1V9DA

Crystal structure of the core fh2 domain of mouse mdia1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
332
structure length
308
Chain Sequence
VKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLSFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The core FH2 domain of diaphanous-related formins is an elongated actin binding protein that inhibits polymerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Diaphanous protein homolog 1
total genus 120
structure length 308
sequence length 332
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA01
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA02
2J1DG 3O4XE 3OBVE 1UX4A 4EAHA 1UX5A 1Y64B 2Z6EA 1V9DA
chains in the Genus database with same CATH superfamily
1HR0T 3NKZA 3RYHE 1HNZT 4B3TT 2C5IT 3R84B 1Y01A 4AXPA 5HXCA 2NOXA 3PUXF 3AAAB 2CXFA 1NAFA 2WAUA 3FZFB 3J7Yq 3KV6A 3RI5A 3ZC0A 2VWAA 3O4XE 5CA1E 1W0AA 3MKDA 4AKHA 2NR4A 2ACXA 1VRBA 1GQEA 4WW0A 3I9YA 5F5WA 3RIUC 3LBXA 4DV6T 3RYIE 4DBQA 1OEDC 1XZYA 2IC9A 3F57A 4IHJE 5H6RB 3NZQA 5LOVE 2KZ7B 2LM9A 2CEAA 2XASB 4GK0E 4KX6A 4PJLA 3K1SA 4IGUA 4ZI3D 4YHJA 1IZNB 3FB2A 2J47A 1YQ3A 3NRXA 4QH1A 2LE8A 2LHRA 4YXDA 2EHOB 3AB3B 3AXJA 4DMVA 5JR9B 4LF8T 3KV4A 4OX9T 4YJ2E 1ZOYA 3ONJA 2CXDA 2PFVA 4IE7A 2XQYA 5ABEA 2V5DA 5ETWA 2KXPB 4PAGA 4Z91A 3PUVF 5FKYA 2DWGA 2V6XA 3C64A 5FL0A 5GONE 3I0OA 5L3FB 2ZM6T 4CN1A 3N9NA 3N9QA 2WDVA 4NUVA 2VKJA 2VKDA 2CXLA 5LHIB 2BG9A 3ONXA 5CGMA 3NBXX 3GMIA 3C4ZA 3KV9A 3MJXA 3RQWA 3UT5E 4L5GA 3ANWB 3T8OA 3OVUA 5JDMA 2XQ7A 3TLUA 2LSIA 3HKDE 4TWDA 2DWKA 4YSYA 5FL1A 3QK6A 3SRZA 2VKHA 2ZM8A 1XNQT 3L8RA 2FJEA 4G2AA 2QYWA 2M6IA 4AI6A 5LNKA 2ZLYA 4DV5T 3K3OA 1JNZA 3AE8A 2QA7A 4IDZA 4K0UA 2XM2A 3RF1A 1OWAA 2YU2A 4MBQA 2ZM2A 3LJCA 2LHNA 3PUWF 4PJJA 3LDQB 4U2YA 3UUMA 4ZHQE 5HXEA 4CXXA 4P0AA 5IYZE 3AEDA 3Q5EA 4K0KT 2I59A 3FHNA 4YTMA 3Q5XA 3VKGA 2I6HA 3HL6A 1XNRT 4UF0A 2VKOA 2IIUA 5C8YE 2K9AA 1W09A 3AE1A 2KMFA 3CQXC 5IWAT 1KNRA 1SE7A 2CM0A 3O9XA 4O4IE 4JI0T 3N9MA 4BA9A 5FVKA 4O2BE 5DQWA 3CX6B 4CN4A 4U31A 3MK7C 4WBNE 1D1CA 2BKOA 2N1GA 3P4RA 4ZI2C 5F8PA 5EK4A 1Y64B 2A2FX 2YKSA 3NWIA 4P09A 4QKNA 3CMLA 4OYKA 3Q9DA 3ESLA 5JDGA 3ANWA 1KFYA 3BQKA 3ZYMA 3I9WA 1WR6A 1Z0PA 2QRXA 3O1HA 2V7MA 2Q9QC 3HKBE 4HFIA 2MBGA 2BKNA 4I43B 5FYMA 3L09A 3PU3A 4ZI2D 1S94A 4KBMB 5FXZA 1FMWA 2BS4A 2V7JA 1BR2A 2H7OA 2V6YB 4HWFA 5L3CB 4UXNB 4ZEYA 5JR9A 4B3MT 3IA3A 4IL4A 2H89A 5AQKB 2XQ8A 1IJ6A 3N9PA 3UU3A 2CWOA 2H88A 2NW8A 3PUQA 4LF4T 5FXWA 4JV5T 2CPTA 3CQGB 4IDNA 2BG9E 4DR1T 4BJNA 3PUYF 5AQRB 3FXEB 3ZSSA 2XJ7A 2I0MA 1MMAA 2WMOA 3RC3A 2YN6A 2BG9B 2YDSA 3CIRA 2ES0A 4TWHA 2CMRA 3KINB 5AQMB 3AA6B 2CBIA 2JJ9A 2YOEA 3EDUA 4I4TE 2Q9QD 3JADA 4Z8XA 3RIUA 4DV4T 2UUCT 5JRCA 1WYBA 2CBJA 4AKRB 4HFEA 1J1JA 3GN5A 5HYAA 4TV8E 5JDLA 4EB6E 1I6ZA 4X1KE 1Z8UA 4ANJA 4PJMA 3BK9A 3BQLA 4P0BA 4ZZCA 4YSXA 3AE2A 4OHFA 2C0SA 2LSJA 2IHR1 2V7IA 3B13A 3CPZA 4I55E 4O4LE 5LBMA 5AQJB 3ZT5A 4YTPA 2XAHB 1LVFA 4LF7T 5JDFA 1ZP0A 4DIDB 1MMNA 2D2SA 3ZLIA 3PTRB 2X0LB 4EZ4A 1XDOA 2XQ9A 1NWMX 3ZT6A 5FP3A 5HWXA 2B76A 1N34T 2X9XA 4IIJE 2MOZA 3MACA 5FXVA 2H7VC 1HX8A 1KF6A 2VL0A 2JQHA 2M67A 4AKLA 3PUZF 4I50E 3NZPA 1IBLT 1ZKEA 3AE9A 1HG5A 3HA4A 4HWHA 5FY7A 3L39A 3UUNA 1HS7A 2WDQA 2WWUA 2X0HA 4MLKA 3ZN0B 5LP6E 2PJQA 2ZMAA 4IDPA 3K3QC 3ZMUB 3RX6A 2WZHA 2A9UA 2XSBA 4V1Av 1OEDB 2X51A 3HKCE 4FJOA 4IE4A 3VR8A 3VHLA 3ZJ2A 4QH4A 4UELA 2XAJB 2FJBA 2LRKA 2XQ3A 2UXBT 3I0QA 3LBXB 4H9SE 4A98A 2VASA 1SHZC 3AAEB 2C5JA 2P9BA 3AEEA 3AEBA 4L0RA 2D0TA 5AQOB 3P8CD 2BDEA 5AQPB 2J1DG 1ZHCA 2AXDS 2LT3A 4ILUA 2EHOC 4QWNB 3PUSA 5JVDE 3C4XA 1UX5A 3AE4A 2XZEA 4TWFA 4JLEA 4UV9B 2N2NA 2LSGA 2IDOB 3EHZA 2Y8DA 1KEYA 3M65A 3OKQA 2FBWA 3FZLB 4H9NC 4XZCA 1LKXA 3V5SA 3ZJ1A 1E7PA 2HH7A 2K24A 1IJ5A 2KINB 4TN7B 3G06A 3Q5WA 4E7SA 4NPPA 4HKAA 4F6RC 2VL8A 1SA0E 4PK6A 1WYCA 4QH5A 3N2OA 5AQHB 4B6XA 1N36T 4MFRA 3RHWA 3R6NA 2L3LA 3H3AA 4HFHA 1MIYA 3OPCA 3WAKA 3AECA 2XY8B 4HE8A 2BBJA 2L9QA 3LFMA 3NRYA 1FIOA 4G63A 5LJNA 4JUYA 2XAQB 4HWIB 2WB5A 1I94T 1WCRA 3LK3B 1M7KA 2SPCA 2WU5A 2XQ6A 1LRZA 2CA5A 3AEFA 3ZMZB 4JI1T 2CLYC 4YJ3E 2VVNA 3AE6A 3E22E 2CRBA 3KBTA 4CI1B 3WAJA 5EK3A 4X66T 4H9RC 4DV1T 2BS2A 2BBHA 1N32T 2LKHA 2HN2A 2UXXB 2XQ5A 3P4PA 5J2TE 4EZHA 4NXMT 1DU2A 2LSKA 2E9XC 5HCMA 4AQFC 5LG4A 2DHRA 