2UUBT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uubT00
4YHHT 2UXBT 1HNZT 4GKKT 4DV6T 4LF8T 1XNRT 4DUZT 4B3RT 1HNXT 4JI4T 1N33T 5LMNT 2UXDT 4K0KT 4YY3T 4LF6T 4JI3T 1XMOT 2UUAT 4OX9T 5IWAT 2UUCT 4KHPT 5BR8T 1I94T 4DV5T 4JV5T 4DR3T 1XMQT 2VQFT 1N36T 4DV1T 4NXNT 4LFAT 1FJGT 2UUBT 4DV0T 4X64T 4JI0T 4DR6T 4DR4T 4DV7T 4LF7T 1XNQT 1J5ET 4LFBT 4B3ST 1HR0T 4X66T 1IBKT 2VQET 4AQYT 4DR7T 2F4VT 3T1HT 4LFCT 1HNWT 2ZM6T 2UU9T 4JI5T 4DR2T 4DV4T 3T1YT 4JI7T 4JI8T 4LF9T 4JYAT 4JI2T 4LF5T 4B3MT 4GKJT 1N32T 2HHHT 4X62T 1IBLT 4JI1T 4LF4T 5LMUT 4DR1T 1N34T 4X65T 4DR5T 4JI6T 3OTOT 1IBMT 4DV2T 2E5LT 4B3TT 4NXMT 2UXCT 4DV3T 4DUYT
chains in the Genus database with same CATH superfamily
2D0TA 3PUAA 2BZBA 1XNRT 3O9XA 5E0OA 3EABA 1XZYA 3Q5XA 2PG8A 1YW0A 5AQGB 3RKGA 5IHYA 1UUSA 5HEGA 1FEWA 2EHOB 2W2UA 2X67A 1GQEA 4OK0A 2VASA 2LSYA 3N9LA 2K48A 5EK4A 1NWMX 1FMVA 4LF7T 1Y64B 1UX5A 3I9WA 4LFBT 3OJAA 2NP9A 1D1AA 3A7MA 3S4UA 2VL0A 3AA7B 4WW0A 4H9QC 2HH7A 3NZPA 4DR7T 4YHJA 1KEYA 2BKOA 4LFCT 4EZHA 2W63A 2LSJA 5IUXA 5L4HA 5LYJE 4AI6A 3N2GE 4EB6E 4JI7T 4H9SE 3K3OA 4JEHB 2WDVA 2XUEA 2ODVA 4HFHA 3RQUA 4OYJA 2A9UA 4DNDA 2CBIA 4AIUA 1SE7A 5JREA 2CWYA 2KINB 4HKAA 2I59A 5AQIB 4Z91A 3RI5A 1XDPA 4YJ2E 5BMVE 2XQ9A 4IL9A 2L3LA 2X66A 5KMGP 5KXJA 5AQKB 1T7SA 4H9RC 5H6QB 3RYHE 1L0VA 3LG7A 3ZT6A 3JAFA 5CGMA 4O2AE 4X1KE 4WNKA 4U33A 4EV6A 4TV9E 3OBVE 3C50A 3UU4A 3ZPOA 3K3QC 2WWVA 3NZQA 2A3DA 4KBMB 1YKEB 2VQFT 1N36T 2LM2A 2WU2A 4LFAT 2JMHA 2V26A 3LSVA 3CMLA 5L3GB 2D2SA 4X1IE 2ZM8A 4YLHA 3RYCE 3HKDE 2WBLA 2QRXA 4ASKA 2VQET 3LBXB 3SOLA 4CI3B 1ZP0A 2V5CA 2X68A 3ONXA 4YSYA 2HN2A 5LHIB 5DABA 5FL0A 4JYAT 2WAUA 2PFVA 2LSGA 4QXBB 4B3MT 2QYWA 1O3XA 4EIWA 3BQIA 3C4WA 3ZN0B 4DR5T 4JI6T 3OTOT 4HFVA 4J2CA 1CUNA 5LXTE 2PJQA 2UXCT 5EK3A 4C91A 4DMWA 4HN9A 5HAXA 5LP6E 1FIOA 1OWAA 4JI4T 5HXHA 4IHJE 4K0KT 2CMRA 4CXWA 4YY3T 2LKGA 1IJ6A 5BR8T 2CHNA 5CJ5A 1T8BA 5FNVE 5HEJA 5AQPB 5KDMC 4P1NA 4DIDB 1WRDA 4L5GA 3KDSE 3AXJA 3AE6A 3H3MA 1M7KA 4C90A 1WYCA 4TUYE 3K8PC 3PJAA 5HEOA 1HNWT 2QA7A 4DBRA 5AQQB 1US7B 2LSIA 5M4YA 2E8IA 2X0YA 4KX6A 3L8RA 2OA5A 3CWZB 4Z90A 4ILUA 3ZMTB 5JDMA 3AA6B 3ZYKA 5L2LA 3NRXA 4LF4T 3N2KE 4G63A 3GN5A 4AQFC 2CWOA 3NWIA 3AEEA 3CX7B 3RIAA 2XAFB 4NUVA 1HNZT 2H7VC 5HXRA 3FXDB 3RIUC 2CE7A 4ANJA 4GK0E 3Q5EA 1E7PA 2C0SA 5IWAT 3AA1B 4IT4A 4IDZA 1J5WA 2NTYA 4IE0A 2DL1A 3AECA 4GYRA 3PUWF 3F57A 3RIFA 5JR9A 4IDPA 2YKSA 4WBNE 3AXJB 3WAKA 3EAMA 3VR8A 2Y8DA 2DLRA 1ZOYA 4WYVA 3AEAA 2CPTA 2Z6EA 5HYAA 1VOMA 5DQWA 3ZJ2A 3E08A 3UT5E 2XQ8A 3T8OA 3SFEA 3UUXB 5HEHA 4BAYB 4ILAA 2K5BB 2W62A 2NOXA 2CXDA 3KFWX 4HWCA 2BS2A 5AQTB 2BS4A 4YSZA 4DR1T 2KWHA 4IIJE 3GN5B 4AKRB 1VCTA 4BJNA 2MAWA 5HCMA 2VK9A 3MJXA 3HA4A 4MALA 4DUYT 3P4SA 3IBPA 1HF8A 2XY8B 3BQKA 4B3RT 3HKCE 4U2ZA 2IIUA 2IAKA 4GOUA 4M1PA 2VKJA 3QOFA 2DWGA 3TLWA 4CXYA 3AE7A 2L9QA 3CKDA 2V6YB 2MYSA 3KV6A 2K9AA 2V7KA 2V8SV 3ABVA 4HWDA 3RIUA 2ODUA 4E7SA 5JR9B 4ZEYA 3PUQA 3CPZA 3RKOA 2Q9QC 2CEAA 4X66T 4IDQA 3ZMVB 1VRBA 2N1GA 