2UUBT

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 36
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 2uubT00
4LF6T 1IBMT 1XMOT 4DV0T 2UXBT 4LF8T 4DV2T 4KHPT 4X62T 4LFBT 4B3TT 2UXDT 2UUBT 4JI4T 4DV7T 2UU9T 4DR4T 1XNQT 4JI2T 1HR0T 4DR5T 4DUYT 2HHHT 4K0KT 1J5ET 4JV5T 1FJGT 4JI6T 4JI3T 2ZM6T 4DR3T 4JI0T 4DUZT 3T1HT 2UUCT 1HNZT 2VQET 4LF5T 2VQFT 5IWAT 2E5LT 4JI5T 4YY3T 4OX9T 4X64T 4LFAT 4LF4T 4B3ST 4JI8T 4JI1T 4AQYT 4DV5T 4DV6T 5LMUT 1XNRT 4DV1T 3OTOT 4GKJT 4LFCT 4LF7T 1HNWT 2F4VT 4JI7T 4LF9T 5BR8T 4B3RT 4DV3T 1N33T 4X66T 4YHHT 1IBKT 3T1YT 1N36T 4DV4T 1HNXT 1I94T 4X65T 4DR1T 2UUAT 4DR6T 1N34T 5LMNT 4B3MT 1N32T 4DR7T 1IBLT 4JYAT 4GKKT 1XMQT 4NXMT 4NXNT 2UXCT 4DR2T
chains in the Genus database with same CATH superfamily
3SS1A 3PUVF 4V1Av 4KP3C 3KVAA 2BG9B 1WYBA 3PUWF 3CX8B 5CB4E 4BAYB 3ETUA 2LOPA 1HR0T 3TLUA 5L3FB 4U2ZA 3ZT6A 3MXZA 1VCTA 3QOFA 2ZM6T 4EV6A 2W00A 2WAUA 3I0QA 2ACZA 1MNEA 3IEEA 3PTRB 1JNRA 5IWAT 4LF4T 3JAEA 4ZI7E 4HWIB 5AQGB 2J62A 3RYIE 2FJDA 4L9IA 5FYMA 5JR9B 1ZHCA 2WU5A 3N9LA 4P0AA 1IJ5A 3ZJ1A 4WBOA 2HPLA 2WM9A 1W9RA 4B3RT 5DQVA 4I43B 4HFBA 5FNVE 3UU4A 3T1YT 3OYZA 3AEFA 1VOMA 4X5TA 4C91A 3CQXC 2VK9A 4HWDA 4UVCB 1MMGA 4ZHQE 1G73A 2V7MA 1WR0A 2L8KA 4EEDA 4WW0A 4Q25A 2JMKA 5C8YE 3AE8A 4Z91A 3BK9A 5L4HA 3S4UA 4LF6T 2CM0A 4GYRA 4YTNA 3CMLA 4PJNA 2IAKA 2KNDA 5L3GB 4A98A 1FIOA 3OBVE 4YSXA 5H6RB 2JMHA 3RRWA 4EZ4A 2QA7A 3ZEFB 1SUMB 4IT4A 1X9BA 4DIDB 4H63V 2RPAA 4DUZT 3QUJA 2XASB 4YT0A 2V5CA 3OYXA 4O4IE 2BBJA 2EHOA 4UELA 5LBQB 2P9BA 3DTOA 5LXTE 5HCJA 2XY8B 4U7IA 3H3MA 3FBLA 4UR9A 3UQ7A 2V7LA 2LM9A 4PJJA 1IAPA 1AJ3A 3AE6A 2WZHA 3NWIA 3HKEE 3MA9A 5AQLB 3K3QC 2OV9A 1B7TA 2Q9QC 3N9OA 5J0ZA 4TZ4C 4QKNA 4G63A 3P4RA 3AEBA 2IDOB 5AQVB 5HCMA 3B5MA 3RYFE 5LYJE 3HKBE 5ABEA 2XQ3A 4I55E 2R6GF 3NRXA 2M6IA 5IYZE 5LHIB 3ZCIA 1QLBA 4DMVA 4OYKA 4LF8T 5JDHA 1U4QA 4X62T 1LRZA 3FHNA 4MHCA 2IIUA 3PUAA 4N78D 2WMOA 3IHRA 3ZSSA 2MOZA 2JQKA 4HFHA 4NIQA 5HEUA 3JC6D 2BVMA 2VB6A 5KXJA 1HS7A 2L9QA 3LFMA 3KINB 3RYHE 3N9PA 4IE0A 3KBUA 1OEDC 4IIJE 5JRCB 2LE8A 4AISA 3RRCA 4H9QC 4KBMB 4EXTA 2PJQA 2K24A 5BR8T 2JIWA 2YDSA 4OFZA 4P0BA 3I1AA 3AAIA 3LBXB 3T8OA 2IMLA 1XDPA 2KMFA 3P4QA 5HEHA 2MPKA 3HKDE 4ZI2D 4A5XA 1BR1A 3G06A 4X20E 3UUBA 4DR2T 2JQHA 2BS3A 4U33A 1R8IA 4CN4A 1XDOA 4ZEYA 5M4YA 3ZCJA 2W62A 4KI0F 4DVDA 5LG3A 2ZM2A 1OEDE 2LSYA 3A7MA 3CX6B 5F5WA 2BS2A 4O8SA 2VKHA 3ZN0B 2XSAA 4JI3T 5FP3A 1HF8A 3CX7B 2D0UA 4WBNE 3D0TA 3AE5A 2E5LT 2YKSA 4L5GA 4H9PC 4PFOA 3QC9A 5JVDE 2VURA 3L09A 3C50A 2ODUA 4FI5A 4QH4A 4TWHA 5LMUT 3CWZB 1W0BA 3CKDA 3K3NA 5EK4A 3L8RA 3TLWA 2QYWA 3TLTA 3N9MA 4YXDA 3UULA 4JI7T 4XBFB 2FJEA 2Y8DA 4EZHA 1KNZA 4I50E 1I6ZA 4H9SE 4CN6A 4U72A 3PUSA 2VWAA 4U2YA 4EOZB 3N9QA 4HEAA 3ZC1A 3DJBA 1FMWA 3PURA 2CLYC 2NW9A 2CRBA 3KV5A 5DQWA 2DWKA 4EIWA 3IF8B 2UXXB 2CXFA 4O2AE 3UUXB 1KK7A 2UXBT 2HN1A 4LFBT 3IA3A 4B3TT 4A56A 2KWIB 2UUBT 1BR0A 4MBQA 4TV9E 1BR2A 2A3DA 4AQGA 2E9XD 3AE7A 1J5ET 4JV5T 3ZLIA 1MMDA 1W0AA 4HKAA 3E0ZA 3EABA 