2UUBT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uubT00
4X66T 1XMOT 4LF4T 1I94T 1IBLT 4JI6T 4LFAT 4LF9T 4KHPT 4DV2T 4DV4T 4B3TT 4NXNT 2UXBT 4DUYT 1XNQT 1HNWT 1IBMT 4NXMT 4DV5T 4B3MT 4GKKT 4JI7T 4X64T 4JYAT 4DR7T 1N34T 4LFCT 1N33T 4X65T 2UUBT 2F4VT 4YHHT 4OX9T 5LMNT 4X62T 4DV0T 4DR3T 2VQFT 5LMUT 2UU9T 4DR4T 4JI2T 4YY3T 2UUCT 1XMQT 4LF8T 4DV3T 4JI0T 4JI1T 1HNZT 4JI4T 1XNRT 4DUZT 4DV6T 3T1HT 5BR8T 4GKJT 4B3RT 4JV5T 1FJGT 2UUAT 2UXCT 3OTOT 2ZM6T 4DR1T 4DR6T 5IWAT 4DR2T 4K0KT 2VQET 4DV1T 4LF7T 1HR0T 3T1YT 4DR5T 1IBKT 4JI5T 1HNXT 1N32T 4AQYT 4LFBT 4DV7T 4JI3T 2E5LT 4JI8T 1N36T 1J5ET 4B3ST 4LF5T 2HHHT 2UXDT 4LF6T
chains in the Genus database with same CATH superfamily
2IC9A 3M3ZB 1IBLT 2BKOA 4DV2T 3RKGA 2KINB 4CQIA 2FJAA 2VL8A 2X9XA 3ZYKA 2ZMAA 2XZEA 4GKKT 2Q9QA 5AQMB 3UT5E 2JJ9A 5FVLA 5FXWA 1HCIA 4ZS2A 3AE7A 2BKNA 2Y8DA 2J62A 5FY1A 3KVBA 3L8RA 4ZOLE 3BQKA 5LP6E 3FBLA 4O4IE 2VQFT 4U33A 5ABFB 4P1NA 2FJDA 1I6ZA 1J1JA 1UX5A 3H3MA 4GIWA 1BR1A 2ZLYA 4NUUA 4ANJA 1AJ3A 4KUMB 4L0RA 1Z0PA 3P4WA 1MNDA 2BG9E 2JQHA 3OPCA 2LHNA 1DU2A 3MACA 3K3OA 4PJNA 5LB7B 5LHHB 4TUYE 5DJQC 1IJ5A 3I9YA 2V26A 3PTRB 2CBIA 3HKCE 5J0ZA 3WAKA 4L5GA 3RYIE 2V7LA 3NRYA 3ZMSB 2E8IA 4ZI7E 4QWNB 3Q2MA 4KBMB 1N36T 2CHOA 1LRZA 1M62A 3LBXB 5FL0A 3EDUA 4QXCB 5JDLA 3MKDA 3EABA 4GYRA 4MALA 3PUVF 1T72A 2VVNA 5AQGB 4NIQA 5JDFA 3ZSTA 3NZPA 4EXTA 2X9WA 4Q25A 2V1DB 2YDQA 2LEHA 3FXDB 4OX9T 4ZEYA 3DJBA 4DV0T 1ZP0A 1UX4A 1WRDA 3VRAA 3AEEA 5H6QB 4HFEA 3UU5A 3J9X1 3KV4A 4IDOA 4JI4T 5LG4A 5HXSA 4DIDB 3PUQA 5TAOA 3CIRA 4I55E 1L0VA 2L9QA 3I0QA 2YDSA 4X5TA 4OFZA 1FEWA 3K8PC 2EHOA 1WR0A 2LSIA 2E9XC 2XUEA 2H88A 3VKHA 5AQKB 4H9OC 1G73A 1IZNB 2ZM0A 3RYCE 3A5XA 1LKXA 3AAEB 4ILUA 4MHCA 4AQFA 2MTQA 2B76A 4ZI2C 4ISTA 4PJLA 4ZS3A 2MYSA 2XHEB 3AE1A 3N2KE 4KX6A 1LVKA 3AA7B 3PJAJ 1HNWT 5EZYE 5E0OA 5JR9B 3QC9A 5HCJA 2E9XB 4U2ZA 2QVAA 1H7CA 3HKEE 1T7SA 3RIUA 3HL6A 3OJAA 4IL4A 3EDVA 3V5UA 4WBOA 5LMNT 4I4TE 2D2SA 1OEDE 5LMUT 2MOZA 3KVAA 1KEYA 3QNUA 5BMVE 2UUCT 5HXRA 4ZXLA 1T98A 4GK0E 5HCMA 4QH5A 1ZKEA 2VASA 2W63A 3ZT5A 3UUNA 2ZM6T 2LRLA 4CXWA 3SS1A 4Z91A 4X20E 4NUVA 5L3GB 4CI3B 3IBPA 2X9HA 3Q5XA 3HKBE 2J47A 2Q9QD 2GK9A 4M1PA 2WY2A 2Q9QB 5AQPB 4O8SA 4ZZCA 2LOPA 2XAFB 3RHWA 4QXBB 2X0LB 4U31A 2RP4A 3SRZA 2M6BA 4HWHA 3KFWX 3T8OA 2C5JA 2IC6A 4O4LE 3LK2B 4DUYT 3FXEB 3Q5DA 3MZKB 2XQ5A 1SE7A 4U72A 3BK9A 5EK3A 1HX1B 5AQTB 2CHNA 2D5UA 2W66A 3NBXX 3QB5K 2NR4A 2YK0A 2E5VA 4COFA 3ONJA 2WU5A 4J2CA 3EVYA 1UURA 4FI5A 3N9LA 2L3LA 3TLSA 1ZOYA 2XQAA 5CFBA 4E7SA 4YY3T 4GYSA 3ZLIA 3I0OA 4A56A 3UUMA 1OXZA 5LYJE 4DUZT 4IDQA 4DBQA 4DV6T 2LJLA 4DMWA 2J4GA 4HWFA 4JV5T 2CM0A 2ES0A 2KLQA 2NWBA 5A1LA 4DBRA 5IWAT 1WFDA 3N9QA 4YTNA 4IE0A 3RLFF 3NZQA 2CE7A 1VOMA 1N32T 4JI3T 2OA5A 5ETWA 4EB6E 4YT0A 3SFDA 1XMOT 3VRBA 3ZJ2A 4U7IA 3I1AA 3O1HA 3JC6C 2CBJA 5HYAA 1KNPA 4HFCA 1E1HB 2X66A 4ERRA 2V8SV 4A97A 5AQVB 4U3CA 3HKDE 4XBFB 3ONXA 1YQ4A 3PUXF 2X0YA 2CXLA 3OKQA 2EHOD 3PDYA 2JPFA 2LT3A 3N9PA 3F31A 2I6HA 2BKPA 