4CZZB

Histone demethylase lsd1(kdm1a)-corest3 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
CRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQGVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSINE-SPECIFIC HISTONE DEMETHYLASE 1A
publication title Differential Properties of Transcriptional Complexes Formed by the Corest Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
B PF01448 ELM2 ELM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4czzB00
3ZMVB 2V1DB 2XAJB 4KUMB 4CZZB 4UXNB 5L3GB 5L3DB 2XASB 5LGNB 5LGUB 5H6QB 2XAGB 4UVBB 3ZN0B 5LHHB 3ZMUB 3ZMZB 5H6RB 2XAFB 4UV8B 5LHIB 5L3FB 2Y48B 3ZMTB 4UVAB 2XAQB 5L3EB 4BAYB 4XBFB 3ZN1B 5LHGB 4UVCB 2IW5B 3ZMSB 4UV9B 5L3BB 5LBQB 5LGTB 2UXNB 2UXXB 2XAHB 2X0LB 5L3CB
chains in the Genus database with same CATH superfamily
4QXHB 2WY2A 3O4XE 2H7VC 1W9RA 3F2EA 1YXRA 4A97A 4YTNA 1OWAA 3JAEA 4MBQA 2XHEB 3AECA 3RC8A 4ILCA 3AE6A 2AE9A 3ZCJA 4V1Av 1O3XA 1MIYA 1VCTA 2X0HA 3OTOT 2BG9A 2JPFA 4H9PC 4C90A 5KX5E 3HA4A 4ILUA 3RYCE 5JR9A 1V9DA 3L09A 3KV5A 1H7CA 2C5IT 2G0UA 5AQQB 1KF6A 3RIFA 4CXWA 3C98B 3PUVF 3J9X1 1D0YA 4PNIA 4BJNA 2L3LA 2IUBA 3I9WA 4WYVA 2BVMA 3S4UA 4JLEA 2W00A 3P4WA 3R84B 3O1HA 4HE8A 4EYUA 4IHJE 3JCFA 2CEAA 1LVFA 2YDSA 3N2OA 3EHZA 3DJBA 4LF7T 3SWHA 4UF0A 3AE8A 4HFIA 4JEUB 4UVCB 1N36T 5HXSA 2V7JA 2DWKA 2X67A 3CX8B 4DNDA 4YSXA 3N9NA 3MA9A 2XM2A 1FEWA 5JDLA 3FZLB 3O1IA 3LSVA 3Q2MA 4HKAA 4HEAA 4ZS2A 2CM0A 4B3ST 2JQ9A 5FY7A 4ILBA 1I94T 1WRDA 5F5WA 5HEGA 2UXNB 2MOZA 3N9PA 1XMQT 1VOMA 5JRCB 3SFDA 2XAGB 5JDHA 4LFAT 4H9OC 4ADZA 5AQJB 1BR1A 3U3IA 1YKEB 2VURA 3VHLA 2YKSA 2W63A 1NAFA 5HCMA 3UU6A 4LMKA 3ESLA 2NWBA 2K3WA 2HHHT 2SPCA 2JQQA 4B6XA 4JI7T 5HCJA 3AB3B 1HR0T 1FJGT 1UGOA 3PU3A 4TZ4C 2JQHA 5FL0A 2LOPA 1UUSA 4HFDA 5L3GB 3LK3B 3PUZF 1HNZT 5L4HA 2CHOA 3RI5A 3ZC0A 4YTMA 5LCYA 2GK9A 4X62T 4LF6T 4QKNA 5LXTE 3NBXX 3QOFA 2E8IA 2H88A 4NUVA 3PUYF 3ZT7A 3AEAA 3RIAA 4QXCB 3AE2A 1U5PA 4KUMB 2IC6A 2V8SV 3AA0B 3P7IA 2ZMAA 5AQNB 2BKPA 5LYJE 4DMVA 2EHOC 1X9BA 1IJ6A 3GA8A 3RIUC 2KINB 5KDMC 1HNWT 2X0LB 2VB6A 2E9XB 5F8PA 5HWXA 1J5WA 4LFCT 1LKXA 4U74A 1T7SA 3ZYLA 1WLXA 2H7OA 5C2TA 2W62A 2WQYA 4ZEYA 4UV9B 3P8CD 4DR7T 2JMHA 2L8KA 4A56A 2BBHA 2NW8A 1Z0PA 4JI2T 1S35A 4AKGA 3ZN0B 5JRCA 5J0ZA 3ANWA 3TLUA 1N34T 1WCRA 5HWYA 2CE7A 1D0ZA 1HCIA 3OPCA 2KZ7B 2AXDS 4O8SA 2WAUA 2YDRA 2HH7A 3X1DA 3ZJ1A 4CXXA 2VQET 2EHOD 4U7IA 3UU4A 4GIWA 3DTOA 3AE7A 1HF8A 4BA9A 4A5XA 4LMJA 2LT3A 2MPKA 3TLVA 1NEKA 3OJAA 2DHRA 2KMFA 1T98A 2PG8A 3GMIA 3NZPA 3FZMB 5HEOA 4TX5A 2PTFA 5JDNA 4HWDA 1G73A 4YJ3E 4PJLA 5BMVE 2CMRA 2JQKA 3EDVA 3PUGA 4DV3T 2VKHA 2WP9A 3CPZA 1GQEA 2X9YA 2YU2A 3OVUA 5CJ5A 3LFMA 4GKJT 2XQ3A 1QSDA 1WFDA 5AQRB 2MAWA 2VASA 3N2KE 5DQWA 4O4JE 2WBLA 5ADXL 4JI6T 1MIVA 1HS7A 4ISTA 5ABGA 2QA7A 5C8YE 2LKHA 3SRZA 1BR0A 4IDPA 2CLYC 5AQUB 4YT0A 2KLQA 2E2AA 3NZQA 5AQVB 3L3PA 2LHNA 1SUMB 4AKLA 3VKGA 4HFVA 4YJ2E 1XZYA 2J47A 3AEDA 4ZI3C 1WYCA 2M6BA 3TLWA 4IE4A 2XQ9A 1W0BA 3EI0A 3OYXA 5JDQA 4PJMA 3J7Yq 2VVNA 3MACA 2UUBT 2ZM2A 4U72A 4HN9A 3KINB 4HWIB 2ZM0A 1D1BA 2I59A 2IMLA 4AXPA 2B76A 3UUBA 4ISSA 2BS2A 5JR9B 3AEGA 4EEBA 3AXJB 5LB7B 1YKHB 2XPKA 2IC9A 4Z90A 4AQGA 4K0KT 3ZN1B 2LM2A 4F6RC 4AQFC 4OYKA 5LHGB 4DVDA 1E2AA 2HN1A 3ZYMA 5LJMA 3VRAA 1OEDE 3PUAA 1J5ET 3A7MA 2BBJA 2VKJA 4U33A 5H6QB 4DR5T 5LHHB 3OKQA 1WR6A 2QRXA 4DUZT 4EV6A 4J2CA 2P9BA 1SE7A 3ZYKA 4ZOLE 2Q9QC 3ZT5A 5IUXA 3PJAA 3LJCA 1M7KA 2BS4A 2A2FX 2LLYA 3JADA 4HWFA 3P4QA 4P09A 4L9IA 4HTEA 1G8XA 2CRBA 3RF1A 2XJ7A 1KEYA 2XTLA 3QNUA 3FZHB 2RPAA 5HEUA 1I6ZA 2MTQA 3UU5A 5L3BB 5HXRA 2VQFT 1WYBA 2YEVC 2EHOB 4KI0F 5TAOA 4UV8B 2RP4A 4DBRA 2X66A 2X9WA 1FMVA 3EAMA 3V5UA 1KNZA 3LK2B 4U2ZA 2VWAA 3AE5A 4AKIA 3H3MA 4U3CA 2N9DA 3ONLC 3UU3A 4O2BE 3KDSE 3PJAJ 5LJNA 2XASB 4IIJE 2LRLA 4KMCA 4O4LE 5LG4A 2CBIA 3RYFE 4DO0A 2Q9QD 4DV5T 3RHWA 4CN1A 4JUYA 2LJLA 4X1IE 5AQKB 2UXBT 2K48A 5AQLB 2I6HA 5JQGE 2XZEA 5LMNT 4IDQA 3PDYA 5GONE 2FJEA 3C4WA 3AXJA 2NR4A 3AE4A 2XY8B 2A3DA 5CGMA 2A9UA 5AQSB 4KP3C 4YTPA 2W4XA 3TKLB 2VKOA 1MNDA 3ZC1A 2V6YB 3NRXA 1IZNB 4UEMA 4TV8E 4X20E 2DL1A 4JI0T 4EAHA 2PBIA 2BS3A 5AQOB 4OFZA 2ACXA 3PUQA 1KFYA 1OEDC 1HFAA 5AQMB 2D2SA 3CX6B 4O2AE 2WDVA 3AAAB 4HFEA 4DR1T 3PURA 3M3ZB 4YSYA 4DV1T 5IYZE 3K8PC 4EEDA 1XNRT 2XSAA 2EHOA 3AVSA 5LOVE 2DCFA 3I9YA 3RGLA 2KWIB 3QK6A 3UTKA 4ERRA 4ANJA 4UELA 