1V9DA

Crystal structure of the core fh2 domain of mouse mdia1
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
332
structure length
308
Chain Sequence
b'VKELKVLDSKTAQNLSIFLGSFRMPYQEIKNVILEVNEAVLTESMIQNLIKQMPEPEQLKMLSELKEEYDDLAESEQFGVVMGTVPRLRPRLNAILFKLQFSEQVENIKPEIVSVTAACEELRKSENFSSLLSFLCKLRDTKSADQKMTLLHFLAELCENDHPEVLKFPDELAHVEKASRVSAENLQKSLDQMKKQIADVERDVQNFPAATDEKDKFVEKMTSFVKDAQEQYNKLRMMHSNMETLYKELGDYFVFDPKKLSVEEFFMDLHNFRNMFLQAVKENQKRRETEEKMRRAKLAKEKAEKERL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Diaphanous protein homolog 1
publication title The core FH2 domain of diaphanous-related formins is an elongated actin binding protein that inhibits polymerization.
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 120
structure length 308
sequence length 332
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-01-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.630 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA01
1.20.58.2220 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1v9dA02
2J1DG 3O4XE 1Y64B 2Z6EA 4EAHA 1UX4A 1UX5A 3OBVE 1V9DA
chains in the Genus database with same CATH superfamily
1N34T 4ADZA 3EAMA 4UVCB 3LSVA 4B6XA 3AE2A 4PK4A 2MOZA 2N2NA 4UR9A 1Y01A 4P09A 3LK42 2K5BB 5LBMA 3ZPOA 1SHZC 2LRKA 3AEBA 4QH4A 2CLYB 2WCAA 3ZMVB 1WYBA 1IBMT 4O2BE 4ZXLA 2XQAA 2WSSV 5C3JA 2ODVA 2YOEA 2J62A 2JIWA 5L3DB 3UU5A 5JDMA 2YN6A 2V1DB 3P4SA 2V7KA 2IC9A 4DUYT 3RYIE 4ZZCA 2W66A 4IL4A 4DBQA 4O4HE 4PFOA 3Q5WA 4NUUA 1GQEA 2YINA 1YKEB 4UEMA 3TLUA 3N9MA 5AQPB 3IA3A 2ZM6T 2WQYA 2BVMA 5HEOA 2OV9A 2C0SA 3P4WA 1X79A 3EI0A 5EK2A 3DP7A 2DCFA 2LKHA 3TKLB 3ZSTA 4HFCA 4WBOA 4YLHA 3G06A 4AXPA 2EHOC 1WRDA 4H9OC 3ESLA 3ZYLA 3LDQB 1NEKA 1WFDA 4XBFB 4IDQA 5LA6E 3NRXA 1J1JA 2LRLA 3LJCA 4BJMA 2BG9A 2XY8B 3N5LA 2E9XA 4GK0E 3AEGA 4ZI2C 1HNZT 3N9NA 3N9QA 3AE7A 3RX6A 2XQ3A 4TN7B 4Z91A 3AA0B 4EIWA 2CHOA 1S35A 2XQ5A 3KINB 1L0VA 2BVLA 3JC6C 3A8YC 3ZN0B 3UU4A 3P4RA 3EVYA 3ZKRA 5HXEA 3DJBA 3UTKA 3QC9A 5H6QB 5EK4A 2QRXA 3OPCA 3ZEFB 1FJGT 3P4QA 3NBXX 2CLYC 4CI1B 2N9DA 4PW8A 5CGMA 5FXWA 2C5JA 4OHFA 5ABEA 4JI4T 2X67A 5LJNA 4AKLA 3PUWF 1MMDA 4QH1A 4HN9A 1UX5A 2V7IA 4KI0F 2JQ9A 4JI0T 4CZZB 2C5KT 3IF8B 1WR0A 4A5XA 1G8XA 2FUPA 1DU2A 3ZLIA 4ZZBA 3Q5EA 2WZHA 4DV4T 4DV6T 1R8IA 2DLRA 2CHNA 1UURA 4TV9E 2WS3A 5LCYA 4NIQA 1FMWA 3AA1B 1VCTA 4OYJA 4IE4A 2XUEA 3IEEA 2B76A 4C91A 3RYCE 5HXSA 4CN4A 2KZ7B 2YDQA 2IMLA 2L8KA 2XHEB 2XAQB 4TZ4C 4B3TT 4EYUA 1ZOYA 4H9QC 3VKHA 4KUMB 4ZEYA 2DHRA 5F3JA 3CIRA 3I1AA 5J2UE 1HCIA 2CXLA 2WDRA 2J47A 2J4GA 4DR6T 2BS4A 5IWAT 2UU9T 1D1AA 2HN1A 3IHRA 4NXNT 4ZI3C 4FJOA 1ZKEA 3AE4A 4PJJA 4JI1T 1HX1B 2LE8A 5L47A 2CE7A 2UXBT 4UVAB 1UCUA 3OVUA 2WY2A 3EDVA 3MZKB 5LBQB 3N9OA 4DMWA 5FVLA 1NAFA 4HFDA 2VK9A 3K3OA 3ETVA 5CA1E 3Q9DA 2M6IA 3I9YA 2VKJA 2VQET 3AEEA 3PU8A 3T1YT 2ZM8A 3V5UA 3PUQA 1OEDB 1ZV4X 2K48A 3NZPA 2KMFA 2NWBA 5AQGB 5H6RB 2X9WA 4UF0B 2NTXA 4YSYA 2Q9QA 5HAXA 1BR4A 3ZC1A 3CQCB 4EYYR 1B7TA 4F8HA 5ABHA 2V5CA 4DV7T 3ZMZB 4CI3B 4U74A 2PJQA 2VWAA 3CPZA 2XSAA 1OWAA 3K1SA 5CA0E 3Q5XA 3F2EA 4X1YE 3B57A 2R6GF 3ANWA 1W09A 4HWDA 5FVKA 4HFVA 3FHNA 5IHYA 2D0TA 4QXBB 3CQGB 1YKHB 3KDSE 4G2AA 2IHR1 4ASKA 3E22E 2PBIA 2LSGA 2HN2A 2Y6XA 3KVBA 3QUJA 3ABVA 3UQ4A 2XM2A 3P7IA 3AA6B 3PURA 3Q5DA 4QHOA 3ZYKA 5LG3A 2V5DA 4U31A 4TWFA 5KDMC 3LBXA 4XAXB 1UUSA 1V9DA 5ABGA 4E7ZA 4WW0A 4IE7A 3A5XA 1MMAA 2JQKA 1SUMB 3ZC0A 2BKNA 3H3AA 4HWFA 1N32T 4ILAA 3RQUA 3OTOT 2LJLA 2LHRA 3AXJA 1YXRA 2JQQA 5AQOB 3AE9A 4BAYB 3UU8A 3KV5A 2UXXB 2QA7A 3FXDB 2H89A 3L3PA 2W67A 4X5TA 3RC8A 4DO0A 1S94A 4GYRA 2ZLYA 1WCRA 4CQIA 5J0ZA 4LF7T 1MIVA 1HS7A 2XJ7A 4XZCA 1OEDC 2XQ9A 4ILBA 4J2CA 3L39A 2X51A 2NW8A 1CHUA 2MBGA 3IBPA 2BKOA 1X9BA 3AA7B 1IZNB 4H9NC 4O4IE 4JI5T 3ZJ1A 2HH7A 3AVSA 3RF1A 2F4VT 1SA0E 2EHOB 4UV8B 3J7Yq 3R84B 5LYJE 3SOLA 1KF6A 3P4PA 1XMOT 4NXMT 2XAJB 5JDHA 3MACA 5JREA 2WM9A 2V8SV 3UU6A 3V5SA 3T8OA 2IDOB 3FXEB 2JPFA 3PJAJ 4WZXA 4ZI7E 3PUVF 5JQGE 3BQKA 3UULA 2E9XB 4NPPA 4YTNA 2WP9A 4HWCA 4H9SE 3QNUA 5BR8T 4HFBA 2XAHB 3F57A 3CVRA 5HEGA 3ZMSB 2IUBA 2JMHA 1O3XA 2XPKA 3ZMTB 4BA9A 1M7KA 1J5WA 3KVAA 2HPJA 4N78D 5JR9B 4YSXA 3HL6A 5AQMB 1WLXA 4JI2T 3AE6A 3O4XE 3BK9A 1IJ6A 5HXHA 3C98B 2W2UA 3VU7H 5DJQC 2W61A 5KMGP 3C64A 5C2TA 2ODUA 4MLKA 5AQVB 2B1EA 3RIFA 2HPLA 2K3WA 5AQKB 2KXPB 3EHZA 3UFEA 4B3RT 