2UUBT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uubT00
1N36T 1XNRT 1HNWT 4DV5T 2VQET 3OTOT 4DR3T 4JI4T 2HHHT 4DR7T 4DV6T 4K0KT 4JV5T 4LF4T 1N34T 4X66T 4LF7T 4B3RT 4DR1T 4DV3T 2UUAT 4NXMT 4LFCT 4JI8T 4DR5T 4X64T 1N33T 4DR4T 1I94T 4B3MT 4DUYT 2UUBT 2UU9T 1HNZT 4GKKT 1IBLT 4B3ST 2E5LT 2VQFT 4JI6T 1HR0T 2ZM6T 2F4VT 4LFAT 4LF9T 4DV4T 4DV1T 4OX9T 4LF8T 3T1YT 4X62T 1XNQT 4B3TT 1N32T 4JI2T 1IBKT 4YY3T 2UUCT 2UXCT 4KHPT 5LMNT 1XMOT 4LFBT 2UXDT 2UXBT 4DV0T 4YHHT 4GKJT 4DV2T 5IWAT 5LMUT 4JI5T 1IBMT 4JI0T 1J5ET 4JI7T 4DR6T 4JI3T 1XMQT 1FJGT 4DUZT 4DV7T 5BR8T 3T1HT 4X65T 4DR2T 4AQYT 4LF5T 1HNXT 4LF6T 4JI1T 4JYAT 4NXNT
chains in the Genus database with same CATH superfamily
1G8XA 5LNKA 3AECA 2LSGA 3ZMVB 3AA1B 3FZKB 2V7IA 2YN6A 5AQSB 3RLFF 3Q5DA 3ZYMA 4FJOA 5L3FB 4V1Av 3RIUA 2N2NA 4TZ4C 2ZM8A 4C90A 1HNWT 2KWHA 3FZLB 4QXHB 1FMVA 2JMHA 2LE8A 4IE4A 5AQFB 2KLQA 3TLSA 4QXBB 3SOLA 2XQ8A 1JNRA 1BR4A 4A97A 5JRCA 2BZBA 1KK7A 2CLYB 2QRXA 4DR7T 5AQKB 2XUEA 4L0RA 3MXZA 1ZEEA 2DWGA 1KNRA 2DCFA 5FL0A 1MNDA 2YKSA 5IYZE 4A5XA 1NAFA 5J1GA 3ZC1A 5LXTE 4ZOLE 5FMNA 2C5JA 2JQKA 2Y8DA 1IJ5A 2WP9A 3DP7A 3QB5A 2W0GA 4DR5T 1LVFA 2YU2A 4PJNA 3ZCJA 3I1AA 3RRWA 5CB4E 2J1DG 5JDNA 3NZPA 3PUVF 1I94T 2YDRA 3ABVA 1NEKA 2RP4A 1S35A 4CXYA 2JIWA 2A72A 2E9XC 4UV9B 3LG7A 2E5LT 2EHOA 4G2AA 1HX1B 1I6ZA 3K3OA 3UU8A 2BKNA 2YDQA 2JQHA 2X0YA 4GOUA 5JREA 1VCSA 2L8KA 5FL1A 2WM9A 3C50A 4JUYA 1MMDA 3IEEA 3QNUA 2QVAA 3I0OA 2NP9A 4KBMB 4PNIA 3P4PA 4UELA 2XSAA 1BR2A 4BJMA 4PFPA 3QB5K 4XZCA 3WI3A 3KV5A 3C51A 4P1NA 4UR9A 3ZJ1A 2YDSA 3TKLB 4WNKA 3AEDA 1FIOA 2IAKA 3F31A 3BQIA 3CX7B 3RRCA 4DV1T 4QHOA 3T1YT 3VRAA 2WU5A 2WDQA 3ZKRA 3OYZA 4X62T 1H7CA 4HFEA 2JQQA 3I9WA 3AAAB 5CA1E 5JH7E 2LSKA 2VKHA 2IMLA 2JPFA 3ESLA 4ISTA 4B3TT 2K5BB 4IL4A 4HFIA 2IIUA 5HXEA 2FJEA 2LM9A 3LFMA 2FJDA 2CCQA 3JADA 5HCJA 4PAGA 4JI2T 4X1KE 4AKLA 4AI6A 5H6QB 3ZSTA 2J4GA 2WSSV 3FXDB 5AQUB 1WCRA 3ONLC 5FY1A 3C4ZA 2K24A 2RPAA 3M3ZB 5GONE 3KV9A 5HEUA 4EOZB 5FXVA 2JQ9A 5L47A 2V5CA 1YKHB 3AA6B 1MIVA 4QKNA 2X9WA 3VRBA 4EV6A 5FVKA 4LFBT 2P9BA 2J62A 3UUXB 4PK6A 5LG3A 3AEFA 1L0VA 3CVRA 2KWIB 2YINA 1SE7A 4PJMA 4DBQA 2GK9A 3OPCA 1T8BA 1GQEA 4Z8XA 2H88A 3RGLA 3OKQA 2CBJA 2Q9QD 3CQCB 3ONJA 3NBXX 4K0UA 4O4LE 5DJQC 2WDVA 3PUZF 5EK3A 4YSZA 1YXRA 2BKPA 1HX8A 2VKDA 3O1HA 4QH1A 4L5GA 3RYFE 4JI5T 5FXWA 4UV8B 5AQJB 5ABEA 1YKEB 1V9DA 5DABA 4ISSA 3KV4A 2XM1A 4MALA 1YQ3A 2XQ6A 2WCAA 5J2TE 1XMQT 5FKYA 2V7MA 2KT9A 4IE5A 2V7KA 4HWIB 3V5UA 4YTNA 1ZHCA 4AKRB 2X0LB 4U33A 4HGAA 3RI5A 1BR1A 3UU6A 1IZNB 3PU3A 4QWNB 5FY0A 5IWAT 4I43B 4DO0A 3Q2MA 4P09A 1M62A 2BG9C 1HNXT 2VVSA 5LP6E 4JI1T 2LKHA 3B13A 4H9QC 3A5XA 3HKEE 3FBLA 1OEDA 3O1IA 4ZI2C 5L3GB 3B5MA 2YOEA 1YQ4A 4ASKA 1W0AA 4Z90A 5FP3A 4WBNE 1WYBA 5CGMA 1X9BA 3AB3B 1O3XA 3LDQB 4PJLA 1N36T 2Z6EA 3MACA 4HWHA 5JDMA 2MYSA 3A8YC 3U3IA 2X67A 4DBRA 2E2AA 5LBQB 4CZZB 2BS3A 4JBWF 3IF8B 3AE8A 3BK9A 1T98A 3PUGA 4JI4T 4CI1B 2LT3A 4HFHA 1OEDB 3CQXC 1KNZA 2Y6XA 3N9QA 3FXEB 5ABGA 4DV6T 