1V9DA

Crystal structure of the core fh2 domain of mouse mdia1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
332
structure length
308
Chain Sequence
VKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLSFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The core FH2 domain of diaphanous-related formins is an elongated actin binding protein that inhibits polymerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Diaphanous protein homolog 1
total genus 120
structure length 308
sequence length 332
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA01
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA02
3OBVE 1Y64B 1UX5A 2J1DG 3O4XE 2Z6EA 1UX4A 1V9DA 4EAHA
chains in the Genus database with same CATH superfamily
5AQHB 5FKYA 3K1SA 3PU8A 3AA6B 5HXCA 2M6IA 4DBQA 1NENA 2ZMAA 1YD8G 3KFWX 4JI5T 3DJBA 1D1AA 2BS3A 2V26A 1MIVA 1W0BA 3ZC1A 3B5MA 4AQGA 4I55E 4JEUB 3P50A 2XASB 5GONE 4EB6E 1OXZA 1ZV4X 3AAEB 4G63A 3NWIA 2XHEB 3ZN1B 1GQEA 4PK5A 4AQYT 3AE5A 4O4JE 1HF8A 3ZSTA 5CA1E 4OX9T 2BVLA 1D0YA 2Q9QA 2WZIA 1H7CA 1JNRA 2LRLA 3AE3A 3G06A 1XDOA 2D0TA 4B6XA 5FXVA 4IIJE 4NPPA 4YFSA 4ERRA 5JRCA 3ZYLA 4YHHT 2MYSA 2GK9A 5EZYE 5CJ5A 3M3ZB 2LHRA 1N32T 5BMVE 2FJDA 5C3JA 2BS2A 3VHLA 4PW8A 3ZMTB 5E0OA 4QX8B 3O9XA 2NP9A 3P8CD 2IUBA 2CE7A 2ZM2A 3RGLA 3AE9A 4DV6T 3GA8A 1Y01A 3IBPA 2XQ3A 2ACZA 2L8KA 3HI2A 1W09A 4IE5A 4AKLA 5L47A 4YY3T 3EUHA 4X64T 4B3RT 4DR7T 3IEEA 3FBLA 2PJQA 2LOPA 4QXBB 2Z6EA 3ONJA 4DV3T 1XMOT 5AQMB 3WAKA 2UXXB 3ZJ1A 4DIDB 4TNWA 3PUYF 1XNRT 3JAEA 2X9XA 3UFGA 2BG9A 2QA7A 3CQCB 3NBXX 2E2AA 2LE8A 2MOZA 2WDRA 3PUGA 4U2ZA 3ZPOA 2V6YA 5LCYA 4JI0T 5L4HA 3O1HA 3PUWF 3TLUA 1FMVA 3KBUA 3ZJ2A 3C4ZA 4U7IA 1HNXT 3TLSA 2A2FX 3TLWA 3ZYMA 3KVBA 1HG5A 4COFA 4JI8T 2Y6XA 4O4LE 4YLHA 1WFDA 4DNDA 4IGUA 5KXJA 1CUNA 5ABFB 3AECA 3JC6C 4I50E 4GK5E 2BG9C 1KF6A 2KINB 2VVSA 2WDVA 3ESLA 2V5DA 4PJNA 5AQIB 3PE0A 1MMGA 5H6QB 3HKBE 2W61A 5AQVB 1US7B 2UXNB 4ZI3C 2NW9A 1UCUA 1YKHB 4FJOA 3C98B 4IE7A 4X5TA 4YXDA 2BG9B 2LM2A 1LVKA 2XAFB 2XSBA 5LG3A 2CEAA 5JREA 1BR0A 4UR9A 5HXRA 3N2OA 4LF8T 3SOLA 3ZCJA 2CM0A 2X51A 3UQ7A 1N33T 3LSVA 4YHJA 5L4EA 1N34T 3OKQA 3BK9A 5AQKB 4IE4A 4DV1T 3IA3A 2X0YA 4HFDA 2WAUA 2IAKA 2X68A 5FY7A 5LB7B 4NXNT 2XAGB 5EK4A 3KDSE 2KWHA 4UF0A 3QB5A 3EDVA 3OJAA 3ZLIA 4ZOLE 2XTLA 5HEGA 5HWYA 3MACA 4WYVA 5LP6E 4H9SE 5FL0A 2VKDA 2UUAT 2K3WA 2WWUA 4HFEA 2MAWA 1QSDA 4UV9B 5F8PA 4H9RC 4PJMA 3RYFE 4NUUA 3LK3B 3O1IA 1E2AA 4HFBA 4JEHB 4DR5T 3PU3A 2UXBT 4U7YA 3X1DA 2OA5A 2H89A 2NWBA 3Q9DA 4P0BA 4UV8B 3RRWA 4EEDA 1HFAA 4YSXA 4CI3B 3Q5EA 4L9IA 4CI1B 3FBZA 3PUXF 5HCMA 3BQLA 5JVDE 3J7Yq 4DUYT 4AISA 2KT9A 3MJXA 2C5JA 4TV8E 4UF0B 3RLFF 2V7KA 4YSYA 5FNVE 3V5UA 3VKGA 5F3JA 2LJLA 5DQWA 4ZI2D 3AEDA 3P4PA 4EYYR 1L0VA 2E9XC 5FVKA 3ZMZB 2G0UA 4ZS3A 2XQ9A 5HEJA 1OEDE 2WQYA 3N9PA 1XZYA 3AEEA 4IDZA 4B3TT 5LMNT 4PFOA 4ANJA 2XAQB 4DR1T 2UUCT 1IJ6A 3RC8A 1FJGT 3QB5K 2D0UA 4TWHA 3AEBA 4MFRA 1V9DA 3PDYA 4L5GA 3L8RA 4HWHA 4NXMT 1KK7A 3N5LA 2IHR1 4LF7T 3AEFA 3U3IA 1W0AA 2LM9A 3RIUA 3EABA 2X66A 5HEHA 4EZ4A 2B76A 2K48A 3C51A 3FXDB 1G73A 1QUUA 3EVYA 3UUNA 1BR2A 1T8BA 1YQ3A 2EHOB 2NOXA 1HG2A 2XSAA 2YINA 3PUZF 4I43B 3UU4A 3AE6A 2Y48B 2CPTA 4P1NA 3I9WA 3WAJA 3AAAB 3UU5A 3JC6D 4GKKT 2VASA 2H7VC 2X0LB 1MMDA 1WLXA 3C4WA 3RQUA 3ZYKA 4LFCT 2F4VT 4UVCB 5JDNA 5JH7E 4KP3C 4DR6T 1KNRA 2W2UA 4LFAT 4X1YE 2BBJA 4DR2T 5JR9B 2HN1A 1OEDA 2CXDA 2H88A 2IC9A 1UGOA 2JPFA 4CZZB 1KNPA 2WCAA 4JLEA 5FMNA 2A72A 3UU6A 3NZPA 3EI0A 4IDPA 3UUXB 3AB3B 4A98A 5LHIB 4B3MT 2BKOA 5KX5E 2K24A 5HXEA 1YQ4A 2BS4A 4CI2B 1AJ3A 3ZCIA 2XJ7A 3C4XA 4GK0E 3L39A 1Z8UA 3SWHA 2VL0A 2LSGA 1O3XA 2D2SA 2YDQA 3EAMA 3N9MA 4LF4T 4HWCA 2HN2A 4IDQA 5L2LA 4LF5T 2Q9QD 3UUBA 4MLKA 5LOVE 3L3PA 3NZQA 5LA6E 5AQNB 5FXXA 1NWMX 2JQ9A 2J47A 2WM9A 1Z0PA 2WU2A 2ZM6T 3I9YA 3NRXA 4HFHA 2W63A 4DR3T 5F5WA 1IBMT 3PUQA 3ABVA 5JR9A 3ZEFB 4X20E 3VRAA 2HH7A 2QYWA 2KLQA 3RI5A 2WMNA 2Q9QC 2WZHA 2HHHT 3M65A 4P09A 4PK6A 5LBMA 5CFBA 3UQ4A 2YU2A 2RPAA 2NW7A 3AEGA 2JQQA 4JI3T 4ZS2A 4OHFA 2WSSV 1YKEB 3A8YC 3LDQB 4U3CA 1X9BA 3AE8A 5HXHA 5JDLA 3H3MA 4K0KT 4HN9A 4Q25A 1WCRA 3KV6A 2NTXA 1MMNA 4H63V 5H6RB 5J1GA 4I4TE 4UVAB 2PTFA 2UXDT 1DU2A 2FJEA 4PK4A 1UX5A 3MA9A 5DABA 4WBNE 2EHOA 5KDMC 3VR8A 4X62T 2CXLA 5LMUT 3FZKB 3Q5WA 3Q5DA 3MXZA 