1V9DA

Crystal structure of the core fh2 domain of mouse mdia1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
332
structure length
308
Chain Sequence
VKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLSFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Diaphanous protein homolog 1
publication title The core FH2 domain of diaphanous-related formins is an elongated actin binding protein that inhibits polymerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 120
structure length 308
sequence length 332
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA01
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA02
1UX4A 3O4XE 4EAHA 1V9DA 1UX5A 2J1DG 3OBVE 2Z6EA 1Y64B
chains in the Genus database with same CATH superfamily
3VKGA 3P4RA 4QXCB 1BR1A 1UGOA 4ILCA 5LG4A 3KV6A 5FYMA 2FJDA 4A97A 1KNRA 2X51A 3KINB 5AQKB 1XNRT 5FXVA 1XNQT 4ZI2C 2XY8B 3AE4A 4EZHA 4AXPA 4WYVA 5CJ5A 4KP3C 5FY0A 5LJNA 2EHOD 4O2BE 3AE1A 2CRBA 2CXLA 3EABA 4QX8B 4JI5T 2GK9A 4AKLA 4DMVA 4DV1T 4UVAB 3CK6A 1H7CA 2VQFT 3GN5A 4DR3T 4YFSA 1W09A 2CCQA 1U5PA 5FVKA 4QX7B 3B13A 2Y8DA 2V26A 5A1LA 4UF0B 4ZI7E 4LFAT 3SFDA 3OPCA 3VRBA 2MTQA 2M67A 2WDRA 2XHEB 3HI2A 1GQEA 4AKIA 2BS2A 2UUAT 2V5DA 3ZSSA 3VKHA 4JBWF 4HN9A 5JR9C 1S35A 4UEMA 5AQUB 5LGNB 5H6QB 3O4XE 5CB4E 4OFZA 3VRAA 2WM9A 2IUBA 3UFGA 3ZN1B 2FJEA 2DWKA 1V9DA 1VRBA 3SS1A 2VVSA 1N33T 3K3NA 4ZS2A 3AVSA 4TX5A 3PUGA 4YSZA 5ABGA 4I55E 2KINB 4AISA 3IEEA 3ZJ1A 2DNXA 2H7OA 2R6GF 4KBMB 3BK9A 3P7IA 2NW7A 3N9QA 3AXJA 1J1JA 5IWAT 4GK0E 3ZC0A 4IDZA 3UU5A 1OEDB 4TWDA 5HEHA 1IJ6A 3LSVA 1MIVA 3AE5A 3FXDB 2QGSA 3MXZA 3PTRB 5LJMA 4DR2T 1YKEB 4B3RT 2AE9A 1XMOT 3JADA 3SWHA 3X1DA 4PJJA 4E7SA 5DJQC 3U78A 4U7YA 4DV2T 4IE7A 2L3LA 4L9IA 4QXBB 4HWFA 3RYCE 5JDLA 3C64A 1OEDE 4HFHA 4HWIB 4IREA 3UU3A 4HFIA 5LHHB 2QYWA 3ZEFB 2FJAA 3LK42 5BR8T 3V5UA 1FIOA 4Z8XA 2LSJA 3KFWX 3UQ4A 2C0SA 1HCIA 3EVYA 3OYXA 2XAQB 3ZYLA 1OWAA 3LK3B 4IIJE 2D0UA 2Y48B 3UQ7A 3FBLA 3ONLC 5JREA 4DBRA 3PUWF 4HFDA 5CGMA 2NW9A 4OYKA 4DVDA 4ZOLE 4X65T 5KDMC 2JQ9A 1W9RA 3RKGA 3AEEA 2ES0A 1HX1B 5HEGA 2IDOB 3QUJA 4U2YA 5EK2A 4IE0A 2UUBT 3TLUA 2FBWA 3UFEA 3RQUA 2BG9A 2VK9A 3DTOA 2JQQA 5JDHA 2YDRA 2C5JA 3VR8A 5L3CB 3SOLA 2KMFA 2E9XA 3VU7H 4WBOA 2N1GA 1WYCA 3PV0F 3E08A 4ZXLA 3IBPA 4QWNB 3CX7B 5LCYA 2BVLA 2H7VC 3HR0A 5FXZA 2QRXA 3AE2A 5HWYA 5HXSA 4DV6T 1IZNB 4IT4A 1MMAA 4QXHB 4X20E 2E5LT 4COFA 3N9OA 3FHNA 2FJBA 2I0MA 1UK5A 2PFVA 3A5XA 2A72A 4TUYE 3AA1B 3BQIA 4ZI3C 3RLFF 2JPFA 2V7MA 3AEAA 2BG9B 3ONXA 4CXYA 2J1DG 5JRCB 2L9QA 1HTJF 1FMWA 2X9YA 2ZM0A 4QHOA 3OKQA 1HFAA 4ZS3A 3KBTA 3P4QA 4NUVA 2V6YB 1EZ3A 3L09A 4TV8E 3T8OA 2BKPA 4HTEA 3ZYMA 3AE7A 5F5WA 4O4HE 3RYFE 2DLRA 5L2LA 2LKGA 4HEAA 3FZHB 5FXXA 4MFRA 3ZMUB 3RGLA 4HWDA 4UVCB 1UUSA 3MA9A 4DR7T 1IAPA 5AQLB 1UX5A 1SA0E 5L47A 2MOZA 2YU1A 2ODVA 2D5UA 3CX8B 2Q9QD 3AE6A 1N34T 3B5MA 3QB5A 4UELA 2XQ8A 3EDUA 2I59A 4DV5T 3EAMA 1NAFA 3ANWB 3KDSE 4QH5A 4IE6A 1T8BA 4HFVA 3ZC1A 3HKDE 4GKJT 5HEUA 2Y6XA 4ISTA 2LJLA 4YY3T 4ZI3D 2UXNB 4H63V 4LMLA 1LRZA 4FJOA 2CMRA 1US7B 4UIGA 2YDSA 5LNKA 3M3ZB 5L4HA 2X0HA 3OJAA 4PK6A 1LKXA 2CBIA 4HFCA 4OX9T 3GWHA 5C2TA 5J1GA 1XMQT 5LG3A 4LF8T 3AE3A 2VASA 3Q9DA 3AECA 3RRCA 4CQIA 2NWBA 1ZOYA 2EHOB 3ETVA 3HKCE 1UCUA 3D0TA 3UU6A 3IHRA 5JDQA 3QOFA 2H89A 1QUUA 3VHLA 4LF6T 5JDFA 2XASB 1U4QA 2EHOC 2W63A 5JDNA 3TLWA 5KX5E 4L5GA 2X9XA 3RC8A 1AJ3A 2X9WA 3PJAA 2XQ9A 5HCMA 3CMLA 2W2UA 2E9XD 1X79A 2J4GA 4I50E 1I94T 1YXRA 1E2AA 1T7SA 4EYUA 2F4VT 4JEUB 3ZT5A 2CA5A 2WBLA 2LOPA 4LF7T 2J62A 5LXTE 2NTYA 5FL1A 1WYBA 4JI6T 2XQ3A 2IW5B 2XSAA 3C51A 3RIUC 5AQNB 4IDPA 4UF0A 4X1YE 1QLBA 3QK6A 4NPPA 3CQXC 5KMGP 4IE5A 4DV0T 4PAGA 2JQHA 3AEFA 2VKHA 2YEVC 5JR9A 2CWOA 4CN6A 3C50A 2XQ4A 2CM0A 5BMVE 5JH7E 3MKDA 3FZKB 5LA6E 3OYZA 1SE7A 3L39A 2D0TA 4G63A 4O4LE 4H9PC 5HXRA 3Q5XA 5H6RB 5AQOB 4ANJA 2W66A 2WWUA 4YTNA 2LHNA 4CN1A 2JIWA 2X9HA 5HYAA 3KVBA 1T72A 4P0BA 2WAUA 5HXEA 3FZFB 3LBXB 4EB6E 4X5TA 1XDOA 2ZM2A 5JTGA 5IYZE 4B6XA 1HF8A 5DQVA 2LHRA 2XQYA 4YSXA 1J5WA 3AA7B 2BZBA 4WZXA 5L4EA 3PUQA 2VWAA 4A98A 1OEDA 5JR9B 2CHOA 4B3TT 4CZZB 2WZIA 3U3IA 1VCSA 2ZM8A 3QC9A 3GA8A 5FNVE 4JYAT 4KHPT 5FXWA 3RQWA 3LK2B 3R84B 3UT5E 3ZCIA 2LT3A 1B7TA 2CXDA 5EZYE 3NVOA 1E1HB 4DUYT 3FXEB 4UVBB 4IE4A 3NBXX 3Q5EA 1YQ3A 4GYRA 2PBIA 5AFUL 