4CZZB

Histone demethylase lsd1(kdm1a)-corest3 complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
133
structure length
133
Chain Sequence
b'CRPPKGMYLTQEDVVAVSCSPNAANTILRQLDMELISLKRQVQNAKQVNSALKQKMEGGIEEFKPPESNQKINARWTTEEQLLAVQGVRKYGKDFQAIADVIGNKTVGQVKNFFVNYRRRFNLEEVLQEWEAE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LYSINE-SPECIFIC HISTONE DEMETHYLASE 1A
publication title Differential Properties of Transcriptional Complexes Formed by the Corest Family.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 46
structure length 133
sequence length 133
ec nomenclature
pdb deposition date 2014-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00249 Myb_DNA-binding Myb-like DNA-binding domain
B PF01448 ELM2 ELM2 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4czzB00
4BAYB 4UVAB 5L3GB 4UVCB 3ZMTB 5L3FB 5L3BB 2XAHB 5LHGB 2XAJB 2Y48B 4UV9B 2XAQB 2UXXB 2V1DB 5L3CB 5LGNB 5LHIB 2XAFB 3ZMVB 2UXNB 5LHHB 5LBQB 5L3DB 2XASB 3ZMUB 3ZN0B 2XAGB 4KUMB 4CZZB 4XBFB 4UV8B 3ZMZB 5H6RB 3ZMSB 3ZN1B 5LGTB 5L3EB 2IW5B 2X0LB 4UXNB 4UVBB 5H6QB 5LGUB
chains in the Genus database with same CATH superfamily
3T8OA 5AQRB 3BQKA 2BZBA 4UELA 2J1DG 3AEEA 2M6IA 3QOFA 4EXTA 3AE6A 3AE8A 2LKGA 4PFPA 4HFDA 5AQSB 1UX5A 2XM2A 3I0QA 2Y8DA 3K8PC 1NAFA 2KT9A 1MMNA 2V7MA 3H3AA 4LF8T 4I43B 5EK4A 5L3CB 5JRCA 4TX5A 4JI2T 4QXBB 2WS3A 2KMFA 5AQTB 2VKOA 3MACA 4UV8B 4KX6A 3OPCA 4V1Av 5HXRA 3JC6C 4ILUA 4BA9A 5JR9C 1T72A 3O4XE 1HG2A 2X51A 1MMGA 1KK7A 2BBHA 3GWHA 2X0HA 3AE9A 4OX9T 2HN2A 4HWCA 2XQYA 2I59A 3AA7B 4IREA 2EHOA 5ABGA 4K0UA 4O4LE 1HS7A 2YU2A 4YSYA 2VQFT 1MNDA 4CN6A 1L0VA 3B57A 3F31A 4AIUA 2N1GA 4IT4A 3FZHB 5FKYA 2NR4A 4I50E 3W15B 2IC9A 4ZXLA 3KV6A 3ZC1A 3EABA 3C64A 3H37A 4LF7T 4LFAT 4DMWA 2XM1A 3V5SA 3RRCA 4DV4T 1UUSA 2SPCA 3RH3A 2LHRA 3P4QA 3ZEFB 5L2LA 1CUNA 4M1PA 5CJ5A 2MPKA 2DNXA 4TWHA 4H9PC 2XPKA 3VRBA 4X66T 3I9WA 2J4GA 3UUNA 3TLUA 4YTMA 4H9SE 4UVBB 1W0BA 2CWOA 2WDVA 4ZS3A 4L9IA 5J0ZA 3UQ4A 1ZP0A 1T7SA 2YU1A 3FZLB 2X9HA 2YDRA 1HF8A 2WDRA 2KZ7B 1T8BA 5FY7A 3L8RA 4UVAB 1US7B 3CQCB 5JQGE 2VVSA 2QGSA 4IE0A 4IL4A 3EUHA 4X62T 1HX8A 3LBXA 4PJLA 1JNRA 5IHYA 5KMGP 4BJNA 2ES0A 4QWNB 4XAXB 1IAPA 1N34T 3OYZA 2IW5B 4MBQA 4C90A 2UXCT 5L3BB 2XAHB 2FBWA 3RYFE 1OEDE 1YKHB 2UXNB 3PURA 3PU3A 3BK9A 1OXZA 4TNWA 2H89A 3N9OA 5DQWA 2W4XA 3ZN1B 5HEOA 4TWDA 5LHGB 2V6XA 2HH7A 4LMLA 2FJBA 4ZEYA 1XMOT 4A56A 3EDUA 3U3IA 4K0KT 1Y01A 4FJOA 3ZKRA 4G63A 1FMWA 3LK3B 1OEDA 3ZT6A 5LCYA 5HEHA 2Q9QB 1FIOA 4IHJE 3NKZA 2DWKA 4BAYB 3ZLIA 2UXBT 2XQ5A 2RPAA 2XQAA 4JI4T 2XZEA 5FL0A 3E08A 3KV4A 3QB5K 3JADA 3T1YT 4JI1T 1UCUA 3N5LA 4ZI3D 1ZOYA 1WRDA 2WZIA 3K3NA 2K48A 2B76A 2YN6A 4GKKT 4QHOA 3ZMUB 3NZPA 5IWAT 5JDHA 4DV3T 3N9NA 2VQET 2M67A 4CN4A 4H9NC 1BR1A 1LVFA 4UVCB 5LA6E 3C4WA 2JMHA 4DBQA 5JR9B 1KEYA 2L8KA 3S4UA 3CX7B 1XMQT 3QC9A 4CI3B 4PAGA 3VHLA 3BQIA 2JQQA 4OFZA 5AQPB 1YQ3A 5FP3A 1UURA 2VWAA 4HFVA 3B13A 4QKNA 2WQYA 5LOVE 2D0UA 4LFBT 1KFYA 1LVKA 3LG7A 4AQFA 5EK2A 4AQGA 3UU4A 5BR8T 5HXSA 3VKGA 2W61A 5KDMC 2LKHA 3KV5A 2LLYA 5CA0E 3RKGA 2Q9QA 4U2ZA 3P7IA 3PUGA 3I9YA 2DHRA 3UTKA 3F2EA 3ANWB 2DWGA 3KVAA 5HXEA 1BR2A 4IIJE 5JDQA 5FXWA 2E9XD 3FHNA 2LSKA 4AISA 5AQIB 4DNDA 4IDNA 4HE8A 2Z6EA 1H7CA 2ZMAA 1IBKT 5F3JA 1JNZA 4GYSA 4CQIA 2A3DA 1MIVA 2KWIB 4DIDB 2WWVA 4U2YA 2BVLA 2L9QA 3ETVA 4ILCA 2NW8A 5DQVA 1WFDA 2X0LB 3AXJB 1FEWA 3DP7A 2V6YA 4O4HE 3JAFA 4P0BA 4IE5A 4IDZA 2XHEB 2VKDA 1WYBA 3RIUA 3NVOA 4PK5A 1SE7A 1ZKEA 5AQHB 3I1AA 3RKOA 1OWAA 2WCAA 3UU3A 1UK5A 1YD8G 4HFIA 2JPFA 2JIWA 3PUQA 2ZM2A 3KVBA 1M62A 4HFEA 1IBMT 3FZFB 4DV6T 1QLBA 3N9QA 4ASKA 2BS2A 2CCQA 2ZLYA 5AQMB 4IE4A 5FL1A 3X1DA 1MMAA 2CWYA 4U74A 4DV1T 5AQOB 4GYRA 3AEAA 3ZMTB 1J5WA 4YSXA 4CXYA 3PUVF 4XZCA 5JDFA 4CXWA 2HPLA 4YJ3E 1MIWA 3R84B 4EOZB 5LXTE 1ZHCA 4DR2T 5FMNA 3PJAA 2PTFA 3CMLA 3C51A 3KV9A 4JYAT 2CMRA 3SS1A 3PV0F 1SA0E 2L3LA 5JH7E 5ABEA 1WYCA 2ZM0A 1X9BA 3D0TA 3M3ZB 3UUMA 4ADZA 3OKQA 2NOXA 2N9DA 5A1LA 4AQYT 1NEKA 1W9RA 2QVAA 4O4JE 2XAFB 4WW0A 3ZMSB 2LOSA 2B1EA 3ONXA 2E9XA 4DO0A 5H6QB 2JRKA 2VL0A 4YY3T 5ABFB 1HR0T 4G2AA 4EIWA 4YXDA 5TAOA 1CHUA 4CZZB 3AB3B 2NW7A 4Q25A 4OYKA 5AQFB 5LGUB 5FXZA 4HFBA 1BR0A 2IIUA 2QRXA 4NIQA 4PFOA 5FVLA 3IF8B 1Y64B 2WMOA 2X68A 1W09A 4H63V 5HCMA 2OLTA 5FY1A 3NWIA 2X67A 3KFWX 2LM2A 2BG9A 4E7SA 2KINB 2N2NA 3HA4A 5AFUL 4X1KE 3GMIA 1YXRA 4IGUA 3J9X1 4TN7B 4UF0B 4J2CA 