2EHOB 1VCTA 2CWYA 1XWMA 2HPJA 2DLRA 3E22E 2YOEA 2CLYC 3RIAA 3QUJA 1U5PA 4MLKA 2B1EA 1QLBA 2WZIA 4O2BE 2LKGA 2SPCA 3ABVA 5L3DB 1NENA 4HE8A 3LSVA 2N1GA 3ZC1A 4Z8XA 4WBNE 2IW5B 3K3QC 3ZCIA 4UR9A 3UUXB 5ADXL 1WCRA 3CX6B 1HNXT 5KX5E 4AQYT 2N2NA 3C64A 2LE8A 2XQ6A 4EEDA 2WCAA 4B3ST 3PE0A 4H63H 2XSBA 2ACXA 4MFRA 5CA1E 2YEVC 3PUZF 4YFSA 2K9AA 5FP3A 2CXFA 1D0XA 1ZHCA 5JVDE 3QK6A 3CX8B 2KNDA 2DCFA 4AKGA 2BG9A 4HEAA 4PJJA 3VHLA 4PW8A 4L9IA 4JBWF 4X64T 1VCSA 4X1IE 5JDHA 5J2UE 1MMNA 2MBGA 3AE2A 4AKLA 4DR3T 4H63V 4HFDA 4I43B 2Y6XA 3RC3A 4UVBB 4YSYA 5FXZA 2JQKA 4OYJA 4JLEA 1HNZT 3VKGA 3UU6A 1O3XA 2KSRA 4KI0F 2VVSA 2Z6EA 2Y48B 3L09A 4WW0A 4V1Av 5AQHB 3KDSE 4EZHA 1UUSA 5J1GA 2FJEA 4ADZA 1NEKA 4PJMA 2WB5A 2IDOB 3A8YC 3C4XA 5DABA 3RI5A 4DV7T 4JI8T 5HXHA 4H9QC 5FKYA 4ZI3D 4YLHA 4EAHA 4JEHB 1X9BA 1G8XA 2R6GF 4WZXA 1YXRA 4C91A 4N78D 3M65A 5KXJA 2VB6A 4G2AA 4CN6A 3ZMZB 2KZ7B 3UTKA 4YJ3E 2BZBA 3FZKB 2X67A 2W4XA 4KHZF 5FVKA 4DR7T 2V7MA 3SWHA 2IMLA 4JEUB 1YKEB 4I50E 4UELA 3MJXA 2LOSA 2W2UA 4ILCA 5AQSB 4IDPA 3N5LA 4P0AA 3O9XA 3NVOA 2X51A 5F5WA 3G06A 1T8BA 2VWAA 1MIVA 3O4XE 2XJ7A 2ODUA 3ETUA 2BS2A 4AISA 3P4PA 1KNRA 2NTYA 2WMNA 3AE5A 1HFAA 3I9WA 4NPPA 2LRKA 4IIJE 4TWFA 1D1CA 1BR2A 4QHOA 4CXYA 3N2GE 4DR5T 4IE7A 4IE4A 5LNKA 3FZHB 3FBZA 3ZYMA 4BA9A 3AVRA 2YU1A 2E5LT 3LFMA 5HXCA 1US7B 2BDEA 4LF6T 2QRXA 2BS3A 3EUHA 5JR9C 2LKHA 1HF8A 2KWIB 2XQ9A 1S94A 3CPZA 1Y64B 5FL1A 3LG7A 2XQ3A 2I59A 1N33T 2W61A 2WWUA 4CI2B 5FY0A 3UFEA 2UXXB 4KMCA 3ESLA 4DR4T 3ZPOA 1JNZA 2V5DA 4ZZBA 3AA6B 2XQ8A 2YINA 1YKHB 4X1KE 2D0UA 4HWCA 3P7IA 3LDQB 2UUAT 3RX6A 5FNVE 3OTOT 5L4HA 3PU8A 4H9RC 3B13A 2VKJA 3V5SA 4DMVA 2C5KT 3H37A 2Q9QC 3RC8A 5L47A 5LHGB 5LJMA 2LSYA 2CEAA 1IBKT 3IEEA 2BG9B 3E08A 2LHRA 3AEAA 1BR4A 5EK4A 4LF5T 3Q5WA 2QGSA 2C0SA 4LFAT 3RYHE 3VR9A 3Q9DA 2LSJA 2LLYA 2LSKA 5AQUB 4QKNA 3LK3B 2KWHA 3ZT7A 3KBUA 3UFGA 2ACZA 4BJMA 1HX8A 4QH4A 3VR8A 5L3EB 2G0UA 3DTOA 4X62T 5JRCA 2HPLA 4H9PC 2ODVA 3JADA 3TLTA 2NW7A 5JDNA 2UU9T 1KNZA 3KBTA 2XTLA 4LF8T 3AXJA 3OYZA 4UF0A 1KF6A 2JMKA 3PUWF 2LSGA 4DR1T 3L39A 4YXDA 1KFYA 2VKOA 3HA4A 3UUBA 3CX7B 5LGNB 3GN5A 3ZJ1A 4LF7T 2RPAA 4B6XA 1GQEA 1WLXA 3FB2A 3TKLB 2XAQB 3C4ZA 1IJ6A 4YJ2E 4IDZA 3RKOA 5JREA 3J7Yq 3L3PA 4IDNA 1J5ET 2K48A 1MMAA 2X9YA 3AECA 5LOVE 2VK9A 1YQ3A 3UU3A 3ANWA 3FHNA 3P4QA 4X66T 4HFIA 2WM9A 2A9UA 4CN1A 4AXPA 4KHPT 2ZM8A 4B3TT 5EK2A 1D0YA 3NRXA 1WR6A 3NWIA 5JH7E 4B3MT 5ABEA 4QH1A 3TLWA 1V9DA 5CA0E 4JYAT 3OYXA 2QYWA 1CHUA 2KMFA 5HWXA 2F4VT 2H7VC 4H9NC 2XQ4A 5F3JA 2EHOC 2IIUA 2PTFA 2V5CA 3SOLA 1ZV4X 3IHRA 4GOUA 4DV3T 3RRCA 3PUAA 2V7KA 3C50A 3P50A 2V7JA 4AQFC 4TN7B 1B7TA 3ZN0B 4H9SE 3AEDA 3AB3B 2PJQA 4WNKA 4K0KT 3CVRA 5IHYA 5JTGA 4QXHB 5HEHA 4EYUA 3W15B 1D1BA 4TWHA 4TV8E 4P0BA 4XZCA 3K1SA 3RIUC 2JQQA 3ZMUB 3AE9A 4LFBT 4TX5A 4I0UA 2L8KA 4U74A 1UGOA 4YSZA 5AQQB 4CI1B 5LCYA 1MNEA 3K3NA 4IGUA 1NWMX 3CK6A 3RQWA 1NAFA 4OK0A 3CQCB 5GONE 4AIUA 5KDMC 5H6RB 3BQLA 1OWAA 2V7IA 5LJNA 4XAXB 5C2TA 4LMKA 4TNWA 5LGUB 2IUBA 3BQIA 