5LCYA

Formaldehyde-responsive regulator frmr e64h variant from salmonella enterica serovar typhimurium
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
88
structure length
88
Chain Sequence
PHSPEDKKRILTRVRRIRGQVEALERALESGEPCLAILQQIAAVRGASNGLMSEMVEIHLKDHLVSGETTPDQRAVRMAEIGHLLRAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Effectors and Sensory Sites of Formaldehyde-responsive Regulator FrmR and Metal-sensing Variant.
pubmed doi rcsb
source organism Salmonella enterica serovar typhimurium
molecule tags Transcription
molecule keywords Frmr
total genus 35
structure length 88
sequence length 88
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2016-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02583 Trns_repr_metal Metal-sensitive transcriptional repressor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1000 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 5lcyA00
3AAIA 5LBMA 4ADZA 4UIGA 5LCYA 2HH7A 4M1PA 5FMNA
chains in the Genus database with same CATH superfamily
3A7MA 5L4EA 5JR9C 3AXJA 4O2AE 4IHJE 2XASB 2X9XA 4I4TE 3FBLA 4GIWA 4TX5A 2VKDA 3ZMZB 2X51A 3DJBA 5KDMC 3Q2MA 5LYJE 5HEUA 4DMVA 2WCAA 4YHJA 5IHYA 2DHRA 4AQFC 3AAIA 4JI7T 2XZEA 3RI5A 3RGLA 3NZPA 2X9HA 2MAWA 3EVYA 2YK0A 2BKPA 2VASA 4CZZB 2DL1A 2KXPB 4ISSA 3S4UA 1I94T 2CCQA 5LOVE 3LK42 3RRWA 1LVKA 2XAHB 5L3GB 4OX9T 1HNWT 1XWMA 4JI0T 3T1YT 2RPAA 2M6BA 3FZMB 5E0OA 1FIOA 2ES0A 2VVSA 2F4VT 3PUYF 2W62A 2DCFA 3ANWB 3C64A 4QHOA 5LGNB 1UCUA 3LK3B 3UT5E 3ZJ1A 3UUMA 3CQGB 5LHHB 5BR8T 3J7Yq 1WLXA 3B13A 3RKOA 3ZYKA 2BDEA 5FY1A 2ZM6T 2J62A 3KV5A 4EZ4A 2G0UA 4IDOA 5L4HA 2XM1A 4TUYE 5KXJA 4HFHA 1FJGT 2W0GA 3N9QA 4KHPT 4X1IE 2A72A 2LKGA 1D1AA 2LHNA 4ZZCA 3TLUA 4AKLA 2NW8A 4P1NA 4X1KE 4DR7T 1YD8G 4X5TA 4EIWA 4GK0E 2VL8A 2ZMAA 4F6RC 3LJCA 4EGWA 4IE6A 1IBLT 1HG2A 2NTXA 5L3EB 1VRBA 2FBWA 3A8YC 3HKBE 5AQUB 3WI3A 2NP9A 2V8SV 4X65T 5HXRA 3KV6A 5LP6E 4IE7A 3HKDE 3QC9A 3F31A 2WSSV 2KMFA 4H9PC 4FI5A 5JQGE 2QA7A 2I6HA 4QX7B 3PTRB 3AA1B 3OTOT 2FJEA 1XNRT 4WNKA 2LRKA 3H3AA 4GKJT 2V1DB 1BR1A 2Y6XA 3EUHA 3ZC1A 2E9XA 4PJJA 4PFOA 5L2LA 2AE9A 5AQGB 2HPJA 1HCIA 4AISA 3P8CD 3ANWA 2KNDA 2WB5A 3DP7A 3AEGA 4DV5T 1U5PA 2XSBA 3OPCA 4TWDA 1I6ZA 2YOEA 4E7SA 4BJMA 4UVAB 4CN6A 3BQLA 2FJBA 1X79A 1Z0PA 3N9OA 4BAYB 2PFVA 1T98A 2BVLA 4JV5T 3UUNA 4EAHA 4A97A 3ZYMA 5JH7E 4U7YA 4NXMT 4KI0F 4MHCA 2W61A 4YT0A 5AFUL 4NPPA 2Y8DA 5HWXA 1YKHB 3KFWX 4L5GA 3ETUA 1L0VA 4EEBA 4HFIA 5ABFA 2P9BA 2BKOA 4CXWA 2DWGA 4U2YA 2W00A 4I0UA 3L39A 3P4SA 4PW8A 4WYVA 4LF5T 3PUQA 5LG4A 5FXZA 1HR0T 5FXXA 5CFBA 1JNZA 2N2NA 1D0YA 1ZEEA 4AKGA 4YY3T 3RYIE 2E9XD 5JDLA 5J0ZA 3Q5DA 4CI2B 2VB6A 4TNWA 1B7TA 3CMLA 1ZHCA 5FVKA 4COFA 5JRCA 3ZSTA 2UU9T 2FUPA 5JDMA 2YEVC 2IMLA 1KEYA 3ABVA 3RPUA 3RQUA 3AE6A 1US7B 3LK2B 3W15B 3PUGA 3CVRA 5CA0E 4JI6T 5JRCB 1QSDA 4CXXA 4I50E 5HYAA 5DABA 5JR9B 2NTYA 2QGSA 3RIAA 5HXHA 2CLYC 2LT3A 4UIGA 4JI5T 3DTOA 4IL4A 4JI2T 3RRCA 4AIUA 5IWAT 2C5KT 3B5MA 3PDYA 4H9RC 2BS2A 4TWFA 5J2UE 3K3OA 4YLHA 5ETWA 1XNQT 5ABGA 3AE3A 2DLRA 3RC8A 2LEHA 3FZKB 2V5DA 4LFBT 3JAFA 5CB4E 2V6XA 4YSZA 4EB6E 2W4XA 1HG5A 3EI0A 2JQHA 4WZXA 3P4PA 5EK4A 4YHHT 5KX5E 2W66A 4B3TT 2Q9QB 2RP4A 3F2EA 3KV4A 1OWAA 2KWHA 4H9QC 2J47A 4UELA 5KMGP 5HEOA 3MJXA 1OEDB 2K24A 1HS7A 5H6RB 4KBMB 2AXDS 3QB5A 3VRAA 3M65A 2WBLA 3O9XA 5LCYA 1SHZC 2EHOB 2KSRA 4H9SE 3RIFA 3ZSSA 5ADXL 3ZC0A 2Q9QD 3R84B 3GWHA 3UU6A 1IJ5A 4TWHA 4YJ2E 4UEMA 5LGTB 3O1JA 4YFSA 4CN4A 4AKHA 1CUNA 1W0AA 5L3CB 2ZM0A 4LMKA 2CXDA 3ETVA 4K0KT 3C50A 4KP3C 3CPZA 2XPKA 3N2KE 4LF6T 2LE8A 5AQVB 2WP9A 2RA1A 3ONLC 4ZI2C 3RH3A 1OEDC 3MZKB 3PUAA 1LVFA 3C51A 2XQAA 3JC6D 2FJAA 3EABA 2V6YB 2EHOC 2VVNA 3NBXX 2XY8B 4HGAA 4ISTA 1KNRA 2BBJA 4PAGA 1WYBA 1NEKA 4U72A 3RYCE 5L3BB 5AQMB 2VL0A 2ZM8A 2M6IA 4ZI3D 3TLSA 1YKEB 3AECA 1D1CA 2C0SA 2NW7A 3IEEA 4UV8B 4NUVA 1UX5A 2XAGB 3CX6B 3GMIA 1HTJF 3P4RA 4XAXB 3AAAB 4YTNA 2VKHA 4ZI2D 4ZI3C 4V1Av 4DV2T 2X0LB 5DJQC 3N9NA 3Q5EA 2Q9QA 3CIRA 3C98B 2CBIA 3CK6A 3OKQA 3RHWA 4TNVA 4DV3T 4A56A 2XSAA 3N9LA 3AE5A 3ZCJA 5LNKA 4OHFA 5LMUT 3I0OA 3AEBA 3LDQB 4U31A 4PJMA 5AQQB 3KBTA 5FY7A 2BG9A 2VQET 1IAPA 2CHNA 3H37A 4DV1T 4DR2T 4ZS2A 1J1JA 1G8XA 2JQKA 2BG9B 3K8PC 3UU4A 4X64T 3SRZA 3U3IA 2MOZA 2MPKA 2K5BB 3RYHE 1KNZA 5F8PA 5J2TE 3C4XA 3VU7H 3OYXA 2H3RA 5HXCA 4HWFA 3RYFE 4DV4T 4Z90A 