2X9XA 3PV0F 4EAHA 3MACA 2LM9A 3T1HT 4I55E 4COFA 4IDNA 4QHOA 1KNPA 3QUJA 3QNUA 2N9DA 4HWIB 3UUNA 1QLBA 2XTLA 4ZI2C 2LKHA 4UV8B 1T72A 1UURA 2J4GA 2ZM2A 2FBWA 3PUGA 3LK3B 2XM1A 4CI1B 2XQYA 2NW9A 2Y48B 4U7YA 1N34T 2ACZA 1WLXA 5L3BB 2LOPA 2XJ7A 1ZHCA 2E5LT 3VHLA 3H3AA 3U78A 2XM2A 4DV6T 2BG9C 5ABHA 2VB6A 4NPPA 2JQKA 3IF8B 2FUPA 4UXNB 1UK5A 4CN6A 5AFUL 2W0GA 1OEDB 3C4XA 3I9YA 1FJGT 3GWHA 3FB2A 1Y01A 2SPCA 1OXZA 5LHHB 2E2AA 5ABFA 3FBZA 1YQ3A 1W0BA 3F2EA 3RRWA 2WSSV 1HFAA 3EUHA 3IHRA 4DBQA 5FY1A 3WAJA 2V1DB 2E9XC 3ANWA 1MNEA 4DO0A 5LA6E 4L9IA 2KWIB 5DJQC 2IUBA 3AAEB 5LB7B 4JEUB 2ZLYA 1U4QA 3JADA 2BS3A 2G0UA 4QX7B 1T98A 4KUMB 2J1DG 1N32T 2NWBA 4HWHA 2VL8A 5ETWA 2I0MA 2LT3A 3JCFA 1VCSA 1IBMT 4DV2T 1MMAA 5TAOA 2X51A 4TNVA 5LBMA 4DV3T 2CLYC 2BVLA 3L3PA 3OYZA 5L4EA 3LFMA 5F5WA 3ZMSB 4X5TA 3JC6C 4OFZA 5LMNT 4H9PC 3ZEFB 4JI3T 2UUAT 5J0ZA 1HG5A 3Q5WA 5AQVB 3ESLA 4KHPT 5LGNB 1LVKA 4ERRA 4DV1T 2LOSA 4AISA 3L09A 4I0UA 2BG9A 4XAXB 4DR4T 3P8CD 5ABFB 4U3CA 4ZOLE 2XZEA 4DV7T 5JDLA 1XNQT 5JDQA 4YTPA 1MIYA 3AE9A 5J1GA 2H7OA 4TWHA 3A8YC 1BR0A 2W00A 2DNXA 3AVSA 1YKHB 3OPCA 2XQ5A 2NTXA 2WS3A 4UEMA 3ZN1B 3AEFA 2KMFA 3C64A 2X9YA 5L3EB 4PK6A 3GMIA 3RQWA 1ZV4X 2VWAA 4CXXA 4HFCA 5EZYE 5F8PA 4UVCB 3ZLIA 1MMNA 5AQUB 2WDQA 1YQ4A 3KBUA 4HE8A 4LMLA 2MPKA 4XZCA 4H63H 4DMVA 4PJMA 2J47A 1E1HB 4AKHA 3ZC1A 2WZIA 3HKBE 2B76A 5KX5E 3I0QA 1OEDE 3N9QA 3CVRA 3UU3A 3N9NA 3ZMZB 2ES0A 5JRCA 3VKGA 5HWYA 4HFBA 2CHOA 2V7JA 2A2FX 3TLTA 4OX9T 1J1JA 5HXCA 5LCYA 1X9BA 1WR0A 2JQ9A 1WYBA 3M3ZB 3AEGA 2LHRA 3SRZA 1SUMB 4TNWA 1UGOA 1D1CA 3SWHA 2H89A 1SHZC 5FY0A 4O8SA 5HXSA 4UIGA 4YT0A 4KHZF 5LOVE 4QXHB 1S94A 4PW8A 2UU9T 5EK2A 1LRZA 2XAQB 3Q5DA 4HTEA 4TWDA 3KVBA 2KT9A 2XAGB 3P4WA 2RP4A 5CA1E 3VRBA 4PAGA 4UR9A 2IC6A 5AQSB 5FVKA 5FXXA 3LJCA 1WR6A 2HHHT 4X62T 1W0AA 2YOEA 3K1SA 4CQIA 4F8HA 2XQAA 2A72A 3FZFB 1EZ3A 4IDOA 2CXLA 3HKEE 2MTQA 2YK0A 2VKDA 3ZCJA 3JAEA 2BKPA 2JQQA 4HEAA 2D5UA 4ZXLA 3Q2MA 5LG4A 3KV4A 3EDUA 2V7MA 5JRCB 3RC8A 3AE2A 3UULA 1XWMA 2MOZA 2VKOA 5FL1A 4IE7A 2IC9A 4BJMA 5FMNA 1XMQT 4A56A 3AE5A 3EI0A 5H6RB 1HG2A 3QB5K 3B13A 1J5ET 2PBIA 3CIRA 2FJAA 1HR0T 3LK2B 3UUBA 2KSRA 1IBKT 3OKQA 3MXZA 1KF6A 3UU8A 3RYFE 4PK5A 2C5IT 4LMKA 3LK42 4DV4T 4B6XA 3N5LA 2V5DA 2CBJA 4YJ3E 4LF9T 2AXDS 4PNIA 4ZHQE 4LF5T 5J2UE 1JNZA 3RYIE 2EHOC 3UTKA 2YDQA 1ZEEA 4CZZB 1BR1A 3B57A 3FZLB 2HPLA 2ZMAA 5AQLB 4F6RC 5JH7E 3O1HA 3PUXF 4EEDA 4AKGA 4PK4A 2WB5A 2DI4A 3H37A 5JDFA 5LGUB 1H7CA 2UXXB 4KMCA 2YEVC 4GIWA 4LF8T 1IAPA 3HR0A 3V5SA 3RC3A 1N33T 2HPJA 2D0UA 2M6IA 2FJDA 2XSBA 1E2AA 4ZI7E 4P0AA 4TZ4C 3D0TA 2P9BA 1MIWA 3P7IA 2CXFA 1D0XA 1I94T 3M65A 4PFPA 1CHUA 3VRAA 4OYKA 2UUBT 4NUUA 3DJBA 3W15B 4AQFA 2XQ4A 4B3ST 5L3CB 2Q9QD 4A97A 2WU5A 2XASB 4L0RA 3V5UA 2K3WA 4KP3C 4A98A 2LSKA 3MK7C 3MKDA 1NENA 1WFDA 2VVSA 2VKHA 5AQJB 3N9PA 2ACXA 4ILCA 4ZI2D 2WY2A 4ADZA 2LRLA 3KINB 2LHNA 1I6ZA 3RF1A 4YTMA 3ZSTA 3R84B 1BR2A 1NAFA 2JRKA 4H9NC 1NEKA 3AB3B 5LJNA 3P4PA 1DU2A 3VKHA 1KNZA 2UXBT 3ONJA 4QWNB 4GKKT 