1E7PA 3UUMA 3HKBE 2E5VA 1M7KA 2AXDS 3RPUA 4U2ZA 3GMIA 3RX6A 4AQFC 3NKZA 2BBHA 3L3PA 2Z6EA 2LSYA 3TKLB 2DI4A 5FP3A 2V7IA 5JVDE 4WW0A 2YK0A 4PJMA 3AEGA 2P9BA 1MMGA 4WBNE 5CA1E 2BVMA 4P1NA 1N32T 3N9LA 5ABFA 4NXMT 2PJQA 3N2OA 4DMWA 2LM9A 1HNXT 4DR1T 5FL0A 2N2NA 2IC6A 3ZT6A 4PFOA 3ZYKA 2CPTA 4DUZT 4U31A 2VQET 3NRYA 2KWHA 3DJBA 2UXDT 3KV5A 4JI1T 3ESLA 5C3JA 3PU8A 4YTMA 5FY7A 2WB5A 2DHRA 4O4IE 3CQCB 3C4WA 3RHWA 3CX6B 3UUNA 2UXCT 2BBJA 5E0OA 2W00A 2N9DA 3JCFA 4DNDA 5L3FB 4Z90A 3RI5A 3AAEB 1JNZA 3PU3A 2XAJB 2LEHA 1OXZA 2MPKA 4H9RC 2WMNA 4EEBA 2LOSA 4IHJE 5KXJA 3WI3A 2UXBT 3P4SA 2W0GA 4CI1B 5ABFB 2X67A 2PG8A 3G06A 3FB2A 4TWFA 4ZHQE 2RPAA 3LG7A 1HG5A 4NXNT 1D0ZA 3OBVE 3NZQA 3FZLB 3AEBA 2CEAA 3C4XA 5JRCA 2NR4A 1WCRA 4YHJA 4C91A 2X0LB 4EGWA 1G8XA 2V6YA 1T98A 3EHZA 3PUZF 2Q9QB 3ZKRA 4K0KT 2WMOA 2YN6A 3CVRA 3JC6D 2OA5A 4U3CA 2Q9QC 1NENA 3RYHE 4PFPA 5AQQB 3AE9A 4ASKA 3KV9A 4F6RC 1ZV4X 1UURA 5AQHB 3L8RA 2XJ7A 1DU2A 5F8PA 5L3EB 5HWXA 2XZEA 5LYJE 2G0UA 4TWHA 3O1JA 1SUMB 3P8CD 2I6HA 4BJNA 3KVAA 2WWVA 2IMLA 1M62A 4X66T 3ANWA 3V5SA 4EV6A 2E2AA 4EAHA 2QA7A 3AE8A 3N9PA 5JQGE 3ABVA 4HFBA 1IBLT 4CN4A 4MHCA 4I4TE 3C98B 4CXXA 3NWIA 2HN1A 4M1PA 4BA9A 3SFEA 5LBQB 5AQJB 4ADZA 2VVNA 4QH4A 5J2TE 1YKHB 5FY1A 5ETWA 2UXXB 5LHIB 2LSKA 3EDVA 4B3ST 5CA0E 3AVRA 3F2EA 1NEKA 3PUAA 2EHOA 4IL4A 2MAWA 2BDEA 4GK5E 2A9UA 5J0ZA 1MMNA 2E9XC 2NTXA 3A7MA 1L0VA 2KZ7B 5DQWA 2V7KA 4PK5A 3UU8A 4LF5T 5L3DB 2ZMAA 1D0YA 4A5XA 5EK4A 3ZMVB 1XDPA 4ILUA 1D1AA 4KHZF 3A8YC 5LGTB 2HH7A 1Z8UA 3ZCJA 3H3AA 1JNRA 2BKOA 5C8YE 5ABEA 4U33A 4X64T 2V8SV 4LMJA 1NWMX 4KMCA 5LMUT 3O1IA 1IJ5A 3O9XA 2LRLA 4JV5T 2V1DB 2CHNA 3N9NA 4LFCT 2VKDA 1KFYA 3AAIA 1LVFA 4DR4T 5HCJA 3ZLIA 3HA4A 1J5ET 2K5BB 3CWZB 2A2FX 2XPKA 5ADXL 4X1IE 2ZLYA 3NZPA 1KF6A 5LMNT 4Z91A 4AI6A 1R8IA 4IDOA 3AAAB 4BJMA 5F3JA 2YU2A 4XBFB 3H37A 2YKSA 4HKAA 1MIWA 2JJ9A 1O3XA 3N2GE 3AA0B 1HX8A 2XQAA 2OV9A 4E7ZA 2HPLA 2L8KA 5JDGA 5LB7B 3ETUA 4FI5A 5AQTB 4YLHA 2VKJA 2IHR1 5GONE 2C5IT 4UV9B 4TV9E 1WR0A 3ZMTB 4XZCA 3LBXA 4DV7T 3Q5WA 2CLYB 3AB3B 5M4YA 3OVUA 4CI3B 4TZ4C 4JI3T 1D0XA 2K48A 4CI2B 3ZSTA 5IHYA 2CLYC 1N36T 1KNZA 3N9MA 4LFBT 2M6IA 4H9OC 2YDQA 4OYJA 3I9WA 4ZZBA 2K3WA 3VR9A 4X1KE 4C90A 1HNWT 4EOZB 4EIWA 2H88A 3HL6A 4ILAA 4OHFA 3ZMSB 3P50A 2CXFA 5LP6E 4P0AA 4MLKA 4AQFA 4GYSA 5HXHA 2OLTA 3PDYA 2XM2A 2ODUA 3MACA 2VL8A 1LVKA 4DV3T 2D9DA 2IAKA 1BR4A 2HN2A 4XAXB 3KBUA 1BR0A 1MIYA 1W0AA 3E0ZA 2W61A 5CFBA 3SRZA 3I0QA 3RRWA 4ERRA 1KK7A 3MK7C 2CBJA 3R6NA 4O2AE 4ILBA 4JI7T 4ISSA 3PURA 4EXTA 4TNVA 3JAFA 3AEDA 5AQFB 1HNZT 3TLVA 2V6XA 2KNDA 1Y64B 4EYYR 4GOUA 2D2SA 4O4JE 1KNPA 4A56A 1FJGT 5AQPB 3RF1A 3ZMZB 5AQGB 1HR0T 2XAFB 2PTFA 4YXDA 4QH1A 2QVAA 1HS7A 1VOMA 1MNDA 2WDQA 3I0OA 3AA6B 5L3GB 3F57A 5AQMB 3T1YT 4AQYT 3UU4A 4ZI2D 2KSRA 3GN5B 1D1BA 4AIUA 2WU2A 4DR6T 1XZYA 4YJ3E 1S94A 4NUUA 1G73A 4HGAA 4OK0A 1MNEA 3MJXA 4U7IA 3QNUA 1WRDA 2H3RA 4GKKT 3J7Yq 4JI0T 3RKOA 4JUYA 3PUYF 2WY2A 3CPZA 2X0YA 2WS3A 4N78D 1OEDC 3TLTA 2VURA 1Y01A 1YD8G 3JC6C 2E8IA 2LSIA 1CUNA 3ONJA 2KWIB 2RP4A 2VKOA 3K3OA 2Q9QA 4Q25A 3CIRA 2V7JA 2JMKA 3K8PC 4U74A 2WQYA 1D1CA 3PUVF 2CE7A 2XSBA 3NRXA 4EZ4A 5J2UE 3CKDA 3Q5DA 1UX4A 1WFDA 3BQKA 3FBZA 2W62A 1I6ZA 1VCTA 2VB6A 4IGUA 5LHGB 2IC9A 2XQ5A 2K9AA 2C5KT 2YINA 1HG2A 3AXJB 3PUXF 3ZN0B 4CXWA 3O1HA 3LFMA 3P4WA 1ZKEA 4YHHT 2XQ7A 3MZKB 2XAGB 3JAEA 3FZMB 1CHUA 4H63H 3LJCA 4GIWA 4JI4T 4ZEYA 4TNWA 4P09A 4PJNA 1FEWA 2M6BA 2FUPA 2SPCA 4TN7B 3N5LA 4JEHB 1WR6A 4LF9T 5AQSB 4DBQA 5LOVE 1X9BA 5HEJA 4KX6A 4JI8T 4V1Av 5FKYA 2RA1A 4UR9A 2V5CA 4I0UA 4ZZCA 5AQIB 3KV4A 3UULA 4HE8A 2LLYA 3BQLA 2XAHB 3W15B 3Q2MA 4B3MT 5EK3A 2BKNA 1QSDA 2KLQA 2IIUA 5L3BB 4AKRB 2XQ6A 4YT0A 4PJLA 5DABA 2HHHT 4KUMB 3K1SA 2HPJA 1KEYA 2LSGA 3UUXB 1IBMT 4HWCA 3I1AA 3S4UA 3K3QC 3UTKA 2UU9T 3C4ZA 3WAKA 2WZHA 2X66A 3ZJ2A 3WAJA 2V7LA 4I43B 3B57A 3ZPOA 4PW8A 4X62T 5LGUB 2CWYA 2WU5A 4MALA 1W0BA 1BR2A 3HKEE 2K24A 2W67A 2A3DA 4MBQA 1FMVA 5AQVB 5ABHA 2X68A 2BG9C 3P4PA 2XTLA 3PJAJ 4F8HA 2E9XB 2ZM6T 3EI0A 3QB5K 1XWMA 3E22E 5HAXA 4PK4A 2BG9E 2J47A 5TAOA 2WCAA 4IL9A 4DV4T 4WNKA 2JMHA 4AKGA 2UUCT 1Z0PA 2VL0A 2LM2A 4UV8B 3IA3A 1ZP0A 2NP9A 2B1EA 1ZEEA 3RH3A 4AQGA 2JQKA 3OTOT 4QKNA 4EEDA 3RIUA 4DIDB 4JLEA 5FVLA 4DR5T 4JI2T 1IBKT 3PE0A 2NW8A 3IF8B 2KT9A 3J9X1 2NOXA 4DO0A 3M65A 2MYSA 4H9NC 3N2KE 1YQ4A 4AKHA 2DWGA 4IDNA 2LKHA 2B76A 3DP7A 4BAYB 2BS3A 4H9QC 3UUBA 1MMDA 4J2CA 2ACXA 3RYIE 1YW0A 3I9YA 4O8SA 4IDQA 4K0UA 2DCFA 2MBGA 4H9SE 2JRKA 4HWHA 3T1HT 4L0RA 4NIQA 3TLSA 3PUSA 4YTPA 5FMNA 2DL1A 3LDQB 3ZT7A 2YOEA 2LE8A 1ZHCA 5HXCA 3H3MA 2BS4A 3RIAA 5IUXA 3CQGB 4LF4T 2W4XA 4LMKA 1SHZC 3RIFA 2XUEA 4UXNB 4KI0F 5LBMA 2KXPB 4U72A 2WDVA 1WLXA 4HFEA 4YSYA 2ACZA 2LRKA 5HEOA 3RC3A 5AQRB 2WP9A 2XM1A 3F31A 2WSSV 5JDMA 4G2AA 4PNIA 4YJ2E 3EUHA