2UXNB 5HWYA 5JDNA 3NZPA 1OWAA 3PU8A 1D1CA 4WYVA 3O1JA 4TN7B 4AKRB 1NEKA 2NP9A 4AI6A 2X9XA 2C5JA 3ZPOA 4DV6T 4ZI2C 4GYSA 3FZKB 1D0YA 2X0HA 1X79A 2KWHA 2W61A 5JTGA 4YJ2E 4IL9A 2CPTA 3AB3B 3JAFA 5CGMA 4CQIA 4GKJT 5GONE 2F4VT 2BG9A 4IDQA 2W2UA 2WS3A 5L2LA 3AEGA 1KF6A 3FXDB 1E1HB 4IGUA 2LKHA 5AQSB 2NTYA 4ANJA 2LSGA 2FBWA 2V6YB 4HFVA 4YSZA 3UU5A 4DR7T 3RI5A 3ZMVB 2C5IT 4O4HE 1CHUA 5LP6E 2LSJA 3O1HA 5HXEA 2DI4A 4NUUA 5EZYE 5J1GA 3V5UA 4YTMA 2ZM8A 4P09A 2UXDT 2LM2A 4AKGA 1MIYA 4PJMA 2UU9T 5JR9A 1KNPA 2H88A 2BS4A 3PUXF 2YU1A 3KBTA 1YW0A 4DMWA 5H6QB 3Q5DA 3C4WA 3EUHA 4H63H 2Q9QD 3UTKA 4AXPA 4QH5A 2KXPB 2M67A 1NWMX 2BZBA 2I0MA 4E7ZA 3TKLB 3AAEB 2ODVA 4JI1T 2H3RA 2XHEB 4OYJA 1L0VA 2SPCA 3W15B 1UURA 4TUYE 2WY2A 5AQQB 3AXJA 3PE0A 5AQPB 4ZZBA 4B6XA 3FBZA 3MK7C 3ZT7A 3K3OA 1N34T 2E9XC 5L3CB 2N1GA 3V5SA 1EZ3A 5E0OA 1LKXA 4JYAT 3ZYKA 3FZFB 5A1LA 4EYUA 3RIUA 4COFA 5FY1A 2KINB 5ABGA 3RGLA 2XQAA 4DV2T 3WAJA 2WBLA 3VU7H 2BKPA 4YLHA 1Z8UA 4JI4T 3N9NA 3LK2B 4DR5T 3EHZA 1YXRA 3AECA 2XM1A 4HFDA 3CQGB 3LG7A 2ES0A 4PNIA 2PBIA 1FJGT 2DWGA 2XTLA 2I6HA 3AA1B 3AXJB 4TWDA 2N2NA 4M1PA 2IHR1 1WYCA 3ZKRA 4AIUA 2C0SA 4C90A 2H89A 4LF5T 3H3AA 5JDQA 2XQ8A 4U7YA 3TLVA 3NVOA 4YTPA 4AQFA 4UXNB 3KVBA 2WWVA 2WB5A 4QX8B 1HG2A 1HX1B 3QB5K 4G2AA 2W4XA 3KFWX 4DV4T 1T8BA 2UUAT 1D0ZA 2IUBA 2RP4A 2VKOA 2PTFA 3EDVA 4PAGA 5HAXA 3ZSTA 2XAQB 3N2OA 3SOLA 1HTJF 5AQMB 3ABVA 2XUEA 4LMKA 1UX5A 4ZS2A 4X1IE 3MJXA 2Y48B 5L3BB 1BR4A 3NBXX 2CE7A 2YN6A 2CBIA 4DV0T 4IE7A 1OXZA 3M65A 1T72A 5AQUB 2XQ9A 2X66A 3HA4A 4ZXLA 5JRCA 3IBPA 4DR4T 3Q9DA 2ZMAA 4K0KT 3KV6A 5LHHB 4U74A 2W66A 2VKDA 2C5KT 2V5DA 2CMRA 2ZLYA 3ONJA 3LBXA 3WAKA 4XZCA 5LGNB 4YY3T 4OX9T 4OK0A 2VASA 2BDEA 2YOEA 2DL1A 1WLXA 4ILAA 2VKJA 2CLYB 2K5BB 3RHWA 1ZP0A 2XZEA 4ZS3A 4H9RC 4LF7T 1UCUA 2LRLA 5HEJA 1IZNB 4DV3T 4YSYA 1ZEEA 1IBKT 3LK3B 3AEEA 4DR1T 1D0XA 5HEOA 3AVSA 4B3MT 5FKYA 2WU2A 3E22E 4IDOA 2JQQA 4U3CA 4CN1A 2NWBA 1XMQT 1D1BA 3EVYA 4HFIA 3SFDA 1M62A 1U5PA 3ZMZB 5LJMA 2YDQA 3UU6A 2V6XA 1WFDA 4TWFA 3OJAA 5ETWA 2XQ4A 2LT3A 2XQYA 2MTQA 1QUUA 3N5LA 1YKEB 3RQWA 5AQRB 3ESLA 5ADXL 4TNWA 3AE9A 4J2CA 5HXHA 5AFUL 3I0OA 3AAAB 2X0YA 5FXZA 2G0UA 2E2AA 4ERRA 5AQHB 3RKGA 4FJOA 3OKQA 4EB6E 3RC8A 1D1AA 3AVRA 4IDPA 1HG5A 4UIGA 3Q5WA 4HE8A 4IE6A 2XSBA 2LKGA 3VR9A 4H9NC 4MLKA 4O4LE 2LRKA 2XAHB 3P4WA 4MALA 4HWFA 2LLYA 2CWYA 4GK5E 2KZ7B 4H9OC 3R84B 2CXLA 3UUNA 3HKCE 4ILUA 3PJAA 5AQFB 5LMNT 5AQTB 2LJLA 1DU2A 4TV8E 4F6RC 2FUPA 3NZQA 4KHZF 5JDLA 2PFVA 4YHJA 4JUYA 2BVLA 3PUYF 5CA0E 5IUXA 2V1DB 3H37A 1E7PA 5JDGA 3P8CD 2XPKA 2GK9A 5LA6E 3LSVA 4CI3B 2KT9A 2WDVA 4JLEA 2EHOC 4HN9A 4K0UA 4DV7T 1XNQT 5KDMC 3ZT5A 3LDQB 3EDUA 1WR6A 4I0UA 4AKLA 2WZIA 4JI0T 5JDFA 2MAWA 5L3DB 2CHNA 3P7IA 2V6YA 4UEMA 1YD8G 2D5UA 3M3ZB 4JI5T 3JCFA 1G8XA 2YINA 4O2BE 1SHZC 2E9XB 2AE9A 1XNRT 2OLTA 1HNWT 4BJMA 5TAOA 5LG4A 4LF9T 2N9DA 3HR0A 4PJLA 2D9DA 5L4EA 3RIAA 2YU2A 2VL8A 3B57A 1WCRA 1QSDA 4ISTA 5FXVA 2XM2A 3ETVA 2WSSV 3ZYMA 3RC3A 3MACA 5DABA 2Q9QA 4QHOA 4UF0B 1YQ3A 