E 5LGUB 3ETUA 2EHOD 4LFCT 4ERRA 5L3EB 1Y64B 3LBXB 1VRBA 3E22E 3AA7B 2JRKA 3ZJ1A 2E2AA 1WYBA 3PUXF 3QNUA 4QX8B 1B7TA 2CXFA 4HFEA 4LMKA 4DIDB 1US7B 2XAQB 3PDYA 3KV6A 4IHJE 2K48A 4PAGA 1LVKA 5LCYA 2DWGA 2ODUA 4TV9E 2YINA 3RQWA 3AVSA 3RYHE 5AQIB 5ABEA 2LEHA 2X67A 3ZLIA 2LSIA 3PUQA 1FIOA 3SS1A 4QH4A 3ZMVB 5IWAT 3CX7B 5JDGA 5JDNA 3I9YA 3JAEA 4M1PA 4P0AA 4UVBB 3SRZA 5AFUL 1HCIA 3ONJA 4B3RT 1LKXA 4AKIA 4JI1T 4ISSA 3M3ZB 2UUAT 2BVMA 2IC6A 3HR0A 3UTKA 2N9DA 4UEMA 4DNDA 3RF1A 2IAKA 2KZ7B 2HPJA 2MOZA 5CFBA 2V6XA 3RYCE 5FY0A 4B3TT 1T98A 5JDFA 4DVDA 5FXWA 3RRCA 4NXNT 1WR0A 5LYJE 4AKRB 1YQ3A 3KDSE 4AQYT 3TKLB 4EZ4A 4U7IA 3UUBA 2UXCT 3KVAA 3LK3B 4ADZA 2W63A 2I6HA 1D0ZA 3P4WA 4ZS3A 5AQVB 3RIAA 4ASKA 2C5IT 3RQUA 4ZZCA 3FHNA 1MMDA 2HN1A 4ZOLE 2K3WA 2CE7A 3PUWF 2WWUA 3PUYF 4EV6A 3AEGA 3P4QA 4I50E 4AQFA 4ZXLA 2VVNA 2X9HA 2LHNA 3M65A 5FVKA 2FJDA 2XUEA 3MA9A 4JYAT 4BJNA 3ETVA 5BR8T 4MFRA 2DWKA 2XQ7A 3RRWA 4CN1A 4HEAA 5LMNT 1XWMA 3IHRA 3HKCE 1MNDA 2WCAA 4YTPA 3OYXA 3N9MA 4HWDA 4IT4A 2BS2A 2NOXA 2PTFA 2UXNB 3NZQA 5AQHB 2YDRA 2LOPA 4UELA 4DBRA 3C64A 3N9PA 3OPCA 3UUMA 2CBIA 4CI3B 4IDOA 5M4YA 5EK4A 1N34T 5CA0E 5LBMA 4JI6T 2XJ7A 2Q9QC 3KV9A 2HN2A 2KNDA 1OEDB 4HFDA 5HEUA 5L4HA 2XY8B 5LOVE 4A5XA 2ZMAA 5C8YE 3UQ7A 3TLSA 3PJAA 3CMLA 3O4XE 5AQRB 4DV3T 1SUMB 2KLQA 2W2UA 2BZBA 3KFWX 4U31A 3ZSTA 4ZI2D 3DJBA 3UU5A 5HXEA 5AQUB 3VKHA 4QXCB 4O8SA 5L3FB 4ZZBA 3H37A 4QXBB 3L3PA 2X51A 2IMLA 4H9SE 4TN7B 1IJ6A 2YU2A 5L47A 2WU2A 4ZI3C 1G73A 3ZMTB 5HCMA 5ETWA 4X64T 1M62A 3FZFB 3RX6A 4YSYA 4TNVA 1IAPA 5AQSB 1W0AA 3EUHA 5H6QB 4O4LE 2CM0A 4E7SA 3O9XA 2I59A 3R6NA 2VVSA 3CK6A 3KBUA 4YFSA 5CJ5A 4QH1A 4I43B 3HKDE 3RIFA 3ZN1B 1BR2A 2VKJA 3ZC1A 3T8OA 2LM2A 2R6GF 2X66A 2PJQA 3PUSA 3ABVA 4CI2B 2V7MA 2A3DA 3AVRA 5IYZE 1VCTA 2D5UA 4HFVA 4U3CA 4LF4T 3UT5E 2X9YA 4X62T 5AQPB 1MIVA 3HKEE 3V5UA 3WAKA 5LMUT 3AE5A 2CMRA 3AE8A 2EHOA 5LB7B 2LOSA 3ONLC 3RKOA 5JDQA 2J62A 4FJOA 1MMNA 1HX8A 3OBVE 3OKQA 4GYSA 1FEWA 4U72A 3RLFF 5C3JA 3AE9A 3HL6A 2ZM8A 3ZSSA 4P1NA 5L3BB 2EHOB 4H63V 4J2CA 1IBKT 2OLTA 3GMIA 2FJBA 2MPKA 2MTQA 2ACZA 4YY3T 1MMGA 1W0BA 1Y01A 3LJCA 4H9NC 4DR7T 1HNXT 4OYKA 2C5KT 1Z0PA 2D2SA 2WBLA 5EK3A 5FXVA 4HFIA 4JI0T 2WSSV 1BR0A 3I0OA 4EIWA 3ZT6A 2Q9QA 4DR2T 3AB3B 2UUBT 2V7IA 3I9WA 3C4ZA 2JJ9A 3CPZA 4L0RA 4BAYB 4JEUB 5EZYE 5FY1A 2UXBT 3DTOA 2LLYA 3L8RA 2H88A 2JMKA 1YQ4A 2H7OA 4LF6T 3MK7C 3U78A 3PU8A 1QSDA 4MHCA 2QGSA 2WS3A 3Q5EA 5AQOB 5FY7A 3AA1B 3OTOT 2CA5A 2BG9A 2VK9A 3LSVA 4HE8A 1D0XA 1D1AA 2IUBA 4PW8A 5FKYA 3TLTA 5J2TE 3GN5A 3MXZA 4LFBT 1O3XA 1YW0A 4YHHT 3VR8A 2AXDS 2IDOB 5JR9C 3L39A 1KEYA 1FMWA 2IC9A 3UU4A 2V8SV 3ZJ2A 4EEBA 2LE8A 2LSGA 5FXZA 1KFYA 2KT9A 3JCFA 4YT0A 4ZEYA 2FBWA 2PG8A 5L3DB 4PK6A 3QUJA 1WYCA 2CWYA 4EYUA 1ZHCA 1SE7A 5HXRA 5AQTB 2BKNA 2XQ5A 2K5BB 3ZYLA 2BS3A 3ZKRA 1U5PA 2NW7A 4X20E 4AKGA 2ZM2A 1ZEEA 3AE2A 1CHUA 5HXHA 1XDOA 2KMFA 1MIWA 2FUPA 2OA5A 2VASA 3NBXX 4I4TE 3ZMSB 4AIUA 4DV4T 4A97A 1WCRA 2JMHA 4U2YA 4UR9A 4ZS2A 3UUNA 3DP7A 2UUCT 1HNWT 2N1GA 2Y48B 3ZYMA 4IE4A 3AEBA 1T8BA 3CVRA 3OVUA 2W4XA 3B57A 4H9QC 4JEHB 4KUMB 1W09A 1LVFA 3AE1A 3E08A 4KI0F 4O4JE 3RYIE 2YN6A 3U3IA 4DBQA 4HWFA 1HF8A 3JC6C 5AQGB 4UF0A 2ZM6T 4IDQA 2ZM0A 4Z90A 1OEDA 4GYRA 3HA4A 3NWIA 2WB5A 2J1DG 2X0YA 1X9BA 1N36T 1VCSA 3RYFE 2VQFT 5DQVA 2X0HA 3PJAJ 3CIRA 3RI5A 4LF5T 4X1YE 2CWOA 2XAFB 3B5MA 4IGUA 3MKDA 5FL1A 5AQKB 4JV5T 4EB6E 4MLKA 2QVAA 2D0TA 1HR0T 2QYWA 4AXPA 2WWVA 5HEHA 2L9QA 3Q2MA 4HN9A 4NUVA 2WDVA 3O1HA 2A9UA 4QH5A 5F8PA 5GONE 4CZZB 5L2LA 4EEDA 3VKGA 2W0GA 5AQNB 4PJJA 3GA8A 2N2NA 2LSYA 2W61A 2VL8A 4KP3C 3RHWA 3ZCJA 2CXLA 2VKHA 3RIUA 3JAFA 5LG3A 2V7KA 5J2UE 3V5SA 3C4WA 1E2AA 4JBWF 3BQIA 3P4SA 1V9DA 4C91A 3ZC0A 1UURA 4HKAA 3QC9A 1DU2A 4WNKA 5HEOA 1NEKA 2CHOA 2XQAA 2M6IA 1NENA 4X1IE 3QB5A 1L0VA 1YD8G 3ZCIA 1I6ZA 