1G8XA 5JDNA 1W0AA 2E5VA 2UXDT 4B3ST 3UU8A 4X20E 4UR9A 4B3MT 1IZNB 1I6ZA 4ZZCA 3TLWA 4QX8B 4CXXA 3FBZA 5ADXL 4EGWA 2FJEA 2WWUA 2A9UA 3ZMVB 3AEDA 4TZ4C 2VKJA 2X9XA 3AEBA 2A72A 3NRXA 4YTPA 2LE8A 1EZ3A 5FY0A 5LMUT 4I4TE 2OA5A 2WZHA 3PTRB 4U7YA 2J62A 5FVKA 2NWBA 4JEUB 2KXPB 3CX6B 3SRZA 1MIYA 2IMLA 4YSZA 2DLRA 2W67A 2I6HA 2AE9A 5HXCA 4AKIA 2V7KA 5HCJA 3U78A 4MALA 2E2AA 4WZXA 3ABVA 5EZYE 4X65T 5AQLB 3AEFA 4IE7A 4P1NA 2PJQA 4KHZF 4ZOLE 4CN1A 1R8IA 2D9DA 4LMKA 2NW9A 2MOZA 5AQUB 2E5LT 5AQJB 4NXNT 4HWIB 3WAJA 3UUXB 3ZYKA 3PE0A 1HCIA 3AAAB 2XAGB 4PJJA 1S94A 1D1BA 3ZJ2A 4ANJA 4UF0A 3RYHE 3MXZA 3IA3A 2XSBA 4EEBA 3EVYA 2XAQB 4GKJT 4NUVA 5GONE 2W0GA 2VASA 4KP3C 3N2GE 1QUUA 2WB5A 2V7JA 2VURA 5H6RB 2CA5A 2W63A 4COFA 4HN9A 3K1SA 3NBXX 4ZZBA 3CQXC 4MFRA 3RIFA 2V1DB 2Q9QD 3AE7A 4QH4A 2CBIA 2YINA 2CLYC 3CPZA 2CPTA 1QSDA 3EI0A 1LRZA 2C0SA 4F6RC 4DV7T 3FBLA 2WSSV 1AJ3A 3UU6A 3SFDA 2HHHT 5LJNA 4ILBA 4JI8T 4LFCT 5LHIB 5JREA 5JDMA 3FZMB 4OYJA 2EHOC 1UGOA 5HWXA 3UFEA 3HR0A 2C5KT 5M4YA 5HWYA 5E0OA 1WLXA 1D0XA 5LMNT 1XZYA 4X1YE 3PUYF 3JC6D 4O8SA 3QNUA 2J47A 2G0UA 4LF4T 4QH5A 2H7VC 2YEVC 5JVDE 2E8IA 1UX4A 2V7IA 2DL1A 4ILAA 2X9YA 4OHFA 2K9AA 3CK6A 3P4WA 5KXJA 5FXXA 1Z8UA 5L3FB 3AEGA 1T98A 4ISTA 4DBRA 3ESLA 3CX8B 2QYWA 5HEJA 4EV6A 2JJ9A 3RC8A 1SHZC 3Q9DA 3OTOT 2JQHA 3WI3A 3HKDE 2K5BB 3ZT7A 3AE3A 4P0AA 2KWHA 3A8YC 3LDQB 1KF6A 5LNKA 1WR0A 1O3XA 3P4SA 5AQKB 1DU2A 2UU9T 3QK6A 3AECA 3PUSA 2WY2A 4I0UA 3EHZA 3CKDA 3ZC0A 3PUXF 3OVUA 4DV5T 5J2TE 4PJNA 3JCFA 3TLSA 3V5UA 3E22E 4O2AE 4HFCA 3VU7H 2MTQA 4HGAA 2WBLA 2ACXA 4TUYE 2XQ4A 4DR1T 4UXNB 3VKHA 4CI1B 5J1GA 3TLVA 2UUBT 3PDYA 4KHPT 3LSVA 3O1IA 3RX6A 2UUCT 3C98B 5CA1E 4JLEA 3K3OA 2DI4A 1ZEEA 5LYJE 4UEMA 1HNWT 4IDPA 1E7PA 5JDGA 4EB6E 2ZM8A 4GOUA 3O9XA 3QB5A 5L47A 2MYSA 2C5IT 5L3DB 3SOLA 3HI2A 3O1HA 3GN5B 3ZN0B 4KUMB 2V7LA 3ZMZB 5JR9A 4HKAA 1OEDC 5F5WA 1IJ6A 2XSAA 2FUPA 3PUWF 4JI6T 2YK0A 2XTLA 4HWHA 3MJXA 3GA8A 4H9QC 2NTYA 4Z90A 2HPJA 4DVDA 3MKDA 5HYAA 1XDOA 4DUYT 4FI5A 5HEGA 3B5MA 3C4XA 3ETUA 1G73A 3TKLB 3M65A 3SFEA 2VL8A 2RP4A 2W62A 3UULA 2YDQA 2PFVA 3KBUA 1VRBA 4QX7B 3ANWA 3HKEE 4LF6T 2H88A 5JRCB 3AAEB 3ONLC 2CLYB 3OJAA 3NZQA 4YJ2E 4U33A 4DR4T 2BBJA 3CQGB 2JQKA 5ETWA 4WNKA 3R6NA 3OYXA 4KBMB 1S35A 2VKHA 5BMVE 1E2AA 5J2UE 1XWMA 2EHOB 4DV0T 3AXJA 3AA0B 2XY8B 2XASB 3HL6A 1N36T 2IDOB 4AQFC 2Y6XA 4AXPA 2NP9A 3PU8A 4AI6A 4YLHA 1M7KA 3A5XA 2CXFA 4KMCA 2X9WA 1MNEA 1I94T 4IDOA 2Q9QC 3MA9A 3C4ZA 5HXHA 2XQ9A 2LEHA 2LHNA 4GK0E 2BG9E 2UUAT 2IUBA 3HKBE 5L3GB 3FXDB 4LMJA 1HFAA 2CM0A 4PK6A 4AKHA 4YFSA 3F57A 4GK5E 2XQ6A 3KBTA 5IUXA 3AE5A 4NUUA 2K3WA 3P50A 4ZI2D 4TV9E 4AKRB 2ODUA 1X79A 2Y48B 1HTJF 1J1JA 2JQ9A 3L09A 3MK7C 3RIUC 3RF1A 5CB4E 3RGLA 3RQUA 5HAXA 2VVNA 4ZI3C 4YHJA 4ERRA 1D0ZA 2PG8A 2AXDS 5CGMA 3ZCJA 4NXMT 1V9DA 1XNRT 4GIWA 4PNIA 4YT0A 3IHRA 3LBXB 2CXDA 4ISSA 4CI2B 3ZT5A 4YHHT 2F4VT 3CWZB 1WR6A 3FZKB 2C5JA 3AE2A 3ONJA 1YKEB 1NENA 5ABFA 3LFMA 5IYZE 3AVRA 5LJMA 1N33T 4DR3T 1VCSA 4LF5T 5AQVB 2LSYA 2LOPA 4IL9A 2WAUA 4DUZT 3AAIA 4P09A 4IE6A 4EZHA 5LGNB 2OV9A 2W00A 4QXHB 3RYCE 2MBGA 5LBQB 2NTXA 3G06A 3RLFF 4U3CA 1IBLT 5FNVE 3ZYLA 2WM9A 2WMNA 3UFGA 4L0RA 3RI5A 2LM9A 4F8HA 3N9PA 3RQWA 1SUMB 1OEDB 2HN1A 2KLQA 2ODVA 4TWFA 2R6GF 4E7ZA 2YOEA 4X5TA 4XBFB 1FJGT 5C2TA 3CVRA 5FXVA 3SWHA 2E9XC 1XNQT 2UXXB 3RPUA 4IDQA 4HWDA 2DCFA 5C8YE 3LK2B 2V26A 5HEUA 1IJ5A 2K24A 2CBJA 4WBNE 2D0TA 3FB2A 3AE4A 2W66A 2VB6A 3Q2MA 1FMVA 4DR5T 4PW8A 4X64T 2RA1A 2W2UA 3TLTA 1BR4A 4HWFA 2BKPA 4EYYR 2IHR1 2IC6A 4DR7T 1HNZT 2MAWA 2ZM6T 2BG9C 4EAHA 5CFBA 4EZ4A 2IAKA 2XQ3A 1YW0A 3LK42 4DV2T 3I0OA 1U5PA 3WAKA 3ZJ1A 5JTGA 5C3JA 4PJMA 3N2KE 5LG4A 4UIGA 2GK9A 3DTOA 2CXLA 3QUJA 5AQGB 5LHHB 3L39A 3JAEA 4C91A 3Q5EA 3ZSTA 3E0ZA 1VOMA 2CE7A 2BKNA 4O2BE 5AQNB 1NWMX 3KINB 4U72A 3CIRA 5F8PA 3IEEA 2XQ7A 3J7Yq 5FYMA 2ACZA 4JI5T 4YTNA 3RRWA 2A2FX 4H63H 4MLKA 3N2OA 2BVMA 2FJDA 1WCRA 3H3MA 2CHNA 2V6YB 4A5XA 2D2SA 4JEHB 2X0YA 4TNVA 3P8CD 4BJMA 2PBIA 2XJ7A 2LRLA 3UQ7A 4JUYA 4JI3T 2V5CA 5AQQB 4KI0F 1ZV4X 1D1CA 3ZCIA 4B3TT 1VCTA 1KNRA 4QXCB 2JMKA 5LP6E 4HFHA 5LBMA 3O1JA 2H3RA 4LF9T 5EK3A 4I55E 4B6XA 2M6BA 2WDQA 4AKGA 2LT3A 1HNXT 5LGTB 5KX5E 3UT5E 4ZI2C 4DR6T 3N9MA 4UV9B 2X66A 1N32T 1J5ET 1LKXA 3AVSA 1HG5A 3RHWA 4JV5T 1Z0PA 5JDLA 5L4EA 4WBOA 1GQEA 4JBWF 2QA7A 2LSGA 3EAMA 3A7MA 1D0YA 3RIAA 2V8SV 3FXEB 4Z91A 2YDSA 4U31A 4N78D 3VR9A 3K3QC 2FJAA 1YQ4A 