2UXCT 3UT5E 3E08A 4KUMB 1VRBA 4ISSA 1V9DA 2KSRA 3FXEB 4O4JE 4YJ3E 3BQIA 4IHJE 3N2KE 2A9UA 4IE4A 3C4XA 5JDMA 2IW5B 2JRKA 5LOVE 2BBHA 1MMAA 3AA7B 4IREA 1Z0PA 1S35A 2BKNA 3P50A 5LGTB 5HWXA 2L3LA 3F57A 3PDYA 5FL0A 3VRAA 3J7Yq 2NW7A 2K3WA 2Q9QB 1IJ6A 4DO0A 3R6NA 4QXCB 1UK5A 5CJ5A 2LOSA 3WI3A 1N36T 4EEBA 2NR4A 4QWNB 4L0RA 1OEDA 1IBLT 3RF1A 4X1YE 5EK2A 2WQYA 1M7KA 4TX5A 3O9XA 4CXXA 4F8HA 2HN2A 4A97A 1KEYA 3Q5XA 3FZLB 2CEAA 2WWUA 2H7OA 3RPUA 1Y01A 1ZKEA 2FJBA 2WDQA 1IBMT 3N2GE 3QK6A 5L47A 5FY7A 1WRDA 4ASKA 3RH3A 5HXSA 1HFAA 1KNRA 2HHHT 3RKOA 3KDSE 2QRXA 3O4XE 1CUNA 2XQ7A 2E8IA 3QB5A 2MYSA 3GWHA 3FZHB 2VQFT 3EI0A 2JPFA 1NENA 3GN5B 5J2UE 2X0LB 4AQYT 1OEDB 1XZYA 4DBQA 3HL6A 3U78A 3PU3A 1NAFA 1JNZA 1W09A 2WCAA 3UFEA 4BA9A 4QXBB 2CXDA 2LSIA 3GA8A 5CA1E 4HGAA 2IC6A 4NPPA 2W63A 5BMVE 2CWOA 5DJQC 4XAXB 2B76A 5HXCA 3PV0F 3PUGA 2AXDS 2LHNA 4PFPA 3ONLC 4NUVA 2DLRA 2Y6XA 4CI1B 3A5XA 4CXYA 4ZI3D 2D2SA 3ONXA 2RA1A 4WNKA 2WDRA 4QXHB 2LHRA 1SA0E 4KHPT 1O3XA 3Q2MA 3BQLA 4JI2T 2XJ7A 3UUMA 2I59A 5FVKA 3EAMA 1KFYA 1SE7A 5HXRA 3KV4A 1XWMA 1Y64B 3P4PA 3B13A 2BG9C 3LK42 3ZMUB 3GMIA 5CFBA 3ZN1B 2JQ9A 2XQ5A 4LFAT 5LNKA 2X9HA 1ZOYA 3ZC0A 1UX4A 1J5WA 4X1KE 3J9X1 2M6BA 4DV1T 2V26A 4UVBB 1HX8A 3FZMB 2ZM0A 1S94A 4LFCT 3F2EA 3TLSA 3L39A 2V7IA 5LBMA 2J47A 2BKOA 5LJNA 2W67A 3AE4A 4DR6T 2A72A 3NKZA 4LMLA 2E5VA 3CPZA 4PW8A 4TNVA 2EHOD 2EHOB 2WP9A 1LVKA 3VRBA 1N32T 4GKKT 2CHOA 5JR9C 4NXMT 3RQUA 2BG9E 2X67A 2PG8A 3K1SA 1MIVA 3CVRA 3CK6A 4ZZCA 4UV9B 4IDNA 5HYAA 2DHRA 5L3EB 1H7CA 4DUYT 4HWHA 5JH7E 2K48A 3KV9A 4EYYR 3T1HT 4MFRA 5JREA 3L3PA 3AA0B 4DNDA 3Q5EA 3QNUA 3VR8A 5FMNA 1UUSA 4B3ST 4QX7B 5KMGP 3AEAA 4DV5T 1FMVA 2B1EA 3PUZF 3AA6B 4ZI3C 3MKDA 3MZKB 1GQEA 5FVLA 3K8PC 3F31A 3ZMSB 4U31A 1MNDA 2J1DG 1N33T 4X66T 1HCIA 1HNXT 1I94T 3RIUC 2YEVC 2NW8A 5FXXA 3X1DA 3C51A 4AKIA 3OPCA 3UU8A 5F3JA 2X51A 4NXNT 2KLQA 3RIFA 4Z8XA 2DNXA 2V8SV 2HPJA 5IHYA 4JBWF 2VL0A 1XMOT 2E9XA 4I4TE 2H7VC 4YFSA 4GK0E 3RLFF 3UU3A 3PUQA 4GIWA 2Z6EA 5FY0A 4AKHA 4HWCA 1T7SA 2X9YA 1UGOA 4IE5A 4JI6T 1ZV4X 4AQFC 3ZMTB 4DR3T 4KX6A 3UFGA 2ACXA 2J4GA 3DP7A 5KX5E 3PJAJ 2X68A 2UUCT 3OVUA 2LEHA 4IL4A 2WMNA 4WZXA 4UF0A 2VVNA 5AQIB 4HFEA 3OTOT 3ZJ2A 3ZYLA 4PK6A 1VCSA 2CCQA 4LMJA 1FEWA 3AE2A 3JC6C 3AEDA 4HFCA 3P4SA 3AE1A 3JADA 2JJ9A 3SWHA 3HI2A 2W0GA 2FJAA 2QGSA 2YK0A 4CI2B 3CIRA 3SFEA 5FXWA 1YQ4A 5LHGB 1E2AA 2CA5A 2LSKA 2YDRA 3C98B 4PK4A 2XAFB 2VVSA 4EAHA 5C2TA 3C4ZA 4ILBA 3RYCE 4UVAB 4KMCA 4GOUA 3UQ4A 2MBGA 3I9YA 2DCFA 2XAJB 2HH7A 4ZOLE 1MMNA 5J2TE 2NOXA 3VKHA 4HTEA 5AQNB 4Z90A 1US7B 4E7SA 3C64A 4BJNA 5ABFA 3VHLA 4QH1A 5EK3A 3LJCA 4UV8B 4ILCA 4CXWA 5JQGE 1T98A 3SRZA 3ANWA 4JEUB 2OA5A 2CBJA 3RX6A 1HNZT 2VQET 2A2FX 2NTXA 1MIWA 4X64T 3AE3A 4JI8T 3CQCB 5LCYA 5AQKB 4PK5A 5FL1A 4P1NA 4CZZB 4OHFA 3U3IA 2V7JA 5LGUB 2IC9A 4EGWA 1LVFA 1J1JA 4YHHT 4IDZA 3VKGA 4X65T 2QVAA 2XQ6A 4JEHB 2K9AA 2D0TA 3BQKA 3NRYA 4DBRA 3I9WA 4ADZA 3FB2A 5ABFB 1YKHB 2V7KA 5HEGA 5AQOB 2X9WA 3A8YC 5F8PA 5ABHA 5AQJB 5C3JA 5LB7B 3O1IA 3GN5A 2XAGB 3ANWB