3ZC0A 3AEAA 3OBVE 3RQWA 1Y64B 3P7IA 3CMLA 4HEAA 1ZP0A 2LLYA 4JUYA 2W66A 2JMHA 5FL1A 3UU8A 2EHOD 2YU1A 1T98A 3CWZB 2X9WA 3LBXA 1D0XA 3CX7B 3RC3A 2PFVA 4TN7B 3RH3A 4YTNA 3KV5A 3N2GE 4CXWA 2KWIB 1UUSA 3AA7B 1IZNB 3N2KE 4DV2T 1BR1A 3GN5B 4LFBT 5CB4E 4JI1T 2XZEA 2WDQA 3FZLB 3OYZA 2C5IT 1MMAA 2WWVA 5L3EB 5HEOA 2IDOB 3TKLB 3BQKA 1BR4A 2I6HA 4ZZCA 5IYZE 4M1PA 5ABHA 5JTGA 1KNZA 3UTKA 4AKHA 4WZXA 3KV9A 3FHNA 5LBQB 4U33A 4DUZT 2JMKA 3PV0F 1T7SA 3RRCA 3AVRA 2LSJA 2V7MA 2VURA 3ETVA 3GN5A 3UULA 4ZI3D 4U2YA 1ZKEA 4HWFA 2OLTA 4IE0A 4CN1A 4TX5A 2ODVA 4H63H 4AQFA 5DJQC 3F31A 4NUVA 3QK6A 2FBWA 5AQOB 3HKEE 1SE7A 4DVDA 1YW0A 1S94A 5AQJB 5JDGA 5LGTB 1S35A 2J4GA 2CRBA 4O2BE 4TUYE 2W4XA 4EGWA 1JNZA 5LNKA 4EAHA 3RX6A 2JRKA 4TNVA 5J2TE 1E1HB 3ZT7A 2LT3A 1LRZA 5AQFB 3C64A 2V6YB 4QXHB 1ZEEA 3PJAJ 4LMKA 5EK3A 2DWKA 3W15B 2CHNA 1OEDB 2RA1A 3CPZA 4GKJT 3ZT6A 3N9LA 4QWNB 1LKXA 2XM1A 5LJMA 4QH1A 2W0GA 5L3DB 3GWHA 2YKSA 2KXPB 4IE6A 2XQ6A 3TLTA 4X66T 1ZHCA 2J1DG 2BBHA 2XQYA 3CK6A 2CXFA 4YT0A 1FMWA 2CWYA 1T72A 4F6RC 3AXJB 4BA9A 2JQHA 3HKDE 2L9QA 4HFIA 4CN4A 4EV6A 5IUXA 1J1JA 3AAIA 1KEYA 3AA1B 1W9RA 4EYUA 4GOUA 4C91A 2V5CA 4O2AE 4EIWA 2K9AA 4OYJA 5FVLA 5HCJA 4LF6T 5JR9C 3LG7A 5FY0A 4JI2T 5CA0E 2M67A 1SA0E 4H9NC 3VRBA 4E7ZA 2LRKA 4OK0A 1WR0A 4NIQA 1UURA 1MNEA 3ANWB 3QUJA 3P4RA 4QHOA 4YTMA 4MBQA 2LKHA 4DMWA 5L3CB 1N36T 4KUMB 2WY2A 4KHPT 2BDEA 2E9XA 2ACXA 2QVAA 3K3NA 2N1GA 2VKJA 3I0QA 3T1HT 5JRCB 4Z8XA 2NR4A 1FEWA 2C5KT 3OYXA 3ZKRA 3AE4A 2JQKA 4HWIB 2R6GF 2CLYC 3ETUA 4QXCB 1D1BA 4JBWF 2SPCA 1YXRA 2VB6A 2ODUA 2XY8B 3AE2A 3OPCA 5L3GB 1VRBA 2DL1A 2W67A 3SFEA 2W00A 2YDRA 1G8XA 3D0TA 2XQ7A 3QNUA 3VU7H 2MPKA 3F57A 5FY1A 5ADXL 3RHWA 1UK5A 3MK7C 4H9QC 4ISTA 5AQGB 4AI6A 4DV4T 2DI4A 2N9DA 4JI4T 3FZHB 3OVUA 4FI5A 4IT4A 3MKDA 2C0SA 4TWFA 4UVBB 5JDFA 3CQXC 3SFDA 4BJMA 3H3AA 3NRYA 2MBGA 3ONXA 4EXTA 2DNXA 4MHCA 5FYMA 4BJNA 2LEHA 3E22E 2CWOA 5J2UE 4ISSA 5EK2A 3OTOT 5HXSA 2RP4A 4J2CA 3R84B 5AQPB 5AQUB 2E9XB 4PFPA 5AQQB 4I0UA 5JDQA 2XQ8A 4YTPA 3FB2A 2WMOA 4U31A 4ADZA 3VR9A 3KV4A 1XMQT 3RYHE 4ZZBA 2ZM8A 1SUMB 5LHGB 2K5BB 1EZ3A 2AE9A 2CLYB 2D9DA 2DLRA 3CVRA 4AQFC 4DBRA 4JI6T 2XQ4A 4TV9E 4QX7B 2QRXA 4V1Av 5HYAA 2XM2A 2CBIA 3LFMA 2IMLA 2IC6A 4MALA 3Q5XA 5IHYA 1VOMA 4HFCA 5KMGP 4A56A 1M62A 3SRZA 3AXJA 4PAGA 5AQTB 3R6NA 5LHHB 3ZMVB 4EEBA 2WB5A 3P4WA 4QH5A 4Z90A 3RYCE 3RYIE 4AXPA 1HR0T 4K0UA 5L3BB 3EHZA 1XNQT 1CHUA 4UXNB 2M6BA 1E7PA 3FZFB 4PNIA 3TLVA 5DQVA 2VL8A 1HTJF 1J5WA 1NAFA 2FUPA 3K3QC 1HNWT 5CGMA 1U4QA 4N78D 3RPUA 2LSYA 3RF1A 5AQSB 4EOZB 4ZEYA 3PURA 5HWXA 5L3FB 3PTRB 4E7SA 3AE7A 2V7LA 2WU5A 1IAPA 2H3RA 4KX6A 3L09A 3QOFA 2VK9A 4A5XA 1LVFA 2OV9A 5TAOA 5LYJE 3WI3A 5AQLB 2ZM0A 2BKPA 1IBLT 3CIRA 2V8SV 4A97A 4HKAA 2YK0A 3Q2MA 4LMJA 2FJAA 4AKGA 4U74A 4KMCA 2ZLYA 1WRDA 4PJLA 3DP7A 4CN6A 3LJCA 2WBLA 4PJJA 4UIGA 3BQIA 2BKNA 2X67A 4ILUA 4ILCA 4WBOA 5BR8T 4JI7T 3B57A 3UFEA 4GYRA 3E08A 3QC9A 1KFYA 3AVSA 4GIWA 5LGUB 1VCTA 3CQGB 3J9X1 2XAJB 2PBIA 2BVMA 5IWAT 3HL6A 4DO0A 4X1IE 2YOEA 2LSKA 4F8HA 3P4QA 1HS7A 1XDPA 4TZ4C 4YJ2E 5AQRB 2UXCT 5LXTE 2CCQA 1R8IA 2VVNA 3I0OA 1SHZC 3K3OA 3VKHA 4HTEA 1ZOYA 5FXZA 2JIWA 4DV5T 3PUAA 2WS3A 3H37A 5ETWA 2A3DA 1HNZT 1IJ5A 2XUEA 2Y8DA 1M7KA 2J62A 4O4IE 3NKZA 2P9BA 3LK42 3GMIA 4L0RA 4OYKA 3O1JA 4U72A 3RIAA 4EZHA 5LG4A 1HCIA 3ANWA 1D0ZA 3FZMB 2E9XD 3KBTA 2NW8A 5AFUL 4Z91A 2A9UA 2XAHB 4O4HE 2X9YA 4H9PC 3ZSSA 5JQGE 4BAYB 4QKNA 1X79A 2JJ9A 2LHNA 1HX1B 2AXDS 3PUVF 4IREA 4GYSA 4X1KE 5HEUA 1D1CA 4HWDA 3ZMUB 4QH4A 3AE1A 3V5SA 2HPLA 1XWMA 3E0ZA 5C2TA 3K8PC 1HX8A 4KHZF 4DR4T 1OWAA 4IL4A 5ABGA 4ZI7E 2KMFA 2VWAA 3RIUC 4ZI2C 3A5XA 2ES0A 2LOSA 2YN6A 2XPKA 3UU3A 4CQIA 2VQFT 5ABEA 3C50A 3P4SA 3CX8B 4ILBA 4OFZA 5A1LA 3RKOA 1QLBA 5J0ZA 2B1EA 2VKOA 1FIOA 3JAFA 2BG9E 4AKIA 3EDUA 1WR6A 2CMRA 2FJBA 3PJAA 2WP9A 4WNKA 3IHRA 2X9HA 4IHJE 5FXWA 4DMVA 4JV5T 1I6ZA 3IF8B 3S4UA 4YJ3E 3RIFA 3N9QA 2XQ5A 2HPJA 2Q9QB 2W62A 4ZXLA 4AKRB 5JDMA 4LF9T 1WYBA 4G2AA 4LMLA 4H9OC 4UELA 1OEDC 2N2NA 2YDSA 2V7IA 3ONLC 4UEMA 4WW0A 2DHRA 2CBJA 3DTOA 2E8IA 2DCFA 3N9NA 2D5UA 2V7JA 2CA5A 4ILAA 2H7OA 2IW5B 3T8OA 1IBKT 3ZN0B 1MIWA 1WYCA 2YEVC 2IIUA 2PG8A 1VCSA 2DWGA 4HFVA 4HE8A 3ZMSB 4CXYA 5FP3A 3B13A 3HKCE 3N9OA 2NTYA 4P0AA 4X65T 3T1YT 2XQAA 4DV0T 3HR0A 4IDNA 2I0MA 4XBFB 4O8SA 2I59A 3MZKB 3KVAA 1U5PA 4ASKA 1MNDA 1UX4A 4HGAA 3AA0B 4IDOA 4KI0F 5JDHA 5LGNB 3F2EA 2KNDA 5ABFA 2UU9T 2MTQA 1J5ET 2V6XA 3KINB 3HA4A 3SS1A 2KSRA 2LKGA 3JADA 4KBMB 2BZBA 3I1AA 3LBXB 3O4XE 5HAXA 3UUMA 3LK2B 4CXXA 2KZ7B 3PUSA 4IL9A 2X0HA 2VQET 4DV7T 4AIUA 5M4YA 2UUBT 3CKDA 3ZT5A 3RKGA 4YSZA 3NVOA 5LJNA 2CHOA 2L3LA 2V1DB 3U78A 2VKHA 3FXEB 4ZHQE 4TWDA 3A7MA 2E5VA 3JCFA 1B7TA 1MIYA 4C90A 5C8YE 2QGSA 1NEKA 4JYAT 3UT5E 1I94T 4XZCA 4XAXB 2E5LT 3CX6B 2LSIA 4B3ST 2EHOC