chains in the Genus database with same CATH topology
2WMOA 3CVRA 3JC6D 3VKGA 4OK0A 1MNEA 4QXCB 3MJXA 2Y6XA 1BR1A 4ISTA 5LG4A 1WRDA 2LJLA 2OA5A 3KV6A 5FYMA 2H3RA 4ZI3D 2Q9QC 2UXNB 2X51A 3J7Yq 3RYHE 4PFPA 3KINB 3RKOA 4H63V 5FXVA 4JUYA 1LRZA 4FJOA 4ASKA 4ZI2C 3KV9A 2CMRA 4EZHA 4F6RC 1ZV4X 3CPZA 4AXPA 1US7B 4KP3C 4UIGA 5FY0A 5LJNA 2EHOD 4N78D 5LNKA 4O2BE 3OJAA 4PK6A 5F8PA 1LKXA 5L3EB 2CXLA 5HWXA 3GWHA 1YD8G 5J1GA 5LYJE 2G0UA 3JC6C 4QX8B 2GK9A 4AKLA 3O1JA 3P8CD 4BJNA 2E8IA 4DMVA 4UVAB 2VASA 4HGAA 3Q9DA 3KVAA 1H7CA 2LSIA 1CUNA 3ANWA 2KWIB 3GN5A 3RRCA 2NWBA 2RP4A 4YFSA 2EHOB 3V5SA 4CQIA 3ETVA 3HKCE 2VKOA 4EAHA 1UCUA 2QA7A 3K3OA 2CCQA 1U5PA 2Q9QA 3D0TA 3N9PA 3IHRA 4QX7B 5JQGE 3B13A 2Y8DA 2V7JA 2V26A 5JDQA 2JMKA 3K8PC 5A1LA 4MHCA 4UF0B 4ZI7E 1QUUA 3VHLA 4U74A 4I4TE 2MTQA 3C98B 5JDFA 2XASB 1U4QA 2EHOC 2W63A 2M67A 4CXXA 5JDNA 1D1CA 2CE7A 5KX5E 4L5GA 4M1PA 2X9XA 3RC8A 3NRXA 1AJ3A 2X9WA 4EZ4A 2XHEB 4BA9A 5J2UE 3CKDA 5LBQB 3HI2A 3CMLA 4AKIA 1UX4A 3BQKA 3FBZA 2E9XD 1X79A 2W62A 4ADZA 2VB6A 4I50E 3VKHA 4IGUA 5J2TE 5LHGB 2IC9A 1YKHB 2K9AA 2C5KT 2YINA 1HG2A 5FY1A 4HN9A 5JR9C 3ZN0B 4EYUA 4CXWA 3O1HA 4JEUB 5ETWA 1S35A 2CA5A 2WBLA 2UXXB 2LOPA 3LFMA 5LHIB 2LSKA 1ZKEA 4UEMA 3EDVA 5LXTE 3MZKB 5CA0E 2XAGB 3AVRA 2NTYA 3F2EA 3PUAA 5LGNB 1WYBA 3O4XE 3LJCA 4H63H 2EHOA 4GIWA 4OFZA 5H6QB 5CB4E 3ZYLA 2WM9A 2BDEA 4GK5E 3ZN1B 2IW5B 1MMNA 2DWKA 2E9XC 1V9DA 4P09A 4PJNA 1FEWA 1VRBA 2NTXA 3C51A 3SS1A 4UF0A 2SPCA 4X1YE 3K3NA 4ZS2A 3AVSA 2KZ7B 4TN7B 3N5LA 4JEHB 1WR6A 3QK6A 5DQWA 4TX5A 3PUGA 2V7KA 3CQXC 5KMGP 4IE5A 4I55E 4PK5A 2KINB 4DBQA 4PAGA 5L3DB 2VKHA 2ZMAA 3IEEA 3ZJ1A 1D0YA 2DNXA 2YEVC 5LOVE 5JR9A 5EK4A 2H7OA 3ZMVB 2CWOA 4KBMB 4ILUA 3BK9A 3P7IA 3C50A 2NW7A 1D1AA 4V1Av 2RA1A 2CM0A 5BMVE 5JH7E 3MKDA 5LGTB 3N9QA 2HH7A 5LA6E 3OYZA 3ZCJA 4GK0E 3UULA 3KV4A 2D0TA 3H3AA 4HE8A 4G63A 4O4LE 3ZC0A 5C8YE 4H9PC 4IDZA 5HXRA 3Q5XA 5H6RB 3BQLA 1IJ6A 2XAHB 3W15B 1MIVA 1NWMX 3Q2MA 4ANJA 3FXDB 5EK3A 2QGSA 3MXZA 2KLQA 1QSDA 3O1IA 4KMCA 5L3BB 4AKRB 3PTRB 5LJMA 1YKEB 4PJLA 1IJ5A 3O9XA 5DABA 2WWUA 4KUMB 2V1DB 2HPJA 3N9NA 2VKDA 2LHNA 3SWHA 3AAIA 2LSGA 2X9HA 3UUXB 1LVFA 4PJJA 4E7SA 5HYAA 3ZLIA 3KVBA 4P0BA 5DJQC 3HA4A 3U78A 2K5BB 2WAUA 3CWZB 5HXEA 2A2FX 3LBXB 3I1AA 4EB6E 5ADXL 2ZM2A 2L3LA 4IE7A 4L9IA 4X1IE 2ZLYA 5IYZE 4QXBB 4B6XA 3NZPA 3RYCE 5JDLA 3S4UA 1HF8A 3K3QC 3UTKA 4AI6A 3C64A 5DQVA 2LHRA 2XQYA 3C4ZA 3AAAB 4BJMA 5F3JA 3WAKA 2YU2A 2X66A 3ZJ2A 3ZEFB 5LHHB 4XBFB 3LK42 3AA7B 2V7LA 4I43B 3H37A 2BZBA 1FIOA 3B57A 3V5UA 3WAJA 4Z8XA 4HKAA 2LSJA 3ZPOA 3PUQA 4PW8A 1MIWA 3KFWX 5LGUB 2C0SA 2VWAA 1HCIA 2JJ9A 3EVYA 1O3XA 5JR9B 4CZZB 2CWYA 3N2GE 3U3IA 3AA0B 4MALA 3OYXA 1BR2A 3HKEE 2XAQB 2K24A 2ZM8A 2A3DA 1OWAA 1HX8A 3QC9A 3LK3B 3GA8A 4IIJE 2D0UA 4MBQA 2Y48B 3FBLA 5FNVE 2HPLA 1FMVA 2L8KA 4E7ZA 5JDGA 5FXWA 3ETUA 4FI5A 5JREA 3LK2B 3R84B 3UT5E 2X68A 4DBRA 3ZCIA 2LT3A 2XTLA 4YLHA 2NW9A 4OYKA 4DVDA 1B7TA 2CXDA 2VKJA 4ZOLE 5EZYE 2E9XB 5GONE 1E1HB 2C5IT 5KDMC 4UV9B 4TV9E 3FXEB 3E22E 4UVBB 4IE4A 3ZMTB 4XZCA 3NBXX 5HAXA 3LBXA 4GYRA 3Q5WA 2ES0A 2PBIA 2CLYB 4PK4A 3AB3B 5M4YA 5AFUL 4CI3B 3QUJA 4TZ4C 3UUMA 5EK2A 1D0XA 4IE0A 3HKBE 2K48A 5TAOA 4CI2B 3UFEA 3RPUA 5IHYA 2CLYC 3GMIA 4WNKA 3RX6A 2JMHA 1KNZA 4AKGA 3N9MA 4AQFC 1Z0PA 3L3PA 4H9OC 4UV8B 2Z6EA 2VK9A 2LSYA 3DTOA 3TKLB 2JQQA 2DI4A 5FP3A 2V7IA 2NP9A 4OYJA 2B1EA 4WW0A 5JVDE 3I9WA 1ZEEA 5JDHA 2YK0A 4X1KE 4C90A 2C5JA 4PJMA 4EOZB 3RH3A 2P9BA 4EIWA 5L3CB 1MMGA 3SOLA 2KMFA 4AQGA 3HL6A 4WBNE 4QKNA 2E9XA 5CA1E 4OHFA 3ZMSB 3VU7H 2BVMA 4WBOA 2N1GA 1WYCA 3N9LA 4JLEA 2PJQA 2CXFA 3E08A 3N2OA 4DMWA 2LM9A 5LP6E 4P0AA 3PE0A 2NW8A 3IF8B 3IBPA 4MLKA 2N2NA 4QWNB 2IC6A 2KT9A 4PFOA 3CX7B 3J9X1 2NOXA 3ZYKA 4DO0A 4AQFA 4GYSA 5LCYA 5HXHA 3M65A 2BVLA 2MYSA 2H7VC 4H9NC 3N2KE 3HR0A 3PDYA 5FXZA 2ODUA 3MACA 2VL8A 1LVKA 