chains in the Genus database with same CATH topology
4LF6T 1IBMT 1XMOT 4DV0T 2UXBT 4LF8T 4DV2T 4KHPT 4X62T 4LFBT 4B3TT 2UXDT 2UUBT 4JI4T 4DV7T 2UU9T 4DR4T 1XNQT 4JI2T 1HR0T 4DR5T 4DUYT 2HHHT 4K0KT 1J5ET 4JV5T 1FJGT 4JI6T 4JI3T 2ZM6T 4DR3T 4JI0T 4DUZT 3T1HT 2UUCT 1HNZT 2VQET 4LF5T 2VQFT 5IWAT 2E5LT 4JI5T 4YY3T 4OX9T 4X64T 4LFAT 4LF4T 4B3ST 4JI8T 4JI1T 4AQYT 4DV5T 4DV6T 5LMUT 1XNRT 4DV1T 3OTOT 4GKJT 4LFCT 4LF7T 1HNWT 2F4VT 4JI7T 4LF9T 5BR8T 4B3RT 4DV3T 1N33T 4X66T 4YHHT 1IBKT 3T1YT 1N36T 4DV4T 1HNXT 1I94T 4X65T 4DR1T 2UUAT 4DR6T 1N34T 5LMNT 4B3MT 1N32T 4DR7T 1IBLT 4JYAT 4GKKT 1XMQT 4NXMT 4NXNT 2UXCT 4DR2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF6 T;  1IBM T;  1XMO T;  4DV0 T;  2UXB T;  4LF8 T;  4DV2 T;  4KHP T;  4X62 T;  4LFB T;  4B3T T;  2UXD T;  2UUB T;  4JI4 T;  4DV7 T;  2UU9 T;  4DR4 T;  1XNQ T;  4JI2 T;  1HR0 T;  4DR5 T;  4DUY T;  2HHH T;  4K0K T;  1J5E T;  4JV5 T;  1FJG T;  4JI6 T;  4JI3 T;  2ZM6 T;  4DR3 T;  4JI0 T;  4DUZ T;  3T1H T;  2UUC T;  1HNZ T;  2VQE T;  4LF5 T;  2VQF T;  5IWA T;  2E5L T;  4JI5 T;  4YY3 T;  4OX9 T;  4X64 T;  4LFA T;  4LF4 T;  4B3S T;  4JI8 T;  4JI1 T;  4AQY T;  4DV5 T;  4DV6 T;  5LMU T;  1XNR T;  4DV1 T;  3OTO T;  4GKJ T;  4LFC T;  4LF7 T;  1HNW T;  2F4V T;  4JI7 T;  4LF9 T;  5BR8 T;  4B3R T;  4DV3 T;  1N33 T;  4X66 T;  4YHH T;  1IBK T;  3T1Y T;  1N36 T;  4DV4 T;  1HNX T;  1I94 T;  4X65 T;  4DR1 T;  2UUA T;  4DR6 T;  1N34 T;  5LMN T;  4B3M T;  1N32 T;  4DR7 T;  1IBL T;  4JYA T;  4GKK T;  1XMQ T;  4NXM T;  4NXN T;  2UXC T;  4DR2 T; 
#chains in the Genus database with same CATH topology
 3SS1 A;  3PUV F;  4V1A v;  4KP3 C;  3KVA A;  2BG9 B;  1WYB A;  3PUW F;  3CX8 B;  5CB4 E;  4BAY B;  3ETU A;  2LOP A;  1HR0 T;  3TLU A;  5L3F B;  4U2Z A;  3ZT6 A;  3MXZ A;  1VCT A;  3QOF A;  2ZM6 T;  4EV6 A;  2W00 A;  2WAU A;  3I0Q A;  2ACZ A;  1MNE A;  3IEE A;  3PTR B;  1JNR A;  5IWA T;  4LF4 T;  3JAE A;  4ZI7 E;  4HWI B;  5AQG B;  2J62 A;  3RYI E;  2FJD A;  4L9I A;  5FYM A;  5JR9 B;  1ZHC A;  2WU5 A;  3N9L A;  4P0A A;  1IJ5 A;  3ZJ1 A;  4WBO A;  2HPL A;  2WM9 A;  1W9R A;  4B3R T;  5DQV A;  4I43 B;  4HFB A;  5FNV E;  3UU4 A;  3T1Y T;  3OYZ A;  3AEF A;  1VOM A;  4X5T A;  4C91 A;  3CQX C;  2VK9 A;  4HWD A;  4UVC B;  1MMG A;  4ZHQ E;  1G73 A;  2V7M A;  1WR0 A;  2L8K A;  4EED A;  4WW0 A;  4Q25 A;  2JMK A;  5C8Y E;  3AE8 A;  4Z91 A;  3BK9 A;  5L4H A;  3S4U A;  4LF6 T;  2CM0 A;  4GYR A;  4YTN A;  3CML A;  4PJN A;  2IAK A;  2KND A;  5L3G B;  4A98 A;  1FIO A;  3OBV E;  4YSX A;  5H6R B;  2JMH A;  3RRW A;  4EZ4 A;  2QA7 A;  3ZEF B;  1SUM B;  4IT4 A;  1X9B A;  4DID B;  4H63 V;  2RPA A;  4DUZ T;  3QUJ A;  2XAS B;  4YT0 A;  2V5C A;  3OYX A;  4O4I E;  2BBJ A;  2EHO A;  4UEL A;  5LBQ B;  2P9B A;  3DTO A;  5LXT E;  5HCJ A;  2XY8 B;  4U7I A;  3H3M A;  3FBL A;  4UR9 A;  3UQ7 A;  2V7L A;  2LM9 A;  4PJJ A;  1IAP A;  1AJ3 A;  3AE6 A;  2WZH A;  3NWI A;  3HKE E;  3MA9 A;  5AQL B;  3K3Q C;  