chains in the Genus database with same CATH topology
5HXCA 3PU8A 3AA6B 4DBQA 2ZMAA 1YD8G 3KFWX 3DJBA 1D1AA 2V26A 1MIVA 3ZC1A 4AQGA 4I55E 4JEUB 4EB6E 2XASB 5GONE 1OXZA 1ZV4X 3AAEB 4G63A 3ZN1B 2XHEB 4PK5A 4O4JE 1HF8A 5CA1E 2BVLA 1D0YA 2Q9QA 4HGAA 1H7CA 4B6XA 2D0TA 5JRCA 4ERRA 5FXVA 4IIJE 4YFSA 3ZYLA 2MYSA 2GK9A 5EZYE 2LHRA 5BMVE 3VHLA 4PW8A 3ZMTB 5E0OA 4QX8B 3O9XA 2NP9A 3P8CD 2CE7A 2ZM2A 3GA8A 3IBPA 4AKLA 2L8KA 3HI2A 4IE5A 3EUHA 3IEEA 3FBLA 2PJQA 2LOPA 4QXBB 2Z6EA 3WAKA 2UXXB 3ZJ1A 2X9XA 3CQCB 2QA7A 3NBXX 2LE8A 2MOZA 3PUGA 3ZPOA 5LCYA 3O1HA 1FMVA 3KBUA 3ZJ2A 3C4ZA 2A2FX 3ZYMA 3KVBA 1HG5A 2Y6XA 4O4LE 4YLHA 4DNDA 4IGUA 1CUNA 3JC6C 4I50E 4GK5E 2KINB 3ESLA 4PJNA 3PE0A 1MMGA 5H6QB 3HKBE 2W61A 2NW9A 1US7B 2UXNB 4ZI3C 1UCUA 1YKHB 4FJOA 3C98B 4IE7A 5JREA 1LVKA 2XAFB 2CEAA 5HXRA 3N2OA 3ZCJA 3SOLA 2CM0A 2X51A 4YHJA 3OKQA 3BK9A 4IE4A 5FY7A 2WAUA 2IAKA 2X68A 2XAGB 5EK4A 3KDSE 2KWHA 4UF0A 3EDVA 3OJAA 3ZLIA 4ZOLE 2XTLA 5HWYA 3MACA 5LP6E 4H9SE 2VKDA 2WWUA 1QSDA 4UV9B 5F8PA 4H9RC 4PJMA 3RYFE 4NUUA 3LK3B 3O1IA 4JEHB 3PU3A 2OA5A 2NWBA 3Q9DA 4P0BA 4UV8B 3RRWA 1HFAA 4CI3B 4L9IA 4CI1B 3FBZA 5JVDE 3BQLA 3J7Yq 2KT9A 3MJXA 2C5JA 4TV8E 4UF0B 2V7KA 5FNVE 3V5UA 3VKGA 5F3JA 2LJLA 5DQWA 4ZI2D 4EYYR 2E9XC 2G0UA 4ZS3A 3N9PA 4IDZA 4PFOA 4ANJA 2XAQB 1IJ6A 3RC8A 2D0UA 4MFRA 1V9DA 3PDYA 4L5GA 1KK7A 3N5LA 3U3IA 2LM9A 2X66A 4EZ4A 2K48A 3C51A 3FXDB 1G73A 1QUUA 3EVYA 3UUNA 1BR2A 2EHOB 2YINA 2NOXA 4I43B 1HG2A 2Y48B 3I9WA 3WAJA 3AAAB 3JC6D 2VASA 2H7VC 2X0LB 1WLXA 1MMDA 3C4WA 3ZYKA 4UVCB 5JDNA 5JH7E 4KP3C 4X1YE 5JR9B 2IC9A 4CZZB 2CXDA 2JPFA 3UUXB 4JLEA 5FMNA 2A72A 3NZPA 5LHIB 3AB3B 5KX5E 2K24A 5HXEA 4CI2B 1AJ3A 3ZCIA 3C4XA 4GK0E 3SWHA 2LSGA 1O3XA 2D2SA 3N9MA 5L2LA 2Q9QD 4MLKA 5LOVE 3L3PA 3NZQA 5LA6E 5FXXA 1NWMX 2WM9A 1Z0PA 3I9YA 3NRXA 2W63A 3PUQA 5JR9A 3ZEFB 4X20E 2HH7A 2KLQA 2WMNA 2Q9QC 3M65A 4P09A 4PK6A 5LBMA 2YU2A 2NW7A 2JQQA 4ZS2A 4OHFA 2WSSV 1YKEB 5HXHA 5JDLA 4HN9A 3KV6A 2NTXA 1MMNA 4H63V 5H6RB 5J1GA 4I4TE 4UVAB 4PK4A 1UX5A 3MA9A 5DABA 4WBNE 2EHOA 5KDMC 2CXLA 3Q5WA 3MXZA 3ZC0A 3OBVE 1Y64B 3P7IA 3CMLA 4HEAA 4JUYA 2JMHA 2EHOD 2YU1A 1T98A 3CWZB 2X9WA 3LBXA 1D0XA 3CX7B 3RC3A 2PFVA 4TN7B 3RH3A 3KV5A 3N2GE 4CXWA 2KWIB 3AA7B 1BR0A 1IZNB 3N2KE 1BR1A 3GN5B 5CB4E 5L3EB 3OYZA 2C5IT 1MMAA 3TKLB 3BQKA 1BR4A 1KNZA 5IYZE 4M1PA 4AKHA 3KV9A 3FHNA 5LBQB 2JMKA 3RRCA 3AVRA 2LSJA 2V7MA 3ETVA 3GN5A 3UULA 4ZI3D 1ZKEA 4IE0A 4TX5A 2ODVA 4H63H 4AQFA 5DJQC 3F31A 4NUVA 3QK6A 3HKEE 4DVDA 1YW0A 1S94A 5JDGA 5LGTB 1S35A 4O2BE 4TUYE 5LNKA 4EAHA 3RX6A 2JRKA 5J2TE 1E1HB 2LT3A 1LRZA 3C64A 4QXHB 1ZEEA 5EK3A 2DWKA 3W15B 3CPZA 2RA1A 3N9LA 4QWNB 1LKXA 5LJMA 2W0GA 5L3DB 3GWHA 4IE6A 2KXPB 1ZHCA 2J1DG 2XQYA 2CXFA 1FMWA 2CWYA 4F6RC 4BA9A 3HKDE 2L9QA 3AAIA 3AA1B 4EYUA 4GOUA 4C91A 4EIWA 4O2AE 2K9AA 4OYJA 5JR9C 3LG7A 5FY0A 4CXYA 5CA0E 2M67A 1SA0E 4H9NC 4E7ZA 4OK0A 3QUJA 1MNEA 3ANWB 4DMWA 4QHOA 4AI6A 4MBQA 5L3CB 4KUMB 2BDEA 2E9XA 2ACXA 3K3NA 2N1GA 2VKJA 3I0QA 5JRCB 4Z8XA 1FEWA 2C5KT 3OYXA 3ETUA 2CLYC 4QXCB 1D1BA 5L3GB 2SPCA 2VB6A 2ODUA 1VRBA 2W00A 3D0TA 1G8XA 3VU7H 5FY1A 3F57A 5ADXL 3MK7C 4H9QC 4ISTA 2DI4A 2N9DA 4FI5A 4BJMA 5JDFA 3MKDA 2C0SA 4UVBB 3CQXC 3H3AA 3NRYA 2MBGA 3ONXA 4EXTA 2DNXA 4MHCA 5FYMA 4BJNA 2LEHA 3E22E 2CWOA 5J2UE 4ISSA 5EK2A 5HXSA 2RP4A 4J2CA 3R84B 2E9XB 4PFPA 3FB2A 2WMOA 4ADZA 3KV4A 3RYHE 2ZM8A 5LHGB 2K5BB 1EZ3A 2CLYB 2DLRA 3CVRA 4AQFC 4DBRA 4TV9E 4QX7B 4V1Av 5HYAA 3LFMA 2IC6A 4MALA 3Q5XA 5IHYA 1VOMA 5KMGP 4A56A 3SRZA 4PAGA 3R6NA 5LHHB 3ZMVB 3RYIE 4AXPA 3RYCE 4K0UA 5L3BB 4UXNB 4PNIA 5DQVA 2VL8A 1HTJF 1NAFA 3K3QC 1U4QA 4N78D 3RPUA 2LSYA 4EOZB 5L3FB 3PURA 5HWXA 3PTRB 4E7SA 2V7LA 1IAPA 2H3RA 3L09A 2VK9A 1LVFA 5LYJE 5TAOA 3WI3A 2ZM0A 4HKAA 2YK0A 3Q2MA 4AKGA 4U74A 4KMCA 2ZLYA 1WRDA 4PJLA 3DP7A 3LJCA 2WBLA 4PJJA 4UIGA 3BQIA 2X67A 4ILUA 