3PUZF 5ABHA 4AKLA 4Z8XA 5LG3A 4EYUA 3BQLA 3Q5XA 2CRBA 2LSJA 2BKOA 5DJQC 1U4QA 3ZSSA 3T1HT 3IBPA 3AE1A 4A98A 2XAJB 3P4RA 3VRAA 4NPPA 4WYVA 2E9XB 4X1IE 3VR8A 3HKCE 5L3EB 5LB7B 4OK0A 4O4IE 4H9OC 3PUAA 3RC3A 3ZPOA 3DJBA 3LJCA 2BS4A 4DMVA 3PJAJ 5L4HA 3UUBA 2BDEA 2EHOD 4PK4A 5DABA 2P9BA 2D5UA 4QH1A 3OBVE 4L5GA 3KDSE 2CEAA 3L3PA 3Q5DA 3EDVA 3N9LA 2LJLA 2WP9A 2H7OA 2BG9B 1KNZA 2KSRA 3RYIE 3P4PA 2KNDA 4B3RT 2LRKA 2V5DA 4HTEA 2BS3A 1D1AA 4ZS2A 2YKSA 4TV8E 4H9RC 3MZKB 2LSIA 4JI0T 1HX1B 1XDPA 3ZYMA 4EEDA 4JI7T 1KNPA 2XQ8A 3NRYA 2XUEA 2I0MA 4ZI7E 4U7IA 2WU2A 3GN5A 3AA1B 4A97A 4HEAA 1MMDA 3Q5WA 2WU5A 2CHOA 3C50A 4MHCA 1B7TA 4ZHQE 3UU5A 2VK9A 1E1HB 3AA6B
chains in the Genus database with same CATH topology
3T8OA 3BQKA 3N9PA 1UX4A 2BZBA 2V7IA 4IE5A 4IDZA 4P0BA 4UELA 2J1DG 2XHEB 2VKDA 1WYBA 2KLQA 2X9YA 2ODVA 4PK5A 4EXTA 4OHFA 4E7ZA 1ZKEA 2K9AA 3I1AA 3RKOA 1OWAA 4XBFB 4PFPA 1YD8G 1UX5A 2JPFA 3CVRA 3I0QA 5FXVA 5FXXA 2Y8DA 3SWHA 3PUQA 3K8PC 2E9XC 2ZM2A 3KVBA 1NAFA 2KT9A 5L3FB 1MMNA 1T98A 2V7MA 3H3AA 4I43B 2UXXB 4ISTA 5EK4A 4DBRA 5LA6E 5L3CB 3ESLA 5JRCA 3RPUA 4TX5A 3CX8B 3N9QA 4QXBB 4ASKA 2DCFA 2KMFA 3LK2B 5C8YE 2V26A 2JJ9A 2VKOA 3MACA 3RC8A 2CCQA 1IJ5A 4UV8B 2K24A 1SHZC 3Q9DA 2ZLYA 4IE4A 4V1Av 3WI3A 3HKDE 2D0TA 3FB2A 3JC6C 5HXRA 4WBNE 4ILUA 1MMAA 2CWYA 4U74A 4BA9A 5JR9C 3O4XE 2K5BB 2VB6A 1HG2A 3Q2MA 4GYRA 2X51A 1FMVA 4P0AA 1MMGA 3ZMTB 1KK7A 2KWHA 4PW8A 4CXYA 4XZCA 5LNKA 5JDFA 4CXWA 2HPLA 1O3XA 3GWHA 2RA1A 4YJ3E 1MIWA 2XQYA 1BR4A 2I59A 3AA7B 3R84B 4EYYR 4EOZB 5LXTE 2EHOA 2IC6A 4K0UA 4O4LE 3QK6A 1HS7A 1ZHCA 2YU2A 5FMNA 3PUSA 3CMLA 3C51A 1MNDA 3CKDA 3ZC0A 3KV9A 3B57A 3F31A 4EAHA 5J2TE 4PJNA 2CMRA 3SS1A 4EZ4A 3V5UA 3E22E 1SA0E 2L3LA 2IAKA 4O2AE 5JH7E 2N1GA 1YW0A 3VU7H 2ZM0A 1WYCA 2MTQA 3LK42 4HGAA 3I0OA 1U5PA 4I50E 2WBLA 2ACXA 3WAKA 3D0TA 4TUYE 3ZJ1A 3W15B 2IC9A 3UUMA 4UXNB 4ADZA 3OKQA 2NOXA 3VKHA 4CI1B 3KV6A 5J1GA 2N9DA 3ZC1A 5A1LA 4PJMA 3N2KE 5LG4A 4UIGA 3C64A 2GK9A 3H37A 3PDYA 3DTOA 4O4JE 2CXLA 3QUJA 2XAFB 3O1IA 5LHHB 3RX6A 4DMWA 4O4HE 4C91A 3C98B 5CA1E 4WW0A 4JLEA 3V5SA 3ZMSB 2LOSA 3K3OA 2B1EA 3ONXA 3RRCA 2E9XA 2DI4A 2SPCA 4DO0A 3RH3A 1ZEEA 3E0ZA 1VOMA 5H6QB 5LYJE 2JRKA 2CE7A 4UEMA 5JDGA 2LHRA 4EB6E 4O2BE 3ZEFB 5L2LA 1CUNA 1NWMX 2ZM8A 3KINB 4U72A 4GOUA 3O9XA 4M1PA 2DNXA 4G2AA 4EIWA 5F8PA 2MYSA 2C5IT 5L3DB 5TAOA 3IEEA 4H9PC 3SOLA 3HI2A 3O1HA 3J7Yq 3GN5B 3I9WA 3ZN0B 4KUMB 4CZZB 3AB3B 2V7LA 5FYMA 3ZMZB 5JR9A 2NW7A 4HKAA 3UUNA 1IJ6A 4H9SE 4UVBB 4OYKA 2CWOA 5LGUB 2YK0A 2XTLA 4ZS3A 5FXZA 3RRWA 2A2FX 3MJXA 4H63H 4L9IA 1BR0A 4MLKA 3GA8A 3N2OA 4H9QC 2BVMA 2NTYA 2HPJA 2YU1A 4DVDA 2X9HA 3MKDA 1HF8A 4PFOA 5HYAA 3IF8B 4FI5A 2KZ7B 3C4XA 3ETUA 1Y64B 2WMOA 2X68A 4H63V 1G73A 3TKLB 3M65A 5FY7A 2D2SA 5FY1A 4JEHB 2X67A 3KFWX 4E7SA 3P8CD 4BJMA 2KINB 2N2NA 4UVAB 2VL8A 1US7B 2PBIA 3CQCB 2RP4A 2W62A 3HA4A 5JQGE 5AFUL 4X1KE 4JUYA 2QGSA 3GMIA 4IE0A 3EUHA 4IGUA 3J9X1 1HX8A 3LBXA 1ZV4X 4PJLA 1D1CA 4TN7B 4J2CA 4UF0B 3UULA 3ZCIA 1G8XA 5JDNA 5IHYA 5KMGP 4BJNA 2PFVA 3KBUA 2ES0A 4QWNB 4XAXB 1IAPA 1VRBA 4QXCB 3ANWA 3HKEE 4QX7B 3OYZA 2IW5B 4MBQA 2JMKA 4X20E 5LP6E 5JRCB 3AAEB 2CLYB 4C90A 3OJAA 1IZNB 3NZQA 5LBMA 3O1JA 5L3BB 2XAHB 4QX8B 2H3RA 4CXXA 4YJ2E 5EK3A 3FBZA 3RYFE 5ADXL 4I55E 2WWUA 3ZMVB 1YKHB 2UXNB 4TZ4C 2VKJA 3PURA 3CQGB 3PU3A 2X9XA 1OXZA 2A72A 3BK9A 3NRXA 4B6XA 2LE8A 1EZ3A 5ETWA 4WNKA 3R6NA 3N9OA 5DQWA 5FY0A 3OYXA 4KBMB 4AKGA 3ZN1B 2LT3A 4I4TE 5LGTB 5KX5E 1S35A 2OA5A 2VKHA 3UT5E 3PTRB 4ZI2C 5LHGB 5BMVE 2HH7A 5J2UE 3N9MA 4UV9B 2X66A 2NWBA 4A56A 3EDUA 4JEUB 2EHOB 1LKXA 3AVSA 1HG5A 2KXPB 3U3IA 3CX6B 3AA0B 3SRZA 1Z0PA 5JDLA 1MIYA 4WBOA 4FJOA 2XASB 2DLRA 4G63A 1FMWA 3LK3B 5HXCA 3HL6A 2QA7A 4AKIA 2LSGA 2V7KA 1D0YA 4AQFC 5LCYA 2Y6XA 3FXEB 3U78A 4AXPA 2Q9QB 1FIOA 4IHJE 4MALA 2NP9A 2DWKA 3PU8A 4BAYB 3ZLIA 4N78D 5EZYE 3K3QC 4AI6A 4YLHA 3A5XA 2CXFA 4IE7A 4KMCA 2X9WA 2PJQA 4AKLA 1MNEA 4ZOLE 4Z8XA 2Q9QC 4EYUA 3BQLA 3MA9A 3C4ZA 3E08A 3Q5XA 5HXHA 2LEHA 2LHNA 3KV4A 2NW9A 2LSJA 4GK0E 2MOZA 1UCUA 3N5LA 4ZI3D 5DJQC 1WRDA 1U4QA 3K3NA 3HKBE 3IBPA 5L3GB 3FXDB 2K48A 2XAJB 1HFAA 2CM0A 4PK6A 4AKHA 4YFSA 3F57A 2E9XB 3WAJA 3UUXB 4GK5E 3ZYKA 3PE0A 1HCIA 3AAAB 4QHOA 3KBTA 3ZMUB 3NZPA 2XAGB 4PJJA 1S94A 1D1BA 4NUUA 4X1IE 5JDHA 3ZJ2A 4ANJA 3HKCE 4UF0A 3N9NA 5L3EB 3RYHE 4ZI2D 3MXZA 2M67A 4TV9E 4AKRB 2ODUA 4OK0A 4H9NC 1BR1A 1LVFA 4O4IE 4UVCB 1X79A 2Y48B 1HTJF 