2OV9 A;  1B7T A;  2Q9Q C;  3N9O A;  5J0Z A;  4TZ4 C;  4QKN A;  4G63 A;  3P4R A;  3AEB A;  2IDO B;  5AQV B;  5HCM A;  3B5M A;  3RYF E;  5LYJ E;  3HKB E;  5ABE A;  2XQ3 A;  4I55 E;  2R6G F;  3NRX A;  2M6I A;  5IYZ E;  5LHI B;  3ZCI A;  1QLB A;  4DMV A;  4OYK A;  4LF8 T;  5JDH A;  1U4Q A;  4X62 T;  1LRZ A;  3FHN A;  4MHC A;  2IIU A;  3PUA A;  4N78 D;  2WMO A;  3IHR A;  3ZSS A;  2MOZ A;  2JQK A;  4HFH A;  4NIQ A;  5HEU A;  3JC6 D;  2BVM A;  2VB6 A;  5KXJ A;  1HS7 A;  2L9Q A;  3LFM A;  3KIN B;  3RYH E;  3N9P A;  4IE0 A;  3KBU A;  1OED C;  4IIJ E;  5JRC B;  2LE8 A;  4AIS A;  3RRC A;  4H9Q C;  4KBM B;  4EXT A;  2PJQ A;  2K24 A;  5BR8 T;  2JIW A;  2YDS A;  4OFZ A;  4P0B A;  3I1A A;  3AAI A;  3LBX B;  3T8O A;  2IML A;  1XDP A;  2KMF A;  3P4Q A;  5HEH A;  2MPK A;  3HKD E;  4ZI2 D;  4A5X A;  1BR1 A;  3G06 A;  4X20 E;  3UUB A;  4DR2 T;  2JQH A;  2BS3 A;  4U33 A;  1R8I A;  4CN4 A;  1XDO A;  4ZEY A;  5M4Y A;  3ZCJ A;  2W62 A;  4KI0 F;  4DVD A;  5LG3 A;  2ZM2 A;  1OED E;  2LSY A;  3A7M A;  3CX6 B;  5F5W A;  2BS2 A;  4O8S A;  2VKH A;  3ZN0 B;  2XSA A;  4JI3 T;  5FP3 A;  1HF8 A;  3CX7 B;  2D0U A;  4WBN E;  3D0T A;  3AE5 A;  2E5L T;  2YKS A;  4L5G A;  4H9P C;  4PFO A;  3QC9 A;  5JVD E;  2VUR A;  3L09 A;  3C50 A;  2ODU A;  4FI5 A;  4QH4 A;  4TWH A;  5LMU T;  3CWZ B;  1W0B A;  3CKD A;  3K3N A;  5EK4 A;  3L8R A;  3TLW A;  2QYW A;  3TLT A;  3N9M A;  4YXD A;  3UUL A;  4JI7 T;  4XBF B;  2FJE A;  2Y8D A;  4EZH A;  1KNZ A;  4I50 E;  1I6Z A;  4H9S E;  4CN6 A;  4U72 A;  3PUS A;  2VWA A;  4U2Y A;  4EOZ B;  3N9Q A;  4HEA A;  3ZC1 A;  3DJB A;  1FMW A;  3PUR A;  2CLY C;  2NW9 A;  2CRB A;  3KV5 A;  5DQW A;  2DWK A;  4EIW A;  3IF8 B;  2UXX B;  2CXF A;  4O2A E;  3UUX B;  1KK7 A;  2UXB T;  2HN1 A;  4LFB T;  3IA3 A;  4B3T T;  4A56 A;  2KWI B;  2UUB T;  1BR0 A;  4MBQ A;  4TV9 E;  1BR2 A;  2A3D A;  4AQG A;  2E9X D;  3AE7 A;  1J5E T;  4JV5 T;  3ZLI A;  1MMD A;  1W0A A;  4HKA A;  3E0Z A;  3EAB A;  2UXN B;  5HWY A;  5JDN A;  3NZP A;  1OWA A;  3PU8 A;  1D1C A;  4WYV A;  3O1J A;  4TN7 B;  4AKR B;  1NEK A;  2NP9 A;  4AI6 A;  2X9X A;  2C5J A;  3ZPO A;  4DV6 T;  4ZI2 C;  4GYS A;  3FZK B;  1D0Y A;  2X0H A;  1X79 A;  2KWH A;  2W61 A;  5JTG A;  4YJ2 E;  4IL9 A;  2CPT A;  3AB3 B;  3JAF A;  5CGM A;  4CQI A;  4GKJ T;  5GON E;  2F4V T;  2BG9 A;  4IDQ A;  2W2U A;  2WS3 A;  5L2L A;  3AEG A;  1KF6 A;  3FXD B;  1E1H B;  4IGU A;  2LKH A;  5AQS B;  2NTY A;  4ANJ A;  2LSG A;  2FBW A;  2V6Y B;  4HFV A;  4YSZ A;  3UU5 A;  4DR7 T;  3RI5 A;  3ZMV B;  2C5I T;  4O4H E;  1CHU A;  5LP6 E;  2LSJ A;  3O1H A;  5HXE A;  2DI4 A;  4NUU A;  5EZY E;  5J1G A;  3V5U A;  4YTM A;  2ZM8 A;  4P09 A;  2UXD T;  2LM2 A;  4AKG A;  1MIY A;  4PJM A;  2UU9 T;  5JR9 A;  1KNP A;  2H88 A;  2BS4 A;  3PUX F;  2YU1 A;  3KBT A;  1YW0 A;  4DMW A;  5H6Q B;  3Q5D A;  3C4W A;  3EUH A;  4H63 H;  2Q9Q D;  3UTK A;  4AXP A;  4QH5 A;  2KXP B;  2M67 A;  1NWM X;  2BZB A;  2I0M A;  4E7Z A;  3TKL B;  3AAE B;  2ODV