1SA0E 3MA9A 2WAUA 4BJNA 4EGWA 1XMQT 3ZSSA 1BR0A 3AA1B 4IHJE 4YSXA 2PFVA 3T1HT 2NW9A 1FJGT 3O1JA 3GMIA 5CB4E 4IT4A 2P9BA 2XAJB 2BBHA 2WDQA 1W0BA 2PG8A 2VQET 3B57A 3ZMTB 5AQFB 2CWOA 3P8CD 5AQIB 4QX7B 5LBQB 4PK4A 2HH7A 3RGLA 3N2OA 3TLUA 4AKHA 4ZI3C 1FIOA 4HWDA 5FYMA 2JIWA 4EEBA 1CUNA 5JRCB 4LF4T 3O1IA 4DV4T 3QOFA 2CCQA 2UXBT 4A5XA 3ZC0A 2AE9A 2QA7A 2PBIA 3AXJB 3U3IA 4UF0B 2XM1A 3PUGA 5HEUA 4QX8B 2CXDA 2D0TA 3EAMA 4EIWA 2M67A 2WZHA 5HXEA 2XAGB 4HGAA 3QB5A 3AA0B 5L3FB 2JQ9A 4KP3C 5L3BB 2VKHA 1HG5A 3C51A 3GN5B 4O4HE 5JQGE 4HFVA 2XSAA 2E2AA 1HG2A 1Y01A 3AVSA 3E0ZA 4JI1T 3N9OA 2FUPA 4YHJA 2DNXA 4TWDA 4X1YE 2LM9A 4B3RT 5FMNA 2V6YA 4PFPA 4BAYB 3ZKRA 4F8HA 4ZHQE 3ANWB 4UEMA 4EV6A 4IE6A 2MPKA 4EZ4A 3B5MA 5AQLB 5HEGA 3GA8A 3F57A 4UXNB 3T1YT 4A98A 3RYFE 3FZMB 4HFHA 3C4WA 1HS7A 3UU8A 2BVLA 2ZM2A 3Q5EA 4GK5E 3FZLB 1UCUA 1I94T 4HKAA 3UULA 2XASB 4ILAA 3RIFA 4PAGA 3AE4A 4NXMT 3MXZA 4EOZB 4DV5T 2WSSV 3HR0A 4JUYA 2BBJA 2UXNB 1OEDA 5DQVA 1QUUA 5AQNB 5JDMA 4LFCT 2WQYA 1W9RA 2XM2A 4CZZB 2W67A 4U2YA 1MIYA 3RRWA 3LK42 1VRBA 4PNIA 1X79A 3UQ4A 5DQWA 4HWIB 3AEBA 5FXVA 1KK7A 2WDRA 3NKZA 5KMGP 5FY7A 4G63A 2V6XA 1FMVA 3RH3A 3ZEFB 3C98B 3F2EA 5CJ5A 2VURA 4PK5A 2C5IT 2W00A 2DL1A 3EI0A 4DR6T 4IREA 4DR2T 3HI2A 1XDPA 1JNRA 1W0AA 4DNDA 1WYBA 2BG9C 3AE3A 3AAIA 1D1AA 1YD8G 1HR0T 3U78A 1S35A 2WP9A 2FBWA 1E2AA 2E9XD 3IA3A 3N9MA 5M4YA 3PJAA 2A72A 4PFOA 2XQ7A 3PUYF 2OV9A 5ABGA 3ZMVB 5L2LA 1IAPA 4PK6A 3AEGA 2KT9A 3R6NA 3ZCJA 3OBVE 4UVCB 4UVAB 2VL0A 4JI6T 4ZI2D 4NXNT 5J2TE 1M7KA 5IUXA 4YTMA 2H7OA 3KINB 5C3JA 1HTJF 3AEFA 1U4QA 5AQOB 4MBQA 2MAWA 2WDVA 1SUMB 3KV5A 4U7YA 3IF8B 3P4RA 2WMOA 2WS3A 1YW0A 2NW8A 2YN6A 5HEJA 2K3WA 2KXPB 2D9DA 4JI2T 3WAJA 2JRKA 2NP9A 1FMWA 4CXXA 2H3RA 3R84B 5LG3A 2DWKA 4HFBA 1MMGA 1R8IA 4OYKA 5LHIB 4GKJT 3UU4A 1W09A 3X1DA 2J1DG 5ABFA 5LGTB 2YU2A 2K24A 4DV1T 2N9DA 4HTEA 2DHRA 2DI4A 1UK5A 3S4UA 4O2AE 3D0TA 3DP7A 2XQYA 4DO0A 3A7MA 2OLTA 2WWVA 4JI5T 2BS4A 2NOXA 3ONLC 2CRBA 2A2FX 2IAKA 5AQRB 1XDOA 4ISSA 2HHHT 4P09A 1ZEEA 3KV9A 1WYCA 5CGMA 2DWGA 2FJBA 4WYVA 2RA1A 4Z90A 1XNQT 3N9NA 5C8YE 1XZYA 1IBMT 5FXXA 1J5WA 3H3AA 3LJCA 3PU3A 4HN9A 4CN4A 4FJOA 2CA5A 3LBXA 4AKRB 2JMHA 4X65T 1EZ3A 2UUBT 2XPKA 4YHHT 3ZN1B 2V6YB 3PV0F 3ETVA 5F8PA 1LVFA 3VU7H 4AKIA 4JI0T 3PUSA 1XNRT 4TZ4C 3CQGB 3JCFA 2A3DA 1OEDC 3ZT6A 2BVMA 2UXCT 4YTPA 4OHFA 4K0UA 3CWZB 3P4SA 4UV8B 2NTXA 1QSDA 4TV9E 2I0MA 2K5BB 3CQXC 3UQ7A 1MMDA 3JAFA 3MK7C 5AQJB 1Z8UA 3PURA 5JDGA 1OEDB 3AE6A 3KV6A 2W0GA 2CPTA 2XAHB 4EYYR 4LF9T 2M6IA 5L3CB 4DVDA 3JC6D 4LMLA 3CMLA 2IHR1 4ILBA 4JI7T 3RPUA 2W62A 5LBMA 2YKSA 5JDQA 1N34T 2CMRA 3ZYLA 5L4EA 5IYZE 4IL9A 3JAEA 2LM2A 5LXTE 2HN2A 2H89A 3RQUA 3TLVA 5JR9A 5HEOA 5LA6E 2E9XA 2WU2A 3CKDA 3SFEA 2YDRA 5BR8T 3RF1A 4AQGA 1MIWA 4AI6A 3GWHA 5HAXA 2X68A 1E7PA 3AE8A 2CLYB 4O4JE 2VKDA 2AXDS 5ABHA 3WI3A 4LMJA 3OVUA 5AFUL 1SHZC 3EHZA 4E7ZA 3FZFB 5HWYA 4ASKA 4C90A 3AAAB 4F6RC 4TNVA 2WBLA 4UV9B 2XY8B 2UXDT 4UIGA 1D0ZA 4IE5A 2HN1A 2X0HA