4CI3B 4X62T 1WRDA 2DNXA 1W0BA 4U3CA 2IAKA 2QYWA 2JJ9A 2MTQA 4JI3T 2JMHA 5HEHA 2VURA 1S94A 4HE8A 4U74A 3B57A 3UUXB 3ZMVB 3NVOA 5BMVE 3C4WA 3Q5XA 2XAJB 4IT4A 3LFMA 3PU3A 4JYAT 3ZT7A 4IE5A 5LHGB 4DUZT 3CQCB 4O4IE 1D0XA 1W09A 4OYJA 4AKRB 1UURA 4J2CA 4JEHB 2LM2A 4OYKA 1V9DA 1YXRA 1NENA 5C8YE 2Y48B 1W9RA 1ZV4X 2DI4A 4NUUA 5FYMA 2ZLYA 1N34T 2GK9A 3UTKA 2VK9A 4X66T 3D0TA 2V7JA 1T72A 3AA6B 4EYUA 2YU1A 1YQ4A 2XTLA 3IF8B 1XMQT 1KK7A 3I9WA 3KV9A 4ZOLE 2XQ3A 3HKEE 5DQVA 2E9XC 4G2AA 2JMKA 2PJQA 2K9AA 4M1PA 2IC6A 4P0BA 3MKDA 5JDQA 4DR5T 4DMWA 3U78A 5AQTB 4GOUA 3PUXF 3VHLA 2LSGA 3O1IA 4IL9A 4Z91A 4OFZA 2WQYA 5HWYA 4E7ZA 5C3JA 2BBHA 5EK2A 4AKIA 3RIUA 5L3DB 1IJ6A 1Y01A 1ZOYA 4MALA 1WR0A 3OYZA 2CBJA 3E0ZA 3LSVA 5EK3A 3SS1A 3ZMUB 1VCTA 2K48A 1ZP0A 3KVBA 4PK6A 3R6NA 2LJLA 5LA6E 1X9BA 4ZEYA 4O8SA 5M4YA 2BKNA 2HN2A 3A5XA 4O4HE 4NXNT 2IUBA 3HA4A 2ACXA 3OVUA 5JREA 2A3DA 4UR9A 4EV6A 1DU2A 2WDRA 2CLYB 1SA0E 3N2GE 2B1EA 3IA3A 1G73A 5AQHB 3PUVF 3FXEB 3ZT6A 4LFCT 1BR0A 3BQIA 5HAXA 5LJMA 5IUXA 3L3PA 5L47A 1IZNB 3IHRA 3N5LA 1QUUA 2CM0A 2X68A 2YKSA 5J1GA 3TKLB 2MBGA 1ZKEA 3J9X1 5L3FB 4Q25A 4HFEA 2XQ8A 4WBNE 5ABFB 5EZYE 3FZLB 4LF8T 2I0MA 2H7VC 1FMWA 2PTFA 3O4XE 1EZ3A 3PE0A 3PUWF 2KLQA 4ILCA 5AQKB 2PG8A 3AE8A 3MACA 4N78D 4YTMA 3ZN0B 4WW0A 4YSXA 5AQIB 4UV9B 3VR9A 2UXBT 5AQPB 2BG9E 3RIUC 3SWHA 3K3NA 3AE1A 3GA8A 1N33T 1XDOA 5IYZE 5A1LA 2LOSA 5JTGA 3PJAA 2VKJA 4UF0B 3N2OA 2CRBA 5AQFB 2BVMA 2V7LA 4IIJE 5HCMA 5LGUB 4HTEA 4EZHA 1E7PA 4TV8E 3T1HT 4DR4T 3AE2A 4H63V 5JDHA 4QXCB 2XAFB 3AEEA 2V5CA 4O2BE 1KFYA 4QXHB 5ABHA 3GN5A 3HI2A 1FMVA 1NAFA 2DWKA 1HX1B 2K3WA 3AE9A 4HFBA 4CXYA 4QH1A 5LMNT 3Q5WA 4IDNA 3GN5B 4JUYA 3TLWA 5LB7B 4PFPA 5FXWA 3ONXA 3K3QC 4HFDA 2IIUA 2M67A 1UUSA 3C4ZA 3KINB 4HWIB 1MMNA 1XDPA 5FKYA 2WU5A 2I59A 1GQEA 3G06A 4B6XA 5CJ5A 3JAEA 5AQJB 1YQ3A 4DV0T 4LF9T 1N32T 2IHR1 1LKXA 2B76A 2JIWA 4HEAA 1T8BA 3UQ4A 2XQ7A 2J1DG 4GYRA 2E2AA 3CKDA 3I1AA 3QB5K 4NIQA 3ZCIA 4JI1T 3EAMA 3WAKA 1D0ZA 2EHOA 3TLVA 2OLTA 2YDQA 2LM9A 1MIYA 2QVAA 4HKAA 4IE0A 2XUEA 4LF7T 4I43B 4DR6T 2J4GA 4OK0A 2X0HA 4O4JE 4O4LE 1HX8A 2LSJA 4LMJA 4ILBA 2LLYA 1SUMB 4UF0A 3VR8A 2ACZA 3HR0A 4G63A 2UXCT 2WU2A 2UXNB 2XQYA 3ESLA 3L8RA 5LBQB 1HF8A 4AQYT 4QH4A 3L09A 4F8HA 2YU2A 4IDZA 5F5WA 2E9XB 2ODUA 5JR9A 3ZMSB 4C90A 2V6YA 4JI8T 2VKOA 4ANJA 2CEAA 3AEDA 4H9NC 1Y64B 2CMRA 1QLBA 4YJ3E 4UXNB 3QK6A 4ERRA 4HWHA 4MBQA 1KNPA 3QNUA 4CI1B 4LF4T 3EHZA 3UUBA 1J5ET 5FP3A 4XBFB 1XZYA 3FZFB 4KX6A 4U7IA 2UXDT 2WMNA 3P4QA 5CGMA 1MIVA 2WM9A 2WY2A 3NKZA 2X66A 2V7KA 5H6QB 3AE4A 2LSIA 5HCJA 3FBZA 4PJLA 3SFDA 1MMGA 2LKHA 3LG7A 3BK9A 1WFDA 4B3MT 3F57A 3FB2A 4GKKT 3AA0B 1AJ3A 4HWCA 2XAQB 4AI6A 3VKGA 1UGOA 2H89A 2LSKA 4H63H 3QUJA 2X9YA 4IE4A 4X1YE 3UU3A 5LHIB 1OEDA 4DO0A 1MNDA 2NR4A 2V26A 1BR2A 3ZPOA 2X0YA 3HKCE 5FL1A 3PURA 3P4WA 2ZM2A 3OBVE 3RC3A 3ZMTB 2R6GF 4U33A 4WBOA 3EDVA 2CXFA 3V5SA 2H88A 4UVBB 2WDVA 1JNRA 4GYSA 5FVLA 2KWIB 4YTPA 2JQ9A 3PUZF 2CPTA 5JDNA 5LG3A 2W67A 2NOXA 5JDGA 2OV9A 2EHOD 3KBUA 3K1SA 3NZQA 1R8IA 4P09A 4QXBB 2KINB 5GONE 4HWDA 5TAOA 5C2TA 3VRBA 3IBPA 1MMAA 2XQ5A 5LJNA 2KT9A 4JLEA 2H7OA 4HN9A 5FY0A 2BS3A 2UUCT 1MIWA 3MA9A 4QWNB 1OXZA 5FXVA 2C5IT 1IBKT 4B3RT 2HPLA 4Z8XA 2C5JA 3RQWA 3O1HA 1BR4A 2BG9C 1VCSA 4IDQA 3X1DA 1T7SA 3Q9DA 2HH7A 4H9OC 4DNDA 2UXXB 2CE7A 3EDUA 2L3LA 2X67A 3P50A 1XMOT 4BJNA 4TN7B 3QOFA 4IGUA 4QX8B 2ODVA 3CX8B 3TLTA 5F3JA 3AEAA 4ZI7E 5HXSA 2FJDA 4HFVA 4ZS3A 4ZHQE 3JADA 2JRKA 3NWIA 4EYYR 2WAUA 2HHHT 3CQXC 3NRYA 2E5VA 4CQIA 3UQ7A 3AAEB 4FJOA 4HFCA 2LHRA 2VWAA 1HFAA 3OJAA 4U2ZA 1IBMT 3LBXA 1Z8UA 4UVCB 2XQ9A 2L9QA 3SFEA 5JDFA 4ZXLA 4DR1T 1D1BA 3JCFA 3MK7C 5FNVE 3ZT5A 3LBXB 5AQLB 5LXTE 3I0QA 4PK5A 1NWMX 2UUBT 3AE7A 5FMNA 4DVDA 4GK5E 3CWZB 3KVAA 3UU5A 4K0UA 2N1GA 3ZN1B 2XQ6A 4XZCA 3T8OA 2XHEB 1UX4A 3M3ZB 3N9PA 4JEUB 2IDOB 5JVDE 3UU8A 3MXZA 2UUAT 1E1HB 4ADZA 1O3XA 4AXPA 4A98A 2MYSA 4JBWF 2V7MA 1WR6A 1YW0A 2E8IA 4X20E 3JC6C 3FXDB 5ABEA 2VQFT 2WZIA 4PK4A 3UFEA 2JQQA 2LSYA 2CWYA 2LOPA 4KMCA 4DBQA 2D9DA 4L9IA 2W2UA 2OA5A 5HEJA 2PBIA 4BA9A 4DV7T 4ZZBA 2LRLA 2WWVA 3VKHA 1FEWA 4TZ4C 4A5XA 1U4QA 4L0RA 4LFAT 2V7IA 2HN1A 4C91A 1MMDA 2A2FX 2XJ7A 3ONJA 2L8KA 3ZJ2A 4YXDA 4IDPA 2D0TA 2WWUA 3E08A 2YDRA 2BZBA 3V5UA 1WCRA 2A9UA 2N9DA 4EXTA 3FZHB 3H3MA 4B3ST 3RLFF 3AVSA 5HEGA 2CWOA 1OEDE 2Q9QC 3P7IA 4IREA 4KHZF 3PUSA 