4CZZB

Histone demethylase lsd1(kdm1a)-corest3 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
CRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQGVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords LYSINE-SPECIFIC HISTONE DEMETHYLASE 1A
publication title Differential Properties of Transcriptional Complexes Formed by the Corest Family.
pubmed doi rcsb
source organism Homo sapiens
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
B PF01448 ELM2 ELM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4czzB00
5L3BB 2UXNB 4BAYB 5H6QB 4XBFB 4UVCB 5LGNB 2XAQB 4UXNB 5LGTB 5L3FB 5L3EB 4CZZB 2XASB 5LGUB 4KUMB 4UV8B 5H6RB 2XAFB 3ZMTB 2XAGB 3ZMVB 3ZMSB 3ZMZB 5LHIB 2Y48B 4UV9B 2XAHB 2V1DB 2UXXB 5L3DB 2X0LB 2XAJB 2IW5B 5LHHB 5L3CB 4UVAB 5LBQB 5LHGB 4UVBB 3ZMUB 3ZN0B 5L3GB 3ZN1B
chains in the Genus database with same CATH superfamily
2OA5A 3HKEE 4JV5T 3KFWX 3IHRA 3ZMTB 3Q5DA 3NVOA 1G73A 2LRKA 3IEEA 4X1IE 3ABVA 1I6ZA 2NW9A 2X66A 1Y01A 3C4ZA 4EYYR 2HPLA 3VU7H 4UVCB 2H88A 5DQWA 1ZEEA 5HEOA 5L47A 5JTGA 2XM1A 2XAGB 2GK9A 1WR6A 1KNZA 2IAKA 4GOUA 2N9DA 2WP9A 4HWIB 5FXXA 2J47A 1HNWT 2VL8A 2E9XD 3KV4A 2WWUA 2DWGA 3Q2MA 2ACZA 3HKCE 4Z91A 4A5XA 4PAGA 2SPCA 4HFDA 2I59A 2WM9A 2JJ9A 4IHJE 2D9DA 4JYAT 2XQ6A 3P4RA 1HF8A 5DQVA 2YEVC 4EAHA 2EHOB 4UF0B 2XSBA 2CRBA 3CX6B 4ZZBA 4JI4T 4YY3T 4TV8E 1M62A 2M6BA 4GKKT 1MIYA 5AQHB 2E5LT 3A5XA 2BVMA 3PUYF 3J9X1 2BBJA 2W63A 4OYKA 1UGOA 3AAEB 4OHFA 5LHIB 2QVAA 2NW8A 4I0UA 2JMKA 2VVNA 1LVFA 3BQLA 4LF5T 3PTRB 1Y64B 3JADA 2UUCT 4O4HE 5BR8T 3AE3A 1U4QA 4WZXA 5ABGA 4EEDA 2JRKA 3ZN1B 4IDQA 5CGMA 2Y6XA 2X9XA 4JEHB 5HXCA 3DJBA 3KINB 2BDEA 4IE7A 4NIQA 1J5WA 2XQAA 3UFGA 5ETWA 2YDQA 3QC9A 2W61A 4DR6T 5DJQC 3S4UA 5AQFB 1OWAA 4B6XA 5L3DB 2H89A 4OK0A 4UVAB 3RRCA 5AQNB 3H3AA 1Z8UA 2XQ9A 4AKLA 4WBOA 4JI5T 1MNEA 5LB7B 4ILCA 3U78A 4BJNA 4QH5A 1H7CA 5AQKB 3RRWA 2WY2A 1W0BA 2KT9A 4YFSA 4PFPA 4H9RC 5JREA 2Q9QC 2ZM6T 3VKHA 1J5ET 2KLQA 2CPTA 2V7IA 2BZBA 3EABA 4NPPA 4IE6A 4O2AE 1KFYA 1KF6A 1L0VA 1MMDA 3RLFF 2W2UA 4DV5T 4KI0F 4EIWA 1D1AA 1XDOA 3LBXB 2XTLA 2DCFA 4UEMA 3U3IA 3QB5K 2YKSA 1ZHCA 2V6YA 3VRBA 3ZC1A 1M7KA 4UV8B 3CKDA 1LKXA 3EVYA 1SA0E 1VCSA 4O8SA 2D2SA 3UUMA 4UVBB 4PNIA 3B5MA 4DR5T 3NZPA 3AECA 3UT5E 4X1YE 4ZI7E 2XQ7A 2KNDA 1SHZC 2LSYA 4LMKA 5L3CB 2F4VT 5LMNT 1V9DA 3B13A 4AQFA 3GMIA 2V7KA 2NR4A 4PJLA 2YDSA 5LNKA 2CLYB 2BS4A 4LFCT 3O1JA 4Z90A 3A7MA 4CN4A 1Z0PA 3HKDE 3AA0B 4HN9A 2CXDA 1OXZA 5LGTB 4BAYB 5LGNB 3OKQA 3PUGA 4ILBA 2PG8A 2W66A 2C0SA 5EK4A 5LP6E 1X79A 2NTXA 3RIUA 3RQWA 4UV9B 1HCIA 4ZXLA 4HFEA 2FJDA 2V8SV 2E9XC 3AAAB 2VURA 2CWYA 4ERRA 3CQCB 3OYXA 1S94A 4X20E 1UURA 1VOMA 3ZYKA 4IDZA 5JH7E 4DO0A 4I50E 3UU8A 3C4XA 3ZT5A 2E2AA 4U2ZA 3CX8B 3JCFA 4ADZA 2V5DA 2JMHA 2X67A 5JR9A 5AQJB 2XSAA 4DR4T 5J2UE 1UCUA 4IGUA 2XAHB 3Q5XA 4P0AA 4DR3T 3N9MA 5ABEA 2W62A 3DTOA 2QYWA 3MZKB 4IE5A 2WWVA 4YTPA 3FZLB 3ZT6A 5L3GB 5DABA 4GKJT 4ZS2A 3C98B 5L3FB 5LJNA 3ZJ2A 2W67A 4B3ST 5AQIB 2YU1A 5AQLB 4EZHA 2CCQA 4U33A 2CWOA 3AEAA 3O1IA 4HFVA 5JRCB 3PDYA 2UU9T 1HG2A 3FBLA 5FP3A 1CUNA 1S35A 3T8OA 3UQ4A 5HWXA 1NENA 3VKGA 3RYHE 1HFAA 4O4JE 2LT3A 1WYBA 3N9PA 4X65T 5FMNA 3AE9A 4TV9E 3K8PC 4TWHA 3AVRA 2Y8DA 3PUVF 5JDQA 3D0TA 5LXTE 1U5PA 2N1GA 3WAKA 2X9WA 2LKGA 2KXPB 1EZ3A 2EHOD 2L8KA 1W9RA 2MPKA 1N33T 2XQYA 2JIWA 4YSXA 4MALA 5JDGA 3I1AA 2RP4A 4C91A 4JI7T 5AQSB 1HS7A 3KV9A 5HXSA 1XNRT 5KXJA 3K3NA 3ANWA 2AXDS 4DV4T 2CEAA 1HNXT 3IA3A 4QWNB 2WMNA 5FYMA 4QH4A 1HX1B 2UUAT 3DP7A 2CM0A 3FZMB 4H9SE 2NP9A 2CBJA 4LF4T 4ISTA 1E7PA 1ZV4X 1FIOA 2ACXA 4CN6A 2I0MA 2N2NA 1UX4A 4J2CA 4LF8T 5FXWA 2BG9C 3AB3B 2QGSA 4EXTA 3RIAA 4ASKA 4ZI2D 5FVKA 1W09A 2K48A 4LMLA 3HI2A 1R8IA 1D0ZA 2X68A 4JUYA 3RIFA 3P4WA 5FY1A 5HXHA 5HEUA 4X62T 3RYCE 4AXPA 1WCRA 3JC6D 3TLVA 5JDHA 3N9QA 2L9QA 3AE6A 4TWDA 4KP3C 3BK9A 3B57A 4TWFA 1D1BA 3P8CD 3BQKA 2Q9QA 5JDFA 4AKRB 4EOZB 2KWIB 4DUZT 5L2LA 2HN2A 1OEDC 3E22E 2IDOB 5LA6E 1X9BA 1XWMA 3RC8A 1D0YA 3TLTA 4XZCA 2VK9A 4ZI3D 2XQ5A 2MAWA 2X9YA 2IC9A 1D0XA 4QXHB 4I4TE 5JVDE 3OPCA 3VRAA 3ZMSB 3AXJA 2DI4A 5F5WA 2QA7A 4ANJA 2XQ3A 4KBMB 2HPJA 2WS3A 2YK0A 1HTJF 3ETUA 4X66T 2H3RA 3PUWF 5J1GA 4DR7T 2RA1A 1CHUA 2V1DB 3VR8A 4PJNA 5LBQB 4AKGA 3OBVE 4YSZA 1HG5A 3ZPOA 2JQ9A 1WLXA 1IZNB 2LSJA 2DLRA 4F6RC 3PU3A 3IBPA 3RC3A 4E7ZA 2G0UA 4H9PC 2A3DA 3T1HT 4YSYA 2I6HA 3GN5A 3ETVA 2ZMAA 