1O3XA

Crystal structure of human gga1 gat domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
b'AANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
molecule tags Protein transport
source organism Homo sapiens
publication title Molecular Mechanism of Membrane Recruitment of Gga by Arf in Lysosomal Protein Transport
pubmed doi rcsb
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1o3xA00
1OXZA 1NWMX 1YD8G 2N2NA 1NAFA 1WR6A 1X79A 1WRDA 2N9DA 1O3XA
chains in the Genus database with same CATH superfamily
1Z8UA 3N9OA 1UX4A 5FXZA 3S4UA 3SS1A 3UUNA 2BKNA 2NOXA 2VQFT 3AA7B 4HE8A 4IGUA 1HFAA 3M65A 1FMVA 4Z91A 3UU3A 2Q9QC 2VL0A 1YKEB 1NEKA 1UUSA 2X9XA 1Y64B 3VRAA 5CA0E 5LGUB 4DUZT 3DJBA 4YXDA 5LB7B 5LG3A 1N34T 3RIFA 1XMQT 1W0AA 5JDMA 1VOMA 4JI5T 3HKDE 4LMLA 1HF8A 4TV9E 1BR0A 4YTMA 4ZZBA 4A5XA 3NRXA 2X9WA 3VKHA 2IDOB 4F6RC 5EK3A 1HR0T 3GWHA 2I6HA 1FJGT 4AKLA 4NXNT 2X51A 1XWMA 4EZHA 3ZC1A 1HX1B 2FBWA 4HFVA 3CX6B 3KBUA 2KWHA 2L9QA 3HKCE 4GYSA 3H3AA 2D9DA 3NWIA 4EGWA 2YDRA 4LMJA 4E7SA 4ZHQE 5BMVE 4AKHA 2E9XB 3H37A 2W00A 4JI0T 3RQWA 4TV8E 3UU6A 2H7VC 2HN2A 3NZQA 3CQXC 4HFBA 3ZSTA 2W66A 2V1DB 5C3JA 3P4SA 4JV5T 1ZHCA 2W4XA 2UUCT 1HCIA 2YN6A 3PURA 4DVDA 4HWFA 4EEDA 4ZI3C 2IMLA 5FY1A 3ZKRA 3DP7A 1N32T 3OPCA 4QXBB 3UFGA 4ANJA 5L4EA 3OVUA 4DMVA 2UUBT 3AEAA 4GYRA 5JDHA 4WBOA 3H3MA 3AAIA 4HFDA 4HFCA 4YHJA 3K3OA 2CRBA 2PBIA 3PUVF 5AQHB 4AQFC 1E2AA 2L3LA 4ZZCA 5TAOA 2HN1A 4YY3T 2VL8A 2WMNA 2K5BB 1VRBA 1NWMX 2BVLA 2YEVC 4U31A 4GKJT 5FXVA 1HNZT 3L3PA 2HH7A 2E8IA 2VVNA 5J0ZA 1ZV4X 4J2CA 5ABHA 1D1AA 3MA9A 2DWGA 3ONJA 2LOPA 2WDQA 5HAXA 3J9X1 4NXMT 1DU2A 1BR4A 2BKPA 2C5KT 3AEEA 1YW0A 3AE1A 3CKDA 4NPPA 2X9HA 1Y01A 2MPKA 5AQUB 4WBNE 4B3ST 2BG9C 4IE5A 2MBGA 