4IE0A 4KBMB 2LSJA 5FXVA 2H89A 5KMGP 3ANWB 2E5VA 3RYHE 3JAFA 5JREA 4U2YA 1XNQT 3LG7A 3PU8A 2XQ4A 4B3RT 1S94A 3HKCE 2BKOA 4PFOA 2LSYA 3P50A 3MJXA 4LF4T 4H9RC 3MZKB 2CA5A 3ZMZB 4YLHA 3UU8A 4EIWA 5DQVA 5AQIB 2K5BB 4TV9E 3CVRA 4KX6A 4CQIA 3RYIE 2CBJA 4CI2B 3CQCB 4JI4T 3KV9A 3FBZA 2WDQA 4Z8XA 3G06A 3ZPOA 2DI4A 5FXWA 2V6YA 1HX8A 5EK4A 4H63H 4MHCA 1MNEA 3Q5DA 4OHFA 3B5MA 4AISA 1W0AA 5IHYA 4DV7T 3MK7C 3UULA 3ZMUB 2FUPA 4AIUA 3HKBE 3ONXA 4GYRA 2LM9A 3T1HT 4I0UA 1JNZA 3SS1A 5L4EA 1ZV4X 3V5SA 2R6GF 2K9AA 5JTGA 2BDEA 4CN6A 4TWDA 2V6XA 3GWHA 4F8HA 4QH1A 5FY1A 1IJ5A 3DP7A 4I55E 3K3OA 4KHPT 5A1LA 4P0BA 2VK9A 4WZXA 3VRBA 5L3DB 3P4SA 3N9LA 4H9NC 4CI3B 5IWAT 5J2TE 4PFPA 4EZHA 3EDUA 1NENA 3VR8A 4LF9T 4DR6T 3ZSTA 5AQFB 3I1AA 4WBOA 2CHNA 1EZ3A 1UX4A 4CI1B 4G63A 5FL1A 4M1PA 4ZI7E 1CUNA 4AQYT 3QB5A 1YW0A 5CA1E 1LVKA 2XAHB 2WZHA 1MMNA 3AE9A 2YN6A 2W61A 2J1DG 3PE0A 4FJOA 3WAJA 2UXCT 4LFBT 5E0OA 5FY0A 1IBMT 3NKZA 2I0MA 4YFSA 3ZKRA 4JI5T 1AJ3A 1XWMA 3C50A 2UXDT 3FXDB 2X51A 2WMOA 2HN2A 4GKKT 1D0XA 4IE7A 4QH5A 4HWCA 2NW9A 3NWIA 4AQFA 3C64A 2QYWA 1KNRA 5LA6E 2UUCT 2X9HA 3MKDA 4IE6A 5LG3A 1Y01A 4IDOA 3FZFB 4UIGA 1US7B 4I43B 5F3JA 2LKGA 3NRYA 2LRKA 2WWUA 2Q9QA 2XAQB 3HKEE 4O4IE 2VL0A 2NTXA 4XZCA 1OEDB 4PAGA 2W2UA 2IHR1 5LNKA 2UXXB 3C4ZA 2V7MA 2XAJB 4DIDB 4E7SA 3EUHA 5JH7E 4HWHA 3UFEA 2WS3A 5J1GA 5M4YA 1XMOT 1HNXT 1CHUA 3KVAA 3E08A 4KHZF 2V5CA 4LMLA 3ZLIA 1YQ3A 3Q5WA 5DJQC 2LSIA 5FMNA 3CQXC 3ABVA 5ABHA 4UVBB 3KBUA 3F57A 2X9XA 2WU2A 4K0UA 5LMUT 2E5LT 2ZLYA 4JEHB 2B1EA 4ZZBA 5CA0E 3RLFF 3AE3A 3CWZB 3H3AA 1ZOYA 3C51A 5ABEA 3K1SA 1NWMX 2CWOA 1SA0E 3QB5K 2XSBA 3EABA 2WM9A 2IDOB 1ZEEA 5BR8T 2YU1A 4PK5A 5FYMA 3O1JA 3IF8B 5AQGB 3AA1B 3TLTA 4ZXLA 1OXZA 3A8YC 2LSGA 3I0QA 3WAKA 2W0GA 2OA5A 4PK4A 3RRCA 5L3EB 1YD8G 2YK0A 4ZI3D 2XQ5A 3BK9A 3PTRB 2IAKA 4I4TE 2JJ9A 2N2NA 2NW7A 2XM1A 2DWGA 2WSSV 2XUEA 4IE5A 2J4GA 3R6NA 5JDFA 3E22E 4IDNA 3PUXF 5L3FB 3LDQB 2H3RA 2E9XC 2LHRA 4BJMA 3RKGA 3RKOA 4MLKA 1OEDA 3UFGA 4YHHT 2FJDA 4PJNA 2FBWA 4FI5A 3ZMTB 4GYSA 4NIQA 5CFBA 1FMWA 3M65A 1QLBA 2JRKA 4IGUA 3RH3A 5LGTB 4QX8B 3VKHA 2RA1A 2XQ7A 2LE8A 2Y6XA 5HEJA 4EZ4A 5FKYA 2BG9E 2JMKA 3W15B 3TLSA 4A98A 4TWFA 3LK42 3HL6A 2IIUA 3ZCIA 2W67A 2E9XD 3AEEA 1Y64B 3KV6A 2WCAA 3Q5EA 3K3NA 4NUUA 4QH4A 3B13A 4HFCA 1UURA 4E7ZA 1W09A 2PFVA 3GN5B 1HX1B 4AKRB 5HXCA 2CWYA 1Z8UA 4DR3T 3AA7B 4JI1T 4NXNT 5HXEA 2V1DB 4OYJA 2LOSA 4B3MT 3N2GE 3FBLA 4P1NA 2D0TA 4N78D 1L0VA 4WW0A 2X0YA 4X1KE 4HFBA 1T72A 2VVSA 4DV4T 2CPTA 4GOUA 2NTYA 2BKNA 2QVAA 3KVBA 2WWVA 4QHOA 2K24A 3T1YT 4WBNE 2XAFB 4DV6T 3AA6B 3UUMA 3L39A 4TNVA 1HG5A 3RIUA 3MXZA 2WB5A 2DNXA 3OBVE 4IREA 3ZSSA 2W66A 3FHNA 5EZYE 3UUXB 1UK5A 4AKHA 4JYAT 2C5KT 3Q5XA 3ZMVB 2YOEA 2CLYB 1ZHCA 1KK7A 5LP6E 2L9QA 4X65T 2ES0A 4X66T 5AQHB 5LBQB 3KV4A 2C0SA 2A72A 2D0UA 1ZP0A 3ZT6A 4TUYE 4G2AA 4DR2T 2MYSA 2BG9C 4EB6E 2BVLA 4MFRA 5EK2A 4LF8T 3CX7B 5JR9C 3QUJA 3E0ZA 3BQIA 3RRWA 3IBPA 1DU2A 2V26A 3SFEA 4JBWF 3WI3A 4NXMT 5FVKA 2WDRA 4C91A 1X79A 4O4HE 4BAYB 4ZS3A 3GN5A 3K3QC 3VR9A 4YY3T 3AAIA 2CXDA 4EXTA 4CXYA 4H9SE 3N5LA 2XQ8A 2MBGA 3UT5E 1MMDA 5H6RB 3BQLA 4JI8T 1T8BA 2YINA 3ETVA 2LSKA 2X68A 2VKDA 2C5JA 5HEHA 4PW8A 4ASKA 4YSZA 4DV0T 1IBKT 2Q9QB 1HG2A 2PJQA 2ODUA 2J62A 4IDZA 3FZKB 4IL9A 3B57A 4X1YE 3BQKA 3UQ4A 3F31A 3P4RA 1VRBA 5FXXA 4WNKA 5JVDE 2CXFA 4TWHA 3IA3A 5LGUB 3HKDE 1JNRA 2CXLA 2Y8DA 4QWNB 4DMWA 2V5DA 4HGAA 4GK0E 4XBFB 4PJJA 4ILAA 3ZMSB 5LHIB 2NOXA 1IAPA 3HR0A 1E7PA 2OV9A 4XAXB 5C3JA 4P0AA 4U7YA 5AQTB 3OYZA 1ZKEA 3HI2A 2IW5B 2V7KA 4B3TT 4H9QC 2M67A 3N9OA 4OK0A 4ZI2C 4YHJA 1SHZC 2Y48B 2Z6EA 3I0OA 3CKDA 3U78A 4PK6A 3O9XA 5ABFB 4MALA 3CMLA 1E1HB 3LBXB 2M6IA 3CIRA 4JI3T 1QUUA 5L47A 3RC3A 2XQYA 4QX7B 4EOZB 3ZJ2A 1M62A 2ODVA 3RX6A 3KBTA 2JIWA 3FXEB 5FVLA 1D1AA 5KXJA 4UXNB 1D1CA 3SOLA 3A5XA 3CQGB 2UU9T 5DABA 4TN7B 3JC6C 3AEBA 4Z91A 1N32T 2ZM8A 3AAEB 1FIOA 4DBQA 2HPJA 4L5GA 1YQ4A 3IHRA 4ZI2D 1BR2A 2E9XA 2UUAT 3UQ7A 2QGSA 4DR4T 4AI6A 3UUNA 2V7LA 5LBMA 1IBLT 2FJAA 4QXBB 2D9DA 1HTJF 4L0RA 2XQAA 3AE1A 3PUWF 1J1JA 5CB4E 1MIWA 3RQWA 3CK6A 5JDGA 5AQPB 2BZBA 3IEEA 3NVOA 3PUSA 4IL4A 4CZZB 3ONJA 2LEHA 3H37A 4EGWA 2CCQA 3L8RA 4IT4A 1UX5A 3RPUA 4HFHA 2WMNA 2F4VT 3JC6D 4ZHQE 1BR4A 3AVRA 3N9MA 4UR9A 4YXDA 5FNVE 2ACZA 4COFA 5ABFA 2BG9B 4X5TA 5J2UE 3T8OA 5JDMA 2KXPB 5AFUL 3LBXA 2D5UA 5LGNB 4DV2T 1XDOA 2V7IA 4DUYT 1U4QA 1WR0A 4LF5T 5L2LA 2XQ6A 4EYYR 1VCSA 3Q9DA 4I50E 1MMGA 3ETUA 3AEFA 5HXHA 5EK3A 4ZZCA 4JV5T 2NP9A 2N1GA 2HPLA 2DLRA 1N33T 3PV0F 2KNDA 2WZIA 2KWHA 4GK5E 2ZM6T 1UCUA 4CN4A 3FB2A 1R8IA 5ETWA 5FXZA 2KSRA 4UF0B 3QC9A 3RQUA 2OLTA 3D0TA 3P4PA 1LRZA 1XDPA 3N9QA 2VL8A 4TNWA 1KNPA 2FJBA 2KT9A 2YDQA 5FP3A 4OX9T 1MMAA 4NPPA 3VU7H 1B7TA 3ZEFB 3EVYA 4UVAB 5HYAA 3KFWX 4X64T 4H63V 4U31A 4Q25A 2WU5A 5HAXA 5L3CB 3C4XA