4K0KT 4JV5T 3H3MA 4LF4T 2B76A 4KMCA 2WZHA 3AA7B 3EVYA 3FZFB 4X20E 4XAXB 4B3RT 4IT4A 5LA6E 2EHOB 4ILAA 3TLUA 4C91A 1UCUA 2LRLA 2V1DB 3F2EA 3ZJ2A 2B1EA 2XPKA 2A2FX 5BMVE 4WYVA 4ILCA 2WZIA 5FVLA 3X1DA 5HEGA 4JLEA 2BG9E 3H3AA 2XASB 4LFCT 4JI8T 2VWAA 2WBLA 4Q25A 5JR9C 1VCTA 4TWDA 3E0ZA 2LOSA 3VU7H 4EZ4A 4OK0A 1N33T 5EZYE 5KMGP 2CLYC 4HEAA 3EI0A 2UU9T 1HNZT 2PBIA 3ZMTB 4EEDA 1US7B 5JDQA 3ZPOA 2K48A 1WFDA 1Y64B 5L3BB 5M4YA 4X5TA 2NR4A 2BVMA 4LMLA 2A9UA 1HTJF 3AE7A 3CWZB 3G06A 4BJNA 4COFA 4F8HA 3FZMB 3OJAA 4PK4A 1FEWA 1HG2A 4CN6A 2V6YB 5L3CB 3ZCIA 3RIFA 3EHZA 4KUMB 4ZEYA 3AEAA 2F4VT 4IHJE 3N9PA 1SHZC 4JEUB 2ES0A 3O9XA 3L39A 2QGSA 3MA9A 2BG9B 2A3DA 4DV4T 4CN1A 4LF9T 4TNVA 4X1YE 1WRDA 2KMFA 4OX9T 2BBJA 4CXWA 5C8YE 2C5KT 2HPLA 5DQWA 3TLVA 5L4EA 1OXZA 1BR0A 3AEEA 3EAMA 4UIGA 5HEOA 3C4XA 4AKIA 4GK0E 3I0QA 1HF8A 2X68A 2D5UA 2WQYA 3NZQA 2CHNA 5A1LA 2LHRA 4U2ZA 1QSDA 1N32T 4KX6A 2VB6A 4NPPA 5LCYA 3FB2A 1IBKT 2FBWA 2Q9QA 2X0HA 3DTOA 4AIUA 2IC6A 4DNDA 4QX7B 4EIWA 1HFAA 5JDGA 3SFEA 2E5VA 2UUCT 2ZM0A 3PE0A 3R84B 2IHR1 3C64A 1U5PA 3QOFA 5ETWA 1D0XA 2XAJB 3QK6A 2D2SA 4DR2T 2LOPA 2WY2A 1XMOT 4HWDA 2YEVC 2XY8B 5LOVE 3N5LA 2UXDT 3K3QC 4U3CA 3SRZA 4MBQA 4UVBB 1HCIA 3RC8A 2UXBT 4IE0A 3Q5WA 2KNDA 4NIQA 3ZMZB 4EAHA 1MMAA 1UX4A 1ZV4X 2H7OA 4TV9E 5AQRB 4IDZA 3UU5A 1U4QA 5AQIB 4TV8E 3HKDE 5AQMB 4ZI3C 3ZT7A 4F6RC 2AE9A 2LSJA 2C5IT 5KXJA 1FMWA 3NRXA 3ZMUB 3FBZA 3PUAA 4JI0T 1Z0PA 2HH7A 2LEHA 4HFVA 4QXCB 1NENA 4JI3T 2XM2A 4MHCA 2V26A 2UXXB 1E2AA 2D9DA 2NWBA 4DV7T 2W63A 2JRKA 2CWOA 5BR8T 5F8PA 3P4QA 4DMVA 3PUYF 2UXNB 2XQ9A 4HTEA 3UFGA 4XBFB 5FY7A 4IGUA 2VKOA 2XSBA 4ANJA 2OV9A 3EDUA 4UVCB 2FJBA 2IDOB 5CFBA 4LF6T 3JC6D 4O4IE 3RX6A 4BAYB 3KV6A 2N1GA 4DVDA 1KNPA 3NVOA 4JYAT 1VRBA 4PK5A 3ZLIA 4N78D 5ABFA 3RIUC 2NW8A 3CKDA 2OA5A 2XAFB 4HFDA 1CUNA 3IA3A 1HS7A 3J9X1 1MNEA 4IE7A 3U78A 2NTXA 3UUMA 2HN1A 3N9LA 4O2AE 2VL8A 1MIWA 2ZM2A 2VQET 3OTOT 2X9XA 2RA1A 4YFSA 5AQPB 3T8OA 5HEHA 4EGWA 2XQYA 1W0BA 1KFYA 4ZS3A 1OEDE 5ABFB 2XQ3A 4ZI7E 2HHHT 1MMNA 1UUSA 5EK4A 3GWHA 5AQVB 2XQAA 3RQUA 3A7MA 4O8SA 5HWXA 2BBHA 2E9XD 2N9DA 1XDOA 2V7JA 4HWCA 2W61A 1W9RA 3GN5A 3P8CD 3P4SA 3MZKB 2MTQA 2XAGB 4OHFA 4DR1T 2W2UA 3S4UA 4DV3T 4GYSA 2XQ4A 3UFEA 4UEMA 4NXMT 4IDNA 3D0TA 5HEJA 3VKHA 1XDPA 3AE2A 2WDRA 1OEDC 3N9NA 4GYRA 4QH4A 2V6XA 3ZYKA 4FI5A 3KFWX 3ZEFB 4DUYT 2WMNA 4ILBA 3AE6A 3TLWA 4DIDB 2XJ7A 2QA7A 2VKJA 4AQGA 1IBLT 4B3ST 3CX8B 3H37A 3Q9DA 4H63H 1J5WA 1QLBA 4HWFA 5JTGA 3RKOA 1Z8UA 1ZKEA 2VQFT 2IW5B 3AAEB 1IAPA 3KDSE 3RKGA 2W62A 4TX5A 5L2LA 2VASA 2E9XA 5TAOA 5L3DB 3ZT6A 5HXSA 2ZM6T 2H89A 3LK2B 2WWUA 4AQFC 2BVLA 4NUUA 1T7SA 3RQWA 5HXCA 2V8SV 4CQIA 5LG4A 2XAHB 2WWVA 4G63A 5LGUB 1XWMA 1KEYA 3K3NA 3NWIA 5JRCB 1WR6A 1WLXA 2YU1A 3HI2A 3HKBE 4DMWA 3I9YA 4ADZA 4UXNB 1LVKA 3HKCE 4GIWA 3SFDA 5JDLA 3WAKA 4CI3B 3MKDA 3F57A 2V7LA 3GA8A 3PUXF 3HA4A 3PUQA 2HN2A 2WMOA 2X9YA 4TWHA 3ZC0A 2ACZA 2H3RA 1UGOA 3DJBA 2JMKA 4O4HE 4O4JE 1WR0A 2VK9A 1M7KA 1OWAA 3UT5E 1G73A 3JAFA 1Y01A 3ZT5A 