2IUBA 4LF6T 2KWIB 4TUYE 4JI6T 4X1IE 1OEDE 3AEGA 3Q5DA 3EABA 2A3DA 2LM2A 3FZMB 2DLRA 2LKGA 2XTLA 2WSSV 3FBZA 2E2AA 3ZYLA 1HF8A 2LEHA 4TNVA 1US7B 3Q2MA 2W4XA 1KNPA 2E9XD 4A56A 3T1YT 3PUAA 2W61A 2EHOD 1HTJF 2XAGB 5CB4E 4AQFA 5C2TA 4HEAA 3P50A 4AISA 2XHEB 2Y48B 2UUBT 4LFCT 2V7LA 1HCIA 1XMOT 1JNRA 2NTXA 2JQQA 3QB5K 4OFZA 5KX5E 3ZCJA 3AE5A 1BR4A 5HEGA 3W15B 5JH7E 4CXYA 2E5LT 4H9QC 3ZN1B 3H37A 3ABVA 2XAFB 3HR0A 2UXDT 1NENA 5DABA 3ZCIA 3RYCE 4IE6A 1D0YA 3RPUA 4YSZA 4XBFB 4ZXLA 4A5XA 4H9OC 5JDNA 3VRBA 4YT0A 3SFEA 5L4EA 2Q9QB 3UQ4A 4DUZT 1D1AA 5LHHB 4YTNA 4TZ4C 4IDOA 1XDPA 2W67A 2YEVC 4ISTA 3O1IA 3SOLA 1O3XA 5BR8T 4CQIA 4GKJT 4AKIA 4Z90A 5AQSB 1B7TA 4GIWA 4ISSA 2UXNB 4HWCA 4TNWA 4O4HE 2WQYA 5E0OA 5LHGB 4DUYT 3N5LA 3IBPA 2E5VA 3RC8A 3ZEFB 4HFCA 1J5WA 2BVLA 5H6QB 5ABFA 1VCSA 2CHOA 2MYSA 4EYYR 4GKKT 4EGWA 3FXDB 2W62A 1CHUA 1MMDA 3CK6A 3LG7A 4PNIA 5HWYA 3UFGA 3ZPOA 3PURA 5A1LA 4X65T 1OXZA 2LRLA 5HXSA 2X9HA 4H63V 4C91A 4ASKA 3RH3A 1HNXT 2HHHT 2WDRA 3AA0B 5J1GA 4ZZBA 5IHYA 4CI3B 5KXJA 3F2EA 4YFSA 3UQ7A 4HFDA 3V5UA 1J5ET 5JR9C 3ZMTB 4PFOA 5LJMA 3AA1B 4PJNA 1LVKA 3UTKA 3NVOA 3SWHA 3RGLA 3RRWA 1UUSA 2V8SV 1G73A 3DP7A 4QHOA 1FMVA 3TLWA 3RQUA 4ADZA 2Y6XA 3QOFA 2VB6A 3UUBA 1E1HB 4JEHB 5AQUB 4JI5T 1MIVA 2NW7A 2D9DA 5IUXA 5AQLB 3RLFF 2IW5B 2JMKA 3B5MA 2CCQA 4I0UA 4UVAB 1M62A 3L3PA 3TLVA 4WBOA 4U72A 3CX8B 3OTOT 2HPJA 4H9PC 1WR0A 5FVLA 2E9XA 2LJLA 3GA8A 1UK5A 2UXCT 3FZKB 5CA0E 1HNWT 5KMGP 4B3ST 4BJMA 5J0ZA 5J2UE 4LFBT 1YKHB 3A7MA 2CWYA 2YK0A 2MTQA 5ABFB 2JMHA 3OJAA 2W2UA 4ILCA 4ERRA 4LMKA 3AXJB 3ZMVB 2XM1A 4HFBA 3P4WA 1YQ4A 5AFUL 3MA9A 4J2CA 4L9IA 1NEKA 3ZT7A 1FEWA 4N78D 2LLYA 2DNXA 1U4QA 4KI0F 4O8SA 1X9BA 4GK5E 4DBRA 2XUEA 2VQFT 3UUXB 3OYZA 5LGNB 3GN5B 4HFVA 4UV8B 2L8KA 4AKGA 5L2LA 1L0VA 2XSAA 4U74A 4X1YE 3ZSTA 1YXRA 2IAKA 2ODUA 5F3JA 3RIAA 2X9YA 5LXTE 4DV2T 2D5UA 4ZS3A 2X9WA 3KV5A 1X79A 2RP4A 4ILBA 4KP3C 3U3IA 4EV6A 3LK2B 5HXHA 5AQIB 4JEUB 4CXWA 3KBUA 4DV0T 1XMQT 4JI7T 4X64T 2KWHA 4WZXA 3RIFA 3SFDA 4A97A 1D0ZA 2LOPA 1V9DA 4QX7B 5LCYA 2X66A 2W66A 4TV9E 5L47A 3UU5A 4NUUA 1E2AA 2BVMA 1BR1A 2YDQA 4LMJA 4EEDA 4DMWA 2WMNA 3K8PC 3D0TA 1MMGA 2NP9A 3A8YC 3PV0F 3FBLA 2PG8A 2X0YA 5AQGB 1MNDA 1T7SA 2CLYB 5JQGE 4NXNT 2V1DB 3UU8A 5AQQB 2BS3A 1OEDA 5DJQC 3C51A 3FZHB 3N2KE 3P4SA 3T1HT 4IL9A 5M4YA 1AJ3A 4NIQA 1WRDA 4ZOLE 4QXHB 2PBIA 3CKDA 2WCAA 3DJBA 2NW9A 3TLTA 3VR9A 4IREA 2B1EA 4PK5A 5KDMC 3HKEE 3S4UA 2H3RA 2YINA 4OK0A 2NWBA 3C98B 4FI5A 3ZC1A 1D0XA 4JI3T 2N9DA 2KLQA 2V26A 4UEMA 3RRCA 1WFDA 2AE9A 4WYVA 1CUNA 4DVDA 2JQ9A 4GYRA 4P1NA 4DR4T 2BZBA 1WLXA 4LFAT 1HFAA 2ODVA 2WZIA 3AAIA 5ABHA 5JTGA 4GOUA 5BMVE 5HAXA 2UU9T 4U33A 3KFWX 3JC6D 5LB7B 2EHOA 1ZV4X 2A72A 2W00A 2V6YA 3KDSE 5FY0A 2BG9C 4DR5T 2WBLA 3QB5A 3EI0A 2V7KA 3C4WA 3RKOA 3CQCB 3UU6A 1XWMA 3QNUA 5LYJE 3PJAA 1IBKT 4EEBA 1W0BA 3DTOA 2IMLA 4OYJA 3MXZA 5LMUT 4EAHA 3P7IA 5LA6E 3UULA 4HN9A 4IT4A 2RA1A 1YD8G 1HX1B 1YW0A 3ZKRA 4X20E 4QX8B 2HN1A 3ETUA 3ZYKA 2VK9A 2LOSA 4GYSA 5HEHA 2Q9QA 2XPKA 5HXRA 3PDYA 3AEAA 4DR2T 2CE7A 4E7ZA 4JYAT 4KMCA 2UUAT 2X68A 2G0UA 2IC6A 2K3WA 1UX4A 3E08A 3K3NA 4DNDA 3P4QA 3KVBA 3QC9A 4PW8A 4LF5T 1R8IA 2JQKA 3UU4A 1KNZA 3N9LA 3PUGA 5AQNB 2ACZA 3CX7B 3AVSA 1FJGT 2OLTA 3CWZB 2W0GA 4AIUA 5JREA 2WS3A 3HI2A 4IE5A 3A5XA 2KT9A 2PTFA 4BAYB 3E0ZA 4UIGA 4HGAA 2V5CA 2DL1A 5HCJA 5L3EB 2FJDA 3F31A 2WWVA 1IBMT 3PU8A 3O1JA 1UGOA 4UF0B 3EUHA 5TAOA 4CN6A 5EK2A 5L3DB 3X1DA 1T98A 3B57A 3JAFA 4U7IA 2KNDA 3BQIA 3RKGA 5EZYE 2WY2A 3SS1A 4CI2B 3H3MA 5ABGA 4DV7T 2K48A 1VOMA 1S35A 4ZI7E 2F4VT 2CHNA 2D0UA 4M1PA 3PJAJ 1H7CA 5FY1A 5AQVB 2MPKA 4CZZB 2VQET 4DV3T 2KSRA 4MHCA 4Q25A 1IAPA 4JI4T 4EXTA 2JPFA 3AE7A 4HWDA 5JRCB 1QLBA 2M6BA 1ZEEA 2DCFA 2YU1A 2J4GA 2HPLA 4WNKA 2LSYA 2W63A 4AQGA 4QXCB 2C5KT 3ZMSB 4JI8T 5LG3A 4MALA 5C3JA 3U78A 4TX5A 4EOZB 4IDQA 4YY3T 2JIWA 3AA7B 2ZM0A 3MZKB 1MIWA 5FNVE 3TKLB 5L4HA 2BKPA 3VRAA 2WM9A 2E9XB 2WU2A 3EDVA 4HTEA 4XAXB 5FMNA 3GWHA 5HEUA 4KHPT 1T72A 3LK42 5DQVA 2VVSA 3OBVE 4DR3T 4IE0A 3AE3A 1KK7A 2J62A 1HG2A 2Z6EA 1MNEA 5JDQA 5LGUB 5LMNT 2MAWA 1D1BA 4UVCB 4X5TA 5LGTB 4F8HA 4DO0A 4JI2T 1VCTA 3EAMA 5CJ5A 4O2AE 4EIWA 2QGSA 4KHZF 2OV9A 3AVRA 4DR7T 3VU7H 3N2GE 5ADXL 3J9X1 2X67A 3IHRA 5L3GB 3VKHA 3IF8B 3ETVA 4H63H 3RYFE 1EZ3A 1BR0A 4COFA 1W9RA 2XQ4A 4DR6T 3PE0A 2GK9A 5JDHA 5AQFB 4JBWF 1YKEB 2R6GF 2NTYA 4U2ZA 3UFEA 4LF9T 1U5PA 4C90A 4U3CA 4LMLA 3I1AA 1N33T 2OA5A 3JCFA 2VURA 2YDRA 1QSDA 4U7YA 1G8XA 4YLHA 3TLSA 4YHHT 2DI4A 5AQTB 1UCUA 3M3ZB 2QVAA 1SUMB 2XQAA 4O4JE 3N9OA 4PFPA 4UVBB 2K5BB 1UURA 4B3RT 2FUPA 2FJAA 4UR9A 3KVAA 3C50A 3OYXA 4QXBB 4PK4A 5L3BB 4AQYT 5HEJA 3WI3A 3CVRA 1T8BA 2JRKA 3EVYA 2RPAA 3ONLC 1QUUA 3QUJA 3IEEA 5HEOA 4ILAA 4ZI3C 5FXXA 5LBQB 3LSVA 5CFBA 4KUMB 4EYUA 2E8IA 4X62T 4ZS2A 2WP9A 3JC6C 3JAEA
