2UUBT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uubT00
4LFCT 2UUAT 4JI2T 1N36T 4B3TT 4DV1T 2UXDT 4DV0T 4JI6T 4JI3T 4DR5T 4DV2T 1N32T 4DR2T 4DR6T 4X66T 4JI0T 1J5ET 4OX9T 3OTOT 2VQFT 1HNXT 5LMUT 1XMOT 4YY3T 1XNRT 2UXCT 1IBLT 5IWAT 4NXNT 4DUYT 4JI7T 1IBMT 4NXMT 4GKKT 4JI4T 1N34T 4LFBT 1XNQT 4DR3T 4B3ST 2UUBT 5LMNT 2UU9T 2UXBT 1HNZT 4KHPT 1FJGT 1N33T 4DV3T 4K0KT 4JI5T 4JYAT 4X65T 1HNWT 4DV6T 4DV4T 4GKJT 4JV5T 1HR0T 4X64T 2F4VT 4JI8T 2VQET 4DUZT 4B3RT 4DV7T 4DV5T 4DR7T 4X62T 4AQYT 1IBKT 4LF8T 2UUCT 4YHHT 4LF5T 3T1HT 2E5LT 4DR1T 4LFAT 3T1YT 4LF6T 4LF9T 4DR4T 1I94T 4JI1T 1XMQT 2HHHT 4B3MT 4LF7T 4LF4T 2ZM6T 5BR8T
chains in the Genus database with same CATH superfamily
2VKJA 4FI5A 1V9DA 4TUYE 5AQIB 2XQ8A 2WWVA 5LP6E 2KINB 5GONE 2QVAA 1AJ3A 2HPJA 2NTYA 4CI2B 1HG2A 4BJNA 1WFDA 4B3TT 1E1HB 1WYCA 5L4HA 3JAEA 5HWYA 4F6RC 3L3PA 1NAFA 1MNEA 4HFBA 4IE6A 5AQGB 4KUMB 5JH7E 2BDEA 2OV9A 2EHOB 3KBTA 2WMNA 4HWIB 2VB6A 4N78D 4ZEYA 4COFA 4JI6T 2XQYA 4IDOA 3P4RA 4U33A 2XM2A 4ZZCA 5F3JA 1Z8UA 5AQRB 1NENA 4M1PA 3MZKB 3VHLA 2LLYA 2LKGA 2NW7A 2JQKA 2X9XA 3CX6B 2ODVA 1VCSA 3HKCE 3OVUA 3UFEA 1N32T 3AA1B 5LCYA 3R6NA 3S4UA 4DR2T 2AXDS 4IDZA 2WMOA 2WY2A 4O8SA 2BVLA 2YK0A 1HX8A 4Z91A 2X51A 2DNXA 4TZ4C 2N1GA 4NIQA 5IHYA 3RRCA 4X66T 1KF6A 3SRZA 1OEDC 4JLEA 3I0QA 5LNKA 4ZZBA 4ANJA 2IUBA 1SA0E 4AKRB 4JI0T 4IE0A 1FEWA 1R8IA 2N9DA 2X9YA 2XQ7A 3JAFA 3K3NA 4X1KE 3FXEB 5DQWA 3KBUA 3NBXX 5EK4A 4BAYB 2KSRA 5FL1A 3QK6A 3RIFA 2K9AA 5IWAT 4HE8A 2XAQB 2YEVC 4KMCA 4DUYT 2W61A 1IBMT 4JI7T 3SFEA 4PJNA 5L2LA 2JQHA 5DJQC 5LA6E 3P4QA 3ZC1A 4CQIA 4I43B 4MLKA 5TAOA 2ZM8A 1G8XA 4HKAA 5FY1A 5KDMC 2E9XC 5KX5E 3Q5DA 1MMAA 2KMFA 3KV6A 3AA7B 3QB5A 4O2BE 2J47A 3C98B 3N9PA 3A7MA 3ABVA 4UVAB 2LSIA 2KWIB 2XQAA 2D2SA 3AE8A 3RIUC 4HGAA 2WDVA 2V7KA 1UURA 3UU3A 4OK0A 3CWZB 4KHPT 1SUMB 2JJ9A 2W2UA 3LSVA 3J7Yq 2JMHA 3UU4A 2NW8A 3KINB 1U5PA 3UUMA 4LMJA 5JR9B 1M7KA 2CXFA 1YD8G 3DJBA 5J2UE 1HG5A 3PUAA 4EEDA 2XJ7A 2H3RA 2NWBA 2RA1A 1BR4A 2KT9A 4UR9A 5EZYE 3RYCE 3ZPOA 4DIDB 5HXEA 4GKJT 4OYJA 3ZN0B 1HR0T 3QB5K 4X64T 1QLBA 3PURA 3MJXA 1I6ZA 5ABFB 1MNDA 3M3ZB 4YT0A 5HAXA 4DUZT 4B3RT 1WR0A 3OJAA 4ISTA 3AVSA 2K3WA 4IL9A 3VR9A 3CVRA 4AQGA 4HWFA 4DR7T 4YLHA 5LGUB 4X1YE 2KZ7B 5LJNA 4F8HA 2V7LA 2KWHA 5HEGA 4MFRA 4AQYT 1HF8A 1XWMA 3ETVA 3AEBA 2A2FX 3HI2A 3RGLA 2QGSA 3ZSSA 2H7VC 3SOLA 4DBQA 4LF5T 2IIUA 4TX5A 3PJAA 4ZI7E 2JQQA 3NVOA 4H63H 4DR1T 4G2AA 4K0UA 3T1YT 3RRWA 3IHRA 3AE2A 1MIWA 2CM0A 1X9BA 2WDQA 2HN1A 3B13A 3I9WA 2E8IA 4IGUA 4OFZA 4OYKA 5LGNB 4LF6T 3HA4A 2VKDA 3AA6B 4A56A 3HKEE 4X5TA 5JDFA 4IDPA 5C2TA 1UUSA 4WYVA 3R84B 3ZSTA 3D0TA 4NPPA 4UVCB 5EK3A 2DLRA 5HXCA 4EYUA 2YINA 4ZI2D 5CA1E 4LF4T 3NKZA 4CI3B 2WZHA 4YHJA 3TLVA 2AE9A 3AAEB 4OHFA 3J9X1 5L4EA 4HN9A 3EDVA 1KEYA 1MMGA 2E2AA 4DBRA 4LFCT 2RP4A 5EK2A 3O1IA 3H3AA 1KK7A 2LSGA 2A3DA 4X20E 5LOVE 3U3IA 4CZZB 3LK3B 1HS7A 3LBXB 1KFYA 2BG9A 2LSJA 2WSSV 5C8YE 5L3CB 4U31A 2V7MA 4HEAA 5AQNB 3AE1A 1Y01A 2LHNA 4GK5E 2LOPA 1OEDB 3ZLIA 