5AQHB 4YY3T 2BDEA 3CQGB 3O1JA 2BKOA 4P0BA 2CEAA 2WU2A 4TNWA 2LJLA 2BS2A 2EHOC 2UXCT 2XHEB 2VL0A 4KHPT 3L8RA 5AQOB 3UUNA 5C3JA 1R8IA 4H9RC 2LM2A 3PUWF 5E0OA 5LHGB 5HWYA 3QUJA 2Y48B 2XAQB 3UU3A 4YSYA 2HPJA 4Z91A 4AXPA 4HFCA 3LJCA 4YHHT 3PU8A 3KINB 3E22E 4KI0F 3SS1A 3AEGA 4GK5E 4H9OC 2X51A 3B57A 3AA0B 4HN9A 3NRYA 4YTPA 3RYHE 1EZ3A 4EXTA 2ACXA 3MJXA 2DHRA 2H7VC 2W4XA 5FNVE 4EZHA 4JI7T 1J1JA 3GN5B 4DR6T 2AXDS 5F5WA 3CMLA 4IDOA 3ZYLA 2G0UA 3FHNA 1IJ6A 2R6GF 3HR0A 1FJGT 5LHIB 3LK3B 2XTLA 3AAIA 3T1HT 1YD8G 4X65T 2DNXA 3BQKA 2W00A 4LMJA 2CA5A 2MPKA 1W09A 2SPCA 3JAEA 3JCFA 1D1AA 1D1CA 2CHOA 2Q9QC 2D0UA 3PJAJ 1MMGA 4YLHA 5HAXA 4AQYT 2EHOD 3M65A 2PTFA 2NW9A 3AVSA 2M6BA 3EABA 3SWHA 4J2CA 3ZN0B 4JEHB 2CXFA 3RYCE 2CXLA 5JDHA 3OVUA 3PDYA 5JDFA 3IBPA 2MAWA 4EYYR 5AQQB 4ERRA 2Q9QB 2NOXA 1LRZA 1SUMB 2V6YA 5LYJE 5HXRA 2NTYA 1DU2A 4EB6E 5EK2A 5AQNB 3BQLA 4M1PA 4PFOA 4AISA 4U74A 3RF1A 2CMRA 1XNRT 1VOMA 3ANWB 4E7SA 3UQ7A 4ZS2A 4DV5T 3ZSSA 3LSVA 3NKZA 3GMIA 3VR9A 2I59A 3CIRA 5CA0E 5H6RB 4TUYE 3VR8A 4CXXA 4DR3T 4H63V 4U2YA 2KINB 4UVAB 2CBIA 1CHUA 2W67A 1UX5A 4H9PC 3PV0F 3P50A 4I50E 2DWKA 4YT0A 4U7YA 4AKGA 3VKGA 2I0MA 2BS4A 1N34T 1HG5A 4MLKA 4X66T 3AE3A 4LF7T 4HFBA 3LK42 4PW8A 1XZYA 2LLYA 2X9HA 3AE5A 3L09A 4IDQA 2CE7A 3K8PC 4ZI2D 2FUPA 3O4XE 3KBUA 2IUBA 1KF6A 2UUAT 4ZXLA 1B7TA 2FJAA 3HL6A 4YJ3E 5AQTB 2LKGA 5HYAA 2X66A 3PJAA 3RH3A 4X64T 1JNZA 2ZMAA 2I6HA 2XZEA 2DLRA 4PJJA 3Q5XA 4I4TE 4KP3C 4H9SE 4EYUA 4HE8A 2KSRA 5LGTB 4B3MT 4DR4T 2UUBT 2E8IA 2DL1A 4IIJE 2LHNA 4GKKT 1QUUA 3IHRA 4OFZA 5AQGB 3P7IA 2LSIA 2PJQA 3L3PA 2WS3A 3PTRB 5FXZA 4HKAA 3R6NA 1AJ3A 4AKHA 3E08A 2YK0A 3ZN1B 2ODUA 4WBOA 5J2UE 3VHLA 5LHHB 2W66A 4JI6T 3RIAA 1E7PA 4B6XA 4BA9A 2CWYA 3OYXA 4QH5A 4IL9A 2L9QA 1NWMX 2JJ9A 2M6IA 3WAJA 2ODVA 1HR0T 4A98A 1UK5A 4A56A 3PUSA 3OBVE 4NUVA 5AQLB 2K3WA 5LGNB 3AVRA 4IREA 5KX5E 4YHJA 4CN4A 3CX6B 2PG8A 4OYKA 4QX8B 4YTMA 3UULA 4ILUA 4TWFA 5ADXL 4LFAT 4IDPA 5IHYA 3UQ4A 2D0TA 5F3JA 3AXJB 4LF8T 3AE4A 2LSYA 2L3LA 3ETUA 1E1HB 2CXDA 3EDVA 4LMKA 5LJMA 2OLTA 1ZOYA 3FZHB 2VURA 3AE1A 3PURA 5LB7B 3V5SA 3ZMSB 3CPZA 4CI2B 2CPTA 4X1IE 4ZHQE 5L3EB 1D0ZA 1XNQT 3N2OA 3P4RA 1SA0E 5CJ5A 3W15B 2WB5A 3K1SA 2ZLYA 3N9OA 1WYCA 2C0SA 3TLTA 3RYIE 3AXJA 3KVBA 4H9NC 1S94A 4YJ2E 5KDMC 3KBTA 2QYWA 4U72A 3UU4A 5HXHA 4AQFA 4UF0B 4YXDA 4DV2T 2MOZA 3RHWA 5FYMA 4MFRA 4WZXA 3KVAA 5LMNT 2KXPB 3ONXA 3P4WA 3CK6A 2DI4A 2KZ7B 2XQ7A 5C2TA 2CM0A 4ZZBA 1D0YA 1T72A 5AFUL 5JVDE 4DV0T 5DQVA 1D1BA 2WAUA 3JC6C 5L4HA 3AE9A 3UUBA 4EEBA 2IC9A 1YW0A 4L9IA 4UF0A 4WW0A 5IUXA 3EUHA 2XQ5A 5LJNA 1UURA 3RPUA 4GKJT 5LBMA 4I55E 2E9XB 5LMUT 2VVNA 5J0ZA 2CRBA 2K9AA 5JR9A 2MBGA 3J7Yq 4OYJA 1J5ET 1IBMT 2V5DA 5HCMA 4KHZF 3N2KE 4U31A 4IE6A 2J47A 3LBXB 4YSXA 3N9MA 2BG9A 4DUZT 1LKXA 5ABHA 1ZP0A 3N2GE 4U7IA 1X79A 2PFVA 3UTKA 4TN7B 2M67A 4P0AA 5FXXA 4I0UA 4ZI3D 3MK7C 4LF5T 5JQGE 4O2BE 4ZZCA 3QC9A 1MIYA 3AEBA 3C98B 3ANWA 3LBXA 3Q5EA 5JR9B 2LRKA 4E7ZA 3C4WA 2NW7A 4NXNT 3RC3A 3ETVA