chains in the Genus database with same CATH topology
3RYHE 2C5IT 3R84B 4AXPA 5HXCA 2NOXA 3AAAB 2CXFA 1NAFA 2WAUA 3J7Yq 3KV6A 3ZC0A 2VWAA 3O4XE 5CA1E 3MKDA 4AKHA 2ACXA 1VRBA 4WW0A 3I9YA 3LBXA 3RYIE 4DBQA 3F57A 2IC9A 4IHJE 5H6RB 5LOVE 3NZQA 2KZ7B 2LM9A 2CEAA 2XASB 4GK0E 4PJLA 4IGUA 4ZI3D 4YHJA 1IZNB 3FB2A 3NRXA 2LE8A 2LHRA 2EHOB 3AB3B 4DMVA 5JR9B 3KV4A 4YJ2E 2CXDA 2PFVA 4IE7A 2XQYA 5ETWA 2KXPB 4PAGA 5GONE 2DWGA 3C64A 3I0OA 5L3FB 3N9NA 3N9QA 4NUVA 2VKJA 2VKDA 2CXLA 5LHIB 3ONXA 3NBXX 3GMIA 3C4ZA 3KV9A 3MJXA 3UT5E 4L5GA 3ANWB 3T8OA 5JDMA 2LSIA 3HKDE 2DWKA 3QK6A 3SRZA 2VKHA 2ZM8A 4G2AA 4AI6A 5LNKA 2ZLYA 3K3OA 2QA7A 4IDZA 4K0UA 3VU7H 1OWAA 2YU2A 4MBQA 2ZM2A 3LJCA 2LHNA 4PJJA 3UUMA 5HXEA 4ZHQE 4CXXA 4P0AA 5IYZE 2I59A 3FHNA 3Q5XA 3VKGA 3HL6A 4UF0A 2VKOA 5C8YE 2K9AA 3CQXC 2KMFA 2CM0A 3O9XA 4O4IE 3N9MA 4BA9A 4O2BE 5DQWA 3CX6B 3MK7C 4WBNE 1D1CA 2N1GA 4ZI2C 5F8PA 5EK4A 1Y64B 2A2FX 4P09A 4QKNA 3CMLA 4OYKA 3Q9DA 3ESLA 5JDGA 3ANWA 3BQKA 3ZYMA 3I9WA 1Z0PA 1WR6A 3O1HA 2V7MA 2Q9QC 3HKBE 2MBGA 4I43B 5FYMA 3L09A 3PU3A 4ZI2D 1S94A 4KBMB 5FXZA 1FMWA 2V7JA 1BR2A 2H7OA 5L3CB 4UXNB 5JR9A 1IJ6A 3N9PA 2CWOA 2NW8A 3PUQA 5FXWA 3CQGB 4BJNA 3FXEB 1MMAA 2WMOA 3RC3A 2ES0A 2CMRA 3KINB 3AA6B 2JJ9A 3EDUA 4Z8XA 4I4TE 2Q9QD 5JRCA 1WYBA 4AKRB 3GN5A 5HYAA 4TV8E 5JDLA 4EB6E 4X1KE 4ANJA 4PJMA 3BK9A 3BQLA 4P0BA 4OHFA 2C0SA 2LSJA 2V7IA 3B13A 3CPZA 4I55E 4O4LE 5LBMA 2XAHB 1LVFA 5JDFA 1MMNA 2D2SA 3ZLIA 3PTRB 2X0LB 1NWMX 5FP3A 5HWXA 2X9XA 4IIJE 2MOZA 3MACA 5FXVA 2H7VC 1HX8A 2M67A 4AKLA 4I50E 3NZPA 1ZKEA 3HA4A 1HG5A 5FY7A 1HS7A 3UUNA 2WWUA 3ZN0B 4MLKA 5LP6E 2PJQA 2ZMAA 3K3QC 3ZMUB 3RX6A 4V1Av 2X51A 4IE4A 3HKCE 4FJOA 3VHLA 3ZJ2A 4UELA 2XAJB 3I0QA 3LBXB 4H9SE 2VASA 1SHZC 3AAEB 2C5JA 2P9BA 5LGUB 4L0RA 2D0TA 4EZ4A 3P8CD 2BDEA 5JVDE 2J1DG 1ZHCA 2LT3A 4ILUA 4QWNB 2EHOC 3PUSA 3C4XA 1UX5A 4JLEA 4UV9B 2N2NA 2LSGA 2Y8DA 3M65A 3OKQA 4H9NC 4XZCA 1LKXA 3V5SA 3ZJ1A 2HH7A 2K24A 2KINB 1IJ5A 4TN7B 4E7SA 3Q5WA 4HKAA 4F6RC 2VL8A 1SA0E 4PK6A 1WYCA 4B6XA 3N2OA 4MFRA 3R6NA 2L3LA 3H3AA 3WAKA 1MIYA 4HE8A 2L9QA 3LFMA 3NRYA 4G63A 1FIOA 5LJNA 4JUYA 2XAQB 3LK3B 2SPCA 3ZMZB 1LRZA 2CA5A 2CLYC 4YJ3E 3E22E 3WAJA 3KBTA 4CI1B 5EK3A 4H9RC 2UXXB 5J2TE 4EZHA 2LSKA 2E9XC 4AQFC 5LG4A 2DHRA 2KWIB 4TUYE 4X1IE 2A3DA 2DLRA 2XTLA 3FBZA 2WSSV 3ZYLA 1HF8A 2LEHA 1US7B 3Q2MA 2E9XD 4A56A 3PUAA 2W61A 2EHOD 1HTJF 2XAGB 5CB4E 4AQFA 4HEAA 2XHEB 2Y48B 2V7LA 1HCIA 2NTXA 2JQQA 4OFZA 5KX5E 3ZCJA 1BR4A 3W15B 4CXYA 5JH7E 4H9QC 3ZN1B 3H37A 2XAFB 3HR0A 5DABA 3ZCIA 3RYCE 4IE6A 1D0YA 3RPUA 4XBFB 4H9OC 5JDNA 2Q9QB 1D1AA 5LHHB 4TZ4C 2YEVC 3SOLA 4ISTA 3O1IA 1O3XA 4CQIA 4AKIA 1B7TA 4GIWA 4ISSA 2UXNB 5LHGB 4O4HE 5E0OA 3N5LA 3IBPA 3RC8A 3ZEFB 2BVLA 5H6QB 2MYSA 4EYYR 3FXDB 2W62A 1MMDA 4PNIA 5HWYA 3LG7A 3ZPOA 5A1LA 3PURA 1OXZA 5HXSA 2X9HA 4H63V 4C91A 4ASKA 3RH3A 3AA0B 5J1GA 5IHYA 4CI3B 3F2EA 4YFSA 3V5UA 5JR9C 3ZMTB 4PFOA 5LJMA 3AA1B 4PJNA 1LVKA 3SWHA 3RRWA 4ADZA 1G73A 3DP7A 4QHOA 1FMVA 2Y6XA 2VB6A 1E1HB 4JEHB 1MIVA 2NW7A 2IW5B 2JMKA 2CCQA 4UVAB 3L3PA 4WBOA 4U72A 3CX8B 2HPJA 4H9PC 2E9XA 2LJLA 3GA8A 5CA0E 5KMGP 4BJMA 5J2UE 1YKHB 2CWYA 2YK0A 2MTQA 2JMHA 3OJAA 4ERRA 3ZMVB 5AFUL 3MA9A 4J2CA 4L9IA 1FEWA 4N78D 2DNXA 1U4QA 4O8SA 4GK5E 4DBRA 2XUEA 3UUXB 3OYZA 5LGNB 3GN5B 4HFVA 4UV8B 2L8KA 4AKGA 5L2LA 4X1YE 4U74A 5F3JA 2IAKA 2ODUA 5LXTE 2X9YA 2D5UA 4ZS3A 2X9WA 3KV5A 1X79A 2RP4A 4KP3C 3U3IA 5HXHA 4JEUB 4CXWA 3KBUA 2KWHA 1D0ZA 2LOPA 1V9DA 4QX7B 5LCYA 2X66A 4TV9E 4NUUA 2BVMA 1BR1A 4DMWA 2WMNA 3K8PC 3D0TA 1MMGA 2NP9A 3FBLA 2PG8A 1MNDA 5JQGE 2CLYB 2V1DB 5DJQC 3C51A 3N2KE 5M4YA 1AJ3A 1WRDA 4ZOLE 4QXHB 2PBIA 3CKDA 2NW9A 3DJBA 2B1EA 4PK5A 5KDMC 3HKEE 3S4UA 2H3RA 2YINA 4OK0A 2NWBA 3C98B 4FI5A 3ZC1A 1D0XA 2N9DA 2KLQA 2V26A 4UEMA 3RRCA 1CUNA 4DVDA 4GYRA 2BZBA 1WLXA 1HFAA 2ODVA 3AAIA 4GOUA 5BMVE 