4COFA 4DNDA 5KX5E 3NRXA 4UIGA 3SOLA 2VQET 1YD8G 4CXXA 1MMAA 2E9XA 2MBGA 1XNQT 2KWHA 2LM2A 1MMNA 1HR0T 2C5IT 3RYFE 3CQXC 5A1LA 4GYSA 4WYVA 4WBNE 3KV6A 4HEAA 4P1NA 4NXNT 4KMCA 3BQIA 2XAJB 1VCTA 3AVSA 4HFBA 4CI2B 3QOFA 5HXRA 2EHOC 3ZT7A 4ZZCA 1VRBA 1IBMT 2XQ4A 2PTFA 3HR0A 5E0OA 5HEHA 2ZM8A 4HWHA 5EK3A 3RX6A 5JDMA 1YKEB 5HEJA 3CPZA 2IIUA 3CK6A 2WDRA 5L4HA 4L5GA 4H63V 1IBLT 3FZFB 5GONE 4U3CA 2X51A 4NUVA 4IDPA 2CXFA 4IDNA 4ZEYA 1HX8A 3L8RA 4EGWA 2LKHA 5EK2A 2X0HA 2BVLA 5IUXA 4IT4A 2QRXA 1KK7A 3GA8A 2FBWA 5LBMA 2VVSA 2ODUA 3EUHA 4IIJE 1E2AA 4ZI2C 3FXDB 1IJ6A 3H3MA 3MK7C 2D0UA 3O9XA 5LOVE 3KVBA 5L3EB 2WMOA 2R6GF 5H6RB 3N2KE 3KV5A 4WW0A 1NWMX 5F3JA 2V6YB 4HE8A 4MHCA 4U7IA 4ZS3A 3JC6C 3ZEFB 2KZ7B 4DV3T 5CJ5A 1XZYA 3P7IA 3F31A 1ZOYA 4H63H 2NOXA 3RPUA 2LJLA 4HKAA 2FJEA 3TLSA 3AA1B 3N9OA 2C5JA 2YU2A 5AQPB 4OFZA 3FBZA 1E1HB 2CHOA 3ZYLA 3AEGA 1NAFA 3C51A 4OX9T 3RH3A 2VASA 4JI3T 2JQQA 3NBXX 1ZP0A 4I55E 3AE1A 3ZLIA 5KMGP 4ZI3C 1FMVA 3LJCA 1XDPA 2LSGA 4GIWA 4AISA 2WQYA 2MTQA 2BG9A 4UR9A 1AJ3A 2NTYA 4CQIA 2V5CA 5TAOA 2MYSA 5ABFA 1SE7A 4JI1T 4HFIA 3P4SA 2LRLA 3G06A 3K3QC 4IL4A 4A56A 3PUXF 2AE9A 2NWBA 4JBWF 5C3JA 3ONJA 2LHRA 3QB5A 2UXXB 3KBTA 3ZSSA 1FMWA 3JAFA 5JDLA 3AEEA 4O4LE 4QX7B 3E0ZA 1YKHB 1GQEA 3P4QA 2CLYC 4A97A 3SS1A 4U7YA 3OVUA 1UUSA 3EDVA 4PJJA 3WAJA 2DHRA 5JR9B 3FZHB 1YW0A 4I43B 3HA4A 3SRZA 2IC6A 2LE8A 2XPKA 1LRZA 3NRYA 3LSVA 3UU3A 3TKLB 1OEDA 5ABHA 5L3BB 3NWIA 2K24A 4DUYT 3AEDA 4LMJA 4P0BA 1DU2A 4XAXB 5LCYA 4AIUA 3FXEB 3AAIA 2LM9A 4BA9A 1KNRA 5CA0E 3AE7A 4FJOA 3UUBA 3UTKA 3EAMA 3PU8A 3ZCJA 2XJ7A 5HCJA 3KDSE 2BBHA 4PFOA 2LOSA 4IREA 4PK4A 3RQUA 1MIWA 2E8IA 3PUZF 4MLKA 2WBLA 3UULA 5FL0A 4DV0T 3T1YT 3PE0A 1WYCA 2IW5B 2K5BB 3F2EA 5FY7A 2Q9QD 3M65A 2XAQB 3X1DA 4TX5A 1XMQT 3ZYMA 3CQGB 4KHPT 2KMFA 4QXBB 1QSDA 5IHYA 4HGAA 2VKDA 4F8HA 4MFRA 4TN7B 3RKOA 3E08A 3ONXA 3C4WA 2A2FX 1WFDA 2WAUA 1UK5A 4U2YA 1FJGT 3I9WA 4JLEA 1YQ4A 2X0LB 4QHOA 4GK0E 5H6QB 4XBFB 3VHLA 5AFUL 2XM2A 5AQUB 3JAEA 1HNZT 3R84B 4DMVA 2HHHT 4X1KE 4DV2T 3ZMZB 2Y48B 4YHJA 4BJMA 3ANWB 4YLHA 3QUJA 5LHGB 4HTEA 3ZMUB 1LVKA 4AQGA 3P50A 3Q9DA 2WDQA 5BMVE 3ZJ1A 3PJAA 4K0KT 2D0TA 3L09A 3WI3A 4NXMT 5J0ZA 3EI0A 4B3MT 1I94T 3SFDA 3Q5EA 2J4GA 3TLUA 1KNPA 2EHOA 4UF0A 2HN1A 4V1Av 4YHHT 5AQTB 3CIRA 3UU4A 4DV7T 5KDMC 2RPAA 4UXNB 2YN6A 4ILUA 1IJ5A 4HWFA 4HWCA 4H9QC 2IMLA 4QKNA 4AI6A 2LHNA 4YT0A 3AA6B 4ILAA 3UFEA 1BR1A 4ISSA 4EEBA 4UELA 3UUNA 3Q5WA 1ZKEA 3FB2A 3FZKB 3ESLA 2VL0A 1W0AA 1NEKA 4AKHA 4K0UA 3V5SA 3M3ZB 1D1CA 1QLBA 3HKBE 4U74A 5FL1A 3RF1A 3I9YA 4WNKA 3LK3B 1N36T 3VR9A 5M4YA 5FXZA 2Q9QB 2BKOA 5J2TE 5LYJE 3C64A 2KINB 3V5UA 2B76A 4L9IA 4U72A 3EHZA 4JI6T 3N5LA 3OJAA 2W0GA 1G8XA 2XASB 3MJXA 3NKZA 5IYZE 4X5TA 4O2BE 2VWAA 2H7OA 2M67A 2CXLA 1J1JA 3N2GE 3CVRA 2LOPA 3AXJB 2CE7A 4N78D 4YJ2E 3TLWA 4DIDB 2WU2A 2UXCT 4CI1B 1FEWA 2XY8B 4DR2T 4P09A 3EDUA 1B7TA 2X9HA 5LHHB 4JEUB 3ZC0A 2J62A 2XZEA 1MMGA 1N34T 3AE8A 3ZN0B 3OTOT 3O4XE 3LBXA 1YQ3A 2WDVA 3OYZA 4ZOLE 4LFAT 3NZQA 4GK5E 4DV1T 2PFVA 2VKJA 2FJBA 4CN1A 4IE0A 3UU6A 4LF6T 5HCMA 4AKIA 2LEHA 3W15B 2JQKA 3A8YC 2WZHA 3MKDA 2YDRA 3RHWA 3AA7B 1O3XA 4CZZB 5CFBA 1KEYA 3GN5B 4HWDA 2XAFB 5AQGB 3LK2B 2ODVA 3ZSTA 2J1DG 4OYJA 3CWZB 2WU5A 4YJ3E 2L3LA 2E9XB 2BS2A 2IHR1 2K9AA 5AQQB 2VKHA 3N2OA 3L3PA 3UQ7A 2WB5A 2WCAA 2V7LA 4G63A 2FJAA 4IE4A 4EYUA 5HEGA 4DBRA 2CHNA 2A72A 1YXRA 3PJAJ 3AE2A 4JI2T 2P9BA 5AQMB 3C50A 1T72A 2K3WA 3SWHA 1JNRA 1XMOT 4JI8T 2NW7A 3FHNA 3IF8B 2BKNA 3L39A 2DL1A 5EZYE 4H9OC 4X64T 2W00A 4U31A 2LLYA 5CA1E 3RGLA 3AEBA 1MNDA 4NUUA 1WRDA 2UXNB 1UX5A 3H37A 2PJQA 3P4PA 1IAPA 1US7B 5HYAA 3LFMA 4IL9A 3LK42 4KX6A 5ADXL 4M1PA 3R6NA 4DMWA 3RKGA 3K1SA 3PUSA 5LG3A 1T8BA 2KSRA 4A98A 3PUAA 2M6IA 4EB6E 2FUPA 4CXWA 3CX7B 4E7SA 2H7VC 4KUMB 2ZM2A 1BR2A 1T7SA 4B3RT 2BS3A 3KBUA 3HL6A 4HFCA 3RI5A 2UUBT 3LDQB 4PW8A 2CMRA 5HWYA 1BR4A 2OLTA 4IDOA 2B1EA 5JRCA 3ZCIA 2PBIA 4FI5A 5C8YE 3ZMVB 4YTMA 3O1HA 2ES0A 3K3OA 4Z8XA 4EZ4A 4DV6T 5IWAT 4O4IE 4DR1T 2WZIA 2XUEA 4H9NC 1BR0A 5HXEA 5LGUB 3PUQA 3ZKRA 3I0OA 2VB6A 2YOEA 3CMLA 5F8PA 4PJMA 3QK6A 5JQGE 5FY0A 2YINA 2DNXA 5C2TA 4PK6A 3J7Yq 3I0QA 4CXYA 1N32T 4B3TT 2XHEB 2E5VA 5FNVE 5FKYA 3PURA 2BG9B 4YTNA 2UXDT 3ONLC 1WR0A 2CBIA 4TNWA 2VQFT 5ABFB 4KHZF 2V7JA 2JQHA 3PV0F 2W4XA 4HFHA 4EV6A 3GWHA 4DVDA 5AQVB 2A9UA 5FXVA 4TZ4C 2BG9E 4MBQA 2MOZA 3AE4A 5L4EA 3N9LA 4QX8B 5JDNA 4AQFC 3UU5A 4LFBT 5LJMA 4YXDA 3KVAA 4LF7T 2OV9A 2LSKA 2ZM0A 2CA5A 1T98A 2VKOA 2LSIA 5CB4E 4CI3B 4ZHQE 4QH1A 3MXZA 2V6XA 3MA9A 2XQ8A 1OEDB 3LG7A 4TUYE 2JPFA 1JNZA 2D5UA 2V7MA 4Q25A 5AQOB 2V26A 2ZLYA 3RIUC 1IBKT 3F57A 3N9NA 2X0YA 2UXBT 4PK5A 2IUBA 3UUXB 1MIVA 5AQRB 4C90A 4DBQA 5FVLA 1QUUA 1OEDE 4G2AA 2BKPA 3AEFA 5HAXA 4JI0T 5LMUT 4L0RA 4AQYT 2Z6EA 3MACA 4GYRA 3AE5A 1SUMB 2WSSV 2C5KT 4TNVA 4QXCB 2HH7A 2DWKA 5JR9C 3RYIE 3QNUA 4LF9T 5LG4A 3SFEA
