1V9DA

Crystal structure of the core fh2 domain of mouse mdia1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
332
structure length
308
Chain Sequence
VKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLSFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Diaphanous protein homolog 1
publication title The core FH2 domain of diaphanous-related formins is an elongated actin binding protein that inhibits polymerization.
pubmed doi rcsb
source organism Mus musculus
total genus 120
structure length 308
sequence length 332
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA01
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA02
3O4XE 3OBVE 2J1DG 1V9DA 1UX5A 1UX4A 2Z6EA 1Y64B 4EAHA
chains in the Genus database with same CATH superfamily
4F6RC 5FKYA 3P50A 1VCTA 3KVBA 2UXDT 2ZMAA 5HEOA 3RIFA 2ES0A 2PTFA 4B3ST 4DMWA 2PBIA 4GKJT 4KX6A 3VHLA 5L2LA 2CWOA 2V8SV 2HPLA 2WS3A 4Q25A 3OYZA 3LJCA 4JI5T 4EYYR 1WR0A 3AAEB 3KDSE 2H7OA 3KV5A 2LM9A 1Y64B 5AQGB 5FXXA 4IIJE 5J2UE 2XM1A 3T1HT 3CIRA 1WCRA 2AXDS 2JIWA 2ACXA 5JH7E 3HKEE 5JR9B 2H7VC 3H3AA 4E7ZA 2LSGA 2WP9A 2L9QA 3ZJ2A 3ZC0A 4HGAA 3FBLA 3CPZA 5FY7A 4DV7T 4ZI2D 2CLYC 3FB2A 4QX7B 5JDQA 4H9RC 4QH1A 3C4WA 1BR1A 2WSSV 3KBTA 3EHZA 2X9WA 4PK4A 4ZS2A 3PV0F 4YFSA 3HR0A 2LKGA 2XQ8A 3JC6C 4MLKA 3U78A 2VB6A 2N1GA 3VKHA 3VR9A 1T8BA 1IBKT 2G0UA 3P4PA 1XMOT 2Q9QA 3E22E 3FZMB 5GONE 3LK42 3ETVA 2YDRA 4WZXA 4LF6T 3PURA 3ZT5A 5LMUT 1HR0T 2P9BA 3PU3A 2XQAA 3TKLB 3ZN1B 5DQWA 2CXDA 2E9XD 2LHNA 4X1KE 2VK9A 3UTKA 3UU6A 4HWFA 4QX8B 4DR1T 2CM0A 1FMWA 3AA7B 2YEVC 1KNRA 4XZCA 4I55E 3RIUC 3AAIA 2I0MA 4TZ4C 1IBMT 4IE6A 3ZLIA 4YY3T 1VRBA 3B13A 2M6IA 4WBOA 5JRCA 1KNZA 4DV5T 4O4JE 2C0SA 4H63H 3V5SA 3H37A 4NPPA 4EGWA 3RRWA 3KINB 3I9WA 4ZXLA 4ZZBA 1U4QA 2N9DA 5L4HA 1Z0PA 2E2AA 3AE6A 2Q9QB 3ONLC 1VOMA 4AIUA 2XQ3A 1UX5A 3X1DA 1W0BA 5KXJA 4JI0T 4EEDA 3RYFE 2B1EA 3AEEA 1XZYA 2D0UA 3UULA 1U5PA 4IE7A 2V26A 3A8YC 1SHZC 1J5ET 2FBWA 1ZKEA 4BJMA 3J7Yq 2CPTA 4I50E 5L47A 2IUBA 4EXTA 1YKHB 3PUVF 3MA9A 2ACZA 3DP7A 5FYMA 2M67A 5JRCB 5AQNB 2KWIB 4AKLA 2LOSA 3VR8A 2LOPA 3MJXA 3OVUA 4QXCB 4I43B 5AQKB 2FJBA 5LBMA 2BBHA 4PAGA 4LMJA 3EDUA 3EVYA 1XMQT 3PE0A 5IUXA 3AAAB 3L3PA 4X5TA 3CQXC 1FJGT 4IDOA 2D2SA 4U2YA 4IDPA 2E9XC 4LMKA 3AEGA 1EZ3A 1HFAA 1JNRA 2K3WA 4IE4A 2HN1A 3EDVA 4NIQA 4DBQA 3UU3A 1W9RA 1O3XA 3K1SA 2JPFA 5JR9C 2UUAT 3N2OA 2MPKA 2I6HA 1US7B 2J1DG 4KP3C 3PUSA 2DNXA 5E0OA 1UX4A 3N2GE 4C90A 2BVLA 1L0VA 1OWAA 5JQGE 4NUUA 2E5VA 3TLSA 4CXWA 2XM2A 4TWHA 3PDYA 4ZHQE 2V1DB 1MIVA 3SWHA 3V5UA 4AKRB 2QRXA 3CVRA 2UXNB 2KLQA 2BZBA 1MMGA 2M6BA 3ZYLA 5C8YE 4J2CA 4L9IA 2W2UA 4CI3B 4LF4T 1E1HB 2WB5A 5C3JA 5AQHB 2J47A 2YDQA 5AQFB 4IGUA 3P4WA 5CA0E 1YD8G 2J62A 4ZS3A 2RA1A 5HEGA 4JBWF 4NXMT 4GYSA 3O4XE 3NZPA 3P4RA 1ZV4X 4DBRA 5LGNB 2JQ9A 2K24A 1IZNB 4DV6T 1HG2A 3BQLA 2HN2A 5LA6E 3C50A 2UU9T 4PW8A 4COFA 5JVDE 4H9QC 1T7SA 2XZEA 4KMCA 1GQEA 2VL8A 5KDMC 3QNUA 2BS2A 5FXWA 4ILAA 3NWIA 3OPCA 2IC6A 3B57A 2CA5A 1QSDA 2LSKA 3B5MA 2JJ9A 4ISSA 3JC6D 2ODVA 2NP9A 2BVMA 2V7KA 1YQ3A 3AA6B 3OYXA 2XY8B 2CE7A 4MALA 5LHGB 4JV5T 5AQOB 1UK5A 3RC8A 1LKXA 3PUAA 5FXVA 1OEDA 3SRZA 4X20E 1OEDE 5J0ZA 2WY2A 2XSAA 3NZQA 3KVAA 4ILBA 5CB4E 4X65T 3RYCE 2DWKA 4EV6A 4I0UA 3C64A 2K48A 2FJDA 4Z90A 2NOXA 4IDQA 3OJAA 1HTJF 4PK6A 3FZLB 4GKKT 2AE9A 3JAFA 3HKCE 2KT9A 2KNDA 2QVAA 3CMLA 4H9NC 5AQIB 2MYSA 2IMLA 2JRKA 3TLVA 4ZI7E 2H89A 4XBFB 4OK0A 5JDFA 2XQ5A 4H9SE 4HFIA 1HNXT 4X1IE 1W09A 3KV9A 2BBJA 3UQ4A 5HEUA 3FZKB 5ETWA 5LCYA 4H9OC 1HCIA 4CN1A 2ZLYA 2CWYA 3GWHA 2E5LT 2HHHT 4HFHA 1OXZA 1OEDB 4U33A 4TN7B 2XAJB 3ETUA 4MHCA 4A98A 2CMRA 3ONXA 4DR5T 4IL4A 4GOUA 4DV1T 4AQFA 5HWXA 4X64T 2H3RA 1J5WA 3AVSA 2DHRA 3NKZA 2WZHA 3CQGB 4LF7T 4MFRA 2WCAA 4JI8T 1BR4A 2PFVA 1X9BA 3LK3B 5KX5E 3O1HA 5HXSA 3ZSSA 4UXNB 4CQIA 4U3CA 5JDGA 3LSVA 3RIAA 2BKPA 2X67A 2XASB 3RYIE 3HKDE 3EABA 2VASA 1MMDA 3ZJ1A 2I59A 2VURA 4ZZCA 3MACA 3O1IA 4LFAT 5BR8T 3KBUA 5FXZA 2MBGA 2YN6A 1N34T 2L3LA 3TLWA 1IJ6A 2X9YA 4LMLA 4YT0A 2DWGA 2XQYA 4DV3T 4YHHT 1NENA 1NWMX 4XAXB 3IF8B 4H63V 3Q5WA 3NBXX 5LGUB 4Z91A 2Y8DA 4QXHB 3WI3A 2D0TA 4B3RT 3AEBA 3PU8A 2D5UA 1HNWT 2XQ4A 4K0KT 2ZM2A 3BQKA 4DVDA 2YK0A 4JI2T 4TX5A 4AXPA 3KFWX 5CA1E 3PUWF 5LHIB 4JEUB 2OA5A 3AE8A 4HWIB 1UUSA 3F31A 2YKSA 4NUVA 3JCFA 3PUZF 4O4HE 