chains in the Genus database with same CATH topology
1N36T 1XNRT 1HNWT 4DV5T 2VQET 3OTOT 4DR3T 4JI4T 2HHHT 4DR7T 4DV6T 4K0KT 4JV5T 4LF4T 1N34T 4X66T 4LF7T 4B3RT 4DR1T 4DV3T 2UUAT 4NXMT 4LFCT 4JI8T 4DR5T 4X64T 1N33T 4DR4T 1I94T 4B3MT 4DUYT 2UUBT 2UU9T 1HNZT 4GKKT 1IBLT 4B3ST 2E5LT 2VQFT 4JI6T 1HR0T 2ZM6T 2F4VT 4LFAT 4LF9T 4DV4T 4DV1T 4OX9T 4LF8T 3T1YT 4X62T 1XNQT 4B3TT 1N32T 4JI2T 1IBKT 4YY3T 2UUCT 2UXCT 4KHPT 5LMNT 1XMOT 4LFBT 2UXDT 2UXBT 4DV0T 4YHHT 4GKJT 4DV2T 5IWAT 5LMUT 4JI5T 1IBMT 4JI0T 1J5ET 4JI7T 4DR6T 4JI3T 1XMQT 1FJGT 4DUZT 4DV7T 5BR8T 3T1HT 4X65T 4DR2T 4AQYT 4LF5T 1HNXT 4LF6T 4JI1T 4JYAT 4NXNT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N36 T;  1XNR T;  1HNW T;  4DV5 T;  2VQE T;  3OTO T;  4DR3 T;  4JI4 T;  2HHH T;  4DR7 T;  4DV6 T;  4K0K T;  4JV5 T;  4LF4 T;  1N34 T;  4X66 T;  4LF7 T;  4B3R T;  4DR1 T;  4DV3 T;  2UUA T;  4NXM T;  4LFC T;  4JI8 T;  4DR5 T;  4X64 T;  1N33 T;  4DR4 T;  1I94 T;  4B3M T;  4DUY T;  2UUB T;  2UU9 T;  1HNZ T;  4GKK T;  1IBL T;  4B3S T;  2E5L T;  2VQF T;  4JI6 T;  1HR0 T;  2ZM6 T;  2F4V T;  4LFA T;  4LF9 T;  4DV4 T;  4DV1 T;  4OX9 T;  4LF8 T;  3T1Y T;  4X62 T;  1XNQ T;  4B3T T;  1N32 T;  4JI2 T;  1IBK T;  4YY3 T;  2UUC T;  2UXC T;  4KHP T;  5LMN T;  1XMO T;  4LFB T;  2UXD T;  2UXB T;  4DV0 T;  4YHH T;  4GKJ T;  4DV2 T;  5IWA T;  5LMU T;  4JI5 T;  1IBM T;  4JI0 T;  1J5E T;  4JI7 T;  4DR6 T;  4JI3 T;  1XMQ T;  1FJG T;  4DUZ T;  4DV7 T;  5BR8 T;  3T1H T;  4X65 T;  4DR2 T;  4AQY T;  4LF5 T;  1HNX T;  4LF6 T;  4JI1 T;  4JYA T;  4NXN T; 
#chains in the Genus database with same CATH topology
 1G8X A;  5LNK A;  3AEC A;  2LSG A;  3ZMV B;  3AA1 B;  3FZK B;  2V7I A;  2YN6 A;  5AQS B;  3RLF F;  3Q5D A;  3ZYM A;  4FJO A;  5L3F B;  4V1A v;  3RIU A;  2N2N A;  4TZ4 C;  2ZM8 A;  4C90 A;  1HNW T;  2KWH A;  3FZL B;  4QXH B;  1FMV A;  2JMH A;  2LE8 A;  4IE4 A;  5AQF B;  2KLQ A;  3TLS A;  4QXB B;  3SOL A;  2XQ8 A;  1JNR A;  1BR4 A;  4A97 A;  5JRC A;  2BZB A;  1KK7 A;  2CLY B;  2QRX A;  4DR7 T;  5AQK B;  2XUE A;  4L0R A;  3MXZ A;  1ZEE A;  2DWG A;  1KNR A;  2DCF A;  5FL0 A;  1MND A;  2YKS A;  5IYZ E;  4A5X A;  1NAF A;  5J1G A;  3ZC1 A;  5LXT E;  4ZOL E;  5FMN A;  2C5J A;  2JQK A;  2Y8D A;  1IJ5 A;  2WP9 A;  3DP7 A;  3QB5 A;  2W0G A;  4DR5 T;  1LVF A;  2YU2 A;  4PJN A;  3ZCJ A;  3I1A A;  3RRW A;  5CB4 E;  2J1D G;  5JDN A;  3NZP A;  3PUV F;  1I94 T;  2YDR A;  3ABV A;  1NEK A;  2RP4 A;  1S35 A;  4CXY A;  2JIW A;  2A72 A;  2E9X C;  4UV9 B;  3LG7 A;  2E5L T;  2EHO A;  4G2A A;  1HX1 B;  1I6Z A;  3K3O A;  3UU8 A;  2BKN A;  2YDQ A;  2JQH A;  2X0Y A;  4GOU A;  5JRE A;  1VCS A;  2L8K A;  5FL1 A;  2WM9 A;  3C50 A;  4JUY A;  1MMD A;  3IEE A;  3QNU A;  2QVA A;  3I0O A;  2NP9 A;  4KBM B;  4PNI A;  3P4P A;  4UEL A;  2XSA A;  1BR2 A;  4BJM A;  4PFP A;  3QB5 K;  4XZC A;  3WI3 A;  3KV5 A;  3C51 A;  4P1N A;  4UR9 A;  3ZJ1 A;  2YDS A;  3TKL B;  4WNK A;  3AED A;  1FIO A;  2IAK A;  3F31 A;  3BQI A;  3CX7 B;  3RRC A;  4DV1 