chains in the Genus database with same CATH topology
4IE4A 4QXHB 2A72A 2D0UA 3I1AA 4WBOA 3O4XE 2H7VC 1EZ3A 3OYXA 5JDQA 3F2EA 4PJMA 4TUYE 1UX4A 4G2AA 3J7Yq 4CI1B 4G63A 4M1PA 4ZI7E 3MACA 2MYSA 4EB6E 1OWAA 2ZM2A 2BVLA 4U72A 4HN9A 3KINB 4MFRA 1CUNA 5EK2A 4MBQA 2XHEB 2ZM0A 3RC8A 1YW0A 5CA1E 1D1BA 1LVKA 3CX7B 5JR9C 2I59A 3E0ZA 3QUJA 2XAHB 1MMNA 3BQIA 3RRWA 3IBPA 2W61A 3ZCJA 4V1Av 4AXPA 2J1DG 1O3XA 3PE0A 4FJOA 4ISSA 1MIYA 3WAJA 2V26A 2JPFA 4H9PC 3WI3A 5E0OA 5JR9B 5FY0A 4C90A 5KX5E 3HA4A 4ILUA 4C91A 3RYCE 5JR9A 4YFSA 1V9DA 1YKHB 3L09A 3KV5A 1AJ3A 1X79A 2IC9A 4O4HE 4AQGA 4BAYB 3C50A 4ZS3A 1H7CA 3ZN1B 4F6RC 3FXDB 4OYKA 2C5IT 3GN5A 3K3QC 4AQFC 2G0UA 5LHGB 4DVDA 2X51A 3ZYMA 4CXWA 2WMOA 3AAIA 5LJMA 2CXDA 3C98B 4EXTA 4CXYA 4H9SE 3N5LA 3J9X1 3PUAA 1D0YA 2VKJA 4PNIA 2MBGA 4BJNA 1D0XA 4IE7A 3UT5E 5H6QB 2L3LA 5LHHB 3OKQA 3I9WA 1MMDA 1WR6A 5H6RB 2NW9A 2BVMA 3BQLA 4AQFA 3S4UA 4JLEA 2YINA 3C64A 2W00A 4J2CA 3ETVA 2LSKA 2P9BA 2X68A 2VKDA 3O1HA 3R84B 3ZYKA 4HE8A 2Q9QC 4ZOLE 5LA6E 2C5JA 2X9HA 4EYUA 3MKDA 3LJCA 4IHJE 4IE6A 2CEAA 4PW8A 4ASKA 1LVFA 2A2FX 3N2OA 4UIGA 1US7B 4P09A 4I43B 4L9IA 5F3JA 2Q9QB 4HTEA 3NRYA 3DJBA 1HG2A 1G8XA 2PJQA 2WWUA 2ODUA 3SWHA 2Q9QA 4IDZA 2XAQB 3HKEE 4UF0A 4O4IE 2XTLA 2NTXA 4XZCA 3B57A 2MTQA 4JEUB 4UVCB 4X1YE 3BQKA 4PAGA 5HXSA 2V7JA 3F31A 2DWKA 5L3BB 5LNKA 2UXXB 5HXRA 1VRBA 2X67A 3C4ZA 2YEVC 1WYBA 3CX8B 5FXXA 2V7MA 4WNKA 5JVDE 2EHOB 4DNDA 2XAJB 2CXFA 4E7SA 3N9NA 5TAOA 3EUHA 3MA9A 3HKDE 5LGUB 5JH7E 1FEWA 4UV8B 5JDLA 3UFEA 3O1IA 4ZS2A 3Q2MA 2CXLA 2Y8DA 4HEAA 4HKAA 4QWNB 2RP4A 2CM0A 4DMWA 4HGAA 5M4YA 4DBRA 2X66A 2X9WA 4GK0E 1FMVA 5FY7A 4XBFB 3V5UA 1KNZA 3LK2B 3KVAA 3E08A 4PJJA 2VWAA 3ZMSB 1WRDA 4AKIA 3ZLIA 2UXNB 5LHIB 2MOZA 2NOXA 2N9DA 3Q5WA 1IAPA 5DJQC 3N9PA 3HR0A 1VOMA 5JRCB 4O2BE 2LSIA 3KDSE 4XAXB 5FMNA 5LJNA 3CQXC 2XASB 4IIJE 4O4LE 4KMCA 2XAGB 5JDHA 4UVBB 3KBUA 4H9OC 3F57A 2X9XA 5LG4A 4P0AA 4ADZA 1BR1A 4K0UA 2ZLYA 3RYFE 4JEHB 4DO0A 3OYZA 3U3IA 1ZKEA 3HI2A 1YKEB 2B1EA 2Q9QD 5CA0E 3VHLA 2IW5B 2V7KA 2W63A 3CWZB 1NAFA 4JUYA 3ESLA 4H9QC 2LJLA 4X1IE 2M67A 3H3AA 2NWBA 3N9OA 3C51A 2K48A 4OK0A 4ZI2C 1NWMX 5JQGE 4YHJA 1SHZC 2SPCA 2JQQA 2Y48B 2CWOA 2Z6EA 4B6XA 1SA0E 3I0OA 3CKDA 3U78A 3PDYA 5GONE 4PK6A 3AB3B 2WM9A 1ZEEA 3C4WA 3O9XA 4MALA 2YU1A 3CMLA 3PU3A 4PK5A 2A3DA 1E1HB 4TZ4C 5FYMA 3LBXB 2LOPA 1QUUA 3O1JA 3IF8B 4KP3C 3RC3A 3AA1B 3LK3B 5L3GB 2XQYA 4QX7B 3TKLB 1OXZA 4EOZB 2LSGA 2VKOA 3ZC0A 1MNDA 3ZC1A 3I0QA 3ZJ2A 2ODVA 3NRXA 3WAKA 5LCYA 2W0GA 2OA5A 1IZNB 2GK9A 4PK4A 4TV8E 4UEMA 3RX6A 3RRCA 4X20E 5L3EB 4QKNA 5LXTE 1YD8G 3NBXX 2YK0A 2E8IA 4ZI3D 3KBTA 3BK9A 3PTRB 4NUVA 2IAKA 3FXEB 4I4TE 2JJ9A 2N2NA 2NW7A 4EAHA 2PBIA 2DWGA 2WSSV 1D1AA 4QXCB 1U5PA 4OFZA 4KUMB 2XUEA 4UXNB 2ACXA 4IE5A 2IC6A 3PUQA 1D1CA 3R6NA 3SOLA 3A5XA 5JDFA 1HFAA 3E22E 3AA0B 3CQGB 2D2SA 3CX6B 3P7IA 4O2AE 5L3FB 2ZMAA 3AAAB 5DABA 2H3RA 5LYJE 4DMVA 2E9XC 2LHRA 4BJMA 2EHOC 4TN7B 3JC6C 3PURA 3RKOA 1IJ6A 3GA8A 2KINB 4MLKA 5KDMC 2ZM8A 3AAEB 5IYZE 1FIOA 3K8PC 2X0LB 4DBQA 2VB6A 2E9XB 2HPJA 4L5GA 4PJNA 5F8PA 3IHRA 5J1GA 4ZI2D 1BR2A 5HWXA 2E9XA 2EHOA 4FI5A 3AVSA 3ZMTB 4GYSA 5LOVE 2DCFA 2QGSA 1LKXA 4AI6A 3I9YA 4U74A 3UUNA 2KWIB 2V7LA 3QK6A 3UTKA 5LBMA 3ZYLA 1WLXA 2H7OA 1FMWA 4QXBB 1HTJF 4ERRA 2W62A 3M65A 2JRKA 4IGUA 4L0RA 3RH3A 4UV9B 4ANJA 5LGTB 4UELA 3P8CD 4IE0A 4QX8B 3VKHA 4KBMB 2JMHA 2LSJA 2L8KA 2RA1A 5FXVA 4A56A 2LE8A 2Y6XA 5KMGP 2NW8A 1Z0PA 3ANWB 4EZ4A 1S35A 3RYHE 4AKGA 5JREA 3ZN0B 5JRCA 3ANWA 5CB4E 1MIWA 3LG7A 2JMKA 5JDGA 3PU8A 5HWYA 2CE7A 3W15B 1D0ZA 1HCIA 1S94A 2BZBA 3HKCE 3IEEA 4PFOA 2LSYA 3PUSA 2KZ7B 3LK42 3HL6A 3MJXA 4CZZB 4O8SA 2WAUA 4H9RC 2LEHA 2HH7A 3MZKB 3H37A 2CA5A 3ZMZB 2CCQA 4YLHA 3ZJ1A 4CXXA 3ZCIA 1UX5A 3RPUA 2E9XD 2EHOD 4EIWA 2WMNA 1Y64B 3JC6D 5DQVA 1BR4A 4ZHQE 2K5BB 4TV9E 3AVRA 3N9MA 3KV6A 4GIWA 3CVRA 3DTOA 5FNVE 4CQIA 3RYIE 1HF8A 4BA9A 2LT3A 5J2UE 3OJAA 4CI2B 2DHRA 3T8OA 3CQCB 