3RF1A 3ONJA 3RC3A 3ZMTB 2EHOA 2C5JA 2KSRA 4K0UA 3RX6A 3ZC1A 4YSZA 1XNQT 2VKHA 4CN6A 2RPAA 3F57A 4OFZA 4YSYA 4HWHA 5FNVE 5FP3A 1SUMB 2WDQA 3TLTA 2JQKA 1Y01A 5ABFA 1JNZA 3PUGA 3GMIA 1WRDA 1SA0E 5H6QB 3A5XA 4DNDA 2KXPB 3N2KE 3R84B 3BK9A 3T8OA 3Q9DA 1S94A 4ZEYA 3UU4A 3UUNA 5JDMA 1WFDA 3CKDA 5HEJA 3EAMA 3UU5A 3QK6A 3AE1A 3ZN0B 1QUUA 1YW0A 2LKHA 4EAHA 5L3GB 4CXYA 5F8PA 2XSBA 3OKQA 2X51A 4Z8XA 4HE8A 2X0YA 2UUBT 2WDRA 2VWAA 1KFYA 5L3DB 3N9PA 2BG9A 3LG7A 1IJ5A 1FIOA 2BG9E 4ANJA 3C98B 2EHOB 5DQVA 2WU5A 4DV4T 3SFDA 3ZMVB 3PUQA 4EEBA 1KF6A 3I0OA 2WZIA 4UIGA 5ABFB 3K3OA 4TNVA 2CHNA 2ZM0A 3NRXA 1XWMA 1D1BA 2LSJA 1VCSA 4G63A 3ZEFB 1MMAA 1N36T 4U2ZA 4PK5A 5KMGP 4DR6T 5HWYA 3FXDB 1MMNA 3T1YT 4DUZT 4A56A 5FVLA 3KV4A 5LG4A 4CZZB 1CHUA 5AQMB 4KBMB 4IDNA 4U74A 2NW7A 1IBLT 4DIDB 3OTOT 2CLYB 2KINB 2LRKA 1OEDC 4YTNA 1I6ZA 2D9DA 2CRBA 3C51A 2CBIA 4YHJA 4H9PC 4AI6A 4MBQA 2L8KA 2BG9B 4TV9E 3P7IA 4U31A 1N32T 3W15B 3RLFF 3L39A 4YJ3E 2XUEA 3HL6A 3UQ7A 4U7YA 4N78D 4BAYB 2X9XA 5HCJA 4YLHA 2CBJA 1UGOA 5HYAA 2A72A 2JMHA 3HKBE 1HG5A 3Q2MA 5AQLB 5HAXA 4ADZA 2W4XA 2XQ7A 4DUYT 4UV9B 4OHFA 3MXZA 1UURA 1V9DA 3I0QA 1XDPA 5AQJB 2XJ7A 2A2FX 5L4EA 5H6RB 3Q5XA 4ILCA 5AQQB 2MTQA 4E7SA 4AKHA 1FEWA 2X0LB 3O9XA 4ZOLE 3RRCA 2VVNA 2LEHA 4WW0A 4JYAT 4C91A 4DR2T 4HTEA 3AXJA 4WNKA 1Z8UA 2BS4A 2JQHA 2VKDA 4QXBB 4KHPT 4B3TT 1M7KA 1X79A 1FMVA 2WWVA 4AQFC 1DU2A 4X1YE 2XHEB 3AA0B 3SS1A 3OBVE 2QA7A 2YOEA 5IYZE 4A5XA 4HKAA 1AJ3A 1HF8A 2CXLA 4JI7T 2K9AA 3AEDA 4U72A 3QOFA 3RQWA 4KHZF 2X66A 4HEAA 2E8IA 3LK2B 2VKJA 4LFCT 4EOZB 4WYVA 4QHOA 4LF8T 2CEAA 2KZ7B 4UV8B 3NRYA 5LNKA 5FMNA 4UVAB 1G8XA 4IT4A 4O4IE 2E9XA 3K8PC 1LRZA 3ANWA 2XAQB 5DJQC 4DV2T 4ZI3C 4GK0E 4TV8E 3HA4A 5FVKA 3GA8A 3ZPOA 3P4SA 4CXXA 4I4TE 4AKIA 2WU2A 2A9UA 3G06A 3FZHB 2Q9QC 3AXJB 3RHWA 3RYHE 2W61A 4GK5E 4UR9A 5F5WA 1MNDA 2IHR1 2C5IT 4HN9A 1WR6A 4UVCB 3IA3A 1G73A 2QYWA 2UUCT 4M1PA 3IHRA 4HWCA 4IE0A 1LVFA 5LOVE 3UFGA 4EYUA 5FL0A 4AQYT 3RGLA 5F3JA 2LM2A 2N2NA 5AFUL 2CHOA 4GIWA 5FY0A 2VQFT 3PUXF 3QB5K 3K3NA 2LHRA 5CGMA 3VU7H 2H88A 2K5BB 4AISA 2IW5B 5BMVE 2LSIA 4FJOA 2EHOC 4DR7T 4EB6E 5IHYA 5HXRA 5LBQB 3AB3B 1S35A 4JI6T 4TWDA 4YTMA 4CI1B 2LE8A 4OX9T 2VL0A 4DO0A 5LG3A 2BS3A 1ZEEA 3HI2A 3ZT6A 3RQUA 2E9XB 3ANWB 3AE3A 4HFBA 2IAKA 3Q5DA 2HPJA 1D1AA 3J9X1 3JADA 1NAFA 5L3FB 3P4QA 5M4YA 2UXXB 5L3CB 2V7LA 2FJEA 4HWDA 1WLXA 4IDZA 3RPUA 5C2TA 3ZSTA 4G2AA 4GYRA 5AQPB 4IE5A 3AE5A 3CX6B 4B6XA 3I1AA 2XAGB 5LB7B 2W62A 1YKEB 4LF5T 1QLBA 5J1GA 1CUNA 4AQGA 2CXFA 2KWHA 2W67A 3K3QC 2OLTA 3L09A 2BDEA 5JDNA 4CI2B 4EZ4A 1BR0A 3I9YA 4IREA 4DMVA 2BG9C 5FY1A 4L5GA 2WWUA 3U3IA 3ZYMA 2Y48B 1N33T 4PJLA 1MIWA 2FJAA 2DLRA 5LHHB 4LFBT 2OV9A 3IBPA 5L3EB 1D0YA 1T98A 5ABGA 2XQ6A 3RH3A 4PJJA 1XNRT 1LVKA 3ZMUB 2VKOA 2KMFA 1HS7A 3M3ZB 2MAWA 2NR4A 2XTLA 3ZKRA 3O1JA 2FUPA 1MIYA 4PFOA 5A1LA 1H7CA 4UEMA 3BQIA 3WAKA 4QH4A 1T72A 2XPKA 1BR2A 2NTXA 3N5LA 2HH7A 4PJNA 4AKGA 5JDHA 3VRBA 4EZHA 3CK6A 4ASKA 4KUMB 2MOZA 4YJ2E 2YU1A 4HFVA 1HX8A 2B76A 4L0RA 1XDOA 2ODUA 3Q5EA 3TLUA 2IDOB 2V7IA 4HFEA 2A3DA 2YU2A 1WYBA 4HFDA 3P8CD 4JI1T 1E7PA 2LSYA 4JI4T 4A97A 3N9OA 2V5DA 2NW8A 4UELA 5AQRB 4X62T 3AEFA 5CFBA 1J1JA 3NVOA 2WQYA 3MK7C 1D0XA 2V5CA 2PJQA 2WMOA 3C4ZA 1IAPA 2J4GA 1KK7A 3ABVA 3PJAA 3QC9A 3LBXA 5AQUB 4QWNB 4ERRA 2LLYA 3AVRA 3FHNA 1ZOYA 1R8IA 2DI4A 5HXCA 4JLEA 3UUMA 2YINA 1KNPA 5AQVB 2V6YA 3AE4A 1YXRA 4HFCA 4OYKA 2LJLA 3H3MA 4JI3T 4JEHB 3ZMSB 4JUYA 4FI5A 4QH5A 3AEAA 2F4VT 4KI0F 2NTYA 4ZI2C 1ZHCA 2XAHB 3UUXB 3F2EA 3CWZB 2VQET 3PUYF 5LXTE 3ZCIA 2V6XA 3LFMA 4TWFA 3WAJA 1W0AA 3RI5A 3SOLA 2DCFA 2LT3A 2DL1A 1UCUA 2NWBA 5JDLA 1D0ZA 3KV6A 5TAOA 2ZM8A 5L3BB 5CJ5A 3C4XA 2WBLA 1YQ4A 1B7TA 1I94T 5HXEA 4YSXA 4ZI3D 4YTPA 3PTRB 5ABEA 3LBXB 5DABA 3DJBA 2W66A 5LMNT 4V1Av 4P0AA 3CX8B 2Q9QD 2X9HA 1ZP0A 3SFEA 3ZMZB 3CX7B 4O2AE 3AA1B 3N9QA 1E2AA 3MZKB 2V6YB 3ZYKA 4O2BE 5HXHA 3RIUA 3UFEA 2JMKA 4U7IA 2W00A 3AE9A 3RKOA 5JREA 3E08A 3MKDA 4DR4T 1WYCA 1KEYA 4YXDA 2WM9A 3ZT7A 4BA9A 5HEHA 2XQ9A 3CQCB 4UF0A 2JQQA 3LDQB 4QKNA 3AECA 2BKNA 2EHOD 4O8SA 1NEKA 2W0GA 1SE7A 2V7MA 3PJAJ 3N9MA 3EUHA 2YDSA 3RKGA 2V7JA 3DTOA 2BKOA 5LJNA 5AQSB 5LJMA 2CCQA 2Y6XA 3M65A 3FXEB 2SPCA 3IEEA 3E0ZA 3VKGA 5EK4A 4TNWA 2WMNA 3EI0A 3AE7A 5ADXL 4NXNT 1MNEA 4BJNA 3VRAA 3N9LA 5ABHA 2ZM6T 4ILUA 3FZFB 1M62A 2QGSA 1HX1B 3GN5A 2GK9A 2WAUA 3UT5E 3L8RA 2X68A 4DV0T 5JTGA 3FBZA 3UUBA 4PFPA 5IWAT 2XAFB 5J2TE 2X0HA 4O4LE 4UF0B 5EK2A 5EZYE 4OYJA 3UU8A 3JAEA 2UXCT 2IC9A 4P0BA 5LP6E 3A7MA 3D0TA 4DR3T 4P09A 4WBNE 2Z6EA 3N9NA 1D1CA 2IIUA 1HNZT 5EK3A 4CN4A 2UXBT 4X66T 5HCMA 4P1NA 2VVSA 4EIWA 4ISTA 3R6NA 3QUJA 3QB5A 5LGTB 2NW9A 2LRLA 4B3MT 4LF9T 3ZCJA 5AQTB 2RP4A 3AE2A 4PJMA 4UVBB 5JR9A 4IHJE 5FL1A 2C5KT 2W63A 2WDVA 3S4UA 4F8HA 4IL9A 3GN5B 2R6GF 4PNIA 2PG8A 4TUYE 5LYJE 3ESLA