3EVYA 4H9OC 2XAQB 2JMHA 3C4WA 3PUAA 4NUVA 3L09A 5GONE 3RC3A 2W0GA 3DJBA 3ZPOA 4DBQA 5JR9B 2VASA 4KP3C 2L8KA 3S4UA 3CX7B 3LJCA 3N2GE 1QUUA 4DMVA 3QC9A 4CI3B 3MK7C 4PAGA 3VHLA 2V7JA 3BQIA 2BDEA 5H6RB 2CA5A 2EHOD 2JQQA 4PK4A 5CB4E 2W63A 5DABA 2P9BA 4HN9A 4OFZA 2D5UA 3NBXX 5HAXA 3OBVE 5FP3A 4ZI3C 4L5GA 3CQXC 4YHJA 4MFRA 2VWAA 3KDSE 2CEAA 3L3PA 4ERRA 3EDVA 3N9LA 4HFVA 1D0ZA 2Q9QD 2V1DB 3B13A 4QKNA 5LOVE 2D0UA 2LJLA 2PG8A 1LVKA 2H7OA 3LG7A 2YINA 4AQFA 2CLYC 3CPZA 3ZCJA 1QSDA 4AQGA 5EK2A 1LRZA 1V9DA 1KNZA 2C0SA 5HXSA 4GIWA 4PNIA 3RYIE 4F6RC 3VKGA 3IHRA 2KNDA 2W61A 3LBXB 5KDMC 3FBLA 2CXDA 2WSSV 1AJ3A 4ISSA 4CI2B 4HTEA 3KV5A 5LJNA 1D1AA 3CWZB 4ZS2A 5CA0E 4TV8E 1WR6A 2Q9QA 2C5JA 3P7IA 3PUGA 3I9YA 4H9RC 5LHIB 2DHRA 3UTKA 3F2EA 2LSIA 3ANWB 3MZKB 2DWGA 5JREA 3KVAA 5HXEA 5JDMA 1BR2A 1YKEB 3ZYMA 4IIJE 4OYJA 5JDQA 3LFMA 5IYZE 3AVRA 5LJMA 5FXWA 2E9XD 3NRYA 2XUEA 2EHOC 3FHNA 2LSYA 2LSKA 2LOPA 5HWXA 4ZI7E 4DNDA 3UFEA 3GN5A 3AA1B 2C5KT 3HR0A 4HE8A 5M4YA 2Z6EA 4HEAA 5HWYA 2WAUA 5E0OA 1WLXA 1H7CA 3AAIA 2ZMAA 1MMDA 4P09A 4IE6A 4EZHA 4GYSA 5F3JA 3Q5WA 5LGNB 4CQIA 1D0XA 2W00A 4QXHB 3RYCE 2A3DA 1MIVA 4X1YE 2KWIB 5LBQB 2MBGA 2NTXA 3C50A 4MHCA 2BVLA 1B7TA 3JC6D 2L9QA 3ETVA 5FNVE 4O8SA 5DQVA 2NW8A 2WM9A 3ZYLA 4ZHQE 2VK9A 2G0UA 2X0LB 2WMNA 4L0RA 2H7VC 2YEVC 1E1HB 1FEWA 5JVDE 3DP7A 2LM9A 2E8IA 3AA6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BAY B;  4UVA B;  5L3G B;  4UVC B;  3ZMT B;  5L3F B;  5L3B B;  2XAH B;  5LHG B;  2XAJ B;  2Y48 B;  4UV9 B;  2XAQ B;  2UXX B;  2V1D B;  5L3C B;  5LGN B;  5LHI B;  2XAF B;  3ZMV B;  2UXN B;  5LHH B;  5LBQ B;  5L3D B;  2XAS B;  3ZMU B;  3ZN0 B;  2XAG B;  4KUM B;  4CZZ B;  4XBF B;  4UV8 B;  3ZMZ B;  5H6R B;  3ZMS B;  3ZN1 B;  5LGT B;  5L3E B;  2IW5 B;  2X0L B;  4UXN B;  4UVB B;  5H6Q B;  5LGU B; 
#chains in the Genus database with same CATH topology
 3T8O A;  5AQR B;  3BQK A;  2BZB A;  4UEL A;  2J1D G;  3AEE A;  2M6I A;  3QOF A;  4EXT A;  3AE6 A;  3AE8 A;  2LKG A;  4PFP A;  4HFD A;  5AQS B;  1UX5 A;  2XM2 A;  3I0Q A;  2Y8D A;  3K8P C;  1NAF A;  2KT9 A;  1MMN A;  2V7M A;  3H3A A;  4LF8 T;  4I43 B;  5EK4 A;  5L3C B;  5JRC A;  4TX5 A;  4JI2 T;  4QXB B;  2WS3 A;  2KMF A;  5AQT B;  2VKO A;  3MAC A;  4UV8 B;  4KX6 A;  3OPC A;  4V1A v;  5HXR A;  3JC6 C;  4ILU A;  4BA9 A;  5JR9 C;  1T72 A;  3O4X E;  1HG2 A;  2X51 A;  1MMG A;  1KK7 A;  2BBH A;  3GWH A;  2X0H A;  3AE9 A;  4OX9 T;  2HN2 A;  4HWC A;  2XQY A;  2I59 A;  3AA7 B;  4IRE A;  2EHO A;  5ABG A;  4K0U A;  4O4L E;  1HS7 A;  2YU2 A;  4YSY A;  2VQF T;  1MND A;  4CN6 A;  1L0V A;  3B57 A;  3F31 A;  4AIU A;  2N1G A;  4IT4 A;  3FZH B;  5FKY A;  2NR4 A;  4I50 E;  3W15 B;  2IC9 A;  4ZXL A;  3KV6 A;  3ZC1 A;  3EAB A;  3C64 A;  3H37 A;  4LF7 T;  4LFA T;  4DMW A;  2XM1 A;  3V5S A;  3RRC A;  4DV4 T;  1UUS A;  2SPC A;  3RH3 A;  2LHR A;  3P4Q A;  3ZEF B;  5L2L A;  1CUN A;  4M1P A;  5CJ5 A;  2MPK A;  2DNX A;  4TWH A;  4H9P C;  2XPK A;  3VRB A;  4X66 T;  3I9W A;  2J4G A;  3UUN A;  3TLU A;  4YTM A;  4H9S E;  4UVB B;  1W0B A;  2CWO A;  2WDV A;  4ZS3 A;  4L9I A;  5J0Z A;  3UQ4 A;  1ZP0 A;  1T7S A;  2YU1 A;  3FZL B;  2X9H A;  2YDR A;  1HF8 A;  2WDR A;  2KZ7 B;  1T8B A;  5FY7 A;  3L8R A;  4UVA B;  1US7 B;  3CQC B;  5JQG E;  2VVS A;  2QGS A;  4IE0 A;  4IL4 A;  3EUH A;  4X62 T;  1HX8 A;  3LBX A;  4PJL A;  1JNR A;  5IHY A;  5KMG P;  4BJN A;  2ES0 A;  4QWN B;  4XAX B;  1IAP A;  1N34 T;  3OYZ A;  2IW5 B;  4MBQ A;  4C90 A;  2UXC T;  5L3B B;  2XAH B;  2FBW A;  3RYF E;  1OED E;  1YKH B;  2UXN B;  3PUR A;  3PU3 A;  3BK9 A;  1OXZ A;  4TNW A;  2H89 A;  3N9O A;  5DQW A;  2W4X A;  3ZN1 B;  5HEO A;  4TWD A;  5LHG B;  2V6X A;  2HH7 A;  4LML A;  2FJB A;  4ZEY A;  1XMO T;  4A56 A;  3EDU A;  3U3I A;  4K0K T;  1Y01 A;  4FJO A;  3ZKR A;  4G63 A;  1FMW A;  3LK3 B;  1OED A;  3ZT6 A;  5LCY A;  5HEH A;  2Q9Q B;  1FIO A;  4IHJ E;  3NKZ A;  2DWK A;  4BAY B;  3ZLI A;  2UXB T;  2XQ5 A;  2RPA A;  2XQA A;  4JI4 T;  2XZE A;  5FL0 A;  3E08 A;  3KV4 A;  3QB5 K;  3JAD A;  3T1Y T;  4JI1 T;  1UCU A;  3N5L A;  4ZI3 D;  1ZOY A;  1WRD A;  2WZI A;  3K3N A;  2K48 A;  2B76 A;  2YN6 A;  4GKK T;  4QHO A;  3ZMU B;  3NZP A;  5IWA T;  5JDH A;  4DV3 T;  3N9N A;  2VQE T;  2M67 A;  4CN4 A;  4H9N C;  1BR1 A;  1LVF A;  4UVC B;  5LA6 E;  3C4W A;  2JMH A;  4DBQ A;  5JR9 B;  1KEY A;  2L8K A;  3S4U A;  