4E7ZA 2XQ6A 2DHRA 2MAWA 4U7YA 4GKKT 3UULA 1HNZT 2IIUA 3FZMB 3N9QA 3RC3A 1UX4A 1X79A 5LGTB 2KXPB 1NAFA 2CXDA 3MZKB 3LG7A 1HS7A 3X1DA 1IZNB 2V7LA 5CA1E 1FMVA 5LHHB 1KF6A 3KV5A 4IL4A 2DLRA 3AXJA 3N2GE 3SWHA 1QUUA 3A8YC 3HI2A 2W66A 3CQXC 2FJAA 3P4PA 4XZCA 1OXZA 3PUZF 4P09A 3AAEB 3LK2B 3PE0A 2V6YA 3RGLA 5JRCB 2D9DA 1D0YA 3RPUA 5LXTE 5LNKA 3WI3A 3C50A 2Y6XA 4CXYA 4NXMT 2XQ9A 3UFEA 4DR4T 3PTRB 3PUVF 3C98B 1JNRA 2WM9A 1BR1A 3IF8B 5HWXA 1E1HB 2NW9A 4L9IA 4HFCA 2J47A 2JPFA 1H7CA 3FXEB 5ABFA 4UXNB 3RKGA 4PJMA 1ZP0A 1UUSA 1HTJF 1G8XA 3ZN0B 5AQQB 1KNRA 3F2EA 4UIGA 4EAHA 2IW5B 3ZEFB 4PK4A 1IBMT 2XHEB 3A5XA 1R8IA 4GK5E 4OFZA 4IREA 5C2TA 4LF9T 2DL1A 4H63H 4A56A 3RC8A 3MACA 2XM1A 4O4HE 5KMGP 3D0TA 3BK9A 2BS4A 5DJQC 4HWIB 3W15B 3NVOA 2VURA 2LHRA 3CQCB 4DR5T 2LRKA 2NW8A 5HEGA 4N78D 3SFEA 3Q9DA 4K0UA 5HYAA 2GK9A 4HFHA 4P0BA 4YTNA 2BBHA 3N2OA 3ZPOA 3VR9A 3NRYA 3EI0A 2UXDT 3SOLA 4MALA 2KSRA 3PUGA 2BKOA 3ONXA 4EYYR 4ILBA 3N9NA 4U74A 5LA6E 2J4GA 1Z8UA 3AXJB 2W00A 2E9XB 4FI5A 5AQLB 1HG5A 2E5VA 2WDQA 4TX5A 5E0OA 2WMOA 2RA1A 4TV8E 3VRAA 2MYSA 3P4RA 4C90A 4F6RC 4U2ZA 3UQ4A 2H89A 2LSKA 3UU6A 4H9PC 1QLBA 4ILAA 4ILUA 1XZYA 4A98A 3P8CD 1S94A 5JDHA 4DMVA 2M6BA 3ZMZB 2ODVA
chains in the Genus database with same CATH topology
2NTYA 4V1Av 2RP4A 4HTEA 2XAGB 2B1EA 3N2KE 5HAXA 5LJMA 2VKOA 2XQYA 4G2AA 3P7IA 3RH3A 4CI1B 3LFMA 1IJ5A 3ANWA 5JR9A 1VOMA 3EDVA 2YEVC 3NZPA 2Z6EA 5JDLA 3C51A 4QX7B 5F3JA 5JRCA 3K8PC 3K3NA 4OYJA 2QA7A 4PJLA 1YKHB 3K3OA 2NWBA 1SA0E 1BR4A 2ZLYA 5LBQB 4EOZB 4YHJA 4QKNA 4WBOA 1SHZC 3CX6B 3OJAA 3R84B 2XAJB 4OK0A 1ZKEA 2V26A 5LG4A 1OWAA 3ZYKA 2X0LB 3FBLA 3N9OA 3KINB 2ES0A 3AAIA 2V7JA 4PNIA 4JUYA 3PU3A 2LSJA 2VWAA 3S4UA 2E8IA 2WAUA 5L3GB 5DABA 5HXSA 4UVCB 1KNZA 1D1CA 4KMCA 2D0UA 4I55E 3BQLA 5LGNB 1EZ3A 4UF0B 2LJLA 2YU1A 4QWNB 5EK2A 3KV4A 3Q5WA 2H3RA 4ANJA 3AA6B 3N5LA 4UV8B 2L8KA 3LBXA 1MIYA 2P9BA 2C0SA 5JH7E 2KINB 4JLEA 3CX8B 5JDMA 1AJ3A 1ZV4X 2X68A 2KWIB 2X9XA 3O1JA 4GK0E 3AAAB 3I1AA 4AKHA 4G63A 2YK0A 1D1BA 4L5GA 3ANWB 5JR9B 5KX5E 3WAJA 2HH7A 3L09A 4B6XA 3IEEA 3O1IA 1LRZA 1U4QA 3HKBE 2VB6A 1MMAA 3PUAA 5HXCA 2SPCA 2BVLA 4EXTA 2PFVA 4MBQA 4PFOA 4O2BE 4IE7A 4IE6A 4HGAA 4IE0A 2MBGA 2A72A 2CLYC 4YLHA 5FXXA 3MJXA 5LJNA 5LHIB 2JQQA 2E9XA 2DI4A 3CKDA 4ZHQE 4CQIA 3VU7H 5FP3A 2NP9A 4H9RC 4PK5A 4AQGA 2NTXA 2LM9A 4IDZA 3KVBA 5CB4E 5KDMC 3EDUA 1WRDA 3NRXA 4O2AE 3Q5XA 4QXHB 3JC6D 4IIJE 4NUUA 2ACXA 4CXWA 3GWHA 5LP6E 4GOUA 4DMWA 4QHOA 5LHGB 4BJMA 5BMVE 5FMNA 4CXXA 3IBPA 5JREA 2K9AA 1WR6A 2LT3A 3I0QA 2L3LA 4ZI2C 3CQGB 4XBFB 3C4XA 2UXXB 2Q9QB 1UX5A 3FB2A 3PURA 3N9LA 2Q9QD 5JRCB 5H6RB 3VHLA 2CLYB 4EZHA 2XAHB 3AA0B 4YJ3E 3E0ZA 1S35A 2WMNA 4O4IE 1HG2A 4AI6A 5TAOA 1CUNA 2CCQA 3CWZB 2K24A 3BQKA 3FBZA 3QK6A 4GIWA 5HWYA 5JVDE 4H9OC 2DNXA 4UV9B 4BA9A 3GN5B 2EHOC 4ISTA 1MNEA 1YKEB 2CEAA 2X9WA 4PJNA 3EVYA 5J1GA 2W62A 4ZI3D 3OYZA 3K3QC 3H3AA 4Z8XA 3KBTA 4TZ4C 4PFPA 4WW0A 3J9X1 2E9XC 2VKDA 1NWMX 3LK42 3ESLA 2A2FX 3FXDB 3ZMUB 2BDEA 2H7VC 3B13A 2XTLA 2HPLA 5L3CB 4AKLA 4AQFC 4X1KE 5FNVE 5IHYA 2G0UA 2C5JA 3UUXB 5JQGE 1WLXA 3ZN1B 1UCUA 2XASB 3F31A 4IE5A 2E9XD 4KBMB 4OHFA 5A1LA 4YJ2E 3F57A 2V1DB 3J7Yq 2Y8DA 5FYMA 4DO0A 4UVAB 4XAXB 1HFAA 2PBIA 2KWHA 4TUYE 1KK7A 2DCFA 4WBNE 2M67A 4ZI7E 5LGUB 3ETUA 2EHOD 4ERRA 5L3EB 1Y64B 3LBXB 1VRBA 3E22E 3AA7B 2JRKA 3ZJ1A 1WYBA 4QX8B 1B7TA 2CXFA 1US7B 2XAQB 3PDYA 3KV6A 4IHJE 2K48A 4PAGA 1LVKA 5LCYA 2DWGA 2ODUA 4TV9E 2YINA 3AVSA 3RYHE 2LEHA 2X67A 3ZLIA 2LSIA 3PUQA 1FIOA 3SS1A 3ZMVB 3CX7B 5JDGA 5JDNA 3I9YA 4M1PA 4UVBB 3SRZA 5AFUL 1HCIA 1LKXA 4AKIA 4ISSA 2BVMA 2IC6A 3HR0A 3UTKA 2N9DA 4UEMA 4DNDA 2IAKA 2KZ7B 2HPJA 2MOZA 3RYCE 5FY0A 1T98A 5JDFA 4DVDA 5FXWA 3RRCA 5LYJE 4AKRB 3KDSE 3TKLB 4EZ4A 3KVAA 3LK3B 4ADZA 2W63A 1D0ZA 5ADXL 4ZS3A 4ASKA 2C5IT 3FHNA 1MMDA 4ZOLE 