5HAXA 3KFWX 3JC6D 2EHOA 1ZV4X 2A72A 2W00A 3KDSE 5FY0A 2WBLA 2V7KA 3C4WA 3RKOA 3CQCB 5LYJE 3DTOA 4OYJA 3MXZA 4EAHA 3P7IA 5LA6E 3UULA 4HN9A 2RA1A 1YD8G 1YW0A 4X20E 4QX8B 3ETUA 3ZYKA 2VK9A 2LOSA 4GYSA 5HXRA 2Q9QA 3PDYA 2CE7A 4E7ZA 4KMCA 2X68A 2G0UA 2IC6A 1UX4A 3E08A 3K3NA 4DNDA 3KVBA 3QC9A 4PW8A 1KNZA 3N9LA 3PUGA 3CX7B 3AVSA 3CWZB 5JREA 2W0GA 3HI2A 4IE5A 3A5XA 2KT9A 4BAYB 3E0ZA 4UIGA 4HGAA 5L3EB 3F31A 3PU8A 3O1JA 4UF0B 5TAOA 3EUHA 5EK2A 5L3DB 1T98A 3B57A 2KNDA 3BQIA 4CI2B 5EZYE 3SS1A 2K48A 1VOMA 1S35A 4ZI7E 2D0UA 4M1PA 5FY1A 1H7CA 4CZZB 4MHCA 1IAPA 4EXTA 2JPFA 5JRCB 1ZEEA 2DCFA 2YU1A 2HPLA 4WNKA 2LSYA 2W63A 4AQGA 4QXCB 2C5KT 3ZMSB 4MALA 3U78A 4TX5A 4EOZB 3AA7B 2ZM0A 3MZKB 1MIWA 5FNVE 3TKLB 3EDVA 2E9XB 2WM9A 4HTEA 4XAXB 5FMNA 3GWHA 3LK42 5DQVA 3OBVE 4IE0A 1KK7A 1HG2A 2Z6EA 1MNEA 5JDQA 1D1BA 4UVCB 5LGTB 4DO0A 4O2AE 4EIWA 2QGSA 3AVRA 3N2GE 5ADXL 3J9X1 2X67A 3IHRA 5L3GB 3VKHA 3IF8B 3ETVA 4H63H 3RYFE 1EZ3A 1BR0A 3PE0A 2GK9A 5JDHA 1YKEB 2NTYA 3UFEA 1U5PA 4C90A 3I1AA 2OA5A 1QSDA 1G8XA 4YLHA 2DI4A 1UCUA 4O4JE 4PFPA 4UVBB 3N9OA 2K5BB 3KVAA 3C50A 3OYXA 4QXBB 4PK4A 5L3BB 3WI3A 3CVRA 2JRKA 3EVYA 3QUJA 3UTKA 4ZI3C 1QUUA 3IEEA 5FXXA 5LBQB 4KUMB 4EYUA 2E8IA 4ZS2A 3JC6C 3LK2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1D G;  3O4X E;  3OBV E;  1UX4 A;  4EAH A;  1UX5 A;  1Y64 B;  2Z6E A;  1V9D A; 
#chains in the Genus database with same CATH topology
 1HR0 T;  3NKZ A;  3RYH E;  1HNZ T;  4B3T T;  2C5I T;  3R84 B;  1Y01 A;  4AXP A;  5HXC A;  2NOX A;  3PUX F;  3AAA B;  2CXF A;  1NAF A;  2WAU A;  3FZF B;  3J7Y q;  3KV6 A;  3RI5 A;  3ZC0 A;  2VWA A;  3O4X E;  5CA1 E;  1W0A A;  3MKD A;  4AKH A;  2NR4 A;  2ACX A;  1VRB A;  1GQE A;  4WW0 A;  3I9Y A;  5F5W A;  3RIU C;  3LBX A;  4DV6 T;  3RYI E;  4DBQ A;  1OED C;  1XZY A;  2IC9 A;  3F57 A;  4IHJ E;  5H6R B;  3NZQ A;  5LOV E;  2KZ7 B;  2LM9 A;  2CEA A;  2XAS B;  4GK0 E;  4KX6 A;  4PJL A;  3K1S A;  4IGU A;  4ZI3 D;  4YHJ A;  1IZN B;  3FB2 A;  2J47 A;  1YQ3 A;  3NRX A;  4QH1 A;  2LE8 A;  2LHR A;  4YXD A;  2EHO B;  3AB3 B;  3AXJ A;  4DMV A;  5JR9 B;  4LF8 T;  3KV4 A;  4OX9 T;  4YJ2 E;  1ZOY A;  3ONJ A;  2CXD A;  2PFV A;  4IE7 A;  2XQY A;  5ABE A;  2V5D A;  5ETW A;  2KXP B;  4PAG A;  4Z91 A;  3PUV F;  5FKY A;  2DWG A;  2V6X A;  3C64 A;  5FL0 A;  5GON E;  3I0O A;  5L3F B;  2ZM6 T;  4CN1 A;  3N9N A;  3N9Q A;  2WDV A;  4NUV A;  2VKJ A;  2VKD A;  2CXL A;  5LHI B;  2BG9 A;  3ONX A;  5CGM A;  3NBX X;  3GMI A;  3C4Z A;  3KV9 A;  3MJX A;  3RQW A;  3UT5 E;  4L5G A;  3ANW B;  3T8O A;  3OVU A;  5JDM A;  2XQ7 A;  3TLU A;  2LSI A;  3HKD E;  4TWD A;  2DWK A;  4YSY A;  5FL1 A;  3QK6 A;  3SRZ A;  2VKH A;  2ZM8 A;  1XNQ T;  3L8R A;  2FJE A;  4G2A A;  2QYW A;  2M6I A;  4AI6 A;  5LNK A;  2ZLY A;  4DV5 T;  3K3O A;  1JNZ A;  3AE8 A;  2QA7 A;  4IDZ A;  4K0U A;  2XM2 A;  3RF1 A;  1OWA A;  2YU2 A;  4MBQ A;  2ZM2 A;  3LJC A;  2LHN A;  3PUW F;  4PJJ A;  3LDQ B;  4U2Y A;  3UUM A;  4ZHQ E;  5HXE A;  4CXX A;  4P0A A;  5IYZ E;  3AED A;  3Q5E A;  4K0K T;  2I59 A;  3FHN A;  4YTM A;  3Q5X A;  3VKG A;  2I6H A;  3HL6 A;  1XNR T;  4UF0 A;  2VKO A;  2IIU A;  5C8Y E;  2K9A A;  1W09 A;  3AE1 A;  2KMF A;  3CQX C;  5IWA T;  1KNR A;  1SE7 A;  2CM0 A;  3O9X A;  4O4I E;  4JI0 T;  3N9M A;  4BA9 A;  5FVK A;  4O2B E;  5DQW A;  3CX6 B;  4CN4 A;  4U31 A;  3MK7 C;  4WBN E;  1D1C A;  2BKO A;  2N1G A;  3P4R A;  4ZI2 C;  5F8P A;  5EK4 A;  1Y64 B;  2A2F X;  2YKS A;  3NWI A;  4P09 A;  4QKN A;  3CML A;  4OYK A;  3Q9D A;  3ESL A;  5JDG A;  3ANW A;  1KFY A;  3BQK A;  3ZYM A;  3I9W A;  1WR6 A;  1Z0P A;  2QRX A;  3O1H A;  2V7M A;  2Q9Q C;  3HKB E;  4HFI A;  2MBG A;  2BKN A;  4I43 B;  5FYM A;  3L09 A;  3PU3 A;  4ZI2 D;  1S94 A;  4KBM B;  5FXZ A;  1FMW A;  2BS4 A;  2V7J A;  1BR2 A;  2H7O A;  2V6Y B;  4HWF A;  5L3C B;  4UXN B;  4ZEY A;  5JR9 A;  4B3M T;  3IA3 A;  4IL4 A;  2H89 A;  5AQK B;  2XQ8 A;  1IJ6 A;  3N9P A;  3UU3 A;  2CWO A;  2H88 A;  2NW8 A;  3PUQ A;  4LF4 T;  5FXW A;  4JV5 T;  2CPT A;  3CQG B;  4IDN A;  2BG9 E;  4DR1 T;  4BJN A;  3PUY F;  5AQR B;  3FXE B;  3ZSS A;  2XJ7 A;  2I0M A;  1MMA A;  2WMO A;  3RC3 A;  2YN6 A;  2BG9 B;  2YDS A;  3CIR A;  2ES0 A;  4TWH A;  2CMR A;  3KIN B;  5AQM B;  3AA6 B;  2CBI A;  2JJ9 A;  2YOE A;  3EDU