2G0UA 3CKDA 3BQLA 3JAEA 3O1HA 4PJNA 4GKJT 4EXTA 4IE5A 4CXWA 5AQRB 4PAGA 4U2YA 2WZIA 4DR7T 2L9QA 2V26A 4MHCA 2WAUA 3CQXC 1QLBA 3X1DA 3VRBA 1KK7A 4V1Av 4DNDA 3M3ZB 1XZYA 5DABA 2CA5A 2HHHT 5AQUB 1IJ5A 2ACZA 2H88A 2GK9A 1JNZA 4X1IE 3KBTA 1M62A 2LSIA 2H7VC 2BG9C 3EABA 4I43B 3HKBE 3NZQA 4ZHQE 5TAOA 2LOSA 2YU2A 3OJAA 1OEDE 2E9XC 2V7JA 3OKQA 2WU2A 4X20E 5JTGA 2OLTA 4HEAA 2V6YB 3AAEB 4TNVA 2K24A 4EEDA 3RHWA 1CUNA 4CN1A 4EB6E 4FI5A 5JDNA 3GN5A 2DWKA 3WAJA 5HXRA 5JR9C 1XNQT 4WNKA 4WYVA 2VVNA 3EUHA 2Y48B 2I59A 2YU1A 4YY3T 4I50E 4HFIA 5LB7B 3NKZA 3OYXA 5ABFA 4G63A 4UXNB 3FZFB 1ZHCA 4ZI2D 2A2FX 2LSKA 3AEFA 2AXDS 3ZSSA 2LHNA 4GOUA 1MIYA 2Q9QB 4IDOA 3N2GE 3VHLA 4CI2B 3KFWX 2LM2A 2Y8DA 3JC6D 4OK0A 3AAAB 2BZBA 3FZLB 3JCFA 2BS3A 1OXZA 2M6BA 4H9RC 1LKXA 4U72A 3RRWA 3VR8A 2X0HA 5FXVA 4QXHB 5FY7A 2E2AA 4L9IA 3ANWB 2IIUA 2H7OA 3SFDA 2ZM2A 1MMGA 2YKSA 4EEBA 4DR1T 4EZHA 4HWIB 2BBHA 4DR5T 3BQIA 2ZMAA 4LF4T 1BR0A 4IE0A 3HA4A 4TWDA 1KFYA 2I6HA 4A98A 4M1PA 2LOPA 3RKGA 2J1DG 1VCSA 4L5GA 2KINB 3AE8A 2ZM0A 4PJLA 3AE1A 3LG7A 1VRBA 2W63A 4DV1T 4X1KE 4KP3C 5AQIB 4IL9A 2BKPA 4K0UA 3RC3A 5HWXA 3F31A 3E08A 3NWIA 2VL8A 3AXJB 2XAGB 3C4WA 2UUBT 2CM0A 4A97A 2VB6A 4OX9T 3KV6A 4QX7B 5HEUA 4P1NA 5IYZE 5JDGA 5AQNB 2NP9A 4AQFA 2CBIA 4LF6T 1HNXT 4COFA 3VRAA 3LK2B 2WDVA 2XQYA 3DTOA 2XSBA 3AECA 2VKHA 5HYAA 4PK6A 4IT4A 1MNEA 4CXYA 3E0ZA 2IAKA 3NRYA 2Q9QC 3SRZA 4YFSA 2BS2A 2X9YA 3RIUA 3UUXB 2WBLA 5E0OA 1IAPA 3PU3A 3SS1A 4O8SA 3ZYMA 2PG8A 3PUSA 4JI7T 3P8CD 1NENA 3RGLA 3SWHA 5ADXL 4UIGA 2OA5A 1QSDA 4EGWA 4IDPA 1E1HB 1WYCA 4DUZT 3JAFA 4MALA 2DNXA 3RKOA 4U7IA 2UXCT 4IHJE 1IBKT 3FBLA 1YW0A 1EZ3A 3WAKA 5LGTB 3OYZA 2LEHA 1E7PA 5L4HA 2WU5A 2X0YA 1T8BA 1E2AA 4ISTA 3GA8A 3LK3B 1Y64B 1D0YA 4OYKA 3MA9A 5KXJA 3CX6B 1J5ET 2KWIB 5ETWA 2MYSA 4O4JE 3MJXA 1D0ZA 4TWHA 5HEHA 3W15B 1YD8G 3A7MA 3AVRA 4LF9T 4LFBT 4IDNA 4YTMA 5LGUB 4CN6A 3QB5A 4AISA 2XTLA 3H3MA 1I94T 4HFHA 2PTFA 5LMUT 3K3QC 2D9DA 5FMNA 3CWZB 5AQTB 3J9X1 5AQHB 4ZS2A 2WWUA 2FBWA 2Z6EA 5GONE 4KBMB 3CX8B 4DR2T 4QXCB 4JV5T 1MNDA 3LFMA 4I55E 4AKHA 2D2SA 4I0UA 3ONLC 1D1CA 3C51A 4H63V 3GMIA 3UQ7A 3AAIA 4K0KT 2KSRA 3ZMUB 1T7SA 3I9WA 3Q2MA 2BG9B 4O2AE 1XDPA 2A72A 2CEAA 3B5MA 3KV9A 1N33T 1HFAA 2X68A 3PUYF 4U2ZA 3O1IA 1HR0T 2NW9A 4KHZF 5FL1A 4EAHA 3QOFA 1BR2A 1QUUA 4WBNE 2CMRA 2X0LB 3AE3A 2KLQA 2WMNA 4ANJA 4JI3T 2BBJA 4ERRA 3GN5B 1HG2A 2XZEA 2H3RA 2DL1A 5JVDE 3KV4A 3TLVA 2L3LA 3P50A 4IGUA 2D0UA 5AQFB 3GWHA 5JRCA 2WDQA 2ES0A 4Z8XA 5ABFB 4U33A 2RA1A 3C50A 5HEJA 4O4LE 3CX7B 5HWYA 4X62T 2XAFB 3QB5K 5CFBA 4YJ3E 2LT3A 3AE5A 3PE0A 1FIOA 2XM1A 2UXDT 5LXTE 4MBQA 2WB5A 4DV0T 1HTJF 1UX4A 3QK6A 4HKAA 1ZEEA 5L3FB 3PTRB 4AKGA 4GIWA 3S4UA 2DI4A 4JI8T 3B13A 3RRCA 2E5VA 3MXZA 4X65T 4PJMA 4BJNA 3M65A 3AB3B 3U78A 3FZKB 2QGSA 5L3BB 3N2OA 2A9UA 2QVAA 1SE7A 4HWHA 4DIDB 2JMKA 2PFVA 1T72A 3TLWA 2V6XA 2V7LA 1WR6A 2X66A 5L3GB 5FY1A 1HNWT 3ZCIA 5AQSB 3CK6A 4YXDA 1I6ZA 3PV0F 2XQ6A 4EV6A 4HGAA 1D1BA 4B3MT 4JBWF 2EHOA 1LVFA 3AEDA 4DV2T 4E7SA 1UGOA 2E8IA 3EDUA 2CXFA 3MKDA 5AQLB 1XDOA 4ILUA 4A56A 5JDLA 4LMKA 4LF5T 4HE8A 2EHOD 3FB2A 2UUAT 3C4ZA 5BMVE 4IDZA 1U5PA 5FYMA 4DV5T 2KT9A 4DV3T 3WI3A 5JH7E 3UUBA 1XWMA 1AJ3A 5FP3A 1US7B 3TLSA 2FJBA 5A1LA 2IC6A 5FY0A 1Z0PA 4GYSA 2E9XD 5J1GA 3D0TA 4AQGA 4UV9B 4MFRA 3RYFE 3I0OA 1KEYA 4YSZA 5JR9A 3R6NA 1IBLT 3HI2A 2UUCT 2WWVA 4QX8B 3RI5A 4JEUB 5FXXA 2LSYA 3HKCE 4U3CA 2X9XA 2XASB 2JQHA 4H63H 5FNVE 2I0MA 2VVSA 2XQ8A 3ETUA 2P9BA 4PFPA 5DQWA 2MTQA 2NR4A 2W4XA 4LFAT 3ZJ2A 1W9RA 4JYAT 2M67A 2YDRA 2CBJA 2YDSA 1HX8A 3TLTA 2CCQA 3HKDE 3UUMA 5AQQB 4IREA 3PUGA 4I4TE 3T1HT 5LMNT 2VASA 5L3CB 3U3IA 4KHPT 2ACXA 4LMLA 4YT0A 4PNIA 4P0BA 4JEHB 4AKIA 5FL0A 1Z8UA 2NTYA 3SFEA 4JUYA 3RLFF 4IE6A 2LSJA 4GK5E 1MIWA 2YEVC 4YHJA 4DR3T 4C90A 3UT5E 2VL0A 4X66T 4YHHT 5CJ5A 2FJEA 4YTPA 4JLEA 3LBXB 3UUNA 2IW5B 1HG5A 4LMJA 2VURA 1VOMA 2WMOA 4Q25A 4LF8T 4ZS3A 2MPKA 4GKKT 2FJDA 2JJ9A 3N9LA 3N2KE 5F8PA 4X64T 2C5IT 2W62A 5LG4A 2N1GA 4ZI3D 2V6YA 4AQFC 1XNRT 2BG9E 5LOVE 3PUAA 3KBUA 2CPTA 4DBRA 5LNKA 4TUYE 3PDYA 2E5LT 4DR4T 1ZP0A 1N36T 3RQWA 3RPUA 3HR0A 4DVDA 1JNRA 3RIUC 3PUZF 5IUXA 2W0GA 2JRKA 2NOXA 1G73A 4TNWA 3RYHE 2CWOA 5JDQA 3FBZA 3VKGA 3RIAA 2NW7A 3NVOA 2LM9A 3O9XA 2BDEA 5HXCA 1YQ4A 4TV8E 2XQ4A 4EOZB 2CRBA 1NWMX 4UVBB 5L3EB 3MK7C 2QYWA 2Q9QD 4HFEA 2YK0A 4P0AA 1W0AA 4F6RC 4AI6A 3VR9A 1W0BA 4AQYT 