3CX7 B;  1XMQ T;  3QC9 A;  4CI3 B;  4PAG A;  3VHL A;  3BQI A;  2JQQ A;  4OFZ A;  5AQP B;  1YQ3 A;  5FP3 A;  1UUR A;  2VWA A;  4HFV A;  3B13 A;  4QKN A;  2WQY A;  5LOV E;  2D0U A;  4LFB T;  1KFY A;  1LVK A;  3LG7 A;  4AQF A;  5EK2 A;  4AQG A;  3UU4 A;  5BR8 T;  5HXS A;  3VKG A;  2W61 A;  5KDM C;  2LKH A;  3KV5 A;  2LLY A;  5CA0 E;  3RKG A;  2Q9Q A;  4U2Z A;  3P7I A;  3PUG A;  3I9Y A;  2DHR A;  3UTK A;  3F2E A;  3ANW B;  2DWG A;  3KVA A;  5HXE A;  1BR2 A;  4IIJ E;  5JDQ A;  5FXW A;  2E9X D;  3FHN A;  2LSK A;  4AIS A;  5AQI B;  4DND A;  4IDN A;  4HE8 A;  2Z6E A;  1H7C A;  2ZMA A;  1IBK T;  5F3J A;  1JNZ A;  4GYS A;  4CQI A;  2A3D A;  1MIV A;  2KWI B;  4DID B;  2WWV A;  4U2Y A;  2BVL A;  2L9Q A;  3ETV A;  4ILC A;  2NW8 A;  5DQV A;  1WFD A;  2X0L B;  3AXJ B;  1FEW A;  3DP7 A;  2V6Y A;  4O4H E;  3JAF A;  4P0B A;  4IE5 A;  4IDZ A;  2XHE B;  2VKD A;  1WYB A;  3RIU A;  3NVO A;  4PK5 A;  1SE7 A;  1ZKE A;  5AQH B;  3I1A A;  3RKO A;  1OWA A;  2WCA A;  3UU3 A;  1UK5 A;  1YD8 G;  4HFI A;  2JPF A;  2JIW A;  3PUQ A;  2ZM2 A;  3KVB A;  1M62 A;  4HFE A;  1IBM T;  3FZF B;  4DV6 T;  1QLB A;  3N9Q A;  4ASK A;  2BS2 A;  2CCQ A;  2ZLY A;  5AQM B;  4IE4 A;  5FL1 A;  3X1D A;  1MMA A;  2CWY A;  4U74 A;  4DV1 T;  5AQO B;  4GYR A;  3AEA A;  3ZMT B;  1J5W A;  4YSX A;  4CXY A;  3PUV F;  4XZC A;  5JDF A;  4CXW A;  2HPL A;  4YJ3 E;  1MIW A;  3R84 B;  4EOZ B;  5LXT E;  1ZHC A;  4DR2 T;  5FMN A;  3PJA A;  2PTF A;  3CML A;  3C51 A;  3KV9 A;  4JYA T;  2CMR A;  3SS1 A;  3PV0 F;  1SA0 E;  2L3L A;  5JH7 E;  5ABE A;  1WYC A;  2ZM0 A;  1X9B A;  3D0T A;  3M3Z B;  3UUM A;  4ADZ A;  3OKQ A;  2NOX A;  2N9D A;  5A1L A;  4AQY T;  1NEK A;  1W9R A;  2QVA A;  4O4J E;  2XAF B;  4WW0 A;  3ZMS B;  2LOS A;  2B1E A;  3ONX A;  2E9X A;  4DO0 A;  5H6Q B;  2JRK A;  2VL0 A;  4YY3 T;  5ABF B;  1HR0 T;  4G2A A;  4EIW A;  4YXD A;  5TAO A;  1CHU A;  4CZZ B;  3AB3 B;  2NW7 A;  4Q25 A;  4OYK A;  5AQF B;  5LGU B;  5FXZ A;  4HFB A;  1BR0 A;  2IIU A;  2QRX A;  4NIQ A;  4PFO A;  5FVL A;  3IF8 B;  1Y64 B;  2WMO A;  2X68 A;  1W09 A;  4H63 V;  5HCM A;  2OLT A;  5FY1 A;  3NWI A;  2X67 A;  3KFW X;  2LM2 A;  2BG9 A;  4E7S A;  2KIN B;  2N2N A;  3HA4 A;  5AFU L;  4X1K E;  3GMI A;  1YXR A;  4IGU A;  3J9X 1;  4TN7 B;  4UF0 B;  4J2C A;  1G8X A;  5JDN A;  1W0A A;  2E5V A;  2UXD T;  4B3S T;  3UU8 A;  4X20 E;  4UR9 A;  4B3M T;  1IZN B;  1I6Z A;  4ZZC A;  3TLW A;  4QX8 B;  4CXX A;  3FBZ A;  5ADX L;  4EGW A;  2FJE A;  2WWU A;  2A9U A;  3ZMV B;  3AED A;  4TZ4 C;  2VKJ A;  2X9X A;  3AEB A;  2A72 A;  3NRX A;  4YTP A;  2LE8 A;  1EZ3 A;  5FY0 A;  5LMU T;  4I4T E;  2OA5 A;  2WZH A;  3PTR B;  4U7Y A;  2J62 A;  5FVK A;  2NWB A;  4JEU B;  2KXP B;  3CX6 B;  3SRZ A;  1MIY A;  2IML A;  4YSZ A;  2DLR A;  2W67 A;  2I6H A;  2AE9 A;  5HXC A;  4AKI A;  2V7K A;  5HCJ A;  3U78 A;  4MAL A;  2E2A A;  4WZX A;  3ABV A;  5EZY E;  4X65 T;  5AQL B;  3AEF A;  4IE7 A;  4P1N A;  2PJQ A;  4KHZ F;  4ZOL E;  4CN1 A;  1R8I A;  2D9D A;  4LMK A;  2NW9 A;  2MOZ A;  5AQU B;  2E5L T;  5AQJ B;  4NXN T;  4HWI B;  3WAJ A;  3UUX B;  3ZYK A;  3PE0 A;  1HCI A;  3AAA B;  2XAG B;  4PJJ A;  1S94 A;  1D1B A;  3ZJ2 A;  4ANJ A;  4UF0 A;  3RYH E;  3MXZ A;  3IA3 A;  2XSB A;  4EEB A;  3EVY A;  2XAQ B;  4GKJ T;  4NUV A;  5GON E;  2W0G A;  2VAS A;  4KP3 C;  3N2G E;  1QUU A;  2WB5 A;  2V7J A;  2VUR A;  5H6R B;  2CA5 A;  2W63 A;  4COF A;  4HN9 A;  3K1S A;  3NBX X;  4ZZB A;  3CQX C;  4MFR A;  3RIF A;  2V1D B;  2Q9Q D;  3AE7 A;  4QH4 A;  2CBI A;  2YIN A;  2CLY C;  3CPZ A;  2CPT A;  1QSD A;  3EI0 A;  1LRZ A;  2C0S A;  4F6R C;  4DV7 T;  3FBL A;  2WSS V;  1AJ3 A;  3UU6 A;  3SFD A;  2HHH T;  5LJN A;  4ILB A;  4JI8 T;  4LFC T;  5LHI B;  5JRE A;  5JDM A;  3FZM B;  4OYJ A;  2EHO C;  1UGO A;  5HWX A;  3UFE A;  3HR0 A;  2C5K T;  5M4Y A;  5HWY A;  5E0O A;  1WLX A;  1D0X A;  5LMN T;  1XZY A;  4X1Y E;  3PUY F;  3JC6 D;  4O8S A;  3QNU A;  2J47 A;  2G0U A;  4LF4 T;  4QH5 A;  2H7V C;  2YEV C;  5JVD E;  2E8I A;  1UX4 A;  2V7I A;  2DL1 A;  4ILA A;  2X9Y A;  4OHF A;  2K9A A;  3CK6 A;  3P4W A;  5KXJ A;  5FXX A;  1Z8U A;  5L3F B;  3AEG A;  1T98 A;  4IST A;  4DBR A;  3ESL A;  3CX8 B;  2QYW A;  5HEJ A;  4EV6 A;  2JJ9 A;  3RC8 A;  1SHZ C;  3Q9D A;  3OTO T;  2JQH A;  3WI3 A;  3HKD E;  2K5B B;  3ZT7 A;  3AE3 A;  4P0A A;  2KWH A;  3A8Y C;  3LDQ B;  