5JR9C 5L3CB 3G06A 4CI3B 5JDGA 5L3BB 2DI4A 3BQLA 3CWZB 4PJJA 3RHWA 3ZJ1A 2LEHA 3PE0A 1JNRA 2YU2A 4HWCA 4IREA 2YOEA 3E22E 2H89A 2MYSA 5LA6E 4CN6A 3PUZF 5CA1E 2LJLA 2WU5A 5AQRB 4NUUA 3VR8A 5L3FB 2BBJA 1WYCA 3LJCA 4X66T 3ZCIA 1I94T 3BK9A 4U72A 5FYMA 4ILCA 4CI2B 3TKLB 4OFZA 5DQWA 3AE5A 4X62T 2K48A 3AA6B 2XAQB 2XQ6A 4ISSA 4PW8A 1UGOA 3RLFF 5IWAT 1T72A 2NW7A 5JDLA 5HXCA 2V8SV 1D1BA 1E1HB 4K0KT 3HR0A 4I50E 4ADZA 2KINB 3HI2A 2CHOA 1I6ZA 2ES0A 3BQKA 5LP6E 4KHZF 4XBFB 2KZ7B 2BG9E 3QOFA 2UU9T 2PTFA 3LFMA 2XQYA 2PJQA 4JLEA 2OV9A 2WZIA 4GK5E 3RGLA 3PUXF 1WRDA 2JRKA 5LJMA 1D0YA 2J4GA 5KX5E 3Q5WA 4YT0A 4PJNA 3RC8A 1D0XA 3R6NA 4WW0A 4H9PC 3V5SA 2V7JA 4TNVA 1D1CA 2V5DA 3ESLA 5FL0A 4ZI2C 3IA3A 3LK3B 3EDVA 3DTOA 4QX7B 4YFSA 2KSRA 5IHYA 5LOVE 4COFA 1HX8A 4IE7A 4JI2T 5IYZE 3CX8B 4ZS3A 5AQNB 3R84B 3CQGB 2RPAA 1SA0E 2D5UA 3W15B 2FJDA 4NUVA 4JYAT 3GN5B 2IIUA 1NENA 2WCAA 4O4HE 5AQSB 1U4QA 2VKOA 2XQ8A 4H9OC 4HFEA 4DUYT 2ACXA 3CK6A 2HPJA 4OYKA 3ABVA 2DNXA 2WDRA 2VKDA 4H9QC 4NIQA 2WDVA 3PV0F 4PJMA 5C8YE 4ERRA 4O4IE 4DBRA 2M6IA 3UULA 4YTNA 5JDNA 4YHHT 2IAKA 3ZT5A 2E9XD 3KV9A 1MIVA 2V5CA 1G8XA 1UURA 4UVBB 3EAMA 1EZ3A 1ZKEA 2V7MA 2WB5A 2JPFA 3K3NA 3KFWX 3N9LA 3O4XE 1D0ZA 3QNUA 4P0BA 5AQQB 3ZT6A 2NW8A 4YSXA 2BS3A 2SPCA 2EHOB 3KDSE 3I0OA 4M1PA 4UR9A 3UUXB 1OXZA 4IHJE 2ZLYA 1L0VA 4WNKA 5AQFB 2CXFA 5H6QB 1HS7A 4G63A 5HXSA 2NWBA 4TNWA 3UQ7A 5LBMA 2J62A 1GQEA 3AVSA 2Q9QA 5C2TA 2CE7A 3RH3A 3EDUA 4HWDA 3RIUC 4HWHA 2LSYA 4HKAA 4LF9T 3NVOA 3AEDA 4TX5A 4AKRB 3O9XA 5ADXL 2XY8B 1IBKT 1UX5A 2ZMAA 3MACA 1CHUA 5HCJA 2XQ4A 2LLYA 3FBZA 3IF8B 4TWFA 2WAUA 2CBIA 2BG9B 4UV8B 4IL9A 3UQ4A 3AEFA 5J1GA 5HEJA 5JR9B 4LMKA 4H9RC 5JDFA 2XSAA 3AE3A 2V6XA 2W63A 2YDQA 3P50A 4G2AA 2X9YA 5JH7E 3WAJA 