3K3NA 2KXPB 4NUUA 5AFUL 5JDMA 2KMFA 3LBXA 2D5UA 3KV9A 5LGNB 1T98A 3B13A 3FBZA 4Z8XA 4E7ZA 2V7IA 2PG8A 1U4QA 3GMIA 3NZPA 2PFVA 3ZPOA 3GN5B 5L2LA 4AKRB 2DI4A 5FXWA 5HXCA 2CWYA 4TX5A 4EYYR 1HX8A 5EK4A 4H63H 4MHCA 1MNEA 3AA7B 3Q9DA 5JDNA 4I50E 1MMGA 4OHFA 3ETUA 5HXHA 5EK3A 5HXEA 2V1DB 2NP9A 2N1GA 5IHYA 4OYJA 3MK7C 2HPLA 2DLRA 3UULA 1G73A 2LOSA 3ZMUB 4YJ3E 4PJLA 3N2GE 3FBLA 5BMVE 2CMRA 2D0TA 4N78D 2KNDA 3HKBE 2KWHA 3EDVA 4WW0A 3ONXA 4GK5E 3PUGA 1UCUA 4GYRA 2LM9A 4X1KE 2VKHA 3CPZA 2X9YA 2YU2A 3FB2A 3LFMA 5ETWA 3SS1A 4GOUA 5FXZA 2NTYA 1ZV4X 3V5SA 2K9AA 1QSDA 3KVBA 4QHOA 2BDEA 2VASA 2K24A 4UF0B 3N2KE 3QC9A 5DQWA 2XAFB 4O4JE 4WBNE 2WBLA 5ADXL 3GWHA 3D0TA 1MIVA 1LRZA 3AA6B 3UUMA 5FY1A 1HS7A 1HG5A 1IJ5A 3N9QA 3MXZA 3DP7A 4ISTA 2DNXA 2QA7A 2VL8A 3OBVE 5C8YE 4I55E 3SRZA 3K3OA 1BR0A 3FHNA 5EZYE 3UUXB 4AKHA 5A1LA 2CLYC 2KLQA 4P0BA 2KT9A 2C5KT 3Q5XA 2VK9A 3NZQA 5FP3A 3ZMVB 1MMAA 5L3DB 3VU7H 3L3PA 2LHNA 1B7TA 3N9LA 4H9NC 4AKLA 3ZEFB 3VKGA 4HFVA 4YJ2E 3EVYA 2CLYB 4UVAB 1ZHCA 5HYAA 4CI3B 1KK7A 5LP6E 2L9QA 5J2TE 3KFWX 4H63V 4ZI3C 4PFPA 2ES0A 1WYCA 4EZHA 3EDUA 5LBQB 3KV4A 5HAXA 5L3CB 3C4XA 2C0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZMV B;  2V1D B;  2XAJ B;  4KUM B;  4CZZ B;  4UXN B;  5L3G B;  5L3D B;  2XAS B;  5LGN B;  5LGU B;  5H6Q B;  2XAG B;  4UVB B;  3ZN0 B;  5LHH B;  3ZMU B;  3ZMZ B;  5H6R B;  2XAF B;  4UV8 B;  5LHI B;  5L3F B;  2Y48 B;  3ZMT B;  4UVA B;  2XAQ B;  5L3E B;  4BAY B;  4XBF B;  3ZN1 B;  5LHG B;  4UVC B;  2IW5 B;  3ZMS B;  4UV9 B;  5L3B B;  5LBQ B;  5LGT B;  2UXN B;  2UXX B;  2XAH B;  2X0L B;  5L3C B; 
#chains in the Genus database with same CATH topology
 4QXH B;  2WY2 A;  3O4X E;  2H7V C;  1W9R A;  3F2E A;  1YXR A;  4A97 A;  4YTN A;  1OWA A;  3JAE A;  4MBQ A;  2XHE B;  3AEC A;  3RC8 A;  4ILC A;  3AE6 A;  2AE9 A;  3ZCJ A;  4V1A v;  1O3X A;  1MIY A;  1VCT A;  2X0H A;  3OTO T;  2BG9 A;  2JPF A;  4H9P C;  4C90 A;  5KX5 E;  3HA4 A;  4ILU A;  3RYC E;  5JR9 A;  1V9D A;  3L09 A;  3KV5 A;  1H7C A;  2C5I T;  2G0U A;  5AQQ B;  1KF6 A;  3RIF A;  4CXW A;  3C98 B;  3PUV F;  3J9X 1;  1D0Y A;  4PNI A;  4BJN A;  2L3L A;  2IUB A;  3I9W A;  4WYV A;  2BVM A;  3S4U A;  4JLE A;  2W00 A;  3P4W A;  3R84 B;  3O1H A;  4HE8 A;  4EYU A;  4IHJ E;  3JCF A;  2CEA A;  1LVF A;  2YDS A;  3N2O A;  3EHZ A;  3DJB A;  4LF7 T;  3SWH A;  4UF0 A;  3AE8 A;  4HFI A;  4JEU B;  4UVC B;  1N36 T;  5HXS A;  2V7J A;  2DWK A;  2X67 A;  3CX8 B;  4DND A;  4YSX A;  3N9N A;  3MA9 A;  2XM2 A;  1FEW A;  5JDL A;  3FZL B;  3O1I A;  3LSV A;  3Q2M A;  4HKA A;  4HEA A;  4ZS2 A;  2CM0 A;  4B3S T;  2JQ9 A;  5FY7 A;  4ILB A;  1I94 T;  1WRD A;  5F5W A;  5HEG A;  2UXN B;  2MOZ A;  3N9P A;  1XMQ T;  1VOM A;  5JRC B;  3SFD A;  2XAG B;  5JDH A;  4LFA T;  4H9O C;  4ADZ A;  5AQJ B;  1BR1 A;  3U3I A;  1YKE B;  2VUR A;  3VHL A;  2YKS A;  2W63 A;  1NAF A;  5HCM A;  3UU6 A;  4LMK A;  3ESL A;  2NWB A;  2K3W A;  2HHH T;  2SPC A;  2JQQ A;  4B6X A;  4JI7 T;  5HCJ A;  3AB3 B;  1HR0 T;  1FJG T;  1UGO A;  3PU3 A;  4TZ4 C;  2JQH A;  5FL0 A;  2LOP A;  1UUS A;  4HFD A;  5L3G B;  3LK3 B;  3PUZ F;  1HNZ T;  5L4H A;  2CHO A;  3RI5 A;  3ZC0 A;  4YTM A;  5LCY A;  2GK9 A;  4X62 T;  4LF6 T;  4QKN A;  5LXT E;  3NBX X;  3QOF A;  2E8I A;  2H88 A;  4NUV A;  3PUY F;  3ZT7 A;  3AEA A;  3RIA A;  4QXC B;  3AE2 A;  1U5P A;  4KUM B;  2IC6 A;  2V8S V;  3AA0 B;  3P7I A;  2ZMA A;  5AQN B;  2BKP A;  5LYJ E;  4DMV A;  2EHO C;  1X9B A;  1IJ6 A;  3GA8 A;  3RIU C;  2KIN B;  5KDM C;  1HNW T;  2X0L B;  2VB6 A;  2E9X B;  5F8P A;  5HWX A;  1J5W A;  4LFC T;  1LKX A;  4U74 A;  1T7S A;  3ZYL A;  1WLX A;  2H7O A;  5C2T A;  2W62 A;  2WQY A;  4ZEY A;  4UV9 B;  3P8C D;  4DR7 T;  2JMH A;  2L8K A;  4A56 A;  2BBH A;  2NW8 A;  1Z0P A;  4JI2 T;  1S35 A;  4AKG A;  3ZN0 B;  5JRC A;  5J0Z A;  3ANW A;  3TLU A;  1N34 T;  1WCR A;  5HWY A;  2CE7 A;  1D0Z A;  1HCI A;  3OPC A;  2KZ7 B;  2AXD S;  4O8S A;  2WAU A;  2YDR A;  2HH7 A;  3X1D A;  3ZJ1 A;  4CXX A;  2VQE T;  2EHO D;  4U7I A;  3UU4 A;  4GIW A;  3DTO A;  3AE7 A;  1HF8 A;  4BA9 A;  4A5X A;  4LMJ A;  2LT3 A;  2MPK A;  3TLV A;  1NEK A;  3OJA A;  2DHR A;  2KMF A;  1T98 A;  2PG8 A;  3GMI A;  3NZP A;  3FZM B;  5HEO A;  4TX5 A;  2PTF A;  5JDN A;  4HWD A;  1G73 A;  4YJ3 E;  4PJL A;  5BMV E;  2CMR A;  2JQK A;  3EDV A;  3PUG A;  4DV3 T;  2VKH A;  2WP9 A;  3CPZ A;  1GQE A;  2X9Y A;  2YU2 A;  3OVU A;  5CJ5 A;  3LFM A;  4GKJ T;  2XQ3 A;  1QSD A;  1WFD A;  5AQR B;  2MAW A;  2VAS A;  3N2K E;  5DQW A;  4O4J E;  2WBL A;  5ADX L;  4JI6 T;  1MIV A;  1HS7 A;  4IST A;  5ABG A;  2QA7 A;  5C8Y E;  2LKH A;  3SRZ A;  1BR0 A;  4IDP A;  2CLY C;  5AQU B;  4YT0 A;  2KLQ A;  2E2A A;  3NZQ A;  5AQV B;  3L3P A;  2LHN A;  1SUM B;  4AKL A;  3VKG A;  4HFV A;  4YJ2 E;  1XZY A;  2J47 A;  3AED A;  4ZI3 C;  1WYC A;  2M6B A;  3TLW A;  4IE4 A;  2XQ9 A;  1W0B A;  3EI0 A;  3OYX A;  5JDQ A;  4PJM A;  3J7Y q;  2VVN A;  3MAC A;  2UUB T;  2ZM2 A;  4U72 A;  4HN9 A;  3KIN B;  4HWI B;  2ZM0 A;  1D1B A;  2I59 A;  2IML A;  4AXP A;  2B76 A;  3UUB A;  4ISS A;  2BS2 A;  5JR9 B;  3AEG A;  4EEB A;  3AXJ B;  5LB7 B;  1YKH B;  2XPK A;  2IC9 A;  4Z90 A;  4AQG A;  4K0K T;  3ZN1 B;  2LM2 A;  4F6R C;  4AQF C;  4OYK A;  5LHG B;  4DVD A;  1E2A A;  2HN1 A;  3ZYM A;  5LJM A;  3VRA A;  1OED E;  3PUA A;  1J5E T;  3A7M A;  2BBJ A;  2VKJ A;  4U33 A;  5H6Q B;  4DR5 T;  5LHH B;  3OKQ A;  1WR6 A;  2QRX A;  4DUZ T;  4EV6 A;  4J2C A;  2P9B A;  1SE7 A;  3ZYK A;  4ZOL E;  2Q9Q C;  3ZT5 A;  5IUX A;  3PJA A;  3LJC A;  1M7K A;  2BS4 A;  2A2F X;  2LLY A;  3JAD A;  4HWF A;  3P4Q A;  4P09 A;  4L9I A;  4HTE A;  1G8X A;  2CRB A;  3RF1 A;  2XJ7 A;  1KEY A;  2XTL A;  3QNU A;  3FZH B;  2RPA A;  5HEU A;  1I6Z A;  2MTQ A;  3UU5 A;  5L3B B;  5HXR A;  2VQF T;  1WYB A;  2YEV C;  2EHO B;  4KI0 F;  5TAO A;  4UV8 B;  2RP4 A;  4DBR A;  2X66 A;  2X9W A;  1FMV A;  3EAM A;  3V5U A;  1KNZ A;  3LK2 B;  4U2Z A;  2VWA A;  3AE5 A;  4AKI A;  3H3M A;  4U3C A;  2N9D A;  3ONL C;  3UU3 A;  4O2B E;  3KDS E;  3PJA J;  5LJN A;  2XAS B;  4IIJ E;  2LRL A;  4KMC A;  4O4L E;  5LG4 A;  2CBI A;  3RYF E;  4DO0 A;  2Q9Q D;  4DV5 T;  3RHW A;  4CN1 A;  4JUY A;  2LJL A;  4X1I E;  5AQK B;  2UXB T;  2K48 A;  5AQL B;  2I6H A;  5JQG E;  2XZE A;  5LMN T;  4IDQ A;  3PDY A;  5GON E;  2FJE A;  3C4W A;  3AXJ A;  2NR4 A;  3AE4 A;  2XY8 B;  2A3D A;  5CGM A;  2A9U A;  5AQS B;  4KP3 C;  4YTP A;  2W4X A;  3TKL B;  2VKO A;  1MND A;  3ZC1 A;  2V6Y B;  3NRX A;  1IZN B;  4UEM A;  4TV8 E;  4X20 E;  2DL1 A;  4JI0 T;  4EAH A;  2PBI A;  2BS3 A;  5AQO B;  4OFZ A;  2ACX A;  3PUQ A;  1KFY A;  1OED C;  1HFA A;  5AQM B;  2D2S A;  3CX6 B;  4O2A E;  2WDV A;  3AAA B;  4HFE A;  4DR1 T;  3PUR A;  3M3Z B;  4YSY A;  4DV1 T;  5IYZ E;  3K8P C;  4EED A;  1XNR T;  2XSA A;  2EHO A;  3AVS A;  5LOV E;  2DCF A;  3I9Y A;  3RGL A;  2KWI B;  3QK6 A;  3UTK A;  4ERR A;  4ANJ A;  4UEL A;  4IE0 A;  4KBM B;  2LSJ A;  5FXV A;  2H89 A;  5KMG P;  3ANW B;  2E5V A;  3RYH E;  3JAF A;  5JRE A;  4U2Y A;  1XNQ T;  3LG7 A;  3PU8 A;  2XQ4 A;  4B3R T;  1S94 A;  3HKC E;  2BKO A;  4PFO A;  2LSY A;  3P50 A;  3MJX A;  4LF4 T;  4H9R C;  3MZK B;  2CA5 A;  3ZMZ B;  4YLH A;  3UU8 A;  4EIW A;  5DQV A;  5AQI B;  2K5B B;  4TV9 E;  3CVR A;  4KX6 A;  4CQI A;  3RYI E;  2CBJ A;  4CI2 B;  3CQC B;  4JI4 T;  3KV9 A;  3FBZ A;  2WDQ A;  4Z8X A;  3G06 A;  3ZPO A;  2DI4 A;  5FXW A;  2V6Y A;  1HX8 A;  5EK4 A;  4H63 H;  4MHC A;  1MNE A;  3Q5D A;  4OHF A;  3B5M A;  4AIS A;  1W0A A;  5IHY A;  4DV7 T;  3MK7 C;  3UUL A;  3ZMU B;  2FUP A;  4AIU A;  3HKB E;  3ONX A;  4GYR A;  2LM9 A;  3T1H T;  4I0U A;  1JNZ A;  3SS1 A;  5L4E A;  1ZV4 X;  3V5S A;  2R6G F;  2K9A A;  5JTG A;  2BDE A;  4CN6 A;  4TWD A;  2V6X A;  3GWH A;  4F8H A;  4QH1 A;  5FY1 A;  1IJ5 A;  3DP7 A;  4I55 E;  3K3O A;  4KHP T;  5A1L A;  4P0B A;  2VK9 A;  4WZX A;  3VRB A;  5L3D B;  3P4S A;  3N9L A;  4H9N C;  4CI3 B;  5IWA T;  5J2T E;  4PFP A;  4EZH A;  3EDU A;  1NEN A;  3VR8 A;  4LF9 T;  4DR6 T;  3ZST A;  5AQF B;  3I1A A;  4WBO A;  2CHN A;  1EZ3 A;  1UX4 A;  4CI1 B;  4G63 A;  5FL1 A;  4M1P A;  4ZI7 E;  1CUN A;  4AQY T;  3QB5 A;  1YW0 A;  5CA1 E;  1LVK A;  2XAH B;  2WZH A;  1MMN A;  3AE9 A;  2YN6 A;  2W61 A;  2J1D G;  3PE0 A;  4FJO A;  3WAJ A;  2UXC T;  4LFB T;  5E0O A;  5FY0 A;  1IBM T;  3NKZ A;  2I0M A;  4YFS A;  3ZKR A;  4JI5 T;  1AJ3 A;  1XWM A;  3C50 A;  2UXD T;  3FXD B;  2X51 A;  2WMO A;  2HN2 A;  4GKK T;  1D0X A;  4IE7 A;  4QH5 A;  4HWC A;  2NW9 A;  3NWI A;  4AQF A;  3C64 A;  2QYW A;  1KNR A;  5LA6 E;  2UUC T;  2X9H A;  3MKD A;  4IE6 A;  5LG3 A;  1Y01 A;  4IDO A;  3FZF B;  4UIG A;  1US7 B;  4I43 