2CE7A 2WWUA 4AQFA 4I50E 2X9HA 2LHNA 3M65A 2XUEA 3MA9A 4BJNA 3ETVA 4MFRA 2DWKA 3RRWA 4HEAA 3IHRA 3HKCE 1MNDA 3OYXA 3N9MA 2NOXA 2UXNB 3NZQA 2LOPA 4UELA 4DBRA 3C64A 3N9PA 3UUMA 4CI3B 5M4YA 5EK4A 5CA0E 5LBMA 3RPUA 2Q9QC 3KV9A 2KNDA 5LOVE 5L3BB 5C8YE 2ZMAA 3CMLA 3O4XE 2KLQA 3KFWX 4ZI2D 2BZBA 3DJBA 5HXEA 3VKHA 4QXCB 4O8SA 5L3FB 3H37A 4QXBB 3L3PA 2X51A 4H9SE 4TN7B 1IJ6A 2YU2A 4ZI3C 1G73A 3ZMTB 5ETWA 3RX6A 1IAPA 3EUHA 5H6QB 4O4LE 2CM0A 4E7SA 3O9XA 2I59A 3R6NA 3KBUA 4YFSA 4I43B 3HKDE 1BR2A 2VKJA 3ZC1A 3T8OA 2X66A 2PJQA 3PUSA 4CI2B 2V7MA 2A3DA 3AVRA 5IYZE 2D5UA 4HFVA 3UT5E 2X9YA 1MIVA 3HKEE 3V5UA 3WAKA 2CMRA 5JDQA 2EHOA 2LOSA 3RKOA 4FJOA 1MMNA 1HX8A 3OBVE 3OKQA 4GYSA 1FEWA 4U72A 3HL6A 2ZM8A 2EHOB 4H63V 4J2CA 3GMIA 2MTQA 1MMGA 3LJCA 4H9NC 4OYKA 2C5KT 1Z0PA 2D2SA 2WBLA 5EK3A 5FXVA 1BR0A 2WSSV 3I0OA 4EIWA 2Q9QA 3AB3B 2V7IA 3I9WA 3C4ZA 2JJ9A 3CPZA 4L0RA 4BAYB 4JEUB 5EZYE 5FY1A 3DTOA 2JMKA 2H7OA 3MK7C 3U78A 3PU8A 1QSDA 4MHCA 2QGSA 5FY7A 3AA1B 2CA5A 2VK9A 4HE8A 5J2TE 1D0XA 1D1AA 4PW8A 3GN5A 3MXZA 1O3XA 1YW0A 5JR9C 3ZJ2A 1FMWA 2IC9A 2LE8A 2LSGA 5FXZA 2KT9A 2PG8A 5L3DB 4PK6A 3QUJA 1WYCA 2CWYA 4EYUA 1ZHCA 5HXRA 3ZYLA 2K5BB 1U5PA 2NW7A 4X20E 4AKGA 2ZM2A 1ZEEA 5HXHA 2KMFA 1MIWA 2OA5A 2VASA 3NBXX 4I4TE 3ZMSB 2JMHA 3UUNA 4ZS2A 3DP7A 2N1GA 2Y48B 3ZYMA 4IE4A 3CVRA 4KUMB 3B57A 4H9QC 4JEHB 4O4JE 5DQWA 3RYIE 1LVFA 3E08A 4DBQA 3U3IA 1HF8A 3JC6C 4UF0A 2ZM0A 4GYRA 3HA4A 2J1DG 3RYFE 5DQVA 4X1YE 2CWOA 2XAFB 4IGUA 3MKDA 4EB6E 4MLKA 2D0TA 4AXPA 2L9QA 3Q2MA 4HN9A 4NUVA 3O1HA 5F8PA 5GONE 4CZZB 5L2LA 3VKGA 2W0GA 4PJJA 3GA8A 2N2NA 2LSYA 2W61A 2VL8A 4KP3C 3ZCJA 4P0AA 2CXLA 2VKHA 2V7KA 5J2UE 3V5SA 3C4WA 3BQIA 4C91A 1V9DA 3ZC0A 4HKAA 3QC9A 4WNKA 4X1IE 1YD8G 3ZCIA 4E7ZA 2DHRA 3UULA 3N9QA 3RC3A 1UX4A 1X79A 5LGTB 2KXPB 1NAFA 2CXDA 3MZKB 3LG7A 1HS7A 1IZNB 2V7LA 5CA1E 1FMVA 5LHHB 3KV5A 2DLRA 3N2GE 3SWHA 1QUUA 3HI2A 3CQXC 4XZCA 1OXZA 4P09A 3AAEB 3LK2B 3PE0A 1D0YA 5LXTE 5LNKA 3WI3A 3C50A 2Y6XA 4CXYA 3UFEA 3PTRB 3C98B 2WM9A 1BR1A 3IF8B 5HWXA 1E1HB 2NW9A 4L9IA 2JPFA 1H7CA 3FXEB 4UXNB 4PJMA 1HTJF 1G8XA 3ZN0B 3F2EA 4UIGA 4EAHA 2IW5B 3ZEFB 4PK4A 2XHEB 3A5XA 4GK5E 4OFZA 4H63H 4A56A 3RC8A 3MACA 4O4HE 5KMGP 3D0TA 3BK9A 5DJQC 3W15B 2LHRA 3CQCB 2NW8A 4N78D 3Q9DA 4K0UA 5HYAA 2GK9A 4P0BA 3N2OA 3ZPOA 3NRYA 3SOLA 4MALA 3PUGA 4EYYR 3ONXA 3N9NA 4U74A 5LA6E 2W00A 2E9XB 4FI5A 1HG5A 5E0OA 4TX5A 4C90A 2WMOA 2RA1A 4TV8E 4F6RC 2MYSA 2LSKA 4H9PC 4ILUA 3P8CD 1S94A 5JDHA 4DMVA 3ZMZB 2ODVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JEH B;  5LG4 A;  5M4Y A;  1G73 A;  1FIO A;  1FEW A;  1S94 A;  2DNX A;  3LG7 A;  1HS7 A;  1BR0 A;  4TX5 A;  1EZ3 A;  4JEU B;  2XHE B;  3C98 B; 
#chains in the Genus database with same CATH topology
 2WP9 A;  2E5L T;  4YSX A;  2NTY A;  1XDP A;  2RP4 A;  4HTE A;  4V1A v;  4JI8 T;  2XAG B;  2B1E A;  4HFB A;  2JQK A;  3N2K E;  5HAX A;  5LJM A;  1T72 A;  5ABF B;  2VKO A;  2XQY A;  2XQ8 A;  3P7I A;  4G2A A;  3RH3 A;  3LFM A;  4HWH A;  1IJ5 A;  3ANW A;  5JR9 A;  1VOM A;  4CI1 B;  2LKH A;  3EDV A;  2YEV C;  1XNQ T;  3NZP A;  2CRB A;  5ABG A;  2Z6E A;  5JDL A;  4DUZ T;  3C51 A;  1FJG T;  4QX7 B;  5F3J A;  3SFD A;  5JRC A;  3K8P C;  2V5D A;  3K3N A;  4Z91 A;  4OYJ A;  2QA7 A;  5J0Z A;  4PJL A;  4X5T A;  1N33 T;  1YKH B;  1GQE A;  3K3O A;  5AQF B;  4DR3 T;  4KHP T;  4DV7 T;  2NWB A;  2UU9 T;  1SA0 E;  1BR4 A;  2BKP A;  2ZLY A;  5LBQ B;  4EOZ B;  5L4E A;  2XM2 A;  4YHJ A;  3AEE A;  2BG9 C;  4QKN A;  3JAD A;  1SHZ C;  4WBO A;  3CX6 B;  3AED A;  3OJA A;  2F4V T;  2JIW A;  3R84 B;  2XAJ B;  4OK0 A;  1ZKE A;  1OED C;  2V26 A;  5LG4 A;  1OWA A;  3ZYK A;  2X0L B;  3FBL A;  3N9O A;  1J5E T;  3KIN B;  2ES0 A;  3AAI A;  4X66 T;  2V7J A;  4PNI A;  3TLW A;  3T1H T;  4JUY A;  3PU3 A;  5HCJ A;  3UU3 