2VVSA 3RI5A 5HEJA 2Q9QD 5HEHA 2UXXB 2V6YB 4TNVA 2B1EA 4QWNB 3LK2B 4DO0A 2NW9A 2UXDT 3V5UA 4DV0T 2J4GA 2LJLA 4A97A 4O4IE 2XPKA 4C91A 1IZNB 3L8RA 3RF1A 4JI3T 4DR5T 2K5BB 2NR4A 1Z0PA 3FB2A 3I0OA 2ZLYA 5J0ZA 4TWDA 1YKEB 5L3BB 3VKGA 3PV0F 5L3EB 3AECA 2CA5A 3CIRA 4XAXB 3PUWF 2UXNB 4U2ZA 4UF0B 2K24A 3SS1A 1X79A 3AEDA 5BR8T 2K48A 2SPCA 1HFAA 2FJEA 1SE7A 3KV4A 2JPFA 4FJOA 4IE7A 3RHWA 3RLFF 2LM9A 4EYYR 5CJ5A 2WBLA 2XAGB 5FMNA 2EHOA 5FXXA 4B6XA 3TLUA 3RC8A 2BKOA 2CEAA 3RQWA 4JEHB 3N2KE 3RC3A 4IL4A 5JDHA 3OKQA 5LHIB 4KHZF 3OTOT 4AXPA 5AQVB 2VQFT 1YQ4A 4ILAA 4QXCB 2CXLA 4HFIA 3C51A 4YY3T 1XMOT 1XNRT 1IBLT 4LMLA 2CBIA 3P4PA 2GK9A 2EHOC 3AEFA 2LE8A 1T72A 2YKSA 3F31A 3Q9DA 4TN7B 3ZKRA 5JVDE 1D0XA 4NUUA 4PNIA 3A8YC 1BR1A 2CWOA 2V7IA 2N2NA 2WCAA 3UQ4A 4EZ4A 4LFBT 3O1JA 1OEDE 5HXSA 5HYAA 5L3GB 3RIAA 1S94A 3N9NA 3OYZA 2BS3A 2PBIA 2D0UA 4CN6A 4X1IE 2MAWA 2QYWA 2LSKA 3CMLA 3H37A 3PUYF 4YSZA 5JDGA 2DCFA 4PK5A 3PUGA 4JBWF 3WI3A 4IREA 5JDMA 3JCFA 4ZXLA 3EVYA 4WZXA 4CXYA 2P9BA 3U78A 1E2AA 2BG9C 2WP9A 1OWAA 3TLTA 5J1GA 2ODUA 3C4XA 1N33T 4H63V 4U72A 4DVDA 2C0SA 2XSAA 4EOZB 4GYSA 2E9XD 3E22E 2X68A 2JMKA 1ZHCA 3ZEFB 2XAJB 4HFDA 3MA9A 2ACXA 2BZBA 2XQ3A 5CGMA 1LVKA 4DV6T 4YFSA 1WCRA 1WRDA 3A5XA 3P4WA 3PUQA 4QXBB 4GIWA 2PJQA 2WQYA 2VQET 1FMVA 1US7B 4ISSA 5FY7A 3VKHA 1G73A 3LK42 2CBJA 1M62A 2YU2A 2BBJA 4U2YA 1UGOA 2I0MA 2NP9A 4KX6A 2A72A 2W4XA 4ILBA 3IEEA 5FP3A 3T8OA 4EAHA 3UUNA 1FJGT 2YDRA 4LF8T 4QX7B 2LSYA 3EAMA 1J5WA 3E08A 4YHHT 2CCQA 2H7OA 2R6GF 4U3CA 3ZC0A 2VASA 3ZMUB 2IC9A 3ONJA 4P09A 3C64A 3FHNA 3ZYLA 2MYSA 2FJDA 3N9QA 5FNVE 4O4HE 5ABFA 4HFCA 3AXJB 4PJLA 4XZCA 2VKOA 4I50E 4CN1A 1HTJF 2BG9B 2FUPA 3L39A 5A1LA 3AVRA 5HCMA 3ZJ2A 5LHGB 1XMQT 2IC6A 2VK9A 2W63A 3CKDA 3N2GE 4IIJE 1WR6A 2Z6EA 1Y64B 2VWAA 2YDSA 3VU7H 5JQGE 4CXWA 5LG4A 5HWXA 3NRXA 5AQPB 2XAHB 3I9YA 4U74A 5JRCB 3B5MA 2PG8A 3PDYA 4LMKA 4UV8B 2OA5A 3FBZA 5FYMA 3N9OA 4UV9B 2UUAT 2YDQA 4PAGA 4H9SE 1D1AA 2M67A 5LG3A 2JRKA 3QOFA 2XSBA 3K1SA 2XTLA 4I4TE 2BKPA 5H6QB 1MIVA 1L0VA 4ASKA 2YOEA 3UU6A 3W15B 4DV1T 2LHRA 1T8BA 4AIUA 2LT3A 3FZMB 2CE7A 2BVMA 3K3QC 3RQUA 3B57A 2RPAA 3CQXC 3OYXA 4QH4A 4TWFA 2J1DG 4ILCA 3ZYMA 1YW0A 3PUVF 4HFVA 2I6HA 4YSYA 2H88A 2W00A 1CUNA 5JTGA 1D1CA 4ZI3D 2MPKA 3RIUA 3RYFE 3ZT7A 2IMLA 5L47A 2BKNA 5ETWA 5L3DB 4YTPA 3DP7A 5LYJE 4DMWA 2ZM2A 2ZM0A 4AKGA 2ACZA 4TWHA 4G63A 5KMGP 5HEOA 2DWKA 3HL6A 5H6RB 2D5UA 4P1NA 3TKLB 5ABHA 3AB3B 1UK5A 4L9IA 2WU5A 1IJ6A 2L9QA 2WU2A 3F2EA 3KV9A 3CX8B 3KVBA 3NWIA 3PU3A 2X0LB 3UUXB 3NZPA 3ZT6A 1W0AA 5LJMA 4YXDA 4OX9T 1B7TA 5LMUT 2BBHA 2W66A 4QH1A 3L09A 5FXZA 2MOZA 3E0ZA 3MK7C 4NXNT 1QUUA 2W0GA 4L0RA 3AE3A 4UF0A 4HWHA 3EABA 4CI1B 2C5KT 4PJMA 2J62A 4PK4A 3AE9A 1N34T 2LEHA 1QSDA 1J1JA 4Q25A 2Q9QC 2C5IT 4V1Av 1XNQT 4DR3T 2LRLA 5DQVA 2UUBT 5LMNT 1GQEA 1NEKA 1W0BA 2ZMAA 3CQCB 5AQUB 3ZCJA 4IT4A 2UU9T 2XQ9A 5AFUL 4EB6E 2WWUA 1NWMX 2HN2A 3FZLB 2UXBT 4A5XA 3G06A 4O2AE 3ZYKA 2VKHA 2WDRA 3LG7A 2E9XB 3MKDA 2M6IA 4QKNA 4YJ3E 3N9MA 5HEUA 5L3FB 