4WBOA 3B57A 3UFEA 4GYRA 3E08A 3QC9A 3AVSA 4GIWA 5LGUB 3CQGB 3J9X1 2XAJB 2PBIA 2BVMA 3HL6A 4DO0A 4X1IE 2LSKA 1HS7A 4TZ4C 4YJ2E 5LXTE 2CCQA 3I0OA 3K3OA 1SHZC 3VKHA 4HTEA 5FXZA 3PUAA 3H37A 5ETWA 2A3DA 1IJ5A 2XUEA 2Y8DA 3UTKA 3UT5E 4O4IE 4U72A 2P9BA 3LK42 3GMIA 4L0RA 4OYKA 3O1JA 4EZHA 5LG4A 1HCIA 3ANWA 1D0ZA 2E9XD 3KBTA 2NW8A 5AFUL 2XAHB 4O4HE 2X9YA 4H9PC 5JQGE 4BAYB 4QKNA 1X79A 2JJ9A 2LHNA 4X1KE 3ZMUB 4GYSA 1D1CA 3V5SA 2HPLA 3E0ZA 3K8PC 1HX8A 1OWAA 4ZI7E 2KMFA 2VWAA 4ZI2C 3A5XA 2ES0A 2LOSA 4CQIA 3C50A 3CX8B 4OFZA 5A1LA 3RKOA 2B1EA 2VKOA 1FIOA 4AKIA 3EDUA 1WR6A 2CMRA 5FXWA 4WNKA 3IHRA 2X9HA 4IHJE 4DMVA 3IF8B 3S4UA 4YJ3E 3N9QA 2HPJA 2Q9QB 2W62A 4AKRB 5JDMA 1WYBA 4G2AA 4H9OC 4UELA 2N2NA 2V7IA 4UEMA 4WW0A 2DHRA 3ZMZB 3DTOA 2E8IA 2DCFA 3N9NA 2D5UA 2V7JA 2CA5A 3T8OA 2H7OA 2IW5B 3ZN0B 1MIWA 1WYCA 2YEVC 2PG8A 4HFVA 2DWGA 3ZMSB 4HE8A 5FP3A 3B13A 3HKCE 3N9OA 2NTYA 4P0AA 3HR0A 4XBFB 4O8SA 2I59A 3MZKB 3KVAA 1U5PA 4ASKA 1MNDA 1UX4A 3AA0B 5LGNB 5JDHA 3F2EA 2KNDA 2MTQA 3KINB 3HA4A 3SS1A 4KBMB 3UUMA 2BZBA 3I1AA 3LBXB 3O4XE 5HAXA 4CXXA 3LK2B 5JDQA 2KZ7B 3PUSA 5M4YA 3CKDA 5LJNA 2L3LA 3U78A 2V1DB 2VKHA 3FXEB 4ZHQE 1B7TA 1MIYA 4C90A 5C8YE 2QGSA 4XZCA 4XAXB 3CX6B 2LSIA 2EHOC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OBV E;  1Y64 B;  1UX5 A;  2J1D G;  3O4X E;  2Z6E A;  1UX4 A;  1V9D A;  4EAH A; 
#chains in the Genus database with same CATH topology
 5AQH B;  5FKY A;  3K1S A;  3PU8 A;  3AA6 B;  5HXC A;  2M6I A;  4DBQ A;  1NEN A;  2ZMA A;  1YD8 G;  3KFW X;  4JI5 T;  3DJB A;  1D1A A;  2BS3 A;  2V26 A;  1MIV A;  1W0B A;  3ZC1 A;  3B5M A;  4AQG A;  4I55 E;  4JEU B;  3P50 A;  2XAS B;  5GON E;  4EB6 E;  1OXZ A;  1ZV4 X;  3AAE B;  4G63 A;  3NWI A;  2XHE B;  3ZN1 B;  1GQE A;  4PK5 A;  4AQY T;  3AE5 A;  4O4J E;  1HF8 A;  3ZST A;  5CA1 E;  4OX9 T;  2BVL A;  1D0Y A;  2Q9Q A;  2WZI A;  1H7C A;  1JNR A;  2LRL A;  3AE3 A;  3G06 A;  1XDO A;  2D0T A;  4B6X A;  5FXV A;  4IIJ E;  4NPP A;  4YFS A;  4ERR A;  5JRC A;  3ZYL A;  4YHH T;  2MYS A;  2GK9 A;  5EZY E;  5CJ5 A;  3M3Z B;  2LHR A;  1N32 T;  5BMV E;  2FJD A;  5C3J A;  2BS2 A;  3VHL A;  4PW8 A;  3ZMT B;  5E0O A;  4QX8 B;  3O9X A;  2NP9 A;  3P8C D;  2IUB A;  2CE7 A;  2ZM2 A;  3RGL A;  3AE9 A;  4DV6 T;  3GA8 A;  1Y01 A;  3IBP A;  2XQ3 A;  2ACZ A;  2L8K A;  3HI2 A;  1W09 A;  4IE5 A;  4AKL A;  5L47 A;  4YY3 T;  3EUH A;  4X64 T;  4B3R T;  4DR7 T;  3IEE A;  3FBL A;  2PJQ A;  2LOP A;  4QXB B;  2Z6E A;  3ONJ A;  4DV3 T;  1XMO T;  5AQM B;  3WAK A;  2UXX B;  3ZJ1 A;  4DID B;  4TNW A;  3PUY F;  1XNR T;  3JAE A;  2X9X A;  3UFG A;  2BG9 A;  2QA7 A;  3CQC B;  3NBX X;  2E2A A;  2LE8 A;  2MOZ A;  2WDR A;  3PUG A;  4U2Z A;  3ZPO A;  2V6Y A;  5LCY A;  4JI0 T;  5L4H A;  3O1H A;  3PUW F;  3TLU A;  1FMV A;  3KBU A;  3ZJ2 A;  3C4Z A;  4U7I A;  1HNX T;  3TLS A;  2A2F X;  3TLW A;  3ZYM A;  3KVB A;  1HG5 A;  4COF A;  4JI8 T;  2Y6X A;  4O4L E;  4YLH A;  1WFD A;  4DND A;  4IGU A;  5KXJ A;  1CUN A;  5ABF B;  3AEC A;  3JC6 C;  4I50 E;  4GK5 E;  2BG9 C;  1KF6 A;  2KIN B;  2VVS A;  2WDV A;  3ESL A;  2V5D A;  4PJN A;  5AQI B;  3PE0 A;  1MMG A;  5H6Q B;  3HKB E;  2W61 A;  5AQV B;  1US7 B;  2UXN B;  4ZI3 C;  2NW9 A;  1UCU A;  1YKH B;  4FJO A;  3C98 B;  4IE7 A;  4X5T A;  4YXD A;  2BG9 B;  2LM2 A;  1LVK A;  2XAF B;  2XSB A;  5LG3 A;  2CEA A;  5JRE A;  1BR0 A;  4UR9 A;  5HXR A;  3N2O A;  4LF8 T;  3SOL A;  3ZCJ A;  2CM0 A;  2X51 A;  3UQ7 A;  1N33 T;  3LSV A;  4YHJ A;  5L4E A;  1N34 T;  3OKQ A;  3BK9 A;  5AQK B;  4IE4 A;  4DV1 T;  3IA3 A;  2X0Y A;  4HFD A;  2WAU A;  2IAK A;  2X68 A;  5FY7 A;  5LB7 B;  4NXN T;  2XAG B;  5EK4 A;  3KDS E;  2KWH A;  4UF0 A;  3QB5 A;  3EDV A;  3OJA A;  3ZLI A;  4ZOL E;  2XTL A;  5HEG A;  5HWY A;  3MAC A;  4WYV A;  5LP6 E;  4H9S E;  5FL0 A;  2VKD A;  2UUA T;  2K3W A;  2WWU A;  4HFE A;  2MAW A;  1QSD A;  4UV9 B;  5F8P A;  4H9R C;  4PJM A;  3RYF E;  4NUU A;  3LK3 B;  3O1I A;  1E2A A;  4HFB A;  4JEH B;  4DR5 T;  3PU3 A;  2UXB T;  4U7Y A;  3X1D A;  2OA5 A;  2H89 A;  2NWB A;  3Q9D A;  4P0B A;  4UV8 B;  3RRW A;  4EED A;  1HFA A;  4YSX A;  4CI3 B;  3Q5E A;  4L9I A;  4CI1 B;  3FBZ A;  3PUX F;  5HCM A;  3BQL A;  5JVD E;  3J7Y q;  4DUY T;  4AIS A;  2KT9 A;  3MJX A;  2C5J A;  4TV8 E;  4UF0 B;  3RLF