B;  5F3J A;  2LKG A;  3NRY A;  2LRK A;  2WWU A;  2Q9Q A;  2XAQ B;  3HKE E;  4O4I E;  2VL0 A;  2NTX A;  4XZC A;  1OED B;  4PAG A;  2W2U A;  2IHR 1;  5LNK A;  2UXX B;  3C4Z A;  2V7M A;  2XAJ B;  4DID B;  4E7S A;  3EUH A;  5JH7 E;  4HWH A;  3UFE A;  2WS3 A;  5J1G A;  5M4Y A;  1XMO T;  1HNX T;  1CHU A;  3KVA A;  3E08 A;  4KHZ F;  2V5C A;  4LML A;  3ZLI A;  1YQ3 A;  3Q5W A;  5DJQ C;  2LSI A;  5FMN A;  3CQX C;  3ABV A;  5ABH A;  4UVB B;  3KBU A;  3F57 A;  2X9X A;  2WU2 A;  4K0U A;  5LMU T;  2E5L T;  2ZLY A;  4JEH B;  2B1E A;  4ZZB A;  5CA0 E;  3RLF F;  3AE3 A;  3CWZ B;  3H3A A;  1ZOY A;  3C51 A;  5ABE A;  3K1S A;  1NWM X;  2CWO A;  1SA0 E;  3QB5 K;  2XSB A;  3EAB A;  2WM9 A;  2IDO B;  1ZEE A;  5BR8 T;  2YU1 A;  4PK5 A;  5FYM A;  3O1J A;  3IF8 B;  5AQG B;  3AA1 B;  3TLT A;  4ZXL A;  1OXZ A;  3A8Y C;  2LSG A;  3I0Q A;  3WAK A;  2W0G A;  2OA5 A;  4PK4 A;  3RRC A;  5L3E B;  1YD8 G;  2YK0 A;  4ZI3 D;  2XQ5 A;  3BK9 A;  3PTR B;  2IAK A;  4I4T E;  2JJ9 A;  2N2N A;  2NW7 A;  2XM1 A;  2DWG A;  2WSS V;  2XUE A;  4IE5 A;  2J4G A;  3R6N A;  5JDF A;  3E22 E;  4IDN A;  3PUX F;  5L3F B;  3LDQ B;  2H3R A;  2E9X C;  2LHR A;  4BJM A;  3RKG A;  3RKO A;  4MLK A;  1OED A;  3UFG A;  4YHH T;  2FJD A;  4PJN A;  2FBW A;  4FI5 A;  3ZMT B;  4GYS A;  4NIQ A;  5CFB A;  1FMW A;  3M65 A;  1QLB A;  2JRK A;  4IGU A;  3RH3 A;  5LGT B;  4QX8 B;  3VKH A;  2RA1 A;  2XQ7 A;  2LE8 A;  2Y6X A;  5HEJ A;  4EZ4 A;  5FKY A;  2BG9 E;  2JMK A;  3W15 B;  3TLS A;  4A98 A;  4TWF A;  3LK4 2;  3HL6 A;  2IIU A;  3ZCI A;  2W67 A;  2E9X D;  3AEE A;  1Y64 B;  3KV6 A;  2WCA A;  3Q5E A;  3K3N A;  4NUU A;  4QH4 A;  3B13 A;  4HFC A;  1UUR A;  4E7Z A;  1W09 A;  2PFV A;  3GN5 B;  1HX1 B;  4AKR B;  5HXC A;  2CWY A;  1Z8U A;  4DR3 T;  3AA7 B;  4JI1 T;  4NXN T;  5HXE A;  2V1D B;  4OYJ A;  2LOS A;  4B3M T;  3N2G E;  3FBL A;  4P1N A;  2D0T A;  4N78 D;  1L0V A;  4WW0 A;  2X0Y A;  4X1K E;  4HFB A;  1T72 A;  2VVS A;  4DV4 T;  2CPT A;  4GOU A;  2NTY A;  2BKN A;  2QVA A;  3KVB A;  2WWV A;  4QHO A;  2K24 A;  3T1Y T;  4WBN E;  2XAF B;  4DV6 T;  3AA6 B;  3UUM A;  3L39 A;  4TNV A;  1HG5 A;  3RIU A;  3MXZ A;  2WB5 A;  2DNX A;  3OBV E;  4IRE A;  3ZSS A;  2W66 A;  3FHN A;  5EZY E;  3UUX B;  1UK5 A;  4AKH A;  4JYA T;  2C5K T;  3Q5X A;  3ZMV B;  2YOE A;  2CLY B;  1ZHC A;  1KK7 A;  5LP6 E;  2L9Q A;  4X65 T;  2ES0 A;  4X66 T;  5AQH B;  5LBQ B;  3KV4 A;  2C0S A;  2A72 A;  2D0U A;  1ZP0 A;  3ZT6 A;  4TUY E;  4G2A A;  4DR2 T;  2MYS A;  2BG9 C;  4EB6 E;  2BVL A;  4MFR A;  5EK2 A;  4LF8 T;  3CX7 B;  5JR9 C;  3QUJ A;  3E0Z A;  3BQI A;  3RRW A;  3IBP A;  1DU2 A;  2V26 A;  3SFE A;  4JBW F;  3WI3 A;  4NXM T;  5FVK A;  2WDR A;  4C91 A;  1X79 A;  4O4H E;  4BAY B;  4ZS3 A;  3GN5 A;  3K3Q C;  3VR9 A;  4YY3 T;  3AAI A;  2CXD A;  4EXT A;  4CXY A;  4H9S E;  3N5L A;  2XQ8 A;  2MBG A;  3UT5 E;  1MMD A;  5H6R B;  3BQL A;  4JI8 T;  1T8B A;  2YIN A;  3ETV A;  2LSK A;  2X68 A;  2VKD A;  2C5J A;  5HEH A;  4PW8 A;  4ASK A;  4YSZ A;  4DV0 T;  1IBK T;  2Q9Q B;  1HG2 A;  2PJQ A;  2ODU A;  2J62 A;  4IDZ A;  3FZK B;  4IL9 A;  3B57 A;  4X1Y E;  3BQK A;  3UQ4 A;  3F31 A;  3P4R A;  1VRB A;  5FXX A;  4WNK A;  5JVD E;  2CXF A;  4TWH A;  3IA3 A;  5LGU B;  3HKD E;  1JNR A;  2CXL A;  2Y8D A;  4QWN B;  4DMW A;  2V5D A;  4HGA A;  4GK0 E;  4XBF B;  4PJJ A;  4ILA A;  3ZMS B;  5LHI B;  2NOX A;  1IAP A;  3HR0 A;  1E7P A;  2OV9 A;  4XAX B;  5C3J A;  4P0A A;  4U7Y A;  5AQT B;  3OYZ A;  1ZKE A;  3HI2 A;  2IW5 B;  2V7K A;  4B3T T;  4H9Q C;  2M67 A;  3N9O A;  4OK0 A;  4ZI2 C;  4YHJ A;  1SHZ C;  2Y48 B;  2Z6E A;  3I0O A;  3CKD A;  3U78 A;  4PK6 A;  3O9X A;  5ABF B;  4MAL A;  3CML A;  1E1H B;  3LBX B;  2M6I A;  3CIR A;  4JI3 T;  1QUU A;  5L47 A;  3RC3 A;  2XQY A;  4QX7 B;  4EOZ B;  3ZJ2 A;  1M62 A;  2ODV A;  3RX6 A;  3KBT A;  2JIW A;  3FXE B;  5FVL A;  1D1A A;  5KXJ A;  4UXN B;  1D1C A;  3SOL A;  3A5X A;  3CQG B;  2UU9 T;  5DAB A;  4TN7 B;  3JC6 C;  3AEB A;  4Z91 A;  1N32 T;  2ZM8 A;  3AAE B;  1FIO A;  4DBQ A;  2HPJ A;  4L5G A;  1YQ4 A;  3IHR A;  4ZI2 D;  1BR2 A;  2E9X A;  2UUA T;  3UQ7 A;  2QGS A;  4DR4 T;  4AI6 A;  3UUN A;  2V7L A;  5LBM A;  1IBL T;  2FJA A;  4QXB B;  2D9D A;  1HTJ F;  4L0R A;  2XQA A;  3AE1 A;  3PUW F;  1J1J A;  5CB4 E;  1MIW A;  3RQW A;  3CK6 A;  5JDG