3NRYA 5HWYA 5HXSA 4AKHA 2KWHA 3DJBA 2DWGA 3KV5A 1IZNB 1MMAA 4QXHB 3DP7A 4X20E 4BAYB 3N9OA 3ESLA 3FHNA 3PU8A 5FY7A 2IAKA 1BR4A 2DHRA 4H9QC 4XAXB 4O4IE 3KBUA 3CQCB 3C4WA 1BR0A 1MIYA 2PFVA 1MMDA 4J2CA 3A5XA 2ACXA 3RYIE 2A72A 3CX6B 1YW0A 4TUYE 3UUNA 3I9YA 5E0OA 3AA1B 3BQIA 2W00A 4ZI3C 2N9DA 3E0ZA 4O8SA 2W61A 4K0UA 4DNDA 2DCFA 2JPFA 5L3FB 2V7MA 3ONXA 3SRZA 2MBGA 4H9SE 4CXYA 3AAEB 2J1DG 3I0QA 3PU3A 5JRCB 2L9QA 2JRKA 1HTJF 1FMWA 2X9YA 2XAJB 4L0RA 3RRWA 2ZM0A 2LEHA 1OXZA 4ERRA 3PUSA 1KK7A 3MK7C 4H9RC 5FMNA 2WMNA 2LOSA 3R6NA 4IHJE 4QHOA 3OKQA 4O2AE 1HFAA 4ZS3A 3WI3A 3KBTA 4NUVA 1EZ3A 3L09A 2LE8A 1ZHCA 4TV8E 2W0GA 4ISSA 5HXCA 3T8OA 3PURA 4EXTA 4CI1B 2X67A 3CQGB 4HTEA 2KNDA 2PG8A 3ZYMA 1Y64B 4EYYR 4GOUA 4O4HE 3RYFE 1SHZC 2D2SA 2XUEA 2DLRA 4O4JE 4UXNB 5L2LA 4HEAA 4A56A 3FB2A 4ZHQE 5FXXA 5LBMA 3ZMZB 3LG7A 4MFRA 1HG5A 2KXPB 4U72A 3ZMUB 1WLXA 4UVCB 2XAFB 3MA9A 1D0ZA 1IAPA 3OBVE 3NZQA 1HS7A 1VOMA 1UX5A 1MNDA 1SA0E 3I0OA 2MOZA 2CEAA 2YU1A 3C4XA 2ODVA 3AA6B 2D5UA 5JRCA 3CX8B 2Q9QD 5L3GB 3RC3A 3F57A 4YHJA 4UELA 3EDUA 2I59A 4C91A 4ZI2D 1NAFA 2X0LB 3ANWB 1D1BA 2WSSV 3F31A 3GN5B 3KDSE 4IE6A 5JDMA 4HFVA 3ZC1A 1G8XA 4G2AA 1T98A 2Q9QB 4PNIA 3HKDE 4YJ2E 4YJ3E 1S94A 4NUUA 1G73A 3EUHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UX4 A;  3O4X E;  4EAH A;  1V9D A;  1UX5 A;  2J1D G;  3OBV E;  2Z6E A;  1Y64 B; 
#chains in the Genus database with same CATH topology
 3VKG A;  3P4R A;  4QXC B;  1BR1 A;  1UGO A;  4ILC A;  5LG4 A;  3KV6 A;  5FYM A;  2FJD A;  4A97 A;  1KNR A;  2X51 A;  3KIN B;  5AQK B;  1XNR T;  5FXV A;  1XNQ T;  4ZI2 C;  2XY8 B;  3AE4 A;  4EZH A;  4AXP A;  4WYV A;  5CJ5 A;  4KP3 C;  5FY0 A;  5LJN A;  2EHO D;  4O2B E;  3AE1 A;  2CRB A;  2CXL A;  3EAB A;  4QX8 B;  4JI5 T;  2GK9 A;  4AKL A;  4DMV A;  4DV1 T;  4UVA B;  3CK6 A;  1H7C A;  2VQF T;  3GN5 A;  4DR3 T;  4YFS A;  1W09 A;  2CCQ A;  1U5P A;  5FVK A;  4QX7 B;  3B13 A;  2Y8D A;  2V26 A;  5A1L A;  4UF0 B;  4ZI7 E;  4LFA T;  3SFD A;  3OPC A;  3VRB A;  2MTQ A;  2M67 A;  2WDR A;  2XHE B;  3HI2 A;  1GQE A;  4AKI A;  2BS2 A;  2UUA T;  2V5D A;  3ZSS A;  3VKH A;  4JBW F;  4HN9 A;  5JR9 C;  1S35 A;  4UEM A;  5AQU B;  5LGN B;  5H6Q B;  3O4X E;  5CB4 E;  4OFZ A;  3VRA A;  2WM9 A;  2IUB A;  3UFG A;  3ZN1 B;  2FJE A;  2DWK A;  1V9D A;  1VRB A;  3SS1 A;  2VVS A;  1N33 T;  3K3N A;  4ZS2 A;  3AVS A;  4TX5 A;  3PUG A;  4YSZ A;  5ABG A;  4I55 E;  2KIN B;  4AIS A;  3IEE A;  3ZJ1 A;  2DNX A;  2H7O A;  2R6G F;  4KBM B;  3BK9 A;  3P7I A;  2NW7 A;  3N9Q A;  3AXJ A;  1J1J A;  5IWA T;  4GK0 E;  3ZC0 A;  4IDZ A;  3UU5 A;  1OED B;  4TWD A;  5HEH A;  1IJ6 A;  3LSV A;  1MIV A;  3AE5 A;  3FXD B;  2QGS A;  3MXZ A;  3PTR B;  5LJM A;  4DR2 T;  1YKE B;  4B3R T;  2AE9 A;  1XMO T;  3JAD A;  3SWH A;  3X1D A;  4PJJ A;  4E7S A;  5DJQ C;  3U78 A;  4U7Y A;  4DV2 T;  4IE7 A;  2L3L A;  4L9I A;  4QXB B;  4HWF A;  3RYC E;  5JDL A;  3C64 A;  1OED E;  4HFH A;  4HWI B;  4IRE A;  3UU3 A;  4HFI A;  5LHH B;  2QYW A;  3ZEF B;  2FJA A;  3LK4 2;  5BR8 T;  3V5U A;  1FIO A;  4Z8X A;  2LSJ A;  3KFW X;  3UQ4 A;  2C0S A;  1HCI A;  3EVY A;  3OYX A;  2XAQ B;  3ZYL A;  1OWA A;  3LK3 B;  4IIJ E;  2D0U A;  2Y48 B;  3UQ7 A;  3FBL A;  3ONL C;  5JRE A;  4DBR A;  3PUW F;  4HFD A;  5CGM A;  2NW9 A;  4OYK A;  4DVD A;  4ZOL E;  4X65 T;  5KDM C;  2JQ9 A;  1W9R A;  3RKG A;  3AEE A;  2ES0 A;  1HX1 B;  5HEG A;  2IDO B;  3QUJ A;  4U2Y A;  5EK2 A;  4IE0 A;  2UUB T;  3TLU A;  2FBW A;  3UFE A;  3RQU A;  2BG9 A;  2VK9 A;  3DTO A;  2JQQ A;  5JDH A;  2YDR A;  2C5J A;  3VR8 A;  5L3C B;  3SOL A;  2KMF A;  2E9X A;  3VU7 H;  4WBO A;  2N1G A;  1WYC A;  3PV0 F;  3E08 A;  4ZXL A;  3IBP A;  4QWN B;  3CX7 B;  5LCY A;  2BVL A;  2H7V C;  3HR0 A;  5FXZ A;  2QRX A;  3AE2 A;  5HWY A;  5HXS A;  4DV6 T;  1IZN B;  4IT4 A;  1MMA A;  4QXH B;  4X20 E;  2E5L T;  4COF A;  3N9O A;  3FHN A;  2FJB A;  2I0M A;  1UK5 A;  2PFV A;  3A5X A;  2A72 A;  4TUY E;  3AA1 B;  3BQI A;  4ZI3 C;  3RLF F;  2JPF A;  2V7M A;  3AEA A;  2BG9 B;  3ONX A;  4CXY A;  2J1D G;  5JRC B;  2L9Q A;  1HTJ F;  1FMW A;  2X9Y A;  2ZM0 A;  4QHO A;  3OKQ A;  1HFA A;  4ZS3 A;  3KBT A;  3P4Q A;  4NUV A;  2V6Y B;  1EZ3 A;  3L09 A;  4TV8 E;  3T8O A;  2BKP A;  4HTE A;  3ZYM A;  3AE7 A;  5F5W A;  4O4H E;  