F;  2V7K A;  4YSY A;  5FNV E;  3V5U A;  3VKG A;  5F3J A;  2LJL A;  5DQW A;  4ZI2 D;  3AED A;  3P4P A;  4EYY R;  1L0V A;  2E9X C;  5FVK A;  3ZMZ B;  2G0U A;  4ZS3 A;  2XQ9 A;  5HEJ A;  1OED E;  2WQY A;  3N9P A;  1XZY A;  3AEE A;  4IDZ A;  4B3T T;  5LMN T;  4PFO A;  4ANJ A;  2XAQ B;  4DR1 T;  2UUC T;  1IJ6 A;  3RC8 A;  1FJG T;  3QB5 K;  2D0U A;  4TWH A;  3AEB A;  4MFR A;  1V9D A;  3PDY A;  4L5G A;  3L8R A;  4HWH A;  4NXM T;  1KK7 A;  3N5L A;  2IHR 1;  4LF7 T;  3AEF A;  3U3I A;  1W0A A;  2LM9 A;  3RIU A;  3EAB A;  2X66 A;  5HEH A;  4EZ4 A;  2B76 A;  2K48 A;  3C51 A;  3FXD B;  1G73 A;  1QUU A;  3EVY A;  3UUN A;  1BR2 A;  1T8B A;  1YQ3 A;  2EHO B;  2NOX A;  1HG2 A;  2XSA A;  2YIN A;  3PUZ F;  4I43 B;  3UU4 A;  3AE6 A;  2Y48 B;  2CPT A;  4P1N A;  3I9W A;  3WAJ A;  3AAA B;  3UU5 A;  3JC6 D;  4GKK T;  2VAS A;  2H7V C;  2X0L B;  1MMD A;  1WLX A;  3C4W A;  3RQU A;  3ZYK A;  4LFC T;  2F4V T;  4UVC B;  5JDN A;  5JH7 E;  4KP3 C;  4DR6 T;  1KNR A;  2W2U A;  4LFA T;  4X1Y E;  2BBJ A;  4DR2 T;  5JR9 B;  2HN1 A;  1OED A;  2CXD A;  2H88 A;  2IC9 A;  1UGO A;  2JPF A;  4CZZ B;  1KNP A;  2WCA A;  4JLE A;  5FMN A;  2A72 A;  3UU6 A;  3NZP A;  3EI0 A;  4IDP A;  3UUX B;  3AB3 B;  4A98 A;  5LHI B;  4B3M T;  2BKO A;  5KX5 E;  2K24 A;  5HXE A;  1YQ4 A;  2BS4 A;  4CI2 B;  1AJ3 A;  3ZCI A;  2XJ7 A;  3C4X A;  4GK0 E;  3L39 A;  1Z8U A;  3SWH A;  2VL0 A;  2LSG A;  1O3X A;  2D2S A;  2YDQ A;  3EAM A;  3N9M A;  4LF4 T;  4HWC A;  2HN2 A;  4IDQ A;  5L2L A;  4LF5 T;  2Q9Q D;  3UUB A;  4MLK A;  5LOV E;  3L3P A;  3NZQ A;  5LA6 E;  5AQN B;  5FXX A;  1NWM X;  2JQ9 A;  2J47 A;  2WM9 A;  1Z0P A;  2WU2 A;  2ZM6 T;  3I9Y A;  3NRX A;  4HFH A;  2W63 A;  4DR3 T;  5F5W A;  1IBM T;  3PUQ A;  3ABV A;  5JR9 A;  3ZEF B;  4X20 E;  3VRA A;  2HH7 A;  2QYW A;  2KLQ A;  3RI5 A;  2WMN A;  2Q9Q C;  2WZH A;  2HHH T;  3M65 A;  4P09 A;  4PK6 A;  5LBM A;  5CFB A;  3UQ4 A;  2YU2 A;  2RPA A;  2NW7 A;  3AEG A;  2JQQ A;  4JI3 T;  4ZS2 A;  4OHF A;  2WSS V;  1YKE B;  3A8Y C;  3LDQ B;  4U3C A;  1X9B A;  3AE8 A;  5HXH A;  5JDL A;  3H3M A;  4K0K T;  4HN9 A;  4Q25 A;  1WCR A;  3KV6 A;  2NTX A;  1MMN A;  4H63 V;  5H6R B;  5J1G A;  4I4T E;  4UVA B;  2PTF A;  2UXD T;  1DU2 A;  2FJE A;  4PK4 A;  1UX5 A;  3MA9 A;  5DAB A;  4WBN E;  2EHO A;  5KDM C;  3VR8 A;  4X62 T;  2CXL A;  5LMU T;  3FZK B;  3Q5W A;  3Q5D A;  3MXZ A;  3ZC0 A;  3AEA A;  3OBV E;  3RQW A;  1Y64 B;  3P7I A;  3CML A;  4HEA A;  1ZP0 A;  2LLY A;  4JUY A;  2W66 A;  2JMH A;  5FL1 A;  3UU8 A;  2EHO D;  2YU1 A;  1T98 A;  3CWZ B;  2X9W A;  3LBX A;  1D0X A;  3CX7 B;  3RC3 A;  2PFV A;  4TN7 B;  3RH3 A;  4YTN A;  3KV5 A;  3N2G E;  4CXW A;  2KWI B;  1UUS A;  3AA7 B;  1IZN B;  3N2K E;  4DV2 T;  1BR1 A;  3GN5 B;  4LFB T;  5CB4 E;  4JI1 T;  2XZE A;  2WDQ A;  3FZL B;  3OYZ A;  2C5I T;  1MMA A;  2WWV A;  5L3E B;  5HEO A;  2IDO B;  3TKL B;  3BQK A;  1BR4 A;  2I6H A;  4ZZC A;  5IYZ E;  4M1P A;  5ABH A;  5JTG A;  1KNZ A;  3UTK A;  4AKH A;  4WZX A;  3KV9 A;  3FHN A;  5LBQ B;  4U33 A;  4DUZ T;  2JMK A;  3PV0 F;  1T7S A;  3RRC A;  3AVR A;  2LSJ A;  2V7M A;  2VUR A;  3ETV A;  3GN5 A;  3UUL A;  4ZI3 D;  4U2Y A;  1ZKE A;  4HWF A;  2OLT A;  4IE0 A;  4CN1 A;  4TX5 A;  2ODV A;  4H63 H;  4AQF A;  5DJQ C;  3F31 A;  4NUV A;  3QK6 A;  2FBW A;  5AQO B;  3HKE E;  1SE7 A;  4DVD A;  1YW0 A;  1S94 A;  5AQJ B;  5JDG A;  5LGT B;  1S35 A;  2J4G A;  2CRB A;  4O2B E;  4TUY E;  2W4X A;  4EGW A;  1JNZ A;  5LNK A;  4EAH A;  3RX6 A;  2JRK A;  4TNV A;  5J2T E;  1E1H B;  3ZT7 A;  2LT3 A;  1LRZ A;  5AQF B;  3C64 A;  2V6Y B;  4QXH B;  1ZEE A;  3PJA J;  4LMK A;  5EK3 A;  2DWK A;  3W15 B;  2CHN A;  1OED B;  2RA1 A;  3CPZ A;  4GKJ T;  3ZT6 A;  3N9L A;  4QWN B;  1LKX A;  2XM1 A;  5LJM A;  4QH1 A;  2W0G A;  5L3D B;  3GWH A;  2YKS A;  2KXP B;  4IE6 A;  2XQ6 A;  3TLT A;  4X66 T;  1ZHC A;  2J1D G;  2BBH A;  2XQY A;  3CK6 A;  2CXF A;  4YT0 A;  1FMW A;  2CWY A;  1T72 A;  4F6R C;  3AXJ B;  4BA9 A;  2JQH A;  3HKD E;  2L9Q A;  4HFI A;  4CN4 A;  4EV6 A;  5IUX A;  1J1J A;  3AAI A;  1KEY A;  3AA1 B;  1W9R A;  4EYU A;  4GOU A;  4C91 A;  2V5C A;  4O2A E;  4EIW A;  2K9A A;  4OYJ A;  5FVL A;  5HCJ A;  4LF6 T;  5JR9 C;  3LG7 A;  5FY0 A;  4JI2 T;  5CA0 E;  2M67 A;  1SA0 E;  4H9N C;  