chains in the Genus database with same CATH topology
4F6RC 1HS7A 2UXNB 1IJ5A 1FIOA 4ANJA 2KLQA 2BZBA 1MMGA 3ZYLA 5C8YE 3C98B 2EHOB 2XTLA 4J2CA 5DQVA 4L9IA 4CI3B 1E1HB 3KVBA 3O1JA 2ZMAA 4IGUA 1MIYA 4PFOA 3ZMVB 5A1LA 1H7CA 4UEMA 3BQIA 2ES0A 3WAKA 1YD8G 5CA0E 3PUQA 4ZS3A 2RA1A 4DMWA 2PBIA 3I0OA 4UIGA 3VHLA 5L2LA 1BR2A 2CWOA 4GYSA 2NTXA 3O4XE 3N5LA 2HH7A 3K3OA 3NZPA 2HPLA 1ZV4X 4PJNA 4DBRA 5LGNB 4AKGA 5JDHA 2K24A 2ZM0A 3NRXA 1IZNB 4EZHA 1HG2A 3BQLA 4ASKA 3OYZA 1D1BA 4KUMB 3LJCA 4EYYR 2LSJA 5LA6E 4G63A 3C50A 3ZEFB 3AAEB 1MMAA 3KDSE 2H7OA 2MOZA 4PW8A 4PK5A 5JVDE 5KMGP 3KV5A 2LM9A 1Y64B 4YJ2E 2YU1A 4H9QC 3ESLA 3FXDB 5HWYA 5FXXA 4HFVA 1HX8A 1MMNA 4L0RA 4IIJE 5J2UE 4KMCA 2VL8A 2ODUA 4A56A 3KV4A 5LG4A 5KDMC 4CZZB 2V7IA 4KBMB 2A3DA 4U74A 5FXWA 2NW7A 2YU2A 1WYBA 2IC6A 2ACXA 3B57A 2CA5A 3HKEE 5JH7E 5JR9B 1QSDA 2LSKA 3P8CD 2H7VC 2CLYB 2KINB 2JJ9A 3H3AA 4ISSA 3JC6D 4E7ZA 2LSYA 2ODVA 2NP9A 2LSGA 3ZC0A 2L9QA 3ZJ2A 2BVMA 4HGAA 2V7KA 3FBLA 3C51A 3CPZA 3N9OA 3AA6B 4YHJA 2NW8A 3OYXA 4UELA 5FY7A 4H9PC 4ZI2D 2CE7A 4AI6A 2CLYC 4MBQA 3FB2A 4MALA 2L8KA 5LHGB 4QX7B 3MK7C 1D0XA 2PJQA 4TV9E 2WMOA 3RC8A 1LKXA 3P7IA 3PUAA 3C4ZA 5FXVA 5JDQA 4H9RC 1IAPA 3SRZA 3W15B 1KK7A 3C4WA 4X20E 3QC9A 1BR1A 4YJ3E 2XUEA 3HL6A 3LBXA 4QWNB 4ERRA 4N78D 3NZQA 4BAYB 2X9XA 3KVAA 4YLHA 3AVRA 3FHNA 5CB4E 5HYAA 2WSSV 2A72A 2JMHA 3RYCE 2DI4A 2DWKA 5HXCA 3HKBE 4JLEA 3UUMA 3KBTA 1HG5A 3Q2MA 2X9WA 4PK4A 3C64A 2K48A 2YINA 4ZS2A 5HAXA 4ADZA 4UV9B 4YFSA 3HR0A 3JC6C 4MLKA 2NOXA 3OJAA 1HTJF 4PK6A 4OYKA 2LJLA 4OHFA 3U78A 2VB6A 3MXZA 1V9DA 3I0QA 2N1GA 3HKCE 3VKHA 4JEHB 3ZMSB 2KT9A 4FI5A 4JUYA 2KNDA 2A2FX 2NTYA 5H6RB 3Q5XA 2G0UA 3CMLA 4ZI2C 1ZHCA 2XAHB 2Q9QA 4H9NC 3E22E 3UUXB 2MYSA 3F2EA 2JRKA 2MTQA 5GONE 3LK42 3CWZB 4E7SA 4ZI7E 3ETVA 4XBFB 1FEWA 4OK0A 4AKHA 5LXTE 2X0LB 3ZCIA 3O9XA 4ZOLE 3RRCA 5JDFA 3LFMA 3WAJA 3PURA 2LEHA 4H9SE 2P9BA 3PU3A 3TKLB 4WW0A 3ZN1B 3SOLA 5DQWA 2DCFA 4C91A 4X1IE 2CXDA 2E9XD 4HTEA 4WNKA 3KV9A 2LT3A 2LHNA 4X1KE 1UCUA 2VK9A 2NWBA 2VKDA 3UTKA 5JDLA 4QXBB 5ETWA 5LCYA 4QX8B 1D0ZA 3KV6A 4H9OC 1HCIA 5TAOA 2ZLYA 2ZM8A 2CWYA 1X79A 2CM0A 5L3BB 1FMVA 1FMWA 3GWHA 3AA7B 1OXZA 3C4XA 4AQFC 2WBLA 2YEVC 1B7TA 5HXEA 4TN7B 4X1YE 2XHEB 3AA0B 4ZI3D 3PTRB 2XAJB 3ETUA 3LBXB 4MHCA 4XZCA 5DABA 3SS1A 3OBVE 4I55E 3AAIA 4TZ4C 3DJBA 2QA7A 4V1Av 2CMRA 3CX8B 5IYZE 4IE6A 4P0AA 2Q9QD 3ZLIA 2X9HA 4HKAA 1AJ3A 1HF8A 3ONXA 1VRBA 3ZMZB 3B13A 5JRCA 4GOUA 2CXLA 4WBOA 3CX7B 4O2AE 3AA1B 1KNZA 4AQFA 5HWXA 4O4JE 2H3RA 2K9AA 3AVSA 3N9QA 2DHRA 2C0SA 4U72A 3MZKB 3ZYKA 4H63H 3CQGB 3V5SA 3H37A 4O2BE 5HXHA 2X66A 4HEAA 2E8IA 3LK2B 2VKJA 3UFEA 2JMKA 4MFRA 3RRWA 4EOZB 3KINB 1BR4A 4QHOA 2PFVA 3I9WA 2CEAA 2W00A 3RKOA 2KZ7B 5JREA 3E08A 3LK3B 3MKDA 1U4QA 4UV8B 2N9DA 3NRYA 5LNKA 5KX5E 1Z0PA 5FMNA 3O1HA 5HXSA 4UVAB 2Q9QB 4UXNB 1G8XA 4CQIA 1VOMA 1WYCA 4O4IE 5JDGA 2E9XA 3K8PC 1LRZA 3ANWA 2XAQB 5DJQC 2XASB 2X67A 1UX5A 2WM9A 3RYIE 4ZI3C 4GK0E 4TV8E 4BA9A 3HA4A 3HKDE 3RYFE 3GA8A 2B1EA 2VASA 3ZPOA 4CXXA 4I4TE 1MMDA 3ZJ1A 4AKIA 3CQCB 4UF0A 2JQQA 2I59A 2Q9QC 4QKNA 2D0UA 3MACA 3O1IA 3UULA 2EHOD 1U5PA 3KBUA 4IE7A 2V26A 4O8SA 5FXZA 1SHZC 3RYHE 2MBGA 1ZKEA 2W0GA 4BJMA 3J7Yq 2L3LA 2W61A 4GK5E 1MNDA 4I50E 2V7MA 3N9MA 3EUHA 1IJ6A 2C5IT 2X9YA 2DWGA 2XQYA 4HN9A 1WR6A 4UVCB 1G73A 1NWMX 2V7JA 4EXTA 3DTOA 4XAXB 3IF8B 4M1PA 1YKHB 3IHRA 3Q5WA 4H63V 5LJNA 3NBXX 5LGUB 5LJMA 2Y8DA 4QXHB 3LG7A 3MA9A 3WI3A 2CCQA 2Y6XA 3M65A 4IE0A 1LVFA 5LOVE 3FXEB 4EYUA 2D0TA 3DP7A 2SPCA 3IEEA 3E0ZA 3PU8A 2M67A 5FYMA 3VKGA 5F3JA 5EK4A 2D5UA 2WMNA 2N2NA 5AFUL 4GIWA 5FY0A 5ADXL 5JRCB 1MNEA 2KWIB 2ZM2A 3BQKA 4BJNA 4DVDA 3K3NA 2YK0A 4AKLA 2LHRA 2LOSA 3N9LA 4TX5A 3VU7H 4AXPA 3KFWX 5CA1E 2LOPA 5LHIB 2K5BB 2IW5B 5BMVE 4TUYE 4ILUA 3MJXA 2LSIA 4FJOA 4JEUB 4QXCB 2OA5A 4I43B 2EHOC 4EB6E 5IHYA 2QGSA 