4P0BA 3ZT5A 4CXXA 3RYIE 3RKGA 2W67A 5LBMA 4DV3T 2LM2A 3N2OA 4IE4A 3RH3A 4P0AA 4K0KT 3FBLA 3UUBA 4YJ2E 3ZMVB 2BG9E 2DL1A 4AQFC 4A98A 4X65T 3KFWX 4PFOA 4MALA 5AQFB 4JYAT 1HNWT 1MMDA 4ZI2C 2V8SV 3JC6C 2W62A 4L5GA 3EUHA 2L8KA 4ZS3A 3DTOA 4JI8T 2LOSA 1KNPA 3AA0B 4DV7T 2CXDA 3PJAJ 3LFMA 2IDOB 3SFDA 4DR6T 1VCTA 4X62T 2CRBA 3FXDB 1LRZA 2JQ9A 2VURA 4TV8E 5JDNA 4AKHA 1EZ3A 1FMWA 2CPTA 4UELA 2OLTA 3KV5A 1VRBA 2CHOA 5AQQB 2UUCT 1ZV4X 1U4QA 1JNRA 4UVBB 2WB5A 3QNUA 5IUXA 5KXJA 3O1HA 4GYRA 2E5LT 5JRCA 5AQHB 1CHUA 1O3XA 1FIOA 5BMVE 4MBQA 4WW0A 2FBWA 2X66A 3FZKB 4ADZA 5LGTB 4LF9T 5JR9C 3EHZA 4DR4T 3P4SA 2PFVA 3MACA 4HWDA 1I94T 4JI1T 4I0UA 4DNDA 2I59A 3PUSA 1ZOYA 4QXHB 3WAJA 3VRAA 5CB4E 3MXZA 5LBQB 2WM9A 4PFPA 4IDNA 3Q2MA 1S35A 4Z90A 2DI4A 2VL8A 4ZS2A 4LF7T 3BQLA 3CK6A 4H9RC 1VOMA 2Q9QA 2MTQA 4I55E 1H7CA 5FL0A 2Y6XA 5IYZE 3ZJ1A 3X1DA 3I1AA 3EI0A 3AAAB 4NUVA 4WBNE 2ZM6T 2XHEB 1BR0A 4E7ZA 2BS4A 2IAKA 2XZEA 3CPZA 3JADA 3KVAA 1D1BA 1OEDA 3CQGB 2Q9QB 1KNZA 2KLQA 2X9HA 4UXNB 3V5SA 2L3LA 4JI2T 1DU2A 2Y8DA 2NOXA 3GN5B 4U7YA 4TV9E 4J2CA 5HXRA 2X67A 1UX5A 1N36T 4XBFB 2VL0A 3ZMZB 3BQKA 3ETUA 3RKOA 1OXZA 3FZFB 5FXVA 3QC9A 4ZHQE 3GN5A 1XDPA 4GOUA 5ABGA 4O4JE 3M65A 3EDUA 2MBGA 5JDLA 3PU8A 3Q5XA 3GA8A 3UT5E 4AQFA 4DMVA 2DHRA 2ES0A 3ONLC 3ONXA 4DV2T 1BR2A 2XUEA 3CX7B 3OBVE 3UULA 1ZP0A 5J2TE 3C4ZA 4AISA 4WBOA 3HKDE 2IW5B 4JEUB 4AKLA 4E7SA 4TNWA 4H9OC 4ILUA 4YSXA 3IA3A 1ZEEA 3UU8A 3AEEA 2FJBA 4IHJE 4Z8XA 2NTXA 3PE0A 5FKYA 4PW8A 5ADXL 1HCIA 1D0YA 3VR8A 2X9WA 3LDQB 5FVKA 1W09A 3GWHA 3AE5A 1LVFA 5AQKB 3ZN1B 1J5ET 1MIYA 5E0OA 4U7IA 3RX6A 2D0TA 3RYHE 1HNXT 1ZKEA 2V5CA 5HCJA 2QA7A 4H9PC 5LXTE 4KI0F 3AE4A 2UXCT 4PJJA 3WAKA 3NRYA 3NZQA 2E9XA 3UU5A 2M6BA 3AE6A 3SWHA 2XQ6A 5HXHA 1YKHB 4QX8B 2H89A 4NXMT 4GKKT 1WLXA 3OPCA 1IAPA 3RPUA 4JI4T 2JIWA 4EXTA 3JC6D 3F57A 2EHOD 4H9QC 5AQMB 4C90A 4HFHA 4B3ST 2V26A 5AQTB 2G0UA 2CHNA 5AQJB 2YN6A 5LB7B 1LKXA 3UTKA 2HPLA 4HTEA 4KBMB 2B76A 3ZCIA 1HNZT 3KDSE 1IJ5A 2E5VA 3P8CD 1KNRA 2QRXA 3AE7A 5FVLA 4GK0E 3TLSA 3BQIA 4YTMA 2XQ4A 2C5JA 3N5LA 2WS3A 1JNZA 2XAFB 3ANWB 1UX4A 3ZMTB 4BA9A 4EGWA 3PUZF 1W9RA 3AEGA 4UIGA 2D9DA 5AQSB 4ZI3C 1SHZC 2A9UA 2XY8B 3C4WA 1MMNA 2LKHA 4BJMA 4AKIA 2XM1A 2FJAA 5F8PA 2CWYA 4JI5T 5JREA 4HFEA 3ANWA 3O9XA 4JUYA 4QH5A 5F5WA 2CLYB 3K8PC 5FXWA 5CFBA 1HX1B 1WYBA 1YXRA 5AQOB 3ZMSB 4ERRA 2Y48B 1YQ3A 4DV4T 4JV5T 2DWGA 2F4VT 2X0YA 5ABEA 3K3OA 3P50A 4IDQA 2BS2A 1XZYA 3PTRB 2CMRA 4KP3C 4MHCA 3IBPA 2V1DB 2X0HA 3UQ7A 4DV5T 2XQ5A 3P7IA 3HR0A 2CLYC 3GMIA 5M4YA 5JR9A 5CA0E 1D0ZA 1IBKT 2XASB 5AQLB 3ESLA 3IF8B 3PUXF 3LJCA 2WAUA 4EZHA 3QUJA 3T1HT 4LFAT 4ZOLE 4IE5A 4CN4A 4H9NC 2V7JA 4AI6A 1T98A 5LHHB 3N9LA 4O4LE 3TLWA 2KNDA 3HKBE 2HH7A 2YU1A 3FZHB 3LBXA 3VRBA 3UFGA 5JDQA 2V5DA 5DABA 5FY0A 1T7SA 3Q5EA 2HHHT 1UCUA 4WNKA 4YTNA 4B3MT 3AAIA 4EIWA 5C3JA 3BK9A 3AXJA 3Q5WA 4UEMA 3H3MA 4EEBA 2VVNA 2V6YA 2WZIA 4PK6A 4EV6A 3AEAA 1XDOA 2LRKA 2PTFA 3C50A 1E7PA 3O4XE 4QHOA 2V6XA 2IHR1 2KXPB 4HWCA