chains in the Genus database with same CATH topology
4N78D 1CUNA 2OA5A 4YJ2E 2D0UA 1S35A 3T8OA 5LOVE 3HKEE 3O9XA 3KVBA 5HWXA 5L3EB 3KFWX 2WMOA 5H6RB 3IHRA 3N2KE 3VKGA 3ZMTB 4CI1B 3KV5A 1FEWA 4WW0A 1NWMX 5F3JA 1G73A 4P09A 3IEEA 4X1IE 3EDUA 3RYHE 1HFAA 4HE8A 4O4JE 2LT3A 4MHCA 1B7TA 2X9HA 1WYBA 5LHHB 4ZS3A 3JC6C 4JEUB 3ZEFB 3ZC0A 2NW9A 2X66A 3C4ZA 2KZ7B 3N9PA 4EYYR 1MMGA 3ZN0B 2HPLA 3VU7H 5FMNA 4UVCB 3P7IA 3F31A 3O4XE 4TV9E 5DQWA 3K8PC 1ZEEA 3LBXA 4H63H 4ZOLE 3OYZA 3AVRA 2NOXA 3RPUA 3NZQA 4GK5E 2LJLA 2XAGB 2GK9A 2Y8DA 4HKAA 1WR6A 3D0TA 2PFVA 5JDQA 1KNZA 2VKJA 2IAKA 4GOUA 4IE0A 5LXTE 2N9DA 1U5PA 2N1GA 3AA1B 3WAKA 3N9OA 4AKIA 2LEHA 5FXXA 2X9WA 2KXPB 3W15B 2VL8A 1EZ3A 2C5JA 2E9XD 2YU2A 4OFZA 3FBZA 1E1HB 2EHOD 3KV4A 2WWUA 3MKDA 2DWGA 3Q2MA 2L8KA 3HKCE 3ZYLA 1NAFA 4PAGA 3AA7B 2SPCA 1O3XA 4CZZB 2XQYA 3C51A 3GN5B 3RH3A 2VASA 2XAFB 2JQQA 3LK2B 3NBXX 2ODVA 4MALA 2J1DG 5JDGA 4I55E 2I59A 2WM9A 4OYJA 3ZLIA 2JJ9A 4IHJE 3I1AA 5KMGP 3CWZB 2RP4A 4C91A 4ZI3C 1FMVA 3LJCA 4YJ3E 1HS7A 3KV9A 2LSGA 5HXSA 2L3LA 2E9XB 1HF8A 4GIWA 5DQVA 2YEVC 3K3NA 2EHOB 4EAHA 4UF0B 3ANWA 2K9AA 2MTQA 2VKHA 2CEAA 3N2OA 3L3PA 3CX6B 4QWNB 1AJ3A 2WMNA 2NTYA 4TV8E 5FYMA 4CQIA 3DP7A 5TAOA 1MIYA 2V7LA 4G63A 2MYSA 2CM0A 3A5XA 2BVMA 3J9X1 4H9SE 4IE4A 2NP9A 4EYUA 2W63A 4DBRA 4ISTA 1ZV4X 4OYKA 1FIOA 2ACXA 2A72A 3K3QC 4A56A 3AAEB 2P9BA 2N2NA 2NWBA 1UX4A 4OHFA 3C50A 4J2CA 5LHIB 2NW8A 2LHRA 2JMKA 2UXXB 3KBTA 3SWHA 1LVFA 3BQLA 1FMWA 3PTRB 1Y64B 5FXWA 3AB3B 5JDLA 2QGSA 4EXTA 4O4LE 4QX7B 4ASKA 3E0ZA 4ZI2D 4O4HE 2K48A 1U4QA 1YKHB 2NW7A 3FHNA 2CLYC 2JRKA 3ZN1B 3HI2A 3SS1A 3IF8B 1D0ZA 2X68A 2Y6XA 4JUYA 2X9XA 4JEHB 5HXCA 5FY1A 5HXHA 5EZYE 3DJBA 3EDVA 4PJJA 4H9OC 3RYCE 3WAJA 2W00A 2DHRA 3KINB 5CA1E 5JR9B 1YW0A 4I43B 3HA4A 4AXPA 1MNDA 3SRZA 2IC6A 2LE8A 3JC6D 1LRZA 3NRYA 4NUUA 2BDEA 3TKLB 5JDHA 4IE7A 3N9QA 2L9QA 1WRDA 5L3BB 2UXNB 4KP3C 3BK9A 1UX5A 2K24A 3H37A 2PJQA 3B57A 1IAPA 5ETWA 3QC9A 1D1BA 1US7B 2W61A 3LFMA 3P8CD 4P0BA 4XAXB 5DJQC 5HYAA 5LCYA 3LK42 3FXEB 3S4UA 3AAIA 5ADXL 2LM9A 4M1PA 4BA9A 3R6NA 4DMWA 3PUSA 1OWAA 3BQKA 5CA0E 2Q9QA 4B6XA 5L3DB 3PUAA 4OK0A 4UVAB 5JDFA 3RRCA 4AKRB 4EOZB 4FJOA 3H3AA 2KWIB 4EB6E 3UTKA 3PU8A 3ZCJA 4AKLA 4WBOA 5L2LA 1MNEA 4CXWA 3KDSE 3CX7B 3U78A 4E7SA 4PFOA 2H7VC 2LOSA 4BJNA 4KUMB 4PK4A 1MIWA 2E8IA 3E22E 4MLKA 5LA6E 2ZM2A 1BR2A 2WBLA 3UULA 3RC8A 1D0YA 1H7CA 3KBUA 3HL6A 4XZCA 3PE0A 3RRWA 1WYCA 2KT9A 4YFSA 2IW5B 4PFPA 4PW8A 2CMRA 5HWYA 2K5BB 2VK9A 4H9RC 4ZI3D 3F2EA 5FY7A 2Q9QD 5JREA 2Q9QC 1BR4A 3M65A 3VKHA 2X9YA 2IC9A 1D0XA 2XAQB 2KLQA 2V7IA 2B1EA 2BZBA 4QXHB 5JRCA 4TX5A 3ZCIA 2PBIA 4I4TE 5JVDE 4IE6A 3CQGB 3ZYMA 4FI5A 5C8YE 4O2AE 3ZMVB 3ZMSB 2KMFA 3O1HA 4QXBB 1MMDA 1QSDA 2DI4A 2QA7A 2ES0A 3K3OA 4Z8XA 4ANJA 5IHYA 4EZ4A 4EIWA 1D1AA 3LBXB 4HGAA 2XTLA 2DCFA 4UEMA 3U3IA 4KBMB 4O4IE 2VKDA 1ZHCA 4MFRA 2XUEA 4H9NC 2HPJA 3ZC1A 2YK0A 1HTJF 3ETUA 1BR0A 5HXEA 4TN7B 3RKOA 5LGUB 2H3RA 3E08A 3PUQA 4UV8B 3ONXA 3C4WA 3CKDA 5J1GA 2A2FX 2WAUA 3I0OA 2VB6A 1LKXA 2RA1A 3EVYA 1SA0E 2V1DB 4O8SA 3CMLA 3I9WA 4JLEA 5F8PA 2D2SA 2X0LB 4PJMA 3UUMA 4PJNA 3QK6A 5LBQB 4UVBB 4AKGA 5JQGE 4PNIA 5FY0A 3OBVE 2YINA 2DNXA 1HG5A 4QHOA 3ZPOA 4GK0E 5H6QB 4XBFB 1WLXA 1IZNB 3VHLA 2LSJA 4PK6A 5AFUL 3NZPA 2DLRA 4F6RC 3PU3A 3IBPA 3R84B 3RC3A 3J7Yq 4DMVA 3UT5E 3I0QA 4X1KE 4X1YE 4E7ZA 4CXYA 2G0UA 3ZMZB 2Y48B 4ZI7E 4H9PC 2A3DA 4YHJA 2KNDA 4BJMA 2XHEB 1SHZC 5FNVE 2LSYA 3ANWB 3PURA 4YLHA 5L3CB 3QUJA 3GN5A 5LHGB 1V9DA 3B13A 4HTEA 3ETVA 3ZMUB 4AQFA 1LVKA 3GMIA 2ZMAA 4AQGA 2V7KA 3Q9DA 4PJLA 5LNKA 4DNDA 5KX5E 5BMVE 2CLYB 3ZJ1A 2D0TA 3L09A 3NRXA 3O1JA 4UIGA 3SOLA 3WI3A 1YD8G 4CXXA 2V7JA 1MMAA 2E9XA 1Z0PA 3HKDE 3GWHA 2MBGA 2EHOA 4UF0A 4DVDA 4V1Av 5FXVA 3AA0B 4TZ4C 2KWHA 4HN9A 4MBQA 2MOZA 1MMNA 2CXDA 5KDMC 1OXZA 5LGTB 4BAYB 3N9LA 5LGNB 2C5IT 3OKQA 4QX8B 3RYFE 3PUGA 5JDNA 4UXNB 3CQXC 4AQFC 5A1LA 4GYSA 