5JDQA 3ZYMA 2IHR1 1W0BA 4ZS2A 4DIDB 4B3TT 4B3RT 1UCUA 3RYFE 1M62A 2LHNA 4LF6T 3RRCA 4U33A 4E7ZA 2L8KA 2W67A 3ZYLA 5F3JA 3UTKA 3AAEB 2IUBA 3EABA 2VKHA 5L4HA 2QVAA 2QA7A 1M7KA 1U5PA 1YXRA 4ASKA 2V7KA 2H7OA 2JQKA 3RQUA 3BQIA 3PU3A 4YJ2E 4L5GA 1UK5A 4MALA 5HEUA 3O1HA 5FKYA 5ABFB 2JMHA 1KNPA 2XAHB 3TLTA 1FMWA 2JIWA 1IZNB 2LSKA 2LRLA 3K8PC 3UUMA 3VU7H 3K1SA 1IJ5A 2VURA 4AQFA 2DCFA 2VASA 3E0ZA 3F2EA 5HXEA 2LSJA 1SE7A 2WZHA 3TLUA 3ZN0B 5L2LA 1XZYA 2JQQA 4IDQA 3C64A 2LSIA 1WFDA 3CIRA 3FZHB 3GMIA 3ZMUB 1SHZC 4ILAA 3UFEA 4O2AE 3CX7B 2WM9A 2P9BA 1WYBA 4P09A 2XPKA 2XM2A 3AB3B 1MNEA 1WR0A 2IC6A 2MOZA 2XQ5A 3ONLC 4DR3T 2ZM0A 4TWHA 3UT5E 3RRWA 4A98A 4DO0A 3TLWA 2DLRA 3WI3A 2CPTA 4FI5A 1NAFA 3ZSSA 4OK0A 3VHLA 3ZMSB 5KDMC 3F57A 2JJ9A 3J7Yq 5KMGP 3N5LA 2NW9A 1LVFA 4KHPT 2E5LT 2WMOA 5AQKB 1OEDC 1OEDE 1T7SA 4ZXLA 2LKHA 5HXHA 2K24A 4ZI2D 2BZBA 3L39A 4DV0T 4ILUA 4MLKA 3C98B 1ZP0A 5FVKA 5HEOA 5AFUL 5BR8T 2NTXA 4DMWA 2NP9A 5JRCA 2H3RA 3AXJB 4O8SA 3SFEA 4LF4T 4LFCT 4EAHA 1X79A 3PJAA 1T98A 2Q9QD 1E7PA 1HTJF 4DR7T 4CZZB 2X66A 2MAWA 3AE9A 1YD8G 5GONE 2C5JA 3KV4A 3AECA 2UUAT 2W2UA 5JREA 2ZM2A 4QX8B 2M67A 2PFVA 4PFPA 2DWKA 3JC6C 2NR4A 5CFBA 5J2UE 1YQ3A 2LE8A 3CQCB 4JBWF 4P1NA 2CXDA 3N2GE 5EK4A 3FXDB 4EB6E 3HA4A 3AEGA 5FXWA 3P7IA 1T8BA 1J5WA 3GN5A 1KNRA 3TLVA 5IUXA 2ODVA 4Z8XA 4BJMA 3NZPA 2XUEA 2LM9A 3CMLA 3RKOA 5FVLA 1N33T 3LG7A 3ZMTB 1FIOA 4IDZA 4EOZB 4GIWA 4U3CA 4UEMA 3PUWF 4UF0A 4CXXA 3UU4A 2VKJA 3JCFA 3ANWA 3I1AA 4HN9A 5FY0A 3SFDA 4DV6T 1OWAA 2V6YA 3T1HT 1VCTA 3ZJ2A 5LMUT 4DR6T 4CXWA 2WBLA 1KFYA 3JADA 2FJAA 4LFAT 4PAGA 2ZM6T 2E9XC 4I43B 4HFIA 2H88A 3CVRA 3P8CD 3RIUA 3MXZA 2BS2A 3UUBA 4DR5T 2KWIB 4JI6T 2YINA 4JI7T 4AQGA 3I9WA 1XNRT 3VKGA 3LK2B 2EHOA 2XQ3A 2A3DA 2DHRA 