chains in the Genus database with same CATH topology
4LFCT 2UUAT 4JI2T 1N36T 4B3TT 4DV1T 2UXDT 4DV0T 4JI6T 4JI3T 4DR5T 4DV2T 1N32T 4DR2T 4DR6T 4X66T 4JI0T 1J5ET 4OX9T 3OTOT 2VQFT 1HNXT 5LMUT 1XMOT 4YY3T 1XNRT 2UXCT 1IBLT 5IWAT 4NXNT 4DUYT 4JI7T 1IBMT 4NXMT 4GKKT 4JI4T 1N34T 4LFBT 1XNQT 4DR3T 4B3ST 2UUBT 5LMNT 2UU9T 2UXBT 1HNZT 4KHPT 1FJGT 1N33T 4DV3T 4K0KT 4JI5T 4JYAT 4X65T 1HNWT 4DV6T 4DV4T 4GKJT 4JV5T 1HR0T 4X64T 2F4VT 4JI8T 2VQET 4DUZT 4B3RT 4DV7T 4DV5T 4DR7T 4X62T 4AQYT 1IBKT 4LF8T 2UUCT 4YHHT 4LF5T 3T1HT 2E5LT 4DR1T 4LFAT 3T1YT 4LF6T 4LF9T 4DR4T 1I94T 4JI1T 1XMQT 2HHHT 4B3MT 4LF7T 4LF4T 2ZM6T 5BR8T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC T;  2UUA T;  4JI2 T;  1N36 T;  4B3T T;  4DV1 T;  2UXD T;  4DV0 T;  4JI6 T;  4JI3 T;  4DR5 T;  4DV2 T;  1N32 T;  4DR2 T;  4DR6 T;  4X66 T;  4JI0 T;  1J5E T;  4OX9 T;  3OTO T;  2VQF T;  1HNX T;  5LMU T;  1XMO T;  4YY3 T;  1XNR T;  2UXC T;  1IBL T;  5IWA T;  4NXN T;  4DUY T;  4JI7 T;  1IBM T;  4NXM T;  4GKK T;  4JI4 T;  1N34 T;  4LFB T;  1XNQ T;  4DR3 T;  4B3S T;  2UUB T;  5LMN T;  2UU9 T;  2UXB T;  1HNZ T;  4KHP T;  1FJG T;  1N33 T;  4DV3 T;  4K0K T;  4JI5 T;  4JYA T;  4X65 T;  1HNW T;  4DV6 T;  4DV4 T;  4GKJ T;  4JV5 T;  1HR0 T;  4X64 T;  2F4V T;  4JI8 T;  2VQE T;  4DUZ T;  4B3R T;  4DV7 T;  4DV5 T;  4DR7 T;  4X62 T;  4AQY T;  1IBK T;  4LF8 T;  2UUC T;  4YHH T;  4LF5 T;  3T1H T;  2E5L T;  4DR1 T;  4LFA T;  3T1Y T;  4LF6 T;  4LF9 T;  4DR4 T;  1I94 T;  4JI1 T;  1XMQ T;  2HHH T;  4B3M T;  4LF7 T;  4LF4 T;  2ZM6 T;  5BR8 T; 
#chains in the Genus database with same CATH topology
 2VKJ A;  4FI5 A;  1V9D A;  4TUY E;  5AQI B;  2XQ8 A;  2WWV A;  5LP6 E;  2KIN B;  5GON E;  2QVA A;  1AJ3 A;  2HPJ A;  2NTY A;  4CI2 B;  1HG2 A;  4BJN A;  1WFD A;  4B3T T;  1E1H B;  1WYC A;  5L4H A;  3JAE A;  5HWY A;  4F6R C;  3L3P A;  1NAF A;  1MNE A;  4HFB A;  4IE6 A;  5AQG B;  4KUM B;  5JH7 E;  2BDE A;  2OV9 A;  2EHO B;  3KBT A;  2WMN A;  4HWI B;  2VB6 A;  4N78 D;  4ZEY A;  4COF A;  4JI6 T;  2XQY A;  4IDO A;  3P4R A;  4U33 A;  2XM2 A;  4ZZC A;  5F3J A;  1Z8U A;  5AQR B;  1NEN A;  4M1P A;  3MZK B;  3VHL A;  2LLY A;  2LKG A;  2NW7 A;  2JQK A;  2X9X A;  3CX6 B;  2ODV A;  1VCS A;  3HKC E;  3OVU A;  3UFE A;  1N32 T;  3AA1 B;  5LCY A;  3R6N A;  3S4U A;  4DR2 T;  2AXD S;  4IDZ A;  2WMO A;  2WY2 A;  4O8S A;  2BVL A;  2YK0 A;  1HX8 A;  4Z91 A;  2X51 A;  2DNX A;  4TZ4 C;  2N1G A;  4NIQ A;  5IHY A;  3RRC A;  4X66 T;  1KF6 A;  3SRZ A;  1OED C;  4JLE A;  3I0Q A;  5LNK A;  4ZZB A;  4ANJ A;  2IUB A;  1SA0 E;  4AKR B;  4JI0 T;  4IE0 A;  1FEW A;  1R8I A;  2N9D A;  2X9Y A;  2XQ7 A;  3JAF A;  3K3N A;  4X1K E;  3FXE B;  5DQW A;  3KBU A;  3NBX X;  5EK4 A;  4BAY B;  2KSR A;  5FL1 A;  3QK6 A;  3RIF A;  2K9A A;  5IWA T;  4HE8 A;  2XAQ B;  2YEV C;  4KMC A;  4DUY T;  2W61 A;  1IBM T;  4JI7 T;  3SFE A;  4PJN A;  5L2L A;  2JQH A;  5DJQ C;  5LA6 E;  3P4Q A;  3ZC1 A;  4CQI A;  4I43 B;  4MLK A;  5TAO A;  2ZM8 A;  1G8X A;  4HKA