4WBNE 4ILUA 1IJ5A 2PG8A 3KV6A 4HEAA 2C0SA 5LJMA 5EK4A 5LP6E 1X79A 2NTXA 4UV9B 3KVAA 4H9QC 4KMCA 4QKNA 1HCIA 4AI6A 3BQIA 2LSKA 2ZM0A 2CA5A 2XAJB 2LHNA 1T98A 2VKOA 2LSIA 3AVSA 3AA6B 2E9XC 4CI2B 3AAAB 5HXRA 2EHOC 3UFEA 1BR1A 4ISSA 2CWYA 1VRBA 4UELA 3UUNA 5CB4E 3Q5WA 4ERRA 4CI3B 4ZHQE 3CQCB 3MXZA 3OYXA 1S94A 4X20E 1ZKEA 3FB2A 3MA9A 3HR0A 3LG7A 3ESLA 4TUYE 5E0OA 2JPFA 2D5UA 1VOMA 4AKHA 4K0UA 3V5SA 2ZM8A 4IDZA 3ZYKA 2V7MA 1D1CA 2V26A 5JH7E 3HKBE 2ZLYA 5EK3A 4I50E 4DO0A 4U74A 3RX6A 3C4XA 5JDMA 3F57A 3N9NA 3I9YA 4WNKA 1YKEB 3LK3B 3CX8B 4ADZA 5M4YA 2JMHA 5FXZA 2Q9QB 3CPZA 4PK5A 5J2TE 2X67A 5JR9A 5LYJE 3C64A 3UUXB 1MIVA 4C90A 5J2UE 4DBQA 1QUUA 2KINB 4L5GA 4H63V 1UCUA 4IGUA 2XAHB 4G2AA 3V5UA 3Q5XA 4P0AA 5GONE 5HAXA 2X51A 4NUVA 2CXFA 3N9MA 2W62A 3DTOA 4L9IA 4L0RA 1HX8A 2Z6EA 3MZKB 4IE5A 4U72A 3MACA 4GYRA 5EK2A 3N5LA 5L3GB 5DABA 2WSSV 2C5KT 2BVLA 4QXCB 3OJAA 2HH7A 4ZS2A 3C98B 5L3FB 2W0GA 1G8XA 1KK7A 2XASB 3GA8A 3MJXA 5IYZE 5LJNA 2DWKA 3ZJ2A 4O2BE 5LBMA 2VWAA 2H7OA 2M67A 2ODUA 2CXLA 5JR9C 3RYIE 3EUHA 3N2GE 2YU1A 4IIJE 4EZHA 2CCQA 2CWOA 3O1IA 4HFVA 5JRCB 3PDYA 5LG4A 3CVRA 4ZI2C 2LOPA 3FXDB 1IJ6A 1HG2A 3FBLA 5FP3A 2CE7A 3MK7C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5L3B B;  2UXN B;  4BAY B;  5H6Q B;  4XBF B;  4UVC B;  5LGN B;  2XAQ B;  4UXN B;  5LGT B;  5L3F B;  5L3E B;  4CZZ B;  2XAS B;  5LGU B;  4KUM B;  4UV8 B;  5H6R B;  2XAF B;  3ZMT B;  2XAG B;  3ZMV B;  3ZMS B;  3ZMZ B;  5LHI B;  2Y48 B;  4UV9 B;  2XAH B;  2V1D B;  2UXX B;  5L3D B;  2X0L B;  2XAJ B;  2IW5 B;  5LHH B;  5L3C B;  4UVA B;  5LBQ B;  5LHG B;  4UVB B;  3ZMU B;  3ZN0 B;  5L3G B;  3ZN1 B; 
#chains in the Genus database with same CATH topology
 2OA5 A;  3HKE E;  4JV5 T;  3KFW X;  3IHR A;  3ZMT B;  3Q5D A;  3NVO A;  1G73 A;  2LRK A;  3IEE A;  4X1I E;  3ABV A;  1I6Z A;  2NW9 A;  2X66 A;  1Y01 A;  3C4Z A;  4EYY R;  2HPL A;  3VU7 H;  4UVC B;  2H88 A;  5DQW A;  1ZEE A;  5HEO A;  5L47 A;  5JTG A;  2XM1 A;  2XAG B;  2GK9 A;  1WR6 A;  1KNZ A;  2IAK A;  4GOU A;  2N9D A;  2WP9 A;  4HWI B;  5FXX A;  2J47 A;  1HNW T;  2VL8 A;  2E9X D;  3KV4 A;  2WWU A;  2DWG A;  3Q2M A;  2ACZ A;  3HKC E;  4Z91 A;  4A5X A;  4PAG A;  2SPC A;  4HFD A;  2I59 A;  2WM9 A;  2JJ9 A;  4IHJ E;  2D9D A;  4JYA T;  2XQ6 A;  3P4R A;  1HF8 A;  5DQV A;  2YEV C;  4EAH A;  2EHO B;  4UF0 B;  2XSB A;  2CRB A;  3CX6 B;  4ZZB A;  4JI4 T;  4YY3 T;  4TV8 E;  1M62 A;  2M6B A;  4GKK T;  1MIY A;  5AQH B;  2E5L T;  3A5X A;  2BVM A;  3PUY F;  3J9X 1;  2BBJ A;  2W63 A;  4OYK A;  1UGO A;  3AAE B;  4OHF A;  5LHI B;  2QVA A;  2NW8 A;  4I0U A;  2JMK A;  2VVN A;  1LVF A;  3BQL A;  4LF5 T;  3PTR B;  1Y64 B;  3JAD A;  2UUC T;  4O4H E;  5BR8 T;  3AE3 A;  1U4Q A;  4WZX A;  5ABG A;  4EED A;  2JRK A;  3ZN1 B;  4IDQ A;  5CGM A;  2Y6X A;  2X9X A;  4JEH B;  5HXC A;  3DJB A;  3KIN B;  2BDE A;  4IE7 A;  4NIQ A;  1J5W A;  2XQA A;  3UFG A;  5ETW A;  2YDQ A;  3QC9 A;  2W61 A;  4DR6 T;  5DJQ C;  3S4U A;  5AQF B;  1OWA A;  4B6X A;  5L3D B;  2H89 A;  4OK0 A;  4UVA B;  3RRC A;  5AQN B;  3H3A A;  1Z8U A;  2XQ9 A;  4AKL A;  4WBO A;  4JI5 T;  1MNE A;  5LB7 B;  4ILC A;  3U78 A;  4BJN A;  4QH5 A;  1H7C A;  5AQK B;  3RRW A;  2WY2 A;  1W0B A;  2KT9 A;  4YFS A;  4PFP A;  4H9R C;  5JRE A;  2Q9Q C;  2ZM6 T;  3VKH A;  1J5E T;  2KLQ A;  2CPT A;  2V7I A;  2BZB A;  3EAB A;  4NPP A;  4IE6 A;  4O2A E;  1KFY A;  1KF6 A;  1L0V A;  1MMD A;  3RLF F;  2W2U A;  4DV5 T;  4KI0 F;  4EIW A;  1D1A A;  1XDO A;  3LBX B;  2XTL A;  2DCF A;  4UEM A;  3U3I A;  3QB5 K;  2YKS A;  1ZHC A;  2V6Y A;  3VRB A;  3ZC1 A;  1M7K A;  4UV8 B;  3CKD A;  1LKX A;  3EVY A;  1SA0 E;  1VCS A;  4O8S A;  2D2S A;  3UUM A;  4UVB B;  4PNI A;  3B5M A;  4DR5 T;  3NZP A;  3AEC A;  3UT5 E;  4X1Y E;  4ZI7 E;  2XQ7 A;  2KND A;  1SHZ C;  2LSY A;  4LMK A;  5L3C B;  2F4V T;  5LMN T;  1V9D A;  3B13 A;  4AQF A;  3GMI A;  2V7K A;  2NR4 A;  4PJL A;  2YDS A;  5LNK A;  2CLY B;  2BS4 A;  4LFC T;  3O1J A;  4Z90 A;  3A7M A;  4CN4 A;  1Z0P A;  3HKD E;  3AA0 B;  4HN9 A;  2CXD A;  1OXZ A;  5LGT B;  4BAY B;  5LGN B;  3OKQ A;  3PUG A;  4ILB A;  2PG8 A;  2W66 A;  2C0S A;  5EK4 A;  5LP6 E;  1X79 A;  2NTX A;  3RIU A;  3RQW A;  4UV9 B;  1HCI A;  4ZXL A;  4HFE A;  2FJD A;  2V8S V;  2E9X C;  3AAA B;  2VUR A;  2CWY A;  4ERR A;  3CQC B;  3OYX A;  1S94 A;  4X20 