A;  4JI1 T;  2H3R A;  2XHE B;  4OYJ A;  1L0V A;  2SPC A;  3W15 B;  1UUR A;  4TUY E;  2WY2 A;  5AQQ B;  3AXJ A;  3PE0 A;  5AQP B;  4ZZB A;  4B6X A;  3FBZ A;  3MK7 C;  3ZT7 A;  3K3O A;  1N34 T;  2E9X C;  5L3C B;  2N1G A;  3V5S A;  1EZ3 A;  5E0O A;  1LKX A;  4JYA T;  3ZYK A;  3FZF B;  5A1L A;  4EYU A;  3RIU A;  4COF A;  5FY1 A;  2KIN B;  5ABG A;  3RGL A;  2XQA A;  4DV2 T;  3WAJ A;  2WBL A;  3VU7 H;  2BKP A;  4YLH A;  1Z8U A;  4JI4 T;  3N9N A;  3LK2 B;  4DR5 T;  3EHZ A;  1YXR A;  3AEC A;  2XM1 A;  4HFD A;  3CQG B;  3LG7 A;  2ES0 A;  4PNI A;  2PBI A;  1FJG T;  2DWG A;  2XTL A;  2I6H A;  3AA1 B;  3AXJ B;  4TWD A;  2N2N A;  4M1P A;  2IHR 1;  1WYC A;  3ZKR A;  4AIU A;  2C0S A;  4C90 A;  2H89 A;  4LF5 T;  3H3A A;  5JDQ A;  2XQ8 A;  4U7Y A;  3TLV A;  3NVO A;  4YTP A;  4AQF A;  4UXN B;  3KVB A;  2WWV A;  2WB5 A;  4QX8 B;  1HG2 A;  1HX1 B;  3QB5 K;  4G2A A;  2W4X A;  3KFW X;  4DV4 T;  1T8B A;  2UUA T;  1D0Z A;  2IUB A;  2RP4 A;  2VKO A;  2PTF A;  3EDV A;  4PAG A;  5HAX A;  3ZST A;  2XAQ B;  3N2O A;  3SOL A;  1HTJ F;  5AQM B;  3ABV A;  2XUE A;  4LMK A;  1UX5 A;  4ZS2 A;  4X1I E;  3MJX A;  2Y48 B;  5L3B B;  1BR4 A;  3NBX X;  2CE7 A;  2YN6 A;  2CBI A;  4DV0 T;  4IE7 A;  1OXZ A;  3M65 A;  1T72 A;  5AQU B;  2XQ9 A;  2X66 A;  3HA4 A;  4ZXL A;  5JRC A;  3IBP A;  4DR4 T;  3Q9D A;  2ZMA A;  4K0K T;  3KV6 A;  5LHH B;  4U74 A;  2W66 A;  2VKD A;  2C5K T;  2V5D A;  2CMR A;  2ZLY A;  3ONJ A;  3LBX A;  3WAK A;  4XZC A;  5LGN B;  4YY3 T;  4OX9 T;  4OK0 A;  2VAS A;  2BDE A;  2YOE A;  2DL1 A;  1WLX A;  4ILA A;  2VKJ A;  2CLY B;  2K5B B;  3RHW A;  1ZP0 A;  2XZE A;  4ZS3 A;  4H9R C;  4LF7 T;  1UCU A;  2LRL A;  5HEJ A;  1IZN B;  4DV3 T;  4YSY A;  1ZEE A;  1IBK T;  3LK3 B;  3AEE A;  4DR1 T;  1D0X A;  5HEO A;  3AVS A;  4B3M T;  5FKY A;  2WU2 A;  3E22 E;  4IDO A;  2JQQ A;  4U3C A;  4CN1 A;  2NWB A;  1XMQ T;  1D1B A;  3EVY A;  4HFI A;  3SFD A;  1M62 A;  1U5P A;  3ZMZ B;  5LJM A;  2YDQ A;  3UU6 A;  2V6X A;  1WFD A;  4TWF A;  3OJA A;  5ETW A;  2XQ4 A;  2LT3 A;  2XQY A;  2MTQ A;  1QUU A;  3N5L A;  1YKE B;  3RQW A;  5AQR B;  3ESL A;  5ADX L;  4TNW A;  3AE9 A;  4J2C A;  5HXH A;  5AFU L;  3I0O A;  3AAA B;  2X0Y A;  5FXZ A;  2G0U A;  2E2A A;  4ERR A;  5AQH B;  3RKG A;  4FJO A;  3OKQ A;  4EB6 E;  3RC8 A;  1D1A A;  3AVR A;  4IDP A;  1HG5 A;  4UIG A;  3Q5W A;  4HE8 A;  4IE6 A;  2XSB A;  2LKG A;  3VR9 A;  4H9N C;  4MLK A;  4O4L E;  2LRK A;  2XAH B;  3P4W A;  4MAL A;  4HWF A;  2LLY A;  2CWY A;  4GK5 E;  2KZ7 B;  4H9O C;  3R84 B;  2CXL A;  3UUN A;  3HKC E;  4ILU A;  3PJA A;  5AQF B;  5LMN T;  5AQT B;  2LJL A;  1DU2 A;  4TV8 E;  4F6R C;  2FUP A;  3NZQ A;  4KHZ F;  5JDL A;  2PFV A;  4YHJ A;  4JUY A;  2BVL A;  3PUY F;  5CA0 E;  5IUX A;  2V1D B;  3H37 A;  1E7P A;  5JDG A;  3P8C D;  2XPK A;  2GK9 A;  5LA6 E;  3LSV A;  4CI3 B;  2KT9 A;  2WDV A;  4JLE A;  2EHO C;  4HN9 A;  4K0U A;  4DV7 T;  1XNQ T;  5KDM C;  3ZT5 A;  3LDQ B;  3EDU A;  1WR6 A;  4I0U A;  4AKL A;  