3RF1A 4KUMB 2YN6A 4ASKA 1HNXT 5AQSB 3ZYLA 2CXLA 4QH5A 4I55E 2Z6EA 5AQOB 2XM2A 3WAJA 4ILUA 4DIDB 2BS4A 3RX6A 2E5LT 5HXEA 4DUYT 3ZLIA 1J5WA 5DQWA 4AQFA 2X9WA 3UULA 3PJAJ 2YINA 1CHUA 1E2AA 2WZHA 3AEFA 3HL6A 3I9YA 1VOMA 2QRXA 5FL0A 3SOLA 4EEDA 4P0AA 3PU8A 2WS3A 1M62A 3PV0F 3ZEFB 3CX7B 3KDSE 2D2SA 1M7KA 2JPFA 5AQRB 1S35A 4MFRA 2IC9A 4JI4T 3E22E 3AB3B 1SE7A 4PJNA 5AQNB 3AA7B 4DR3T 3BQKA 2D5UA 2XQ4A 1H7CA 4PNIA 4AQGA 1HNZT 1MNEA 1WYCA 1LRZA 2NWBA 2WMOA 3FHNA 4LMLA 2D0UA 2CA5A 4QKNA 2IW5B 1UK5A 4DBRA 4YSYA 4ILAA 4DV6T 4EOZB 2NW9A 2CHOA 2KZ7B 5LBMA 1N36T 4MLKA 4TV9E 3ZKRA 4CN1A 2WDQA 1KF6A 2YDSA 3NRXA 3RKGA 2W63A 3UFGA 5CA1E 3AXJB 3AVRA 2SPCA 3N9MA
chains in the Genus database with same CATH topology
5JR9C 4O2AE 4IHJE 2XASB 2X9XA 4I4TE 3FBLA 4GIWA 4TX5A 2VKDA 3ZMZB 2X51A 3DJBA 5KDMC 3Q2MA 5LYJE 4DMVA 4YHJA 5IHYA 4AQFC 2DHRA 3AAIA 3NZPA 2X9HA 3EVYA 2YK0A 2VASA 4CZZB 2KXPB 4ISSA 3S4UA 2CCQA 3LK42 3RRWA 1LVKA 2XAHB 5L3GB 5E0OA 1FIOA 2ES0A 2W62A 2DCFA 3ANWB 3C64A 4QHOA 5LGNB 1UCUA 3LK3B 3UT5E 3ZJ1A 3UUMA 3CQGB 5LHHB 3J7Yq 1WLXA 3B13A 3RKOA 3ZYKA 2BDEA 5FY1A 3KV5A 4EZ4A 2G0UA 4TUYE 2W0GA 3N9QA 4X1IE 2A72A 1D1AA 2LHNA 4AKLA 2NW8A 4X1KE 1YD8G 4EIWA 4GK0E 2VL8A 2ZMAA 4F6RC 3LJCA 4IE6A 1HG2A 2NTXA 5L3EB 1VRBA 3HKBE 3WI3A 2NP9A 5HXRA 3KV6A 5LP6E 4IE7A 3HKDE 3QC9A 3F31A 2WSSV 2KMFA 4H9PC 4FI5A 5JQGE 2QA7A 4QX7B 3PTRB 3AA1B 4WNKA 3H3AA 2V1DB 1BR1A 2Y6XA 3EUHA 3ZC1A 2E9XA 4PJJA 4PFOA 5L2LA 2HPJA 1HCIA 3P8CD 3ANWA 2KNDA 3DP7A 1U5PA 4E7SA 4BJMA 4UVAB 3BQLA 1X79A 1Z0PA 3N9OA 4BAYB 2PFVA 1T98A 2BVLA 3UUNA 4EAHA 3ZYMA 5JH7E 4MHCA 2W61A 5AFUL 5HWXA 2Y8DA 1YKHB 3KFWX 4L5GA 3ETUA 2P9BA 4CXWA 2DWGA 2W00A 4PW8A 3PUQA 5LG4A 5FXZA 5FXXA 2N2NA 1D0YA 1ZEEA 4AKGA 3RYIE 2E9XD 5JDLA 4CI2B 2VB6A 1B7TA 3CMLA 1ZHCA 5JRCA 5JDMA 2YEVC 3RPUA 3W15B 3LK2B 1US7B 5CA0E 5JRCB 3PUGA 3CVRA 1QSDA 4CXXA 4I50E 5HYAA 5DABA 5JR9B 2NTYA 2QGSA 5HXHA 2CLYC 2LT3A 4UIGA 3RRCA 3DTOA 2C5KT 4H9RC 3PDYA 5J2UE 3K3OA 4YLHA 5ETWA 2DLRA 3RC8A 2LEHA 5CB4E 4EB6E 1HG5A 5EK4A 5KX5E 2Q9QB 2RP4A 3F2EA 3KV4A 1OWAA 2KWHA 4H9QC 4UELA 5KMGP 3MJXA 2K24A 1HS7A 5H6RB 4KBMB 3M65A 2WBLA 3O9XA 5LCYA 1SHZC 2EHOB 4H9SE 5ADXL 3ZC0A 2Q9QD 3R84B 3GWHA 1IJ5A 4YJ2E 4UEMA 5LGTB 3O1JA 4YFSA 4AKHA 1CUNA 5L3CB 2ZM0A 2CXDA 3ETVA 3C50A 4KP3C 3CPZA 3N2KE 2LE8A 2RA1A 4ZI2C 3RH3A 3MZKB 3PUAA 1LVFA 3C51A 3JC6D 2EHOC 3NBXX 4HGAA 3RYCE 4ISTA 4U72A 4PAGA 1WYBA 5L3BB 2ZM8A 4ZI3D 1YKEB 1D1CA 2C0SA 2NW7A 3IEEA 4UV8B 4NUVA 1UX5A 2XAGB 3CX6B 3GMIA 1HTJF 4XAXB 3AAAB 2VKHA 4ZI2D 4ZI3C 4V1Av 2X0LB 5DJQC 3N9NA 2Q9QA 3C98B 3OKQA 4A56A 3N9LA 5LNKA 3ZCJA 4OHFA 3I0OA 4PJMA 5FY7A 3KBTA 1IAPA 3H37A 4ZS2A 1G8XA 3K8PC 3SRZA 3U3IA 2MOZA 3RYHE 2K5BB 1KNZA 5F8PA 5J2TE 3C4XA 3VU7H 3OYXA 2H3RA 5HXCA 3RYFE 4CI3B 1WRDA 2DNXA 2IAKA 2JJ9A 2MTQA 2JMHA 4HE8A 1S94A 4U74A 3UUXB 3B57A 3ZMVB 5BMVE 3C4WA 3Q5XA 2XAJB 3LFMA 3PU3A 4IE5A 5LHGB 3CQCB 4O4IE 1D0XA 4OYJA 4AKRB 4J2CA 4JEHB 4OYKA 1V9DA 5C8YE 2Y48B 1ZV4X 2DI4A 4NUUA 5FYMA 2ZLYA 2GK9A 3UTKA 2VK9A 3D0TA 2V7JA 3AA6B 4EYUA 2YU1A 2XTLA 3IF8B 1KK7A 3I9WA 3KV9A 4ZOLE 3HKEE 5DQVA 2E9XC 4G2AA 2JMKA 2PJQA 2K9AA 4M1PA 2IC6A 4P0BA 3MKDA 5JDQA 4DMWA 4GOUA 3VHLA 2LSGA 3O1IA 4OFZA 5HWYA 4E7ZA 5EK2A 4AKIA 5L3DB 1IJ6A 4MALA 3SS1A 3OYZA 5EK3A 3E0ZA 3ZMUB 2K48A 3KVBA 4PK6A 3R6NA 2LJLA 5LA6E 4O8SA 5M4YA 3A5XA 4O4HE 3HA4A 2ACXA 5JREA 2A3DA 2CLYB 1SA0E 3N2GE 2B1EA 1BR0A 1G73A 3FXEB 3BQIA 5HAXA 5LJMA 3L3PA 1IZNB 3IHRA 3N5LA 1QUUA 2CM0A 2X68A 5J1GA 3TKLB 2MBGA 1ZKEA 3J9X1 5L3FB 4WBNE 5EZYE 2H7VC 1FMWA 3O4XE 3PE0A 1EZ3A 5LOVE 2KLQA 2PG8A 3MACA 4N78D 3ZN0B 4WW0A 4UV9B 3SWHA 3K3NA 3GA8A 5IYZE 5A1LA 2LOSA 4UF0B 2VKJA 3N2OA 2BVMA 2V7LA 4IIJE 5LGUB 4HTEA 4EZHA 4TV8E 4H63V 5JDHA 4QXCB 2XAFB 4O2BE 4QXHB 3GN5A 3HI2A 1FMVA 1NAFA 2DWKA 4CXYA 3Q5WA 3GN5B 4JUYA 4PFPA 5FXWA 3ONXA 3K3QC 2M67A 3C4ZA 3KINB 1MMNA 4B6XA 2I59A 1LKXA 4HEAA 2J1DG 4GYRA 3CKDA 3I1AA 3ZCIA 3WAKA 1D0ZA 2EHOA 2LM9A 1MIYA 4HKAA 4IE0A 2XUEA 4I43B 4OK0A 4O4JE 4O4LE 1HX8A 2LSJA 4UF0A 3HR0A 4G63A 2UXNB 2XQYA 3ESLA 5LBQB 1HF8A 3L09A 2YU2A 4IDZA 2E9XB 2ODUA 5JR9A 3ZMSB 4C90A 2VKOA 4ANJA 2CEAA 4H9NC 1Y64B 2CMRA 4YJ3E 4ERRA 4UXNB 3QK6A 4MBQA 4CI1B 4XBFB 5FP3A 2WMNA 1MIVA 2WM9A 2X66A 2V7KA 5H6QB 2LSIA 3FBZA 4PJLA 1MMGA 3LG7A 3BK9A 3F57A 3FB2A 3AA0B 1AJ3A 2XAQB 4AI6A 3VKGA 2LSKA 4IE4A 