3RYF E;  2DLR A;  5L2L A;  2LKG A;  4HEA A;  3FZH B;  5FXX A;  4MFR A;  3ZMU B;  3RGL A;  4HWD A;  4UVC B;  1UUS A;  3MA9 A;  4DR7 T;  1IAP A;  5AQL B;  1UX5 A;  1SA0 E;  5L47 A;  2MOZ A;  2YU1 A;  2ODV A;  2D5U A;  3CX8 B;  2Q9Q D;  3AE6 A;  1N34 T;  3B5M A;  3QB5 A;  4UEL A;  2XQ8 A;  3EDU A;  2I59 A;  4DV5 T;  3EAM A;  1NAF A;  3ANW B;  3KDS E;  4QH5 A;  4IE6 A;  1T8B A;  4HFV A;  3ZC1 A;  3HKD E;  4GKJ T;  5HEU A;  2Y6X A;  4IST A;  2LJL A;  4YY3 T;  4ZI3 D;  2UXN B;  4H63 V;  4LML A;  1LRZ A;  4FJO A;  2CMR A;  1US7 B;  4UIG A;  2YDS A;  5LNK A;  3M3Z B;  5L4H A;  2X0H A;  3OJA A;  4PK6 A;  1LKX A;  2CBI A;  4HFC A;  4OX9 T;  3GWH A;  5C2T A;  5J1G A;  1XMQ T;  5LG3 A;  4LF8 T;  3AE3 A;  2VAS A;  3Q9D A;  3AEC A;  3RRC A;  4CQI A;  2NWB A;  1ZOY A;  2EHO B;  3ETV A;  3HKC E;  1UCU A;  3D0T A;  3UU6 A;  3IHR A;  5JDQ A;  3QOF A;  2H89 A;  1QUU A;  3VHL A;  4LF6 T;  5JDF A;  2XAS B;  1U4Q A;  2EHO C;  2W63 A;  5JDN A;  3TLW A;  5KX5 E;  4L5G A;  2X9X A;  3RC8 A;  1AJ3 A;  2X9W A;  3PJA A;  2XQ9 A;  5HCM A;  3CML A;  2W2U A;  2E9X D;  1X79 A;  2J4G A;  4I50 E;  1I94 T;  1YXR A;  1E2A A;  1T7S A;  4EYU A;  2F4V T;  4JEU B;  3ZT5 A;  2CA5 A;  2WBL A;  2LOP A;  4LF7 T;  2J62 A;  5LXT E;  2NTY A;  5FL1 A;  1WYB A;  4JI6 T;  2XQ3 A;  2IW5 B;  2XSA A;  3C51 A;  3RIU C;  5AQN B;  4IDP A;  4UF0 A;  4X1Y E;  1QLB A;  3QK6 A;  4NPP A;  3CQX C;  5KMG P;  4IE5 A;  4DV0 T;  4PAG A;  2JQH A;  3AEF A;  2VKH A;  2YEV C;  5JR9 A;  2CWO A;  4CN6 A;  3C50 A;  2XQ4 A;  2CM0 A;  5BMV E;  5JH7 E;  3MKD A;  3FZK B;  5LA6 E;  3OYZ A;  1SE7 A;  3L39 A;  2D0T A;  4G63 A;  4O4L E;  4H9P C;  5HXR A;  3Q5X A;  5H6R B;  5AQO B;  4ANJ A;  2W66 A;  2WWU A;  4YTN A;  2LHN A;  4CN1 A;  2JIW A;  2X9H A;  5HYA A;  3KVB A;  1T72 A;  4P0B A;  2WAU A;  5HXE A;  3FZF B;  3LBX B;  4EB6 E;  4X5T A;  1XDO A;  2ZM2 A;  5JTG A;  5IYZ E;  4B6X A;  1HF8 A;  5DQV A;  2LHR A;  2XQY A;  4YSX A;  1J5W A;  3AA7 B;  2BZB A;  4WZX A;  5L4E A;  3PUQ A;  2VWA A;  4A98 A;  1OED A;  5JR9 B;  2CHO A;  4B3T T;  4CZZ B;  2WZI A;  3U3I A;  1VCS A;  2ZM8 A;  3QC9 A;  3GA8 A;  5FNV E;  4JYA T;  4KHP T;  5FXW A;  3RQW A;  3LK2 B;  3R84 B;  3UT5 E;  3ZCI A;  2LT3 A;  1B7T A;  2CXD A;  5EZY E;  3NVO A;  1E1H B;  4DUY T;  3FXE B;  4UVB B;  4IE4 A;  3NBX X;  3Q5E A;  1YQ3 A;  4GYR A;  2PBI A;  5AFU L;  1E7P A;  3UUM A;  3HKB E;  2E5V A;  1M7K A;  2AXD S;  3RPU A;  4U2Z A;  3GMI A;  3RX6 A;  4AQF C;  3NKZ A;  2BBH A;  3L3P A;  2Z6E A;  2LSY A;  3TKL B;  2DI4 A;  5FP3 A;  2V7I A;  5JVD E;  4WW0 A;  2YK0 A;  4PJM A;  3AEG A;  2P9B A;  1MMG A;  4WBN E;  5CA1 E;  2BVM A;  4P1N A;  1N32 T;  3N9L A;  5ABF A;  4NXM T;  2PJQ A;  3N2O A;  4DMW A;  2LM9 A;  1HNX T;  4DR1 T;  5FL0 A;  2N2N A;  2IC6 A;  3ZT6 A;  4PFO A;  3ZYK A;  2CPT A;  4DUZ T;  4U31 A;  2VQE T;  3NRY A;  2KWH A;  3DJB A;  2UXD T;  3KV5 A;  4JI1 T;  3ESL A;  5C3J A;  3PU8 A;  4YTM A;  5FY7 A;  2WB5 A;  2DHR A;  4O4I E;  3CQC B;  3C4W A;  3RHW A;  3CX6 B;  3UUN A;  2UXC T;  2BBJ A;  5E0O A;  2W00 A;  2N9D A;  3JCF A;  4DND A;  5L3F B;  4Z90 A;  3RI5 A;  3AAE B;  1JNZ A;  3PU3 A;  2XAJ B;  2LEH A;  1OXZ A;  2MPK A;  4H9R C;  2WMN A;  4EEB A;  2LOS A;  4IHJ E;  5KXJ A;  3WI3 A;  2UXB T;  3P4S A;  2W0G A;  4CI1 B;  5ABF B;  2X67 A;  2PG8 A;  3G06 A;  3FB2 A;  4TWF A;  4ZHQ E;  2RPA A;  3LG7 A;  1HG5 A;  4NXN T;  1D0Z A;  3OBV E;  3NZQ A;  3FZL B;  3AEB A;  2CEA A;  3C4X A;  5JRC A;  2NR4 A;  1WCR A;  4YHJ A;  4C91 A;  2X0L B;  4EGW A;  1G8X A;  2V6Y A;  1T98 A;  3EHZ A;  3PUZ F;  2Q9Q B;  3ZKR A;  4K0K T;  2WMO A;  2YN6 A;  3CVR A;  3JC6 D;  2OA5 A;  4U3C A;  2Q9Q C;  1NEN A;  3RYH E;  4PFP A;  5AQQ B;  3AE9 A;  4ASK A;  3KV9 A;  4F6R C;  1ZV4 X;  1UUR A;  5AQH B;  3L8R A;  2XJ7 A;  1DU2 A;  5F8P A;  5L3E B;  5HWX A;  2XZE A;  5LYJ E;  2G0U A;  4TWH A;  3O1J A;  1SUM B;  3P8C D;  2I6H A;  4BJN A;  3KVA A;  2WWV A;  2IML A;  1M62 A;  4X66 T;  3ANW A;  3V5S A;  4EV6 A;  2E2A A;  4EAH A;  2QA7 A;  3AE8 A;  3N9P A;  5JQG E;  3ABV A;  4HFB A;  1IBL T;  4CN4 A;  4MHC A;  4I4T E;  3C98 B;  4CXX A;  3NWI A;  2HN1 A;  4M1P A;  4BA9 A;  3SFE A;  5LBQ B;  5AQJ B;  4ADZ A;  2VVN A;  4QH4 A;  5J2T E;  1YKH B;  5FY1 A;  5ETW