4Z90A 2K9AA 1LVKA 4TX5A 4HTEA 3ZCJA 3ONJA 5FKYA 5DQVA 5JRCB 2KNDA 1XMQT 5M4YA 5LHIB 3PUXF 2LKGA 2CXDA 1KNPA 4ZOLE 4LFCT 5L4EA 2X9HA 3C4XA 5F5WA 3ZT6A 1KNZA 5AFUL 3I0QA 2FJAA 2MAWA 4QH5A 3ZT7A 3O1JA 3L09A 4QKNA 5EZYE 3PJAA 5LJMA 2XQ7A 4PK5A 3ONXA 4IIJE 3H37A 3K8PC 4L0RA 3K3NA 3JADA 3FZMB 5C8YE 2RP4A 2CWYA 1T98A 5EK3A 4QWNB 3AEAA 3CMLA 4ILCA 1U4QA 2VKDA 1FMVA 1OEDA 4U7YA 1FEWA 2RPAA 4B3ST 5AQJB 4DMVA 1KNRA 1HF8A 5L2LA 3HKEE 3FZHB 3ZN1B 1LRZA 1BR1A 4UF0A 2D5UA 4ISSA 4KX6A 4H9PC 4CXXA 5LHHB 1D0XA 2VQFT 4JI6T 2VKOA 1UK5A 2SPCA 4YJ2E 2W00A 5JDFA 5KX5E 2AE9A 2DWGA 4KMCA 4AKRB 5LGNB 2V7MA 3L8RA 1H7CA 5LHGB 5HCJA 4AIUA 3N9PA 4OFZA 4UELA 3OBVE 4NUVA 5FXZA 5J2TE 1YQ3A 1MMNA 3ZT5A 2LLYA 4EZ4A 2UXNB 2KWHA 5CB4E 3RH3A 5LP6E 3UU3A 5HCMA 2A3DA 3UFGA
chains in the Genus database with same CATH topology
4KP3C 2KT9A 4QHOA 3ZYKA 4ADZA 3WI3A 4UVCB 5JH7E 4K0UA 3RC3A 4B6XA 1AJ3A 5HWXA 3F31A 5FP3A 1US7B 3E08A 4PK4A 5KDMC 3LBXA 4XAXB 2VL8A 5A1LA 2XAGB 2MOZA 1V9DA 2IC6A 2N2NA 3C4WA 4E7ZA 4P09A 3LK42 5FY0A 4WW0A 2K5BB 2CM0A 4IE7A 1Z0PA 3A5XA 4GYSA 5LBMA 2VB6A 1MMAA 2E9XD 3ZPOA 1SHZC 3ZC0A 3KV6A 4QX7B 3H3AA 3D0TA 5J1GA 4AQGA 4UV9B 4MFRA 3RYFE 3I0OA 5IYZE 5JDGA 5JR9A 2LJLA 2LHRA 2CLYB 3R6NA 3ZMVB 1WYBA 3HI2A 4O2BE 2NP9A 2WSSV 4AQFA 2ODVA 4QX8B 2JQQA 3LK2B 4BAYB 4JEUB 5FXXA 2LSYA 5L3DB 5JDMA 3HKCE 2V1DB 2X9XA 3KV5A 2XASB 2UXXB 4H63H 5FNVE 2QA7A 2V7KA 2XQYA 3FXDB 3DTOA 3L3PA 3RC8A 3ETUA 2IC9A 2P9BA 4DO0A 3RYIE 4PFPA 1S94A 2VKHA 2ZLYA 4GYRA 5DQWA 5HYAA 2MTQA 4PK6A 1MNEA 4CQIA 4CXYA 3ZJ2A 4DBQA 4O4HE 3E0ZA 4PFOA 1MIVA 2IAKA 3Q5WA 4NUUA 1HS7A 4XZCA 3NRYA 2Q9QC 2YINA 3SRZA 4YFSA 1YKEB 2M67A 2X9YA 3UUXB 2WBLA 1HX8A 4UEMA 2CCQA 5E0OA 3HKDE 3UUMA 4J2CA 1IAPA 3PU3A 3SS1A 3N9MA 2X51A 4O8SA 3ZYMA 2PG8A 3PUSA 2NW8A 3P8CD 3PUGA 2MBGA 3IBPA 4I4TE 2VASA 2BVMA 5L3CB 3U3IA 3AA7B 2ACXA 3SWHA 1IZNB 4H9NC 4O4IE 3ZJ1A 2HH7A 3AVSA 5ADXL 4UIGA 4PNIA 2C0SA 1SA0E 1X79A 2EHOB 2OA5A 4UV8B 3J7Yq 1QSDA 4P0BA 4JEHB 3R84B 5EK2A 5LYJE 4AKIA 3SOLA 1E1HB 3DP7A 1WYCA 2NTYA 4JUYA 2XAJB 2DCFA 4MALA 5JDHA 2DNXA 3MACA 4IE6A 5JREA 2LSJA 3TKLB 4GK5E 3RKOA 1MIWA 2WM9A 2YEVC 4WBOA 4YLHA 4YHJA 4AXPA 2EHOC 1WRDA 4IHJE 3V5SA 3T8OA 4H9OC 3ESLA 4C90A 3FXEB 3UT5E 2JPFA 3ZYLA 3FBLA 4ZI7E 1YW0A 5JQGE 3BQKA 1EZ3A 4XBFB 3WAKA 5LA6E 3UULA 2E9XB 3NRXA 5LGTB 3LJCA 3OYZA 2LEHA 4BJMA 4H9SE 4JLEA 3LBXB 3UUNA 2XAHB 2IW5B 3F57A 3CVRA 4ISTA 3ZMSB 3GA8A 3N5LA 1HG5A 3LK3B 2JMHA 1Y64B 1D0YA 1O3XA 2E9XA 4OYKA 3MA9A 3ZMTB 4GK0E 4BA9A 1VOMA 2WMOA 4ZI2C 3KVAA 2HPJA 3CX6B 4N78D 3N9NA 5JR9B 3N9QA 3RX6A 2KWIB 3HL6A 4TN7B 5ETWA 2MYSA 3AA0B 4ZS3A 4O4JE 1WLXA 2JJ9A 3N9LA 3N2KE 4EIWA 3O4XE 3BK9A 1IJ6A 3MJXA 1D0ZA 5HXHA 3C98B 1S35A 3VU7H 5DJQC 5F8PA 2C5IT 3W15B 1YD8G 2W61A 3AVRA 3KINB 2W62A 2BVLA 3JC6C 5KMGP 2N1GA 5LG4A 4ZI3D 3ZN0B 3C64A 4AQFC 2ODUA 3EVYA 4MLKA 5LGUB 5LOVE 5HXEA 3PUAA 3DJBA 3UTKA 2XTLA 3QC9A 5EK4A 5H6QB 2B1EA 2HPLA 3ZEFB 2KXPB 3KBUA 3NBXX 4DBRA 2CLYC 3UFEA 5LNKA 4TUYE 2G0UA 3PDYA 3K3QC 3CKDA 4CI1B 2N9DA 4PW8A 3BQLA 3O1HA 5FMNA 5FXWA 2C5JA 4OHFA 2X67A 3CWZB 3HR0A 3RPUA 4PJNA 4EXTA 4DVDA 5LJNA 4IE5A 3J9X1 4AKLA 4CXWA 1MMDA 4PAGA 4HN9A 1UX5A 4ZS2A 2WWUA 2W0GA 2V7IA 2JRKA 2NOXA 2Z6EA 5GONE 1G73A 2L9QA 2V26A 4CZZB 2C5KT 2CWOA 3IF8B 4KBMB 4MHCA 3RYHE 5JDQA 3FBZA 3VKGA 3CX8B 2WAUA 2NW7A 4QXCB 3CQXC 1G8XA 1MNDA 3LFMA 2LM9A 4I55E 4AKHA 2D2SA 3O9XA 3ZLIA 2BDEA 5HXCA 1D1CA 3C51A 4H63V 1KK7A 4V1Av 4TV8E 4DNDA 5DABA 3GMIA 2CA5A 3AAIA 4EOZB 1NWMX 2DLRA 4UVBB 4X1KE 3ZMUB 5L3EB 3I9WA 3Q2MA 3MK7C 4TV9E 2Q9QD 4O2AE 5LCYA 1IJ5A 1FMWA 2A72A 2YK0A 2CEAA 3AA1B 2GK9A 3KV9A 4P0AA 4OYJA 4X1IE 3KBTA 1HFAA 2XUEA 3IEEA 4IE4A 2X68A 2LSIA 3O1IA 3RYCE 4C91A 2H7VC 4F6RC 4AI6A 5HXSA 2KZ7B 2NW9A 2L8KA 2K9AA 2XHEB 1LVKA 4TX5A 4HTEA 4EAHA 4I43B 2XAQB 4TZ4C 4EYUA 3ZCJA 1BR2A 3HKBE 3NZQA 4ZHQE 1QUUA 4H9QC 3VKHA 4KUMB 4WBNE 2DHRA 5TAOA 2LOSA 2CMRA 2X0LB 2KLQA 2YU2A 2WMNA 5DQVA 5F3JA 2KNDA 3OJAA 4ANJA 5JRCB 2E9XC 3I1AA 2V7JA 3OKQA 4ERRA 1HCIA 2CXLA 5J2UE 5LHIB 5M4YA 4X20E 3GN5B 1HG2A 2CXDA 2H3RA 4ZOLE 1D1AA 5JVDE 3KV4A 4HEAA 2L3LA 3IHRA 4ZI3C 4FJOA 3AAEB 4IGUA 2D0UA 2K24A 1CUNA 1ZKEA 4PJJA 3GWHA 2X9HA 3C4XA 5JRCA 4EB6E 4FI5A 2ES0A 2LE8A 4Z8XA 5JDNA 1KNZA 2CE7A 2RA1A 3GN5A 5AFUL 2DWKA 3C50A 4UVAB 3WAJA 5HXRA 1UCUA 4O4LE 5JR9C 4WNKA 3CX7B 3I0QA 3EUHA 5HWYA 3EDVA 3MZKB 2Y48B 