4H63H 3QUJA 2X9YA 4X1YE 5LHIB 4DO0A 1MNDA 2V26A 1BR2A 3ZPOA 3HKCE 3PURA 2ZM2A 3OBVE 3RC3A 3ZMTB 4WBOA 3EDVA 2CXFA 3V5SA 4UVBB 4GYSA 2KWIB 5JDNA 2NOXA 5JDGA 3KBUA 2EHOD 3NZQA 5GONE 4P09A 4QXBB 5TAOA 2KINB 3IBPA 1MMAA 5LJNA 2KT9A 4JLEA 2H7OA 4HN9A 5FY0A 1MIWA 3MA9A 4QWNB 1OXZA 5FXVA 2C5IT 2HPLA 4Z8XA 2C5JA 3O1HA 1BR4A 4H9OC 3Q9DA 2HH7A 4DNDA 2UXXB 2CE7A 3EDUA 2L3LA 2X67A 4BJNA 4TN7B 4IGUA 4QX8B 2ODVA 3CX8B 5F3JA 5HXSA 4ZI7E 4HFVA 4ZS3A 4ZHQE 2JRKA 4EYYR 2WAUA 3CQXC 3NRYA 4CQIA 3AAEB 4FJOA 2LHRA 2VWAA 1HFAA 3OJAA 3LBXA 4UVCB 2L9QA 5JDFA 1D1BA 3MK7C 5FNVE 3LBXB 5LXTE 3I0QA 4PK5A 1NWMX 5FMNA 4DVDA 4GK5E 3CWZB 3KVAA 4K0UA 2N1GA 3ZN1B 4XZCA 3T8OA 2XHEB 1UX4A 3N9PA 4JEUB 5JVDE 3MXZA 1E1HB 4ADZA 1O3XA 4AXPA 2MYSA 4X20E 2V7MA 1WR6A 1YW0A 2E8IA 3JC6C 3FXDB 4PK4A 3UFEA 2JQQA 2LSYA 2CWYA 2LOPA 4KMCA 4DBQA 4L9IA 2OA5A 2PBIA 4BA9A 3VKHA 1FEWA 4TZ4C 1U4QA 4L0RA 2V7IA 4C91A 1MMDA 2A2FX 2L8KA 3ZJ2A 2D0TA 2WWUA 3E08A 2BZBA 3V5UA 2N9DA 4EXTA 3AVSA 3U78A 2CWOA 3P7IA 2Q9QC 3PUSA 4KUMB 4ASKA 3ZYLA 2CXLA 3WAJA 4I55E 2Z6EA 4ILUA 3RX6A 5HXEA 3ZLIA 5DQWA 4AQFA 2X9WA 3UULA 2YINA 3HL6A 3SOLA 3I9YA 1VOMA 4P0AA 3PU8A 3ZEFB 3CX7B 3KDSE 2D2SA 2JPFA 1S35A 4MFRA 2IC9A 3E22E 3AB3B 4PJNA 3AA7B 3BQKA 2D5UA 1H7CA 4PNIA 4AQGA 1MNEA 1WYCA 1LRZA 2NWBA 2WMOA 3FHNA 2IW5B 2D0UA 2CA5A 4QKNA 4DBRA 4EOZB 2NW9A 5LBMA 2KZ7B 4MLKA 4TV9E 3NRXA 5CA1E 2W63A 3AVRA 2SPCA 3N9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AAI A;  5LBM A;  4ADZ A;  4UIG A;  5LCY A;  2HH7 A;  4M1P A;  5FMN A; 
#chains in the Genus database with same CATH topology
 3A7M A;  5L4E A;  5JR9 C;  3AXJ A;  4O2A E;  4IHJ E;  2XAS B;  2X9X A;  4I4T E;  3FBL A;  4GIW A;  4TX5 A;  2VKD A;  3ZMZ B;  2X51 A;  3DJB A;  5KDM C;  3Q2M A;  5LYJ E;  5HEU A;  4DMV A;  2WCA A;  4YHJ A;  5IHY A;  2DHR A;  4AQF C;  3AAI A;  4JI7 T;  2XZE A;  3RI5 A;  3RGL A;  3NZP A;  2X9H A;  2MAW A;  3EVY A;  2YK0 A;  2BKP A;  2VAS A;  4CZZ B;  2DL1 A;  2KXP B;  4ISS A;  3S4U A;  1I94 T;  2CCQ A;  5LOV E;  3LK4 2;  3RRW A;  1LVK A;  2XAH B;  5L3G B;  4OX9 T;  1HNW T;  1XWM A;  4JI0 T;  3T1Y T;  2RPA A;  2M6B A;  3FZM B;  5E0O A;  1FIO A;  2ES0 A;  2VVS A;  2F4V T;  3PUY F;  2W62 A;  2DCF A;  3ANW B;  3C64 A;  4QHO A;  5LGN B;  1UCU A;  3LK3 B;  3UT5 E;  3ZJ1 A;  3UUM A;  3CQG B;  5LHH B;  5BR8 T;  3J7Y q;  1WLX A;  3B13 A;  3RKO A;  3ZYK A;  2BDE A;  5FY1 A;  2ZM6 T;  2J62 A;  3KV5 A;  4EZ4 A;  2G0U A;  4IDO A;  5L4H A;  2XM1 A;  4TUY E;  5KXJ A;  4HFH A;  1FJG T;  2W0G A;  3N9Q A;  4KHP T;  4X1I E;  2A72 A;  2LKG A;  1D1A A;  2LHN A;  4ZZC A;  3TLU A;  4AKL A;  2NW8 A;  4P1N A;  4X1K E;  4DR7 T;  1YD8 G;  4X5T A;  4EIW A;  4GK0 E;  2VL8 A;  2ZMA A;  4F6R C;  3LJC A;  4EGW A;  4IE6 A;  1IBL T;  1HG2 A;  2NTX A;  5L3E B;  1VRB A;  2FBW A;  3A8Y C;  3HKB E;  5AQU B;  3WI3 A;  2NP9 A;  2V8S V;  4X65 T;  5HXR A;  3KV6 A;  5LP6 E;  4IE7 A;  3HKD E;  3QC9 A;  3F31 A;  2WSS V;  2KMF A;  4H9P C;  4FI5 A;  5JQG E;  2QA7 A;  2I6H A;  4QX7 B;  3PTR B;  3AA1 B;  3OTO T;  2FJE A;  1XNR T;  4WNK A;  2LRK A;  3H3A A;  4GKJ T;  2V1D B;  1BR1 A;  2Y6X A;  3EUH A;  3ZC1 A;  2E9X A;  4PJJ A;  4PFO A;  5L2L A;  2AE9 A;  5AQG B;  2HPJ A;  1HCI A;  4AIS A;  3P8C D;  3ANW A;  2KND A;  2WB5 A;  3DP7 A;  3AEG A;  4DV5 T;  1U5P A;  2XSB A;  3OPC A;  4TWD A;  1I6Z A;  2YOE A;  4E7S A;  4BJM A;  4UVA B;  4CN6 A;  3BQL A;  2FJB A;  1X79 A;  1Z0P A;  3N9O A;  4BAY B;  2PFV A;  1T98 A;  2BVL A;  4JV5 T;  3UUN A;  4EAH A;  4A97 A;  3ZYM A;  5JH7 E;  4U7Y A;  4NXM T;  4KI0 F;  4MHC A;  2W61 A;  4YT0 A;  5AFU L;  4NPP A;  2Y8D A;  5HWX A;  1YKH B;  3KFW X;  4L5G A;  3ETU A;  1L0V A;  4EEB A;  4HFI A;  5ABF A;  2P9B A;  2BKO A;  4CXW A;  2DWG A;  4U2Y A;  2W00 A;  4I0U A;  3L39 A;  3P4S A;  4PW8 A;  4WYV A;  4LF5 T;  3PUQ A;  5LG4 A;  5FXZ A;  1HR0 T;  5FXX A;  5CFB A;  1JNZ A;  2N2N A;  1D0Y A;  1ZEE A;  4AKG A;  4YY3 T;  3RYI E;  2E9X D;  5JDL A;  5J0Z A;  3Q5D A;  4CI2 B;  2VB6 A;  4TNW A;  1B7T A;  3CML A;  1ZHC A;  5FVK A;  4COF A;  5JRC A;  3ZST A;  2UU9 T;  2FUP A;  5JDM A;  2YEV C;  2IML A;  1KEY A;  3ABV A;  3RPU A;  3RQU A;  3AE6 A;  1US7 B;  3LK2 B;  3W15 B;  3PUG A;  3CVR A;  5CA0 E;  4JI6 T;  5JRC B;  1QSD A;  4CXX A;  4I50 E;  5HYA A;  5DAB A;  5JR9 B;  