5HXRA 5LBQB 3AB3B 3GN5A 3F31A 1S35A 2GK9A 2WAUA 4CI1B 5LBMA 2LE8A 4NUVA 3UT5E 4PAGA 2X68A 4O4HE 3EDUA 4DO0A 3FBZA 3EVYA 3RC3A 1ZEEA 3HI2A 3PE0A 2E9XB 3ZMTB 3ANWB 2EHOA 2C5JA 3AAAB 3L3PA 2IAKA 4K0UA 4PFPA 2HPJA 3RX6A 2XAFB 3ZC1A 1D1AA 2VKHA 3J9X1 3CQXC 1NAFA 5L3FB 3F57A 5J2TE 5M4YA 2D2SA 2UXXB 4OFZA 4O4LE 4UF0B 5FNVE 5L3CB 5FP3A 5EK2A 2V7LA 5EZYE 4OYJA 2E9XC 2IC9A 3PUGA 4P0BA 3GMIA 1WLXA 5LP6E 1EZ3A 3D0TA 4IDZA 1HFAA 3RPUA 4P09A 4WBNE 1WRDA 4G2AA 1SA0E 4GYRA 4IE4A 5H6QB 3EDVA 2Z6EA 3N9NA 1D1CA 3A5XA 4DBQA 4IE5A 4DNDA 2KXPB 3N2KE 3CX6B 5EK3A 4B6XA 3R84B 3I1AA 1O3XA 2XAGB 2JPFA 2W62A 1YKEB 5JR9C 5J1GA 3BK9A 3N2OA 1CUNA 3T8OA 3Q9DA 4AQGA 4EIWA 4ISTA 2CXFA 1S94A 2KWHA 1US7B 2J1DG 3R6NA 3K3QC 3QUJA 5LGTB 4KP3C 3UUNA 2NW9A 5JDMA 3PUSA 2DNXA 5E0OA 3CKDA 3L09A 2BDEA 1UX4A 3N2GE 4CI2B 3ZCJA 4EZ4A 2RP4A 5JDNA 4PJMA 4UVBB 1BR0A 3I9YA 4C90A 3QK6A 5JR9A 4DMVA 5FY1A 4IHJE 2BVLA 4L5GA 3ZN0B 1QUUA 2WWUA 3U3IA 1YW0A 4EAHA 1OWAA 3ZYMA 5L3GB 2C5KT 2W63A 5JQGE 3S4UA 2Y48B 4CXYA 4NUUA 4PJLA 1MIWA 5F8PA 3OKQA 4CXWA 2X51A 3PDYA 2DLRA 4HE8A 4Z8XA 4ZHQE 5LHHB 3IBPA 5L3EB 2V1DB 1D0YA 1T98A 1MIVA 3GN5B 2VWAA 5L3DB 3RH3A 3SWHA 3V5UA 4AKRB 4PJJA 4PNIA 1LVKA 3N9PA 2PG8A 3ZMUB 2VKOA 5LYJE 2KMFA 3CVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O4X E;  3OBV E;  2J1D G;  1V9D A;  1UX5 A;  1UX4 A;  2Z6E A;  1Y64 B;  4EAH A; 
#chains in the Genus database with same CATH topology
 4F6R C;  5FKY A;  3P50 A;  1VCT A;  3KVB A;  2UXD T;  2ZMA A;  5HEO A;  3RIF A;  2ES0 A;  2PTF A;  4B3S T;  4DMW A;  2PBI A;  4GKJ T;  4KX6 A;  3VHL A;  5L2L A;  2CWO A;  2V8S V;  2HPL A;  2WS3 A;  4Q25 A;  3OYZ A;  3LJC A;  4JI5 T;  4EYY R;  1WR0 A;  3AAE B;  3KDS E;  2H7O A;  3KV5 A;  2LM9 A;  1Y64 B;  5AQG B;  5FXX A;  4IIJ E;  5J2U E;  2XM1 A;  3T1H T;  3CIR A;  1WCR A;  2AXD S;  2JIW A;  2ACX A;  5JH7 E;  3HKE E;  5JR9 B;  2H7V C;  3H3A A;  4E7Z A;  2LSG A;  2WP9 A;  2L9Q A;  3ZJ2 A;  3ZC0 A;  4HGA A;  3FBL A;  3CPZ A;  5FY7 A;  4DV7 T;  4ZI2 D;  2CLY C;  3FB2 A;  4QX7 B;  5JDQ A;  4H9R C;  4QH1 A;  3C4W A;  1BR1 A;  2WSS V;  3KBT A;  3EHZ A;  2X9W A;  4PK4 A;  4ZS2 A;  3PV0 F;  4YFS A;  3HR0 A;  2LKG A;  2XQ8 A;  3JC6 C;  4MLK A;  3U78 A;  2VB6 A;  2N1G A;  3VKH A;  3VR9 A;  1T8B A;  1IBK T;  2G0U A;  3P4P A;  1XMO T;  2Q9Q A;  3E22 E;  3FZM B;  5GON E;  3LK4 2;  3ETV A;  2YDR A;  4WZX A;  4LF6 T;  3PUR A;  3ZT5 A;  5LMU T;  1HR0 T;  2P9B A;  3PU3 A;  2XQA A;  3TKL B;  3ZN1 B;  5DQW A;  2CXD A;  2E9X D;  2LHN A;  4X1K E;  2VK9 A;  3UTK A;  3UU6 A;  4HWF A;  4QX8 B;  4DR1 T;  2CM0 A;  1FMW A;  3AA7 B;  2YEV C;  1KNR A;  4XZC A;  4I55 E;  3RIU C;  3AAI A;  2I0M A;  4TZ4 C;  1IBM T;  4IE6 A;  3ZLI A;  4YY3 T;  1VRB A;  3B13 A;  2M6I A;  4WBO A;  5JRC A;  1KNZ A;  4DV5 T;  4O4J E;  2C0S A;  4H63 H;  3V5S A;  3H37 A;  4NPP A;  4EGW A;  3RRW A;  3KIN B;  3I9W A;  4ZXL A;  4ZZB A;  1U4Q A;  2N9D A;  5L4H A;  1Z0P A;  2E2A A;  3AE6 A;  2Q9Q B;  3ONL C;  1VOM A;  4AIU A;  2XQ3 A;  1UX5 A;  3X1D A;  1W0B A;  5KXJ A;  4JI0 T;  4EED A;  3RYF E;  2B1E A;  3AEE A;  1XZY A;  2D0U A;  3UUL A;  1U5P A;  4IE7 A;  2V26 A;  3A8Y C;  1SHZ C;  1J5E T;  2FBW A;  1ZKE A;  4BJM A;  3J7Y q;  2CPT A;  4I50 E;  5L47 A;  2IUB A;  4EXT A;  1YKH B;  3PUV F;  3MA9 A;  2ACZ A;  3DP7 A;  5FYM A;  2M67 A;  5JRC B;  5AQN B;  2KWI B;  4AKL A;  2LOS A;  3VR8 A;  2LOP A;  3MJX A;  3OVU A;  4QXC B;  4I43 B;  5AQK B;  2FJB A;  5LBM A;  2BBH A;  4PAG A;  4LMJ A;  3EDU A;  3EVY A;  1XMQ T;  3PE0 A;  5IUX A;  3AAA B;  3L3P A;  4X5T A;  3CQX C;  1FJG T;  4IDO A;  2D2S A;  4U2Y A;  4IDP A;  2E9X C;  4LMK A;  3AEG A;  1EZ3 A;  1HFA A;  1JNR A;  2K3W A;  4IE4 A;  2HN1 A;  3EDV A;  4NIQ A;  4DBQ A;  3UU3 A;  1W9R A;  1O3X A;  3K1S A;  2JPF A;  5JR9 C;  2UUA T;  3N2O A;  2MPK A;  2I6H A;  1US7 B;  2J1D G;  4KP3 C;  3PUS A;  2DNX A;  5E0O A;  1UX4 A;  3N2G E;  4C90 A;  2BVL A;  1L0V A;  1OWA A;  5JQG E;  4NUU A;  2E5V A;  3TLS A;  4CXW A;  2XM2 A;  4TWH A;  3PDY A;  4ZHQ E;  2V1D B;  1MIV A;  3SWH A;  3V5U A;  4AKR B;  2QRX A;  3CVR A;  2UXN B;  2KLQ A;  2BZB A;  1MMG A;  2M6B A;  3ZYL A;  5C8Y E;  4J2C A;  4L9I A;  2W2U A;  4CI3 B;  4LF4 T;  1E1H B;  2WB5 A;  5C3J A;  5AQH B;  2J47 A;  2YDQ A;  5AQF