E;  1UUR A;  1VOM A;  3ZYK A;  4IDZ A;  5JH7 E;  4DO0 A;  4I50 E;  3UU8 A;  3C4X A;  3ZT5 A;  2E2A A;  4U2Z A;  3CX8 B;  3JCF A;  4ADZ A;  2V5D A;  2JMH A;  2X67 A;  5JR9 A;  5AQJ B;  2XSA A;  4DR4 T;  5J2U E;  1UCU A;  4IGU A;  2XAH B;  3Q5X A;  4P0A A;  4DR3 T;  3N9M A;  5ABE A;  2W62 A;  3DTO A;  2QYW A;  3MZK B;  4IE5 A;  2WWV A;  4YTP A;  3FZL B;  3ZT6 A;  5L3G B;  5DAB A;  4GKJ T;  4ZS2 A;  3C98 B;  5L3F B;  5LJN A;  3ZJ2 A;  2W67 A;  4B3S T;  5AQI B;  2YU1 A;  5AQL B;  4EZH A;  2CCQ A;  4U33 A;  2CWO A;  3AEA A;  3O1I A;  4HFV A;  5JRC B;  3PDY A;  2UU9 T;  1HG2 A;  3FBL A;  5FP3 A;  1CUN A;  1S35 A;  3T8O A;  3UQ4 A;  5HWX A;  1NEN A;  3VKG A;  3RYH E;  1HFA A;  4O4J E;  2LT3 A;  1WYB A;  3N9P A;  4X65 T;  5FMN A;  3AE9 A;  4TV9 E;  3K8P C;  4TWH A;  3AVR A;  2Y8D A;  3PUV F;  5JDQ A;  3D0T A;  5LXT E;  1U5P A;  2N1G A;  3WAK A;  2X9W A;  2LKG A;  2KXP B;  1EZ3 A;  2EHO D;  2L8K A;  1W9R A;  2MPK A;  1N33 T;  2XQY A;  2JIW A;  4YSX A;  4MAL A;  5JDG A;  3I1A A;  2RP4 A;  4C91 A;  4JI7 T;  5AQS B;  1HS7 A;  3KV9 A;  5HXS A;  1XNR T;  5KXJ A;  3K3N A;  3ANW A;  2AXD S;  4DV4 T;  2CEA A;  1HNX T;  3IA3 A;  4QWN B;  2WMN A;  5FYM A;  4QH4 A;  1HX1 B;  2UUA T;  3DP7 A;  2CM0 A;  3FZM B;  4H9S E;  2NP9 A;  2CBJ A;  4LF4 T;  4IST A;  1E7P A;  1ZV4 X;  1FIO A;  2ACX A;  4CN6 A;  2I0M A;  2N2N A;  1UX4 A;  4J2C A;  4LF8 T;  5FXW A;  2BG9 C;  3AB3 B;  2QGS A;  4EXT A;  3RIA A;  4ASK A;  4ZI2 D;  5FVK A;  1W09 A;  2K48 A;  4LML A;  3HI2 A;  1R8I A;  1D0Z A;  2X68 A;  4JUY A;  3RIF A;  3P4W A;  5FY1 A;  5HXH A;  5HEU A;  4X62 T;  3RYC E;  4AXP A;  1WCR A;  3JC6 D;  3TLV A;  5JDH A;  3N9Q A;  2L9Q A;  3AE6 A;  4TWD A;  4KP3 C;  3BK9 A;  3B57 A;  4TWF A;  1D1B A;  3P8C D;  3BQK A;  2Q9Q A;  5JDF A;  4AKR B;  4EOZ B;  2KWI B;  4DUZ T;  5L2L A;  2HN2 A;  1OED C;  3E22 E;  2IDO B;  5LA6 E;  1X9B A;  1XWM A;  3RC8 A;  1D0Y A;  3TLT A;  4XZC A;  2VK9 A;  4ZI3 D;  2XQ5 A;  2MAW A;  2X9Y A;  2IC9 A;  1D0X A;  4QXH B;  4I4T E;  5JVD E;  3OPC A;  3VRA A;  3ZMS B;  3AXJ A;  2DI4 A;  5F5W A;  2QA7 A;  4ANJ A;  2XQ3 A;  4KBM B;  2HPJ A;  2WS3 A;  2YK0 A;  1HTJ F;  3ETU A;  4X66 T;  2H3R A;  3PUW F;  5J1G A;  4DR7 T;  2RA1 A;  1CHU A;  2V1D B;  3VR8 A;  4PJN A;  5LBQ B;  4AKG A;  3OBV E;  4YSZ A;  1HG5 A;  3ZPO A;  2JQ9 A;  1WLX A;  1IZN B;  2LSJ A;  2DLR A;  4F6R C;  3PU3 A;  3IBP A;  3RC3 A;  4E7Z A;  2G0U A;  4H9P C;  2A3D A;  3T1H T;  4YSY A;  2I6H A;  3GN5 A;  3ETV A;  2ZMA A;  4COF A;  4DND A;  5KX5 E;  3NRX A;  4UIG A;  3SOL A;  2VQE T;  1YD8 G;  4CXX A;  1MMA A;  2E9X A;  2MBG A;  1XNQ T;  2KWH A;  2LM2 A;  1MMN A;  1HR0 T;  2C5I T;  3RYF E;  3CQX C;  5A1L A;  4GYS A;  4WYV A;  4WBN E;  3KV6 A;  4HEA A;  4P1N A;  4NXN T;  4KMC A;  3BQI A;  2XAJ B;  1VCT A;  3AVS A;  4HFB A;  4CI2 B;  3QOF A;  5HXR A;  2EHO C;  3ZT7 A;  4ZZC A;  1VRB A;  1IBM T;  2XQ4 A;  2PTF A;  3HR0 A;  5E0O A;  5HEH A;  2ZM8 A;  4HWH A;  5EK3 A;  3RX6 A;  5JDM A;  1YKE B;  5HEJ A;  3CPZ A;  2IIU A;  3CK6 A;  2WDR A;  5L4H A;  4L5G A;  4H63 V;  1IBL T;  3FZF B;  5GON E;  4U3C A;  2X51 A;  4NUV A;  4IDP A;  2CXF A;  4IDN A;  4ZEY A;  1HX8 A;  3L8R A;  4EGW A;  2LKH A;  5EK2 A;  2X0H A;  2BVL A;  5IUX A;  4IT4 A;  2QRX A;  1KK7 A;  3GA8 A;  2FBW A;  5LBM A;  2VVS A;  2ODU A;  3EUH A;  4IIJ E;  1E2A A;  4ZI2 C;  3FXD B;  1IJ6 A;  3H3M A;  3MK7 C;  2D0U A;  3O9X A;  5LOV E;  3KVB A;  5L3E B;  2WMO A;  2R6G F;  5H6R B;  3N2K E;  3KV5 A;  4WW0 A;  1NWM X;  5F3J A;  2V6Y B;  4HE8 A;  4MHC A;  4U7I A;  4ZS3 A;  3JC6 C;  3ZEF B;  2KZ7 B;  4DV3 T;  5CJ5 A;  1XZY A;  3P7I A;  3F31 A;  1ZOY A;  4H63 H;  2NOX A;  3RPU A;  2LJL A;  4HKA A;  2FJE A;  3TLS A;  3AA1 B;  3N9O A;  2C5J A;  2YU2 A;  5AQP B;  4OFZ A;  3FBZ A;  1E1H B;  2CHO A;  3ZYL A;  3AEG A;  1NAF A;  3C51 A;  4OX9 T;  3RH3 A;  2VAS A;  4JI3 T;  2JQQ A;  3NBX X;  1ZP0 A;  4I55 E;  3AE1 A;  3ZLI A;  5KMG P;  4ZI3 C;  1FMV A;  3LJC A;  1XDP A;  2LSG A;  4GIW A;  4AIS A;  2WQY A;  2MTQ A;  2BG9 A;  4UR9 A;  1AJ3 A;  2NTY A;  4CQI A;  2V5C A;  5TAO A;  2MYS A;  5ABF A;  1SE7 A;  4JI1 T;  4HFI A;  3P4S A;  2LRL A;  3G06 A;  3K3Q C;  4IL4 A;  4A56 A;  3PUX F;  2AE9 A;  2NWB A;  4JBW F;  5C3J A;  3ONJ A;  2LHR A;  3QB5 A;  2UXX B;  3KBT A;  3ZSS A;  