2XQ3A 4WZXA 3PE0A 3AE8A 3BK9A 4I4TE 1G8XA 3UU5A 2QGSA 2WWUA 4MLKA 3FBLA 2WZHA 1W09A 4JV5T 4DR3T 5LG3A 4DV0T 3ZMUB 4EYYR 4HWFA 2BKNA 3CX8B 4JI0T 5C3JA 4IE6A 5FYMA 3N9MA 5FVLA 2OLTA 5AQHB 3PU8A 5A1LA 2F4VT 4MHCA 3TKLB 4YFSA 3O1JA 4GK5E 2E9XD 4CN1A 4DR2T 3T1YT 3EVYA 3PUSA 4EYUA 4JI8T 3ETUA 3TLVA 4O2BE 5AQRB 1KNRA 4H9OC 1WCRA 5JDGA 2CA5A 4YTNA 2HN1A 3OYXA 5ADXL 4EXTA 1IBLT 4JI1T 3AAAB 2RPAA 5LJMA 2MBGA 4ZS2A 1MIVA 3I0OA 3ZKRA 2YINA 5CFBA 2Q9QA 2YDSA 3CQXC 1UX4A 1IZNB 2V6XA 3RGLA 4G2AA 1G73A 1HNXT 3JC6D 1IJ5A 5AQFB 2E5VA 2UXNB 5JVDE 3NRYA 2X0LB 1FMWA 3AEBA 3LBXA 2LRKA 1XDOA 2WDRA 4JLEA 4DVDA 4U7IA 4NXNT 3UUMA 3PU3A 3PUVF 4I50E 4IE5A 4IL4A 1JNRA 2VVNA 3E22E 4U74A 2NR4A 4ZS3A 5CA0E 5FXVA 3FZKB 2FJEA 2VURA 3QK6A 4O4HE 1V9DA 2I6HA 3PURA 3N2OA 2ZM6T 5J2TE 2N2NA 3PDYA 3SS1A 2IHR1 3ZT5A 2FJBA 1D0YA 4PFOA 4V1Av 4NIQA 3AAIA 4MFRA 1HCIA 4MBQA 1W9RA 5IYZE 2W4XA 1S35A 2D9DA 4QH1A 4HFDA 3CK6A 3WI3A 4EGWA 3P4QA 1KK7A 3ANWB 3PUZF 2ZM0A 3TLSA 3NKZA 3I1AA 2WMNA 3X1DA 4AKLA 2Q9QB 5FKYA 4P09A 1U5PA 2E9XA 3AEDA 2YU1A 3J7Yq 4DUZT 3UQ7A 4TN7B 3NVOA 3C98B 3IA3A 4PJJA 3PJAJ 2BBJA 5C8YE 3ONLC 3CQGB 3ZYMA 4QXCB 3B5MA 2JJ9A 5L47A 5C2TA 2V7IA 3SFDA 2W61A 2M67A 2WQYA 2LE8A 2CRBA 3UQ4A 1UCUA 3DP7A 1AJ3A 3PTRB 2BG9B 2C5KT 3RX6A 4FI5A 1YXRA 2RA1A 3A5XA 3ZT7A 4ZI3D 4TX5A 2NW8A 4HFIA 3K3NA 1LVFA 2JIWA 5FXWA 1HX1B 5JR9C 3F31A 3QB5A 3AVRA 4BA9A 5JDHA 3IEEA 2AE9A 3P4RA 4UV9B 3PUYF 2LLYA 4ZI3C 3ETVA 3Q9DA 3VR9A 2E9XB 3ZC0A 4Q25A 2X0HA 2C5JA 3R6NA 4OHFA 4UELA 3AE1A 2IW5B 1D0ZA 2KLQA 3OVUA 1B7TA 4ILBA 3RHWA 3ZYLA 3RLFF 3UU6A 1M62A 4DR6T 4IREA 2L8KA 4H63V 3RRCA 2H3RA 3KV9A 5JDNA 4U72A 4QH5A 4QH4A 4TV8E 4I43B 3AE4A 2M6BA 4AQYT 2CLYB 1YD8G 4UF0A 2X9WA 2KXPB 3LDQB 5CB4E 3RH3A 3UFGA 3J9X1 4ZZBA 4P0BA 3HL6A 2XHEB 2XSAA 4Z8XA 4GYSA 2XPKA 1OEDC 4KI0F 4CI2B 2BBHA 2GK9A 3EDVA 2EHOD 1KFYA 2YDRA 4FJOA 2H88A 3O4XE 3QC9A 4X65T 5LBQB 2JPFA 1SA0E 1QUUA 2W66A 3MA9A 1HX8A 4ZZCA 3AA0B 2W67A 5HEUA 4NXMT 4IE4A 3ZCIA 4AXPA 4YHHT 3BQLA 2KZ7B 2V6YA 4CN4A 3L39A 1HS7A 4AQGA 2WCAA 4QX8B 4IGUA 4LF6T 3RPUA 5JTGA 2KNDA 2JMKA 4O4JE 4TWFA 2YU2A 1R8IA 2XAHB 4A5XA 4ISTA 4JUYA 3CX6B 4O4IE 2BG9E 4UVBB 2PTFA 4WBOA 5HCJA 5HWXA 1MNDA 4O4LE 5JQGE 2OV9A 3AE3A 1HTJF 3U3IA 2B1EA 2WMOA 4EZ4A 5HXEA 1X79A 4UF0B 1BR4A 3NBXX 3CQCB 5ABGA 2V7LA 5F3JA 3DTOA 3UFEA 2DWKA 4XBFB 2DHRA 1MMGA 1QSDA 4X1YE 5L3DB 5ABEA 3KV5A 4PJLA 2QVAA 3ZSSA 2DCFA 4JBWF 4LMJA 3G06A 2XQ7A 3FXEB 4YSXA 1OEDA 5LHGB 1LKXA 2JQHA 2XAJB 1D1BA 5AQNB 2NW7A 2UXDT 4U2YA 2YN6A 1Z0PA 2BVMA 3EHZA 5AQOB 1XMOT 2UUCT 4PJNA 3C51A 4QKNA 2LEHA 5LNKA 2EHOA 4DV5T 2IDOB 3FZHB 3MZKB 4EOZB 3TLUA 4U31A 4X64T 2XQ6A 4N78D 3KVAA 4ISSA 3P50A 2CCQA 5FP3A 3O1IA 1MMDA 1ZKEA 2WP9A 5LGTB 4X20E 2Y6XA 2CM0A 4JI5T 3HI2A 4YXDA 5GONE 4K0UA 2LJLA 3GA8A 2WM9A 4E7ZA 4JI2T 3FZMB 3E0ZA 4GKJT 3KBTA 4HGAA 5DQVA 2J62A 3N9OA 5FXZA 2BDEA 3FHNA 5L3FB 4HFEA 1Z8UA 3VU7H 5FY7A 5LMUT 3ZJ1A 2IMLA 3C4ZA 2R6GF 4EEBA 4UVAB 2K24A 5AQMB 2X9HA 4B3TT 4AKIA