B;  4IGU A;  3P4W A;  5CA0 E;  1YD8 G;  2J62 A;  4ZS3 A;  2RA1 A;  5HEG A;  4JBW F;  4NXM T;  4GYS A;  3O4X E;  3NZP A;  3P4R A;  1ZV4 X;  4DBR A;  5LGN B;  2JQ9 A;  2K24 A;  1IZN B;  4DV6 T;  1HG2 A;  3BQL A;  2HN2 A;  5LA6 E;  3C50 A;  2UU9 T;  4PW8 A;  4COF A;  5JVD E;  4H9Q C;  1T7S A;  2XZE A;  4KMC A;  1GQE A;  2VL8 A;  5KDM C;  3QNU A;  2BS2 A;  5FXW A;  4ILA A;  3NWI A;  3OPC A;  2IC6 A;  3B57 A;  2CA5 A;  1QSD A;  2LSK A;  3B5M A;  2JJ9 A;  4ISS A;  3JC6 D;  2ODV A;  2NP9 A;  2BVM A;  2V7K A;  1YQ3 A;  3AA6 B;  3OYX A;  2XY8 B;  2CE7 A;  4MAL A;  5LHG B;  4JV5 T;  5AQO B;  1UK5 A;  3RC8 A;  1LKX A;  3PUA A;  5FXV A;  1OED A;  3SRZ A;  4X20 E;  1OED E;  5J0Z A;  2WY2 A;  2XSA A;  3NZQ A;  3KVA A;  4ILB A;  5CB4 E;  4X65 T;  3RYC E;  2DWK A;  4EV6 A;  4I0U A;  3C64 A;  2K48 A;  2FJD A;  4Z90 A;  2NOX A;  4IDQ A;  3OJA A;  1HTJ F;  4PK6 A;  3FZL B;  4GKK T;  2AE9 A;  3JAF A;  3HKC E;  2KT9 A;  2KND A;  2QVA A;  3CML A;  4H9N C;  5AQI B;  2MYS A;  2IML A;  2JRK A;  3TLV A;  4ZI7 E;  2H89 A;  4XBF B;  4OK0 A;  5JDF A;  2XQ5 A;  4H9S E;  4HFI A;  1HNX T;  4X1I E;  1W09 A;  3KV9 A;  2BBJ A;  3UQ4 A;  5HEU A;  3FZK B;  5ETW A;  5LCY A;  4H9O C;  1HCI A;  4CN1 A;  2ZLY A;  2CWY A;  3GWH A;  2E5L T;  2HHH T;  4HFH A;  1OXZ A;  1OED B;  4U33 A;  4TN7 B;  2XAJ B;  3ETU A;  4MHC A;  4A98 A;  2CMR A;  3ONX A;  4DR5 T;  4IL4 A;  4GOU A;  4DV1 T;  4AQF A;  5HWX A;  4X64 T;  2H3R A;  1J5W A;  3AVS A;  2DHR A;  3NKZ A;  2WZH A;  3CQG B;  4LF7 T;  4MFR A;  2WCA A;  4JI8 T;  1BR4 A;  2PFV A;  1X9B A;  3LK3 B;  5KX5 E;  3O1H A;  5HXS A;  3ZSS A;  4UXN B;  4CQI A;  4U3C A;  5JDG A;  3LSV A;  3RIA A;  2BKP A;  2X67 A;  2XAS B;  3RYI E;  3HKD E;  3EAB A;  2VAS A;  1MMD A;  3ZJ1 A;  2I59 A;  2VUR A;  4ZZC A;  3MAC A;  3O1I A;  4LFA T;  5BR8 T;  3KBU A;  5FXZ A;  2MBG A;  2YN6 A;  1N34 T;  2L3L A;  3TLW A;  1IJ6 A;  2X9Y A;  4LML A;  4YT0 A;  2DWG A;  2XQY A;  4DV3 T;  4YHH T;  1NEN A;  1NWM X;  4XAX B;  3IF8 B;  4H63 V;  3Q5W A;  3NBX X;  5LGU B;  4Z91 A;  2Y8D A;  4QXH B;  3WI3 A;  2D0T A;  4B3R T;  3AEB A;  3PU8 A;  2D5U A;  1HNW T;  2XQ4 A;  4K0K T;  2ZM2 A;  3BQK A;  4DVD A;  2YK0 A;  4JI2 T;  4TX5 A;  4AXP A;  3KFW X;  5CA1 E;  3PUW F;  5LHI B;  4JEU B;  2OA5 A;  3AE8 A;  4HWI B;  1UUS A;  3F31 A;  2YKS A;  4NUV A;  3JCF A;  3PUZ F;  4O4H E;  3RF1 A;  3ONJ A;  3RC3 A;  3ZMT B;  2EHO A;  2C5J A;  2KSR A;  4K0U A;  3RX6 A;  3ZC1 A;  4YSZ A;  1XNQ T;  2VKH A;  4CN6 A;  2RPA A;  3F57 A;  4OFZ A;  4YSY A;  4HWH A;  5FNV E;  5FP3 A;  1SUM B;  2WDQ A;  3TLT A;  2JQK A;  1Y01 A;  5ABF A;  1JNZ A;  3PUG A;  3GMI A;  1WRD A;  1SA0 E;  5H6Q B;  3A5X A;  4DND A;  2KXP B;  3N2K E;  3R84 B;  3BK9 A;  3T8O A;  3Q9D A;  1S94 A;  4ZEY A;  3UU4 A;  3UUN A;  5JDM A;  1WFD A;  3CKD A;  5HEJ A;  3EAM A;  3UU5 A;  3QK6 A;  3AE1 A;  3ZN0 B;  1QUU A;  1YW0 A;  2LKH A;  4EAH A;  5L3G B;  4CXY A;  5F8P A;  2XSB A;  3OKQ A;  2X51 A;  4Z8X A;  4HE8 A;  2X0Y A;  2UUB T;  2WDR A;  2VWA A;  1KFY A;  5L3D B;  3N9P A;  2BG9 A;  3LG7 A;  1IJ5 A;  1FIO A;  2BG9 E;  4ANJ A;  3C98 B;  2EHO B;  5DQV A;  2WU5 A;  4DV4 T;  3SFD A;  3ZMV B;  3PUQ A;  4EEB A;  1KF6 A;  3I0O A;  2WZI A;  4UIG A;  5ABF B;  3K3O A;  4TNV A;  2CHN A;  2ZM0 A;  3NRX A;  1XWM A;  1D1B A;  2LSJ A;  1VCS A;  4G63 A;  3ZEF B;  1MMA A;  1N36 T;  4U2Z A;  4PK5 A;  5KMG P;  4DR6 T;  5HWY A;  3FXD B;  1MMN A;  3T1Y T;  4DUZ T;  4A56 A;  5FVL A;  3KV4 A;  5LG4 A;  4CZZ B;  1CHU A;  5AQM B;  4KBM B;  4IDN A;  4U74 A;  2NW7 A;  1IBL T;  4DID B;  3OTO T;  2CLY B;  2KIN B;  2LRK A;  1OED C;  4YTN A;  1I6Z A;  2D9D A;  2CRB A;  3C51 A;  2CBI A;  4YHJ A;  4H9P C;  4AI6 A;  4MBQ A;  2L8K A;  2BG9 B;  4TV9 E;  3P7I A;  4U31 A;  1N32 T;  3W15 B;  3RLF F;  3L39 A;  4YJ3 E;  2XUE A;  3HL6 A;  3UQ7 A;  4U7Y A;  4N78 D;  4BAY B;  2X9X A;  5HCJ A;  4YLH A;  2CBJ A;  1UGO A;  5HYA A;  2A72 A;  2JMH A;  3HKB E;  1HG5 A;  3Q2M A;  5AQL B;  5HAX A;  4ADZ A;  2W4X A;  2XQ7 A;  4DUY T;  4UV9 B;  4OHF A;  3MXZ A;  1UUR A;  1V9D A;  3I0Q A;  1XDP A;  5AQJ B;  2XJ7 A;  2A2F X;  5L4E A;  5H6R B;  3Q5X A;  4ILC A;  5AQQ B;  2MTQ A;  4E7S A;  4AKH A;  1FEW A;  2X0L B;  3O9X A;  4ZOL E;  3RRC A;  2VVN A;  