2I59A 2YU1A 5LBQB 2XAFB 3N9OA 4DMWA 3O1JA 3L09A 4QKNA 4YJ3E 2LT3A 4I50E 1NAFA 5EZYE 3PE0A 5LJMA 3OYXA 2VK9A 1FIOA 4G63A 3K3OA 4UXNB 3ETVA 4PK5A 3ONXA 1ZHCA 5LXTE 4MBQA 4ZI2D 4IIJE 2A2FX 2LSKA 5CA1E 3Q9DA 1HTJF 2LHNA 3I9YA 4GOUA 2VKJA 1UX4A 3H37A 3K8PC 4L0RA 3QK6A 4HKAA 3K3NA 1ZEEA 5L3FB 3PU8A 1MIYA 2ZM8A 2Q9QB 3V5UA 3PTRB 3PUQA 4AKGA 4GIWA 3S4UA 2DI4A 3N2GE 1ZV4X 2K48A 3B13A 3NZPA 3RRCA 3VHLA 5C8YE 4CI2B 3MXZA 3KFWX 2KMFA 2RP4A 2CWYA 1T98A 4PJMA 5EK3A 4BJNA 2Y8DA 3JC6D 3M65A 4OK0A 3AB3B 4QWNB 2NWBA 3AAAB 3U78A 2QGSA 3CMLA 5H6RB 2X9WA 5L3BB 2BZBA 4UF0B 2NTXA 1U4QA 2VKDA 2Q9QA 1FMVA 3N2OA 1OXZA 5HAXA 1BR4A 4H9RC 1FEWA 3ZC1A 3CQCB 1LKXA 4EYYR 1B7TA 4U72A 3RRWA 4DMVA 2JMKA 2PFVA 1HF8A 5L2LA 3HKEE 3ZN1B 5FXVA 1LRZA 1BR1A 3ZMZB 4UF0A 4CI3B 4QXHB 5FY7A 2D5UA 4L9IA 4U74A 3ANWB 2PJQA 2H7OA 2VWAA 4ISSA 3CPZA 2ZM2A 2V7LA 1MMGA 1WR6A 2X66A 5L3GB 5FY1A 4EZHA 1OWAA 4H9PC 3ZCIA 4CXXA 5LHHB 1D0XA 5CA0E 3Q5XA 3F2EA 4X1YE 2VKOA 3B57A 2ZMAA 3BQIA 1BR0A 4IE0A 3HA4A 2SPCA 4YJ2E 4HGAA 2W00A 5JDFA 5KX5E 3ANWA 1D1BA 2DWGA 4HFVA 2EHOA 4KMCA 4M1PA 1LVFA 2LOPA 4AKRB 5LGNB 4E7SA 3FHNA 5IHYA 2V7MA 2D0TA 2J1DG 4QXBB 2E8IA 1H7CA 3EDUA 5LHGB 2CXFA 4L5GA 2KINB 3N9PA 3CQGB 3MKDA 4OFZA 3OBVE 4UELA 4ILUA 4NUVA 5FXZA 1YKHB 4A56A 5J2TE 3KDSE 4G2AA 4ASKA 5JDLA 1MMNA 3E22E 4HE8A 4EZ4A 2PBIA 2EHOD 3FB2A 2LSGA 2UXNB 2Y6XA 3KVBA 3C4ZA 2KWHA 5CB4E 3RH3A 3QUJA 2ZM0A 5LP6E 3P7IA 4PJLA 5BMVE 3LG7A 1VRBA 2A3DA 2W63A 4IDZA 3AA6B 1U5PA 5FYMA 3PURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J1D G;  3O4X E;  1Y64 B;  2Z6E A;  4EAH A;  1UX4 A;  1UX5 A;  3OBV E;  1V9D A; 
#chains in the Genus database with same CATH topology
 1N34 T;  4ADZ A;  3EAM A;  4UVC B;  3LSV A;  4B6X A;  3AE2 A;  4PK4 A;  2MOZ A;  2N2N A;  4UR9 A;  1Y01 A;  4P09 A;  3LK4 2;  2K5B B;  5LBM A;  3ZPO A;  1SHZ C;  2LRK A;  3AEB A;  4QH4 A;  2CLY B;  2WCA A;  3ZMV B;  1WYB A;  1IBM T;  4O2B E;  4ZXL A;  2XQA A;  2WSS V;  5C3J A;  2ODV A;  2YOE A;  2J62 A;  2JIW A;  5L3D B;  3UU5 A;  5JDM A;  2YN6 A;  2V1D B;  3P4S A;  2V7K A;  2IC9 A;  4DUY T;  3RYI E;  4ZZC A;  2W66 A;  4IL4 A;  4DBQ A;  4O4H E;  4PFO A;  3Q5W A;  4NUU A;  1GQE A;  2YIN A;  1YKE B;  4UEM A;  3TLU A;  3N9M A;  5AQP B;  3IA3 A;  2ZM6 T;  2WQY A;  2BVM A;  5HEO A;  2OV9 A;  2C0S A;  3P4W A;  1X79 A;  3EI0 A;  5EK2 A;  3DP7 A;  2DCF A;  2LKH A;  3TKL B;  3ZST A;  4HFC A;  4WBO A;  4YLH A;  3G06 A;  4AXP A;  2EHO C;  1WRD A;  4H9O C;  3ESL A;  3ZYL A;  3LDQ B;  1NEK A;  1WFD A;  4XBF B;  4IDQ A;  5LA6 E;  3NRX A;  1J1J A;  2LRL A;  3LJC A;  4BJM A;  2BG9 A;  2XY8 B;  3N5L A;  2E9X A;  4GK0 E;  3AEG A;  4ZI2 C;  1HNZ T;  3N9N A;  3N9Q A;  3AE7 A;  3RX6 A;  2XQ3 A;  4TN7 B;  4Z91 A;  3AA0 B;  4EIW A;  2CHO A;  1S35 A;  2XQ5 A;  3KIN B;  1L0V A;  2BVL A;  3JC6 C;  3A8Y C;  3ZN0 B;  3UU4 A;  3P4R A;  3EVY A;  3ZKR A;  5HXE A;  3DJB A;  3UTK A;  3QC9 A;  5H6Q B;  5EK4 A;  2QRX A;  3OPC A;  3ZEF B;  1FJG T;  3P4Q A;  3NBX X;  2CLY C;  4CI1 B;  2N9D A;  4PW8 A;  5CGM A;  5FXW A;  2C5J A;  4OHF A;  5ABE A;  4JI4 T;  2X67 A;  5LJN A;  4AKL A;  3PUW F;  1MMD A;  4QH1 A;  4HN9 A;  1UX5 A;  2V7I A;  4KI0 F;  2JQ9 A;  4JI0 T;  4CZZ B;  2C5K T;  3IF8 B;  1WR0 A;  4A5X A;  1G8X A;  2FUP A;  1DU2 A;  3ZLI A;  4ZZB A;  3Q5E A;  2WZH A;  4DV4 T;  4DV6 T;  1R8I A;  2DLR A;  2CHN A;  1UUR A;  4TV9 E;  2WS3 A;  5LCY A;  4NIQ A;  1FMW A;  3AA1 B;  1VCT A;  4OYJ A;  4IE4 A;  2XUE A;  3IEE A;  2B76 A;  4C91 A;  3RYC E;  5HXS A;  4CN4 A;  2KZ7 B;  2YDQ A;  2IML A;  2L8K A;  2XHE B;  2XAQ B;  4TZ4 C;  4B3T T;  4EYU A;  1ZOY A;  4H9Q C;  3VKH A;  4KUM B;  4ZEY A;  2DHR A;  5F3J A;  3CIR A;  3I1A A;  5J2U E;  1HCI A;  2CXL A;  2WDR A;  2J47 A;  2J4G A;  4DR6 T;  2BS4 A;  5IWA T;  2UU9 T;  1D1A A;  2HN1 A;  3IHR A;  4NXN T;  4ZI3 C;  4FJO A;  1ZKE A;  3AE4 A;  4PJJ A;  4JI1 T;  1HX1 B;  2LE8 A;  5L47 A;  2CE7 A;  2UXB T;  4UVA B;  1UCU A;  3OVU A;  2WY2 A;  3EDV A;  3MZK B;  5LBQ B;  3N9O A;  4DMW A;  5FVL A;  1NAF A;  4HFD A;  2VK9 A;  3K3O A;  3ETV A;  5CA1 E;  3Q9D A;  2M6I A;  3I9Y A;  2VKJ A;  2VQE T;  3AEE A;  3PU8 A;  3T1Y T;  2ZM8 A;  3V5U A;  3PUQ A;  1OED B;  1ZV4 X;  2K48 A;  3NZP A;  2KMF A;  2NWB A;  5AQG B;  5H6R B;  2X9W A;  4UF0 B;  2NTX A;  4YSY A;  2Q9Q A;  5HAX A;  