1FMW A;  3JAF A;  5JDL A;  3AEE A;  4O4L E;  4QX7 B;  3E0Z A;  1YKH B;  1GQE A;  3P4Q A;  2CLY C;  4A97 A;  3SS1 A;  4U7Y A;  3OVU A;  1UUS A;  3EDV A;  4PJJ A;  3WAJ A;  2DHR A;  5JR9 B;  3FZH B;  1YW0 A;  4I43 B;  3HA4 A;  3SRZ A;  2IC6 A;  2LE8 A;  2XPK A;  1LRZ A;  3NRY A;  3LSV A;  3UU3 A;  3TKL B;  1OED A;  5ABH A;  5L3B B;  3NWI A;  2K24 A;  4DUY T;  3AED A;  4LMJ A;  4P0B A;  1DU2 A;  4XAX B;  5LCY A;  4AIU A;  3FXE B;  3AAI A;  2LM9 A;  4BA9 A;  1KNR A;  5CA0 E;  3AE7 A;  4FJO A;  3UUB A;  3UTK A;  3EAM A;  3PU8 A;  3ZCJ A;  2XJ7 A;  5HCJ A;  3KDS E;  2BBH A;  4PFO A;  2LOS A;  4IRE A;  4PK4 A;  3RQU A;  1MIW A;  2E8I A;  3PUZ F;  4MLK A;  2WBL A;  3UUL A;  5FL0 A;  4DV0 T;  3T1Y T;  3PE0 A;  1WYC A;  2IW5 B;  2K5B B;  3F2E A;  5FY7 A;  2Q9Q D;  3M65 A;  2XAQ B;  3X1D A;  4TX5 A;  1XMQ T;  3ZYM A;  3CQG B;  4KHP T;  2KMF A;  4QXB B;  1QSD A;  5IHY A;  4HGA A;  2VKD A;  4F8H A;  4MFR A;  4TN7 B;  3RKO A;  3E08 A;  3ONX A;  3C4W A;  2A2F X;  1WFD A;  2WAU A;  1UK5 A;  4U2Y A;  1FJG T;  3I9W A;  4JLE A;  1YQ4 A;  2X0L B;  4QHO A;  4GK0 E;  5H6Q B;  4XBF B;  3VHL A;  5AFU L;  2XM2 A;  5AQU B;  3JAE A;  1HNZ T;  3R84 B;  4DMV A;  2HHH T;  4X1K E;  4DV2 T;  3ZMZ B;  2Y48 B;  4YHJ A;  4BJM A;  3ANW B;  4YLH A;  3QUJ A;  5LHG B;  4HTE A;  3ZMU B;  1LVK A;  4AQG A;  3P50 A;  3Q9D A;  2WDQ A;  5BMV E;  3ZJ1 A;  3PJA A;  4K0K T;  2D0T A;  3L09 A;  3WI3 A;  4NXM T;  5J0Z A;  3EI0 A;  4B3M T;  1I94 T;  3SFD A;  3Q5E A;  2J4G A;  3TLU A;  1KNP A;  2EHO A;  4UF0 A;  2HN1 A;  4V1A v;  4YHH T;  5AQT B;  3CIR A;  3UU4 A;  4DV7 T;  5KDM C;  2RPA A;  4UXN B;  2YN6 A;  4ILU A;  1IJ5 A;  4HWF A;  4HWC A;  4H9Q C;  2IML A;  4QKN A;  4AI6 A;  2LHN A;  4YT0 A;  3AA6 B;  4ILA A;  3UFE A;  1BR1 A;  4ISS A;  4EEB A;  4UEL A;  3UUN A;  3Q5W A;  1ZKE A;  3FB2 A;  3FZK B;  3ESL A;  2VL0 A;  1W0A A;  1NEK A;  4AKH A;  4K0U A;  3V5S A;  3M3Z B;  1D1C A;  1QLB A;  3HKB E;  4U74 A;  5FL1 A;  3RF1 A;  3I9Y A;  4WNK A;  3LK3 B;  1N36 T;  3VR9 A;  5M4Y A;  5FXZ A;  2Q9Q B;  2BKO A;  5J2T E;  5LYJ E;  3C64 A;  2KIN B;  3V5U A;  2B76 A;  4L9I A;  4U72 A;  3EHZ A;  4JI6 T;  3N5L A;  3OJA A;  2W0G A;  1G8X A;  2XAS B;  3MJX A;  3NKZ A;  5IYZ E;  4X5T A;  4O2B E;  2VWA A;  2H7O A;  2M67 A;  2CXL A;  1J1J A;  3N2G E;  3CVR A;  2LOP A;  3AXJ B;  2CE7 A;  4N78 D;  4YJ2 E;  3TLW A;  4DID B;  2WU2 A;  2UXC T;  4CI1 B;  1FEW A;  2XY8 B;  4DR2 T;  4P09 A;  3EDU A;  1B7T A;  2X9H A;  5LHH B;  4JEU B;  3ZC0 A;  2J62 A;  2XZE A;  1MMG A;  1N34 T;  3AE8 A;  3ZN0 B;  3OTO T;  3O4X E;  3LBX A;  1YQ3 A;  2WDV A;  3OYZ A;  4ZOL E;  4LFA T;  3NZQ A;  4GK5 E;  4DV1 T;  2PFV A;  2VKJ A;  2FJB A;  4CN1 A;  4IE0 A;  3UU6 A;  4LF6 T;  5HCM A;  4AKI A;  2LEH A;  3W15 B;  2JQK A;  3A8Y C;  2WZH A;  3MKD A;  2YDR A;  3RHW A;  3AA7 B;  1O3X A;  4CZZ B;  5CFB A;  1KEY A;  3GN5 B;  4HWD A;  2XAF B;  5AQG B;  3LK2 B;  2ODV A;  3ZST A;  2J1D G;  4OYJ A;  3CWZ B;  2WU5 A;  4YJ3 E;  2L3L A;  2E9X B;  2BS2 A;  2IHR 1;  2K9A A;  5AQQ B;  2VKH A;  3N2O A;  3L3P A;  3UQ7 A;  2WB5 A;  2WCA A;  2V7L A;  4G63 A;  2FJA A;  4IE4 A;  4EYU A;  5HEG A;  4DBR A;  2CHN A;  2A72 A;  1YXR A;  3PJA J;  3AE2 A;  4JI2 T;  2P9B A;  5AQM B;  3C50 A;  1T72 A;  2K3W A;  3SWH A;  1JNR A;  1XMO T;  4JI8 T;  2NW7 A;  3FHN A;  3IF8 B;  2BKN A;  3L39 A;  2DL1 A;  5EZY E;  4H9O C;  4X64 T;  2W00 A;  4U31 A;  2LLY A;  5CA1 E;  3RGL A;  3AEB A;  1MND A;  4NUU A;  1WRD A;  2UXN B;  1UX5 A;  3H37 A;  2PJQ A;  3P4P A;  1IAP A;  1US7 B;  5HYA A;  3LFM A;  4IL9 A;  3LK4 2;  4KX6 A;  5ADX L;  4M1P A;  3R6N A;  4DMW A;  3RKG A;  3K1S A;  3PUS A;  5LG3 A;  1T8B A;  2KSR A;  4A98 A;  3PUA A;  2M6I A;  4EB6 E;  2FUP A;  4CXW A;  3CX7 B;  4E7S A;  2H7V C;  4KUM B;  2ZM2 A;  1BR2 A;  1T7S A;  4B3R T;  2BS3 A;  3KBU A;  3HL6 A;  4HFC A;  3RI5 A;  2UUB T;  3LDQ B;  4PW8 A;  2CMR A;  5HWY A;  1BR4 A;  2OLT A;  4IDO A;  2B1E A;  5JRC A;  3ZCI A;  2PBI A;  4FI5 A;  5C8Y E;  3ZMV B;  4YTM A;  3O1H A;  2ES0 A;  3K3O A;  4Z8X A;  4EZ4 A;  4DV6 T;  5IWA T;  4O4I E;  4DR1 T;  2WZI A;  2XUE A;  4H9N C;  1BR0 A;  5HXE A;  5LGU B;  3PUQ A;  3ZKR A;  3I0O A;  2VB6 A;  2YOE A;  3CML A;  5F8P A;  4PJM A;  3QK6 A;  5JQG E;  5FY0 A;  2YIN A;  2DNX A;  5C2T A;  4PK6 A;  