A;  2LSJ A;  2VWA A;  3Q5D A;  3S4U A;  2E8I A;  2WAU A;  5L3G B;  5DAB A;  5HXS A;  4UVC B;  4HWC A;  1KNZ A;  2I0M A;  1D1C A;  4KMC A;  2D0U A;  4I55 E;  4JI2 T;  3BQL A;  3UU8 A;  1EZ3 A;  5LGN B;  4UF0 B;  2LJL A;  2YU1 A;  4QWN B;  5EK2 A;  1E7P A;  3FZK B;  3KV4 A;  3Q5W A;  4WZX A;  2H3R A;  2V5C A;  4IDP A;  3AA6 B;  3N5L A;  5FL0 A;  4UV8 B;  4ANJ A;  2L8K A;  3LBX A;  1MIY A;  4DUY T;  2W67 A;  2P9B A;  2C0S A;  5JH7 E;  2KIN B;  4JLE A;  5ABH A;  2IHR 1;  2AE9 A;  2OV9 A;  3CX8 B;  3TLU A;  2XSB A;  5JDM A;  1ZV4 X;  1AJ3 A;  2X68 A;  2KWI B;  2X9X A;  3O1J A;  4GK0 E;  4TWD A;  3AAA B;  1I94 T;  3I1A A;  4AKH A;  4G63 A;  2YK0 A;  1D1B A;  4L5G A;  3ANW B;  5JR9 B;  5KX5 E;  2CPT A;  3WAJ A;  2HH7 A;  3L09 A;  3FZH B;  4B6X A;  4DV6 T;  1OED E;  3A7M A;  4EGW A;  3IEE A;  3O1I A;  1LRZ A;  3EAM A;  1HX1 B;  1U4Q A;  4KX6 A;  5AQM B;  3HKB E;  2VB6 A;  3LDQ B;  1MMA A;  3PUA A;  5HXC A;  1YXR A;  2SPC A;  2BVL A;  5JTG A;  4EXT A;  2PFV A;  5FVL A;  4MBQ A;  4PFO A;  5HEJ A;  4O2B E;  5DQW A;  4IE7 A;  1KNP A;  2WU5 A;  4IE6 A;  4LMJ A;  3EHZ A;  3ZT7 A;  4HGA A;  2YOE A;  4IE0 A;  1UGO A;  2MBG A;  2A72 A;  2CLY C;  2NR4 A;  2VL0 A;  3EAB A;  4YLH A;  5FXX A;  4YXD A;  4B3M T;  3MJX A;  5LJN A;  4LF7 T;  5LHI B;  2JQQ A;  4X65 T;  4B3S T;  2E9X A;  2DI4 A;  3CKD A;  4ZHQ E;  4CQI A;  3VU7 H;  2FJE A;  5FP3 A;  4K0K T;  2NP9 A;  4H9R C;  4PK5 A;  5AQJ B;  2NTX A;  2LM9 A;  4IDZ A;  3ZT5 A;  4AQG A;  3KVB A;  5CB4 E;  5KDM C;  3AE6 A;  2RPA A;  3EDU A;  1WRD A;  2LRL A;  1WFD A;  1ZOY A;  3NRX A;  3QOF A;  1UK5 A;  3Q5X A;  4O2A E;  3H3M A;  4QXH B;  3JC6 D;  3VRB A;  1XMO T;  4IIJ E;  4NUU A;  1N32 T;  2ACX A;  2JQH A;  3GWH A;  4CXW A;  4GOU A;  5LP6 E;  3AE3 A;  4DMW A;  4QHO A;  5LHG B;  2VQE T;  3T1Y T;  4U33 A;  4GKJ T;  4BJM A;  4JI7 T;  5BMV E;  2WDR A;  5FMN A;  4CXX A;  2HHH T;  3IBP A;  4LF8 T;  5JQG E;  2CBJ A;  5JRE A;  4DV5 T;  2QRX A;  2K9A A;  1WR6 A;  2YDQ A;  5ADX L;  2LT3 A;  3I0Q A;  2L3L A;  4KHZ F;  2XPK A;  4COF A;  3CQG B;  4ZI2 C;  3FZL B;  4JI4 T;  4XBF B;  2YKS A;  3C4X A;  2UXX B;  2Q9Q B;  2V6Y B;  3K1S A;  4TWH A;  4OX9 T;  1UX5 A;  2WY2 A;  3FB2 A;  3N9L A;  2Q9Q D;  3PUR A;  4I0U A;  5F5W A;  1T7S A;  5H6R B;  2CLY B;  4LML A;  3VHL A;  2XAH B;  2XZE A;  3AA0 B;  3PV0 F;  3E0Z A;  4YJ3 E;  4EZH A;  4IL9 A;  4YSZ A;  1S35 A;  2WMN A;  4O4I E;  1HG2 A;  4AI6 A;  5TAO A;  2CHN A;  1CUN A;  2CCQ A;  3CWZ B;  4LFA T;  2K24 A;  3BQK A;  3FBZ A;  4AIS A;  5IUX A;  1XMQ T;  1J5W A;  2YDS A;  3QK6 A;  4GIW A;  4Q25 A;  5HWY A;  3TLV A;  4CN4 A;  5JVD E;  4DR1 T;  4H9O C;  2DNX A;  3AE4 A;  4UV9 B;  4BA9 A;  2B76 A;  2JQ9 A;  3GN5 B;  2EHO C;  4TNW A;  4DV1 T;  4IST A;  1MNE A;  1YKE B;  2CEA A;  2X9W A;  1IBL T;  4PJN A;  3G06 A;  2XQ3 A;  3EVY A;  5J1G A;  2W62 A;  4ZI3 D;  3OYZ A;  4DR6 T;  3K3Q C;  3H3A A;  2WZH A;  2BG9 B;  4F8H A;  4Z8X A;  3KBT A;  4TZ4 C;  4PFP A;  3UFG A;  4WW0 A;  4NPP A;  2E9X C;  2VKD A;  3P50 A;  3J9X 1;  5KXJ A;  4JI3 T;  1NWM X;  2BG9 E;  3LK4 2;  4DV2 T;  3ESL A;  2A2F X;  3FXD B;  3ZMU B;  2BDE A;  2WZI A;  2H7V C;  4ILC A;  4YTM A;  3B13 A;  2XTL A;  2HPL A;  3AEF A;  2XSA A;  3QB5 K;  4IDN A;  5L3C B;  4AKL A;  4AQF C;  4DV0 T;  4JI5 T;  4X1K E;  5FNV E;  3NKZ A;  5IHY A;  2G0U A;  2C5J A;  3UUX B;  2BBJ A;  1WLX A;  2LKG A;  1UCU A;  2XAS B;  3F31 A;  4IE5 A;  2E9X D;  4KBM B;  4OHF A;  3AEC A;  4WYV A;  5A1L A;  4YJ2 E;  1J1J A;  1M7K A;  4CN6 A;  3F57 A;  2V1D B;  3J7Y q;  2Y8D A;  5FYM A;  3IA3 A;  4UVA B;  4XAX B;  1HFA A;  3AE7 A;  3AEA A;  4DO0 A;  5CGM A;  2PBI A;  1W9R A;  2WQY A;  3RIU C;  4NIQ A;  1XNR T;  2KWH A;  4TWF A;  4TUY E;  1KK7 A;  2DCF A;  1JNZ A;  2M67 A;  2XQ4 A;  4WBN E;  4ZI7 E;  5LGU B;  3ETU A;  2EHO D;  4LFC T;  4ERR A;  5L3E B;  1Y64 B;  3LBX B;  1VRB A;  3E22 E;  3AA7 B;  2JRK A;  3ZJ1 A;  2E2A A;  1WYB A;  3PUX F;  3QNU A;  4QX8 B;  1B7T A;  2CXF A;  4HFE A;  4LMK A;  4DID B;  1US7 B;  2XAQ B;  3PDY A;  3KV6 A;  4IHJ E;  2K48 A;  4PAG A;  1LVK A;  5LCY A;  2DWG A;  2ODU A;  4TV9 E;  2YIN A;  3RQW A;  3AVS A;  3RYH E;  5AQI B;  5ABE A;  2LEH A;  2X67 A;  3ZLI A;  2LSI A;  3PUQ A;  1FIO A;  3SS1 A;  4QH4 A;  3ZMV B;  5IWA T;  3CX7 B;  5JDG A;  5JDN A;  3I9Y A;  3JAE A;  4M1P A;  4P0A A;  4UVB B;  3SRZ A;  5AFU L;  1HCI A;  3ONJ A;  4B3R T;  1LKX A;  4AKI A;  4JI1 T;  4ISS A;  3M3Z B;  2UUA T;  2BVM A;  2IC6 A;  3HR0 A;  3UTK A;  2N9D A;  4UEM A;  4DND A;  3RF1 A;  2IAK A;  2KZ7 B;  2HPJ A;  2MOZ A;  5CFB A;  2V6X A;  3RYC E;  5FY0 A;  4B3T T;  1T98 A;  5JDF A;  4DVD A;  5FXW A;  3RRC A;  4NXN T;  1WR0 A;  5LYJ E;  4AKR B;  1YQ3 A;  3KDS E;  4AQY T;  3TKL B;  4EZ4 A;  4U7I A;  3UUB A;  2UXC T;  3KVA A;  3LK3 B;  4ADZ A;  2W63 A;  2I6H A;  1D0Z A;  3P4W A;  4ZS3 A;  5AQV B;  3RIA A;  4ASK A;  2C5I T;  3RQU A;  4ZZC A;  3FHN A;  1MMD A;  2HN1 A;  4ZOL E;  2K3W A;  2CE7 A;  3PUW F;  2WWU A;  3PUY F;  4EV6 A;  3AEG A;  3P4Q A;  4I50 E;  4AQF A;  4ZXL A;  2VVN A;  2X9H A;  2LHN A;  3M65 A;  5FVK A;  2FJD A;  2XUE A;  3MA9 A;  4JYA T;  4BJN A;  3ETV A;  5BR8 T;  4MFR A;  2DWK A;  2XQ7 A;  3RRW A;  4CN1 A;  4HEA A;  5LMN T;  1XWM A;  3IHR A;  3HKC E;  1MND A;  2WCA A;  4YTP A;  3OYX A;  3N9M A;  4HWD A;  4IT4 A;  2BS2 A;  2NOX A;  2PTF A;  2UXN B;  3NZQ A;  5AQH B;  2YDR A;  2LOP A;  4UEL A;  4DBR A;  3C64 A;  3N9P A;  3OPC A;  3UUM A;  2CBI A;  4CI3 B;  4IDO A;  5M4Y A;  5EK4 A;  1N34 T;  5CA0 E;  5LBM A;  4JI6 T;  2XJ7 A;  2Q9Q C;  3KV9 A;  2HN2 A;  2KND A;  1OED B;  4HFD A;  5HEU A;  5L4H A;  2XY8 B;  5LOV E;  4A5X A;  2ZMA A;  5C8Y E;  3UQ7 A;  3TLS A;  3PJA A;  3CML A;  3O4X E;  5AQR B;  4DV3 T;  1SUM B;  2KLQ A;  2W2U A;  2BZB A;  3KFW X;  4U31 A;  3ZST A;  4ZI2 D;  3DJB A;  3UU5 A;  5HXE A;  5AQU B;  3VKH A;  4QXC B;  4O8S A;  5L3F B;  4ZZB A;  3H37 A;  4QXB B;  3L3P A;  2X51 A;  2IML A;  4H9S E;  4TN7 B;  1IJ6 A;  2YU2 A;  5L47 A;  2WU2 A;  4ZI3 C;  1G73 A;  3ZMT B;  5HCM A;  5ETW A;  4X64 T;  1M62 A;  3FZF B;  3RX6 A;  4YSY A;  4TNV A;  1IAP A;  5AQS B;  1W0A A;  3EUH A;  5H6Q B;  4O4L E;  2CM0 A;  4E7S A;  3O9X A;  2I59 A;  3R6N A;  2VVS A;  3CK6 A;  3KBU A;  4YFS A;  5CJ5 A;  4QH1 A;  4I43 B;  3HKD E;  3RIF A;  3ZN1 B;  1BR2 A;  2VKJ A;  3ZC1 A;  3T8O A;  2LM2 A;  2R6G F;  2X66 A;  2PJQ A;  3PUS A;  3ABV A;  4CI2 B;  2V7M A;  2A3D A;  3AVR A;  5IYZ E;  1VCT A;  2D5U A;  4HFV A;  4U3C A;  4LF4 T;  3UT5 E;  2X9Y A;  4X62 T;  5AQP B;  1MIV A;  3HKE E;  3V5U A;  3WAK A;  5LMU T;  3AE5 A;  2CMR A;  3AE8 A;  2EHO A;  5LB7 B;  2LOS A;  3ONL C;  3RKO A;  5JDQ A;  2J62 A;  4FJO A;  1MMN A;  1HX8 A;  3OBV E;  3OKQ A;  4GYS A;  1FEW A;  4U72 A;  3RLF F;  5C3J A;  3AE9 A;  3HL6 A;  2ZM8 A;  3ZSS A;  4P1N A;  5L3B B;  2EHO B;  4H63 V;  4J2C A;  1IBK T;  2OLT A;  3GMI A;  2FJB A;  2MPK A;  2MTQ A;  2ACZ A;  4YY3 T;  1MMG A;  1W0B A;  1Y01 A;  3LJC A;  4H9N C;  4DR7 T;  1HNX T;  4OYK A;  2C5K T;  1Z0P A;  2D2S A;  2WBL A;  5EK3 A;  5FXV A;  4HFI A;  4JI0 T;  2WSS V;  1BR0 A;  3I0O A;  4EIW A;  3ZT6 A;  2Q9Q A;  4DR2 T;  3AB3 B;  2UUB T;  2V7I A;  3I9W A;  3C4Z A;  2JJ9 A;  3CPZ A;  4L0R A;  4BAY B;  4JEU B;  5EZY E;  5FY1 A;  2UXB T;  3DTO A;  2LLY A;  3L8R A;  2H88 A;  2JMK A;  1YQ4 A;  2H7O A;  4LF6 T;  3MK7 C;  3U78 A;  3PU8 A;  1QSD A;  4MHC A;  2QGS A;  2WS3 A;  3Q5E A;  5AQO B;  5FY7 A;  3AA1 B;  3OTO T;  2CA5 A;  2BG9 A;  2VK9 A;  3LSV A;  4HE8 A;  1D0X A;  1D1A A;  2IUB