2LEH A;  4WW0 A;  4JYA T;  4C91 A;  4DR2 T;  4HTE A;  3AXJ A;  4WNK A;  1Z8U A;  2BS4 A;  2JQH A;  2VKD A;  4QXB B;  4KHP T;  4B3T T;  1M7K A;  1X79 A;  1FMV A;  2WWV A;  4AQF C;  1DU2 A;  4X1Y E;  2XHE B;  3AA0 B;  3SS1 A;  3OBV E;  2QA7 A;  2YOE A;  5IYZ E;  4A5X A;  4HKA A;  1AJ3 A;  1HF8 A;  2CXL A;  4JI7 T;  2K9A A;  3AED A;  4U72 A;  3QOF A;  3RQW A;  4KHZ F;  2X66 A;  4HEA A;  2E8I A;  3LK2 B;  2VKJ A;  4LFC T;  4EOZ B;  4WYV A;  4QHO A;  4LF8 T;  2CEA A;  2KZ7 B;  4UV8 B;  3NRY A;  5LNK A;  5FMN A;  4UVA B;  1G8X A;  4IT4 A;  4O4I E;  2E9X A;  3K8P C;  1LRZ A;  3ANW A;  2XAQ B;  5DJQ C;  4DV2 T;  4ZI3 C;  4GK0 E;  4TV8 E;  3HA4 A;  5FVK A;  3GA8 A;  3ZPO A;  3P4S A;  4CXX A;  4I4T E;  4AKI A;  2WU2 A;  2A9U A;  3G06 A;  3FZH B;  2Q9Q C;  3AXJ B;  3RHW A;  3RYH E;  2W61 A;  4GK5 E;  4UR9 A;  5F5W A;  1MND A;  2IHR 1;  2C5I T;  4HN9 A;  1WR6 A;  4UVC B;  3IA3 A;  1G73 A;  2QYW A;  2UUC T;  4M1P A;  3IHR A;  4HWC A;  4IE0 A;  1LVF A;  5LOV E;  3UFG A;  4EYU A;  5FL0 A;  4AQY T;  3RGL A;  5F3J A;  2LM2 A;  2N2N A;  5AFU L;  2CHO A;  4GIW A;  5FY0 A;  2VQF T;  3PUX F;  3QB5 K;  3K3N A;  2LHR A;  5CGM A;  3VU7 H;  2H88 A;  2K5B B;  4AIS A;  2IW5 B;  5BMV E;  2LSI A;  4FJO A;  2EHO C;  4DR7 T;  4EB6 E;  5IHY A;  5HXR A;  5LBQ B;  3AB3 B;  1S35 A;  4JI6 T;  4TWD A;  4YTM A;  4CI1 B;  2LE8 A;  4OX9 T;  2VL0 A;  4DO0 A;  5LG3 A;  2BS3 A;  1ZEE A;  3HI2 A;  3ZT6 A;  3RQU A;  2E9X B;  3ANW B;  3AE3 A;  4HFB A;  2IAK A;  3Q5D A;  2HPJ A;  1D1A A;  3J9X 1;  3JAD A;  1NAF A;  5L3F B;  3P4Q A;  5M4Y A;  2UXX B;  5L3C B;  2V7L A;  2FJE A;  4HWD A;  1WLX A;  4IDZ A;  3RPU A;  5C2T A;  3ZST A;  4G2A A;  4GYR A;  5AQP B;  4IE5 A;  3AE5 A;  3CX6 B;  4B6X A;  3I1A A;  2XAG B;  5LB7 B;  2W62 A;  1YKE B;  4LF5 T;  1QLB A;  5J1G A;  1CUN A;  4AQG A;  2CXF A;  2KWH A;  2W67 A;  3K3Q C;  2OLT A;  3L09 A;  2BDE A;  5JDN A;  4CI2 B;  4EZ4 A;  1BR0 A;  3I9Y A;  4IRE A;  4DMV A;  2BG9 C;  5FY1 A;  4L5G A;  2WWU A;  3U3I A;  3ZYM A;  2Y48 B;  1N33 T;  4PJL A;  1MIW A;  2FJA A;  2DLR A;  5LHH B;  4LFB T;  2OV9 A;  3IBP A;  5L3E B;  1D0Y A;  1T98 A;  5ABG A;  2XQ6 A;  3RH3 A;  4PJJ A;  1XNR T;  1LVK A;  3ZMU B;  2VKO A;  2KMF A;  1HS7 A;  3M3Z B;  2MAW A;  2NR4 A;  2XTL A;  3ZKR A;  3O1J A;  2FUP A;  1MIY A;  4PFO A;  5A1L A;  1H7C A;  4UEM A;  3BQI A;  3WAK A;  4QH4 A;  1T72 A;  2XPK A;  1BR2 A;  2NTX A;  3N5L A;  2HH7 A;  4PJN A;  4AKG A;  5JDH A;  3VRB A;  4EZH A;  3CK6 A;  4ASK A;  4KUM B;  2MOZ A;  4YJ2 E;  2YU1 A;  4HFV A;  1HX8 A;  2B76 A;  4L0R A;  1XDO A;  2ODU A;  3Q5E A;  3TLU A;  2IDO B;  2V7I A;  4HFE A;  2A3D A;  2YU2 A;  1WYB A;  4HFD A;  3P8C D;  4JI1 T;  1E7P A;  2LSY A;  4JI4 T;  4A97 A;  3N9O A;  2V5D A;  2NW8 A;  4UEL A;  5AQR B;  4X62 T;  3AEF A;  5CFB A;  1J1J A;  3NVO A;  2WQY A;  3MK7 C;  1D0X A;  2V5C A;  2PJQ A;  2WMO A;  3C4Z A;  1IAP A;  2J4G A;  1KK7 A;  3ABV A;  3PJA A;  3QC9 A;  3LBX A;  5AQU B;  4QWN B;  4ERR A;  2LLY A;  3AVR A;  3FHN A;  1ZOY A;  1R8I A;  2DI4 A;  5HXC A;  4JLE A;  3UUM A;  2YIN A;  1KNP A;  5AQV B;  2V6Y A;  3AE4 A;  1YXR A;  4HFC A;  4OYK A;  2LJL A;  3H3M A;  4JI3 T;  4JEH B;  3ZMS B;  4JUY A;  4FI5 A;  4QH5 A;  3AEA A;  2F4V T;  4KI0 F;  2NTY A;  4ZI2 C;  1ZHC A;  2XAH B;  3UUX B;  3F2E A;  3CWZ B;  2VQE T;  3PUY F;  5LXT E;  3ZCI A;  2V6X A;  3LFM A;  4TWF A;  3WAJ A;  1W0A A;  3RI5 A;  3SOL A;  2DCF A;  2LT3 A;  2DL1 A;  1UCU A;  2NWB A;  5JDL A;  1D0Z A;  3KV6 A;  5TAO A;  2ZM8 A;  5L3B B;  5CJ5 A;  3C4X A;  2WBL A;  1YQ4 A;  1B7T A;  1I94 T;  5HXE A;  4YSX A;  4ZI3 D;  4YTP A;  3PTR B;  5ABE A;  3LBX B;  5DAB A;  3DJB A;  2W66 A;  5LMN T;  4V1A v;  4P0A A;  3CX8 B;  2Q9Q D;  2X9H A;  1ZP0 A;  3SFE A;  3ZMZ B;  3CX7 B;  4O2A E;  3AA1 B;  3N9Q A;  1E2A A;  3MZK B;  2V6Y B;  3ZYK A;  4O2B E;  5HXH A;  3RIU A;  3UFE A;  2JMK A;  4U7I A;  2W00 A;  3AE9 A;  3RKO A;  5JRE A;  3E08 A;  3MKD A;  4DR4 T;  1WYC A;  1KEY A;  4YXD A;  2WM9 A;  3ZT7 A;  4BA9 A;  5HEH A;  2XQ9 A;  3CQC B;  4UF0 A;  2JQQ A;  3LDQ B;  4QKN A;  3AEC A;  2BKN A;  2EHO D;  4O8S A;  1NEK A;  2W0G A;  1SE7 A;  2V7M A;  3PJA J;  3N9M A;  3EUH A;  2YDS A;  3RKG A;  2V7J A;  3DTO A;  2BKO A;  5LJN A;  5AQS