1KF6 A;  5LNK A;  1WR0 A;  1O3X A;  3P4S A;  5AQK B;  1DU2 A;  2UU9 T;  3QK6 A;  3AEC A;  3PUS A;  2WY2 A;  4I0U A;  3EHZ A;  3CKD A;  3ZC0 A;  3PUX F;  3OVU A;  4DV5 T;  5J2T E;  4PJN A;  3JCF A;  3TLS A;  3V5U A;  3E22 E;  4O2A E;  4HFC A;  3VU7 H;  2MTQ A;  4HGA A;  2WBL A;  2ACX A;  4TUY E;  2XQ4 A;  4DR1 T;  4UXN B;  3VKH A;  4CI1 B;  5J1G A;  3TLV A;  2UUB T;  3PDY A;  4KHP T;  3LSV A;  3O1I A;  3RX6 A;  2UUC T;  3C98 B;  5CA1 E;  4JLE A;  3K3O A;  2DI4 A;  1ZEE A;  5LYJ E;  4UEM A;  1HNW T;  4IDP A;  1E7P A;  5JDG A;  4EB6 E;  2ZM8 A;  4GOU A;  3O9X A;  3QB5 A;  5L47 A;  2MYS A;  2C5I T;  5L3D B;  3SOL A;  3HI2 A;  3O1H A;  3GN5 B;  3ZN0 B;  4KUM B;  2V7L A;  3ZMZ B;  5JR9 A;  4HKA A;  1OED C;  5F5W A;  1IJ6 A;  2XSA A;  2FUP A;  3PUW F;  4JI6 T;  2YK0 A;  2XTL A;  4HWH A;  3MJX A;  3GA8 A;  4H9Q C;  2NTY A;  4Z90 A;  2HPJ A;  4DVD A;  3MKD A;  5HYA A;  1XDO A;  4DUY T;  4FI5 A;  5HEG A;  3B5M A;  3C4X A;  3ETU A;  1G73 A;  3TKL B;  3M65 A;  3SFE A;  2VL8 A;  2RP4 A;  2W62 A;  3UUL A;  2YDQ A;  2PFV A;  3KBU A;  1VRB A;  4QX7 B;  3ANW A;  3HKE E;  4LF6 T;  2H88 A;  5JRC B;  3AAE B;  3ONL C;  2CLY B;  3OJA A;  3NZQ A;  4YJ2 E;  4U33 A;  4DR4 T;  2BBJ A;  3CQG B;  2JQK A;  5ETW A;  4WNK A;  3R6N A;  3OYX A;  4KBM B;  1S35 A;  2VKH A;  5BMV E;  1E2A A;  5J2U E;  1XWM A;  2EHO B;  4DV0 T;  3AXJ A;  3AA0 B;  2XY8 B;  2XAS B;  3HL6 A;  1N36 T;  2IDO B;  4AQF C;  2Y6X A;  4AXP A;  2NP9 A;  3PU8 A;  4AI6 A;  4YLH A;  1M7K A;  3A5X A;  2CXF A;  4KMC A;  2X9W A;  1MNE A;  1I94 T;  4IDO A;  2Q9Q C;  3MA9 A;  3C4Z A;  5HXH A;  2XQ9 A;  2LEH A;  2LHN A;  4GK0 E;  2BG9 E;  2UUA T;  2IUB A;  3HKB E;  5L3G B;  3FXD B;  4LMJ A;  1HFA A;  2CM0 A;  4PK6 A;  4AKH A;  4YFS A;  3F57 A;  4GK5 E;  2XQ6 A;  3KBT A;  5IUX A;  3AE5 A;  4NUU A;  2K3W A;  3P50 A;  4ZI2 D;  4TV9 E;  4AKR B;  2ODU A;  1X79 A;  2Y48 B;  1HTJ F;  1J1J A;  2JQ9 A;  3L09 A;  3MK7 C;  3RIU C;  3RF1 A;  5CB4 E;  3RGL A;  3RQU A;  5HAX A;  2VVN A;  4ZI3 C;  4YHJ A;  4ERR A;  1D0Z A;  2PG8 A;  2AXD S;  5CGM A;  3ZCJ A;  4NXM T;  1V9D A;  1XNR T;  4GIW A;  4PNI A;  4YT0 A;  3IHR A;  3LBX B;  2CXD A;  4ISS A;  4CI2 B;  3ZT5 A;  4YHH T;  2F4V T;  3CWZ B;  1WR6 A;  3FZK B;  2C5J A;  3AE2 A;  3ONJ A;  1YKE B;  1NEN A;  5ABF A;  3LFM A;  5IYZ E;  3AVR A;  5LJM A;  1N33 T;  4DR3 T;  1VCS A;  4LF5 T;  5AQV B;  2LSY A;  2LOP A;  4IL9 A;  2WAU A;  4DUZ T;  3AAI A;  4P09 A;  4IE6 A;  4EZH A;  5LGN B;  2OV9 A;  2W00 A;  4QXH B;  3RYC E;  2MBG A;  5LBQ B;  2NTX A;  3G06 A;  3RLF F;  4U3C A;  1IBL T;  5FNV E;  3ZYL A;  2WM9 A;  2WMN A;  3UFG A;  4L0R A;  3RI5 A;  2LM9 A;  4F8H A;  3N9P A;  3RQW A;  1SUM B;  1OED B;  2HN1 A;  2KLQ A;  2ODV A;  4TWF A;  2R6G F;  4E7Z A;  2YOE A;  4X5T A;  4XBF B;  1FJG T;  5C2T A;  3CVR A;  5FXV A;  3SWH A;  2E9X C;  1XNQ T;  2UXX B;  3RPU A;  4IDQ A;  4HWD A;  2DCF A;  5C8Y E;  3LK2 B;  2V26 A;  5HEU A;  1IJ5 A;  2K24 A;  2CBJ A;  4WBN E;  2D0T A;  3FB2 A;  3AE4 A;  2W66 A;  2VB6 A;  3Q2M A;  1FMV A;  4DR5 T;  4PW8 A;  4X64 T;  2RA1 A;  2W2U A;  3TLT A;  1BR4 A;  4HWF A;  2BKP A;  4EYY R;  2IHR 1;  2IC6 A;  4DR7 T;  1HNZ T;  2MAW A;  2ZM6 T;  2BG9 C;  4EAH A;  5CFB A;  4EZ4 A;  2IAK A;  2XQ3 A;  1YW0 A;  3LK4 2;  4DV2 T;  3I0O A;  1U5P A;  3WAK A;  3ZJ1 A;  5JTG A;  5C3J A;  4PJM A;  3N2K E;  5LG4 A;  4UIG A;  2GK9 A;  3DTO A;  2CXL A;  3QUJ A;  5AQG B;  5LHH B;  3L39 A;  3JAE A;  4C91 A;  3Q5E A;  3ZST A;  3E0Z A;  1VOM A;  2CE7 A;  2BKN A;  4O2B E;  5AQN B;  1NWM X;  3KIN B;  4U72 A;  3CIR A;  5F8P A;  3IEE A;  2XQ7 A;  3J7Y q;  5FYM A;  2ACZ A;  4JI5 T;  4YTN A;  3RRW A;  2A2F X;  4H63 H;  4MLK A;  3N2O A;  2BVM A;  2FJD A;  1WCR A;  3H3M A;  2CHN A;  2V6Y B;  4A5X A;  2D2S A;  4JEH B;  2X0Y A;  4TNV A;  3P8C D;  4BJM A;  2PBI A;  2XJ7 A;  2LRL A;  3UQ7 A;  4JUY A;  4JI3 T;  2V5C A;  5AQQ B;  4KI0 F;  1ZV4 X;  1D1C A;  3ZCI A;  4B3T T;  1VCT A;  1KNR A;  4QXC B;  2JMK A;  5LP6 E;  4HFH A;  5LBM A;  3O1J A;  2H3R A;  4LF9 T;  5EK3 A;  4I55 E;  4B6X A;  2M6B A;  2WDQ A;  4AKG A;  2LT3 A;  1HNX T;  5LGT B;  5KX5 E;  3UT5 E;  4ZI2 C;  4DR6 T;  3N9M A;  4UV9 B;  2X66 A;  1N32 T;  1J5E T;  1LKX A;  3AVS A;  1HG5 A;  3RHW A;  4JV5 T;  1Z0P A;  5JDL A;  5L4E A;  4WBO A;  1GQE A;  4JBW F;  2QA7 A;  2LSG A;  3EAM A;  