1BR4 A;  3ZC1 A;  3CQC B;  4EYY R;  1B7T A;  4F8H A;  5ABH A;  2V5C A;  4DV7 T;  3ZMZ B;  4CI3 B;  4U74 A;  2PJQ A;  2VWA A;  3CPZ A;  2XSA A;  1OWA A;  3K1S A;  5CA0 E;  3Q5X A;  3F2E A;  4X1Y E;  3B57 A;  2R6G F;  3ANW A;  1W09 A;  4HWD A;  5FVK A;  4HFV A;  3FHN A;  5IHY A;  2D0T A;  4QXB B;  3CQG B;  1YKH B;  3KDS E;  4G2A A;  2IHR 1;  4ASK A;  3E22 E;  2PBI A;  2LSG A;  2HN2 A;  2Y6X A;  3KVB A;  3QUJ A;  3ABV A;  3UQ4 A;  2XM2 A;  3P7I A;  3AA6 B;  3PUR A;  3Q5D A;  4QHO A;  3ZYK A;  5LG3 A;  2V5D A;  4U31 A;  4TWF A;  5KDM C;  3LBX A;  4XAX B;  1UUS A;  1V9D A;  5ABG A;  4E7Z A;  4WW0 A;  4IE7 A;  3A5X A;  1MMA A;  2JQK A;  1SUM B;  3ZC0 A;  2BKN A;  3H3A A;  4HWF A;  1N32 T;  4ILA A;  3RQU A;  3OTO T;  2LJL A;  2LHR A;  3AXJ A;  1YXR A;  2JQQ A;  5AQO B;  3AE9 A;  4BAY B;  3UU8 A;  3KV5 A;  2UXX B;  2QA7 A;  3FXD B;  2H89 A;  3L3P A;  2W67 A;  4X5T A;  3RC8 A;  4DO0 A;  1S94 A;  4GYR A;  2ZLY A;  1WCR A;  4CQI A;  5J0Z A;  4LF7 T;  1MIV A;  1HS7 A;  2XJ7 A;  4XZC A;  1OED C;  2XQ9 A;  4ILB A;  4J2C A;  3L39 A;  2X51 A;  2NW8 A;  1CHU A;  2MBG A;  3IBP A;  2BKO A;  1X9B A;  3AA7 B;  1IZN B;  4H9N C;  4O4I E;  4JI5 T;  3ZJ1 A;  2HH7 A;  3AVS A;  3RF1 A;  2F4V T;  1SA0 E;  2EHO B;  4UV8 B;  3J7Y q;  3R84 B;  5LYJ E;  3SOL A;  1KF6 A;  3P4P A;  1XMO T;  4NXM T;  2XAJ B;  5JDH A;  3MAC A;  5JRE A;  2WM9 A;  2V8S V;  3UU6 A;  3V5S A;  3T8O A;  2IDO B;  3FXE B;  2JPF A;  3PJA J;  4WZX A;  4ZI7 E;  3PUV F;  5JQG E;  3BQK A;  3UUL A;  2E9X B;  4NPP A;  4YTN A;  2WP9 A;  4HWC A;  4H9S E;  3QNU A;  5BR8 T;  4HFB A;  2XAH B;  3F57 A;  3CVR A;  5HEG A;  3ZMS B;  2IUB A;  2JMH A;  1O3X A;  2XPK A;  3ZMT B;  4BA9 A;  1M7K A;  1J5W A;  3KVA A;  2HPJ A;  4N78 D;  5JR9 B;  4YSX A;  3HL6 A;  5AQM B;  1WLX A;  4JI2 T;  3AE6 A;  3O4X E;  3BK9 A;  1IJ6 A;  5HXH A;  3C98 B;  2W2U A;  3VU7 H;  5DJQ C;  2W61 A;  5KMG P;  3C64 A;  5C2T A;  2ODU A;  4MLK A;  5AQV B;  2B1E A;  3RIF A;  2HPL A;  2K3W A;  5AQK B;  2KXP B;  3EHZ A;  3UFE A;  4B3R T;  2G0U A;  3CKD A;  3BQL A;  3JAE A;  3O1H A;  4PJN A;  4GKJ T;  4EXT A;  4IE5 A;  4CXW A;  5AQR B;  4PAG A;  4U2Y A;  2WZI A;  4DR7 T;  2L9Q A;  2V26 A;  4MHC A;  2WAU A;  3CQX C;  1QLB A;  3X1D A;  3VRB A;  1KK7 A;  4V1A v;  4DND A;  3M3Z B;  1XZY A;  5DAB A;  2CA5 A;  2HHH T;  5AQU B;  1IJ5 A;  2ACZ A;  2H88 A;  2GK9 A;  1JNZ A;  4X1I E;  3KBT A;  1M62 A;  2LSI A;  2H7V C;  2BG9 C;  3EAB A;  4I43 B;  3HKB E;  3NZQ A;  4ZHQ E;  5TAO A;  2LOS A;  2YU2 A;  3OJA A;  1OED E;  2E9X C;  2V7J A;  3OKQ A;  2WU2 A;  4X20 E;  5JTG A;  2OLT A;  4HEA A;  2V6Y B;  3AAE B;  4TNV A;  2K24 A;  4EED A;  3RHW A;  1CUN A;  4CN1 A;  4EB6 E;  4FI5 A;  5JDN A;  3GN5 A;  2DWK A;  3WAJ A;  5HXR A;  5JR9 C;  1XNQ T;  4WNK A;  4WYV A;  2VVN A;  3EUH A;  2Y48 B;  2I59 A;  2YU1 A;  4YY3 T;  4I50 E;  4HFI A;  5LB7 B;  3NKZ A;  3OYX A;  5ABF A;  4G63 A;  4UXN B;  3FZF B;  1ZHC A;  4ZI2 D;  2A2F X;  2LSK A;  3AEF A;  2AXD S;  3ZSS A;  2LHN A;  4GOU A;  1MIY A;  2Q9Q B;  4IDO A;  3N2G E;  3VHL A;  4CI2 B;  3KFW X;  2LM2 A;  2Y8D A;  3JC6 D;  4OK0 A;  3AAA B;  2BZB A;  3FZL B;  3JCF A;  2BS3 A;  1OXZ A;  2M6B A;  4H9R C;  1LKX A;  4U72 A;  3RRW A;  3VR8 A;  2X0H A;  5FXV A;  4QXH B;  5FY7 A;  2E2A A;  4L9I A;  3ANW B;  2IIU A;  2H7O A;  3SFD A;  2ZM2 A;  1MMG A;  2YKS A;  4EEB A;  4DR1 T;  4EZH A;  4HWI B;  2BBH A;  4DR5 T;  3BQI A;  2ZMA A;  4LF4 T;  1BR0 A;  4IE0 A;  3HA4 A;  4TWD A;  1KFY A;  2I6H A;  4A98 A;  4M1P A;  2LOP A;  3RKG A;  2J1D G;  1VCS A;  4L5G A;  2KIN B;  3AE8 A;  2ZM0 A;  4PJL A;  3AE1 A;  3LG7 A;  1VRB A;  2W63 A;  4DV1 T;  4X1K E;  4KP3 C;  5AQI B;  4IL9 A;  2BKP A;  4K0U A;  3RC3 A;  5HWX A;  3F31 A;  3E08 A;  3NWI A;  2VL8 A;  3AXJ B;  2XAG B;  3C4W A;  2UUB T;  2CM0 A;  4A97 A;  2VB6 A;  4OX9 T;  3KV6 A;  4QX7 B;  5HEU A;  4P1N A;  5IYZ E;  5JDG A;  5AQN B;  2NP9 A;  4AQF A;  2CBI A;  4LF6 T;  1HNX T;  4COF A;  3VRA A;  3LK2 B;  2WDV A;  2XQY A;  3DTO A;  2XSB A;  3AEC A;  2VKH A;  5HYA A;  4PK6 A;  4IT4 A;  1MNE A;  4CXY A;  3E0Z A;  2IAK A;  3NRY A;  2Q9Q C;  3SRZ A;  4YFS A;  2BS2 A;  2X9Y A;  3RIU A;  3UUX B;  2WBL A;  5E0O A;  1IAP A;  3PU3 A;  3SS1 A;  4O8S A;  3ZYM A;  2PG8 A;  3PUS A;  4JI7 T;  3P8C D;  1NEN A;  3RGL A;  