T;  4QHO A;  3T1Y T;  3VRA A;  2WU5 A;  2WDQ A;  3ZKR A;  3OYZ A;  4X62 T;  1H7C A;  4HFE A;  2JQQ A;  3I9W A;  3AAA B;  5CA1 E;  5JH7 E;  2LSK A;  2VKH A;  2IML A;  2JPF A;  3ESL A;  4IST A;  4B3T T;  2K5B B;  4IL4 A;  4HFI A;  2IIU A;  5HXE A;  2FJE A;  2LM9 A;  3LFM A;  2FJD A;  2CCQ A;  3JAD A;  5HCJ A;  4PAG A;  4JI2 T;  4X1K E;  4AKL A;  4AI6 A;  5H6Q B;  3ZST A;  2J4G A;  2WSS V;  3FXD B;  5AQU B;  1WCR A;  3ONL C;  5FY1 A;  3C4Z A;  2K24 A;  2RPA A;  3M3Z B;  5GON E;  3KV9 A;  5HEU A;  4EOZ B;  5FXV A;  2JQ9 A;  5L47 A;  2V5C A;  1YKH B;  3AA6 B;  1MIV A;  4QKN A;  2X9W A;  3VRB A;  4EV6 A;  5FVK A;  4LFB T;  2P9B A;  2J62 A;  3UUX B;  4PK6 A;  5LG3 A;  3AEF A;  1L0V A;  3CVR A;  2KWI B;  2YIN A;  1SE7 A;  4PJM A;  4DBQ A;  2GK9 A;  3OPC A;  1T8B A;  1GQE A;  4Z8X A;  2H88 A;  3RGL A;  3OKQ A;  2CBJ A;  2Q9Q D;  3CQC B;  3ONJ A;  3NBX X;  4K0U A;  4O4L E;  5DJQ C;  2WDV A;  3PUZ F;  5EK3 A;  4YSZ A;  1YXR A;  2BKP A;  1HX8 A;  2VKD A;  3O1H A;  4QH1 A;  4L5G A;  3RYF E;  4JI5 T;  5FXW A;  4UV8 B;  5AQJ B;  5ABE A;  1YKE B;  1V9D A;  5DAB A;  4ISS A;  3KV4 A;  2XM1 A;  4MAL A;  1YQ3 A;  2XQ6 A;  2WCA A;  5J2T E;  1XMQ T;  5FKY A;  2V7M A;  2KT9 A;  4IE5 A;  2V7K A;  4HWI B;  3V5U A;  4YTN A;  1ZHC A;  4AKR B;  2X0L B;  4U33 A;  4HGA A;  3RI5 A;  1BR1 A;  3UU6 A;  1IZN B;  3PU3 A;  4QWN B;  5FY0 A;  5IWA T;  4I43 B;  4DO0 A;  3Q2M A;  4P09 A;  1M62 A;  2BG9 C;  1HNX T;  2VVS A;  5LP6 E;  4JI1 T;  2LKH A;  3B13 A;  4H9Q C;  3A5X A;  3HKE E;  3FBL A;  1OED A;  3O1I A;  4ZI2 C;  5L3G B;  3B5M A;  2YOE A;  1YQ4 A;  4ASK A;  1W0A A;  4Z90 A;  5FP3 A;  4WBN E;  1WYB A;  5CGM A;  1X9B A;  3AB3 B;  1O3X A;  3LDQ B;  4PJL A;  1N36 T;  2Z6E A;  3MAC A;  4HWH A;  5JDM A;  2MYS A;  3A8Y C;  3U3I A;  2X67 A;  4DBR A;  2E2A A;  5LBQ B;  4CZZ B;  2BS3 A;  4JBW F;  3IF8 B;  3AE8 A;  3BK9 A;  1T98 A;  3PUG A;  4JI4 T;  4CI1 B;  2LT3 A;  4HFH A;  1OED B;  3CQX C;  1KNZ A;  2Y6X A;  3N9Q A;  3FXE B;  5ABG A;  4DV6 T;  4K0K T;  4JV5 T;  3H3M A;  4LF4 T;  2B76 A;  4KMC A;  2WZH A;  3AA7 B;  3EVY A;  3FZF B;  4X20 E;  4XAX B;  4B3R T;  4IT4 A;  5LA6 E;  2EHO B;  4ILA A;  3TLU A;  4C91 A;  1UCU A;  2LRL A;  2V1D B;  3F2E A;  3ZJ2 A;  2B1E A;  2XPK A;  2A2F X;  5BMV E;  4WYV A;  4ILC A;  2WZI A;  5FVL A;  3X1D A;  5HEG A;  4JLE A;  2BG9 E;  3H3A A;  2XAS B;  4LFC T;  4JI8 T;  2VWA A;  2WBL A;  4Q25 A;  5JR9 C;  1VCT A;  4TWD A;  3E0Z A;  2LOS A;  3VU7 H;  4EZ4 A;  4OK0 A;  1N33 T;  5EZY E;  5KMG P;  2CLY C;  4HEA A;  3EI0 A;  2UU9 T;  1HNZ T;  2PBI A;  3ZMT B;  4EED A;  1US7 B;  5JDQ A;  3ZPO A;  2K48 A;  1WFD A;  1Y64 B;  5L3B B;  5M4Y A;  4X5T A;  2NR4 A;  2BVM A;  4LML A;  2A9U A;  1HTJ F;  3AE7 A;  3CWZ B;  3G06 A;  4BJN A;  4COF A;  4F8H A;  3FZM B;  3OJA A;  4PK4 A;  1FEW A;  1HG2 A;  4CN6 A;  2V6Y B;  5L3C B;  3ZCI A;  3RIF A;  3EHZ A;  4KUM B;  4ZEY A;  3AEA A;  2F4V T;  4IHJ E;  3N9P A;  1SHZ C;  4JEU B;  