3A7M A;  1D0Y A;  3RIA A;  2V8S V;  3FXE B;  4Z91 A;  2YDS A;  4U31 A;  4N78 D;  3VR9 A;  3K3Q C;  2FJA A;  1YQ4 A;  3PUZ F;  5ABH A;  4AKL A;  4Z8X A;  5LG3 A;  4EYU A;  3BQL A;  3Q5X A;  2CRB A;  2LSJ A;  2BKO A;  5DJQ C;  1U4Q A;  3ZSS A;  3T1H T;  3IBP A;  3AE1 A;  4A98 A;  2XAJ B;  3P4R A;  3VRA A;  4NPP A;  4WYV A;  2E9X B;  4X1I E;  3VR8 A;  3HKC E;  5L3E B;  5LB7 B;  4OK0 A;  4O4I E;  4H9O C;  3PUA A;  3RC3 A;  3ZPO A;  3DJB A;  3LJC A;  2BS4 A;  4DMV A;  3PJA J;  5L4H A;  3UUB A;  2BDE A;  2EHO D;  4PK4 A;  5DAB A;  2P9B A;  2D5U A;  4QH1 A;  3OBV E;  4L5G A;  3KDS E;  2CEA A;  3L3P A;  3Q5D A;  3EDV A;  3N9L A;  2LJL A;  2WP9 A;  2H7O A;  2BG9 B;  1KNZ A;  2KSR A;  3RYI E;  3P4P A;  2KND A;  4B3R T;  2LRK A;  2V5D A;  4HTE A;  2BS3 A;  1D1A A;  4ZS2 A;  2YKS A;  4TV8 E;  4H9R C;  3MZK B;  2LSI A;  4JI0 T;  1HX1 B;  1XDP A;  3ZYM A;  4EED A;  4JI7 T;  1KNP A;  2XQ8 A;  3NRY A;  2XUE A;  2I0M A;  4ZI7 E;  4U7I A;  2WU2 A;  3GN5 A;  3AA1 B;  4A97 A;  4HEA A;  1MMD A;  3Q5W A;  2WU5 A;  2CHO A;  3C50 A;  4MHC A;  1B7T A;  4ZHQ E;  3UU5 A;  2VK9 A;  1E1H B;  3AA6 B; 
#chains in the Genus database with same CATH homology
 3T8O A;  3BQK A;  3N9P A;  1UX4 A;  2BZB A;  2V7I A;  4IE5 A;  4IDZ A;  4P0B A;  4UEL A;  2J1D G;  2XHE B;  2VKD A;  1WYB A;  2KLQ A;  2X9Y A;  2ODV A;  4PK5 A;  4EXT A;  4OHF A;  4E7Z A;  1ZKE A;  2K9A A;  3I1A A;  3RKO A;  1OWA A;  4XBF B;  4PFP A;  1YD8 G;  1UX5 A;  2JPF A;  3CVR A;  3I0Q A;  5FXV A;  5FXX A;  2Y8D A;  3SWH A;  3PUQ A;  3K8P C;  2E9X C;  2ZM2 A;  3KVB A;  1NAF A;  2KT9 A;  5L3F B;  1MMN A;  1T98 A;  2V7M A;  3H3A A;  4I43 B;  2UXX B;  4IST A;  5EK4 A;  4DBR A;  5LA6 E;  5L3C B;  3ESL A;  5JRC A;  3RPU A;  4TX5 A;  3CX8 B;  3N9Q A;  4QXB B;  4ASK A;  2DCF A;  2KMF A;  3LK2 B;  5C8Y E;  2V26 A;  2JJ9 A;  2VKO A;  3MAC A;  3RC8 A;  2CCQ A;  1IJ5 A;  4UV8 B;  2K24 A;  1SHZ C;  3Q9D A;  2ZLY A;  4IE4 A;  4V1A v;  3WI3 A;  3HKD E;  2D0T A;  3FB2 A;  3JC6 C;  5HXR A;  4WBN E;  4ILU A;  1MMA A;  2CWY A;  4U74 A;  4BA9 A;  5JR9 C;  3O4X E;  2K5B B;  2VB6 A;  1HG2 A;  3Q2M A;  4GYR A;  2X51 A;  1FMV A;  4P0A A;  1MMG A;  3ZMT B;  1KK7 A;  2KWH A;  4PW8 A;  4CXY A;  4XZC A;  5LNK A;  5JDF A;  4CXW A;  2HPL A;  1O3X A;  3GWH A;  2RA1 A;  4YJ3 E;  1MIW A;  2XQY A;  1BR4 A;  2I59 A;  3AA7 B;  3R84 B;  4EYY R;  4EOZ B;  5LXT E;  2EHO A;  2IC6 A;  4K0U A;  4O4L E;  3QK6 A;  1HS7 A;  1ZHC A;  2YU2 A;  5FMN A;  3PUS A;  3CML A;  3C51 A;  1MND A;  3CKD A;  3ZC0 A;  3KV9 A;  3B57 A;  3F31 A;  4EAH A;  5J2T E;  4PJN A;  2CMR A;  3SS1 A;  4EZ4 A;  3V5U A;  3E22 E;  1SA0 E;  2L3L A;  2IAK A;  4O2A E;  5JH7 E;  2N1G A;  1YW0 A;  3VU7 H;  2ZM0 A;  1WYC A;  2MTQ A;  3LK4 2;  4HGA A;  3I0O A;  1U5P A;  4I50 E;  2WBL A;  2ACX A;  3WAK A;  3D0T A;  4TUY E;  3ZJ1 A;  3W15 B;  2IC9 A;  3UUM A;  4UXN B;  4ADZ A;  3OKQ A;  2NOX A;  3VKH A;  4CI1 B;  3KV6 A;  5J1G A;  2N9D A;  3ZC1 A;  5A1L A;  4PJM A;  3N2K E;  5LG4 A;  4UIG A;  3C64 A;  2GK9 A;  3H37 A;  3PDY A;  3DTO A;  4O4J E;  2CXL A;  3QUJ A;  2XAF B;  3O1I A;  5LHH B;  3RX6 A;  4DMW A;  4O4H E;  4C91 A;  3C98 B;  5CA1 E;  4WW0 A;  4JLE A;  3V5S A;  3ZMS B;  2LOS A;  3K3O A;  2B1E A;  3ONX A;  3RRC A;  2E9X A;  2DI4 A;  2SPC A;  4DO0 A;  3RH3 A;  1ZEE A;  3E0Z A;  1VOM A;  5H6Q B;  5LYJ E;  2JRK A;  2CE7 A;  4UEM A;  5JDG A;  2LHR A;  4EB6 E;  4O2B E;  3ZEF B;  5L2L A;  1CUN A;  1NWM X;  2ZM8 A;  3KIN B;  4U72 A;  4GOU A;  3O9X A;  4M1P A;  2DNX A;  4G2A A;  4EIW A;  5F8P A;  2MYS A;  2C5I T;  5L3D B;  5TAO A;  3IEE A;  4H9P C;  3SOL A;  3HI2 A;  3O1H A;  3J7Y q;  3GN5 B;  3I9W A;  3ZN0 B;  4KUM B;  4CZZ B;  3AB3 B;  2V7L A;  5FYM A;  3ZMZ B;  5JR9 A;  2NW7 A;  4HKA A;  3UUN A;  1IJ6 A;  4H9S E;  4UVB B;  4OYK A;  2CWO A;  5LGU B;  2YK0 A;  2XTL A;  4ZS3 A;  5FXZ A;  3RRW A;  2A2F X;  3MJX A;  4H63 H;  4L9I A;  1BR0 A;  4MLK A;  3GA8 A;  3N2O A;  4H9Q C;  2BVM A;  2NTY A;  2HPJ A;  2YU1 A;  4DVD A;  2X9H A;  3MKD A;  1HF8 A;  4PFO A;  5HYA A;  3IF8 B;  4FI5 A;  2KZ7 B;  3C4X A;  3ETU A;  1Y64 B;  2WMO A;  2X68 A;  4H63 V;  1G73 A;  3TKL B;  3M65 A;  5FY7 A;  2D2S A;  5FY1 A;  4JEH B;  2X67 A;  3KFW X;  4E7S A;  3P8C D;  4BJM A;  2KIN B;  2N2N A;  4UVA B;  2VL8 A;  1US7 B;  2PBI A;  3CQC B;  2RP4 A;  2W62 A;  3HA4 