3SWH A;  5ADX L;  4UIG A;  2OA5 A;  1QSD A;  4EGW A;  4IDP A;  1E1H B;  1WYC A;  4DUZ T;  3JAF A;  4MAL A;  2DNX A;  3RKO A;  4U7I A;  2UXC T;  4IHJ E;  1IBK T;  3FBL A;  1YW0 A;  1EZ3 A;  3WAK A;  5LGT B;  3OYZ A;  2LEH A;  1E7P A;  5L4H A;  2WU5 A;  2X0Y A;  1T8B A;  1E2A A;  4IST A;  3GA8 A;  3LK3 B;  1Y64 B;  1D0Y A;  4OYK A;  3MA9 A;  5KXJ A;  3CX6 B;  1J5E T;  2KWI B;  5ETW A;  2MYS A;  4O4J E;  3MJX A;  1D0Z A;  4TWH A;  5HEH A;  3W15 B;  1YD8 G;  3A7M A;  3AVR A;  4LF9 T;  4LFB T;  4IDN A;  4YTM A;  5LGU B;  4CN6 A;  3QB5 A;  4AIS A;  2XTL A;  3H3M A;  1I94 T;  4HFH A;  2PTF A;  5LMU T;  3K3Q C;  2D9D A;  5FMN A;  3CWZ B;  5AQT B;  3J9X 1;  5AQH B;  4ZS2 A;  2WWU A;  2FBW A;  2Z6E A;  5GON E;  4KBM B;  3CX8 B;  4DR2 T;  4QXC B;  4JV5 T;  1MND A;  3LFM A;  4I55 E;  4AKH A;  2D2S A;  4I0U A;  3ONL C;  1D1C A;  3C51 A;  4H63 V;  3GMI A;  3UQ7 A;  3AAI A;  4K0K T;  2KSR A;  3ZMU B;  1T7S A;  3I9W A;  3Q2M A;  2BG9 B;  4O2A E;  1XDP A;  2A72 A;  2CEA A;  3B5M A;  3KV9 A;  1N33 T;  1HFA A;  2X68 A;  3PUY F;  4U2Z A;  3O1I A;  1HR0 T;  2NW9 A;  4KHZ F;  5FL1 A;  4EAH A;  3QOF A;  1BR2 A;  1QUU A;  4WBN E;  2CMR A;  2X0L B;  3AE3 A;  2KLQ A;  2WMN A;  4ANJ A;  4JI3 T;  2BBJ A;  4ERR A;  3GN5 B;  1HG2 A;  2XZE A;  2H3R A;  2DL1 A;  5JVD E;  3KV4 A;  3TLV A;  2L3L A;  3P50 A;  4IGU A;  2D0U A;  5AQF B;  3GWH A;  5JRC A;  2WDQ A;  2ES0 A;  4Z8X A;  5ABF B;  4U33 A;  2RA1 A;  3C50 A;  5HEJ A;  4O4L E;  3CX7 B;  5HWY A;  4X62 T;  2XAF B;  3QB5 K;  5CFB A;  4YJ3 E;  2LT3 A;  3AE5 A;  3PE0 A;  1FIO A;  2XM1 A;  2UXD T;  5LXT E;  4MBQ A;  2WB5 A;  4DV0 T;  1HTJ F;  1UX4 A;  3QK6 A;  4HKA A;  1ZEE A;  5L3F B;  3PTR B;  4AKG A;  4GIW A;  3S4U A;  2DI4 A;  4JI8 T;  3B13 A;  3RRC A;  2E5V A;  3MXZ A;  4X65 T;  4PJM A;  4BJN A;  3M65 A;  3AB3 B;  3U78 A;  3FZK B;  2QGS A;  5L3B B;  3N2O A;  2A9U A;  2QVA A;  1SE7 A;  4HWH A;  4DID B;  2JMK A;  2PFV A;  1T72 A;  3TLW A;  2V6X A;  2V7L A;  1WR6 A;  2X66 A;  5L3G B;  5FY1 A;  1HNW T;  3ZCI A;  5AQS B;  3CK6 A;  4YXD A;  1I6Z A;  3PV0 F;  2XQ6 A;  4EV6 A;  4HGA A;  1D1B A;  4B3M T;  4JBW F;  2EHO A;  1LVF A;  3AED A;  4DV2 T;  4E7S A;  1UGO A;  2E8I A;  3EDU A;  2CXF A;  3MKD A;  5AQL B;  1XDO A;  4ILU A;  4A56 A;  5JDL A;  4LMK A;  4LF5 T;  4HE8 A;  2EHO D;  3FB2 A;  2UUA T;  3C4Z A;  5BMV E;  4IDZ A;  1U5P A;  5FYM A;  4DV5 T;  2KT9 A;  4DV3 T;  3WI3 A;  5JH7 E;  3UUB A;  1XWM A;  1AJ3 A;  5FP3 A;  1US7 B;  3TLS A;  2FJB A;  5A1L A;  2IC6 A;  5FY0 A;  1Z0P A;  4GYS A;  2E9X D;  5J1G A;  3D0T A;  4AQG A;  4UV9 B;  4MFR A;  3RYF E;  3I0O A;  1KEY A;  4YSZ A;  5JR9 A;  3R6N A;  1IBL T;  3HI2 A;  2UUC T;  2WWV A;  4QX8 B;  3RI5 A;  4JEU B;  5FXX A;  2LSY A;  3HKC E;  4U3C A;  2X9X A;  2XAS B;  2JQH A;  4H63 H;  5FNV E;  2I0M A;  2VVS A;  2XQ8 A;  3ETU A;  2P9B A;  4PFP A;  5DQW A;  2MTQ A;  2NR4 A;  2W4X A;  4LFA T;  3ZJ2 A;  1W9R A;  4JYA T;  2M67 A;  2YDR A;  2CBJ A;  2YDS A;  1HX8 A;  3TLT A;  2CCQ A;  3HKD E;  3UUM A;  5AQQ B;  4IRE A;  3PUG A;  4I4T E;  3T1H T;  5LMN T;  2VAS A;  5L3C B;  3U3I A;  4KHP T;  2ACX A;  4LML A;  4YT0 A;  4PNI A;  4P0B A;  4JEH B;  4AKI A;  5FL0 A;  1Z8U A;  2NTY A;  3SFE A;  4JUY A;  3RLF F;  4IE6 A;  2LSJ A;  4GK5 E;  1MIW A;  2YEV C;  4YHJ A;  4DR3 T;  4C90 A;  3UT5 E;  2VL0 A;  4X66 T;  4YHH T;  5CJ5 A;  2FJE A;  4YTP A;  4JLE A;  3LBX B;  3UUN A;  2IW5 B;  1HG5 A;  4LMJ A;  2VUR A;  1VOM A;  2WMO A;  4Q25 A;  4LF8 T;  4ZS3 A;  2MPK A;  4GKK T;  2FJD A;  2JJ9 A;  3N9L A;  3N2K E;  5F8P A;  4X64 T;  2C5I T;  2W62 A;  5LG4 A;  2N1G A;  4ZI3 D;  2V6Y A;  4AQF C;  1XNR T;  2BG9 E;  5LOV E;  3PUA A;  3KBU A;  2CPT A;  4DBR A;  5LNK A;  4TUY E;  3PDY A;  2E5L T;  4DR4 T;  1ZP0 A;  1N36 T;  3RQW A;  3RPU A;  3HR0 A;  4DVD A;  1JNR A;  3RIU C;  3PUZ F;  5IUX A;  2W0G A;  2JRK A;  2NOX A;  1G73 A;  4TNW A;  3RYH E;  2CWO A;  5JDQ A;  3FBZ A;  3VKG A;  3RIA A;  2NW7 A;  3NVO A;  2LM9 A;  3O9X A;  2BDE A;  5HXC A;  1YQ4 A;  4TV8 E;  2XQ4 A;  4EOZ B;  2CRB A;  1NWM X;  4UVB B;  5L3E B;  3MK7 C;  2QYW A;  2Q9Q D;  4HFE A;  2YK0 A;  4P0A A;  1W0A A;  4F6R C;  4AI6 A;  3VR9 A;  1W0B A;  4AQY T;  4Z90 A;  2K9A A;  1LVK A;  4TX5 A;  4HTE A;  3ZCJ A;  3ONJ A;  5FKY A;  5DQV A;  5JRC B;  2KND A;  