2XQ7A 3LBXB 4IE0A 3OYZA 3PU8A 3MJXA 3FBLA 1KK7A 1MIWA 4IIJE 4EZ4A 4TZ4C 5ABFA 3AAAB 2BBHA 3KV5A 3UU5A 1WCRA 5KXJA 1AJ3A 4QXCB 2W62A 2XAJB 3KBTA 5EK2A 4X65T 5A1LA 1G73A 2M6BA 2X67A 2V7LA 3LK42 1LRZA 3D0TA 4KI0F 4MHCA 2W0GA 2Q9QB 2VWAA 1X9BA 5AQPB 2CWYA 5AQVB 4GOUA 3CPZA 2C5IT 3RX6A 2WS3A 3FXEB 3N2OA 1S35A 2N2NA 5DABA 3RYHE 3C4ZA 4PNIA 2KT9A 1ZOYA 3PJAJ 4WZXA 2B1EA 1MMDA 5FL1A 2EHOC 3C50A 4UELA 4O4LE 3PDYA 4ZOLE 4JI8T 3ZLIA 2KLQA 3KV6A 2ODUA 4AI6A 2BG9A 2LT3A 5JR9A 4N78D 4I0UA 4U2YA 4TUYE 3ZCJA 4FJOA 3P4PA 3AVRA 2PG8A 4O4JE 3V5UA 4X1KE 4DV1T 4UVAB 2AXDS 4KBMB 5AQMB 3IBPA 3E08A 3IEEA 5ETWA 1CUNA 3NRYA 4MFRA 3C51A 3RI5A 5LJNA 1IBLT 3IHRA 3AE4A 3ZPOA 2XAGB 1XDPA 3AE7A 5AQGB 5FY7A 4AKGA 1KF6A 3K3QC 3RKGA 3OTOT 2QRXA 1XMOT 1HNWT 1MIYA 4TN7B 2I59A 3ZEFB 2JQ9A 3AXJA 3F31A 2V7IA 4UIGA 1JNZA 1IAPA 2XAFB 4A56A 2E2AA 3FZLB 1N36T 4LF8T 3PUSA 4UVCB 4EXTA 2LSGA 4YLHA 3UU8A 3TLSA 3FZKB 3RYIE 3U78A 2HPLA 5ABEA 4CN4A 5HWXA 2UXBT 5HXRA 2C0SA 3I9YA 3JC6D 2J47A 3LDQB 5LG4A 1VCSA 3PUYF 5LHIB 4DR4T 5AQJB 3L09A 5LCYA 4XAXB 5AQTB 3RIAA 4YSZA 2UXCT 1Z0PA 4AIUA 4EYUA 2JQHA 4HEAA 3A7MA 1SUMB 3C4XA 1BR1A 4JEHB 3Q5DA 1R8IA 3EUHA 4ISTA 4HTEA 3Q5XA 4BJNA 4H9SE 5JVDE 5LXTE 3T8OA 4ZEYA 1KEYA 4K0UA 3NBXX 4KMCA 4DV7T 4JEUB 4O2BE 2CA5A 5H6RB 1J5ET 1W09A 1W9RA 4U7IA 3ANWB 2GK9A 3O1JA 4WYVA 2HHHT 2CLYC 3EVYA 2CWOA 3I0QA 3RC3A 2XQ9A 2F4VT 2XASB 1QUUA 3OYXA 2CHNA 2XJ7A 4I4TE 4OYJA 5LGNB 4DV4T 4JI4T 2YU1A 3HKEE 1LVKA 3OKQA 3FB2A 1HG5A 3MKDA 3P4QA 4IT4A 3SRZA 4QXHB 3RF1A 3RPUA 5HYAA 2UXXB 2X0YA 3QB5K 4JI3T 5L3DB 2CCQA 4AQYT 4QH5A 1WLXA 4U74A 2CM0A 5JRCB 2JMKA 4F8HA 4QKNA 4U2ZA 4H63V 3VR9A 2E5VA 4L9IA 5CJ5A 3AE6A 1WR6A 2XM1A 3KVBA 4DV5T 2CXLA 2KMFA 4A97A 4AISA 2BVMA 2WWUA 3ZN1B 5CB4E 