A;  4PW8 A;  5FKY A;  3TLT A;  5J2T E;  3GN5 A;  3MXZ A;  4LFB T;  1O3X A;  1YW0 A;  4YHH T;  3VR8 A;  2AXD S;  2IDO B;  5JR9 C;  3L39 A;  1KEY A;  1FMW A;  2IC9 A;  3UU4 A;  2V8S V;  3ZJ2 A;  4EEB A;  2LE8 A;  2LSG A;  5FXZ A;  1KFY A;  2KT9 A;  3JCF A;  4YT0 A;  4ZEY A;  2FBW A;  2PG8 A;  5L3D B;  4PK6 A;  3QUJ A;  1WYC A;  2CWY A;  4EYU A;  1ZHC A;  1SE7 A;  5HXR A;  5AQT B;  2BKN A;  2XQ5 A;  2K5B B;  3ZYL A;  2BS3 A;  3ZKR A;  1U5P A;  2NW7 A;  4X20 E;  4AKG A;  2ZM2 A;  1ZEE A;  3AE2 A;  1CHU A;  5HXH A;  1XDO A;  2KMF A;  1MIW A;  2FUP A;  2OA5 A;  2VAS A;  3NBX X;  4I4T E;  3ZMS B;  4AIU A;  4DV4 T;  4A97 A;  1WCR A;  2JMH A;  4U2Y A;  4UR9 A;  4ZS2 A;  3UUN A;  3DP7 A;  2UUC T;  1HNW T;  2N1G A;  2Y48 B;  3ZYM A;  4IE4 A;  3AEB A;  1T8B A;  3CVR A;  3OVU A;  2W4X A;  3B57 A;  4H9Q C;  4JEH B;  4KUM B;  1W09 A;  1LVF A;  3AE1 A;  3E08 A;  4KI0 F;  4O4J E;  3RYI E;  2YN6 A;  3U3I A;  4DBQ A;  4HWF A;  1HF8 A;  3JC6 C;  5AQG B;  4UF0 A;  2ZM6 T;  4IDQ A;  2ZM0 A;  4Z90 A;  1OED A;  4GYR A;  3HA4 A;  3NWI A;  2WB5 A;  2J1D G;  2X0Y A;  1X9B A;  1N36 T;  1VCS A;  3RYF E;  2VQF T;  5DQV A;  2X0H A;  3PJA J;  3CIR A;  3RI5 A;  4LF5 T;  4X1Y E;  2CWO A;  2XAF B;  3B5M A;  4IGU A;  3MKD A;  5FL1 A;  5AQK B;  4JV5 T;  4EB6 E;  4MLK A;  2QVA A;  2D0T A;  1HR0 T;  2QYW A;  4AXP A;  2WWV A;  5HEH A;  2L9Q A;  3Q2M A;  4HN9 A;  4NUV A;  2WDV A;  3O1H A;  2A9U A;  4QH5 A;  5F8P A;  5GON E;  4CZZ B;  5L2L A;  4EED A;  3VKG A;  2W0G A;  5AQN B;  4PJJ A;  3GA8 A;  2N2N A;  2LSY A;  2W61 A;  2VL8 A;  4KP3 C;  3RHW A;  3ZCJ A;  2CXL A;  2VKH A;  3RIU A;  3JAF A;  5LG3 A;  2V7K A;  5J2U E;  3V5S A;  3C4W A;  1E2A A;  4JBW F;  3BQI A;  3P4S A;  1V9D A;  4C91 A;  3ZC0 A;  1UUR A;  4HKA A;  3QC9 A;  1DU2 A;  4WNK A;  5HEO A;  1NEK A;  2CHO A;  2XQA A;  2M6I A;  1NEN A;  4X1I E;  3QB5 A;  1L0V A;  1YD8 G;  3ZCI A;  1I6Z A;  4E7Z A;  2XQ6 A;  2DHR A;  2MAW A;  4U7Y A;  4GKK T;  3UUL A;  1HNZ T;  2IIU A;  3FZM B;  3N9Q A;  3RC3 A;  1UX4 A;  1X79 A;  5LGT B;  2KXP B;  1NAF A;  2CXD A;  3MZK B;  3LG7 A;  1HS7 A;  3X1D A;  1IZN B;  2V7L A;  5CA1 E;  1FMV A;  5LHH B;  1KF6 A;  3KV5 A;  4IL4 A;  2DLR A;  3AXJ A;  3N2G E;  3SWH A;  1QUU A;  3A8Y C;  3HI2 A;  2W66 A;  3CQX C;  2FJA A;  3P4P A;  4XZC A;  1OXZ A;  3PUZ F;  4P09 A;  3AAE B;  3LK2 B;  3PE0 A;  2V6Y A;  3RGL A;  5JRC B;  2D9D A;  1D0Y A;  3RPU A;  5LXT E;  5LNK A;  3WI3 A;  3C50 A;  2Y6X A;  4CXY A;  4NXM T;  2XQ9 A;  3UFE A;  4DR4 T;  3PTR B;  3PUV F;  3C98 B;  1JNR A;  2WM9 A;  1BR1 A;  3IF8 B;  5HWX A;  1E1H B;  2NW9 A;  4L9I A;  4HFC A;  2J47 A;  2JPF A;  1H7C A;  3FXE B;  5ABF A;  4UXN B;  3RKG A;  4PJM A;  1ZP0 A;  1UUS A;  1HTJ F;  1G8X A;  3ZN0 B;  5AQQ B;  1KNR A;  3F2E A;  4UIG A;  4EAH A;  2IW5 B;  3ZEF B;  4PK4 A;  1IBM T;  2XHE B;  3A5X A;  1R8I A;  4GK5 E;  4OFZ A;  4IRE A;  5C2T A;  4LF9 T;  2DL1 A;  4H63 H;  4A56 A;  3RC8 A;  3MAC A;  2XM1 A;  4O4H E;  5KMG P;  3D0T A;  3BK9 A;  2BS4 A;  5DJQ C;  4HWI B;  3W15 B;  3NVO A;  2VUR A;  2LHR A;  3CQC B;  4DR5 T;  2LRK A;  2NW8 A;  5HEG A;  4N78 D;  3SFE A;  3Q9D A;  4K0U A;  5HYA A;  2GK9 A;  4HFH A;  4P0B A;  4YTN A;  2BBH A;  3N2O A;  3ZPO A;  3VR9 A;  3NRY A;  3EI0 A;  2UXD T;  3SOL A;  4MAL A;  2KSR A;  3PUG A;  2BKO A;  3ONX A;  4EYY R;  4ILB A;  3N9N A;  4U74 A;  5LA6 E;  2J4G A;  1Z8U A;  3AXJ B;  2W00 A;  2E9X B;  4FI5 A;  5AQL B;  1HG5 A;  2E5V A;  2WDQ A;  4TX5 A;  5E0O A;  2WMO A;  2RA1 A;  4TV8 E;  3VRA A;  2MYS A;  3P4R A;  4C90 A;  4F6R C;  4U2Z A;  3UQ4 A;  2H89 A;  2LSK A;  3UU6 A;  4H9P C;  1QLB A;  4ILA A;  4ILU A;  1XZY A;  4A98 A;  3P8C D;  1S94 A;  5JDH A;  4DMV A;  2M6B A;  3ZMZ B;  2ODV A; 