A;  5JQG E;  5AFU L;  4X1K E;  4JUY A;  2QGS A;  3GMI A;  4IE0 A;  3EUH A;  4IGU A;  3J9X 1;  1HX8 A;  3LBX A;  1ZV4 X;  4PJL A;  1D1C A;  4TN7 B;  4J2C A;  4UF0 B;  3UUL A;  3ZCI A;  1G8X A;  5JDN A;  5IHY A;  5KMG P;  4BJN A;  2PFV A;  3KBU A;  2ES0 A;  4QWN B;  4XAX B;  1IAP A;  1VRB A;  4QXC B;  3ANW A;  3HKE E;  4QX7 B;  3OYZ A;  2IW5 B;  4MBQ A;  2JMK A;  4X20 E;  5LP6 E;  5JRC B;  3AAE B;  2CLY B;  4C90 A;  3OJA A;  1IZN B;  3NZQ A;  5LBM A;  3O1J A;  5L3B B;  2XAH B;  4QX8 B;  2H3R A;  4CXX A;  4YJ2 E;  5EK3 A;  3FBZ A;  3RYF E;  5ADX L;  4I55 E;  2WWU A;  3ZMV B;  1YKH B;  2UXN B;  4TZ4 C;  2VKJ A;  3PUR A;  3CQG B;  3PU3 A;  2X9X A;  1OXZ A;  2A72 A;  3BK9 A;  3NRX A;  4B6X A;  2LE8 A;  1EZ3 A;  5ETW A;  4WNK A;  3R6N A;  3N9O A;  5DQW A;  5FY0 A;  3OYX A;  4KBM B;  4AKG A;  3ZN1 B;  2LT3 A;  4I4T E;  5LGT B;  5KX5 E;  1S35 A;  2OA5 A;  2VKH A;  3UT5 E;  3PTR B;  4ZI2 C;  5LHG B;  5BMV E;  2HH7 A;  5J2U E;  3N9M A;  4UV9 B;  2X66 A;  2NWB A;  4A56 A;  3EDU A;  4JEU B;  2EHO B;  1LKX A;  3AVS A;  1HG5 A;  2KXP B;  3U3I A;  3CX6 B;  3AA0 B;  3SRZ A;  1Z0P A;  5JDL A;  1MIY A;  4WBO A;  4FJO A;  2XAS B;  2DLR A;  4G63 A;  1FMW A;  3LK3 B;  5HXC A;  3HL6 A;  2QA7 A;  4AKI A;  2LSG A;  2V7K A;  1D0Y A;  4AQF C;  5LCY A;  2Y6X A;  3FXE B;  3U78 A;  4AXP A;  2Q9Q B;  1FIO A;  4IHJ E;  4MAL A;  2NP9 A;  2DWK A;  3PU8 A;  4BAY B;  3ZLI A;  4N78 D;  5EZY E;  3K3Q C;  4AI6 A;  4YLH A;  3A5X A;  2CXF A;  4IE7 A;  4KMC A;  2X9W A;  2PJQ A;  4AKL A;  1MNE A;  4ZOL E;  4Z8X A;  2Q9Q C;  4EYU A;  3BQL A;  3MA9 A;  3C4Z A;  3E08 A;  3Q5X A;  5HXH A;  2LEH A;  2LHN A;  3KV4 A;  2NW9 A;  2LSJ A;  4GK0 E;  2MOZ A;  1UCU A;  3N5L A;  4ZI3 D;  5DJQ C;  1WRD A;  1U4Q A;  3K3N A;  3HKB E;  3IBP A;  5L3G B;  3FXD B;  2K48 A;  2XAJ B;  1HFA A;  2CM0 A;  4PK6 A;  4AKH A;  4YFS A;  3F57 A;  2E9X B;  3WAJ A;  3UUX B;  4GK5 E;  3ZYK A;  3PE0 A;  1HCI A;  3AAA B;  4QHO A;  3KBT A;  3ZMU B;  3NZP A;  2XAG B;  4PJJ A;  1S94 A;  1D1B A;  4NUU A;  4X1I E;  5JDH A;  3ZJ2 A;  4ANJ A;  3HKC E;  4UF0 A;  3N9N A;  5L3E B;  3RYH E;  4ZI2 D;  3MXZ A;  2M67 A;  4TV9 E;  4AKR B;  2ODU A;  4OK0 A;  4H9N C;  1BR1 A;  1LVF A;  4O4I E;  4UVC B;  1X79 A;  2Y48 B;  1HTJ F;  3EVY A;  4H9O C;  2XAQ B;  2JMH A;  3C4W A;  3PUA A;  4NUV A;  3L09 A;  5GON E;  3RC3 A;  2W0G A;  3DJB A;  3ZPO A;  4DBQ A;  5JR9 B;  2VAS A;  4KP3 C;  2L8K A;  3S4U A;  3CX7 B;  3LJC A;  3N2G E;  1QUU A;  4DMV A;  3QC9 A;  4CI3 B;  3MK7 C;  4PAG A;  3VHL A;  2V7J A;  3BQI A;  2BDE A;  5H6R B;  2CA5 A;  2EHO D;  2JQQ A;  4PK4 A;  5CB4 E;  2W63 A;  5DAB A;  2P9B A;  4HN9 A;  4OFZ A;  2D5U A;  3NBX X;  5HAX A;  3OBV E;  5FP3 A;  4ZI3 C;  4L5G A;  3CQX C;  4YHJ A;  4MFR A;  2VWA A;  3KDS E;  2CEA A;  3L3P A;  4ERR A;  3EDV A;  3N9L A;  4HFV A;  1D0Z A;  2Q9Q D;  2V1D B;  3B13 A;  4QKN A;  5LOV E;  2D0U A;  2LJL A;  2PG8 A;  1LVK A;  2H7O A;  3LG7 A;  2YIN A;  4AQF A;  2CLY C;  3CPZ A;  3ZCJ A;  1QSD A;  4AQG A;  5EK2 A;  1LRZ A;  1V9D A;  1KNZ A;  2C0S A;  5HXS A;  4GIW A;  4PNI A;  3RYI E;  4F6R C;  3VKG A;  3IHR A;  2KND A;  2W61 A;  3LBX B;  5KDM C;  3FBL A;  2CXD A;  2WSS V;  1AJ3 A;  4ISS A;  4CI2 B;  4HTE A;  3KV5 A;  5LJN A;  1D1A A;  3CWZ B;  4ZS2 A;  5CA0 E;  4TV8 E;  1WR6 A;  2Q9Q A;  2C5J A;  3P7I A;  3PUG A;  3I9Y A;  4H9R C;  5LHI B;  2DHR A;  3UTK A;  3F2E A;  2LSI A;  3ANW B;  3MZK B;  2DWG A;  5JRE A;  3KVA A;  5HXE A;  5JDM A;  1BR2 A;  1YKE B;  3ZYM A;  4IIJ E;  4OYJ A;  5JDQ A;  3LFM A;  5IYZ E;  3AVR A;  5LJM A;  5FXW A;  2E9X D;  3NRY A;  2XUE A;  2EHO C;  3FHN A;  2LSY A;  2LSK A;  2LOP A;  5HWX A;  4ZI7 E;  4DND A;  3UFE A;  3GN5 A;  3AA1 B;  2C5K T;  3HR0 A;  4HE8 A;  5M4Y A;  2Z6E A;  4HEA A;  5HWY A;  2WAU A;  5E0O A;  1WLX A;  1H7C A;  3AAI A;  2ZMA A;  1MMD A;  4P09 A;  4IE6 A;  4EZH A;  4GYS A;  5F3J A;  3Q5W A;  5LGN B;  4CQI A;  1D0X A;  2W00 A;  4QXH B;  3RYC E;  2A3D A;  1MIV A;  4X1Y E;  2KWI B;  5LBQ B;  2MBG A;  2NTX A;  3C50 A;  4MHC A;  2BVL A;  1B7T A;  3JC6 D;  2L9Q A;  3ETV A;  5FNV E;  4O8S A;  5DQV A;  2NW8 A;  2WM9 A;  3ZYL A;  4ZHQ E;  2VK9 A;  2G0U A;  2X0L B;  2WMN A;  4L0R A;  2H7V C;  2YEV C;  1E1H B;  1FEW A;  5JVD E;  3DP7 A;  2LM9 A;  2E8I A;  3AA6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...