3J7Y q;  3I0Q A;  4CXY A;  1N32 T;  4B3T T;  2XHE B;  2E5V A;  5FNV E;  5FKY A;  3PUR A;  2BG9 B;  4YTN A;  2UXD T;  3ONL C;  1WR0 A;  2CBI A;  4TNW A;  2VQF T;  5ABF B;  4KHZ F;  2V7J A;  2JQH A;  3PV0 F;  2W4X A;  4HFH A;  4EV6 A;  3GWH A;  4DVD A;  5AQV B;  2A9U A;  5FXV A;  4TZ4 C;  2BG9 E;  4MBQ A;  2MOZ A;  3AE4 A;  5L4E A;  3N9L A;  4QX8 B;  5JDN A;  4AQF C;  3UU5 A;  4LFB T;  5LJM A;  4YXD A;  3KVA A;  4LF7 T;  2OV9 A;  2LSK A;  2ZM0 A;  2CA5 A;  1T98 A;  2VKO A;  2LSI A;  5CB4 E;  4CI3 B;  4ZHQ E;  4QH1 A;  3MXZ A;  2V6X A;  3MA9 A;  2XQ8 A;  1OED B;  3LG7 A;  4TUY E;  2JPF A;  1JNZ A;  2D5U A;  2V7M A;  4Q25 A;  5AQO B;  2V26 A;  2ZLY A;  3RIU C;  1IBK T;  3F57 A;  3N9N A;  2X0Y A;  2UXB T;  4PK5 A;  2IUB A;  3UUX B;  1MIV A;  5AQR B;  4C90 A;  4DBQ A;  5FVL A;  1QUU A;  1OED E;  4G2A A;  2BKP A;  3AEF A;  5HAX A;  4JI0 T;  5LMU T;  4L0R A;  4AQY T;  2Z6E A;  3MAC A;  4GYR A;  3AE5 A;  1SUM B;  2WSS V;  2C5K T;  4TNV A;  4QXC B;  2HH7 A;  2DWK A;  5JR9 C;  3RYI E;  3QNU A;  4LF9 T;  5LG4 A;  3SFE A; 
#chains in the Genus database with same CATH homology
 4N78 D;  1CUN A;  2OA5 A;  4YJ2 E;  2D0U A;  1S35 A;  3T8O A;  5LOV E;  3HKE E;  3O9X A;  3KVB A;  5HWX A;  5L3E B;  3KFW X;  2WMO A;  5H6R B;  3IHR A;  3N2K E;  3VKG A;  3ZMT B;  4CI1 B;  3KV5 A;  1FEW A;  4WW0 A;  1NWM X;  5F3J A;  1G73 A;  4P09 A;  3IEE A;  4X1I E;  3EDU A;  3RYH E;  1HFA A;  4HE8 A;  4O4J E;  2LT3 A;  4MHC A;  1B7T A;  2X9H A;  1WYB A;  5LHH B;  4ZS3 A;  3JC6 C;  4JEU B;  3ZEF B;  3ZC0 A;  2NW9 A;  2X66 A;  3C4Z A;  2KZ7 B;  3N9P A;  4EYY R;  1MMG A;  3ZN0 B;  2HPL A;  3VU7 H;  5FMN A;  4UVC B;  3P7I A;  3F31 A;  3O4X E;  4TV9 E;  5DQW A;  3K8P C;  1ZEE A;  3LBX A;  4H63 H;  4ZOL E;  3OYZ A;  3AVR A;  2NOX A;  3RPU A;  3NZQ A;  4GK5 E;  2LJL A;  2XAG B;  2GK9 A;  2Y8D A;  4HKA A;  1WR6 A;  3D0T A;  2PFV A;  5JDQ A;  1KNZ A;  2VKJ A;  2IAK A;  4GOU A;  4IE0 A;  5LXT E;  2N9D A;  1U5P A;  2N1G A;  3AA1 B;  3WAK A;  3N9O A;  4AKI A;  2LEH A;  5FXX A;  2X9W A;  2KXP B;  3W15 B;  2VL8 A;  1EZ3 A;  2C5J A;  2E9X D;  2YU2 A;  4OFZ A;  3FBZ A;  1E1H B;  2EHO D;  3KV4 A;  2WWU A;  3MKD A;  2DWG A;  3Q2M A;  2L8K A;  3HKC E;  3ZYL A;  1NAF A;  4PAG A;  3AA7 B;  2SPC A;  1O3X A;  4CZZ B;  2XQY A;  3C51 A;  3GN5 B;  3RH3 A;  2VAS A;  2XAF B;  2JQQ A;  3LK2 B;  3NBX X;  2ODV A;  4MAL A;  2J1D G;  5JDG A;  4I55 E;  2I59 A;  2WM9 A;  4OYJ A;  3ZLI A;  2JJ9 A;  4IHJ E;  3I1A A;  5KMG P;  3CWZ B;  2RP4 A;  4C91 A;  4ZI3 C;  1FMV A;  3LJC A;  4YJ3 E;  1HS7 A;  3KV9 A;  2LSG A;  5HXS A;  2L3L A;  2E9X B;  1HF8 A;  4GIW A;  5DQV A;  2YEV C;  3K3N A;  2EHO B;  4EAH A;  4UF0 B;  3ANW A;  2K9A A;  2MTQ A;  2VKH A;  2CEA A;  3N2O A;  3L3P A;  3CX6 B;  4QWN B;  1AJ3 A;  2WMN A;  2NTY A;  4TV8 E;  5FYM A;  4CQI A;  3DP7 A;  5TAO A;  1MIY A;  2V7L A;  4G63 A;  2MYS A;  2CM0 A;  3A5X A;  2BVM A;  3J9X 1;  4H9S E;  4IE4 A;  2NP9 A;  4EYU A;  2W63 A;  4DBR A;  4IST A;  1ZV4 X;  4OYK A;  1FIO A;  2ACX A;  2A72 A;  3K3Q C;  4A56 A;  3AAE B;  2P9B A;  2N2N A;  2NWB A;  1UX4 A;  4OHF A;  3C50 A;  4J2C A;  5LHI B;  2NW8 A;  2LHR A;  2JMK A;  2UXX B;  3KBT A;  3SWH A;  1LVF A;  3BQL A;  1FMW A;  3PTR B;  1Y64 B;  5FXW A;  3AB3 B;  5JDL A;  2QGS A;  4EXT A;  4O4L E;  4QX7 B;  4ASK A;  3E0Z A;  4ZI2 D;  4O4H E;  2K48 A;  1U4Q A;  1YKH B;  2NW7 A;  3FHN A;  2CLY C;  2JRK A;  3ZN1 B;  3HI2 A;  3SS1 A;  3IF8 B;  1D0Z A;  2X68 A;  2Y6X A;  4JUY A;  2X9X A;  4JEH B;  5HXC A;  5FY1 A;  5HXH A;  5EZY E;  3DJB A;  3EDV A;  4PJJ A;  4H9O C;  3RYC E;  3WAJ A;  2W00 A;  2DHR A;  3KIN B;  5CA1 E;  5JR9 B;  1YW0 A;  4I43 B;  3HA4 A;  4AXP A;  1MND A;  3SRZ A;  2IC6 A;  2LE8 A;  3JC6 D;  1LRZ A;  3NRY A;  4NUU A;  2BDE A;  3TKL B;  5JDH A;  4IE7 A;  3N9Q A;  2L9Q A;  1WRD A;  5L3B B;  2UXN B;  4KP3 C;  3BK9 A;  1UX5 A;  2K24 A;  3H37 A;  2PJQ A;  3B57 A;  1IAP A;  5ETW A;  3QC9 A;  1D1B A;  1US7 B;  2W61 A;  3LFM A;  3P8C D;  4P0B A;  4XAX B;  5DJQ C;  5HYA A;  5LCY A;  3LK4 2;  3FXE B;  3S4U A;  3AAI A;  5ADX L;  2LM9 A;  4M1P A;  4BA9 A;  3R6N A;  4DMW A;  3PUS A;  1OWA A;  3BQK A;  5CA0 E;  2Q9Q A;  4B6X A;  5L3D B;  3PUA A;  4OK0 A;  4UVA B;  5JDF A;  3RRC A;  4AKR B;  4EOZ B;  4FJO A;  3H3A A;  2KWI B;  4EB6 E;  3UTK