chains in the Genus database with same CATH topology
4YHHT 2UXBT 1HNZT 4GKKT 4DV6T 4LF8T 1XNRT 4DUZT 4B3RT 1HNXT 4JI4T 1N33T 5LMNT 2UXDT 4K0KT 4YY3T 4LF6T 4JI3T 1XMOT 2UUAT 4OX9T 5IWAT 2UUCT 4KHPT 5BR8T 1I94T 4DV5T 4JV5T 4DR3T 1XMQT 2VQFT 1N36T 4DV1T 4NXNT 4LFAT 1FJGT 2UUBT 4DV0T 4X64T 4JI0T 4DR6T 4DR4T 4DV7T 4LF7T 1XNQT 1J5ET 4LFBT 4B3ST 1HR0T 4X66T 1IBKT 2VQET 4AQYT 4DR7T 2F4VT 3T1HT 4LFCT 1HNWT 2ZM6T 2UU9T 4JI5T 4DR2T 4DV4T 3T1YT 4JI7T 4JI8T 4LF9T 4JYAT 4JI2T 4LF5T 4B3MT 4GKJT 1N32T 2HHHT 4X62T 1IBLT 4JI1T 4LF4T 5LMUT 4DR1T 1N34T 4X65T 4DR5T 4JI6T 3OTOT 1IBMT 4DV2T 2E5LT 4B3TT 4NXMT 2UXCT 4DV3T 4DUYT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH T;  2UXB T;  1HNZ T;  4GKK T;  4DV6 T;  4LF8 T;  1XNR T;  4DUZ T;  4B3R T;  1HNX T;  4JI4 T;  1N33 T;  5LMN T;  2UXD T;  4K0K T;  4YY3 T;  4LF6 T;  4JI3 T;  1XMO T;  2UUA T;  4OX9 T;  5IWA T;  2UUC T;  4KHP T;  5BR8 T;  1I94 T;  4DV5 T;  4JV5 T;  4DR3 T;  1XMQ T;  2VQF T;  1N36 T;  4DV1 T;  4NXN T;  4LFA T;  1FJG T;  2UUB T;  4DV0 T;  4X64 T;  4JI0 T;  4DR6 T;  4DR4 T;  4DV7 T;  4LF7 T;  1XNQ T;  1J5E T;  4LFB T;  4B3S T;  1HR0 T;  4X66 T;  1IBK T;  2VQE T;  4AQY T;  4DR7 T;  2F4V T;  3T1H T;  4LFC T;  1HNW T;  2ZM6 T;  2UU9 T;  4JI5 T;  4DR2 T;  4DV4 T;  3T1Y T;  4JI7 T;  4JI8 T;  4LF9 T;  4JYA T;  4JI2 T;  4LF5 T;  4B3M T;  4GKJ T;  1N32 T;  2HHH T;  4X62 T;  1IBL T;  4JI1 T;  4LF4 T;  5LMU T;  4DR1 T;  1N34 T;  4X65 T;  4DR5 T;  4JI6 T;  3OTO T;  1IBM T;  4DV2 T;  2E5L T;  4B3T T;  4NXM T;  2UXC T;  4DV3 T;  4DUY T; 
#chains in the Genus database with same CATH topology
 2D0T A;  3PUA A;  2BZB A;  1XNR T;  3O9X A;  5E0O A;  3EAB A;  1XZY A;  3Q5X A;  2PG8 A;  1YW0 A;  5AQG B;  3RKG A;  5IHY A;  1UUS A;  5HEG A;  1FEW A;  2EHO B;  2W2U A;  2X67 A;  1GQE A;  4OK0 A;  2VAS A;  2LSY A;  3N9L A;  2K48 A;  5EK4 A;  1NWM X;  1FMV A;  4LF7 T;  1Y64 B;  1UX5 A;  3I9W A;  4LFB T;  3OJA A;  2NP9 A;  1D1A A;  3A7M A;  3S4U A;  2VL0 A;  3AA7 B;  4WW0 A;  4H9Q C;  2HH7 A;  3NZP A;  4DR7 T;  4YHJ A;  1KEY A;  2BKO A;  4LFC T;  4EZH A;  2W63 A;  2LSJ A;  5IUX A;  5L4H A;  5LYJ E;  4AI6 A;  3N2G E;  4EB6 E;  4JI7 T;  4H9S E;  3K3O A;  4JEH B;  2WDV A;  2XUE A;  2ODV A;  4HFH A;  3RQU A;  4OYJ A;  2A9U A;  4DND A;  2CBI A;  4AIU A;  1SE7 A;  5JRE A;  2CWY A;  2KIN B;  4HKA A;  2I59 A;  5AQI B;  4Z91 A;  3RI5 A;  1XDP A;  4YJ2 E;  5BMV E;  2XQ9 A;  4IL9 A;  2L3L A;  2X66 A;  5KMG P;  5KXJ A;  5AQK B;  1T7S A;  4H9R C;  5H6Q B;  3RYH E;  1L0V A;  3LG7 A;  3ZT6 A;  3JAF A;  5CGM A;  4O2A E;  4X1K E;  4WNK A;  4U33 A;  4EV6 A;  4TV9 E;  3OBV E;  3C50 A;  3UU4 A;  3ZPO A;  3K3Q C;  2WWV A;  3NZQ A;  2A3D A;  4KBM B;  1YKE B;  2VQF T;  1N36 T;  2LM2 A;  2WU2 A;  4LFA T;  2JMH A;  2V26 A;  3LSV A;  3CML A;  5L3G B;  2D2S A;  4X1I E;  2ZM8 A;  4YLH A;  3RYC E;  3HKD E;  2WBL A;  2QRX A;  4ASK A;  2VQE T;  3LBX B;  3SOL A;  4CI3 B;  1ZP0 A;  2V5C A;  2X68 A;  3ONX A;  4YSY A;  2HN2 A;  5LHI