2ES0 A;  3O9X A;  3L39 A;  2QGS A;  3MA9 A;  2BG9 B;  2A3D A;  4DV4 T;  4CN1 A;  4LF9 T;  4TNV A;  4X1Y E;  1WRD A;  2KMF A;  4OX9 T;  2BBJ A;  4CXW A;  5C8Y E;  2C5K T;  2HPL A;  5DQW A;  3TLV A;  5L4E A;  1OXZ A;  1BR0 A;  3AEE A;  3EAM A;  4UIG A;  5HEO A;  3C4X A;  4AKI A;  4GK0 E;  3I0Q A;  1HF8 A;  2X68 A;  2D5U A;  2WQY A;  3NZQ A;  2CHN A;  5A1L A;  2LHR A;  4U2Z A;  1QSD A;  1N32 T;  4KX6 A;  2VB6 A;  4NPP A;  5LCY A;  3FB2 A;  1IBK T;  2FBW A;  2Q9Q A;  2X0H A;  3DTO A;  4AIU A;  2IC6 A;  4DND A;  4QX7 B;  4EIW A;  1HFA A;  5JDG A;  3SFE A;  2E5V A;  2UUC T;  2ZM0 A;  3PE0 A;  3R84 B;  2IHR 1;  3C64 A;  1U5P A;  3QOF A;  5ETW A;  1D0X A;  2XAJ B;  3QK6 A;  2D2S A;  4DR2 T;  2LOP A;  2WY2 A;  1XMO T;  4HWD A;  2YEV C;  2XY8 B;  5LOV E;  3N5L A;  2UXD T;  3K3Q C;  4U3C A;  3SRZ A;  4MBQ A;  4UVB B;  1HCI A;  3RC8 A;  2UXB T;  4IE0 A;  3Q5W A;  2KND A;  4NIQ A;  3ZMZ B;  4EAH A;  1MMA A;  1UX4 A;  1ZV4 X;  2H7O A;  4TV9 E;  5AQR B;  4IDZ A;  3UU5 A;  1U4Q A;  5AQI B;  4TV8 E;  3HKD E;  5AQM B;  4ZI3 C;  3ZT7 A;  4F6R C;  2AE9 A;  2LSJ A;  2C5I T;  5KXJ A;  1FMW A;  3NRX A;  3ZMU B;  3FBZ A;  3PUA A;  4JI0 T;  1Z0P A;  2HH7 A;  2LEH A;  4HFV A;  4QXC B;  1NEN A;  4JI3 T;  2XM2 A;  4MHC A;  2V26 A;  2UXX B;  1E2A A;  2D9D A;  2NWB A;  4DV7 T;  2W63 A;  2JRK A;  2CWO A;  5BR8 T;  5F8P A;  3P4Q A;  4DMV A;  3PUY F;  2UXN B;  2XQ9 A;  4HTE A;  3UFG A;  4XBF B;  5FY7 A;  4IGU A;  2VKO A;  2XSB A;  4ANJ A;  2OV9 A;  3EDU A;  4UVC B;  2FJB A;  2IDO B;  5CFB A;  4LF6 T;  3JC6 D;  4O4I E;  3RX6 A;  4BAY B;  3KV6 A;  2N1G A;  4DVD A;  1KNP A;  3NVO A;  4JYA T;  1VRB A;  4PK5 A;  3ZLI A;  4N78 D;  5ABF A;  3RIU C;  2NW8 A;  3CKD A;  2OA5 A;  2XAF B;  4HFD A;  1CUN A;  3IA3 A;  1HS7 A;  3J9X 1;  1MNE A;  4IE7 A;  3U78 A;  2NTX A;  3UUM A;  2HN1 A;  3N9L A;  4O2A E;  2VL8 A;  1MIW A;  2ZM2 A;  2VQE T;  3OTO T;  2X9X A;  2RA1 A;  4YFS A;  5AQP B;  3T8O A;  5HEH A;  4EGW A;  2XQY A;  1W0B A;  1KFY A;  4ZS3 A;  1OED E;  5ABF B;  2XQ3 A;  4ZI7 E;  2HHH T;  1MMN A;  1UUS A;  5EK4 A;  3GWH A;  5AQV B;  2XQA A;  3RQU A;  3A7M A;  4O8S A;  5HWX A;  2BBH A;  2E9X D;  2N9D A;  1XDO A;  2V7J A;  4HWC A;  2W61 A;  1W9R A;  3GN5 A;  3P8C D;  3P4S A;  3MZK B;  2MTQ A;  2XAG B;  4OHF A;  4DR1 T;  2W2U A;  3S4U A;  4DV3 T;  4GYS A;  2XQ4 A;  3UFE A;  4UEM A;  4NXM T;  4IDN A;  3D0T A;  5HEJ A;  3VKH A;  1XDP A;  3AE2 A;  2WDR A;  1OED C;  3N9N A;  4GYR A;  4QH4 A;  2V6X A;  3ZYK A;  4FI5 A;  3KFW X;  3ZEF B;  4DUY T;  2WMN A;  4ILB A;  3AE6 A;  3TLW A;  4DID B;  2XJ7 A;  2QA7 A;  2VKJ A;  4AQG A;  1IBL T;  4B3S T;  3CX8 B;  3H37 A;  3Q9D A;  4H63 H;  1J5W A;  1QLB A;  4HWF A;  5JTG A;  3RKO A;  1Z8U A;  1ZKE A;  2VQF T;  2IW5 B;  3AAE B;  1IAP A;  3KDS E;  3RKG A;  2W62 A;  4TX5 A;  5L2L A;  2VAS A;  2E9X A;  5TAO A;  5L3D B;  3ZT6 A;  5HXS A;  2ZM6 T;  2H89 A;  3LK2 B;  2WWU A;  4AQF C;  2BVL A;  4NUU A;  1T7S A;  3RQW