#chains in the Genus database with same CATH homology
 2NTY A;  4V1A v;  2RP4 A;  4HTE A;  2XAG B;  2B1E A;  3N2K E;  5HAX A;  5LJM A;  2VKO A;  2XQY A;  4G2A A;  3P7I A;  3RH3 A;  4CI1 B;  3LFM A;  1IJ5 A;  3ANW A;  5JR9 A;  1VOM A;  3EDV A;  2YEV C;  3NZP A;  2Z6E A;  5JDL A;  3C51 A;  4QX7 B;  5F3J A;  5JRC A;  3K8P C;  3K3N A;  4OYJ A;  2QA7 A;  4PJL A;  1YKH B;  3K3O A;  2NWB A;  1SA0 E;  1BR4 A;  2ZLY A;  5LBQ B;  4EOZ B;  4YHJ A;  4QKN A;  4WBO A;  1SHZ C;  3CX6 B;  3OJA A;  3R84 B;  2XAJ B;  4OK0 A;  1ZKE A;  2V26 A;  5LG4 A;  1OWA A;  3ZYK A;  2X0L B;  3FBL A;  3N9O A;  3KIN B;  2ES0 A;  3AAI A;  2V7J A;  4PNI A;  4JUY A;  3PU3 A;  2LSJ A;  2VWA A;  3S4U A;  2E8I A;  2WAU A;  5L3G B;  5DAB A;  5HXS A;  4UVC B;  1KNZ A;  1D1C A;  4KMC A;  2D0U A;  4I55 E;  3BQL A;  5LGN B;  1EZ3 A;  4UF0 B;  2LJL A;  2YU1 A;  4QWN B;  5EK2 A;  3KV4 A;  3Q5W A;  2H3R A;  4ANJ A;  3AA6 B;  3N5L A;  4UV8 B;  2L8K A;  3LBX A;  1MIY A;  2P9B A;  2C0S A;  5JH7 E;  2KIN B;  4JLE A;  3CX8 B;  5JDM A;  1AJ3 A;  1ZV4 X;  2X68 A;  2KWI B;  2X9X A;  3O1J A;  4GK0 E;  3AAA B;  3I1A A;  4AKH A;  4G63 A;  2YK0 A;  1D1B A;  4L5G A;  3ANW B;  5JR9 B;  5KX5 E;  3WAJ A;  2HH7 A;  3L09 A;  4B6X A;  3IEE A;  3O1I A;  1LRZ A;  1U4Q A;  3HKB E;  2VB6 A;  1MMA A;  3PUA A;  5HXC A;  2SPC A;  2BVL A;  4EXT A;  2PFV A;  4MBQ A;  4PFO A;  4O2B E;  4IE7 A;  4IE6 A;  4HGA A;  4IE0 A;  2MBG A;  2A72 A;  2CLY C;  4YLH A;  5FXX A;  3MJX A;  5LJN A;  5LHI B;  2JQQ A;  2E9X A;  2DI4 A;  3CKD A;  4ZHQ E;  4CQI A;  3VU7 H;  5FP3 A;  2NP9 A;  4H9R C;  4PK5 A;  4AQG A;  2NTX A;  2LM9 A;  4IDZ A;  3KVB A;  5CB4 E;  5KDM C;  3EDU A;  1WRD A;  3NRX A;  4O2A E;  3Q5X A;  4QXH B;  3JC6 D;  4IIJ E;  4NUU A;  2ACX A;  4CXW A;  3GWH A;  5LP6 E;  4GOU A;  4DMW A;  4QHO A;  5LHG B;  4BJM A;  5BMV E;  5FMN A;  4CXX A;  3IBP A;  5JRE A;  2K9A A;  1WR6 A;  2LT3 A;  3I0Q A;  2L3L A;  4ZI2 C;  3CQG B;  4XBF B;  3C4X A;  2UXX B;  2Q9Q B;  1UX5 A;  3FB2 A;  3PUR A;  3N9L A;  2Q9Q D;  5JRC B;  5H6R B;  3VHL A;  2CLY B;  4EZH A;  2XAH B;  3AA0 B;  4YJ3 E;  3E0Z A;  1S35 A;  2WMN A;  4O4I E;  1HG2 A;  4AI6 A;  5TAO A;  1CUN A;  2CCQ A;  3CWZ B;  2K24 A;  3BQK A;  3FBZ A;  3QK6 A;  4GIW A;  5HWY A;  5JVD E;  4H9O C;  2DNX A;  4UV9 B;  4BA9 A;  3GN5 B;  2EHO C;  4IST A;  1MNE A;  1YKE B;  2CEA A;  2X9W A;  4PJN A;  3EVY A;  5J1G A;  2W62 A;  4ZI3 D;  3OYZ A;  3K3Q C;  3H3A A;  4Z8X A;  3KBT A;  4TZ4 C;  4PFP A;  4WW0 A;  3J9X 1;  2E9X C;  2VKD A;  1NWM X;  3LK4 2;  3ESL A;  2A2F X;  3FXD B;  3ZMU B;  2BDE A;  2H7V C;  3B13 A;  2XTL A;  2HPL A;  5L3C B;  4AKL A;  4AQF C;  4X1K E;  5FNV E;  5IHY A;  2G0U A;  2C5J A;  3UUX B;  5JQG E;  1WLX A;  3ZN1 B;  1UCU A;  2XAS B;  3F31 A;  4IE5 A;  2E9X D;  4KBM B;  4OHF A;  5A1L A;  4YJ2 E;  3F57 A;  2V1D B;  3J7Y q;  2Y8D A;  5FYM A;  4DO0 A;  4UVA B;  4XAX B;  1HFA A;  2PBI A;  2KWH A;  4TUY E;  1KK7 A;  2DCF A;  4WBN E;  2M67 A;  4ZI7 E;  5LGU B;  3ETU A;  2EHO D;  4ERR A;  5L3E B;  1Y64 B;  3LBX B;  1VRB A;  3E22 E;  3AA7 B;  2JRK A;  3ZJ1 A;  1WYB A;  4QX8 B;  1B7T A;  2CXF A;  1US7 B;  2XAQ B;  3PDY A;  3KV6 A;  4IHJ E;  2K48 A;  4PAG A;  1LVK A;  5LCY A;  2DWG A;  2ODU A;  4TV9 E;  2YIN A;  3AVS A;  3RYH E;  2LEH A;  2X67 A;  3ZLI A;  2LSI A;  3PUQ A;  1FIO A;  3SS1 A;  3ZMV B;  3CX7 B;  5JDG A;  5JDN A;  3I9Y A;  4M1P A;  4UVB B;  3SRZ A;  5AFU L;  1HCI A;  1LKX A;  4AKI A;  4ISS A;  2BVM A;  2IC6 A;  3HR0 A;  3UTK A;  2N9D A;  4UEM A;  4DND A;  2IAK A;  2KZ7 B;  2HPJ A;  2MOZ A;  3RYC E;  5FY0 A;  1T98 A;  5JDF A;  4DVD A;  5FXW A;  3RRC A;  5LYJ E;  4AKR B;  3KDS E;  3TKL B;  4EZ4 A;  3KVA A;  3LK3 B;  4ADZ A;  2W63 A;  1D0Z A;  5ADX L;  4ZS3 A;  4ASK A;  2C5I T;  3FHN A;  1MMD