A;  4I4T E;  2Q9Q D;  3JAD A;  4Z8X A;  3RIU A;  4DV4 T;  2UUC T;  5JRC A;  1WYB A;  2CBJ A;  4AKR B;  4HFE A;  1J1J A;  3GN5 A;  5HYA A;  4TV8 E;  5JDL A;  4EB6 E;  1I6Z A;  4X1K E;  1Z8U A;  4ANJ A;  4PJM A;  3BK9 A;  3BQL A;  4P0B A;  4ZZC A;  4YSX A;  3AE2 A;  4OHF A;  2C0S A;  2LSJ A;  2IHR 1;  2V7I A;  3B13 A;  3CPZ A;  4I55 E;  4O4L E;  5LBM A;  5AQJ B;  3ZT5 A;  4YTP A;  2XAH B;  1LVF A;  4LF7 T;  5JDF A;  1ZP0 A;  4DID B;  1MMN A;  2D2S A;  3ZLI A;  3PTR B;  2X0L B;  4EZ4 A;  1XDO A;  2XQ9 A;  1NWM X;  3ZT6 A;  5FP3 A;  5HWX A;  2B76 A;  1N34 T;  2X9X A;  4IIJ E;  2MOZ A;  3MAC A;  5FXV A;  2H7V C;  1HX8 A;  1KF6 A;  2VL0 A;  2JQH A;  2M67 A;  4AKL A;  3PUZ F;  4I50 E;  3NZP A;  1IBL T;  1ZKE A;  3AE9 A;  1HG5 A;  3HA4 A;  4HWH A;  5FY7 A;  3L39 A;  3UUN A;  1HS7 A;  2WDQ A;  2WWU A;  2X0H A;  4MLK A;  3ZN0 B;  5LP6 E;  2PJQ A;  2ZMA A;  4IDP A;  3K3Q C;  3ZMU B;  3RX6 A;  2WZH A;  2A9U A;  2XSB A;  4V1A v;  1OED B;  2X51 A;  3HKC E;  4FJO A;  4IE4 A;  3VR8 A;  3VHL A;  3ZJ2 A;  4QH4 A;  4UEL A;  2XAJ B;  2FJB A;  2LRK A;  2XQ3 A;  2UXB T;  3I0Q A;  3LBX B;  4H9S E;  4A98 A;  2VAS A;  1SHZ C;  3AAE B;  2C5J A;  2P9B A;  3AEE A;  3AEB A;  4L0R A;  2D0T A;  5AQO B;  3P8C D;  2BDE A;  5AQP B;  2J1D G;  1ZHC A;  2AXD S;  2LT3 A;  4ILU A;  2EHO C;  4QWN B;  3PUS A;  5JVD E;  3C4X A;  1UX5 A;  3AE4 A;  2XZE A;  4TWF A;  4JLE A;  4UV9 B;  2N2N A;  2LSG A;  2IDO B;  3EHZ A;  2Y8D A;  1KEY A;  3M65 A;  3OKQ A;  2FBW A;  3FZL B;  4H9N C;  4XZC A;  1LKX A;  3V5S A;  3ZJ1 A;  1E7P A;  2HH7 A;  2K24 A;  1IJ5 A;  2KIN B;  4TN7 B;  3G06 A;  3Q5W A;  4E7S A;  4NPP A;  4HKA A;  4F6R C;  2VL8 A;  1SA0 E;  4PK6 A;  1WYC A;  4QH5 A;  3N2O A;  5AQH B;  4B6X A;  1N36 T;  4MFR A;  3RHW A;  3R6N A;  2L3L A;  3H3A A;  4HFH A;  1MIY A;  3OPC A;  3WAK A;  3AEC A;  2XY8 B;  4HE8 A;  2BBJ A;  2L9Q A;  3LFM A;  3NRY A;  1FIO A;  4G63 A;  5LJN A;  4JUY A;  2XAQ B;  4HWI B;  2WB5 A;  1I94 T;  1WCR A;  3LK3 B;  1M7K A;  2SPC A;  2WU5 A;  2XQ6 A;  1LRZ A;  2CA5 A;  3AEF A;  3ZMZ B;  4JI1 T;  2CLY C;  4YJ3 E;  2VVN A;  3AE6 A;  3E22 E;  2CRB A;  3KBT A;  4CI1 B;  3WAJ A;  5EK3 A;  4X66 T;  4H9R C;  4DV1 T;  2BS2 A;  2BBH A;  1N32 T;  2LKH A;  2HN2 A;  2UXX B;  2XQ5 A;  3P4P A;  5J2T E;  4EZH A;  4NXM T;  1DU2 A;  2LSK A;  2E9X C;  5HCM A;  4AQF C;  5LG4 A;  2DHR A;  2IUB A;  4LF6 T;  2KWI B;  4TUY E;  4JI6 T;  4X1I E;  1OED E;  3AEG A;  3Q5D A;  3EAB A;  2A3D A;  2LM2 A;  3FZM B;  2DLR A;  2LKG A;  2XTL A;  2WSS V;  3FBZ A;  2E2A A;  3ZYL A;  1HF8 A;  2LEH A;  4TNV A;  1US7 B;  3Q2M A;  2W4X A;  1KNP A;  2E9X D;  4A56 A;  3T1Y T;  3PUA A;  2W61 A;  2EHO D;  1HTJ F;  2XAG B;  5CB4 E;  4AQF A;  5C2T A;  4HEA A;  3P50 A;  4AIS A;  2XHE B;  2Y48 B;  2UUB T;  4LFC T;  2V7L A;  1HCI A;  1XMO T;  1JNR A;  2NTX A;  2JQQ A;  3QB5 K;  4OFZ A;  5KX5 E;  3ZCJ A;  3AE5 A;  1BR4 A;  5HEG A;  3W15 B;  5JH7 E;  4CXY A;  2E5L T;  4H9Q C;  3ZN1 B;  3H37 A;  3ABV A;  2XAF B;  3HR0 A;  2UXD T;  1NEN A;  5DAB A;  3ZCI A;  3RYC E;  4IE6 A;  1D0Y A;  3RPU A;  4YSZ A;  4XBF B;  4ZXL A;  4A5X A;  4H9O C;  5JDN A;  3VRB A;  4YT0 A;  3SFE A;  5L4E A;  2Q9Q B;  3UQ4 A;  4DUZ T;  1D1A A;  5LHH B;  4YTN A;  4TZ4 C;  4IDO A;  1XDP A;  2W67 A;  2YEV C;  4IST A;  3O1I A;  3SOL A;  1O3X A;  5BR8 T;  4CQI A;  4GKJ T;  4AKI A;  4Z90 A;  5AQS B;  1B7T A;  4GIW A;  4ISS A;  2UXN B;  4HWC A;  4TNW A;  4O4H E;  2WQY A;  5E0O A;  5LHG B;  4DUY T;  3N5L A;  3IBP A;  2E5V A;  3RC8 A;  3ZEF B;  4HFC A;  1J5W A;  2BVL A;  5H6Q B;  5ABF A;  1VCS A;  2CHO A;  2MYS A;  4EYY R;  4GKK T;  4EGW A;  3FXD B;  2W62 A;  1CHU A;  1MMD A;  3CK6 A;  3LG7 A;  4PNI A;  5HWY A;  3UFG A;  3ZPO A;  3PUR A;  5A1L A;  4X65 T;  1OXZ A;  2LRL A;  5HXS A;  2X9H A;  4H63 V;  4C91 A;  4ASK A;  3RH3 A;  1HNX T;  2HHH T;  2WDR A;  3AA0 B;  5J1G A;  4ZZB A;  5IHY A;  4CI3 B;  5KXJ A;  3F2E A;  4YFS A;  3UQ7 A;  4HFD A;  3V5U A;  1J5E T;  5JR9 C;  3ZMT B;  4PFO A;  5LJM A;  3AA1 B;  4PJN A;  1LVK A;  3UTK A;  3NVO A;  3SWH A;  3RGL A;  3RRW A;  1UUS A;  2V8S V;  1G73 A;  3DP7 A;  4QHO A;  1FMV A;  3TLW A;  3RQU A;  4ADZ A;  2Y6X A;  3QOF A;  2VB6 A;  3UUB A;  1E1H B;  4JEH B;  5AQU B;  4JI5 