A;  5FY1 A;  5KDM C;  2E9X C;  5KX5 E;  3Q5D A;  1MMA A;  2KMF A;  3KV6 A;  3AA7 B;  3QB5 A;  4O2B E;  2J47 A;  3C98 B;  3N9P A;  3A7M A;  3ABV A;  4UVA B;  2LSI A;  2KWI B;  2XQA A;  2D2S A;  3AE8 A;  3RIU C;  4HGA A;  2WDV A;  2V7K A;  1UUR A;  3UU3 A;  4OK0 A;  3CWZ B;  4KHP T;  1SUM B;  2JJ9 A;  2W2U A;  3LSV A;  3J7Y q;  2JMH A;  3UU4 A;  2NW8 A;  3KIN B;  1U5P A;  3UUM A;  4LMJ A;  5JR9 B;  1M7K A;  2CXF A;  1YD8 G;  3DJB A;  5J2U E;  1HG5 A;  3PUA A;  4EED A;  2XJ7 A;  2H3R A;  2NWB A;  2RA1 A;  1BR4 A;  2KT9 A;  4UR9 A;  5EZY E;  3RYC E;  3ZPO A;  4DID B;  5HXE A;  4GKJ T;  4OYJ A;  3ZN0 B;  1HR0 T;  3QB5 K;  4X64 T;  1QLB A;  3PUR A;  3MJX A;  1I6Z A;  5ABF B;  1MND A;  3M3Z B;  4YT0 A;  5HAX A;  4DUZ T;  4B3R T;  1WR0 A;  3OJA A;  4IST A;  3AVS A;  2K3W A;  4IL9 A;  3VR9 A;  3CVR A;  4AQG A;  4HWF A;  4DR7 T;  4YLH A;  5LGU B;  4X1Y E;  2KZ7 B;  5LJN A;  4F8H A;  2V7L A;  2KWH A;  5HEG A;  4MFR A;  4AQY T;  1HF8 A;  1XWM A;  3ETV A;  3AEB A;  2A2F X;  3HI2 A;  3RGL A;  2QGS A;  3ZSS A;  2H7V C;  3SOL A;  4DBQ A;  4LF5 T;  2IIU A;  4TX5 A;  3PJA A;  4ZI7 E;  2JQQ A;  3NVO A;  4H63 H;  4DR1 T;  4G2A A;  4K0U A;  3T1Y T;  3RRW A;  3IHR A;  3AE2 A;  1MIW A;  2CM0 A;  1X9B A;  2WDQ A;  2HN1 A;  3B13 A;  3I9W A;  2E8I A;  4IGU A;  4OFZ A;  4OYK A;  5LGN B;  4LF6 T;  3HA4 A;  2VKD A;  3AA6 B;  4A56 A;  3HKE E;  4X5T A;  5JDF A;  4IDP A;  5C2T A;  1UUS A;  4WYV A;  3R84 B;  3ZST A;  3D0T A;  4NPP A;  4UVC B;  5EK3 A;  2DLR A;  5HXC A;  4EYU A;  2YIN A;  4ZI2 D;  5CA1 E;  4LF4 T;  3NKZ A;  4CI3 B;  2WZH A;  4YHJ A;  3TLV A;  2AE9 A;  3AAE B;  4OHF A;  3J9X 1;  5L4E A;  4HN9 A;  3EDV A;  1KEY A;  1MMG A;  2E2A A;  4DBR A;  4LFC T;  2RP4 A;  5EK2 A;  3O1I A;  3H3A A;  1KK7 A;  2LSG A;  2A3D A;  4X20 E;  5LOV E;  3U3I A;  4CZZ B;  3LK3 B;  1HS7 A;  3LBX B;  1KFY A;  2BG9 A;  2LSJ A;  2WSS V;  5C8Y E;  5L3C B;  4U31 A;  2V7M A;  4HEA A;  5AQN B;  3AE1 A;  1Y01 A;  2LHN A;  4GK5 E;  2LOP A;  1OED B;  3ZLI A;  2VVS A;  3RI5 A;  5HEJ A;  2Q9Q D;  5HEH A;  2UXX B;  2V6Y B;  4TNV A;  2B1E A;  4QWN B;  3LK2 B;  4DO0 A;  2NW9 A;  2UXD T;  3V5U A;  4DV0 T;  2J4G A;  2LJL A;  4A97 A;  4O4I E;  2XPK A;  4C91 A;  1IZN B;  3L8R A;  3RF1 A;  4JI3 T;  4DR5 T;  2K5B B;  2NR4 A;  1Z0P A;  3FB2 A;  3I0O A;  2ZLY A;  5J0Z A;  4TWD A;  1YKE B;  5L3B B;  3VKG A;  3PV0 F;  5L3E B;  3AEC A;  2CA5 A;  3CIR A;  4XAX B;  3PUW F;  2UXN B;  4U2Z A;  4UF0 B;  2K24 A;  3SS1 A;  1X79 A;  3AED A;  5BR8 T;  2K48 A;  2SPC A;  1HFA A;  2FJE A;  1SE7 A;  3KV4 A;  2JPF A;  4FJO A;  4IE7 A;  3RHW A;  3RLF F;  2LM9 A;  4EYY R;  5CJ5 A;  2WBL A;  2XAG B;  5FMN A;  2EHO A;  5FXX A;  4B6X A;  3TLU A;  3RC8 A;  2BKO A;  2CEA A;  3RQW A;  4JEH B;  3N2K E;  3RC3 A;  4IL4 A;  5JDH A;  3OKQ A;  5LHI B;  4KHZ F;  3OTO T;  4AXP A;  5AQV B;  2VQF T;  1YQ4 A;  4ILA A;  4QXC B;  2CXL A;  4HFI A;  3C51 A;  4YY3 T;  1XMO T;  1XNR T;  1IBL T;  4LML A;  