3VRB A;  4E7Z A;  2LRK A;  4OK0 A;  1WR0 A;  4NIQ A;  1UUR A;  1MNE A;  3ANW B;  3QUJ A;  3P4R A;  4QHO A;  4YTM A;  4MBQ A;  2LKH A;  4DMW A;  5L3C B;  1N36 T;  4KUM B;  2WY2 A;  4KHP T;  2BDE A;  2E9X A;  2ACX A;  2QVA A;  3K3N A;  2N1G A;  2VKJ A;  3I0Q A;  3T1H T;  5JRC B;  4Z8X A;  2NR4 A;  1FEW A;  2C5K T;  3OYX A;  3ZKR A;  3AE4 A;  2JQK A;  4HWI B;  2R6G F;  2CLY C;  3ETU A;  4QXC B;  1D1B A;  4JBW F;  2SPC A;  1YXR A;  2VB6 A;  2ODU A;  2XY8 B;  3AE2 A;  3OPC A;  5L3G B;  1VRB A;  2DL1 A;  2W67 A;  3SFE A;  2W00 A;  2YDR A;  1G8X A;  3D0T A;  2XQ7 A;  3QNU A;  3VU7 H;  2MPK A;  3F57 A;  5FY1 A;  5ADX L;  3RHW A;  1UK5 A;  3MK7 C;  4H9Q C;  4IST A;  5AQG B;  4AI6 A;  4DV4 T;  2DI4 A;  2N9D A;  4JI4 T;  3FZH B;  3OVU A;  4FI5 A;  4IT4 A;  3MKD A;  2C0S A;  4TWF A;  4UVB B;  5JDF A;  3CQX C;  3SFD A;  4BJM A;  3H3A A;  3NRY A;  2MBG A;  3ONX A;  4EXT A;  2DNX A;  4MHC A;  5FYM A;  4BJN A;  2LEH A;  3E22 E;  2CWO A;  5J2U E;  4ISS A;  5EK2 A;  3OTO T;  5HXS A;  2RP4 A;  4J2C A;  3R84 B;  5AQP B;  5AQU B;  2E9X B;  4PFP A;  5AQQ B;  4I0U A;  5JDQ A;  2XQ8 A;  4YTP A;  3FB2 A;  2WMO A;  4U31 A;  4ADZ A;  3VR9 A;  3KV4 A;  1XMQ T;  3RYH E;  4ZZB A;  2ZM8 A;  1SUM B;  5LHG B;  2K5B B;  1EZ3 A;  2AE9 A;  2CLY B;  2D9D A;  2DLR A;  3CVR A;  4AQF C;  4DBR A;  4JI6 T;  2XQ4 A;  4TV9 E;  4QX7 B;  2QRX A;  4V1A v;  5HYA A;  2XM2 A;  2CBI A;  3LFM A;  2IML A;  2IC6 A;  4MAL A;  3Q5X A;  5IHY A;  1VOM A;  4HFC A;  5KMG P;  4A56 A;  1M62 A;  3SRZ A;  3AXJ A;  4PAG A;  5AQT B;  3R6N A;  5LHH B;  3ZMV B;  4EEB A;  2WB5 A;  3P4W A;  4QH5 A;  4Z90 A;  3RYC E;  3RYI E;  4AXP A;  1HR0 T;  4K0U A;  5L3B B;  3EHZ A;  1XNQ T;  1CHU A;  4UXN B;  2M6B A;  1E7P A;  3FZF B;  4PNI A;  3TLV A;  5DQV A;  2VL8 A;  1HTJ F;  1J5W A;  1NAF A;  2FUP A;  3K3Q C;  1HNW T;  5CGM A;  1U4Q A;  4N78 D;  3RPU A;  2LSY A;  3RF1 A;  5AQS B;  4EOZ B;  4ZEY A;  3PUR A;  5HWX A;  5L3F B;  3PTR B;  4E7S A;  3AE7 A;  2V7L A;  2WU5 A;  1IAP A;  2H3R A;  4KX6 A;  3L09 A;  3QOF A;  2VK9 A;  4A5X A;  1LVF A;  2OV9 A;  5TAO A;  5LYJ E;  3WI3 A;  5AQL B;  2ZM0 A;  2BKP A;  1IBL T;  3CIR A;  2V8S V;  4A97 A;  4HKA A;  2YK0 A;  3Q2M A;  4LMJ A;  2FJA A;  4AKG A;  4U74 A;  4KMC A;  2ZLY A;  1WRD A;  4PJL A;  3DP7 A;  4CN6 A;  3LJC A;  2WBL A;  4PJJ A;  4UIG A;  3BQI A;  2BKN A;  2X67 A;  4ILU A;  4ILC A;  4WBO A;  5BR8 T;  4JI7 T;  3B57 A;  3UFE A;  4GYR A;  3E08 A;  3QC9 A;  1KFY A;  3AVS A;  4GIW A;  5LGU B;  1VCT A;  3CQG B;  3J9X 1;  2XAJ B;  2PBI A;  2BVM A;  5IWA T;  3HL6 A;  4DO0 A;  4X1I E;  2YOE A;  2LSK A;  4F8H A;  3P4Q A;  1HS7 A;  1XDP A;  4TZ4 C;  4YJ2 E;  5AQR B;  2UXC T;  5LXT E;  2CCQ A;  1R8I A;  2VVN A;  3I0O A;  1SHZ C;  3K3O A;  3VKH A;  4HTE A;  1ZOY A;  5FXZ A;  2JIW A;  4DV5 T;  3PUA A;  2WS3 A;  3H37 A;  5ETW A;  2A3D A;  1HNZ T;  1IJ5 A;  2XUE A;  2Y8D A;  1M7K A;  2J62 A;  4O4I E;  3NKZ A;  2P9B A;  3LK4 2;  3GMI A;  4L0R A;  4OYK A;  3O1J A;  4U72 A;  3RIA A;  4EZH A;  5LG4 A;  1HCI A;  3ANW A;  1D0Z A;  3FZM B;  2E9X D;  3KBT A;  2NW8 A;  5AFU L;  4Z91 A;  2A9U A;  2XAH B;  4O4H E;  2X9Y A;  4H9P C;  3ZSS A;  5JQG E;  4BAY B;  4QKN A;  1X79 A;  2JJ9 A;  2LHN A;  1HX1 B;  2AXD S;  3PUV F;  4IRE A;  4GYS A;  4X1K E;  5HEU A;  1D1C A;  4HWD A;  3ZMU B;  4QH4 A;  3AE1 A;  3V5S A;  2HPL A;  1XWM A;  3E0Z A;  5C2T A;  3K8P C;  1HX8 A;  4KHZ F;  4DR4 T;  1OWA A;  4IL4 A;  5ABG A;  4ZI7 E;  2KMF A;  2VWA A;  3RIU C;  4ZI2 C;  3A5X A;  2ES0 A;  2LOS A;  2YN6 A;  2XPK A;  3UU3 A;  4CQI A;  2VQF T;  5ABE A;  3C50 A;  3P4S A;  3CX8 B;  4ILB A;  4OFZ A;  5A1L A;  3RKO A;  1QLB A;  5J0Z A;  2B1E A;  2VKO A;  1FIO A;  3JAF A;  2BG9 E;  4AKI A;  3EDU A;  1WR6 A;  2CMR A;  2FJB A;  3PJA A;  2WP9 A;  4WNK A;  3IHR A;  2X9H A;  4IHJ E;  5FXW A;  4DMV A;  4JV5 T;  1I6Z A;  3IF8 B;  3S4U A;  4YJ3 E;  3RIF A;  3N9Q A;  2XQ5 A;  2HPJ A;  2Q9Q B;  2W62 A;  4ZXL A;  4AKR B;  5JDM A;  4LF9 T;  1WYB A;  4G2A A;  4LML A;  4H9O C;  4UEL A;  1OED C;  2N2N A;  2YDS A;  2V7I A;  3ONL C;  4UEM A;  4WW0 A;  2DHR A;  2CBJ A;  3DTO A;  2E8I A;  2DCF A;  3N9N A;  2D5U A;  2V7J A;  2CA5 A;  4ILA A;  2H7O A;  2IW5 B;  3T8O A;  1IBK T;  3ZN0 B;  1MIW A;  