A;  5AQP B;  2BZB A;  3IEE A;  3NVO A;  3PUS A;  4IL4 A;  4CZZ B;  3ONJ A;  2LEH A;  3H37 A;  4EGW A;  2CCQ A;  3L8R A;  4IT4 A;  1UX5 A;  3RPU A;  4HFH A;  2WMN A;  2F4V T;  3JC6 D;  4ZHQ E;  1BR4 A;  3AVR A;  3N9M A;  4UR9 A;  4YXD A;  5FNV E;  2ACZ A;  4COF A;  5ABF A;  2BG9 B;  4X5T A;  5J2U E;  3T8O A;  5JDM A;  2KXP B;  5AFU L;  3LBX A;  2D5U A;  5LGN B;  4DV2 T;  1XDO A;  2V7I A;  4DUY T;  1U4Q A;  1WR0 A;  4LF5 T;  5L2L A;  2XQ6 A;  4EYY R;  1VCS A;  3Q9D A;  4I50 E;  1MMG A;  3ETU A;  3AEF A;  5HXH A;  5EK3 A;  4ZZC A;  4JV5 T;  2NP9 A;  2N1G A;  2HPL A;  2DLR A;  1N33 T;  3PV0 F;  2KND A;  2WZI A;  2KWH A;  4GK5 E;  2ZM6 T;  1UCU A;  4CN4 A;  3FB2 A;  1R8I A;  5ETW A;  5FXZ A;  2KSR A;  4UF0 B;  3QC9 A;  3RQU A;  2OLT A;  3D0T A;  3P4P A;  1LRZ A;  1XDP A;  3N9Q A;  2VL8 A;  4TNW A;  1KNP A;  2FJB A;  2KT9 A;  2YDQ A;  5FP3 A;  4OX9 T;  1MMA A;  4NPP A;  3VU7 H;  1B7T A;  3ZEF B;  3EVY A;  4UVA B;  5HYA A;  3KFW X;  4X64 T;  4H63 V;  4U31 A;  4Q25 A;  2WU5 A;  5HAX A;  5L3C B;  3C4X A; 
#chains in the Genus database with same CATH homology
 4IE4 A;  4QXH B;  2A72 A;  2D0U A;  3I1A A;  4WBO A;  3O4X E;  2H7V C;  1EZ3 A;  3OYX A;  5JDQ A;  3F2E A;  4PJM A;  4TUY E;  1UX4 A;  4G2A A;  3J7Y q;  4CI1 B;  4G63 A;  4M1P A;  4ZI7 E;  3MAC A;  2MYS A;  4EB6 E;  1OWA A;  2ZM2 A;  2BVL A;  4U72 A;  4HN9 A;  3KIN B;  4MFR A;  1CUN A;  5EK2 A;  4MBQ A;  2XHE B;  2ZM0 A;  3RC8 A;  1YW0 A;  5CA1 E;  1D1B A;  1LVK A;  3CX7 B;  5JR9 C;  2I59 A;  3E0Z A;  3QUJ A;  2XAH B;  1MMN A;  3BQI A;  3RRW A;  3IBP A;  2W61 A;  3ZCJ A;  4V1A v;  4AXP A;  2J1D G;  1O3X A;  3PE0 A;  4FJO A;  4ISS A;  1MIY A;  3WAJ A;  2V26 A;  2JPF A;  4H9P C;  3WI3 A;  5E0O A;  5JR9 B;  5FY0 A;  4C90 A;  5KX5 E;  3HA4 A;  4ILU A;  4C91 A;  3RYC E;  5JR9 A;  4YFS A;  1V9D A;  1YKH B;  3L09 A;  3KV5 A;  1AJ3 A;  1X79 A;  2IC9 A;  4O4H E;  4AQG A;  4BAY B;  3C50 A;  4ZS3 A;  1H7C A;  3ZN1 B;  4F6R C;  3FXD B;  4OYK A;  2C5I T;  3GN5 A;  3K3Q C;  4AQF C;  2G0U A;  5LHG B;  4DVD A;  2X51 A;  3ZYM A;  4CXW A;  2WMO A;  3AAI A;  5LJM A;  2CXD A;  3C98 B;  4EXT A;  4CXY A;  4H9S E;  3N5L A;  3J9X 1;  3PUA A;  1D0Y A;  2VKJ A;  4PNI A;  2MBG A;  4BJN A;  1D0X A;  4IE7 A;  3UT5 E;  5H6Q B;  2L3L A;  5LHH B;  3OKQ A;  3I9W A;  1MMD A;  1WR6 A;  5H6R B;  2NW9 A;  2BVM A;  3BQL A;  4AQF A;  3S4U A;  4JLE A;  2YIN A;  3C64 A;  2W00 A;  4J2C A;  3ETV A;  2LSK A;  2P9B A;  2X68 A;  2VKD A;  3O1H A;  3R84 B;  3ZYK A;  4HE8 A;  2Q9Q C;  4ZOL E;  5LA6 E;  2C5J A;  2X9H A;  4EYU A;  3MKD A;  3LJC A;  4IHJ E;  4IE6 A;  2CEA A;  4PW8 A;  4ASK A;  1LVF A;  2A2F X;  3N2O A;  4UIG A;  1US7 B;  4P09 A;  4I43 B;  4L9I A;  5F3J A;  2Q9Q B;  4HTE A;  3NRY A;  3DJB A;  1HG2 A;  1G8X A;  2PJQ A;  2WWU A;  2ODU A;  3SWH A;  2Q9Q A;  4IDZ A;  2XAQ B;  3HKE E;  4UF0 A;  4O4I E;  2XTL A;  2NTX A;  4XZC A;  3B57 A;  2MTQ A;  4JEU B;  4UVC B;  4X1Y E;  3BQK A;  4PAG A;  5HXS A;  2V7J A;  3F31 A;  2DWK A;  5L3B B;  5LNK A;  2UXX B;  5HXR A;  1VRB A;  2X67 A;  3C4Z A;  2YEV C;  1WYB A;  3CX8 B;  5FXX A;  2V7M A;  4WNK A;  5JVD E;  2EHO B;  4DND A;  2XAJ B;  2CXF A;  4E7S A;  3N9N A;  5TAO A;  3EUH A;  3MA9 A;  3HKD E;  5LGU B;  5JH7 E;  1FEW A;  4UV8 B;  5JDL A;  3UFE A;  3O1I A;  4ZS2 A;  3Q2M A;  2CXL A;  2Y8D A;  4HEA A;  4HKA A;  4QWN B;  2RP4 A;  2CM0 A;  4DMW A;  4HGA A;  5M4Y A;  4DBR A;  2X66 A;  2X9W A;  4GK0 E;  1FMV A;  5FY7 A;  4XBF B;  3V5U A;  1KNZ A;  3LK2 B;  3KVA A;  3E08 A;  4PJJ A;  2VWA A;  3ZMS B;  1WRD A;  4AKI A;  3ZLI A;  2UXN B;  5LHI B;  2MOZ A;  2NOX A;  2N9D A;  3Q5W A;  1IAP A;  5DJQ C;  3N9P A;  3HR0 A;  1VOM A;  5JRC B;  4O2B E;  2LSI A;  3KDS E;  4XAX B;  5FMN A;  5LJN A;  3CQX C;  2XAS B;  4IIJ E;  4O4L E;  4KMC A;  2XAG B;  5JDH A;  4UVB B;  3KBU A;  4H9O C;  3F57 A;  2X9X A;  5LG4 A;  4P0A A;  4ADZ A;  1BR1 A;  4K0U A;  2ZLY A;  3RYF E;  4JEH B;  4DO0 A;  3OYZ A;  3U3I A;  1ZKE A;  3HI2 A;  1YKE B;  2B1E A;  2Q9Q D;  5CA0 E;  3VHL A;  2IW5 B;  2V7K A;  2W63 A;  3CWZ B;  1NAF A;  4JUY A;  3ESL A;  4H9Q C;  2LJL A;  4X1I E;  2M67 A;  3H3A A;  2NWB A;  3N9O A;  3C51 A;  2K48 A;  4OK0 A;  4ZI2 C;  1NWM X;  5JQG E;  4YHJ A;  1SHZ C;  2SPC A;  2JQQ A;  2Y48 B;  2CWO A;  2Z6E A;  4B6X A;  