2CBI A;  3P4P A;  2GK9 A;  2EHO C;  3AEF A;  2LE8 A;  1T72 A;  2YKS A;  3F31 A;  3Q9D A;  4TN7 B;  3ZKR A;  5JVD E;  1D0X A;  4NUU A;  4PNI A;  3A8Y C;  1BR1 A;  2CWO A;  2V7I A;  2N2N A;  2WCA A;  3UQ4 A;  4EZ4 A;  4LFB T;  3O1J A;  1OED E;  5HXS A;  5HYA A;  5L3G B;  3RIA A;  1S94 A;  3N9N A;  3OYZ A;  2BS3 A;  2PBI A;  2D0U A;  4CN6 A;  4X1I E;  2MAW A;  2QYW A;  2LSK A;  3CML A;  3H37 A;  3PUY F;  4YSZ A;  5JDG A;  2DCF A;  4PK5 A;  3PUG A;  4JBW F;  3WI3 A;  4IRE A;  5JDM A;  3JCF A;  4ZXL A;  3EVY A;  4WZX A;  4CXY A;  2P9B A;  3U78 A;  1E2A A;  2BG9 C;  2WP9 A;  1OWA A;  3TLT A;  5J1G A;  2ODU A;  3C4X A;  1N33 T;  4H63 V;  4U72 A;  4DVD A;  2C0S A;  2XSA A;  4EOZ B;  4GYS A;  2E9X D;  3E22 E;  2X68 A;  2JMK A;  1ZHC A;  3ZEF B;  2XAJ B;  4HFD A;  3MA9 A;  2ACX A;  2BZB A;  2XQ3 A;  5CGM A;  1LVK A;  4DV6 T;  4YFS A;  1WCR A;  1WRD A;  3A5X A;  3P4W A;  3PUQ A;  4QXB B;  4GIW A;  2PJQ A;  2WQY A;  2VQE T;  1FMV A;  1US7 B;  4ISS A;  5FY7 A;  3VKH A;  1G73 A;  3LK4 2;  2CBJ A;  1M62 A;  2YU2 A;  2BBJ A;  4U2Y A;  1UGO A;  2I0M A;  2NP9 A;  4KX6 A;  2A72 A;  2W4X A;  4ILB A;  3IEE A;  5FP3 A;  3T8O A;  4EAH A;  3UUN A;  1FJG T;  2YDR A;  4LF8 T;  4QX7 B;  2LSY A;  3EAM A;  1J5W A;  3E08 A;  4YHH T;  2CCQ A;  2H7O A;  2R6G F;  4U3C A;  3ZC0 A;  2VAS A;  3ZMU B;  2IC9 A;  3ONJ A;  4P09 A;  3C64 A;  3FHN A;  3ZYL A;  2MYS A;  2FJD A;  3N9Q A;  5FNV E;  4O4H E;  5ABF A;  4HFC A;  3AXJ B;  4PJL A;  4XZC A;  2VKO A;  4I50 E;  4CN1 A;  1HTJ F;  2BG9 B;  2FUP A;  3L39 A;  5A1L A;  3AVR A;  5HCM A;  3ZJ2 A;  5LHG B;  1XMQ T;  2IC6 A;  2VK9 A;  2W63 A;  3CKD A;  3N2G E;  4IIJ E;  1WR6 A;  2Z6E A;  1Y64 B;  2VWA A;  2YDS A;  3VU7 H;  5JQG E;  4CXW A;  5LG4 A;  5HWX A;  3NRX A;  5AQP B;  2XAH B;  3I9Y A;  4U74 A;  5JRC B;  3B5M A;  2PG8 A;  3PDY A;  4LMK A;  4UV8 B;  2OA5 A;  3FBZ A;  5FYM A;  3N9O A;  4UV9 B;  2UUA T;  2YDQ A;  4PAG A;  4H9S E;  1D1A A;  2M67 A;  5LG3 A;  2JRK A;  3QOF A;  2XSB A;  3K1S A;  2XTL A;  4I4T E;  2BKP A;  5H6Q B;  1MIV A;  1L0V A;  4ASK A;  2YOE A;  3UU6 A;  3W15 B;  4DV1 T;  2LHR A;  1T8B A;  4AIU A;  2LT3 A;  3FZM B;  2CE7 A;  2BVM A;  3K3Q C;  3RQU A;  3B57 A;  2RPA A;  3CQX C;  3OYX A;  4QH4 A;  4TWF A;  2J1D G;  4ILC A;  3ZYM A;  1YW0 A;  3PUV F;  4HFV A;  2I6H A;  4YSY A;  2H88 A;  2W00 A;  1CUN A;  5JTG A;  1D1C A;  4ZI3 D;  2MPK A;  3RIU A;  3RYF E;  3ZT7 A;  2IML A;  5L47 A;  2BKN A;  5ETW A;  5L3D B;  4YTP A;  3DP7 A;  5LYJ E;  4DMW A;  2ZM2 A;  2ZM0 A;  4AKG A;  2ACZ A;  4TWH A;  4G63 A;  5KMG P;  5HEO A;  2DWK A;  3HL6 A;  5H6R B;  2D5U A;  4P1N A;  3TKL B;  5ABH A;  3AB3 B;  1UK5 A;  4L9I A;  2WU5 A;  1IJ6 A;  2L9Q A;  2WU2 A;  3F2E A;  3KV9 A;  3CX8 B;  3KVB A;  3NWI A;  3PU3 A;  2X0L B;  3UUX B;  3NZP A;  3ZT6 A;  1W0A A;  5LJM A;  4YXD A;  4OX9 T;  1B7T A;  5LMU T;  2BBH A;  2W66 A;  4QH1 A;  3L09 A;  5FXZ A;  2MOZ A;  3E0Z A;  3MK7 C;  4NXN T;  1QUU A;  2W0G