2NTY A;  2QGS A;  3RIA A;  5HXH A;  2CLY C;  2LT3 A;  4UIG A;  4JI5 T;  3DTO A;  4IL4 A;  4JI2 T;  3RRC A;  4AIU A;  5IWA T;  2C5K T;  3B5M A;  3PDY A;  4H9R C;  2BS2 A;  4TWF A;  5J2U E;  3K3O A;  4YLH A;  5ETW A;  1XNQ T;  5ABG A;  3AE3 A;  2DLR A;  3RC8 A;  2LEH A;  3FZK B;  2V5D A;  4LFB T;  3JAF A;  5CB4 E;  2V6X A;  4YSZ A;  4EB6 E;  2W4X A;  1HG5 A;  3EI0 A;  2JQH A;  4WZX A;  3P4P A;  5EK4 A;  4YHH T;  5KX5 E;  2W66 A;  4B3T T;  2Q9Q B;  2RP4 A;  3F2E A;  3KV4 A;  1OWA A;  2KWH A;  4H9Q C;  2J47 A;  4UEL A;  5KMG P;  5HEO A;  3MJX A;  1OED B;  2K24 A;  1HS7 A;  5H6R B;  4KBM B;  2AXD S;  3QB5 A;  3VRA A;  3M65 A;  2WBL A;  3O9X A;  5LCY A;  1SHZ C;  2EHO B;  2KSR A;  4H9S E;  3RIF A;  3ZSS A;  5ADX L;  3ZC0 A;  2Q9Q D;  3R84 B;  3GWH A;  3UU6 A;  1IJ5 A;  4TWH A;  4YJ2 E;  4UEM A;  5LGT B;  3O1J A;  4YFS A;  4CN4 A;  4AKH A;  1CUN A;  1W0A A;  5L3C B;  2ZM0 A;  4LMK A;  2CXD A;  3ETV A;  4K0K T;  3C50 A;  4KP3 C;  3CPZ A;  2XPK A;  3N2K E;  4LF6 T;  2LE8 A;  5AQV B;  2WP9 A;  2RA1 A;  3ONL C;  4ZI2 C;  3RH3 A;  1OED C;  3MZK B;  3PUA A;  1LVF A;  3C51 A;  2XQA A;  3JC6 D;  2FJA A;  3EAB A;  2V6Y B;  2EHO C;  2VVN A;  3NBX X;  2XY8 B;  4HGA A;  4IST A;  1KNR A;  2BBJ A;  4PAG A;  1WYB A;  1NEK A;  4U72 A;  3RYC E;  5L3B B;  5AQM B;  2VL0 A;  2ZM8 A;  2M6I A;  4ZI3 D;  3TLS A;  1YKE B;  3AEC A;  1D1C A;  2C0S A;  2NW7 A;  3IEE A;  4UV8 B;  4NUV A;  1UX5 A;  2XAG B;  3CX6 B;  3GMI A;  1HTJ F;  3P4R A;  4XAX B;  3AAA B;  4YTN A;  2VKH A;  4ZI2 D;  4ZI3 C;  4V1A v;  4DV2 T;  2X0L B;  5DJQ C;  3N9N A;  3Q5E A;  2Q9Q A;  3CIR A;  3C98 B;  2CBI A;  3CK6 A;  3OKQ A;  3RHW A;  4TNV A;  4DV3 T;  4A56 A;  2XSA A;  3N9L A;  3AE5 A;  3ZCJ A;  5LNK A;  4OHF A;  5LMU T;  3I0O A;  3AEB A;  3LDQ B;  4U31 A;  4PJM A;  5AQQ B;  3KBT A;  5FY7 A;  2BG9 A;  2VQE T;  1IAP A;  2CHN A;  3H37 A;  4DV1 T;  4DR2 T;  4ZS2 A;  1J1J A;  1G8X A;  2JQK A;  2BG9 B;  3K8P C;  3UU4 A;  4X64 T;  3SRZ A;  3U3I A;  2MOZ A;  2MPK A;  2K5B B;  3RYH E;  1KNZ A;  5F8P A;  5J2T E;  3C4X A;  3VU7 H;  3OYX A;  2H3R A;  5HXC A;  4HWF A;  3RYF E;  4DV4 T;  4Z90 A;  4CI3 B;  4X62 T;  1WRD A;  2DNX A;  1W0B A;  4U3C A;  2IAK A;  2QYW A;  2JJ9 A;  2MTQ A;  4JI3 T;  2JMH A;  5HEH A;  2VUR A;  1S94 A;  4HE8 A;  4U74 A;  3B57 A;  3UUX B;  3ZMV B;  3NVO A;  5BMV E;  3C4W A;  3Q5X A;  2XAJ B;  4IT4 A;  3LFM A;  3PU3 A;  4JYA T;  3ZT7 A;  4IE5 A;  5LHG B;  4DUZ T;  3CQC B;  4O4I E;  1D0X A;  1W09 A;  4OYJ A;  4AKR B;  1UUR A;  4J2C A;  4JEH B;  2LM2 A;  4OYK A;  1V9D A;  1YXR A;  1NEN A;  5C8Y E;  2Y48 B;  1W9R A;  1ZV4 X;  2DI4 A;  4NUU A;  5FYM A;  2ZLY A;  1N34 T;  2GK9 A;  3UTK A;  2VK9 A;  4X66 T;  3D0T A;  2V7J A;  1T72 A;  3AA6 B;  4EYU A;  2YU1 A;  1YQ4 A;  2XTL A;  3IF8 B;  1XMQ T;  1KK7 A;  3I9W A;  3KV9 A;  4ZOL E;  2XQ3 A;  3HKE E;  5DQV A;  2E9X C;  4G2A A;  2JMK A;  2PJQ A;  2K9A A;  4M1P A;  2IC6 A;  4P0B A;  3MKD A;  5JDQ A;  4DR5 T;  4DMW A;  3U78 A;  5AQT B;  4GOU A;  3PUX F;  3VHL A;  2LSG A;  3O1I A;  4IL9 A;  4Z91 A;  4OFZ A;  2WQY A;  5HWY A;  4E7Z A;  5C3J A;  2BBH A;  5EK2 A;  4AKI A;  3RIU A;  5L3D B;  1IJ6 A;  1Y01 A;  1ZOY A;  4MAL A;  1WR0 A;  3OYZ A;  2CBJ A;  3E0Z A;  3LSV A;  5EK3 A;  3SS1 A;  3ZMU B;  1VCT A;  2K48 A;  1ZP0 A;  3KVB A;  4PK6 A;  3R6N A;  2LJL A;  5LA6 E;  1X9B A;  4ZEY A;  4O8S A;  5M4Y A;  2BKN A;  2HN2 A;  3A5X A;  4O4H E;  4NXN T;  2IUB A;  3HA4 A;  2ACX A;  3OVU A;  5JRE A;  2A3D A;  4UR9 A;  4EV6 A;  1DU2 A;  2WDR A;  2CLY B;  1SA0 E;  3N2G E;  2B1E A;  3IA3 A;  1G73 A;  5AQH B;  3PUV F;  3FXE B;  3ZT6 A;  4LFC T;  1BR0 A;  3BQI A;  5HAX A;  5LJM A;  5IUX A;  3L3P A;  5L47 A;  1IZN B;  3IHR A;  3N5L A;  1QUU A;  2CM0 A;  2X68 A;  2YKS A;  5J1G A;  3TKL B;  2MBG A;  1ZKE A;  3J9X 1;  5L3F B;  4Q25 A;  4HFE A;  2XQ8 A;  4WBN E;  5ABF B;  5EZY E;  3FZL B;  4LF8 T;  2I0M A;  2H7V C;  1FMW A;  2PTF A;  3O4X E;  1EZ3 A;  3PE0 A;  3PUW F;  2KLQ A;  4ILC A;  5AQK B;  2PG8 A;  3AE8 A;  3MAC A;  4N78 D;  4YTM A;  3ZN0 B;  4WW0 A;  4YSX A;  5AQI B;  4UV9 B;  3VR9 A;  2UXB T;  5AQP B;  2BG9 E;  3RIU C;  3SWH A;  3K3N A;  3AE1 A;  3GA8 A;  1N33 T;  1XDO A;  5IYZ E;  5A1L A;  2LOS A;  5JTG A;  3PJA A;  2VKJ A;  4UF0 B;  3N2O A;  2CRB A;  