A;  2UXX B;  5LHI B;  2LSK A;  3EDV A;  4B3S T;  5CA0 E;  3AVR A;  3F2E A;  1NEK A;  3PUA A;  2EHO A;  4IL4 A;  2MAW A;  2BDE A;  4GK5 E;  2A9U A;  5J0Z A;  1MMN A;  2E9X C;  2NTX A;  3A7M A;  1L0V A;  2KZ7 B;  5DQW A;  2V7K A;  4PK5 A;  3UU8 A;  4LF5 T;  5L3D B;  2ZMA A;  1D0Y A;  4A5X A;  5EK4 A;  3ZMV B;  1XDP A;  4ILU A;  1D1A A;  4KHZ F;  3A8Y C;  5LGT B;  2HH7 A;  1Z8U A;  3ZCJ A;  3H3A A;  1JNR A;  2BKO A;  5C8Y E;  5ABE A;  4U33 A;  4X64 T;  2V8S V;  4LMJ A;  1NWM X;  4KMC A;  5LMU T;  3O1I A;  1IJ5 A;  3O9X A;  2LRL A;  4JV5 T;  2V1D B;  2CHN A;  3N9N A;  4LFC T;  2VKD A;  1KFY A;  3AAI A;  1LVF A;  4DR4 T;  5HCJ A;  3ZLI A;  3HA4 A;  1J5E T;  2K5B B;  3CWZ B;  2A2F X;  2XPK A;  5ADX L;  4X1I E;  2ZLY A;  3NZP A;  1KF6 A;  5LMN T;  4Z91 A;  4AI6 A;  1R8I A;  4IDO A;  3AAA B;  4BJM A;  5F3J A;  2YU2 A;  4XBF B;  3H37 A;  2YKS A;  4HKA A;  1MIW A;  2JJ9 A;  1O3X A;  3N2G E;  3AA0 B;  1HX8 A;  2XQA A;  2OV9 A;  4E7Z A;  2HPL A;  2L8K A;  5JDG A;  5LB7 B;  3ETU A;  4FI5 A;  5AQT B;  4YLH A;  2VKJ A;  2IHR 1;  5GON E;  2C5I T;  4UV9 B;  4TV9 E;  1WR0 A;  3ZMT B;  4XZC A;  3LBX A;  4DV7 T;  3Q5W A;  2CLY B;  3AB3 B;  5M4Y A;  3OVU A;  4CI3 B;  4TZ4 C;  4JI3 T;  1D0X A;  2K48 A;  4CI2 B;  3ZST A;  5IHY A;  2CLY C;  1N36 T;  1KNZ A;  3N9M A;  4LFB T;  2M6I A;  4H9O C;  2YDQ A;  4OYJ A;  3I9W A;  4ZZB A;  2K3W A;  3VR9 A;  4X1K E;  4C90 A;  1HNW T;  4EOZ B;  4EIW A;  2H88 A;  3HL6 A;  4ILA A;  4OHF A;  3ZMS B;  3P50 A;  2CXF A;  5LP6 E;  4P0A A;  4MLK A;  4AQF A;  4GYS A;  5HXH A;  2OLT A;  3PDY A;  2XM2 A;  2ODU A;  3MAC A;  2VL8 A;  1LVK A;  4DV3 T;  2D9D A;  2IAK A;  1BR4 A;  2HN2 A;  4XAX B;  3KBU A;  1BR0 A;  1MIY A;  1W0A A;  3E0Z A;  2W61 A;  5CFB A;  3SRZ A;  3I0Q A;  3RRW A;  4ERR A;  1KK7 A;  3MK7 C;  2CBJ A;  3R6N A;  4O2A E;  4ILB A;  4JI7 T;  4ISS A;  3PUR A;  4EXT A;  4TNV A;  3JAF A;  3AED A;  5AQF B;  1HNZ T;  3TLV A;  2V6X A;  2KND A;  1Y64 B;  4EYY R;  4GOU A;  2D2S A;  4O4J E;  1KNP A;  4A56 A;  1FJG T;  5AQP B;  3RF1 A;  3ZMZ B;  5AQG B;  1HR0 T;  2XAF B;  2PTF A;  4YXD A;  4QH1 A;  2QVA A;  1HS7 A;  1VOM A;  1MND A;  2WDQ A;  3I0O A;  3AA6 B;  5L3G B;  3F57 A;  5AQM B;  3T1Y T;  4AQY T;  3UU4 A;  4ZI2 D;  2KSR A;  3GN5 B;  1D1B A;  4AIU A;  2WU2 A;  4DR6 T;  1XZY A;  4YJ3 E;  1S94 A;  4NUU A;  1G73 A;  4HGA A;  4OK0 A;  1MNE A;  3MJX A;  4U7I A;  3QNU A;  1WRD A;  2H3R A;  4GKK T;  3J7Y q;  4JI0 T;  3RKO A;  4JUY A;  3PUY F;  2WY2 A;  3CPZ A;  2X0Y A;  2WS3 A;  4N78 D;  1OED C;  3TLT A;  2VUR A;  1Y01 A;  1YD8 G;  3JC6 C;  2E8I A;  2LSI A;  1CUN A;  3ONJ A;  2KWI B;  2RP4 A;  2VKO A;  3K3O A;  2Q9Q A;  4Q25 A;  3CIR A;  2V7J A;  2JMK A;  3K8P C;  4U74 A;  2WQY A;  1D1C A;  3PUV F;  2CE7 A;  2XSB A;  3NRX A;  4EZ4 A;  5J2U E;  3CKD A;  3Q5D A;  1UX4 A;  1WFD A;  3BQK A;  3FBZ A;  2W62 A;  1I6Z A;  1VCT A;  2VB6 A;  4IGU A;  5LHG B;  2IC9 A;  2XQ5 A;  2K9A A;  2C5K T;  2YIN A;  1HG2 A;  3AXJ B;  3PUX F;  3ZN0 B;  4CXW A;  3O1H A;  3LFM A;  3P4W A;  1ZKE A;  4YHH T;  2XQ7 A;  3MZK B;  2XAG B;  3JAE A;  3FZM B;  1CHU A;  4H63 H;  3LJC A;  4GIW A;  4JI4 T;  4ZEY A;  4TNW A;  4P09 A;  4PJN A;  1FEW A;  2M6B A;  2FUP A;  2SPC A;  4TN7 B;  3N5L A;  4JEH B;  1WR6 A;  4LF9 T;  5AQS B;  4DBQ A;  5LOV E;  1X9B A;  5HEJ A;  4KX6 A;  4JI8 T;  4V1A v;  5FKY A;  2RA1 A;  4UR9 A;  2V5C A;  4I0U A;  4ZZC A;  5AQI B;  3KV4 A;  3UUL A;  4HE8 A;  2LLY A;  3BQL A;  2XAH B;  3W15 B;  3Q2M A;  4B3M T;  5EK3 A;  2BKN A;  1QSD A;  2KLQ A;  2IIU A;  5L3B B;  4AKR B;  2XQ6 A;  4YT0 A;  4PJL A;  5DAB A;  2HHH T;  4KUM B;  3K1S A;  2HPJ A;  1KEY A;  2LSG A;  3UUX B;  1IBM T;  4HWC A;  3I1A A;  3S4U A;  3K3Q C;  3UTK A;  2UU9 T;  3C4Z A;  3WAK A;  2WZH A;  2X66 A;  3ZJ2 A;  3WAJ A;  2V7L A;  4I43 B;  3B57 A;  3ZPO A;  4PW8 A;  4X62 T;  5LGU B;  2CWY A;  2WU5 A;  4MAL A;  1W0B A;  1BR2 A;  3HKE E;  2K24 A;  2W67 A;  2A3D A;  4MBQ A;  1FMV A;  5AQV B;  5ABH A;  2X68 A;  2BG9 C;  3P4P A;  2XTL A;  3PJA J;  4F8H A;  2E9X B;  2ZM6 T;  3EI0 A;  3QB5 K;  1XWM A;  3E22 E;  5HAX A;  4PK4 A;  2BG9 E;  2J47 A;  5TAO A;  2WCA A;  4IL9 A;  4DV4 T;  4WNK A;  2JMH A;  4AKG A;  2UUC T;  1Z0P A;  2VL0 A;  2LM2 A;  4UV8 B;  