A;  4L0R A;  3AE3 A;  4UF0 A;  4HWH A;  3EAB A;  4CI1 B;  2C5K T;  4PJM A;  2J62 A;  4PK4 A;  3AE9 A;  1N34 T;  2LEH A;  1QSD A;  1J1J A;  4Q25 A;  2Q9Q C;  2C5I T;  4V1A v;  1XNQ T;  4DR3 T;  2LRL A;  5DQV A;  2UUB T;  5LMN T;  1GQE A;  1NEK A;  1W0B A;  2ZMA A;  3CQC B;  5AQU B;  3ZCJ A;  4IT4 A;  2UU9 T;  2XQ9 A;  5AFU L;  4EB6 E;  2WWU A;  1NWM X;  2HN2 A;  3FZL B;  2UXB T;  4A5X A;  3G06 A;  4O2A E;  3ZYK A;  2VKH A;  2WDR A;  3LG7 A;  2E9X B;  3MKD A;  2M6I A;  4QKN A;  4YJ3 E;  3N9M A;  5HEU A;  5L3F B;  4P0B A;  3ZT5 A;  4CXX A;  3RYI E;  3RKG A;  2W67 A;  5LBM A;  4DV3 T;  2LM2 A;  3N2O A;  4IE4 A;  3RH3 A;  4P0A A;  4K0K T;  3FBL A;  3UUB A;  4YJ2 E;  3ZMV B;  2BG9 E;  2DL1 A;  4AQF C;  4A98 A;  4X65 T;  3KFW X;  4PFO A;  4MAL A;  5AQF B;  4JYA T;  1HNW T;  1MMD A;  4ZI2 C;  2V8S V;  3JC6 C;  2W62 A;  4L5G A;  3EUH A;  2L8K A;  4ZS3 A;  3DTO A;  4JI8 T;  2LOS A;  1KNP A;  3AA0 B;  4DV7 T;  2CXD A;  3PJA J;  3LFM A;  2IDO B;  3SFD A;  4DR6 T;  1VCT A;  4X62 T;  2CRB A;  3FXD B;  1LRZ A;  2JQ9 A;  2VUR A;  4TV8 E;  5JDN A;  4AKH A;  1EZ3 A;  1FMW A;  2CPT A;  4UEL A;  2OLT A;  3KV5 A;  1VRB A;  2CHO A;  5AQQ B;  2UUC T;  1ZV4 X;  1U4Q A;  1JNR A;  4UVB B;  2WB5 A;  3QNU A;  5IUX A;  5KXJ A;  3O1H A;  4GYR A;  2E5L T;  5JRC A;  5AQH B;  1CHU A;  1O3X A;  1FIO A;  5BMV E;  4MBQ A;  4WW0 A;  2FBW A;  2X66 A;  3FZK B;  4ADZ A;  5LGT B;  4LF9 T;  5JR9 C;  3EHZ A;  4DR4 T;  3P4S A;  2PFV A;  3MAC A;  4HWD A;  1I94 T;  4JI1 T;  4I0U A;  4DND A;  2I59 A;  3PUS A;  1ZOY A;  4QXH B;  3WAJ A;  3VRA A;  5CB4 E;  3MXZ A;  5LBQ B;  2WM9 A;  4PFP A;  4IDN A;  3Q2M A;  1S35 A;  4Z90 A;  2DI4 A;  2VL8 A;  4ZS2 A;  4LF7 T;  3BQL A;  3CK6 A;  4H9R C;  1VOM A;  2Q9Q A;  2MTQ A;  4I55 E;  1H7C A;  5FL0 A;  2Y6X A;  5IYZ E;  3ZJ1 A;  3X1D A;  3I1A A;  3EI0 A;  3AAA B;  4NUV A;  4WBN E;  2ZM6 T;  2XHE B;  1BR0 A;  4E7Z A;  2BS4 A;  2IAK A;  2XZE A;  3CPZ A;  3JAD A;  3KVA A;  1D1B A;  1OED A;  3CQG B;  2Q9Q B;  1KNZ A;  2KLQ A;  2X9H A;  4UXN B;  3V5S A;  2L3L A;  4JI2 T;  1DU2 A;  2Y8D A;  2NOX A;  3GN5 B;  4U7Y A;  4TV9 E;  4J2C A;  5HXR A;  2X67 A;  1UX5 A;  1N36 T;  4XBF B;  2VL0 A;  3ZMZ B;  3BQK A;  3ETU A;  3RKO A;  1OXZ A;  3FZF B;  5FXV A;  3QC9 A;  4ZHQ E;  3GN5 A;  1XDP A;  4GOU A;  5ABG A;  4O4J E;  3M65 A;  3EDU A;  2MBG A;  5JDL A;  3PU8 A;  3Q5X A;  3GA8 A;  3UT5 E;  4AQF A;  4DMV A;  2DHR A;  2ES0 A;  3ONL C;  3ONX A;  4DV2 T;  1BR2 A;  2XUE A;  3CX7 B;  3OBV E;  3UUL A;  1ZP0 A;  5J2T E;  3C4Z A;  4AIS A;  4WBO A;  3HKD E;  2IW5 B;  4JEU B;  4AKL A;  4E7S A;  4TNW A;  4H9O C;  4ILU A;  4YSX A;  3IA3 A;  1ZEE A;  3UU8 A;  3AEE A;  2FJB A;  4IHJ E;  4Z8X A;  2NTX A;  3PE0 A;  5FKY A;  4PW8 A;  5ADX L;  1HCI A;  1D0Y A;  3VR8 A;  2X9W A;  3LDQ B;  5FVK A;  1W09 A;  3GWH A;  3AE5 A;  1LVF A;  5AQK B;  3ZN1 B;  1J5E T;  1MIY A;  5E0O A;  4U7I A;  3RX6 A;  2D0T A;  3RYH E;  1HNX T;  1ZKE A;  2V5C A;  5HCJ A;  2QA7 A;  4H9P C;  5LXT E;  4KI0 F;  3AE4 A;  2UXC T;  4PJJ A;  3WAK A;  3NRY A;  3NZQ A;  2E9X A;  3UU5 A;  2M6B A;  3AE6 A;  3SWH A;  2XQ6 A;  5HXH A;  1YKH B;  4QX8 B;  2H89 A;  4NXM T;  4GKK T;  1WLX A;  3OPC A;  1IAP A;  3RPU A;  4JI4 T;  2JIW A;  4EXT A;  3JC6 D;  3F57 A;  2EHO D;  4H9Q C;  5AQM B;  4C90 A;  4HFH A;  4B3S T;  2V26 A;  5AQT B;  2G0U A;  2CHN A;  5AQJ B;  2YN6 A;  5LB7 B;  1LKX A;  3UTK A;  2HPL A;  4HTE A;  4KBM B;  2B76 A;  3ZCI A;  1HNZ T;  3KDS E;  1IJ5 A;  2E5V A;  3P8C D;  1KNR A;  2QRX A;  3AE7 A;  5FVL A;  4GK0 E;  3TLS A;  3BQI A;  4YTM A;  2XQ4 A;  2C5J A;  3N5L A;  2WS3 A;  1JNZ A;  2XAF B;  3ANW B;  1UX4 A;  3ZMT B;  4BA9 A;  4EGW A;  3PUZ F;  1W9R A;  3AEG A;  4UIG A;  2D9D A;  5AQS B;  4ZI3 C;  1SHZ C;  2A9U A;  2XY8 B;  3C4W A;  1MMN A;  2LKH A;  4BJM A;  4AKI A;  2XM1 A;  2FJA A;  5F8P A;  2CWY A;  4JI5 T;  5JRE A;  4HFE A;  3ANW A;  3O9X A;  4JUY A;  4QH5 A;  5F5W A;  2CLY B;  3K8P C;  5FXW A;  5CFB A;  1HX1 B;  1WYB A;  1YXR A;  5AQO B;  3ZMS B;  4ERR A;  2Y48 B;  1YQ3 A;  4DV4 T;  4JV5 T;  2DWG A;  2F4V T;  2X0Y A;  5ABE A;  3K3O A;  3P50 A;  4IDQ A;  2BS2 A;  1XZY A;  3PTR B;  2CMR A;  4KP3 C;  4MHC A;  3IBP A;  2V1D B;  2X0H A;  3UQ7 A;  4DV5 T;  2XQ5 A;  3P7I A;  3HR0 A;  2CLY C;  3GMI A;  5M4Y A;  5JR9 A;  5CA0 E;  1D0Z A;  1IBK T;  2XAS B;  5AQL B;  3ESL A;  3IF8 B;  3PUX F;  3LJC A;  2WAU A;  4EZH A;  3QUJ A;  3T1H T;  4LFA T;  4ZOL E;  4IE5 A;  4CN4 A;  4H9N C;  2V7J A;  4AI6 A;  1T98 A;  5LHH B;  3N9L A;  4O4L E;  3TLW A;  2KND A;  3HKB E;  2HH7 A;  2YU1 A;  3FZH B;  3LBX A;  3VRB A;  3UFG A;  5JDQ A;  2V5D A;  5DAB A;  5FY0 A;  1T7S A;  3Q5E A;  2HHH T;  1UCU A;  4WNK A;  4YTN A;  4B3M T;  3AAI A;  4EIW A;  5C3J A;  3BK9 A;  3AXJ A;  3Q5W A;  4UEM A;  3H3M A;  4EEB A;  2VVN A;  2V6Y A;  2WZI A;  4PK6 A;  4EV6 A;  3AEA A;  1XDO A;  2LRK A;  2PTF A;  3C50 A;  1E7P A;  3O4X E;  4QHO A;  2V6X A;  2IHR 1;  2KXP B;  4HWC A; 
#chains in the Genus database with same CATH homology
 4LFC T;  2UUA T;  4JI2 T;  1N36 T;  4B3T T;  4DV1 T;  2UXD T;  4DV0 T;  4JI6 T;  4JI3 T;  4DR5 T;  4DV2 T;  1N32 T;  4DR2 T;  4DR6 T;  4X66 T;  4JI0 T;  1J5E T;  4OX9 T;  3OTO T;  2VQF T;  1HNX T;  5LMU T;  1XMO T;  4YY3 T;  1XNR T;  2UXC T;  1IBL T;  5IWA T;  4NXN T;  4DUY T;  4JI7 T;  1IBM T;  4NXM T;  4GKK T;  4JI4 T;  1N34 T;  4LFB T;  1XNQ T;  4DR3 T;  4B3S T;  2UUB T;  5LMN T;  2UU9 T;  2UXB T;  1HNZ T;  4KHP T;  1FJG T;  1N33 T;  4DV3 T;  4K0K T;  4JI5 T;  4JYA T;  4X65 T;  1HNW T;  4DV6 T;  4DV4 T;  4GKJ T;  4JV5 T;  1HR0 T;  4X64 T;  2F4V T;  4JI8 T;  2VQE T;  4DUZ T;  4B3R T;  4DV7 T;  4DV5 T;  4DR7 T;  4X62 T;  4AQY T;  1IBK T;  4LF8 T;  2UUC T;  4YHH T;  4LF5 T;  3T1H T;  2E5L T;  4DR1 T;  4LFA T;  3T1Y T;  4LF6 T;  4LF9 T;  4DR4 T;  1I94 T;  4JI1 T;  1XMQ T;  2HHH T;  4B3M T;  4LF7 T;  4LF4 T;  2ZM6 T;  5BR8 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...