chains in the Genus database with same CATH topology
4X66T 1XMOT 4LF4T 1I94T 1IBLT 4JI6T 4LFAT 4LF9T 4KHPT 4DV2T 4DV4T 4B3TT 4NXNT 2UXBT 4DUYT 1XNQT 1HNWT 1IBMT 4NXMT 4DV5T 4B3MT 4GKKT 4JI7T 4X64T 4JYAT 4DR7T 1N34T 4LFCT 1N33T 4X65T 2UUBT 2F4VT 4YHHT 4OX9T 5LMNT 4X62T 4DV0T 4DR3T 2VQFT 5LMUT 2UU9T 4DR4T 4JI2T 4YY3T 2UUCT 1XMQT 4LF8T 4DV3T 4JI0T 4JI1T 1HNZT 4JI4T 1XNRT 4DUZT 4DV6T 3T1HT 5BR8T 4GKJT 4B3RT 4JV5T 1FJGT 2UUAT 2UXCT 3OTOT 2ZM6T 4DR1T 4DR6T 5IWAT 4DR2T 4K0KT 2VQET 4DV1T 4LF7T 1HR0T 3T1YT 4DR5T 1IBKT 4JI5T 1HNXT 1N32T 4AQYT 4LFBT 4DV7T 4JI3T 2E5LT 4JI8T 1N36T 1J5ET 4B3ST 4LF5T 2HHHT 2UXDT 4LF6T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X66 T;  1XMO T;  4LF4 T;  1I94 T;  1IBL T;  4JI6 T;  4LFA T;  4LF9 T;  4KHP T;  4DV2 T;  4DV4 T;  4B3T T;  4NXN T;  2UXB T;  4DUY T;  1XNQ T;  1HNW T;  1IBM T;  4NXM T;  4DV5 T;  4B3M T;  4GKK T;  4JI7 T;  4X64 T;  4JYA T;  4DR7 T;  1N34 T;  4LFC T;  1N33 T;  4X65 T;  2UUB T;  2F4V T;  4YHH T;  4OX9 T;  5LMN T;  4X62 T;  4DV0 T;  4DR3 T;  2VQF T;  5LMU T;  2UU9 T;  4DR4 T;  4JI2 T;  4YY3 T;  2UUC T;  1XMQ T;  4LF8 T;  4DV3 T;  4JI0 T;  4JI1 T;  1HNZ T;  4JI4 T;  1XNR T;  4DUZ T;  4DV6 T;  3T1H T;  5BR8 T;  4GKJ T;  4B3R T;  4JV5 T;  1FJG T;  2UUA T;  2UXC T;  3OTO T;  2ZM6 T;  4DR1 T;  4DR6 T;  5IWA T;  4DR2 T;  4K0K T;  2VQE T;  4DV1 T;  4LF7 T;  1HR0 T;  3T1Y T;  4DR5 T;  1IBK T;  4JI5 T;  1HNX T;  1N32 T;  4AQY T;  4LFB T;  4DV7 T;  4JI3 T;  2E5L T;  4JI8 T;  1N36 T;  1J5E T;  4B3S T;  4LF5 T;  2HHH T;  2UXD T;  4LF6 T; 
#chains in the Genus database with same CATH topology
 2IC9 A;  3M3Z B;  1IBL T;  2BKO A;  4DV2 T;  3RKG A;  2KIN B;  4CQI A;  2FJA A;  2VL8 A;  2X9X A;  3ZYK A;  2ZMA A;  2XZE A;  4GKK T;  2Q9Q A;  5AQM B;  3UT5 E;  2JJ9 A;  5FVL A;  5FXW A;  1HCI A;  4ZS2 A;  3AE7 A;  2BKN A;  2Y8D A;  2J62 A;  5FY1 A;  3KVB A;  3L8R A;  4ZOL E;  3BQK A;  5LP6 E;  3FBL A;  4O4I E;  2VQF T;  4U33 A;  5ABF B;  4P1N A;  2FJD A;  1I6Z A;  1J1J A;  1UX5 A;  3H3M A;  4GIW A;  1BR1 A;  2ZLY A;  4NUU A;  4ANJ A;  1AJ3 A;  4KUM B;  4L0R A;  1Z0P A;  3P4W A;  1MND A;  2BG9 E;  2JQH A;  3OPC A;  2LHN A;  1DU2 A;  3MAC A;  3K3O A;  4PJN A;  5LB7 B;  5LHH B;  4TUY E;  5DJQ C;  1IJ5 A;  3I9Y A;  2V26 A;  3PTR B;  2CBI A;  3HKC E;  5J0Z A;  3WAK A;  4L5G A;  3RYI E;  2V7L A;  3NRY A;  3ZMS B;  2E8I A;  4ZI7 E;  4QWN B;  3Q2M A;  4KBM B;  1N36 T;  2CHO A;  1LRZ A;  1M62 A;  3LBX B;  5FL0 A;  3EDU A;  4QXC B;  5JDL A;  3MKD A;  3EAB A;  4GYR A;  4MAL A;  3PUV F;  1T72 A;  2VVN A;  5AQG B;  4NIQ A;  5JDF A;  3ZST A;  3NZP A;  4EXT A;  2X9W A;  4Q25 A;  2V1D B;  2YDQ A;  2LEH A;  3FXD B;  4OX9 T;  4ZEY A;  3DJB A;  4DV0 T;  1ZP0 A;  1UX4 A;  1WRD A;  3VRA A;  3AEE A;  5H6Q B;  4HFE A;  3UU5 A;  3J9X 1;  3KV4 A;  4IDO A;  4JI4 T;  5LG4 A;  5HXS A;  4DID B;  3PUQ A;  5TAO A;  3CIR A;  4I55 E;  1L0V A;  2L9Q A;  3I0Q A;  2YDS A;  4X5T A;  4OFZ A;  1FEW A;  3K8P C;  2EHO A;  1WR0 A;  2LSI