T;  1MIV A;  2NW7 A;  2D9D A;  5IUX A;  5AQL B;  3RLF F;  2IW5 B;  2JMK A;  3B5M A;  2CCQ A;  4I0U A;  4UVA B;  1M62 A;  3L3P A;  3TLV A;  4WBO A;  4U72 A;  3CX8 B;  3OTO T;  2HPJ A;  4H9P C;  1WR0 A;  5FVL A;  2E9X A;  2LJL A;  3GA8 A;  1UK5 A;  2UXC T;  3FZK B;  5CA0 E;  1HNW T;  5KMG P;  4B3S T;  4BJM A;  5J0Z A;  5J2U E;  4LFB T;  1YKH B;  3A7M A;  2CWY A;  2YK0 A;  2MTQ A;  5ABF B;  2JMH A;  3OJA A;  2W2U A;  4ILC A;  4ERR A;  4LMK A;  3AXJ B;  3ZMV B;  2XM1 A;  4HFB A;  3P4W A;  1YQ4 A;  5AFU L;  3MA9 A;  4J2C A;  4L9I A;  1NEK A;  3ZT7 A;  1FEW A;  4N78 D;  2LLY A;  2DNX A;  1U4Q A;  4KI0 F;  4O8S A;  1X9B A;  4GK5 E;  4DBR A;  2XUE A;  2VQF T;  3UUX B;  3OYZ A;  5LGN B;  3GN5 B;  4HFV A;  4UV8 B;  2L8K A;  4AKG A;  5L2L A;  1L0V A;  2XSA A;  4U74 A;  4X1Y E;  3ZST A;  1YXR A;  2IAK A;  2ODU A;  5F3J A;  3RIA A;  2X9Y A;  5LXT E;  4DV2 T;  2D5U A;  4ZS3 A;  2X9W A;  3KV5 A;  1X79 A;  2RP4 A;  4ILB A;  4KP3 C;  3U3I A;  4EV6 A;  3LK2 B;  5HXH A;  5AQI B;  4JEU B;  4CXW A;  3KBU A;  4DV0 T;  1XMQ T;  4JI7 T;  4X64 T;  2KWH A;  4WZX A;  3RIF A;  3SFD A;  4A97 A;  1D0Z A;  2LOP A;  1V9D A;  4QX7 B;  5LCY A;  2X66 A;  2W66 A;  4TV9 E;  5L47 A;  3UU5 A;  4NUU A;  1E2A A;  2BVM A;  1BR1 A;  2YDQ A;  4LMJ A;  4EED A;  4DMW A;  2WMN A;  3K8P C;  3D0T A;  1MMG A;  2NP9 A;  3A8Y C;  3PV0 F;  3FBL A;  2PG8 A;  2X0Y A;  5AQG B;  1MND A;  1T7S A;  2CLY B;  5JQG E;  4NXN T;  2V1D B;  3UU8 A;  5AQQ B;  2BS3 A;  1OED A;  5DJQ C;  3C51 A;  3FZH B;  3N2K E;  3P4S A;  3T1H T;  4IL9 A;  5M4Y A;  1AJ3 A;  4NIQ A;  1WRD A;  4ZOL E;  4QXH B;  2PBI A;  3CKD A;  2WCA A;  3DJB A;  2NW9 A;  3TLT A;  3VR9 A;  4IRE A;  2B1E A;  4PK5 A;  5KDM C;  3HKE E;  3S4U A;  2H3R A;  2YIN A;  4OK0 A;  2NWB A;  3C98 B;  4FI5 A;  3ZC1 A;  1D0X A;  4JI3 T;  2N9D A;  2KLQ A;  2V26 A;  4UEM A;  3RRC A;  1WFD A;  2AE9 A;  4WYV A;  1CUN A;  4DVD A;  2JQ9 A;  4GYR A;  4P1N A;  4DR4 T;  2BZB A;  1WLX A;  4LFA T;  1HFA A;  2ODV A;  2WZI A;  3AAI A;  5ABH A;  5JTG A;  4GOU A;  5BMV E;  5HAX A;  2UU9 T;  4U33 A;  3KFW X;  3JC6 D;  5LB7 B;  2EHO A;  1ZV4 X;  2A72 A;  2W00 A;  2V6Y A;  3KDS E;  5FY0 A;  2BG9 C;  4DR5 T;  2WBL A;  3QB5 A;  3EI0 A;  2V7K A;  3C4W A;  3RKO A;  3CQC B;  3UU6 A;  1XWM A;  3QNU A;  5LYJ E;  3PJA A;  1IBK T;  4EEB A;  1W0B A;  3DTO A;  2IML A;  4OYJ A;  3MXZ A;  5LMU T;  4EAH A;  3P7I A;  5LA6 E;  3UUL A;  4HN9 A;  4IT4 A;  2RA1 A;  1YD8 G;  1HX1 B;  1YW0 A;  3ZKR A;  4X20 E;  4QX8 B;  2HN1 A;  3ETU A;  3ZYK A;  2VK9 A;  2LOS A;  4GYS A;  5HEH A;  2Q9Q A;  2XPK A;  5HXR A;  3PDY A;  3AEA A;  4DR2 T;  2CE7 A;  4E7Z A;  4JYA T;  4KMC A;  2UUA T;  2X68 A;  2G0U A;  2IC6 A;  2K3W A;  1UX4 A;  3E08 A;  3K3N A;  4DND A;  3P4Q A;  3KVB A;  3QC9 A;  4PW8 A;  4LF5 T;  1R8I A;  2JQK A;  3UU4 A;  1KNZ A;  3N9L A;  3PUG A;  5AQN B;  2ACZ A;  3CX7 B;  3AVS A;  1FJG T;  2OLT A;  3CWZ B;  2W0G A;  4AIU A;  5JRE A;  2WS3 A;  3HI2 A;  4IE5 A;  3A5X A;  2KT9 A;  2PTF A;  4BAY B;  3E0Z A;  4UIG A;  4HGA A;  2V5C A;  2DL1 A;  5HCJ A;  5L3E B;  2FJD A;  3F31 A;  2WWV A;  1IBM T;  3PU8 A;  3O1J A;  1UGO A;  4UF0 B;  3EUH A;  5TAO A;  4CN6 A;  5EK2 A;  5L3D B;  3X1D A;  1T98 A;  3B57 A;  3JAF A;  4U7I A;  2KND A;  3BQI A;  3RKG A;  5EZY E;  2WY2 A;  3SS1 A;  4CI2 B;  3H3M A;  5ABG A;  4DV7 T;  2K48 A;  1VOM A;  1S35 A;  4ZI7 E;  2F4V T;  2CHN A;  2D0U A;  4M1P A;  3PJA J;  1H7C A;  5FY1 A;  5AQV B;  2MPK A;  4CZZ B;  2VQE T;  4DV3 T;  2KSR A;  4MHC A;  4Q25 A;  1IAP A;  4JI4 T;  4EXT A;  2JPF A;  3AE7 A;  4HWD A;  5JRC B;  1QLB A;  2M6B A;  1ZEE A;  2DCF A;  2YU1 A;  2J4G A;  2HPL A;  4WNK A;  2LSY A;  2W63 A;  4AQG A;  4QXC B;  2C5K T;  3ZMS B;  4JI8 T;  5LG3 A;  4MAL A;  5C3J A;  3U78 A;  4TX5 A;  4EOZ B;  4IDQ A;  4YY3 T;  2JIW A;  3AA7 B;  2ZM0 A;  3MZK B;  1MIW A;  5FNV E;  3TKL B;  5L4H A;  2BKP A;  3VRA A;  2WM9 A;  2E9X B;  2WU2 A;  3EDV A;  4HTE A;  4XAX B;  5FMN A;  3GWH A;  5HEU A;  4KHP T;  1T72 A;  3LK4 2;  5DQV A;  2VVS A;  3OBV E;  4DR3 T;  4IE0 A;  3AE3 A;  1KK7 A;  2J62 A;  1HG2 A;  2Z6E A;  1MNE A;  5JDQ A;  5LGU B;  5LMN T;  2MAW A;  1D1B A;  4UVC B;  4X5T A;  5LGT B;  4F8H A;  4DO0 A;  4JI2 T;  1VCT A;  3EAM A;  5CJ5 A;  