B;  5DAB A;  5FL0 A;  4JYA T;  2WAU A;  2PFV A;  2LSG A;  4QXB B;  4B3M T;  2QYW A;  1O3X A;  4EIW A;  3BQI A;  3C4W A;  3ZN0 B;  4DR5 T;  4JI6 T;  3OTO T;  4HFV A;  4J2C A;  1CUN A;  5LXT E;  2PJQ A;  2UXC T;  5EK3 A;  4C91 A;  4DMW A;  4HN9 A;  5HAX A;  5LP6 E;  1FIO A;  1OWA A;  4JI4 T;  5HXH A;  4IHJ E;  4K0K T;  2CMR A;  4CXW A;  4YY3 T;  2LKG A;  1IJ6 A;  5BR8 T;  2CHN A;  5CJ5 A;  1T8B A;  5FNV E;  5HEJ A;  5AQP B;  5KDM C;  4P1N A;  4DID B;  1WRD A;  4L5G A;  3KDS E;  3AXJ A;  3AE6 A;  3H3M A;  1M7K A;  4C90 A;  1WYC A;  4TUY E;  3K8P C;  3PJA A;  5HEO A;  1HNW T;  2QA7 A;  4DBR A;  5AQQ B;  1US7 B;  2LSI A;  5M4Y A;  2E8I A;  2X0Y A;  4KX6 A;  3L8R A;  2OA5 A;  3CWZ B;  4Z90 A;  4ILU A;  3ZMT B;  5JDM A;  3AA6 B;  3ZYK A;  5L2L A;  3NRX A;  4LF4 T;  3N2K E;  4G63 A;  3GN5 A;  4AQF C;  2CWO A;  3NWI A;  3AEE A;  3CX7 B;  3RIA A;  2XAF B;  4NUV A;  1HNZ T;  2H7V C;  5HXR A;  3FXD B;  3RIU C;  2CE7 A;  4ANJ A;  4GK0 E;  3Q5E A;  1E7P A;  2C0S A;  5IWA T;  3AA1 B;  4IT4 A;  4IDZ A;  1J5W A;  2NTY A;  4IE0 A;  2DL1 A;  3AEC A;  4GYR A;  3PUW F;  3F57 A;  3RIF A;  5JR9 A;  4IDP A;  2YKS A;  4WBN E;  3AXJ B;  3WAK A;  3EAM A;  3VR8 A;  2Y8D A;  2DLR A;  1ZOY A;  4WYV A;  3AEA A;  2CPT A;  2Z6E A;  5HYA A;  1VOM A;  5DQW A;  3ZJ2 A;  3E08 A;  3UT5 E;  2XQ8 A;  3T8O A;  3SFE A;  3UUX B;  5HEH A;  4BAY B;  4ILA A;  2K5B B;  2W62 A;  2NOX A;  2CXD A;  3KFW X;  4HWC A;  2BS2 A;  5AQT B;  2BS4 A;  4YSZ A;  4DR1 T;  2KWH A;  4IIJ E;  3GN5 B;  4AKR B;  1VCT A;  4BJN A;  2MAW A;  5HCM A;  2VK9 A;  3MJX A;  3HA4 A;  4MAL A;  4DUY T;  3P4S A;  3IBP A;  1HF8 A;  2XY8 B;  3BQK A;  4B3R T;  3HKC E;  4U2Z A;  2IIU A;  2IAK A;  4GOU A;  4M1P A;  2VKJ A;  3QOF A;  2DWG A;  3TLW A;  4CXY A;  3AE7 A;  2L9Q A;  3CKD A;  2V6Y B;  2MYS A;  3KV6 A;  2K9A A;  2V7K A;  2V8S V;  3ABV A;  4HWD A;  3RIU A;  2ODU A;  4E7S A;  5JR9 B;  4ZEY A;  3PUQ A;  3CPZ A;  3RKO A;  2Q9Q C;  2CEA A;  4X66 T;  4IDQ A;  3ZMV B;  1VRB A;  2N1G A;  2X9X A;  3PV0 F;  4EAH A;  3MAC A;  2LM9 A;  3T1H T;  4I55 E;  4COF A;  4IDN A;  4QHO A;  1KNP A;  3QUJ A;  3QNU A;  2N9D A;  4HWI B;  3UUN A;  1QLB A;  2XTL A;  4ZI2 C;  2LKH A;  4UV8 B;  1T72 A;  1UUR A;  2J4G A;  2ZM2 A;  2FBW A;  3PUG A;  3LK3 B;  2XM1 A;  4CI1 B;  2XQY A;  2NW9 A;  2Y48 B;  4U7Y A;  1N34 T;  2ACZ A;  1WLX A;  5L3B B;  2LOP A;  2XJ7 A;  1ZHC A;  2E5L T;  3VHL A;  3H3A A;  3U78 A;  2XM2 A;  4DV6 T;  2BG9 C;  5ABH A;  2VB6 A;  4NPP A;  2JQK A;  3IF8 B;  2FUP A;  4UXN B;  1UK5 A;  4CN6 A;  5AFU L;  2W0G A;  1OED B;  3C4X A;  3I9Y A;  1FJG T;  3GWH A;  3FB2 A;  1Y01 A;  2SPC A;  1OXZ A;  5LHH B;  2E2A A;  5ABF A;  3FBZ A;  1YQ3 A;  1W0B A;  3F2E A;  3RRW A;  2WSS V;  1HFA A;  3EUH A;  3IHR A;  4DBQ A;  5FY1 A;  3WAJ A;  2V1D B;  2E9X C;  3ANW A;  1MNE A;  4DO0 A;  5LA6 E;  4L9I A;  2KWI B;  5DJQ C;  2IUB A;  3AAE B;  5LB7 B;  4JEU B;  2ZLY A;  1U4Q A;  3JAD A;  2BS3 A;  2G0U A;  