A;  2E9X C;  2XUE A;  2H88 A;  3VKH A;  5AQK B;  4H9O C;  1G73 A;  1IZN B;  2ZM0 A;  3RYC E;  3A5X A;  1LKX A;  3AAE B;  4ILU A;  4MHC A;  4AQF A;  2MTQ A;  2B76 A;  4ZI2 C;  4IST A;  4PJL A;  4ZS3 A;  2MYS A;  2XHE B;  3AE1 A;  3N2K E;  4KX6 A;  1LVK A;  3AA7 B;  3PJA J;  1HNW T;  5EZY E;  5E0O A;  5JR9 B;  3QC9 A;  5HCJ A;  2E9X B;  4U2Z A;  2QVA A;  1H7C A;  3HKE E;  1T7S A;  3RIU A;  3HL6 A;  3OJA A;  4IL4 A;  3EDV A;  3V5U A;  4WBO A;  5LMN T;  4I4T E;  2D2S A;  1OED E;  5LMU T;  2MOZ A;  3KVA A;  1KEY A;  3QNU A;  5BMV E;  2UUC T;  5HXR A;  4ZXL A;  1T98 A;  4GK0 E;  5HCM A;  4QH5 A;  1ZKE A;  2VAS A;  2W63 A;  3ZT5 A;  3UUN A;  2ZM6 T;  2LRL A;  4CXW A;  3SS1 A;  4Z91 A;  4X20 E;  4NUV A;  5L3G B;  4CI3 B;  3IBP A;  2X9H A;  3Q5X A;  3HKB E;  2J47 A;  2Q9Q D;  2GK9 A;  4M1P A;  2WY2 A;  2Q9Q B;  5AQP B;  4O8S A;  4ZZC A;  2LOP A;  2XAF B;  3RHW A;  4QXB B;  2X0L B;  4U31 A;  2RP4 A;  3SRZ A;  2M6B A;  4HWH A;  3KFW X;  3T8O A;  2C5J A;  2IC6 A;  4O4L E;  3LK2 B;  4DUY T;  3FXE B;  3Q5D A;  3MZK B;  2XQ5 A;  1SE7 A;  4U72 A;  3BK9 A;  5EK3 A;  1HX1 B;  5AQT B;  2CHN A;  2D5U A;  2W66 A;  3NBX X;  3QB5 K;  2NR4 A;  2YK0 A;  2E5V A;  4COF A;  3ONJ A;  2WU5 A;  4J2C A;  3EVY A;  1UUR A;  4FI5 A;  3N9L A;  2L3L A;  3TLS A;  1ZOY A;  2XQA A;  5CFB A;  4E7S A;  4YY3 T;  4GYS A;  3ZLI A;  3I0O A;  4A56 A;  3UUM A;  1OXZ A;  5LYJ E;  4DUZ T;  4IDQ A;  4DBQ A;  4DV6 T;  2LJL A;  4DMW A;  2J4G A;  4HWF A;  4JV5 T;  2CM0 A;  2ES0 A;  2KLQ A;  2NWB A;  5A1L A;  4DBR A;  5IWA T;  1WFD A;  3N9Q A;  4YTN A;  4IE0 A;  3RLF F;  3NZQ A;  2CE7 A;  1VOM A;  1N32 T;  4JI3 T;  2OA5 A;  5ETW A;  4EB6 E;  4YT0 A;  3SFD A;  1XMO T;  3VRB A;  3ZJ2 A;  4U7I A;  3I1A A;  3O1H A;  3JC6 C;  2CBJ A;  5HYA A;  1KNP A;  4HFC A;  1E1H B;  2X66 A;  4ERR A;  2V8S V;  4A97 A;  5AQV B;  4U3C A;  3HKD E;  4XBF B;  3ONX A;  1YQ4 A;  3PUX F;  2X0Y A;  2CXL A;  3OKQ A;  2EHO D;  3PDY A;  2JPF A;  2LT3 A;  3N9P A;  3F31 A;  2I6H A;  2BKP A;  2EHO B;  1VCT A;  2CWY A;  1XWM A;  2HPJ A;  2DLR A;  3E22 E;  2YOE A;  2CLY C;  3RIA A;  3QUJ A;  1U5P A;  4MLK A;  2B1E A;  1QLB A;  2WZI A;  4O2B E;  2LKG A;  2SPC A;  3ABV A;  5L3D B;  1NEN A;  4HE8 A;  3LSV A;  2N1G A;  3ZC1 A;  4Z8X A;  4WBN E;  2IW5 B;  3K3Q C;  3ZCI A;  4UR9 A;  3UUX B;  5ADX L;  1WCR A;  3CX6 B;  1HNX T;  5KX5 E;  4AQY T;  2N2N A;  3C64 A;  2LE8 A;  2XQ6 A;  4EED A;  2WCA A;  4B3S T;  3PE0 A;  4H63 H;  2XSB A;  2ACX A;  4MFR A;  5CA1 E;  2YEV C;  3PUZ F;  4YFS A;  2K9A A;  5FP3 A;  2CXF A;  1D0X A;  1ZHC A;  5JVD E;  3QK6 A;  3CX8 B;  2KND A;  2DCF A;  4AKG A;  2BG9 A;  4HEA A;  4PJJ A;  3VHL A;  4PW8 A;  4L9I A;  4JBW F;  4X64 T;  1VCS A;  4X1I E;  5JDH A;  5J2U E;  1MMN A;  2MBG A;  3AE2 A;  4AKL A;  4DR3 T;  4H63 V;  4HFD A;  4I43 B;  2Y6X A;  3RC3 A;  4UVB B;  4YSY A;  5FXZ A;  2JQK A;  4OYJ A;  4JLE A;  1HNZ T;  3VKG A;  3UU6 A;  1O3X A;  2KSR A;  4KI0 F;  2VVS A;  