4O2A E;  4EIW A;  2QGS A;  4KHZ F;  2OV9 A;  3AVR A;  4DR7 T;  3VU7 H;  3N2G E;  5ADX L;  3J9X 1;  2X67 A;  3IHR A;  5L3G B;  3VKH A;  3IF8 B;  3ETV A;  4H63 H;  3RYF E;  1EZ3 A;  1BR0 A;  4COF A;  1W9R A;  2XQ4 A;  4DR6 T;  3PE0 A;  2GK9 A;  5JDH A;  5AQF B;  4JBW F;  1YKE B;  2R6G F;  2NTY A;  4U2Z A;  3UFE A;  4LF9 T;  1U5P A;  4C90 A;  4U3C A;  4LML A;  3I1A A;  1N33 T;  2OA5 A;  3JCF A;  2VUR A;  2YDR A;  1QSD A;  4U7Y A;  1G8X A;  4YLH A;  3TLS A;  4YHH T;  2DI4 A;  5AQT B;  1UCU A;  3M3Z B;  2QVA A;  1SUM B;  2XQA A;  4O4J E;  3N9O A;  4PFP A;  4UVB B;  2K5B B;  1UUR A;  4B3R T;  2FUP A;  2FJA A;  4UR9 A;  3KVA A;  3C50 A;  3OYX A;  4QXB B;  4PK4 A;  5L3B B;  4AQY T;  5HEJ A;  3WI3 A;  3CVR A;  1T8B A;  2JRK A;  3EVY A;  2RPA A;  3ONL C;  1QUU A;  3QUJ A;  3IEE A;  5HEO A;  4ILA A;  4ZI3 C;  5FXX A;  5LBQ B;  3LSV A;  5CFB A;  4KUM B;  4EYU A;  2E8I A;  4X62 T;  4ZS2 A;  2WP9 A;  3JC6 C;  3JAE A; 
#chains in the Genus database with same CATH homology
 3RYH E;  2C5I T;  3R84 B;  4AXP A;  5HXC A;  2NOX A;  3AAA B;  2CXF A;  1NAF A;  2WAU A;  3J7Y q;  3KV6 A;  3ZC0 A;  2VWA A;  3O4X E;  5CA1 E;  3MKD A;  4AKH A;  2ACX A;  1VRB A;  4WW0 A;  3I9Y A;  3LBX A;  3RYI E;  4DBQ A;  3F57 A;  2IC9 A;  4IHJ E;  5H6R B;  5LOV E;  3NZQ A;  2KZ7 B;  2LM9 A;  2CEA A;  2XAS B;  4GK0 E;  4PJL A;  4IGU A;  4ZI3 D;  4YHJ A;  1IZN B;  3FB2 A;  3NRX A;  2LE8 A;  2LHR A;  2EHO B;  3AB3 B;  4DMV A;  5JR9 B;  3KV4 A;  4YJ2 E;  2CXD A;  2PFV A;  4IE7 A;  2XQY A;  5ETW A;  2KXP B;  4PAG A;  5GON E;  2DWG A;  3C64 A;  3I0O A;  5L3F B;  3N9N A;  3N9Q A;  4NUV A;  2VKJ A;  2VKD A;  2CXL A;  5LHI B;  3ONX A;  3NBX X;  3GMI A;  3C4Z A;  3KV9 A;  3MJX A;  3UT5 E;  4L5G A;  3ANW B;  3T8O A;  5JDM A;  2LSI A;  3HKD E;  2DWK A;  3QK6 A;  3SRZ A;  2VKH A;  2ZM8 A;  4G2A A;  4AI6 A;  5LNK A;  2ZLY A;  3K3O A;  2QA7 A;  4IDZ A;  4K0U A;  3VU7 H;  1OWA A;  2YU2 A;  4MBQ A;  2ZM2 A;  3LJC A;  2LHN A;  4PJJ A;  3UUM A;  5HXE A;  4ZHQ E;  4CXX A;  4P0A A;  5IYZ E;  2I59 A;  3FHN A;  3Q5X A;  3VKG A;  3HL6 A;  4UF0 A;  2VKO A;  5C8Y E;  2K9A A;  3CQX C;  2KMF A;  2CM0 A;  3O9X A;  4O4I E;  3N9M A;  4BA9 A;  4O2B E;  5DQW A;  3CX6 B;  3MK7 C;  4WBN E;  1D1C A;  2N1G A;  4ZI2 C;  5F8P A;  5EK4 A;  1Y64 B;  2A2F X;  4P09 A;  4QKN A;  3CML A;  4OYK A;  3Q9D A;  3ESL A;  5JDG A;  3ANW A;  3BQK A;  3ZYM A;  3I9W A;  1Z0P A;  1WR6 A;  3O1H A;  2V7M A;  2Q9Q C;  3HKB E;  2MBG A;  4I43 B;  5FYM A;  3L09 A;  3PU3 A;  4ZI2 D;  1S94 A;  4KBM B;  5FXZ A;  1FMW A;  2V7J A;  1BR2 A;  2H7O A;  5L3C B;  4UXN B;  5JR9 A;  1IJ6 A;  3N9P A;  2CWO A;  2NW8 A;  3PUQ A;  5FXW A;  3CQG B;  4BJN A;  3FXE B;  1MMA A;  2WMO A;  3RC3 A;  2ES0 A;  2CMR A;  3KIN B;  3AA6 B;  2JJ9 A;  3EDU A;  4Z8X A;  4I4T E;  2Q9Q D;  5JRC A;  1WYB A;  4AKR B;  3GN5 A;  5HYA A;  4TV8 E;  5JDL A;  4EB6 E;  4X1K E;  4ANJ A;  4PJM A;  3BK9 A;  3BQL A;  4P0B A;  4OHF A;  2C0S A;  2LSJ A;  2V7I A;  3B13 A;  3CPZ A;  4I55 E;  4O4L E;  5LBM A;  2XAH B;  1LVF A;  5JDF A;  1MMN A;  2D2S A;  3ZLI A;  3PTR B;  2X0L B;  1NWM X;  5FP3 A;  5HWX A;  2X9X A;  4IIJ E;  2MOZ A;  3MAC A;  5FXV A;  2H7V C;  1HX8 A;  2M67 A;  4AKL A;  4I50 E;  3NZP A;  1ZKE A;  3HA4 A;  1HG5 A;  5FY7 A;  1HS7 A;  3UUN A;  2WWU A;  3ZN0 B;  4MLK A;  5LP6 E;  2PJQ A;  2ZMA A;  3K3Q C;  3ZMU B;  3RX6 A;  4V1A v;  2X51 A;  4IE4 A;  3HKC E;  4FJO A;  3VHL A;  3ZJ2 A;  4UEL A;  2XAJ B;  3I0Q A;  3LBX B;  4H9S E;  2VAS A;  1SHZ C;  3AAE B;  2C5J A;  2P9B A;  5LGU B;  4L0R A;  2D0T A;  4EZ4 A;  3P8C D;  2BDE A;  5JVD E;  2J1D G;  1ZHC A;  2LT3 A;  4ILU A;  4QWN B;  2EHO C;  3PUS A;  3C4X A;  1UX5 A;  4JLE A;  4UV9 B;  2N2N A;  2LSG A;  2Y8D A;  3M65 A;  3OKQ A;  4H9N C;  4XZC A;  1LKX A;  3V5S A;  3ZJ1 A;  2HH7 A;  2K24 A;  2KIN B;  1IJ5 A;  4TN7 B;  4E7S A;  3Q5W A;  4HKA A;  4F6R C;  2VL8 A;  1SA0 E;  4PK6 A;  1WYC A;  4B6X A;  3N2O A;  4MFR A;  3R6N A;  2L3L A;  3H3A A;  3WAK A;  1MIY A;  4HE8 A;  2L9Q A;  3LFM A;  3NRY A;  4G63 A;  1FIO A;  5LJN A;  4JUY A;  2XAQ B;  3LK3 B;  2SPC A;  3ZMZ B;  1LRZ A;  2CA5 A;  2CLY C;  4YJ3 E;  3E22 E;  3WAJ A;  3KBT A;  4CI1 B;  5EK3 A;  4H9R C;  2UXX B;  5J2T E;  4EZH A;  2LSK A;  2E9X