4QX7 B;  1T98 A;  4KUM B;  2J1D G;  1N32 T;  2NWB A;  4HWH A;  2VL8 A;  5ETW A;  2I0M A;  2LT3 A;  3JCF A;  1VCS A;  1IBM T;  4DV2 T;  1MMA A;  5TAO A;  2X51 A;  4TNV A;  5LBM A;  4DV3 T;  2CLY C;  2BVL A;  3L3P A;  3OYZ A;  5L4E A;  3LFM A;  5F5W A;  3ZMS B;  4X5T A;  3JC6 C;  4OFZ A;  5LMN T;  4H9P C;  3ZEF B;  4JI3 T;  2UUA T;  5J0Z A;  1HG5 A;  3Q5W A;  5AQV B;  3ESL A;  4KHP T;  5LGN B;  1LVK A;  4ERR A;  4DV1 T;  2LOS A;  4AIS A;  3L09 A;  4I0U A;  2BG9 A;  4XAX B;  4DR4 T;  3P8C D;  5ABF B;  4U3C A;  4ZOL E;  2XZE A;  4DV7 T;  5JDL A;  1XNQ T;  5JDQ A;  4YTP A;  1MIY A;  3AE9 A;  5J1G A;  2H7O A;  4TWH A;  3A8Y C;  1BR0 A;  2W00 A;  2DNX A;  3AVS A;  1YKH B;  3OPC A;  2XQ5 A;  2NTX A;  2WS3 A;  4UEM A;  3ZN1 B;  3AEF A;  2KMF A;  3C64 A;  2X9Y A;  5L3E B;  4PK6 A;  3GMI A;  3RQW A;  1ZV4 X;  2VWA A;  4CXX A;  4HFC A;  5EZY E;  5F8P A;  4UVC B;  3ZLI A;  1MMN A;  5AQU B;  2WDQ A;  1YQ4 A;  3KBU A;  4HE8 A;  4LML A;  2MPK A;  4XZC A;  4H63 H;  4DMV A;  4PJM A;  2J47 A;  1E1H B;  4AKH A;  3ZC1 A;  2WZI A;  3HKB E;  2B76 A;  5KX5 E;  3I0Q A;  1OED E;  3N9Q A;  3CVR A;  3UU3 A;  3N9N A;  3ZMZ B;  2ES0 A;  5JRC A;  3VKG A;  5HWY A;  4HFB A;  2CHO A;  2V7J A;  2A2F X;  3TLT A;  4OX9 T;  1J1J A;  5HXC A;  5LCY A;  1X9B A;  1WR0 A;  2JQ9 A;  1WYB A;  3M3Z B;  3AEG A;  2LHR A;  3SRZ A;  1SUM B;  4TNW A;  1UGO A;  1D1C A;  3SWH A;  2H89 A;  1SHZ C;  5FY0 A;  4O8S A;  5HXS A;  4UIG A;  4YT0 A;  4KHZ F;  5LOV E;  4QXH B;  1S94 A;  4PW8 A;  2UU9 T;  5EK2 A;  1LRZ A;  2XAQ B;  3Q5D A;  4HTE A;  4TWD A;  3KVB A;  2KT9 A;  2XAG B;  3P4W A;  2RP4 A;  5CA1 E;  3VRB A;  4PAG A;  4UR9 A;  2IC6 A;  5AQS B;  5FVK A;  5FXX A;  3LJC A;  1WR6 A;  2HHH T;  4X62 T;  1W0A A;  2YOE A;  3K1S A;  4CQI A;  4F8H A;  2XQA A;  2A72 A;  3FZF B;  1EZ3 A;  4IDO A;  2CXL A;  3HKE E;  2MTQ A;  2YK0 A;  2VKD A;  3ZCJ A;  3JAE A;  2BKP A;  2JQQ A;  4HEA A;  2D5U A;  4ZXL A;  3Q2M A;  5LG4 A;  3KV4 A;  3EDU A;  2V7M A;  5JRC B;  3RC8 A;  3AE2 A;  3UUL A;  1XWM A;  2MOZ A;  2VKO A;  5FL1 A;  4IE7 A;  2IC9 A;  4BJM A;  5FMN A;  1XMQ T;  4A56 A;  3AE5 A;  3EI0 A;  5H6R B;  1HG2 A;  3QB5 K;  3B13 A;  1J5E T;  2PBI A;  3CIR A;  2FJA A;  1HR0 T;  3LK2 B;  3UUB A;  2KSR A;  1IBK T;  3OKQ A;  3MXZ A;  1KF6 A;  3UU8 A;  3RYF E;  4PK5 A;  2C5I T;  4LMK A;  3LK4 2;  4DV4 T;  4B6X A;  3N5L A;  2V5D A;  2CBJ A;  4YJ3 E;  4LF9 T;  2AXD S;  4PNI A;  4ZHQ E;  4LF5 T;  5J2U E;  1JNZ A;  3RYI E;  2EHO C;  3UTK A;  2YDQ A;  1ZEE A;  4CZZ B;  1BR1 A;  3B57 A;  3FZL B;  2HPL A;  2ZMA A;  5AQL B;  4F6R C;  5JH7 E;  3O1H A;  3PUX F;  4EED A;  4AKG A;  4PK4 A;  2WB5 A;  2DI4 A;  3H37 A;  5JDF A;  5LGU B;  1H7C A;  2UXX B;  4KMC A;  2YEV C;  4GIW A;  4LF8 T;  1IAP A;  3HR0 A;  3V5S A;  3RC3 A;  1N33 T;  2HPJ A;  2D0U A;  2M6I A;  2FJD A;  2XSB A;  1E2A A;  4ZI7 E;  4P0A A;  4TZ4 C;  3D0T A;  2P9B A;  1MIW A;  3P7I A;  2CXF A;  1D0X A;  1I94 T;  3M65 A;  4PFP