A;  5HXC A;  2V8S V;  4CQI A;  5LG4 A;  2XAH B;  2WWV A;  4G63 A;  5LGU B;  1XWM A;  1KEY A;  3K3N A;  3NWI A;  5JRC B;  1WR6 A;  1WLX A;  2YU1 A;  3HI2 A;  3HKB E;  4DMW A;  3I9Y A;  4ADZ A;  4UXN B;  1LVK A;  3HKC E;  4GIW A;  3SFD A;  5JDL A;  3WAK A;  4CI3 B;  3MKD A;  3F57 A;  2V7L A;  3GA8 A;  3PUX F;  3HA4 A;  3PUQ A;  2HN2 A;  2WMO A;  2X9Y A;  4TWH A;  3ZC0 A;  2ACZ A;  2H3R A;  1UGO A;  3DJB A;  2JMK A;  4O4H E;  4O4J E;  1WR0 A;  2VK9 A;  1M7K A;  1OWA A;  3UT5 E;  1G73 A;  3JAF A;  1Y01 A;  3ZT5 A;  5AQH B;  4YY3 T;  2BDE A;  3CQG B;  3O1J A;  2BKO A;  4P0B A;  2CEA A;  2WU2 A;  4TNW A;  2LJL A;  2BS2 A;  2EHO C;  2UXC T;  2XHE B;  2VL0 A;  4KHP T;  3L8R A;  5AQO B;  3UUN A;  5C3J A;  1R8I A;  4H9R C;  2LM2 A;  3PUW F;  5E0O A;  5LHG B;  5HWY A;  3QUJ A;  2Y48 B;  2XAQ B;  3UU3 A;  4YSY A;  2HPJ A;  4Z91 A;  4AXP A;  4HFC A;  3LJC A;  4YHH T;  3PU8 A;  3KIN B;  3E22 E;  4KI0 F;  3SS1 A;  3AEG A;  4GK5 E;  4H9O C;  2X51 A;  3B57 A;  3AA0 B;  4HN9 A;  3NRY A;  4YTP A;  3RYH E;  1EZ3 A;  4EXT A;  2ACX A;  3MJX A;  2DHR A;  2H7V C;  2W4X A;  5FNV E;  4EZH A;  4JI7 T;  1J1J A;  3GN5 B;  4DR6 T;  2AXD S;  5F5W A;  3CML A;  4IDO A;  3ZYL A;  2G0U A;  3FHN A;  1IJ6 A;  2R6G F;  3HR0 A;  1FJG T;  5LHI B;  3LK3 B;  2XTL A;  3AAI A;  3T1H T;  1YD8 G;  4X65 T;  2DNX A;  3BQK A;  2W00 A;  4LMJ A;  2CA5 A;  2MPK A;  1W09 A;  2SPC A;  3JAE A;  3JCF A;  1D1A A;  1D1C A;  2CHO A;  2Q9Q C;  2D0U A;  3PJA J;  1MMG A;  4YLH A;  5HAX A;  4AQY T;  2EHO D;  3M65 A;  2PTF A;  2NW9 A;  3AVS A;  2M6B A;  3EAB A;  3SWH A;  4J2C A;  3ZN0 B;  4JEH B;  2CXF A;  3RYC E;  2CXL A;  5JDH A;  3OVU A;  3PDY A;  5JDF A;  3IBP A;  2MAW A;  4EYY R;  5AQQ B;  4ERR A;  2Q9Q B;  2NOX A;  1LRZ A;  1SUM B;  2V6Y A;  5LYJ E;  5HXR A;  2NTY A;  1DU2 A;  4EB6 E;  5EK2 A;  5AQN B;  3BQL A;  4M1P A;  4PFO A;  4AIS A;  4U74 A;  3RF1 A;  2CMR A;  1XNR T;  1VOM A;  3ANW B;  4E7S A;  3UQ7 A;  4ZS2 A;  4DV5 T;  3ZSS A;  3LSV A;  3NKZ A;  3GMI A;  3VR9 A;  2I59 A;  3CIR A;  5CA0 E;  5H6R B;  4TUY E;  3VR8 A;  4CXX A;  4DR3 T;  4H63 V;  4U2Y A;  2KIN B;  4UVA B;  2CBI A;  1CHU A;  2W67 A;  1UX5 A;  4H9P C;  3PV0 F;  3P50 A;  4I50 E;  2DWK A;  4YT0 A;  4U7Y A;  4AKG A;  3VKG A;  2I0M A;  2BS4 A;  1N34 T;  1HG5 A;  4MLK A;  4X66 T;  3AE3 A;  4LF7 T;  4HFB A;  3LK4 2;  4PW8 A;  1XZY A;  2LLY A;  2X9H A;  3AE5 A;  3L09 A;  4IDQ A;  2CE7 A;  3K8P C;  4ZI2 D;  2FUP A;  3O4X E;  3KBU A;  2IUB A;  1KF6 A;  2UUA T;  4ZXL A;  1B7T A;  2FJA A;  3HL6 A;  4YJ3 E;  5AQT B;  2LKG A;  5HYA A;  2X66 A;  3PJA A;  3RH3 A;  4X64 T;  1JNZ A;  2ZMA A;  2I6H A;  2XZE A;  2DLR A;  4PJJ A;  3Q5X A;  4I4T E;  4KP3 C;  4H9S E;  4EYU A;  4HE8 A;  2KSR A;  5LGT B;  4B3M T;  4DR4 T;  2UUB T;  2E8I A;  2DL1 A;  4IIJ E;  2LHN A;  4GKK T;  1QUU A;  3IHR A;  4OFZ A;  5AQG B;  3P7I A;  2LSI A;  2PJQ A;  3L3P A;  2WS3 A;  3PTR B;  5FXZ A;  4HKA A;  3R6N A;  1AJ3 A;  4AKH A;  3E08 