3IA3 A;  1ZP0 A;  2NP9 A;  2B1E A;  1ZEE A;  3RH3 A;  4AQG A;  2JQK A;  3OTO T;  4QKN A;  4EED A;  3RIU A;  4DID B;  4JLE A;  5FVL A;  4DR5 T;  4JI2 T;  1IBK T;  3PE0 A;  2NW8 A;  3IF8 B;  2KT9 A;  3J9X 1;  2NOX A;  4DO0 A;  3M65 A;  2MYS A;  4H9N C;  3N2K E;  1YQ4 A;  4AKH A;  2DWG A;  4IDN A;  2LKH A;  2B76 A;  3DP7 A;  4BAY B;  2BS3 A;  4H9Q C;  3UUB A;  1MMD A;  4J2C A;  2ACX A;  3RYI E;  1YW0 A;  3I9Y A;  4O8S A;  4IDQ A;  4K0U A;  2DCF A;  2MBG A;  4H9S E;  2JRK A;  4HWH A;  3T1H T;  4L0R A;  4NIQ A;  3TLS A;  3PUS A;  4YTP A;  5FMN A;  2DL1 A;  3LDQ B;  3ZT7 A;  2YOE A;  2LE8 A;  1ZHC A;  5HXC A;  3H3M A;  2BS4 A;  3RIA A;  5IUX A;  3CQG B;  4LF4 T;  2W4X A;  4LMK A;  1SHZ C;  3RIF A;  2XUE A;  4UXN B;  4KI0 F;  5LBM A;  2KXP B;  4U72 A;  2WDV A;  1WLX A;  4HFE A;  4YSY A;  2ACZ A;  2LRK A;  5HEO A;  3RC3 A;  5AQR B;  2WP9 A;  2XM1 A;  3F31 A;  2WSS V;  5JDM A;  4G2A A;  4PNI A;  4YJ2 E;  3EUH A; 
#chains in the Genus database with same CATH homology
 2WMO A;  3CVR A;  3JC6 D;  3VKG A;  4OK0 A;  1MNE A;  4QXC B;  3MJX A;  2Y6X A;  1BR1 A;  4IST A;  5LG4 A;  1WRD A;  2LJL A;  2OA5 A;  3KV6 A;  5FYM A;  2H3R A;  4ZI3 D;  2Q9Q C;  2UXN B;  2X51 A;  3J7Y q;  3RYH E;  4PFP A;  3KIN B;  3RKO A;  4H63 V;  5FXV A;  4JUY A;  1LRZ A;  4FJO A;  4ASK A;  4ZI2 C;  3KV9 A;  2CMR A;  4EZH A;  4F6R C;  1ZV4 X;  3CPZ A;  4AXP A;  1US7 B;  4KP3 C;  4UIG A;  5FY0 A;  5LJN A;  2EHO D;  4N78 D;  5LNK A;  4O2B E;  3OJA A;  4PK6 A;  5F8P A;  1LKX A;  5L3E B;  2CXL A;  5HWX A;  3GWH A;  1YD8 G;  5J1G A;  5LYJ E;  2G0U A;  3JC6 C;  4QX8 B;  2GK9 A;  4AKL A;  3O1J A;  3P8C D;  4BJN A;  2E8I A;  4DMV A;  4UVA B;  2VAS A;  4HGA A;  3Q9D A;  3KVA A;  1H7C A;  2LSI A;  1CUN A;  3ANW A;  2KWI B;  3GN5 A;  3RRC A;  2NWB A;  2RP4 A;  4YFS A;  2EHO B;  3V5S A;  4CQI A;  3ETV A;  3HKC E;  2VKO A;  4EAH A;  1UCU A;  2QA7 A;  3K3O A;  2CCQ A;  1U5P A;  2Q9Q A;  3D0T A;  3N9P A;  3IHR A;  4QX7 B;  5JQG E;  3B13 A;  2Y8D A;  2V7J A;  2V26 A;  5JDQ A;  2JMK A;  3K8P C;  5A1L A;  4MHC A;  4UF0 B;  4ZI7 E;  1QUU A;  3VHL A;  4U74 A;  4I4T E;  2MTQ A;  3C98 B;  5JDF A;  2XAS B;  1U4Q A;  2EHO C;  2W63 A;  2M67 A;  4CXX A;  5JDN A;  1D1C A;  2CE7 A;  5KX5 E;  4L5G A;  4M1P A;  2X9X A;  3RC8 A;  3NRX A;  1AJ3 A;  2X9W A;  4EZ4 A;  2XHE B;  4BA9 A;  5J2U E;  3CKD A;  5LBQ B;  3HI2 A;  3CML A;  4AKI A;  1UX4 A;  3BQK A;  3FBZ A;  2E9X D;  1X79 A;  2W62 A;  4ADZ A;  2VB6 A;  4I50 E;  3VKH A;  4IGU A;  5J2T E;  5LHG B;  2IC9 A;  1YKH B;  2K9A A;  2C5K T;  2YIN A;  1HG2 A;  5FY1 A;  4HN9 A;  5JR9 C;  3ZN0 B;  4EYU A;  4CXW A;  3O1H A;  4JEU B;  5ETW A;  1S35 A;  2CA5 A;  2WBL A;  2UXX B;  2LOP A;  3LFM A;  5LHI B;  2LSK A;  1ZKE A;  4UEM A;  3EDV A;  5LXT E;  3MZK B;  5CA0 E;  2XAG B;  3AVR A;  2NTY A;  3F2E A;  3PUA A;  5LGN B;  1WYB A;  3O4X E;  3LJC A;  4H63 H;  2EHO A;  4GIW A;  4OFZ A;  5H6Q B;  5CB4 E;  3ZYL A;  2WM9 A;  2BDE A;  4GK5 E;  3ZN1 B;  2IW5 B;  1MMN A;  2DWK A;  2E9X C;  1V9D A;  4P09 A;  4PJN A;  1FEW A;  1VRB A;  2NTX A;  3C51 A;  3SS1 A;  4UF0 A;  2SPC A;  4X1Y E;  3K3N A;  4ZS2 A;  3AVS A;  2KZ7 B;  4TN7 B;  3N5L A;  4JEH B;  1WR6 A;  3QK6 A;  5DQW A;  4TX5 A;  3PUG A;  2V7K A;  3CQX C;  5KMG P;  4IE5 A;  4I55 E;  4PK5 A;  2KIN B;  4DBQ A;  4PAG A;  5L3D B;  2VKH A;  2ZMA A;  3IEE A;  3ZJ1 A;  1D0Y A;  2DNX A;  2YEV C;  5LOV E;  5JR9 A;  5EK4 A;  2H7O A;  3ZMV B;  2CWO A;  4KBM B;  4ILU A;  3BK9 A;  3P7I A;  3C50 A;  2NW7 A;  1D1A A;  4V1A v;  2RA1 A;  2CM0 A;  5BMV E;  5JH7 E;  3MKD A;  5LGT B;  3N9Q A;  2HH7 A;  5LA6 E;  3OYZ A;  3ZCJ A;  4GK0 E;  3UUL A;  3KV4 A;  2D0T A;  3H3A A;  4HE8 A;  4G63 A;  4O4L E;  3ZC0 A;  5C8Y E;  4H9P C;  4IDZ A;  5HXR A;  3Q5X A;  5H6R B;  3BQL A;  1IJ6 A;  2XAH B;  3W15 B;  1MIV A;  1NWM X;  3Q2M A;  4ANJ A;  3FXD B;  5EK3 A;  2QGS A;  3MXZ A;  2KLQ A;  1QSD A;  3O1I A;  4KMC A;  5L3B B;  4AKR B;  3PTR B;  5LJM A;  1YKE B;  4PJL A;  1IJ5 A;  3O9X A;  5DAB A;  2WWU A;  4KUM B;  2V1D B;  2HPJ A;  3N9N A;  2VKD A;  2LHN A;  3SWH A;  3AAI A;  2LSG A;  2X9H A;  3UUX B;  1LVF A;  4PJJ A;  4E7S A;  5HYA A;  3ZLI A;  3KVB A;  4P0B A;  5DJQ C;  3HA4 A;  3U78 A;  2K5B B;  2WAU A;  3CWZ B;  