4IDOA 3N9NA 2X68A 5LHHB 5FNVE 5CGMA 1HNXT 1OEDB 2WU2A 2VK9A 3B13A 3NKZA 3EHZA 3JAEA 3N9MA 4PK5A 5FMNA 4ZI3D 5L47A 4L0RA 5LYJE 2D0UA 4X64T 4LF7T 4IE4A 3M3ZB 4DNDA 5ABGA 2FUPA 3HL6A 3P4WA 4U7YA 4X1IE 3N2KE 5DJQC 3ZT7A 2VQET 4OX9T 4AKIA 2K3WA 4DV2T 2XZEA 3QB5A 4YJ3E 3WAKA 4P0AA 1XNQT 4BA9A 3AA0B 2A72A 3JAFA 3Q5EA 4GK0E 4MBQA 3QUJA 4IE6A 4CI1B 2VVSA 4LFBT 2LOSA 2RA1A 4PK6A 2K9AA 5JQGE 4UF0B 2LHRA 4GKKT 2BS4A 2CLYB 5J2TE 1ZEEA 4IL4A 3SWHA 4LF5T 4CQIA 2KNDA 4EIWA 5F8PA 1MMNA 2V6YB 2XHEB 4XZCA 3B5MA 3OJAA 4CN1A 5F5WA 3FZMB 2DL1A 4KP3C 4OHFA 3PUGA 5LNKA 2G0UA 4Z90A 5LBQB 2LRKA 2R6GF 4Q25A 3QC9A 4V1Av 5JTGA 1LKXA 2CMRA 3ETVA 4X5TA 1MMGA 4UXNB 3LBXA 4DV3T 4PJLA 1QSDA 4IDPA 2BDEA 2UXNB 1IBMT 3ONXA 2W61A 4C90A 1MNDA 4HGAA 2FJEA 5LMNT 5L3GB 3ETUA 4JUYA 4EEBA 3T1YT 3O1IA 2X0LB 3L8RA 2D0TA 3KVAA 5HEGA 2WP9A 1B7TA 2AE9A 2MTQA 2E9XA 4ZI7E 1S94A 3A5XA 5LHGB 1XDOA 2XSBA 3Q2MA 4H9NC 1V9DA 3SOLA 4DR2T 3ZYKA 1QLBA 2YKSA 3FHNA 2J1DG 1YKHB 3VRBA 4PFOA 4AXPA 2WWVA 5AQIB 3HKBE 5FXXA 4B6XA 3QK6A 5AQOB 5EZYE 5FP3A 2WY2A 3MZKB 5LGTB 3PUQA 4HFHA 4X20E 4X1YE 4EV6A 3ZMVB 4JI1T 5HWYA 2D2SA 5HCMA 2N1GA 2OLTA 3AE2A 4H63H 2LM2A 4PK4A 2A2FX 2B76A 1BR2A 2V26A 2Z6EA 4ILBA 4QH4A 4YSYA 1US7B 1H7CA 2NTYA 2Y6XA 3PTRB 3OBVE 1KNZA 2A9UA 3A8YC 3C4WA 3EI0A 2XQAA 2Y48B 4YTPA 2KXPB 2Y8DA 2N9DA 2CEAA 1J1JA 4QH1A 4TWDA 2IC9A 1FEWA 4HWIB 3AA1B 2FJBA 3N9QA 1IJ6A 2WSSV 2IW5B 3Q9DA 2QGSA 2CBJA 2VB6A 2I0MA 4KUMB 4UV9B 5M4YA 2YDSA 1HG2A 3MK7C 4I55E 5DQVA 2ZM8A 2RP4A 3ZC0A 4DBQA 1YQ4A 1OEDA 4B3MT 3P4RA 1MMAA 2ACZA 2QYWA 2OA5A 3RYCE 2LKGA 4QHOA 2XTLA 2YK0A 3LSVA 5HEHA 3AE8A 3B57A 3U3IA 4IDNA 5E0OA 4DR1T 1O3XA 4BAYB 2X0HA 4C91A 2EHOD 4EYYR 4CXYA 2WQYA 3GA8A 2BKOA 3X1DA 4KX6A 3ZMZB 5L3EB 3PUAA 3AEBA 3FZFB 3N9PA 4QWNB 2UXDT 5AQLB 3KINB