5AQF B;  2BVM A;  2V7L A;  4IIJ E;  5HCM A;  5LGU B;  4HTE A;  4EZH A;  1E7P A;  4TV8 E;  3T1H T;  4DR4 T;  3AE2 A;  4H63 V;  5JDH A;  4QXC B;  2XAF B;  3AEE A;  2V5C A;  4O2B E;  1KFY A;  4QXH B;  5ABH A;  3GN5 A;  3HI2 A;  1FMV A;  1NAF A;  2DWK A;  1HX1 B;  2K3W A;  3AE9 A;  4HFB A;  4CXY A;  4QH1 A;  5LMN T;  3Q5W A;  4IDN A;  3GN5 B;  4JUY A;  3TLW A;  5LB7 B;  4PFP A;  5FXW A;  3ONX A;  3K3Q C;  4HFD A;  2IIU A;  2M67 A;  1UUS A;  3C4Z A;  3KIN B;  4HWI B;  1MMN A;  1XDP A;  5FKY A;  2WU5 A;  2I59 A;  1GQE A;  3G06 A;  4B6X A;  5CJ5 A;  3JAE A;  5AQJ B;  1YQ3 A;  4DV0 T;  4LF9 T;  1N32 T;  2IHR 1;  1LKX A;  2B76 A;  2JIW A;  4HEA A;  1T8B A;  3UQ4 A;  2XQ7 A;  2J1D G;  4GYR A;  2E2A A;  3CKD A;  3I1A A;  3QB5 K;  4NIQ A;  3ZCI A;  4JI1 T;  3EAM A;  3WAK A;  1D0Z A;  2EHO A;  3TLV A;  2OLT A;  2YDQ A;  2LM9 A;  1MIY A;  2QVA A;  4HKA A;  4IE0 A;  2XUE A;  4LF7 T;  4I43 B;  4DR6 T;  2J4G A;  4OK0 A;  2X0H A;  4O4J E;  4O4L E;  1HX8 A;  2LSJ A;  4LMJ A;  4ILB A;  2LLY A;  1SUM B;  4UF0 A;  3VR8 A;  2ACZ A;  3HR0 A;  4G63 A;  2UXC T;  2WU2 A;  2UXN B;  2XQY A;  3ESL A;  3L8R A;  5LBQ B;  1HF8 A;  4AQY T;  4QH4 A;  3L09 A;  4F8H A;  2YU2 A;  4IDZ A;  5F5W A;  2E9X B;  2ODU A;  5JR9 A;  3ZMS B;  4C90 A;  2V6Y A;  4JI8 T;  2VKO A;  4ANJ A;  2CEA A;  3AED A;  4H9N C;  1Y64 B;  2CMR A;  1QLB A;  4YJ3 E;  4UXN B;  3QK6 A;  4ERR A;  4HWH A;  4MBQ A;  1KNP A;  3QNU A;  4CI1 B;  4LF4 T;  3EHZ A;  3UUB A;  1J5E T;  5FP3 A;  4XBF B;  1XZY A;  3FZF B;  4KX6 A;  4U7I A;  2UXD T;  2WMN A;  3P4Q A;  5CGM A;  1MIV A;  2WM9 A;  2WY2 A;  3NKZ A;  2X66 A;  2V7K A;  5H6Q B;  3AE4 A;  2LSI A;  5HCJ A;  3FBZ A;  4PJL A;  3SFD A;  1MMG A;  2LKH A;  3LG7 A;  3BK9 A;  1WFD A;  4B3M T;  3F57 A;  3FB2 A;  4GKK T;  3AA0 B;  1AJ3 A;  4HWC A;  2XAQ B;  4AI6 A;  3VKG A;  1UGO A;  2H89 A;  2LSK A;  4H63 H;  3QUJ A;  2X9Y A;  4IE4 A;  4X1Y E;  3UU3 A;  5LHI B;  1OED A;  4DO0 A;  1MND A;  2NR4 A;  2V26 A;  1BR2 A;  3ZPO A;  2X0Y A;  3HKC E;  5FL1 A;  3PUR A;  3P4W A;  2ZM2 A;  3OBV E;  3RC3 A;  3ZMT B;  2R6G F;  4U33 A;  4WBO A;  3EDV A;  2CXF A;  3V5S A;  2H88 A;  4UVB B;  2WDV A;  1JNR A;  4GYS A;  5FVL A;  2KWI B;  4YTP A;  2JQ9 A;  3PUZ F;  2CPT A;  5JDN A;  5LG3 A;  2W67 A;  2NOX A;  5JDG A;  2OV9 A;  2EHO D;  3KBU A;  3K1S A;  3NZQ A;  1R8I A;  4P09 A;  4QXB B;  2KIN B;  5GON E;  4HWD A;  5TAO A;  5C2T A;  3VRB A;  3IBP A;  1MMA A;  2XQ5 A;  5LJN A;  2KT9 A;  4JLE A;  2H7O A;  4HN9 A;  5FY0 A;  2BS3 A;  2UUC T;  1MIW A;  3MA9 A;  4QWN B;  1OXZ A;  5FXV A;  2C5I T;  1IBK T;  4B3R T;  2HPL A;  4Z8X A;  2C5J A;  3RQW A;  3O1H A;  1BR4 A;  2BG9 C;  1VCS A;  4IDQ A;  3X1D A;  1T7S A;  3Q9D A;  2HH7 A;  4H9O C;  4DND A;  2UXX B;  2CE7 A;  3EDU A;  2L3L A;  2X67 A;  3P50 A;  1XMO T;  4BJN A;  4TN7 B;  3QOF A;  4IGU A;  4QX8 B;  2ODV A;  3CX8 B;  3TLT A;  5F3J A;  3AEA A;  4ZI7 E;  5HXS A;  2FJD A;  4HFV A;  4ZS3 A;  4ZHQ E;  3JAD A;  2JRK A;  3NWI A;  4EYY R;  2WAU A;  2HHH T;  3CQX C;  3NRY A;  2E5V A;  4CQI A;  3UQ7 A;  3AAE B;  4FJO A;  4HFC A;  2LHR A;  2VWA A;  1HFA A;  3OJA A;  4U2Z A;  1IBM T;  3LBX A;  1Z8U A;  4UVC B;  2XQ9 A;  2L9Q A;  3SFE A;  5JDF A;  4ZXL A;  4DR1 T;  1D1B A;  3JCF A;  3MK7 C;  5FNV E;  3ZT5 A;  3LBX B;  5AQL B;  5LXT E;  3I0Q A;  4PK5 A;  1NWM X;  2UUB T;  3AE7 A;  5FMN A;  4DVD A;  4GK5 E;  3CWZ B;  3KVA A;  3UU5 A;  4K0U A;  2N1G A;  3ZN1 B;  2XQ6 A;  4XZC A;  3T8O A;  2XHE B;  1UX4 A;  3M3Z B;  3N9P A;  4JEU B;  2IDO B;  5JVD E;  3UU8 A;  3MXZ A;  2UUA T;  1E1H B;  4ADZ A;  1O3X A;  4AXP A;  4A98 A;  2MYS A;  4JBW F;  2V7M A;  1WR6 A;  1YW0 A;  2E8I A;  4X20 E;  3JC6 C;  3FXD B;  5ABE A;  2VQF T;  2WZI A;  4PK4 A;  3UFE A;  2JQQ A;  2LSY A;  2CWY A;  2LOP A;  4KMC A;  4DBQ A;  2D9D A;  4L9I A;  2W2U A;  2OA5 A;  5HEJ A;  2PBI A;  4BA9 A;  4DV7 T;  4ZZB A;  2LRL A;  2WWV A;  3VKH A;  1FEW A;  4TZ4 C;  4A5X A;  1U4Q A;  4L0R A;  4LFA T;  2V7I A;  2HN1 A;  4C91 A;  1MMD A;  2A2F X;  2XJ7 A;  3ONJ A;  2L8K A;  3ZJ2 A;  4YXD A;  4IDP A;  2D0T A;  2WWU A;  3E08 A;  2YDR A;  2BZB A;  3V5U A;  1WCR A;  2A9U A;  2N9D A;  4EXT A;  3FZH B;  3H3M A;  4B3S T;  3RLF F;  3AVS A;  5HEG A;  2CWO A;  1OED E;  2Q9Q C;  3P7I A;  4IRE A;  4KHZ F;  