A;  3PU8 A;  3ZCJ A;  4AKL A;  4WBO A;  5L2L A;  1MNE A;  4CXW A;  3KDS E;  3CX7 B;  3U78 A;  4E7S A;  4PFO A;  2H7V C;  2LOS A;  4BJN A;  4KUM B;  4PK4 A;  1MIW A;  2E8I A;  3E22 E;  4MLK A;  5LA6 E;  2ZM2 A;  1BR2 A;  2WBL A;  3UUL A;  3RC8 A;  1D0Y A;  1H7C A;  3KBU A;  3HL6 A;  4XZC A;  3PE0 A;  3RRW A;  1WYC A;  2KT9 A;  4YFS A;  2IW5 B;  4PFP A;  4PW8 A;  2CMR A;  5HWY A;  2K5B B;  2VK9 A;  4H9R C;  4ZI3 D;  3F2E A;  5FY7 A;  2Q9Q D;  5JRE A;  2Q9Q C;  1BR4 A;  3M65 A;  3VKH A;  2X9Y A;  2IC9 A;  1D0X A;  2XAQ B;  2KLQ A;  2V7I A;  2B1E A;  2BZB A;  4QXH B;  5JRC A;  4TX5 A;  3ZCI A;  2PBI A;  4I4T E;  5JVD E;  4IE6 A;  3CQG B;  3ZYM A;  4FI5 A;  5C8Y E;  4O2A E;  3ZMV B;  3ZMS B;  2KMF A;  3O1H A;  4QXB B;  1MMD A;  1QSD A;  2DI4 A;  2QA7 A;  2ES0 A;  3K3O A;  4Z8X A;  4ANJ A;  5IHY A;  4EZ4 A;  4EIW A;  1D1A A;  3LBX B;  4HGA A;  2XTL A;  2DCF A;  4UEM A;  3U3I A;  4KBM B;  4O4I E;  2VKD A;  1ZHC A;  4MFR A;  2XUE A;  4H9N C;  2HPJ A;  3ZC1 A;  2YK0 A;  1HTJ F;  3ETU A;  1BR0 A;  5HXE A;  4TN7 B;  3RKO A;  5LGU B;  2H3R A;  3E08 A;  3PUQ A;  4UV8 B;  3ONX A;  3C4W A;  3CKD A;  5J1G A;  2A2F X;  2WAU A;  3I0O A;  2VB6 A;  1LKX A;  2RA1 A;  3EVY A;  1SA0 E;  2V1D B;  4O8S A;  3CML A;  3I9W A;  4JLE A;  5F8P A;  2D2S A;  2X0L B;  4PJM A;  3UUM A;  4PJN A;  3QK6 A;  5LBQ B;  4UVB B;  4AKG A;  5JQG E;  4PNI A;  5FY0 A;  3OBV E;  2YIN A;  2DNX A;  1HG5 A;  4QHO A;  3ZPO A;  4GK0 E;  5H6Q B;  4XBF B;  1WLX A;  1IZN B;  3VHL A;  2LSJ A;  4PK6 A;  5AFU L;  3NZP A;  2DLR A;  4F6R C;  3PU3 A;  3IBP A;  3R84 B;  3RC3 A;  3J7Y q;  4DMV A;  3UT5 E;  3I0Q A;  4X1K E;  4X1Y E;  4E7Z A;  4CXY A;  2G0U A;  3ZMZ B;  2Y48 B;  4ZI7 E;  4H9P C;  2A3D A;  4YHJ A;  2KND A;  4BJM A;  2XHE B;  1SHZ C;  5FNV E;  2LSY A;  3ANW B;  3PUR A;  4YLH A;  5L3C B;  3QUJ A;  3GN5 A;  5LHG B;  1V9D A;  3B13 A;  4HTE A;  3ETV A;  3ZMU B;  4AQF A;  1LVK A;  3GMI A;  2ZMA A;  4AQG A;  2V7K A;  3Q9D A;  4PJL A;  5LNK A;  4DND A;  5KX5 E;  5BMV E;  2CLY B;  3ZJ1 A;  2D0T A;  3L09 A;  3NRX A;  3O1J A;  4UIG A;  3SOL A;  3WI3 A;  1YD8 G;  4CXX A;  2V7J A;  1MMA A;  2E9X A;  1Z0P A;  3HKD E;  3GWH A;  2MBG A;  2EHO A;  4UF0 A;  4DVD A;  4V1A v;  5FXV A;  3AA0 B;  4TZ4 C;  2KWH A;  4HN9 A;  4MBQ A;  2MOZ A;  1MMN A;  2CXD A;  5KDM C;  1OXZ A;  5LGT B;  4BAY B;  3N9L A;  5LGN B;  2C5I T;  3OKQ A;  4QX8 B;  3RYF E;  3PUG A;  5JDN A;  4UXN B;  3CQX C;  4AQF C;  5A1L A;  4GYS A;  4WBN E;  4ILU A;  1IJ5 A;  2PG8 A;  3KV6 A;  4HEA A;  2C0S A;  5LJM A;  5EK4 A;  5LP6 E;  1X79 A;  2NTX A;  4UV9 B;  3KVA A;  4H9Q C;  4KMC A;  4QKN A;  1HCI A;  4AI6 A;  3BQI A;  2LSK A;  2ZM0 A;  2CA5 A;  2XAJ B;  2LHN A;  1T98 A;  2VKO A;  2LSI A;  3AVS A;  3AA6 B;  2E9X C;  4CI2 B;  3AAA B;  5HXR A;  2EHO C;  3UFE A;  1BR1 A;  4ISS A;  2CWY A;  1VRB A;  4UEL A;  3UUN A;  5CB4 E;  3Q5W A;  4ERR A;  4CI3 B;  4ZHQ E;  3CQC B;  3MXZ A;  3OYX A;  1S94 A;  4X20 E;  1ZKE A;  3FB2 A;  3MA9 A;  3HR0 A;  3LG7 A;  3ESL A;  4TUY E;  5E0O A;  2JPF A;  2D5U A;  1VOM A;  4AKH A;  4K0U A;  3V5S A;  2ZM8 A;  4IDZ A;  3ZYK A;  2V7M A;  1D1C A;  2V26 A;  5JH7 E;  3HKB E;  2ZLY A;  5EK3 A;  4I50 E;  4DO0 A;  4U74 A;  3RX6 A;  3C4X A;  5JDM A;  3F57 A;  3N9N A;  3I9Y A;  4WNK A;  1YKE B;  3LK3 B;  3CX8 B;  4ADZ A;  5M4Y A;  2JMH A;  5FXZ A;  2Q9Q B;  3CPZ A;  4PK5 A;  5J2T E;  2X67 A;  5JR9 A;  5LYJ E;  3C64 A;  3UUX B;  1MIV A;  4C90 A;  5J2U E;  4DBQ A;  1QUU A;  2KIN B;  4L5G A;  4H63 V;  1UCU A;  4IGU A;  2XAH B;  4G2A A;  3V5U A;  3Q5X A;  4P0A A;  5GON E;  5HAX A;  2X51 A;  4NUV A;  2CXF A;  3N9M A;  2W62 A;  3DTO A;  4L9I A;  4L0R A;  1HX8 A;  2Z6E A;  3MZK B;  4IE5 A;  4U72 A;  3MAC A;  4GYR A;  5EK2 A;  3N5L A;  5L3G B;  5DAB A;  2WSS V;  2C5K T;  2BVL A;  4QXC B;  3OJA A;  2HH7 A;  4ZS2 A;  3C98 B;  5L3F B;  2W0G A;  1G8X A;  1KK7 A;  2XAS B;  3GA8 A;  3MJX A;  5IYZ E;  5LJN A;  2DWK A;  3ZJ2 A;  4O2B E;  5LBM A;  2VWA A;  2H7O A;  2M67 A;  2ODU A;  2CXL A;  5JR9 C;  3RYI E;  3EUH A;  3N2G E;  2YU1 A;  4IIJ E;  4EZH A;  2CCQ A;  2CWO A;  3O1I A;  4HFV A;  5JRC B;  3PDY A;  5LG4 A;  3CVR A;  4ZI2 C;  2LOP A;  3FXD B;  1IJ6 A;  1HG2 A;  3FBL A;  5FP3 A;  2CE7 A;  3MK7 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...