chains in the Genus database with same CATH topology
3N9OA 1UX4A 5FXZA 3S4UA 3SS1A 3UUNA 2NOXA 3AA7B 4HE8A 4IGUA 1HFAA 3M65A 1FMVA 2Q9QC 1YKEB 2X9XA 5CA0E 5LGUB 1Y64B 3DJBA 1VOMA 3HKDE 4TV9E 1HF8A 1BR0A 3NRXA 2X9WA 3VKHA 4F6RC 5EK3A 3GWHA 4AKLA 2X51A 4EZHA 3ZC1A 4HFVA 3CX6B 3KBUA 2KWHA 2L9QA 3HKCE 4GYSA 3H3AA 4E7SA 4ZHQE 5BMVE 4AKHA 2E9XB 3H37A 2W00A 4TV8E 2H7VC 3NZQA 3CQXC 2V1DB 1ZHCA 1HCIA 3PURA 4DVDA 4ZI3C 5FY1A 3DP7A 4QXBB 4ANJA 4DMVA 4GYRA 5JDHA 4WBOA 3AAIA 4YHJA 4AQFC 3K3OA 2PBIA 5JDMA 2L3LA 5TAOA 2VL8A 2WMNA 2K5BB 1VRBA 1NWMX 2BVLA 2YEVC 5FXVA 3L3PA 2HH7A 2E8IA 1ZV4X 4J2CA 1D1AA 3MA9A 2DWGA 3J9X1 2LOPA 5HAXA 1BR4A 2C5KT 3CKDA 1YW0A 2X9HA 4WBNE 2MBGA 4IE5A 5JR9C 5L3CB 5JDGA 4CI3B 5L3BB 2DI4A 3BQLA 3CWZB 4PJJA 3ZJ1A 2LEHA 3PE0A 2YU2A 5LA6E 3E22E 2MYSA 5CA1E 2LJLA 4NUUA 5L3FB 3LJCA 1WYCA 3ZCIA 3BK9A 4U72A 5FYMA 4CI2B 3TKLB 4OFZA 5DQWA 2K48A 3AA6B 2XAQB 4ISSA 4PW8A 2NW7A 5JDLA 5HXCA 1D1BA 1E1HB 3HR0A 4I50E 4ADZA 2KINB 3HI2A 2ES0A 3BQKA 5LP6E 4XBFB 2KZ7B 3LFMA 2XQYA 2PJQA 4JLEA 4GK5E 1WRDA 2JRKA 5LJMA 1D0YA 5KX5E 3Q5WA 3RC8A 4PJNA 1D0XA 3R6NA 4WW0A 4H9PC 3V5SA 2V7JA 1D1CA 3ESLA 4ZI2C 3LK3B 4QX7B 3EDVA 3DTOA 4YFSA 5IHYA 5LOVE 5EK2A 1HX8A 4IE7A 5IYZE 3CX8B 4ZS3A 3R84B 3CQGB 1SA0E 2D5UA 3W15B 4NUVA 3GN5B 4O4HE 1U4QA 2VKOA 4H9OC 2ACXA 2HPJA 4OYKA 4H9QC 2DNXA 4PJMA 2VKDA 5C8YE 4ERRA 4O4IE 4DBRA 3UULA 5JDNA 2IAKA 2E9XD 3KV9A 1MIVA 1G8XA 4UVBB 1EZ3A 1ZKEA 2V7MA 3K3NA 2JPFA 3KFWX 3N9LA 3O4XE 4P0BA 1D0ZA 3RYHE 2NW8A 2SPCA 3KDSE 2EHOB 3I0OA 4M1PA 3UUXB 1OXZA 4IHJE 2ZLYA 4WNKA 2CXFA 5H6QB 1HS7A 4G63A 5HXSA 2NWBA 5LBMA 3AVSA 2Q9QA 2CE7A 3RH3A 3EDUA 2LSYA 4HKAA 4TX5A 4AKRB 3O9XA 5ADXL 1UX5A 2ZMAA 3MACA 3FBZA 