1XMQ T;  5M4Y A;  5LHI B;  3PUX F;  2LKG A;  2CXD A;  1KNP A;  4ZOL E;  4LFC T;  5L4E A;  2X9H A;  3C4X A;  5F5W A;  3ZT6 A;  1KNZ A;  5AFU L;  3I0Q A;  2FJA A;  2MAW A;  4QH5 A;  3ZT7 A;  3O1J A;  3L09 A;  4QKN A;  5EZY E;  3PJA A;  5LJM A;  2XQ7 A;  4PK5 A;  3ONX A;  4IIJ E;  3H37 A;  3K8P C;  4L0R A;  3K3N A;  3JAD A;  3FZM B;  5C8Y E;  2RP4 A;  2CWY A;  1T98 A;  5EK3 A;  4QWN B;  3AEA A;  3CML A;  4ILC A;  1U4Q A;  2VKD A;  1FMV A;  1OED A;  4U7Y A;  1FEW A;  2RPA A;  4B3S T;  5AQJ B;  4DMV A;  1KNR A;  1HF8 A;  5L2L A;  3HKE E;  3FZH B;  3ZN1 B;  1LRZ A;  1BR1 A;  4UF0 A;  2D5U A;  4ISS A;  4KX6 A;  4H9P C;  4CXX A;  5LHH B;  1D0X A;  2VQF T;  4JI6 T;  2VKO A;  1UK5 A;  2SPC A;  4YJ2 E;  2W00 A;  5JDF A;  5KX5 E;  2AE9 A;  2DWG A;  4KMC A;  4AKR B;  5LGN B;  2V7M A;  3L8R A;  1H7C A;  5LHG B;  5HCJ A;  4AIU A;  3N9P A;  4OFZ A;  4UEL A;  3OBV E;  4NUV A;  5FXZ A;  5J2T E;  1YQ3 A;  1MMN A;  3ZT5 A;  2LLY A;  4EZ4 A;  2UXN B;  2KWH A;  5CB4 E;  3RH3 A;  5LP6 E;  3UU3 A;  5HCM A;  2A3D A;  3UFG A; 
#chains in the Genus database with same CATH homology
 4KP3 C;  2KT9 A;  4QHO A;  3ZYK A;  4ADZ A;  3WI3 A;  4UVC B;  5JH7 E;  4K0U A;  3RC3 A;  4B6X A;  1AJ3 A;  5HWX A;  3F31 A;  5FP3 A;  1US7 B;  3E08 A;  4PK4 A;  5KDM C;  3LBX A;  4XAX B;  2VL8 A;  5A1L A;  2XAG B;  2MOZ A;  1V9D A;  2IC6 A;  2N2N A;  3C4W A;  4E7Z A;  4P09 A;  3LK4 2;  5FY0 A;  4WW0 A;  2K5B B;  2CM0 A;  4IE7 A;  1Z0P A;  3A5X A;  4GYS A;  5LBM A;  2VB6 A;  1MMA A;  2E9X D;  3ZPO A;  1SHZ C;  3ZC0 A;  3KV6 A;  4QX7 B;  3H3A A;  3D0T A;  5J1G A;  4AQG A;  4UV9 B;  4MFR A;  3RYF E;  3I0O A;  5IYZ E;  5JDG A;  5JR9 A;  2LJL A;  2LHR A;  2CLY B;  3R6N A;  3ZMV B;  1WYB A;  3HI2 A;  4O2B E;  2NP9 A;  2WSS V;  4AQF A;  2ODV A;  4QX8 B;  2JQQ A;  3LK2 B;  4BAY B;  4JEU B;  5FXX A;  2LSY A;  5L3D B;  5JDM A;  3HKC E;  2V1D B;  2X9X A;  3KV5 A;  2XAS B;  2UXX B;  4H63 H;  5FNV E;  2QA7 A;  2V7K A;  2XQY A;  3FXD B;  3DTO A;  3L3P A;  3RC8 A;  3ETU A;  2IC9 A;  2P9B A;  4DO0 A;  3RYI E;  4PFP A;  1S94 A;  2VKH A;  2ZLY A;  4GYR A;  5DQW A;  5HYA A;  2MTQ A;  4PK6 A;  1MNE A;  4CQI A;  4CXY A;  3ZJ2 A;  4DBQ A;  4O4H E;  3E0Z A;  4PFO A;  1MIV A;  2IAK A;  3Q5W A;  4NUU A;  1HS7 A;  4XZC A;  3NRY A;  2Q9Q C;  2YIN A;  3SRZ A;  4YFS A;  1YKE B;  2M67 A;  2X9Y A;  3UUX B;  2WBL A;  1HX8 A;  4UEM A;  2CCQ A;  5E0O A;  3HKD E;  3UUM A;  4J2C A;  1IAP A;  3PU3 A;  3SS1 A;  3N9M A;  2X51 A;  4O8S A;  3ZYM A;  2PG8 A;  3PUS A;  2NW8 A;  3P8C D;  3PUG A;  2MBG A;  3IBP A;  4I4T E;  2VAS A;  2BVM A;  5L3C B;  3U3I A;  3AA7 B;  2ACX A;  3SWH A;  1IZN B;  4H9N C;  4O4I E;  3ZJ1 A;  2HH7 A;  3AVS A;  5ADX L;  4UIG A;  4PNI A;  2C0S A;  1SA0 E;  1X79 A;  2EHO B;  2OA5 A;  4UV8 B;  3J7Y q;  1QSD A;  4P0B A;  4JEH B;  3R84 B;  5EK2 A;  5LYJ E;  4AKI A;  3SOL A;  1E1H B;  3DP7 A;  1WYC A;  2NTY A;  4JUY A;  2XAJ B;  2DCF A;  4MAL A;  5JDH A;  2DNX A;  3MAC A;  4IE6 A;  5JRE A;  2LSJ A;  3TKL B;  4GK5 E;  3RKO A;  1MIW A;  2WM9 A;  2YEV C;  4WBO A;  4YLH A;  4YHJ A;  4AXP A;  2EHO C;  1WRD A;  4IHJ E;  3V5S A;  3T8O A;  4H9O C;  3ESL A;  4C90 A;  3FXE B;  3UT5 E;  2JPF A;  3ZYL A;  3FBL A;  4ZI7 E;  1YW0 A;  5JQG E;  3BQK A;  1EZ3 A;  4XBF B;  3WAK A;  5LA6 E;  3UUL A;  2E9X B;  3NRX A;  5LGT B;  3LJC A;  3OYZ A;  2LEH A;  4BJM A;  4H9S E;  4JLE A;  3LBX B;  3UUN A;  2XAH B;  2IW5 B;  3F57 A;  3CVR A;  4IST A;  3ZMS B;  3GA8 A;  3N5L A;  1HG5 A;  3LK3 B;  2JMH A;  1Y64 B;  1D0Y A;  1O3X A;  2E9X A;  4OYK A;  3MA9 A;  3ZMT B;  4GK0 E;  4BA9 A;  1VOM A;  2WMO A;  4ZI2 C;  3KVA A;  2HPJ A;  3CX6 B;  4N78 D;  3N9N A;  5JR9 B;  3N9Q A;  3RX6 A;  2KWI B;  3HL6 A;  4TN7 B;  5ETW A;  2MYS A;  3AA0 B;  4ZS3 A;  4O4J E;  1WLX A;  2JJ9 A;  3N9L A;  3N2K E;  4EIW A;  3O4X E;  3BK9 A;  1IJ6 A;  3MJX A;  1D0Z A;  5HXH A;  3C98 B;  1S35 A;  3VU7 H;  5DJQ C;  5F8P A;  2C5I T;  3W15 B;  1YD8 G;  2W61 A;  3AVR A;  3KIN B;  2W62 A;  2BVL A;  3JC6 C;  5KMG P;  2N1G A;  5LG4 A;  4ZI3 D;  3ZN0 B;  3C64 A;  4AQF C;  2ODU A;  3EVY A;  4MLK A;  5LGU B;  5LOV E;  5HXE A;  3PUA A;  3DJB A;  3UTK A;  2XTL A;  3QC9 A;  5EK4 A;  5H6Q B;  2B1E A;  2HPL A;  3ZEF B;  2KXP B;  3KBU A;  3NBX X;  4DBR A;  2CLY C;  3UFE A;  5LNK A;  4TUY E;  2G0U A;  3PDY A;  3K3Q C;  3CKD A;  4CI1 B;  2N9D A;  4PW8 A;  3BQL A;  3O1H A;  5FMN A;  5FXW A;  2C5J A;  4OHF A;  2X67 A;  3CWZ B;  3HR0 A;  3RPU A;  4PJN A;  4EXT A;  4DVD A;  5LJN A;  4IE5 A;  3J9X 1;  4AKL A;  4CXW A;  1MMD A;  4PAG A;  4HN9 A;  1UX5 A;  4ZS2 A;  2WWU A;  2W0G A;  2V7I A;  2JRK A;  2NOX A;  2Z6E A;  5GON E;  1G73 A;  2L9Q A;  2V26 A;  4CZZ B;  2C5K T;  2CWO A;  3IF8 B;  4KBM B;  4MHC A;  3RYH E;  5JDQ A;  3FBZ A;  3VKG A;  3CX8 B;  2WAU A;  2NW7 A;  4QXC B;  3CQX C;  1G8X A;  1MND A;  3LFM A;  2LM9 A;  4I55 E;  4AKH A;  2D2S A;  3O9X A;  3ZLI A;  2BDE A;  5HXC A;  1D1C A;  3C51 A;  4H63 V;  1KK7 A;  4V1A v;  4TV8 E;  4DND A;  5DAB A;  3GMI A;  2CA5 A;  3AAI A;  4EOZ B;  1NWM X;  2DLR A;  4UVB B;  4X1K E;  3ZMU B;  5L3E B;  3I9W A;  3Q2M A;  3MK7 C;  4TV9 E;  2Q9Q D;  4O2A E;  5LCY A;  1IJ5 A;  1FMW A;  2A72 A;  2YK0 A;  2CEA A;  3AA1 B;  2GK9 A;  3KV9 A;  4P0A A;  4OYJ A;  4X1I E;  3KBT A;  1HFA A;  2XUE A;  3IEE A;  4IE4 A;  2X68 A;  2LSI A;  3O1I A;  3RYC E;  4C91 A;  2H7V C;  4F6R C;  4AI6 A;  5HXS A;  2KZ7 B;  2NW9 A;  2L8K A;  2K9A A;  2XHE B;  1LVK A;  4TX5 A;  4HTE A;  4EAH A;  4I43 B;  2XAQ B;  4TZ4 C;  4EYU A;  3ZCJ A;  1BR2 A;  3HKB E;  3NZQ A;  4ZHQ E;  1QUU A;  4H9Q C;  3VKH A;  4KUM B;  4WBN E;  2DHR A;  5TAO A;  2LOS A;  2CMR A;  2X0L B;  2KLQ A;  2YU2 A;  2WMN A;  5DQV A;  5F3J A;  2KND A;  3OJA A;  4ANJ A;  5JRC B;  2E9X C;  3I1A A;  2V7J A;  3OKQ A;  4ERR A;  1HCI A;  2CXL A;  5J2U E;  5LHI B;  5M4Y A;  4X20 E;  3GN5 B;  1HG2 A;  2CXD A;  2H3R A;  4ZOL E;  1D1A A;  5JVD E;  3KV4 A;  4HEA A;  2L3L A;  3IHR A;  4ZI3 C;  4FJO A;  3AAE B;  4IGU A;  2D0U A;  2K24 A;  1CUN A;  1ZKE A;  4PJJ A;  3GWH A;  2X9H A;  3C4X A;  5JRC A;  4EB6 E;  4FI5 A;  2ES0 A;  2LE8 A;  4Z8X A;  5JDN A;  1KNZ A;  2CE7 A;  2RA1 A;  3GN5 A;  5AFU L;  2DWK A;  3C50 A;  4UVA B;  3WAJ A;  5HXR A;  1UCU A;  4O4L E;  5JR9 C;  4WNK A;  3CX7 B;  3I0Q A;  3EUH A;  5HWY A;  3EDV A;  3MZK B;  2Y48 B;  2I59 A;  2YU1 A;  5LBQ B;  2XAF B;  3N9O A;  4DMW A;  3O1J A;  3L09 A;  4QKN A;  4YJ3 E;  2LT3 A;  4I50 E;  1NAF A;  5EZY E;  3PE0 A;  5LJM A;  3OYX A;  2VK9 A;  1FIO A;  4G63 A;  3K3O A;  4UXN B;  3ETV A;  4PK5 A;  3ONX A;  1ZHC A;  5LXT E;  4MBQ A;  4ZI2 D;  4IIJ E;  2A2F X;  2LSK A;  5CA1 E;  3Q9D A;  1HTJ F;  2LHN A;  3I9Y A;  4GOU A;  2VKJ A;  1UX4 A;  3H37 A;  3K8P C;  4L0R A;  3QK6 A;  4HKA A;  3K3N A;  1ZEE A;  5L3F B;  3PU8 A;  1MIY A;  2ZM8 A;  2Q9Q B;  3V5U A;  3PTR B;  3PUQ A;  4AKG A;  4GIW A;  3S4U A;  2DI4 A;  3N2G E;  1ZV4 X;  2K48 A;  3B13 A;  3NZP A;  3RRC A;  3VHL A;  5C8Y E;  4CI2 B;  3MXZ A;  3KFW X;  2KMF A;  2RP4 A;  2CWY A;  1T98 A;  4PJM A;  5EK3 A;  4BJN A;  2Y8D A;  3JC6 D;  3M65 A;  4OK0 A;  3AB3 B;  4QWN B;  2NWB A;  3AAA B;  3U78 A;  2QGS A;  3CML A;  5H6R B;  2X9W A;  5L3B B;  2BZB A;  4UF0 B;  2NTX A;  1U4Q A;  2VKD A;  2Q9Q A;  1FMV A;  3N2O A;  1OXZ A;  5HAX A;  1BR4 A;  4H9R C;  1FEW A;  3ZC1 A;  3CQC B;  1LKX A;  4EYY R;  1B7T A;  4U72 A;  3RRW A;  4DMV A;  2JMK A;  2PFV A;  1HF8 A;  5L2L A;  3HKE E;  3ZN1 B;  5FXV A;  1LRZ A;  1BR1 A;  3ZMZ B;  4UF0 A;  4CI3 B;  4QXH B;  5FY7 A;  2D5U A;  4L9I A;  4U74 A;  3ANW B;  2PJQ A;  2H7O A;  2VWA A;  4ISS A;  3CPZ A;  2ZM2 A;  2V7L A;  1MMG A;  1WR6 A;  2X66 A;  5L3G B;  5FY1 A;  4EZH A;  1OWA A;  4H9P C;  3ZCI A;  4CXX A;  5LHH B;  1D0X A;  5CA0 E;  3Q5X A;  3F2E A;  4X1Y E;  2VKO A;  3B57 A;  2ZMA A;  3BQI A;  1BR0 A;  4IE0 A;  3HA4 A;  2SPC A;  4YJ2 E;  4HGA A;  2W00 A;  5JDF A;  5KX5 E;  3ANW A;  1D1B A;  2DWG A;  4HFV A;  2EHO A;  4KMC A;  4M1P A;  1LVF A;  2LOP A;  4AKR B;  5LGN B;  4E7S A;  3FHN A;  5IHY A;  2V7M A;  2D0T A;  2J1D G;  4QXB B;  2E8I A;  1H7C A;  3EDU A;  5LHG B;  2CXF A;  4L5G A;  2KIN B;  3N9P A;  3CQG B;  3MKD A;  4OFZ A;  3OBV E;  4UEL A;  4ILU A;  4NUV A;  5FXZ A;  1YKH B;  4A56 A;  5J2T E;  3KDS E;  4G2A A;  4ASK A;  5JDL A;  1MMN A;  3E22 E;  4HE8 A;  4EZ4 A;  2PBI A;  2EHO D;  3FB2 A;  2LSG A;  2UXN B;  2Y6X A;  3KVB A;  3C4Z A;  2KWH A;  5CB4 E;  3RH3 A;  3QUJ A;  2ZM0 A;  5LP6 E;  3P7I A;  4PJL A;  5BMV E;  3LG7 A;  1VRB A;  2A3D A;  2W63 A;  4IDZ A;  3AA6 B;  1U5P A;  5FYM A;  3PUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...