1WYC A;  2YEV C;  2IIU A;  2PG8 A;  1VCS A;  2DWG A;  4HFV A;  4HE8 A;  3ZMS B;  4CXY A;  5FP3 A;  3B13 A;  3HKC E;  3N9O A;  2NTY A;  4P0A A;  4X65 T;  3T1Y T;  2XQA A;  4DV0 T;  3HR0 A;  4IDN A;  2I0M A;  4XBF B;  4O8S A;  2I59 A;  3MZK B;  3KVA A;  1U5P A;  4ASK A;  1MND A;  1UX4 A;  4HGA A;  3AA0 B;  4IDO A;  4KI0 F;  5JDH A;  5LGN B;  3F2E A;  2KND A;  5ABF A;  2UU9 T;  2MTQ A;  1J5E T;  2V6X A;  3KIN B;  3HA4 A;  3SS1 A;  2KSR A;  2LKG A;  3JAD A;  4KBM B;  2BZB A;  3I1A A;  3LBX B;  3O4X E;  5HAX A;  3UUM A;  3LK2 B;  4CXX A;  2KZ7 B;  3PUS A;  4IL9 A;  2X0H A;  2VQE T;  4DV7 T;  4AIU A;  5M4Y A;  2UUB T;  3CKD A;  3ZT5 A;  3RKG A;  4YSZ A;  3NVO A;  5LJN A;  2CHO A;  2L3L A;  2V1D B;  3U78 A;  2VKH A;  3FXE B;  4ZHQ E;  4TWD A;  3A7M A;  2E5V A;  3JCF A;  1B7T A;  1MIY A;  4C90 A;  5C8Y E;  2QGS A;  1NEK A;  4JYA T;  3UT5 E;  1I94 T;  4XZC A;  4XAX B;  2E5L T;  3CX6 B;  2LSI A;  4B3S T;  2EHO C; 
#chains in the Genus database with same CATH homology
 5HXC A;  3PU8 A;  3AA6 B;  4DBQ A;  2ZMA A;  1YD8 G;  3KFW X;  3DJB A;  1D1A A;  2V26 A;  1MIV A;  3ZC1 A;  4AQG A;  4I55 E;  4JEU B;  4EB6 E;  2XAS B;  5GON E;  1OXZ A;  1ZV4 X;  3AAE B;  4G63 A;  3ZN1 B;  2XHE B;  4PK5 A;  4O4J E;  1HF8 A;  5CA1 E;  2BVL A;  1D0Y A;  2Q9Q A;  4HGA A;  1H7C A;  4B6X A;  2D0T A;  5JRC A;  4ERR A;  5FXV A;  4IIJ E;  4YFS A;  3ZYL A;  2MYS A;  2GK9 A;  5EZY E;  2LHR A;  5BMV E;  3VHL A;  4PW8 A;  3ZMT B;  5E0O A;  4QX8 B;  3O9X A;  2NP9 A;  3P8C D;  2CE7 A;  2ZM2 A;  3GA8 A;  3IBP A;  4AKL A;  2L8K A;  3HI2 A;  4IE5 A;  3EUH A;  3IEE A;  3FBL A;  2PJQ A;  2LOP A;  4QXB B;  2Z6E A;  3WAK A;  2UXX B;  3ZJ1 A;  2X9X A;  3CQC B;  2QA7 A;  3NBX X;  2LE8 A;  2MOZ A;  3PUG A;  3ZPO A;  5LCY A;  3O1H A;  1FMV A;  3KBU A;  3ZJ2 A;  3C4Z A;  2A2F X;  3ZYM A;  3KVB A;  1HG5 A;  2Y6X A;  4O4L E;  4YLH A;  4DND A;  4IGU A;  1CUN A;  3JC6 C;  4I50 E;  4GK5 E;  2KIN B;  3ESL A;  4PJN A;  3PE0 A;  1MMG A;  5H6Q B;  3HKB E;  2W61 A;  2NW9 A;  1US7 B;  2UXN B;  4ZI3 C;  1UCU A;  1YKH B;  4FJO A;  3C98 B;  4IE7 A;  5JRE A;  1LVK A;  2XAF B;  2CEA A;  5HXR A;  3N2O A;  3ZCJ A;  3SOL A;  2CM0 A;  2X51 A;  4YHJ A;  3OKQ A;  3BK9 A;  4IE4 A;  5FY7 A;  2WAU A;  2IAK A;  2X68 A;  2XAG B;  5EK4 A;  3KDS E;  2KWH A;  4UF0 A;  3EDV A;  3OJA A;  3ZLI A;  4ZOL E;  2XTL A;  5HWY A;  3MAC A;  5LP6 E;  4H9S E;  2VKD A;  2WWU A;  1QSD A;  4UV9 B;  5F8P A;  4H9R C;  4PJM A;  3RYF E;  4NUU A;  3LK3 B;  3O1I A;  4JEH B;  3PU3 A;  2OA5 A;  2NWB A;  3Q9D A;  4P0B A;  4UV8 B;  3RRW A;  1HFA A;  4CI3 B;  4L9I A;  4CI1 B;  3FBZ A;  5JVD E;  3BQL A;  3J7Y q;  2KT9 A;  3MJX A;  2C5J A;  4TV8 E;  4UF0 B;  2V7K A;  5FNV E;  3V5U A;  3VKG A;  5F3J A;  2LJL A;  5DQW A;  4ZI2 D;  4EYY R;  2E9X C;  2G0U A;  4ZS3 A;  3N9P A;  4IDZ A;  4PFO A;  4ANJ A;  2XAQ B;  1IJ6 A;  3RC8 A;  2D0U A;  4MFR A;  1V9D A;  3PDY A;  4L5G A;  1KK7 A;  3N5L A;  3U3I A;  2LM9 A;  2X66 A;  4EZ4 A;  2K48 A;  3C51 A;  3FXD B;  1G73 A;  1QUU A;  3EVY A;  3UUN A;  1BR2 A;  2EHO B;  2YIN A;  2NOX A;  4I43 B;  1HG2 A;  2Y48 B;  3I9W A;  3WAJ A;  3AAA B;  3JC6 D;  2VAS A;  2H7V C;  2X0L B;  1WLX A;  1MMD A;  3C4W A;  3ZYK A;  4UVC B;  5JDN A;  5JH7 E;  4KP3 C;  4X1Y E;  5JR9 B;  2IC9 A;  4CZZ B;  2CXD A;  2JPF A;  3UUX B;  4JLE A;  5FMN A;  2A72 A;  3NZP A;  5LHI B;  3AB3 B;  5KX5 E;  2K24 A;  5HXE A;  4CI2 B;  1AJ3 A;  3ZCI A;  3C4X A;  4GK0 E;  3SWH A;  2LSG A;  1O3X A;  2D2S A;  3N9M A;  5L2L A;  2Q9Q D;  4MLK A;  5LOV E;  3L3P A;  3NZQ A;  5LA6 E;  5FXX A;  1NWM X;  2WM9 A;  1Z0P A;  3I9Y A;  3NRX A;  2W63 A;  3PUQ A;  5JR9 A;  3ZEF B;  4X20 E;  2HH7 A;  2KLQ A;  2WMN A;  2Q9Q C;  3M65 A;  4P09 A;  4PK6 A;  5LBM A;  2YU2 A;  2NW7 A;  2JQQ A;  4ZS2 A;  4OHF A;  2WSS V;  1YKE B;  5HXH A;  5JDL A;  4HN9 A;  3KV6 A;  2NTX A;  1MMN A;  4H63 V;  5H6R B;  5J1G A;  4I4T E;  4UVA B;  4PK4 A;  1UX5 A;  3MA9 A;  5DAB A;  4WBN E;  2EHO A;  5KDM C;  2CXL A;  3Q5W A;  3MXZ A;  3ZC0 A;  3OBV E;  1Y64 B;  3P7I A;  3CML A;  4HEA A;  4JUY A;  2JMH A;  2EHO D;  2YU1 A;  1T98 A;  3CWZ B;  2X9W A;  3LBX A;  1D0X A;  3CX7 B;  3RC3 A;  2PFV A;  4TN7 B;  3RH3 A;  3KV5 A;  3N2G E;  4CXW A;  2KWI B;  3AA7 B;  1BR0 