1SA0 E;  3I0O A;  3CKD A;  3U78 A;  3PDY A;  5GON E;  4PK6 A;  3AB3 B;  2WM9 A;  1ZEE A;  3C4W A;  3O9X A;  4MAL A;  2YU1 A;  3CML A;  3PU3 A;  4PK5 A;  2A3D A;  1E1H B;  4TZ4 C;  5FYM A;  3LBX B;  2LOP A;  1QUU A;  3O1J A;  3IF8 B;  4KP3 C;  3RC3 A;  3AA1 B;  3LK3 B;  5L3G B;  2XQY A;  4QX7 B;  3TKL B;  1OXZ A;  4EOZ B;  2LSG A;  2VKO A;  3ZC0 A;  1MND A;  3ZC1 A;  3I0Q A;  3ZJ2 A;  2ODV A;  3NRX A;  3WAK A;  5LCY A;  2W0G A;  2OA5 A;  1IZN B;  2GK9 A;  4PK4 A;  4TV8 E;  4UEM A;  3RX6 A;  3RRC A;  4X20 E;  5L3E B;  4QKN A;  5LXT E;  1YD8 G;  3NBX X;  2YK0 A;  2E8I A;  4ZI3 D;  3KBT A;  3BK9 A;  3PTR B;  4NUV A;  2IAK A;  3FXE B;  4I4T E;  2JJ9 A;  2N2N A;  2NW7 A;  4EAH A;  2PBI A;  2DWG A;  2WSS V;  1D1A A;  4QXC B;  1U5P A;  4OFZ A;  4KUM B;  2XUE A;  4UXN B;  2ACX A;  4IE5 A;  2IC6 A;  3PUQ A;  1D1C A;  3R6N A;  3SOL A;  3A5X A;  5JDF A;  1HFA A;  3E22 E;  3AA0 B;  3CQG B;  2D2S A;  3CX6 B;  3P7I A;  4O2A E;  5L3F B;  2ZMA A;  3AAA B;  5DAB A;  2H3R A;  5LYJ E;  4DMV A;  2E9X C;  2LHR A;  4BJM A;  2EHO C;  4TN7 B;  3JC6 C;  3PUR A;  3RKO A;  1IJ6 A;  3GA8 A;  2KIN B;  4MLK A;  5KDM C;  2ZM8 A;  3AAE B;  5IYZ E;  1FIO A;  3K8P C;  2X0L B;  4DBQ A;  2VB6 A;  2E9X B;  2HPJ A;  4L5G A;  4PJN A;  5F8P A;  3IHR A;  5J1G A;  4ZI2 D;  1BR2 A;  5HWX A;  2E9X A;  2EHO A;  4FI5 A;  3AVS A;  3ZMT B;  4GYS A;  5LOV E;  2DCF A;  2QGS A;  1LKX A;  4AI6 A;  3I9Y A;  4U74 A;  3UUN A;  2KWI B;  2V7L A;  3QK6 A;  3UTK A;  5LBM A;  3ZYL A;  1WLX A;  2H7O A;  1FMW A;  4QXB B;  1HTJ F;  4ERR A;  2W62 A;  3M65 A;  2JRK A;  4IGU A;  4L0R A;  3RH3 A;  4UV9 B;  4ANJ A;  5LGT B;  4UEL A;  3P8C D;  4IE0 A;  4QX8 B;  3VKH A;  4KBM B;  2JMH A;  2LSJ A;  2L8K A;  2RA1 A;  5FXV A;  4A56 A;  2LE8 A;  2Y6X A;  5KMG P;  2NW8 A;  1Z0P A;  3ANW B;  4EZ4 A;  1S35 A;  3RYH E;  4AKG A;  5JRE A;  3ZN0 B;  5JRC A;  3ANW A;  5CB4 E;  1MIW A;  3LG7 A;  2JMK A;  5JDG A;  3PU8 A;  5HWY A;  2CE7 A;  3W15 B;  1D0Z A;  1HCI A;  1S94 A;  2BZB A;  3HKC E;  3IEE A;  4PFO A;  2LSY A;  3PUS A;  2KZ7 B;  3LK4 2;  3HL6 A;  3MJX A;  4CZZ B;  4O8S A;  2WAU A;  4H9R C;  2LEH A;  2HH7 A;  3MZK B;  3H37 A;  2CA5 A;  3ZMZ B;  2CCQ A;  4YLH A;  3ZJ1 A;  4CXX A;  3ZCI A;  1UX5 A;  3RPU A;  2E9X D;  2EHO D;  4EIW A;  2WMN A;  1Y64 B;  3JC6 D;  5DQV A;  1BR4 A;  4ZHQ E;  2K5B B;  4TV9 E;  3AVR A;  3N9M A;  3KV6 A;  4GIW A;  3CVR A;  3DTO A;  5FNV E;  4CQI A;  3RYI E;  1HF8 A;  4BA9 A;  2LT3 A;  5J2U E;  3OJA A;  4CI2 B;  2DHR A;  3T8O A;  3CQC B;  3K3N A;  2KXP B;  4NUU A;  5AFU L;  5JDM A;  2KMF A;  3LBX A;  2D5U A;  3KV9 A;  5LGN B;  1T98 A;  3B13 A;  3FBZ A;  4Z8X A;  4E7Z A;  2V7I A;  2PG8 A;  1U4Q A;  3GMI A;  3NZP A;  2PFV A;  3ZPO A;  3GN5 B;  5L2L A;  4AKR B;  2DI4 A;  5FXW A;  5HXC A;  2CWY A;  4TX5 A;  4EYY R;  1HX8 A;  5EK4 A;  4H63 H;  4MHC A;  1MNE A;  3AA7 B;  3Q9D A;  5JDN A;  4I50 E;  1MMG A;  4OHF A;  3ETU A;  5HXH A;  5EK3 A;  5HXE A;  2V1D B;  2NP9 A;  2N1G A;  5IHY A;  4OYJ A;  3MK7 C;  2HPL A;  2DLR A;  3UUL A;  1G73 A;  2LOS A;  3ZMU B;  4YJ3 E;  4PJL A;  3N2G E;  3FBL A;  5BMV E;  2CMR A;  2D0T A;  4N78 D;  2KND A;  3HKB E;  2KWH A;  3EDV A;  4WW0 A;  3ONX A;  4GK5 E;  3PUG A;  1UCU A;  4GYR A;  2LM9 A;  4X1K E;  2VKH A;  3CPZ A;  2X9Y A;  2YU2 A;  3FB2 A;  3LFM A;  5ETW A;  3SS1 A;  4GOU A;  5FXZ A;  2NTY A;  1ZV4 X;  3V5S A;  2K9A A;  1QSD A;  3KVB A;  4QHO A;  2BDE A;  2VAS A;  2K24 A;  4UF0 B;  3N2K E;  3QC9 A;  5DQW A;  2XAF B;  4O4J E;  4WBN E;  2WBL A;  5ADX L;  3GWH A;  3D0T A;  1MIV A;  1LRZ A;  3AA6 B;  3UUM A;  5FY1 A;  1HS7 A;  1HG5 A;  1IJ5 A;  3N9Q A;  3MXZ A;  3DP7 A;  4IST A;  2DNX A;  2QA7 A;  2VL8 A;  3OBV E;  5C8Y E;  4I55 E;  3SRZ A;  3K3O A;  1BR0 A;  3FHN A;  5EZY E;  3UUX B;  4AKH A;  5A1L A;  2CLY C;  2KLQ A;  4P0B A;  2KT9 A;  2C5K T;  3Q5X A;  2VK9 A;  3NZQ A;  5FP3 A;  3ZMV B;  1MMA A;  5L3D B;  3VU7 H;  3L3P A;  2LHN A;  1B7T A;  3N9L A;  4H9N C;  4AKL A;  3ZEF B;  3VKG A;  4HFV A;  4YJ2 E;  3EVY A;  2CLY B;  4UVA B;  1ZHC A;  5HYA A;  4CI3 B;  1KK7 A;  5LP6 E;  2L9Q A;  5J2T E;  3KFW X;  4H63 V;  4ZI3 C;  4PFP A;  2ES0 A;  1WYC A;  4EZH A;  3EDU A;  5LBQ B;  3KV4 A;  5HAX A;  5L3C B;  3C4X A;  2C0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...