3PUS A;  3RF1 A;  4KUM B;  2YN6 A;  4ASK A;  1HNX T;  5AQS B;  3ZYL A;  2CXL A;  4QH5 A;  4I55 E;  2Z6E A;  5AQO B;  2XM2 A;  3WAJ A;  4ILU A;  4DID B;  2BS4 A;  3RX6 A;  2E5L T;  5HXE A;  4DUY T;  3ZLI A;  1J5W A;  5DQW A;  4AQF A;  2X9W A;  3UUL A;  3PJA J;  2YIN A;  1CHU A;  1E2A A;  2WZH A;  3AEF A;  3HL6 A;  3I9Y A;  1VOM A;  2QRX A;  5FL0 A;  3SOL A;  4EED A;  4P0A A;  3PU8 A;  2WS3 A;  1M62 A;  3PV0 F;  3ZEF B;  3CX7 B;  3KDS E;  2D2S A;  1M7K A;  2JPF A;  5AQR B;  1S35 A;  4MFR A;  2IC9 A;  4JI4 T;  3E22 E;  3AB3 B;  1SE7 A;  4PJN A;  5AQN B;  3AA7 B;  4DR3 T;  3BQK A;  2D5U A;  2XQ4 A;  1H7C A;  4PNI A;  4AQG A;  1HNZ T;  1MNE A;  1WYC A;  1LRZ A;  2NWB A;  2WMO A;  3FHN A;  4LML A;  2D0U A;  2CA5 A;  4QKN A;  2IW5 B;  1UK5 A;  4DBR A;  4YSY A;  4ILA A;  4DV6 T;  4EOZ B;  2NW9 A;  2CHO A;  2KZ7 B;  5LBM A;  1N36 T;  4MLK A;  4TV9 E;  3ZKR A;  4CN1 A;  2WDQ A;  1KF6 A;  2YDS A;  3NRX A;  3RKG A;  2W63 A;  3UFG A;  5CA1 E;  3AXJ B;  3AVR A;  2SPC A;  3N9M A; 
#chains in the Genus database with same CATH homology
 5JR9 C;  4O2A E;  4IHJ E;  2XAS B;  2X9X A;  4I4T E;  3FBL A;  4GIW A;  4TX5 A;  2VKD A;  3ZMZ B;  2X51 A;  3DJB A;  5KDM C;  3Q2M A;  5LYJ E;  4DMV A;  4YHJ A;  5IHY A;  4AQF C;  2DHR A;  3AAI A;  3NZP A;  2X9H A;  3EVY A;  2YK0 A;  2VAS A;  4CZZ B;  2KXP B;  4ISS A;  3S4U A;  2CCQ A;  3LK4 2;  3RRW A;  1LVK A;  2XAH B;  5L3G B;  5E0O A;  1FIO A;  2ES0 A;  2W62 A;  2DCF A;  3ANW B;  3C64 A;  4QHO A;  5LGN B;  1UCU A;  3LK3 B;  3UT5 E;  3ZJ1 A;  3UUM A;  3CQG B;  5LHH B;  3J7Y q;  1WLX A;  3B13 A;  3RKO A;  3ZYK A;  2BDE A;  5FY1 A;  3KV5 A;  4EZ4 A;  2G0U A;  4TUY E;  2W0G A;  3N9Q A;  4X1I E;  2A72 A;  1D1A A;  2LHN A;  4AKL A;  2NW8 A;  4X1K E;  1YD8 G;  4EIW A;  4GK0 E;  2VL8 A;  2ZMA A;  4F6R C;  3LJC A;  4IE6 A;  1HG2 A;  2NTX A;  5L3E B;  1VRB A;  3HKB E;  3WI3 A;  2NP9 A;  5HXR A;  3KV6 A;  5LP6 E;  4IE7 A;  3HKD E;  3QC9 A;  3F31 A;  2WSS V;  2KMF A;  4H9P C;  4FI5 A;  5JQG E;  2QA7 A;  4QX7 B;  3PTR B;  3AA1 B;  4WNK A;  3H3A A;  2V1D B;  1BR1 A;  2Y6X A;  3EUH A;  3ZC1 A;  2E9X A;  4PJJ A;  4PFO A;  5L2L A;  2HPJ A;  1HCI A;  3P8C D;  3ANW A;  2KND A;  3DP7 A;  1U5P A;  4E7S A;  4BJM A;  4UVA B;  3BQL A;  1X79 A;  1Z0P A;  3N9O A;  4BAY B;  2PFV A;  1T98 A;  2BVL A;  3UUN A;  4EAH A;  3ZYM A;  5JH7 E;  4MHC A;  2W61 A;  5AFU L;  5HWX A;  2Y8D A;  1YKH B;  3KFW X;  4L5G A;  3ETU A;  2P9B A;  4CXW A;  2DWG A;  2W00 A;  4PW8 A;  3PUQ A;  5LG4 A;  5FXZ A;  5FXX A;  2N2N A;  1D0Y A;  1ZEE A;  4AKG A;  3RYI E;  2E9X D;  5JDL A;  4CI2 B;  2VB6 A;  1B7T A;  3CML A;  1ZHC A;  5JRC A;  5JDM A;  2YEV C;  3RPU A;  3W15 B;  3LK2 B;  1US7 B;  5CA0 E;  5JRC B;  3PUG A;  3CVR A;  1QSD A;  4CXX A;  4I50 E;  5HYA A;  5DAB A;  5JR9 B;  2NTY A;  2QGS A;  5HXH A;  2CLY C;  2LT3 A;  4UIG A;  3RRC A;  3DTO A;  2C5K T;  4H9R C;  3PDY A;  5J2U E;  3K3O A;  4YLH A;  5ETW A;  2DLR A;  3RC8 A;  2LEH A;  5CB4 E;  4EB6 E;  1HG5 A;  5EK4 A;  5KX5 E;  2Q9Q B;  2RP4 A;  3F2E A;  3KV4 A;  1OWA A;  2KWH A;  4H9Q C;  4UEL A;  5KMG P;  3MJX A;  2K24 A;  1HS7 A;  5H6R B;  4KBM B;  3M65 A;  2WBL A;  3O9X A;  5LCY A;  1SHZ C;  2EHO B;  4H9S E;  5ADX L;  3ZC0 A;  2Q9Q D;  3R84 B;  3GWH A;  1IJ5 A;  4YJ2 E;  4UEM A;  5LGT B;  3O1J A;  4YFS A;  4AKH A;  1CUN A;  5L3C B;  2ZM0 A;  2CXD A;  3ETV A;  3C50 A;  4KP3 C;  3CPZ A;  3N2K E;  2LE8 A;  2RA1 A;  4ZI2 C;  3RH3 A;  3MZK B;  3PUA A;  1LVF A;  3C51 A;  3JC6 D;  2EHO C;  3NBX X;  4HGA A;  3RYC E;  4IST A;  4U72 A;  4PAG A;  1WYB A;  5L3B B;  2ZM8 A;  4ZI3 D;  1YKE B;  1D1C A;  2C0S A;  2NW7 A;  3IEE A;  4UV8 B;  4NUV A;  1UX5 A;  2XAG B;  3CX6 B;  3GMI A;  1HTJ F;  4XAX B;  3AAA B;  2VKH A;  4ZI2 D;  4ZI3 C;  4V1A v;  2X0L B;  5DJQ C;  3N9N A;  2Q9Q A;  3C98 B;  3OKQ A;  4A56 A;  3N9L A;  5LNK A;  3ZCJ A;  4OHF A;  3I0O A;  4PJM A;  5FY7 A;  3KBT A;  1IAP A;  3H37 A;  4ZS2 A;  1G8X A;  3K8P C;  3SRZ A;  3U3I A;  2MOZ A;  3RYH E;  2K5B B;  1KNZ A;  5F8P A;  5J2T E;  3C4X A;  3VU7 H;  3OYX A;  2H3R A;  5HXC A;  3RYF E;  4CI3 B;  1WRD A;  2DNX A;  2IAK A;  2JJ9 A;  2MTQ A;  2JMH A;  4HE8 A;  1S94 A;  4U74 A;  3UUX B;  3B57 A;  3ZMV B;  5BMV E;  3C4W A;  3Q5X A;  2XAJ B;  3LFM A;  3PU3 A;  4IE5 