2WZI A;  4JI0 T;  5JDF A;  2MAW A;  5L3D B;  2CHN A;  3P7I A;  2V6Y A;  4UEM A;  1YD8 G;  2D5U A;  3M3Z B;  4JI5 T;  3JCF A;  1G8X A;  2YIN A;  4O2B E;  1SHZ C;  2E9X B;  2AE9 A;  1XNR T;  2OLT A;  1HNW T;  4BJM A;  5TAO A;  5LG4 A;  4LF9 T;  2N9D A;  3HR0 A;  4PJL A;  2D9D A;  5L4E A;  3RIA A;  2YU2 A;  2VL8 A;  3B57 A;  1WCR A;  1QSD A;  4IST A;  5FXV A;  2XM2 A;  3ETV A;  2WSS V;  3ZYM A;  3RC3 A;  3MAC A;  5DAB A;  2Q9Q A;  4QHO A;  4UF0 B;  1YQ3 A;  2UXC T;  3UT5 E;  3E08 A;  4KUM B;  1VRB A;  4ISS A;  1V9D A;  2KSR A;  3FXE B;  4O4J E;  4YJ3 E;  3BQI A;  4IHJ E;  3N2K E;  2A9U A;  4IE4 A;  3C4X A;  5JDM A;  2IW5 B;  2JRK A;  5LOV E;  2BBH A;  1MMA A;  3AA7 B;  4IRE A;  1Z0P A;  1S35 A;  2BKN A;  3P50 A;  5LGT B;  5HWX A;  2L3L A;  3F57 A;  3PDY A;  5FL0 A;  3VRA A;  3J7Y q;  2NW7 A;  2K3W A;  2Q9Q B;  1IJ6 A;  4DO0 A;  3R6N A;  4QXC B;  1UK5 A;  5CJ5 A;  2LOS A;  3WI3 A;  1N36 T;  4EEB A;  2NR4 A;  4QWN B;  4L0R A;  1OED A;  1IBL T;  3RF1 A;  4X1Y E;  5EK2 A;  2WQY A;  1M7K A;  4TX5 A;  3O9X A;  4CXX A;  4F8H A;  2HN2 A;  4A97 A;  1KEY A;  3Q5X A;  3FZL B;  2CEA A;  2WWU A;  2H7O A;  3RPU A;  1Y01 A;  1ZKE A;  2FJB A;  2WDQ A;  1IBM T;  3N2G E;  3QK6 A;  5L47 A;  5FY7 A;  1WRD A;  4ASK A;  3RH3 A;  5HXS A;  1HFA A;  1KNR A;  2HHH T;  3RKO A;  3KDS E;  2QRX A;  3O4X E;  1CUN A;  2XQ7 A;  2E8I A;  3QB5 A;  2MYS A;  3GWH A;  3FZH B;  2VQF T;  3EI0 A;  2JPF A;  1NEN A;  3GN5 B;  5J2U E;  2X0L B;  4AQY T;  1OED B;  1XZY A;  4DBQ A;  3HL6 A;  3U78 A;  3PU3 A;  1NAF A;  1JNZ A;  1W09 A;  2WCA A;  3UFE A;  4BA9 A;  4QXB B;  2CXD A;  2LSI A;  3GA8 A;  5CA1 E;  4HGA A;  2IC6 A;  4NPP A;  2W63 A;  5BMV E;  2CWO A;  5DJQ C;  4XAX B;  2B76 A;  5HXC A;  3PV0 F;  3PUG A;  2AXD S;  2LHN A;  4PFP A;  3ONL C;  4NUV A;  2DLR A;  2Y6X A;  4CI1 B;  3A5X A;  4CXY A;  4ZI3 D;  2D2S A;  3ONX A;  2RA1 A;  4WNK A;  2WDR A;  4QXH B;  2LHR A;  1SA0 E;  4KHP T;  1O3X A;  3Q2M A;  3BQL A;  4JI2 T;  2XJ7 A;  3UUM A;  2I59 A;  5FVK A;  3EAM A;  1KFY A;  1SE7 A;  5HXR A;  3KV4 A;  1XWM A;  1Y64 B;  3P4P A;  3B13 A;  2BG9 C;  3LK4 2;  3ZMU B;  3GMI A;  5CFB A;  3ZN1 B;  2JQ9 A;  2XQ5 A;  4LFA T;  5LNK A;  2X9H A;  1ZOY A;  3ZC0 A;  1UX4 A;  1J5W A;  4X1K E;  3J9X 1;  2M6B A;  4DV1 T;  2V26 A;  4UVB B;  1HX8 A;  3FZM B;  2ZM0 A;  1S94 A;  4LFC T;  3F2E A;  3TLS A;  3L39 A;  2V7I A;  5LBM A;  2J47 A;  2BKO A;  5LJN A;  2W67 A;  3AE4 A;  4DR6 T;  2A72 A;  3NKZ A;  4LML A;  2E5V A;  3CPZ A;  4PW8 A;  4TNV A;  2EHO D;  2EHO B;  2WP9 A;  1LVK A;  3VRB A;  1N32 T;  4GKK T;  2CHO A;  5JR9 C;  4NXM T;  3RQU A;  2BG9 E;  2X67 A;  2PG8 A;  3K1S A;  1MIV A;  3CVR A;  3CK6 A;  4ZZC A;  4UV9 B;  4IDN A;  5HYA A;  2DHR A;  5L3E B;  1H7C A;  4DUY T;  4HWH A;  5JH7 E;  2K48 A;  3KV9 A;  4EYY R;  3T1H T;  4MFR A;  5JRE A;  3L3P A;  3AA0 B;  4DND A;  3Q5E A;  3QNU A;  3VR8 A;  5FMN A;  1UUS A;  4B3S T;  4QX7 B;  5KMG P;  3AEA A;  4DV5 T;  1FMV A;  2B1E