2Z6E A;  2Y48 B;  3L09 A;  4WW0 A;  4V1A v;  5AQH B;  3KDS E;  4EZH A;  1UUS A;  5J1G A;  2FJE A;  4ADZ A;  1NEK A;  4PJM A;  2WB5 A;  2IDO B;  3A8Y C;  3C4X A;  5DAB A;  3RI5 A;  4DV7 T;  4JI8 T;  5HXH A;  4H9Q C;  5FKY A;  4ZI3 D;  4YLH A;  4EAH A;  4JEH B;  1X9B A;  1G8X A;  2R6G F;  4WZX A;  1YXR A;  4C91 A;  4N78 D;  3M65 A;  5KXJ A;  2VB6 A;  4G2A A;  4CN6 A;  3ZMZ B;  2KZ7 B;  3UTK A;  4YJ3 E;  2BZB A;  3FZK B;  2X67 A;  2W4X A;  4KHZ F;  5FVK A;  4DR7 T;  2V7M A;  3SWH A;  2IML A;  4JEU B;  1YKE B;  4I50 E;  4UEL A;  3MJX A;  2LOS A;  2W2U A;  4ILC A;  5AQS B;  4IDP A;  3N5L A;  4P0A A;  3O9X A;  3NVO A;  2X51 A;  5F5W A;  3G06 A;  1T8B A;  2VWA A;  1MIV A;  3O4X E;  2XJ7 A;  2ODU A;  3ETU A;  2BS2 A;  4AIS A;  3P4P A;  1KNR A;  2NTY A;  2WMN A;  3AE5 A;  1HFA A;  3I9W A;  4NPP A;  2LRK A;  4IIJ E;  4TWF A;  1D1C A;  1BR2 A;  4QHO A;  4CXY A;  3N2G E;  4DR5 T;  4IE7 A;  4IE4 A;  5LNK A;  3FZH B;  3FBZ A;  3ZYM A;  4BA9 A;  3AVR A;  2YU1 A;  2E5L T;  3LFM A;  5HXC A;  1US7 B;  2BDE A;  4LF6 T;  2QRX A;  2BS3 A;  3EUH A;  5JR9 C;  2LKH A;  1HF8 A;  2KWI B;  2XQ9 A;  1S94 A;  3CPZ A;  1Y64 B;  5FL1 A;  3LG7 A;  2XQ3 A;  2I59 A;  1N33 T;  2W61 A;  2WWU A;  4CI2 B;  5FY0 A;  3UFE A;  2UXX B;  4KMC A;  3ESL A;  4DR4 T;  3ZPO A;  1JNZ A;  2V5D A;  4ZZB A;  3AA6 B;  2XQ8 A;  2YIN A;  1YKH B;  4X1K E;  2D0U A;  4HWC A;  3P7I A;  3LDQ B;  2UUA T;  3RX6 A;  5FNV E;  3OTO T;  5L4H A;  3PU8 A;  4H9R C;  3B13 A;  2VKJ A;  3V5S A;  4DMV A;  2C5K T;  3H37 A;  2Q9Q C;  3RC8 A;  5L47 A;  5LHG B;  5LJM A;  2LSY A;  2CEA A;  1IBK T;  3IEE A;  2BG9 B;  3E08 A;  2LHR A;  3AEA A;  1BR4 A;  5EK4 A;  4LF5 T;  3Q5W A;  2QGS A;  2C0S A;  4LFA T;  3RYH E;  3VR9 A;  3Q9D A;  2LSJ A;  2LLY A;  2LSK A;  5AQU B;  4QKN A;  3LK3 B;  2KWH A;  3ZT7 A;  3KBU A;  3UFG A;  2ACZ A;  4BJM A;  1HX8 A;  4QH4 A;  3VR8 A;  5L3E B;  2G0U A;  3DTO A;  4X62 T;  5JRC A;  2HPL A;  4H9P C;  2ODV A;  3JAD A;  3TLT A;  2NW7 A;  5JDN A;  2UU9 T;  1KNZ A;  3KBT A;  2XTL A;  4LF8 T;  3AXJ A;  3OYZ A;  4UF0 A;  1KF6 A;  2JMK A;  3PUW F;  2LSG A;  4DR1 T;  3L39 A;  4YXD A;  1KFY A;  2VKO A;  3HA4 A;  3UUB A;  3CX7 B;  5LGN B;  3GN5 A;  3ZJ1 A;  4LF7 T;  2RPA A;  4B6X A;  1GQE A;  1WLX A;  3FB2 A;  3TKL B;  2XAQ B;  3C4Z A;  1IJ6 A;  4YJ2 E;  4IDZ A;  3RKO A;  5JRE A;  3J7Y q;  3L3P A;  4IDN A;  1J5E T;  2K48 A;  1MMA A;  2X9Y A;  3AEC A;  5LOV E;  2VK9 A;  1YQ3 A;  3UU3 A;  3ANW A;  3FHN A;  3P4Q A;  4X66 T;  4HFI A;  2WM9 A;  2A9U A;  4CN1 A;  4AXP A;  4KHP T;  2ZM8 A;  4B3T T;  5EK2 A;  1D0Y A;  3NRX A;  1WR6 A;  3NWI A;  5JH7 E;  4B3M T;  5ABE A;  4QH1 A;  3TLW A;  1V9D A;  5CA0 E;  4JYA T;  3OYX A;  2QYW A;  1CHU A;  2KMF A;  5HWX A;  2F4V T;  2H7V C;  4H9N C;  2XQ4 A;  5F3J A;  2EHO C;  2IIU A;  2PTF A;  2V5C A;  3SOL A;  1ZV4 X;  3IHR A;  4GOU A;  4DV3 T;  3RRC A;  3PUA A;  2V7K A;  3C50 A;  3P50 A;  2V7J A;  4AQF C;  4TN7 B;  1B7T A;  3ZN0 