C;  4AQF C;  5LG4 A;  2DHR A;  2KWI B;  4TUY E;  4X1I E;  2A3D A;  2DLR A;  2XTL A;  3FBZ A;  2WSS V;  3ZYL A;  1HF8 A;  2LEH A;  1US7 B;  3Q2M A;  2E9X D;  4A56 A;  3PUA A;  2W61 A;  2EHO D;  1HTJ F;  2XAG B;  5CB4 E;  4AQF A;  4HEA A;  2XHE B;  2Y48 B;  2V7L A;  1HCI A;  2NTX A;  2JQQ A;  4OFZ A;  5KX5 E;  3ZCJ A;  1BR4 A;  3W15 B;  4CXY A;  5JH7 E;  4H9Q C;  3ZN1 B;  3H37 A;  2XAF B;  3HR0 A;  5DAB A;  3ZCI A;  3RYC E;  4IE6 A;  1D0Y A;  3RPU A;  4XBF B;  4H9O C;  5JDN A;  2Q9Q B;  1D1A A;  5LHH B;  4TZ4 C;  2YEV C;  3SOL A;  4IST A;  3O1I A;  1O3X A;  4CQI A;  4AKI A;  1B7T A;  4GIW A;  4ISS A;  2UXN B;  5LHG B;  4O4H E;  5E0O A;  3N5L A;  3IBP A;  3RC8 A;  3ZEF B;  2BVL A;  5H6Q B;  2MYS A;  4EYY R;  3FXD B;  2W62 A;  1MMD A;  4PNI A;  5HWY A;  3LG7 A;  3ZPO A;  5A1L A;  3PUR A;  1OXZ A;  5HXS A;  2X9H A;  4H63 V;  4C91 A;  4ASK A;  3RH3 A;  3AA0 B;  5J1G A;  5IHY A;  4CI3 B;  3F2E A;  4YFS A;  3V5U A;  5JR9 C;  3ZMT B;  4PFO A;  5LJM A;  3AA1 B;  4PJN A;  1LVK A;  3SWH A;  3RRW A;  4ADZ A;  1G73 A;  3DP7 A;  4QHO A;  1FMV A;  2Y6X A;  2VB6 A;  1E1H B;  4JEH B;  1MIV A;  2NW7 A;  2IW5 B;  2JMK A;  2CCQ A;  4UVA B;  3L3P A;  4WBO A;  4U72 A;  3CX8 B;  2HPJ A;  4H9P C;  2E9X A;  2LJL A;  3GA8 A;  5CA0 E;  5KMG P;  4BJM A;  5J2U E;  1YKH B;  2CWY A;  2YK0 A;  2MTQ A;  2JMH A;  3OJA A;  4ERR A;  3ZMV B;  5AFU L;  3MA9 A;  4J2C A;  4L9I A;  1FEW A;  4N78 D;  2DNX A;  1U4Q A;  4O8S A;  4GK5 E;  4DBR A;  2XUE A;  3UUX B;  3OYZ A;  5LGN B;  3GN5 B;  4HFV A;  4UV8 B;  2L8K A;  4AKG A;  5L2L A;  4X1Y E;  4U74 A;  5F3J A;  2IAK A;  2ODU A;  5LXT E;  2X9Y A;  2D5U A;  4ZS3 A;  2X9W A;  3KV5 A;  1X79 A;  2RP4 A;  4KP3 C;  3U3I A;  5HXH A;  4JEU B;  4CXW A;  3KBU A;  2KWH A;  1D0Z A;  2LOP A;  1V9D A;  4QX7 B;  5LCY A;  2X66 A;  4TV9 E;  4NUU A;  2BVM A;  1BR1 A;  4DMW A;  2WMN A;  3K8P C;  3D0T A;  1MMG A;  2NP9 A;  3FBL A;  2PG8 A;  1MND A;  5JQG E;  2CLY B;  2V1D B;  5DJQ C;  3C51 A;  3N2K E;  5M4Y A;  1AJ3 A;  1WRD A;  4ZOL E;  4QXH B;  2PBI A;  3CKD A;  2NW9 A;  3DJB A;  2B1E A;  4PK5 A;  5KDM C;  3HKE E;  3S4U A;  2H3R A;  2YIN A;  4OK0 A;  2NWB A;  3C98 B;  4FI5 A;  3ZC1 A;  1D0X A;  2N9D A;  2KLQ A;  2V26 A;  4UEM A;  3RRC A;  1CUN A;  4DVD A;  4GYR A;  2BZB A;  1WLX A;  1HFA A;  2ODV A;  3AAI A;  4GOU A;  5BMV E;  5HAX A;  3KFW X;  3JC6 D;  2EHO A;  1ZV4 X;  2A72 A;  2W00 A;  3KDS E;  5FY0 A;  2WBL A;  2V7K A;  3C4W A;  3RKO A;  3CQC B;  5LYJ E;  3DTO A;  4OYJ A;  3MXZ A;  4EAH A;  3P7I A;  5LA6 E;  3UUL A;  4HN9 A;  2RA1 A;  1YD8 G;  1YW0 A;  4X20 E;  4QX8 B;  3ETU A;  3ZYK A;  2VK9 A;  2LOS A;  4GYS A;  5HXR A;  2Q9Q A;  3PDY A;  2CE7 A;  4E7Z A;  4KMC A;  2X68 A;  2G0U A;  2IC6 A;  1UX4 A;  3E08 A;  3K3N A;  4DND A;  3KVB A;  3QC9 A;  4PW8 A;  1KNZ A;  3N9L A;  3PUG A;  3CX7 B;  3AVS A;  3CWZ B;  5JRE A;  2W0G A;  3HI2 A;  4IE5 A;  3A5X A;  2KT9 A;  4BAY B;  3E0Z A;  4UIG A;  4HGA A;  5L3E B;  3F31 A;  3PU8 A;  3O1J A;  4UF0 B;  5TAO A;  3EUH A;  5EK2 A;  5L3D B;  1T98 A;  3B57 A;  2KND A;  3BQI A;  4CI2 B;  5EZY E;  3SS1 A;  2K48 A;  1VOM A;  1S35 A;  4ZI7 E;  2D0U A;  4M1P A;  5FY1 A;  1H7C A;  4CZZ B;  4MHC A;  1IAP A;  4EXT A;  2JPF A;  5JRC B;  1ZEE A;  2DCF A;  2YU1 A;  2HPL A;  4WNK A;  2LSY A;  2W63 A;  4AQG A;  4QXC B;  2C5K T;  3ZMS B;  4MAL A;  3U78 A;  4TX5 A;  4EOZ B;  3AA7 B;  2ZM0 A;  3MZK B;  1MIW A;  5FNV E;  3TKL B;  3EDV A;  2E9X B;  2WM9 A;  4HTE A;  4XAX B;  5FMN A;  3GWH A;  3LK4 2;  5DQV A;  3OBV E;  4IE0 A;  1KK7 A;  1HG2 A;  2Z6E A;  1MNE A;  5JDQ A;  1D1B A;  4UVC B;  5LGT B;  4DO0 A;  4O2A E;  4EIW A;  2QGS A;  3AVR A;  3N2G E;  5ADX L;  3J9X 1;  2X67 A;  3IHR A;  5L3G B;  3VKH A;  3IF8 B;  3ETV A;  4H63 H;  3RYF E;  1EZ3 A;  1BR0 A;  3PE0 A;  2GK9 A;  5JDH A;  1YKE B;  2NTY A;  3UFE A;  1U5P A;  4C90 A;  3I1A A;  2OA5 A;  1QSD A;  1G8X A;  4YLH A;  2DI4 A;  1UCU A;  4O4J E;  4PFP A;  4UVB B;  3N9O A;  2K5B B;  3KVA A;  3C50 A;  3OYX A;  4QXB B;  4PK4 A;  5L3B B;  3WI3 A;  3CVR A;  2JRK A;  3EVY A;  3QUJ A;  3UTK A;  4ZI3 C;  1QUU A;  3IEE A;  5FXX A;  5LBQ B;  4KUM B;  4EYU A;  2E8I A;  4ZS2 A;  3JC6 C;  3LK2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...