A;  2YK0 A;  3ZN1 B;  2ODU A;  4WBO A;  5J2U E;  3VHL A;  5LHH B;  2W66 A;  4JI6 T;  3RIA A;  1E7P A;  4B6X A;  4BA9 A;  2CWY A;  3OYX A;  4QH5 A;  4IL9 A;  2L9Q A;  1NWM X;  2JJ9 A;  2M6I A;  3WAJ A;  2ODV A;  1HR0 T;  4A98 A;  1UK5 A;  4A56 A;  3PUS A;  3OBV E;  4NUV A;  5AQL B;  2K3W A;  5LGN B;  3AVR A;  4IRE A;  5KX5 E;  4YHJ A;  4CN4 A;  3CX6 B;  2PG8 A;  4OYK A;  4QX8 B;  4YTM A;  3UUL A;  4ILU A;  4TWF A;  5ADX L;  4LFA T;  4IDP A;  5IHY A;  3UQ4 A;  2D0T A;  5F3J A;  3AXJ B;  4LF8 T;  3AE4 A;  2LSY A;  2L3L A;  3ETU A;  1E1H B;  2CXD A;  3EDV A;  4LMK A;  5LJM A;  2OLT A;  1ZOY A;  3FZH B;  2VUR A;  3AE1 A;  3PUR A;  5LB7 B;  3V5S A;  3ZMS B;  3CPZ A;  4CI2 B;  2CPT A;  4X1I E;  4ZHQ E;  5L3E B;  1D0Z A;  1XNQ T;  3N2O A;  3P4R A;  1SA0 E;  5CJ5 A;  3W15 B;  2WB5 A;  3K1S A;  2ZLY A;  3N9O A;  1WYC A;  2C0S A;  3TLT A;  3RYI E;  3AXJ A;  3KVB A;  4H9N C;  1S94 A;  4YJ2 E;  5KDM C;  3KBT A;  2QYW A;  4U72 A;  3UU4 A;  5HXH A;  4AQF A;  4UF0 B;  4YXD A;  4DV2 T;  2MOZ A;  3RHW A;  5FYM A;  4MFR A;  4WZX A;  3KVA A;  5LMN T;  2KXP B;  3ONX A;  3P4W A;  3CK6 A;  2DI4 A;  2KZ7 B;  2XQ7 A;  5C2T A;  2CM0 A;  4ZZB A;  1D0Y A;  1T72 A;  5AFU L;  5JVD E;  4DV0 T;  5DQV A;  1D1B A;  2WAU A;  3JC6 C;  5L4H A;  3AE9 A;  3UUB A;  4EEB A;  2IC9 A;  1YW0 A;  4L9I A;  4UF0 A;  4WW0 A;  5IUX A;  3EUH A;  2XQ5 A;  5LJN A;  1UUR A;  3RPU A;  4GKJ T;  5LBM A;  4I55 E;  2E9X B;  5LMU T;  2VVN A;  5J0Z A;  2CRB A;  2K9A A;  5JR9 A;  2MBG A;  3J7Y q;  4OYJ A;  1J5E T;  1IBM T;  2V5D A;  5HCM A;  4KHZ F;  3N2K E;  4U31 A;  4IE6 A;  2J47 A;  3LBX B;  4YSX A;  3N9M A;  2BG9 A;  4DUZ T;  1LKX A;  5ABH A;  1ZP0 A;  3N2G E;  4U7I A;  1X79 A;  2PFV A;  3UTK A;  4TN7 B;  2M67 A;  4P0A A;  5FXX A;  4I0U A;  4ZI3 D;  3MK7 C;  4LF5 T;  5JQG E;  4O2B E;  4ZZC A;  3QC9 A;  1MIY A;  3AEB A;  3C98 B;  3ANW A;  3LBX A;  3Q5E A;  5JR9 B;  2LRK A;  4E7Z A;  3C4W A;  2NW7 A;  4NXN T;  3RC3 A;  3ETV A; 
#chains in the Genus database with same CATH homology
 1N36 T;  1XNR T;  1HNW T;  4DV5 T;  2VQE T;  3OTO T;  4DR3 T;  4JI4 T;  2HHH T;  4DR7 T;  4DV6 T;  4K0K T;  4JV5 T;  4LF4 T;  1N34 T;  4X66 T;  4LF7 T;  4B3R T;  4DR1 T;  4DV3 T;  2UUA T;  4NXM T;  4LFC T;  4JI8 T;  4DR5 T;  4X64 T;  1N33 T;  4DR4 T;  1I94 T;  4B3M T;  4DUY T;  2UUB T;  2UU9 T;  1HNZ T;  4GKK T;  1IBL T;  4B3S T;  2E5L T;  2VQF T;  4JI6 T;  1HR0 T;  2ZM6 T;  2F4V T;  4LFA T;  4LF9 T;  4DV4 T;  4DV1 T;  4OX9 T;  4LF8 T;  3T1Y T;  4X62 T;  1XNQ T;  4B3T T;  1N32 T;  4JI2 T;  1IBK T;  4YY3 T;  2UUC T;  2UXC T;  4KHP T;  5LMN T;  1XMO T;  4LFB T;  2UXD T;  2UXB T;  4DV0 T;  4YHH T;  4GKJ T;  4DV2 T;  5IWA T;  5LMU T;  4JI5 T;  1IBM T;  4JI0 T;  1J5E T;  4JI7 T;  4DR6 T;  4JI3 T;  1XMQ T;  1FJG T;  4DUZ T;  4DV7 T;  5BR8 T;  3T1H T;  4X65 T;  4DR2 T;  4AQY T;  4LF5 T;  1HNX T;  4LF6 T;  4JI1 T;  4JYA T;  4NXN T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...