A;  4ZOL E;  2CE7 A;  2WWU A;  4AQF A;  4I50 E;  2X9H A;  2LHN A;  3M65 A;  2XUE A;  3MA9 A;  4BJN A;  3ETV A;  4MFR A;  2DWK A;  3RRW A;  4HEA A;  3IHR A;  3HKC E;  1MND A;  3OYX A;  3N9M A;  2NOX A;  2UXN B;  3NZQ A;  2LOP A;  4UEL A;  4DBR A;  3C64 A;  3N9P A;  3UUM A;  4CI3 B;  5M4Y A;  5EK4 A;  5CA0 E;  5LBM A;  3RPU A;  2Q9Q C;  3KV9 A;  2KND A;  5LOV E;  5L3B B;  5C8Y E;  2ZMA A;  3CML A;  3O4X E;  2KLQ A;  3KFW X;  4ZI2 D;  2BZB A;  3DJB A;  5HXE A;  3VKH A;  4QXC B;  4O8S A;  5L3F B;  3H37 A;  4QXB B;  3L3P A;  2X51 A;  4H9S E;  4TN7 B;  1IJ6 A;  2YU2 A;  4ZI3 C;  1G73 A;  3ZMT B;  5ETW A;  3RX6 A;  1IAP A;  3EUH A;  5H6Q B;  4O4L E;  2CM0 A;  4E7S A;  3O9X A;  2I59 A;  3R6N A;  3KBU A;  4YFS A;  4I43 B;  3HKD E;  1BR2 A;  2VKJ A;  3ZC1 A;  3T8O A;  2X66 A;  2PJQ A;  3PUS A;  4CI2 B;  2V7M A;  2A3D A;  3AVR A;  5IYZ E;  2D5U A;  4HFV A;  3UT5 E;  2X9Y A;  1MIV A;  3HKE E;  3V5U A;  3WAK A;  2CMR A;  5JDQ A;  2EHO A;  2LOS A;  3RKO A;  4FJO A;  1MMN A;  1HX8 A;  3OBV E;  3OKQ A;  4GYS A;  1FEW A;  4U72 A;  3HL6 A;  2ZM8 A;  2EHO B;  4H63 V;  4J2C A;  3GMI A;  2MTQ A;  1MMG A;  3LJC A;  4H9N C;  4OYK A;  2C5K T;  1Z0P A;  2D2S A;  2WBL A;  5EK3 A;  5FXV A;  1BR0 A;  2WSS V;  3I0O A;  4EIW A;  2Q9Q A;  3AB3 B;  2V7I A;  3I9W A;  3C4Z A;  2JJ9 A;  3CPZ A;  4L0R A;  4BAY B;  4JEU B;  5EZY E;  5FY1 A;  3DTO A;  2JMK A;  2H7O A;  3MK7 C;  3U78 A;  3PU8 A;  1QSD A;  4MHC A;  2QGS A;  5FY7 A;  3AA1 B;  2CA5 A;  2VK9 A;  4HE8 A;  5J2T E;  1D0X A;  1D1A A;  4PW8 A;  3GN5 A;  3MXZ A;  1O3X A;  1YW0 A;  5JR9 C;  3ZJ2 A;  1FMW A;  2IC9 A;  2LE8 A;  2LSG A;  5FXZ A;  2KT9 A;  2PG8 A;  5L3D B;  4PK6 A;  3QUJ A;  1WYC A;  2CWY A;  4EYU A;  1ZHC A;  5HXR A;  3ZYL A;  2K5B B;  1U5P A;  2NW7 A;  4X20 E;  4AKG A;  2ZM2 A;  1ZEE A;  5HXH A;  2KMF A;  1MIW A;  2OA5 A;  2VAS A;  3NBX X;  4I4T E;  3ZMS B;  2JMH A;  3UUN A;  4ZS2 A;  3DP7 A;  2N1G A;  2Y48 B;  3ZYM A;  4IE4 A;  3CVR A;  4KUM B;  3B57 A;  4H9Q C;  4JEH B;  4O4J E;  5DQW A;  3RYI E;  1LVF A;  3E08 A;  4DBQ A;  3U3I A;  1HF8 A;  3JC6 C;  4UF0 A;  2ZM0 A;  4GYR A;  3HA4 A;  2J1D G;  3RYF E;  5DQV A;  4X1Y E;  2CWO A;  2XAF B;  4IGU A;  3MKD A;  4EB6 E;  4MLK A;  2D0T A;  4AXP A;  2L9Q A;  3Q2M A;  4HN9 A;  4NUV A;  3O1H A;  5F8P A;  5GON E;  4CZZ B;  5L2L A;  3VKG A;  2W0G A;  4PJJ A;  3GA8 A;  2N2N A;  2LSY A;  2W61 A;  2VL8 A;  4KP3 C;  3ZCJ A;  4P0A A;  2CXL A;  2VKH A;  2V7K A;  5J2U E;  3V5S A;  3C4W A;  3BQI A;  4C91 A;  1V9D A;  3ZC0 A;  4HKA A;  3QC9 A;  4WNK A;  4X1I E;  1YD8 G;  3ZCI A;  4E7Z A;  2DHR A;  3UUL A;  3N9Q A;  3RC3 A;  1UX4 A;  1X79 A;  5LGT B;  2KXP B;  1NAF A;  2CXD A;  3MZK B;  3LG7 A;  1HS7 A;  1IZN B;  2V7L A;  5CA1 E;  1FMV A;  5LHH B;  3KV5 A;  2DLR A;  3N2G E;  3SWH A;  1QUU A;  3HI2 A;  3CQX C;  4XZC A;  1OXZ A;  4P09 A;  3AAE B;  3LK2 B;  3PE0 A;  1D0Y A;  5LXT E;  5LNK A;  3WI3 A;  3C50 A;  2Y6X A;  4CXY A;  3UFE A;  3PTR B;  3C98 B;  2WM9 A;  1BR1 A;  3IF8 B;  5HWX A;  1E1H B;  2NW9 A;  4L9I A;  2JPF A;  1H7C A;  3FXE B;  4UXN B;  4PJM A;  1HTJ F;  1G8X A;  3ZN0 B;  3F2E A;  4UIG A;  4EAH A;  2IW5 B;  3ZEF B;  4PK4 A;  2XHE B;  3A5X A;  4GK5 E;  4OFZ A;  4H63 H;  4A56 A;  3RC8 A;  3MAC A;  4O4H E;  5KMG P;  3D0T A;  3BK9 A;  5DJQ C;  3W15 B;  2LHR A;  3CQC B;  2NW8 A;  4N78 D;  3Q9D A;  4K0U A;  5HYA A;  2GK9 A;  4P0B A;  3N2O A;  3ZPO A;  3NRY A;  3SOL A;  4MAL A;  3PUG A;  4EYY R;  3ONX A;  3N9N A;  4U74 A;  5LA6 E;  2W00 A;  2E9X B;  4FI5 A;  1HG5 A;  5E0O A;  4TX5 A;  4C90 A;  2WMO A;  2RA1 A;  4TV8 E;  4F6R C;  2MYS A;  2LSK A;  4H9P C;  4ILU A;  3P8C D;  1S94 A;  5JDH A;  4DMV A;  3ZMZ B;  2ODV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...