A;  5LHG B;  3CQC B;  4O4I E;  1D0X A;  4OYJ A;  4AKR B;  4J2C A;  4JEH B;  4OYK A;  1V9D A;  5C8Y E;  2Y48 B;  1ZV4 X;  2DI4 A;  4NUU A;  5FYM A;  2ZLY A;  2GK9 A;  3UTK A;  2VK9 A;  3D0T A;  2V7J A;  3AA6 B;  4EYU A;  2YU1 A;  2XTL A;  3IF8 B;  1KK7 A;  3I9W A;  3KV9 A;  4ZOL E;  3HKE E;  5DQV A;  2E9X C;  4G2A A;  2JMK A;  2PJQ A;  2K9A A;  4M1P A;  2IC6 A;  4P0B A;  3MKD A;  5JDQ A;  4DMW A;  4GOU A;  3VHL A;  2LSG A;  3O1I A;  4OFZ A;  5HWY A;  4E7Z A;  5EK2 A;  4AKI A;  5L3D B;  1IJ6 A;  4MAL A;  3SS1 A;  3OYZ A;  5EK3 A;  3E0Z A;  3ZMU B;  2K48 A;  3KVB A;  4PK6 A;  3R6N A;  2LJL A;  5LA6 E;  4O8S A;  5M4Y A;  3A5X A;  4O4H E;  3HA4 A;  2ACX A;  5JRE A;  2A3D A;  2CLY B;  1SA0 E;  3N2G E;  2B1E A;  1BR0 A;  1G73 A;  3FXE B;  3BQI A;  5HAX A;  5LJM A;  3L3P A;  1IZN B;  3IHR A;  3N5L A;  1QUU A;  2CM0 A;  2X68 A;  5J1G A;  3TKL B;  2MBG A;  1ZKE A;  3J9X 1;  5L3F B;  4WBN E;  5EZY E;  2H7V C;  1FMW A;  3O4X E;  3PE0 A;  1EZ3 A;  5LOV E;  2KLQ A;  2PG8 A;  3MAC A;  4N78 D;  3ZN0 B;  4WW0 A;  4UV9 B;  3SWH A;  3K3N A;  3GA8 A;  5IYZ E;  5A1L A;  2LOS A;  4UF0 B;  2VKJ A;  3N2O A;  2BVM A;  2V7L A;  4IIJ E;  5LGU B;  4HTE A;  4EZH A;  4TV8 E;  4H63 V;  5JDH A;  4QXC B;  2XAF B;  4O2B E;  4QXH B;  3GN5 A;  3HI2 A;  1FMV A;  1NAF A;  2DWK A;  4CXY A;  3Q5W A;  3GN5 B;  4JUY A;  4PFP A;  5FXW A;  3ONX A;  3K3Q C;  2M67 A;  3C4Z A;  3KIN B;  1MMN A;  4B6X A;  2I59 A;  1LKX A;  4HEA A;  2J1D G;  4GYR A;  3CKD A;  3I1A A;  3ZCI A;  3WAK A;  1D0Z A;  2EHO A;  2LM9 A;  1MIY A;  4HKA A;  4IE0 A;  2XUE A;  4I43 B;  4OK0 A;  4O4J E;  4O4L E;  1HX8 A;  2LSJ A;  4UF0 A;  3HR0 A;  4G63 A;  2UXN B;  2XQY A;  3ESL A;  5LBQ B;  1HF8 A;  3L09 A;  2YU2 A;  4IDZ A;  2E9X B;  2ODU A;  5JR9 A;  3ZMS B;  4C90 A;  2VKO A;  4ANJ A;  2CEA A;  4H9N C;  1Y64 B;  2CMR A;  4YJ3 E;  4ERR A;  4UXN B;  3QK6 A;  4MBQ A;  4CI1 B;  4XBF B;  5FP3 A;  2WMN A;  1MIV A;  2WM9 A;  2X66 A;  2V7K A;  5H6Q B;  2LSI A;  3FBZ A;  4PJL A;  1MMG A;  3LG7 A;  3BK9 A;  3F57 A;  3FB2 A;  3AA0 B;  1AJ3 A;  2XAQ B;  4AI6 A;  3VKG A;  2LSK A;  4IE4 A;  4H63 H;  3QUJ A;  2X9Y A;  4X1Y E;  5LHI B;  4DO0 A;  1MND A;  2V26 A;  1BR2 A;  3ZPO A;  3HKC E;  3PUR A;  2ZM2 A;  3OBV E;  3RC3 A;  3ZMT B;  4WBO A;  3EDV A;  2CXF A;  3V5S A;  4UVB B;  4GYS A;  2KWI B;  5JDN A;  2NOX A;  5JDG A;  3KBU A;  2EHO D;  3NZQ A;  5GON E;  4P09 A;  4QXB B;  5TAO A;  2KIN B;  3IBP A;  1MMA A;  5LJN A;  2KT9 A;  4JLE A;  2H7O A;  4HN9 A;  5FY0 A;  1MIW A;  3MA9 A;  4QWN B;  1OXZ A;  5FXV A;  2C5I T;  2HPL A;  4Z8X A;  2C5J A;  3O1H A;  1BR4 A;  4H9O C;  3Q9D A;  2HH7 A;  4DND A;  2UXX B;  2CE7 A;  3EDU A;  2L3L A;  2X67 A;  4BJN A;  4TN7 B;  4IGU A;  4QX8 B;  2ODV A;  3CX8 B;  5F3J A;  5HXS A;  4ZI7 E;  4HFV A;  4ZS3 A;  4ZHQ E;  2JRK A;  4EYY R;  2WAU A;  3CQX C;  3NRY A;  4CQI A;  3AAE B;  4FJO A;  2LHR A;  2VWA A;  1HFA A;  3OJA A;  3LBX A;  4UVC B;  2L9Q A;  5JDF A;  1D1B A;  3MK7 C;  5FNV E;  3LBX B;  5LXT E;  3I0Q A;  4PK5 A;  1NWM X;  5FMN A;  4DVD A;  4GK5 E;  3CWZ B;  3KVA A;  4K0U A;  2N1G A;  3ZN1 B;  4XZC A;  3T8O A;  2XHE B;  1UX4 A;  3N9P A;  4JEU B;  5JVD E;  3MXZ A;  1E1H B;  4ADZ A;  1O3X A;  4AXP A;  2MYS A;  4X20 E;  2V7M A;  1WR6 A;  1YW0 A;  2E8I A;  3JC6 C;  3FXD B;  4PK4 A;  3UFE A;  2JQQ A;  2LSY A;  2CWY A;  2LOP A;  4KMC A;  4DBQ A;  4L9I A;  2OA5 A;  2PBI A;  4BA9 A;  3VKH A;  1FEW A;  4TZ4 C;  1U4Q A;  4L0R A;  2V7I A;  4C91 A;  1MMD A;  2A2F X;  2L8K A;  3ZJ2 A;  2D0T A;  2WWU A;  3E08 A;  2BZB A;  3V5U A;  2N9D A;  4EXT A;  3AVS A;  3U78 A;  2CWO A;  3P7I A;  2Q9Q C;  3PUS A;  4KUM B;  4ASK A;  3ZYL A;  2CXL A;  3WAJ A;  4I55 E;  2Z6E A;  4ILU A;  3RX6 A;  5HXE A;  3ZLI A;  5DQW A;  4AQF A;  2X9W A;  3UUL A;  2YIN A;  3HL6 A;  3SOL A;  3I9Y A;  1VOM A;  4P0A A;  3PU8 A;  3ZEF B;  3CX7 B;  3KDS E;  2D2S A;  2JPF A;  1S35 A;  4MFR A;  2IC9 A;  3E22 E;  3AB3 B;  4PJN A;  3AA7 B;  3BQK A;  2D5U A;  1H7C A;  4PNI A;  4AQG A;  1MNE A;  1WYC A;  1LRZ A;  2NWB A;  2WMO A;  3FHN A;  2IW5 B;  2D0U A;  2CA5 A;  4QKN A;  4DBR A;  4EOZ B;  2NW9 A;  5LBM A;  2KZ7 B;  4MLK A;  4TV9 E;  3NRX A;  5CA1 E;  2W63 A;  3AVR A;  2SPC A;  3N9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...