A;  1IZN B;  3N2K E;  1BR1 A;  3GN5 B;  5CB4 E;  5L3E B;  3OYZ A;  2C5I T;  1MMA A;  3TKL B;  3BQK A;  1BR4 A;  1KNZ A;  5IYZ E;  4M1P A;  4AKH A;  3KV9 A;  3FHN A;  5LBQ B;  2JMK A;  3RRC A;  3AVR A;  2LSJ A;  2V7M A;  3ETV A;  3GN5 A;  3UUL A;  4ZI3 D;  1ZKE A;  4IE0 A;  4TX5 A;  2ODV A;  4H63 H;  4AQF A;  5DJQ C;  3F31 A;  4NUV A;  3QK6 A;  3HKE E;  4DVD A;  1YW0 A;  1S94 A;  5JDG A;  5LGT B;  1S35 A;  4O2B E;  4TUY E;  5LNK A;  4EAH A;  3RX6 A;  2JRK A;  5J2T E;  1E1H B;  2LT3 A;  1LRZ A;  3C64 A;  4QXH B;  1ZEE A;  5EK3 A;  2DWK A;  3W15 B;  3CPZ A;  2RA1 A;  3N9L A;  4QWN B;  1LKX A;  5LJM A;  2W0G A;  5L3D B;  3GWH A;  4IE6 A;  2KXP B;  1ZHC A;  2J1D G;  2XQY A;  2CXF A;  1FMW A;  2CWY A;  4F6R C;  4BA9 A;  3HKD E;  2L9Q A;  3AAI A;  3AA1 B;  4EYU A;  4GOU A;  4C91 A;  4EIW A;  4O2A E;  2K9A A;  4OYJ A;  5JR9 C;  3LG7 A;  5FY0 A;  4CXY A;  5CA0 E;  2M67 A;  1SA0 E;  4H9N C;  4E7Z A;  4OK0 A;  3QUJ A;  1MNE A;  3ANW B;  4DMW A;  4QHO A;  4AI6 A;  4MBQ A;  5L3C B;  4KUM B;  2BDE A;  2E9X A;  2ACX A;  3K3N A;  2N1G A;  2VKJ A;  3I0Q A;  5JRC B;  4Z8X A;  1FEW A;  2C5K T;  3OYX A;  3ETU A;  2CLY C;  4QXC B;  1D1B A;  5L3G B;  2SPC A;  2VB6 A;  2ODU A;  1VRB A;  2W00 A;  3D0T A;  1G8X A;  3VU7 H;  5FY1 A;  3F57 A;  5ADX L;  3MK7 C;  4H9Q C;  4IST A;  2DI4 A;  2N9D A;  4FI5 A;  4BJM A;  5JDF A;  3MKD A;  2C0S A;  4UVB B;  3CQX C;  3H3A A;  3NRY A;  2MBG A;  3ONX A;  4EXT A;  2DNX A;  4MHC A;  5FYM A;  4BJN A;  2LEH A;  3E22 E;  2CWO A;  5J2U E;  4ISS A;  5EK2 A;  5HXS A;  2RP4 A;  4J2C A;  3R84 B;  2E9X B;  4PFP A;  3FB2 A;  2WMO A;  4ADZ A;  3KV4 A;  3RYH E;  2ZM8 A;  5LHG B;  2K5B B;  1EZ3 A;  2CLY B;  2DLR A;  3CVR A;  4AQF C;  4DBR A;  4TV9 E;  4QX7 B;  4V1A v;  5HYA A;  3LFM A;  2IC6 A;  4MAL A;  3Q5X A;  5IHY A;  1VOM A;  5KMG P;  4A56 A;  3SRZ A;  4PAG A;  3R6N A;  5LHH B;  3ZMV B;  3RYI E;  4AXP A;  3RYC E;  4K0U A;  5L3B B;  4UXN B;  4PNI A;  5DQV A;  2VL8 A;  1HTJ F;  1NAF A;  3K3Q C;  1U4Q A;  4N78 D;  3RPU A;  2LSY A;  4EOZ B;  5L3F B;  3PUR A;  5HWX A;  3PTR B;  4E7S A;  2V7L A;  1IAP A;  2H3R A;  3L09 A;  2VK9 A;  1LVF A;  5LYJ E;  5TAO A;  3WI3 A;  2ZM0 A;  4HKA A;  2YK0 A;  3Q2M A;  4AKG A;  4U74 A;  4KMC A;  2ZLY A;  1WRD A;  4PJL A;  3DP7 A;  3LJC A;  2WBL A;  4PJJ A;  4UIG A;  3BQI A;  2X67 A;  4ILU A;  4WBO A;  3B57 A;  3UFE A;  4GYR A;  3E08 A;  3QC9 A;  3AVS A;  4GIW A;  5LGU B;  3CQG B;  3J9X 1;  2XAJ B;  2PBI A;  2BVM A;  3HL6 A;  4DO0 A;  4X1I E;  2LSK A;  1HS7 A;  4TZ4 C;  4YJ2 E;  5LXT E;  2CCQ A;  3I0O A;  3K3O A;  1SHZ C;  3VKH A;  4HTE A;  5FXZ A;  3PUA A;  3H37 A;  5ETW A;  2A3D A;  1IJ5 A;  2XUE A;  2Y8D A;  3UTK A;  3UT5 E;  4O4I E;  4U72 A;  2P9B A;  3LK4 2;  3GMI A;  4L0R A;  4OYK A;  3O1J A;  4EZH A;  5LG4 A;  1HCI A;  3ANW A;  1D0Z A;  2E9X D;  3KBT A;  2NW8 A;  5AFU L;  2XAH B;  4O4H E;  2X9Y A;  4H9P C;  5JQG E;  4BAY B;  4QKN A;  1X79 A;  2JJ9 A;  2LHN A;  4X1K E;  3ZMU B;  4GYS A;  1D1C A;  3V5S A;  2HPL A;  3E0Z A;  3K8P C;  1HX8 A;  1OWA A;  4ZI7 E;  2KMF A;  2VWA A;  4ZI2 C;  3A5X A;  2ES0 A;  2LOS A;  4CQI A;  3C50 A;  3CX8 B;  4OFZ A;  5A1L A;  3RKO A;  2B1E A;  2VKO A;  1FIO A;  4AKI A;  3EDU A;  1WR6 A;  2CMR A;  5FXW A;  4WNK A;  3IHR A;  2X9H A;  4IHJ E;  4DMV A;  3IF8 B;  3S4U A;  4YJ3 E;  3N9Q A;  2HPJ A;  2Q9Q B;  2W62 A;  4AKR B;  5JDM A;  1WYB A;  4G2A A;  4H9O C;  4UEL A;  2N2N A;  2V7I A;  4UEM A;  4WW0 A;  2DHR A;  3ZMZ B;  3DTO A;  2E8I A;  2DCF A;  3N9N A;  2D5U A;  2V7J A;  2CA5 A;  3T8O A;  2H7O A;  2IW5 B;  3ZN0 B;  1MIW A;  1WYC A;  2YEV C;  2PG8 A;  4HFV A;  2DWG A;  3ZMS B;  4HE8 A;  5FP3 A;  3B13 A;  3HKC E;  3N9O A;  2NTY A;  4P0A A;  3HR0 A;  4XBF B;  4O8S A;  2I59 A;  3MZK B;  3KVA A;  1U5P A;  4ASK A;  1MND A;  1UX4 A;  3AA0 B;  5LGN B;  5JDH A;  3F2E A;  2KND A;  2MTQ A;  3KIN B;  3HA4 A;  3SS1 A;  4KBM B;  3UUM A;  2BZB A;  3I1A A;  3LBX B;  3O4X E;  5HAX A;  4CXX A;  3LK2 B;  5JDQ A;  2KZ7 B;  3PUS A;  5M4Y A;  3CKD A;  5LJN A;  2L3L A;  3U78 A;  2V1D B;  2VKH A;  3FXE B;  4ZHQ E;  1B7T A;  1MIY A;  4C90 A;  5C8Y E;  2QGS A;  4XZC A;  4XAX B;  3CX6 B;  2LSI A;  2EHO C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...