B;  5LJM A;  2CCQ A;  2Y6X A;  3M65 A;  3FXE B;  2SPC A;  3IEE A;  3E0Z A;  3VKG A;  5EK4 A;  4TNW A;  2WMN A;  3EI0 A;  3AE7 A;  5ADX L;  4NXN T;  1MNE A;  4BJN A;  3VRA A;  3N9L A;  5ABH A;  2ZM6 T;  4ILU A;  3FZF B;  1M62 A;  2QGS A;  1HX1 B;  3GN5 A;  2GK9 A;  2WAU A;  3UT5 E;  3L8R A;  2X68 A;  4DV0 T;  5JTG A;  3FBZ A;  3UUB A;  4PFP A;  5IWA T;  2XAF B;  5J2T E;  2X0H A;  4O4L E;  4UF0 B;  5EK2 A;  5EZY E;  4OYJ A;  3UU8 A;  3JAE A;  2UXC T;  2IC9 A;  4P0B A;  5LP6 E;  3A7M A;  3D0T A;  4DR3 T;  4P09 A;  4WBN E;  2Z6E A;  3N9N A;  1D1C A;  2IIU A;  1HNZ T;  5EK3 A;  4CN4 A;  2UXB T;  4X66 T;  5HCM A;  4P1N A;  2VVS A;  4EIW A;  4IST A;  3R6N A;  3QUJ A;  3QB5 A;  5LGT B;  2NW9 A;  2LRL A;  4B3M T;  4LF9 T;  3ZCJ A;  5AQT B;  2RP4 A;  3AE2 A;  4PJM A;  4UVB B;  5JR9 A;  4IHJ E;  5FL1 A;  2C5K T;  2W63 A;  2WDV A;  3S4U A;  4F8H A;  4IL9 A;  3GN5 B;  2R6G F;  4PNI A;  2PG8 A;  4TUY E;  5LYJ E;  3ESL A; 
#chains in the Genus database with same CATH homology
 4F6R C;  1HS7 A;  2UXN B;  1IJ5 A;  1FIO A;  4ANJ A;  2KLQ A;  2BZB A;  1MMG A;  3ZYL A;  5C8Y E;  3C98 B;  2EHO B;  2XTL A;  4J2C A;  5DQV A;  4L9I A;  4CI3 B;  1E1H B;  3KVB A;  3O1J A;  2ZMA A;  4IGU A;  1MIY A;  4PFO A;  3ZMV B;  5A1L A;  1H7C A;  4UEM A;  3BQI A;  2ES0 A;  3WAK A;  1YD8 G;  5CA0 E;  3PUQ A;  4ZS3 A;  2RA1 A;  4DMW A;  2PBI A;  3I0O A;  4UIG A;  3VHL A;  5L2L A;  1BR2 A;  2CWO A;  4GYS A;  2NTX A;  3O4X E;  3N5L A;  2HH7 A;  3K3O A;  3NZP A;  2HPL A;  1ZV4 X;  4PJN A;  4DBR A;  5LGN B;  4AKG A;  5JDH A;  2K24 A;  2ZM0 A;  3NRX A;  1IZN B;  4EZH A;  1HG2 A;  3BQL A;  4ASK A;  3OYZ A;  1D1B A;  4KUM B;  3LJC A;  4EYY R;  2LSJ A;  5LA6 E;  4G63 A;  3C50 A;  3ZEF B;  3AAE B;  1MMA A;  3KDS E;  2H7O A;  2MOZ A;  4PW8 A;  4PK5 A;  5JVD E;  5KMG P;  3KV5 A;  2LM9 A;  1Y64 B;  4YJ2 E;  2YU1 A;  4H9Q C;  3ESL A;  3FXD B;  5HWY A;  5FXX A;  4HFV A;  1HX8 A;  1MMN A;  4L0R A;  4IIJ E;  5J2U E;  4KMC A;  2VL8 A;  2ODU A;  4A56 A;  3KV4 A;  5LG4 A;  5KDM C;  4CZZ B;  2V7I A;  4KBM B;  2A3D A;  4U74 A;  5FXW A;  2NW7 A;  2YU2 A;  1WYB A;  2IC6 A;  2ACX A;  3B57 A;  2CA5 A;  3HKE E;  5JH7 E;  5JR9 B;  1QSD A;  2LSK A;  3P8C D;  2H7V C;  2CLY B;  2KIN B;  2JJ9 A;  3H3A A;  4ISS A;  3JC6 D;  4E7Z A;  2LSY A;  2ODV A;  2NP9 A;  2LSG A;  3ZC0 A;  2L9Q A;  3ZJ2 A;  2BVM A;  4HGA A;  2V7K A;  3FBL A;  3C51 A;  3CPZ A;  3N9O A;  3AA6 B;  4YHJ A;  2NW8 A;  3OYX A;  4UEL A;  5FY7 A;  4H9P C;  4ZI2 D;  2CE7 A;  4AI6 A;  2CLY C;  4MBQ A;  3FB2 A;  4MAL A;  2L8K A;  5LHG B;  4QX7 B;  3MK7 C;  1D0X A;  2PJQ A;  4TV9 E;  2WMO A;  3RC8 A;  1LKX A;  3P7I A;  3PUA A;  3C4Z A;  5FXV A;  5JDQ A;  4H9R C;  1IAP A;  3SRZ A;  3W15 B;  1KK7 A;  3C4W A;  4X20 E;  3QC9 A;  1BR1 A;  4YJ3 E;  2XUE A;  3HL6 A;  3LBX A;  4QWN B;  4ERR A;  4N78 D;  3NZQ A;  4BAY B;  2X9X A;  3KVA A;  4YLH A;  3AVR A;  3FHN A;  5CB4 E;  5HYA A;  2WSS V;  2A72 A;  2JMH A;  3RYC E;  2DI4 A;  2DWK A;  5HXC A;  3HKB E;  4JLE A;  3UUM A;  3KBT A;  1HG5 A;  3Q2M A;  2X9W A;  4PK4 A;  3C64 A;  2K48 A;  2YIN A;  4ZS2 A;  5HAX A;  4ADZ A;  4UV9 B;  4YFS A;  3HR0 A;  3JC6 C;  4MLK A;  2NOX A;  3OJA A;  1HTJ F;  4PK6 A;  4OYK A;  2LJL A;  4OHF A;  3U78 A;  2VB6 A;  3MXZ A;  1V9D A;  3I0Q A;  2N1G A;  3HKC E;  3VKH A;  4JEH B;  3ZMS B;  2KT9 A;  4FI5 A;  4JUY A;  2KND A;  2A2F X;  2NTY A;  5H6R B;  3Q5X A;  2G0U A;  3CML A;  4ZI2 C;  1ZHC A;  2XAH B;  2Q9Q A;  4H9N C;  3E22 E;  3UUX B;  2MYS A;  3F2E A;  2JRK A;  2MTQ A;  5GON E;  3LK4 2;  3CWZ B;  4E7S A;  4ZI7 E;  3ETV A;  4XBF B;  1FEW A;  4OK0 A;  4AKH A;  5LXT E;  2X0L B;  3ZCI A;  3O9X A;  4ZOL E;  3RRC A;  5JDF A;  3LFM A;  3WAJ A;  3PUR A;  2LEH A;  4H9S E;  2P9B A;  3PU3 A;  3TKL B;  4WW0 A;  3ZN1 B;  3SOL A;  5DQW A;  2DCF A;  4C91 A;  4X1I E;  2CXD A;  2E9X D;  4HTE A;  4WNK A;  3KV9 A;  2LT3 A;  2LHN A;  4X1K E;  1UCU A;  2VK9 A;  2NWB A;  2VKD A;  3UTK A;  5JDL A;  4QXB B;  5ETW A;  5LCY A;  4QX8 B;  1D0Z A;  3KV6 A;  4H9O C;  1HCI A;  5TAO A;  2ZLY A;  2ZM8 A;  2CWY A;  1X79 A;  2CM0 A;  5L3B B;  1FMV A;  1FMW A;  3GWH A;  3AA7 B;  1OXZ A;  3C4X A;  4AQF C;  2WBL A;  2YEV C;  1B7T A;  5HXE A;  4TN7 B;  4X1Y E;  2XHE B;  3AA0 B;  