A;  1CHU A;  3VRA A;  4OYK A;  2UUB T;  4NUU A;  3DJB A;  3W15 B;  4AQF A;  2XQ4 A;  4B3S T;  5L3C B;  2Q9Q D;  4A97 A;  2WU5 A;  2XAS B;  4L0R A;  3V5U A;  2K3W A;  4KP3 C;  4A98 A;  2LSK A;  3MK7 C;  3MKD A;  1NEN A;  1WFD A;  2VVS A;  2VKH A;  5AQJ B;  3N9P A;  2ACX A;  4ILC A;  4ZI2 D;  2WY2 A;  4ADZ A;  2LRL A;  3KIN B;  2LHN A;  1I6Z A;  3RF1 A;  4YTM A;  3ZST A;  3R84 B;  1BR2 A;  1NAF A;  2JRK A;  4H9N C;  1NEK A;  3AB3 B;  5LJN A;  3P4P A;  1DU2 A;  3VKH A;  1KNZ A;  2UXB T;  3ONJ A;  4QWN B;  4GKK T;  2XQ3 A;  4WZX A;  3PE0 A;  3AE8 A;  3BK9 A;  4I4T E;  1G8X A;  3UU5 A;  2QGS A;  2WWU A;  4MLK A;  3FBL A;  2WZH A;  1W09 A;  4JV5 T;  4DR3 T;  5LG3 A;  4DV0 T;  3ZMU B;  4EYY R;  4HWF A;  2BKN A;  3CX8 B;  4JI0 T;  5C3J A;  4IE6 A;  5FYM A;  3N9M A;  5FVL A;  2OLT A;  5AQH B;  3PU8 A;  5A1L A;  2F4V T;  4MHC A;  3TKL B;  4YFS A;  3O1J A;  4GK5 E;  2E9X D;  4CN1 A;  4DR2 T;  3T1Y T;  3EVY A;  3PUS A;  4EYU A;  4JI8 T;  3ETU A;  3TLV A;  4O2B E;  5AQR B;  1KNR A;  4H9O C;  1WCR A;  5JDG A;  2CA5 A;  4YTN A;  2HN1 A;  3OYX A;  5ADX L;  4EXT A;  1IBL T;  4JI1 T;  3AAA B;  2RPA A;  5LJM A;  2MBG A;  4ZS2 A;  1MIV A;  3I0O A;  3ZKR A;  2YIN A;  5CFB A;  2Q9Q A;  2YDS A;  3CQX C;  1UX4 A;  1IZN B;  2V6X A;  3RGL A;  4G2A A;  1G73 A;  1HNX T;  3JC6 D;  1IJ5 A;  5AQF B;  2E5V A;  2UXN B;  5JVD E;  3NRY A;  2X0L B;  1FMW A;  3AEB A;  3LBX A;  2LRK A;  1XDO A;  2WDR A;  4JLE A;  4DVD A;  4U7I A;  4NXN T;  3UUM A;  3PU3 A;  3PUV F;  4I50 E;  4IE5 A;  4IL4 A;  1JNR A;  2VVN A;  3E22 E;  4U74 A;  2NR4 A;  4ZS3 A;  5CA0 E;  5FXV A;  3FZK B;  2FJE A;  2VUR A;  3QK6 A;  4O4H E;  1V9D A;  2I6H A;  3PUR A;  3N2O A;  2ZM6 T;  5J2T E;  2N2N A;  3PDY A;  3SS1 A;  2IHR 1;  3ZT5 A;  2FJB A;  1D0Y A;  4PFO A;  4V1A v;  4NIQ A;  3AAI A;  4MFR A;  1HCI A;  4MBQ A;  1W9R A;  5IYZ E;  2W4X A;  1S35 A;  2D9D A;  4QH1 A;  4HFD A;  3CK6 A;  3WI3 A;  4EGW A;  3P4Q A;  1KK7 A;  3ANW B;  3PUZ F;  2ZM0 A;  3TLS A;  3NKZ A;  3I1A A;  2WMN A;  3X1D A;  4AKL A;  2Q9Q B;  5FKY A;  4P09 A;  1U5P A;  2E9X A;  3AED A;  2YU1 A;  3J7Y q;  4DUZ T;  3UQ7 A;  4TN7 B;  3NVO A;  3C98 B;  3IA3 A;  4PJJ A;  3PJA J;  2BBJ A;  5C8Y E;  3ONL C;  3CQG B;  3ZYM A;  4QXC B;  3B5M A;  2JJ9 A;  5L47 A;  5C2T A;  2V7I A;  3SFD A;  2W61 A;  2M67 A;  2WQY A;  2LE8 A;  2CRB A;  3UQ4 A;  1UCU A;  3DP7 A;  1AJ3 A;  3PTR B;  2BG9 B;  2C5K T;  3RX6 A;  4FI5 A;  1YXR A;  2RA1 A;  3A5X A;  3ZT7 A;  4ZI3 D;  4TX5 A;  2NW8 A;  4HFI A;  3K3N A;  1LVF A;  2JIW A;  5FXW A;  1HX1 B;  5JR9 C;  3F31 A;  3QB5 A;  3AVR A;  4BA9 A;  5JDH A;  3IEE A;  2AE9 A;  3P4R A;  4UV9 B;  3PUY F;  2LLY A;  4ZI3 C;  3ETV A;  3Q9D A;  3VR9 A;  2E9X B;  3ZC0 A;  4Q25 A;  2X0H A;  2C5J A;  3R6N A;  4OHF A;  4UEL A;  3AE1 A;  2IW5 B;  1D0Z A;  2KLQ A;  3OVU A;  1B7T A;  4ILB A;  3RHW A;  3ZYL A;  3RLF F;  3UU6 A;  1M62 A;  4DR6 T;  4IRE A;  2L8K A;  4H63 V;  3RRC A;  2H3R A;  3KV9 A;  5JDN