B;  4H9S E;  3AED A;  3AB3 B;  2PJQ A;  4WNK A;  4K0K T;  3CVR A;  5IHY A;  5JTG A;  4QXH B;  5HEH A;  4EYU A;  3W15 B;  1D1B A;  4TWH A;  4TV8 E;  4P0B A;  4XZC A;  3K1S A;  3RIU C;  2JQQ A;  3ZMU B;  3AE9 A;  4LFB T;  4TX5 A;  4I0U A;  2L8K A;  4U74 A;  1UGO A;  4YSZ A;  5AQQ B;  4CI1 B;  5LCY A;  1MNE A;  3K3N A;  4IGU A;  1NWM X;  3CK6 A;  3RQW A;  1NAF A;  4OK0 A;  3CQC B;  5GON E;  4AIU A;  5KDM C;  5H6R B;  3BQL A;  1OWA A;  2V7I A;  5LJN A;  4XAX B;  5C2T A;  4LMK A;  4TNW A;  5LGU B;  2IUB A;  3BQI A;  1SA0 E;  3MA9 A;  2WAU A;  4BJN A;  4EGW A;  1XMQ T;  3ZSS A;  1BR0 A;  3AA1 B;  4IHJ E;  4YSX A;  2PFV A;  3T1H T;  2NW9 A;  1FJG T;  3O1J A;  3GMI A;  5CB4 E;  4IT4 A;  2P9B A;  2XAJ B;  2BBH A;  2WDQ A;  1W0B A;  2PG8 A;  2VQE T;  3B57 A;  3ZMT B;  5AQF B;  2CWO A;  3P8C D;  5AQI B;  4QX7 B;  5LBQ B;  4PK4 A;  2HH7 A;  3RGL A;  3N2O A;  3TLU A;  4AKH A;  4ZI3 C;  1FIO A;  4HWD A;  5FYM A;  2JIW A;  4EEB A;  1CUN A;  5JRC B;  4LF4 T;  3O1I A;  4DV4 T;  3QOF A;  2CCQ A;  2UXB T;  4A5X A;  3ZC0 A;  2AE9 A;  2QA7 A;  2PBI A;  3AXJ B;  3U3I A;  4UF0 B;  2XM1 A;  3PUG A;  5HEU A;  4QX8 B;  2CXD A;  2D0T A;  3EAM A;  4EIW A;  2M67 A;  2WZH A;  5HXE A;  2XAG B;  4HGA A;  3QB5 A;  3AA0 B;  5L3F B;  2JQ9 A;  4KP3 C;  5L3B B;  2VKH A;  1HG5 A;  3C51 A;  3GN5 B;  4O4H E;  5JQG E;  4HFV A;  2XSA A;  2E2A A;  1HG2 A;  1Y01 A;  3AVS A;  3E0Z A;  4JI1 T;  3N9O A;  2FUP A;  4YHJ A;  2DNX A;  4TWD A;  4X1Y E;  2LM9 A;  4B3R T;  5FMN A;  2V6Y A;  4PFP A;  4BAY B;  3ZKR A;  4F8H A;  4ZHQ E;  3ANW B;  4UEM A;  4EV6 A;  4IE6 A;  2MPK A;  4EZ4 A;  3B5M A;  5AQL B;  5HEG A;  3GA8 A;  3F57 A;  4UXN B;  3T1Y T;  4A98 A;  3RYF E;  3FZM B;  4HFH A;  3C4W A;  1HS7 A;  3UU8 A;  2BVL A;  2ZM2 A;  3Q5E A;  4GK5 E;  3FZL B;  1UCU A;  1I94 T;  4HKA A;  3UUL A;  2XAS B;  4ILA A;  3RIF A;  4PAG A;  3AE4 A;  4NXM T;  3MXZ A;  4EOZ B;  4DV5 T;  2WSS V;  3HR0 A;  4JUY A;  2BBJ A;  2UXN B;  1OED A;  5DQV A;  1QUU A;  5AQN B;  5JDM A;  4LFC T;  2WQY A;  1W9R A;  2XM2 A;  4CZZ B;  2W67 A;  4U2Y A;  1MIY A;  3RRW A;  3LK4 2;  1VRB A;  4PNI A;  1X79 A;  3UQ4 A;  5DQW A;  4HWI B;  3AEB A;  5FXV A;  1KK7 A;  2WDR A;  3NKZ A;  5KMG P;  5FY7 A;  4G63 A;  2V6X A;  1FMV A;  3RH3 A;  3ZEF B;  3C98 B;  3F2E A;  5CJ5 A;  2VUR A;  4PK5 A;  2C5I T;  2W00 A;  2DL1 A;  3EI0 A;  4DR6 T;  4IRE A;  4DR2 T;  3HI2 A;  1XDP A;  1JNR A;  1W0A A;  4DND A;  1WYB A;  2BG9 C;  3AE3 A;  3AAI A;  1D1A A;  1YD8 G;  1HR0 T;  3U78 A;  1S35 A;  2WP9 A;  2FBW A;  1E2A A;  2E9X D;  3IA3 A;  3N9M A;  5M4Y A;  3PJA A;  2A72 A;  4PFO A;  2XQ7 A;  3PUY F;  2OV9 A;  5ABG A;  3ZMV B;  5L2L A;  1IAP A;  4PK6 A;  3AEG A;  2KT9 A;  3R6N A;  3ZCJ A;  3OBV E;  4UVC B;  4UVA B;  2VL0 A;  4JI6 T;  4ZI2 D;  4NXN T;  5J2T E;  1M7K A;  5IUX A;  4YTM A;  2H7O A;  3KIN B;  5C3J A;  1HTJ F;  3AEF A;  1U4Q A;  5AQO B;  4MBQ A;  2MAW A;  2WDV A;  1SUM B;  3KV5 A;  4U7Y A;  3IF8 B;  