4ZI3 D;  3PTR B;  2XAJ B;  3ETU A;  3LBX B;  4MHC A;  4XZC A;  5DAB A;  3SS1 A;  3OBV E;  4I55 E;  3AAI A;  4TZ4 C;  3DJB A;  2QA7 A;  4V1A v;  2CMR A;  3CX8 B;  5IYZ E;  4IE6 A;  4P0A A;  2Q9Q D;  3ZLI A;  2X9H A;  4HKA A;  1AJ3 A;  1HF8 A;  3ONX A;  1VRB A;  3ZMZ B;  3B13 A;  5JRC A;  4GOU A;  2CXL A;  4WBO A;  3CX7 B;  4O2A E;  3AA1 B;  1KNZ A;  4AQF A;  5HWX A;  4O4J E;  2H3R A;  2K9A A;  3AVS A;  3N9Q A;  2DHR A;  2C0S A;  4U72 A;  3MZK B;  3ZYK A;  4H63 H;  3CQG B;  3V5S A;  3H37 A;  4O2B E;  5HXH A;  2X66 A;  4HEA A;  2E8I A;  3LK2 B;  2VKJ A;  3UFE A;  2JMK A;  4MFR A;  3RRW A;  4EOZ B;  3KIN B;  1BR4 A;  4QHO A;  2PFV A;  3I9W A;  2CEA A;  2W00 A;  3RKO A;  2KZ7 B;  5JRE A;  3E08 A;  3LK3 B;  3MKD A;  1U4Q A;  4UV8 B;  2N9D A;  3NRY A;  5LNK A;  5KX5 E;  1Z0P A;  5FMN A;  3O1H A;  5HXS A;  4UVA B;  2Q9Q B;  4UXN B;  1G8X A;  4CQI A;  1VOM A;  1WYC A;  4O4I E;  5JDG A;  2E9X A;  3K8P C;  1LRZ A;  3ANW A;  2XAQ B;  5DJQ C;  2XAS B;  2X67 A;  1UX5 A;  2WM9 A;  3RYI E;  4ZI3 C;  4GK0 E;  4TV8 E;  4BA9 A;  3HA4 A;  3HKD E;  3RYF E;  3GA8 A;  2B1E A;  2VAS A;  3ZPO A;  4CXX A;  4I4T E;  1MMD A;  3ZJ1 A;  4AKI A;  3CQC B;  4UF0 A;  2JQQ A;  2I59 A;  2Q9Q C;  4QKN A;  2D0U A;  3MAC A;  3O1I A;  3UUL A;  2EHO D;  1U5P A;  3KBU A;  4IE7 A;  2V26 A;  4O8S A;  5FXZ A;  1SHZ C;  3RYH E;  2MBG A;  1ZKE A;  2W0G A;  4BJM A;  3J7Y q;  2L3L A;  2W61 A;  4GK5 E;  1MND A;  4I50 E;  2V7M A;  3N9M A;  3EUH A;  1IJ6 A;  2C5I T;  2X9Y A;  2DWG A;  2XQY A;  4HN9 A;  1WR6 A;  4UVC B;  1G73 A;  1NWM X;  2V7J A;  4EXT A;  3DTO A;  4XAX B;  3IF8 B;  4M1P A;  1YKH B;  3IHR A;  3Q5W A;  4H63 V;  5LJN A;  3NBX X;  5LGU B;  5LJM A;  2Y8D A;  4QXH B;  3LG7 A;  3MA9 A;  3WI3 A;  2CCQ A;  2Y6X A;  3M65 A;  4IE0 A;  1LVF A;  5LOV E;  3FXE B;  4EYU A;  2D0T A;  3DP7 A;  2SPC A;  3IEE A;  3E0Z A;  3PU8 A;  2M67 A;  5FYM A;  3VKG A;  5F3J A;  5EK4 A;  2D5U A;  2WMN A;  2N2N A;  5AFU L;  4GIW A;  5FY0 A;  5ADX L;  5JRC B;  1MNE A;  2KWI B;  2ZM2 A;  3BQK A;  4BJN A;  4DVD A;  3K3N A;  2YK0 A;  4AKL A;  2LHR A;  2LOS A;  3N9L A;  4TX5 A;  3VU7 H;  4AXP A;  3KFW X;  5CA1 E;  2LOP A;  5LHI B;  2K5B B;  2IW5 B;  5BMV E;  4TUY E;  4ILU A;  3MJX A;  2LSI A;  4FJO A;  4JEU B;  4QXC B;  2OA5 A;  4I43 B;  2EHO C;  4EB6 E;  5IHY A;  2QGS A;  5HXR A;  5LBQ B;  3AB3 B;  3GN5 A;  3F31 A;  1S35 A;  2GK9 A;  2WAU A;  4CI1 B;  5LBM A;  2LE8 A;  4NUV A;  3UT5 E;  4PAG A;  2X68 A;  4O4H E;  3EDU A;  4DO0 A;  3FBZ A;  3EVY A;  3RC3 A;  1ZEE A;  3HI2 A;  3PE0 A;  2E9X B;  3ZMT B;  3ANW B;  2EHO A;  2C5J A;  3AAA B;  3L3P A;  2IAK A;  4K0U A;  4PFP A;  2HPJ A;  3RX6 A;  2XAF B;  3ZC1 A;  1D1A A;  2VKH A;  3J9X 1;  3CQX C;  1NAF A;  5L3F B;  3F57 A;  5J2T E;  5M4Y A;  2D2S A;  2UXX B;  4OFZ A;  4O4L E;  4UF0 B;  5FNV E;  5L3C B;  5FP3 A;  5EK2 A;  2V7L A;  5EZY E;  4OYJ A;  2E9X C;  2IC9 A;  3PUG A;  4P0B A;  3GMI A;  1WLX A;  5LP6 E;  1EZ3 A;  3D0T A;  4IDZ A;  1HFA A;  3RPU A;  4P09 A;  4WBN E;  1WRD A;  4G2A A;  1SA0 E;  4GYR A;  4IE4 A;  5H6Q B;  3EDV A;  2Z6E A;  3N9N A;  1D1C A;  3A5X A;  4DBQ A;  4IE5 A;  4DND A;  2KXP B;  3N2K E;  3CX6 B;  5EK3 A;  4B6X A;  3R84 B;  3I1A A;  1O3X A;  2XAG B;  2JPF A;  2W62 A;  1YKE B;  5JR9 C;  5J1G A;  3BK9 A;  3N2O A;  1CUN A;  3T8O A;  3Q9D A;  4AQG A;  4EIW A;  4IST A;  2CXF A;  1S94 A;  2KWH A;  1US7 B;  2J1D G;  3R6N A;  3K3Q C;  3QUJ A;  5LGT B;  4KP3 C;  3UUN A;  2NW9 A;  5JDM A;  3PUS A;  2DNX A;  5E0O A;  3CKD A;  3L09 A;  2BDE A;  1UX4 A;  3N2G E;  4CI2 B;  3ZCJ A;  4EZ4 A;  2RP4 A;  5JDN A;  4PJM A;  4UVB B;  1BR0 A;  3I9Y A;  4C90 A;  3QK6 A;  5JR9 A;  4DMV A;  5FY1 A;  4IHJ E;  2BVL A;  4L5G A;  3ZN0 B;  1QUU A;  2WWU A;  3U3I A;  1YW0 A;  4EAH A;  1OWA A;  3ZYM A;  5L3G B;  2C5K T;  2W63 A;  5JQG E;  3S4U A;  2Y48 B;  4CXY A;  4NUU A;  4PJL A;  1MIW A;  5F8P A;  3OKQ A;  4CXW A;  2X51 A;  3PDY A;  2DLR A;  4HE8 A;  4Z8X A;  4ZHQ E;  5LHH B;  3IBP A;  5L3E B;  2V1D B;  1D0Y A;  1T98 A;  1MIV A;  3GN5 B;  2VWA A;  5L3D B;  3RH3 A;  3SWH A;  3V5U A;  4AKR B;  4PJJ A;  4PNI A;  1LVK A;  3N9P A;  2PG8 A;  3ZMU B;  2VKO A;  5LYJ E;  2KMF A;  3CVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...