A;  3PUZ F;  3AA6 B;  4ZI3 C;  3MKD A;  3MZK B;  1GQE A;  5FVL A;  3K8P C;  3F31 A;  3ZMS B;  4U31 A;  1MND A;  2J1D G;  1N33 T;  4X66 T;  1HCI A;  1HNX T;  1I94 T;  3RIU C;  2YEV C;  2NW8 A;  5FXX A;  3X1D A;  3C51 A;  4AKI A;  3OPC A;  3UU8 A;  5F3J A;  2X51 A;  4NXN T;  2KLQ A;  3RIF A;  4Z8X A;  2DNX A;  2V8S V;  2HPJ A;  5IHY A;  4JBW F;  2VL0 A;  1XMO T;  2E9X A;  4I4T E;  2H7V C;  4YFS A;  4GK0 E;  3RLF F;  3UU3 A;  3PUQ A;  4GIW A;  2Z6E A;  5FY0 A;  4AKH A;  4HWC A;  1T7S A;  2X9Y A;  1UGO A;  4IE5 A;  4JI6 T;  1ZV4 X;  4AQF C;  3ZMT B;  4DR3 T;  4KX6 A;  3UFG A;  2ACX A;  2J4G A;  3DP7 A;  5KX5 E;  3PJA J;  2X68 A;  2UUC T;  3OVU A;  2LEH A;  4IL4 A;  2WMN A;  4WZX A;  4UF0 A;  2VVN A;  5AQI B;  4HFE A;  3OTO T;  3ZJ2 A;  3ZYL A;  4PK6 A;  1VCS A;  2CCQ A;  4LMJ A;  1FEW A;  3AE2 A;  3JC6 C;  3AED A;  4HFC A;  3P4S A;  3AE1 A;  3JAD A;  2JJ9 A;  3SWH A;  3HI2 A;  2W0G A;  2FJA A;  2QGS A;  2YK0 A;  4CI2 B;  3CIR A;  3SFE A;  5FXW A;  1YQ4 A;  5LHG B;  1E2A A;  2CA5 A;  2LSK A;  2YDR A;  3C98 B;  4PK4 A;  2XAF B;  2VVS A;  4EAH A;  5C2T A;  3C4Z A;  4ILB A;  3RYC E;  4UVA B;  4KMC A;  4GOU A;  3UQ4 A;  2MBG A;  3I9Y A;  2DCF A;  2XAJ B;  2HH7 A;  4ZOL E;  1MMN A;  5J2T E;  2NOX A;  3VKH A;  4HTE A;  5AQN B;  4Z90 A;  1US7 B;  4E7S A;  3C64 A;  4BJN A;  5ABF A;  3VHL A;  4QH1 A;  5EK3 A;  3LJC A;  4UV8 B;  4ILC A;  4CXW A;  5JQG E;  1T98 A;  3SRZ A;  3ANW A;  4JEU B;  2OA5 A;  2CBJ A;  3RX6 A;  1HNZ T;  2VQE T;  2A2F X;  2NTX A;  1MIW A;  4X64 T;  3AE3 A;  4JI8 T;  3CQC B;  5LCY A;  5AQK B;  4PK5 A;  5FL1 A;  4P1N A;  4CZZ B;  4OHF A;  3U3I A;  2V7J A;  5LGU B;  2IC9 A;  4EGW A;  1LVF A;  1J1J A;  4YHH T;  4IDZ A;  3VKG A;  4X65 T;  2QVA A;  2XQ6 A;  4JEH B;  2K9A A;  2D0T A;  3BQK A;  3NRY A;  4DBR A;  3I9W A;  4ADZ A;  3FB2 A;  5ABF B;  1YKH B;  2V7K A;  5HEG A;  5AQO B;  2X9W A;  3A8Y C;  5F8P A;  5ABH A;  5AQJ B;  5C3J A;  5LB7 B;  3O1I A;  3GN5 A;  2XAG B;  3ANW B; 
#chains in the Genus database with same CATH homology
 4LF6 T;  1IBM T;  1XMO T;  4DV0 T;  2UXB T;  4LF8 T;  4DV2 T;  4KHP T;  4X62 T;  4LFB T;  4B3T T;  2UXD T;  2UUB T;  4JI4 T;  4DV7 T;  2UU9 T;  4DR4 T;  1XNQ T;  4JI2 T;  1HR0 T;  4DR5 T;  4DUY T;  2HHH T;  4K0K T;  1J5E T;  4JV5 T;  1FJG T;  4JI6 T;  4JI3 T;  2ZM6 T;  4DR3 T;  4JI0 T;  4DUZ T;  3T1H T;  2UUC T;  1HNZ T;  2VQE T;  4LF5 T;  2VQF T;  5IWA T;  2E5L T;  4JI5 T;  4YY3 T;  4OX9 T;  4X64 T;  4LFA T;  4LF4 T;  4B3S T;  4JI8 T;  4JI1 T;  4AQY T;  4DV5 T;  4DV6 T;  5LMU T;  1XNR T;  4DV1 T;  3OTO T;  4GKJ T;  4LFC T;  4LF7 T;  1HNW T;  2F4V T;  4JI7 T;  4LF9 T;  5BR8 T;  4B3R T;  4DV3 T;  1N33 T;  4X66 T;  4YHH T;  1IBK T;  3T1Y T;  1N36 T;  4DV4 T;  1HNX T;  1I94 T;  4X65 T;  4DR1 T;  2UUA T;  4DR6 T;  1N34 T;  5LMN T;  4B3M T;  1N32 T;  4DR7 T;  1IBL T;  4JYA T;  4GKK T;  1XMQ T;  4NXM T;  4NXN T;  2UXC T;  4DR2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...