5HXE A;  2A2F X;  3LBX B;  3I1A A;  4EB6 E;  5ADX L;  2ZM2 A;  2L3L A;  4IE7 A;  4L9I A;  4X1I E;  2ZLY A;  5IYZ E;  4QXB B;  4B6X A;  3NZP A;  3RYC E;  5JDL A;  3S4U A;  1HF8 A;  3K3Q C;  3UTK A;  4AI6 A;  3C64 A;  5DQV A;  2LHR A;  2XQY A;  3C4Z A;  3AAA B;  4BJM A;  5F3J A;  3WAK A;  2YU2 A;  2X66 A;  3ZJ2 A;  3ZEF B;  5LHH B;  4XBF B;  3LK4 2;  3AA7 B;  2V7L A;  4I43 B;  3H37 A;  2BZB A;  1FIO A;  3B57 A;  3V5U A;  3WAJ A;  4Z8X A;  4HKA A;  2LSJ A;  3ZPO A;  3PUQ A;  4PW8 A;  1MIW A;  3KFW X;  5LGU B;  2C0S A;  2VWA A;  1HCI A;  2JJ9 A;  3EVY A;  1O3X A;  5JR9 B;  4CZZ B;  2CWY A;  3N2G E;  3U3I A;  3AA0 B;  4MAL A;  3OYX A;  1BR2 A;  3HKE E;  2XAQ B;  2K24 A;  2ZM8 A;  2A3D A;  1OWA A;  1HX8 A;  3QC9 A;  3LK3 B;  3GA8 A;  4IIJ E;  2D0U A;  4MBQ A;  2Y48 B;  3FBL A;  5FNV E;  2HPL A;  1FMV A;  2L8K A;  4E7Z A;  5JDG A;  5FXW A;  3ETU A;  4FI5 A;  5JRE A;  3LK2 B;  3R84 B;  3UT5 E;  2X68 A;  4DBR A;  3ZCI A;  2LT3 A;  2XTL A;  4YLH A;  2NW9 A;  4OYK A;  4DVD A;  1B7T A;  2CXD A;  2VKJ A;  4ZOL E;  5EZY E;  2E9X B;  5GON E;  1E1H B;  2C5I T;  5KDM C;  4UV9 B;  4TV9 E;  3FXE B;  3E22 E;  4UVB B;  4IE4 A;  3ZMT B;  4XZC A;  3NBX X;  5HAX A;  3LBX A;  4GYR A;  3Q5W A;  2ES0 A;  2PBI A;  2CLY B;  4PK4 A;  3AB3 B;  5M4Y A;  5AFU L;  4CI3 B;  3QUJ A;  4TZ4 C;  3UUM A;  5EK2 A;  1D0X A;  4IE0 A;  3HKB E;  2K48 A;  5TAO A;  4CI2 B;  3UFE A;  3RPU A;  5IHY A;  2CLY C;  3GMI A;  4WNK A;  3RX6 A;  2JMH A;  1KNZ A;  4AKG A;  3N9M A;  4AQF C;  1Z0P A;  3L3P A;  4H9O C;  4UV8 B;  2Z6E A;  2VK9 A;  2LSY A;  3DTO A;  3TKL B;  2JQQ A;  2DI4 A;  5FP3 A;  2V7I A;  2NP9 A;  4OYJ A;  2B1E A;  4WW0 A;  5JVD E;  3I9W A;  1ZEE A;  5JDH A;  2YK0 A;  4X1K E;  4C90 A;  2C5J A;  4PJM A;  4EOZ B;  3RH3 A;  2P9B A;  4EIW A;  5L3C B;  1MMG A;  3SOL A;  2KMF A;  4AQG A;  3HL6 A;  4WBN E;  4QKN A;  2E9X A;  5CA1 E;  4OHF A;  3ZMS B;  3VU7 H;  2BVM A;  4WBO A;  2N1G A;  1WYC A;  3N9L A;  4JLE A;  2PJQ A;  2CXF A;  3E08 A;  3N2O A;  4DMW A;  2LM9 A;  5LP6 E;  4P0A A;  3PE0 A;  2NW8 A;  3IF8 B;  3IBP A;  4MLK A;  2N2N A;  4QWN B;  2IC6 A;  2KT9 A;  4PFO A;  3CX7 B;  3J9X 1;  2NOX A;  3ZYK A;  4DO0 A;  4AQF A;  4GYS A;  5LCY A;  5HXH A;  3M65 A;  2BVL A;  2MYS A;  2H7V C;  4H9N C;  3N2K E;  3HR0 A;  3PDY A;  5FXZ A;  2ODU A;  3MAC A;  2VL8 A;  1LVK A;  3NRY A;  5HWY A;  5HXS A;  4AKH A;  2KWH A;  3DJB A;  2DWG A;  3KV5 A;  1IZN B;  1MMA A;  4QXH B;  3DP7 A;  4X20 E;  4BAY B;  3N9O A;  3ESL A;  3FHN A;  3PU8 A;  5FY7 A;  2IAK A;  1BR4 A;  2DHR A;  4H9Q C;  4XAX B;  4O4I E;  3KBU A;  3CQC B;  3C4W A;  1BR0 A;  1MIY A;  2PFV A;  1MMD A;  4J2C A;  3A5X A;  2ACX A;  3RYI E;  2A72 A;  3CX6 B;  1YW0 A;  4TUY E;  3UUN A;  3I9Y A;  5E0O A;  3AA1 B;  3BQI A;  2W00 A;  4ZI3 C;  2N9D A;  3E0Z A;  4O8S A;  2W61 A;  4K0U A;  4DND A;  2DCF A;  2JPF A;  5L3F B;  2V7M A;  3ONX A;  3SRZ A;  2MBG A;  4H9S E;  4CXY A;  3AAE B;  2J1D G;  3I0Q A;  3PU3 A;  5JRC B;  2L9Q A;  2JRK A;  1HTJ F;  1FMW A;  2X9Y A;  2XAJ B;  4L0R A;  3RRW A;  2ZM0 A;  2LEH A;  1OXZ A;  4ERR A;  3PUS A;  1KK7 A;  3MK7 C;  4H9R C;  5FMN A;  2WMN A;  2LOS A;  3R6N A;  4IHJ E;  4QHO A;  3OKQ A;  4O2A E;  1HFA A;  4ZS3 A;  3WI3 A;  3KBT A;  4NUV A;  1EZ3 A;  3L09 A;  2LE8 A;  1ZHC A;  4TV8 E;  2W0G A;  4ISS A;  5HXC A;  3T8O A;  3PUR A;  4EXT A;  4CI1 B;  2X67 A;  3CQG B;  4HTE A;  2KND A;  2PG8 A;  3ZYM A;  1Y64 B;  4EYY R;  4GOU A;  4O4H E;  3RYF E;  1SHZ C;  2D2S A;  2XUE A;  2DLR A;  4O4J E;  4UXN B;  5L2L A;  4HEA A;  4A56 A;  3FB2 A;  4ZHQ E;  5FXX A;  5LBM A;  3ZMZ B;  3LG7 A;  4MFR A;  1HG5 A;  2KXP B;  4U72 A;  3ZMU B;  1WLX A;  4UVC B;  2XAF B;  3MA9 A;  1D0Z A;  1IAP A;  3OBV E;  3NZQ A;  1HS7 A;  1VOM A;  1UX5 A;  1MND A;  1SA0 E;  3I0O A;  2MOZ A;  2CEA A;  2YU1 A;  3C4X A;  2ODV A;  3AA6 B;  2D5U A;  5JRC A;  3CX8 B;  2Q9Q D;  5L3G B;  3RC3 A;  3F57 A;  4YHJ A;  4UEL A;  3EDU A;  2I59 A;  4C91 A;  4ZI2 D;  1NAF A;  2X0L B;  3ANW B;  1D1B A;  2WSS V;  3F31 A;  3GN5 B;  3KDS E;  4IE6 A;  5JDM A;  4HFV A;  3ZC1 A;  1G8X A;  4G2A A;  1T98 A;  2Q9Q B;  4PNI A;  3HKD E;  4YJ2 E;  4YJ3 E;  1S94 A;  4NUU A;  1G73 A;  3EUH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...