3P4R A;  2WMO A;  2WS3 A;  1YW0 A;  2NW8 A;  2YN6 A;  5HEJ A;  2K3W A;  2KXP B;  2D9D A;  4JI2 T;  3WAJ A;  2JRK A;  2NP9 A;  1FMW A;  4CXX A;  2H3R A;  3R84 B;  5LG3 A;  2DWK A;  4HFB A;  1MMG A;  1R8I A;  4OYK A;  5LHI B;  4GKJ T;  3UU4 A;  1W09 A;  3X1D A;  2J1D G;  5ABF A;  5LGT B;  2YU2 A;  2K24 A;  4DV1 T;  2N9D A;  4HTE A;  2DHR A;  2DI4 A;  1UK5 A;  3S4U A;  4O2A E;  3D0T A;  3DP7 A;  2XQY A;  4DO0 A;  3A7M A;  2OLT A;  2WWV A;  4JI5 T;  2BS4 A;  2NOX A;  3ONL C;  2CRB A;  2A2F X;  2IAK A;  5AQR B;  1XDO A;  4ISS A;  2HHH T;  4P09 A;  1ZEE A;  3KV9 A;  1WYC A;  5CGM A;  2DWG A;  2FJB A;  4WYV A;  2RA1 A;  4Z90 A;  1XNQ T;  3N9N A;  5C8Y E;  1XZY A;  1IBM T;  5FXX A;  1J5W A;  3H3A A;  3LJC A;  3PU3 A;  4HN9 A;  4CN4 A;  4FJO A;  2CA5 A;  3LBX A;  4AKR B;  2JMH A;  4X65 T;  1EZ3 A;  2UUB T;  2XPK A;  4YHH T;  3ZN1 B;  2V6Y B;  3PV0 F;  3ETV A;  5F8P A;  1LVF A;  3VU7 H;  4AKI A;  4JI0 T;  3PUS A;  1XNR T;  4TZ4 C;  3CQG B;  3JCF A;  2A3D A;  1OED C;  3ZT6 A;  2BVM A;  2UXC T;  4YTP A;  4OHF A;  4K0U A;  3CWZ B;  3P4S A;  4UV8 B;  2NTX A;  1QSD A;  4TV9 E;  2I0M A;  2K5B B;  3CQX C;  3UQ7 A;  1MMD A;  3JAF A;  3MK7 C;  5AQJ B;  1Z8U A;  3PUR A;  5JDG A;  1OED B;  3AE6 A;  3KV6 A;  2W0G A;  2CPT A;  2XAH B;  4EYY R;  4LF9 T;  2M6I A;  5L3C B;  4DVD A;  3JC6 D;  4LML A;  3CML A;  2IHR 1;  4ILB A;  4JI7 T;  3RPU A;  2W62 A;  5LBM A;  2YKS A;  5JDQ A;  1N34 T;  2CMR A;  3ZYL A;  5L4E A;  5IYZ E;  4IL9 A;  3JAE A;  2LM2 A;  5LXT E;  2HN2 A;  2H89 A;  3RQU A;  3TLV A;  5JR9 A;  5HEO A;  5LA6 E;  2E9X A;  2WU2 A;  3CKD A;  3SFE A;  2YDR A;  5BR8 T;  3RF1 A;  4AQG A;  1MIW A;  4AI6 A;  3GWH A;  5HAX A;  2X68 A;  1E7P A;  3AE8 A;  2CLY B;  4O4J E;  2VKD A;  2AXD S;  5ABH A;  3WI3 A;  4LMJ A;  3OVU A;  5AFU L;  1SHZ C;  3EHZ A;  4E7Z A;  3FZF B;  5HWY A;  4ASK A;  4C90 A;  3AAA B;  4F6R C;  4TNV A;  2WBL A;  4UV9 B;  2XY8 B;  2UXD T;  4UIG A;  1D0Z A;  4IE5 A;  2HN1 A;  2X0H A; 
#chains in the Genus database with same CATH homology
 4X66 T;  1XMO T;  4LF4 T;  1I94 T;  1IBL T;  4JI6 T;  4LFA T;  4LF9 T;  4KHP T;  4DV2 T;  4DV4 T;  4B3T T;  4NXN T;  2UXB T;  4DUY T;  1XNQ T;  1HNW T;  1IBM T;  4NXM T;  4DV5 T;  4B3M T;  4GKK T;  4JI7 T;  4X64 T;  4JYA T;  4DR7 T;  1N34 T;  4LFC T;  1N33 T;  4X65 T;  2UUB T;  2F4V T;  4YHH T;  4OX9 T;  5LMN T;  4X62 T;  4DV0 T;  4DR3 T;  2VQF T;  5LMU T;  2UU9 T;  4DR4 T;  4JI2 T;  4YY3 T;  2UUC T;  1XMQ T;  4LF8 T;  4DV3 T;  4JI0 T;  4JI1 T;  1HNZ T;  4JI4 T;  1XNR T;  4DUZ T;  4DV6 T;  3T1H T;  5BR8 T;  4GKJ T;  4B3R T;  4JV5 T;  1FJG T;  2UUA T;  2UXC T;  3OTO T;  2ZM6 T;  4DR1 T;  4DR6 T;  5IWA T;  4DR2 T;  4K0K T;  2VQE T;  4DV1 T;  4LF7 T;  1HR0 T;  3T1Y T;  4DR5 T;  1IBK T;  4JI5 T;  1HNX T;  1N32 T;  4AQY T;  4LFB T;  4DV7 T;  4JI3 T;  2E5L T;  4JI8 T;  1N36 T;  1J5E T;  4B3S T;  4LF5 T;  2HHH T;  2UXD T;  4LF6 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...