A;  4U72 A;  4QH5 A;  4QH4 A;  4TV8 E;  4I43 B;  3AE4 A;  2M6B A;  4AQY T;  2CLY B;  1YD8 G;  4UF0 A;  2X9W A;  2KXP B;  3LDQ B;  5CB4 E;  3RH3 A;  3UFG A;  3J9X 1;  4ZZB A;  4P0B A;  3HL6 A;  2XHE B;  2XSA A;  4Z8X A;  4GYS A;  2XPK A;  1OED C;  4KI0 F;  4CI2 B;  2BBH A;  2GK9 A;  3EDV A;  2EHO D;  1KFY A;  2YDR A;  4FJO A;  2H88 A;  3O4X E;  3QC9 A;  4X65 T;  5LBQ B;  2JPF A;  1SA0 E;  1QUU A;  2W66 A;  3MA9 A;  1HX8 A;  4ZZC A;  3AA0 B;  2W67 A;  5HEU A;  4NXM T;  4IE4 A;  3ZCI A;  4AXP A;  4YHH T;  3BQL A;  2KZ7 B;  2V6Y A;  4CN4 A;  3L39 A;  1HS7 A;  4AQG A;  2WCA A;  4QX8 B;  4IGU A;  4LF6 T;  3RPU A;  5JTG A;  2KND A;  2JMK A;  4O4J E;  4TWF A;  2YU2 A;  1R8I A;  2XAH B;  4A5X A;  4IST A;  4JUY A;  3CX6 B;  4O4I E;  2BG9 E;  4UVB B;  2PTF A;  4WBO A;  5HCJ A;  5HWX A;  1MND A;  4O4L E;  5JQG E;  2OV9 A;  3AE3 A;  1HTJ F;  3U3I A;  2B1E A;  2WMO A;  4EZ4 A;  5HXE A;  1X79 A;  4UF0 B;  1BR4 A;  3NBX X;  3CQC B;  5ABG A;  2V7L A;  5F3J A;  3DTO A;  3UFE A;  2DWK A;  4XBF B;  2DHR A;  1MMG A;  1QSD A;  4X1Y E;  5L3D B;  5ABE A;  3KV5 A;  4PJL A;  2QVA A;  3ZSS A;  2DCF A;  4JBW F;  4LMJ A;  3G06 A;  2XQ7 A;  3FXE B;  4YSX A;  1OED A;  5LHG B;  1LKX A;  2JQH A;  2XAJ B;  1D1B A;  5AQN B;  2NW7 A;  2UXD T;  4U2Y A;  2YN6 A;  1Z0P A;  2BVM A;  3EHZ A;  5AQO B;  1XMO T;  2UUC T;  4PJN A;  3C51 A;  4QKN A;  2LEH A;  5LNK A;  2EHO A;  4DV5 T;  2IDO B;  3FZH B;  3MZK B;  4EOZ B;  3TLU A;  4U31 A;  4X64 T;  2XQ6 A;  4N78 D;  3KVA A;  4ISS A;  3P50 A;  2CCQ A;  5FP3 A;  3O1I A;  1MMD A;  1ZKE A;  2WP9 A;  5LGT B;  4X20 E;  2Y6X A;  2CM0 A;  4JI5 T;  3HI2 A;  4YXD A;  5GON E;  4K0U A;  2LJL A;  3GA8 A;  2WM9 A;  4E7Z A;  4JI2 T;  3FZM B;  3E0Z A;  4GKJ T;  3KBT A;  4HGA A;  5DQV A;  2J62 A;  3N9O A;  5FXZ A;  2BDE A;  3FHN A;  5L3F B;  4HFE A;  1Z8U A;  3VU7 H;  5FY7 A;  5LMU T;  3ZJ1 A;  2IML A;  3C4Z A;  2R6G F;  4EEB A;  4UVA B;  2K24 A;  5AQM B;  2X9H A;  4B3T T;  4AKI A; 
#chains in the Genus database with same CATH homology
 4YHH T;  2UXB T;  1HNZ T;  4GKK T;  4DV6 T;  4LF8 T;  1XNR T;  4DUZ T;  4B3R T;  1HNX T;  4JI4 T;  1N33 T;  5LMN T;  2UXD T;  4K0K T;  4YY3 T;  4LF6 T;  4JI3 T;  1XMO T;  2UUA T;  4OX9 T;  5IWA T;  2UUC T;  4KHP T;  5BR8 T;  1I94 T;  4DV5 T;  4JV5 T;  4DR3 T;  1XMQ T;  2VQF T;  1N36 T;  4DV1 T;  4NXN T;  4LFA T;  1FJG T;  2UUB T;  4DV0 T;  4X64 T;  4JI0 T;  4DR6 T;  4DR4 T;  4DV7 T;  4LF7 T;  1XNQ T;  1J5E T;  4LFB T;  4B3S T;  1HR0 T;  4X66 T;  1IBK T;  2VQE T;  4AQY T;  4DR7 T;  2F4V T;  3T1H T;  4LFC T;  1HNW T;  2ZM6 T;  2UU9 T;  4JI5 T;  4DR2 T;  4DV4 T;  3T1Y T;  4JI7 T;  4JI8 T;  4LF9 T;  4JYA T;  4JI2 T;  4LF5 T;  4B3M T;  4GKJ T;  1N32 T;  2HHH T;  4X62 T;  1IBL T;  4JI1 T;  4LF4 T;  5LMU T;  4DR1 T;  1N34 T;  4X65 T;  4DR5 T;  4JI6 T;  3OTO T;  1IBM T;  4DV2 T;  2E5L T;  4B3T T;  4NXM T;  2UXC T;  4DV3 T;  4DUY T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...