3IF8B 2WAUA 4UV8B 5JR9B 5J1GA 4H9RC 5JDFA 2W63A 4G2AA 2X9YA 5JH7E 3WAJA 5JDQA 3ZYMA 4ZS2A 1UCUA 3RYFE 2LHNA 3RRCA 4E7ZA 2L8KA 3ZYLA 5F3JA 3UTKA 3AAEB 2VKHA 2QA7A 1U5PA 4ASKA 2V7KA 2H7OA 4YJ2E 3BQIA 3PU3A 4L5GA 4MALA 3O1HA 2JMHA 2XAHB 1FMWA 3VU7H 1IZNB 2LSKA 3K8PC 3UUMA 1IJ5A 4AQFA 3E0ZA 2DCFA 2VASA 3F2EA 5HXEA 2LSJA 3ZN0B 5L2LA 2JQQA 3ZMUB 3C64A 2LSIA 3GMIA 1SHZC 3UFEA 4O2AE 3CX7B 2WM9A 2P9BA 1WYBA 4P09A 3AB3B 1MNEA 2IC6A 2MOZA 2ZM0A 3UT5E 4DO0A 3RRWA 2DLRA 3WI3A 4FI5A 1NAFA 4OK0A 3VHLA 3ZMSB 5KDMC 3F57A 2JJ9A 5KMGP 3N5LA 2NW9A 1LVFA 2WMOA 5HXHA 2K24A 4ZI2D 2BZBA 4ILUA 4MLKA 3C98B 5AFUL 2NTXA 4DMWA 2NP9A 5JRCA 2H3RA 4O8SA 4EAHA 1X79A 1T98A 2Q9QD 1HTJF 4CZZB 2X66A 1YD8G 5GONE 2C5JA 3KV4A 5JREA 2ZM2A 4QX8B 2M67A 2PFVA 4PFPA 2DWKA 3JC6C 5J2UE 2LE8A 3CQCB 2CXDA 3N2GE 5EK4A 3FXDB 4EB6E 3HA4A 5FXWA 3P7IA 3GN5A 2ODVA 4Z8XA 4BJMA 3NZPA 2XUEA 2LM9A 3CMLA 3RKOA 3LG7A 3ZMTB 1FIOA 4IDZA 4EOZB 4GIWA 4UEMA 4UF0A 4CXXA 2VKJA 3ANWA 3I1AA 4HN9A 5FY0A 1OWAA 3ZJ2A 4CXWA 2WBLA 4PAGA 2E9XC 4I43B 3CVRA 3P8CD 3MXZA 2KWIB 2YINA 4AQGA 3I9WA 3VKGA 3LK2B 2EHOA 5H6RB 2A3DA 2DHRA 3LBXB 4IE0A 3OYZA 3PU8A 3MJXA 3FBLA 1KK7A 1MIWA 4IIJE 4EZ4A 4TZ4C 3AAAB 3KV5A 1AJ3A 4QXCB 2W62A 2XAJB 3KBTA 5A1LA 1G73A 2X67A 3LK42 2V7LA 1LRZA 3D0TA 4MHCA 2W0GA 2Q9QB 2VWAA 2CWYA 4GOUA 3CPZA 2C5IT 3RX6A 3N2OA 3FXEB 5DABA 1S35A 2N2NA 3J7Yq 3C4ZA 4PNIA 2KT9A 2B1EA 1MMDA 2EHOC 3C50A 4UELA 4O4LE 3PDYA 4ZOLE 3ZLIA 2KLQA 3KV6A 2ODUA 4AI6A 2LT3A 5JR9A 4N78D 4TUYE 3ZCJA 4FJOA 3V5UA 3AVRA 2PG8A 4O4JE 4X1KE 4UVAB 4KBMB 3IBPA 3E08A 3IEEA 5ETWA 1CUNA 3NRYA 4MFRA 3C51A 5LJNA 3IHRA 3ZPOA 2XAGB 5FY7A 4AKGA 3K3QC 1MIYA 4TN7B 2I59A 3ZEFB 3F31A 2V7IA 4UIGA 2XAFB 1IAPA 4A56A 3PUSA 4UVCB 4EXTA 2LSGA 4YLHA 3RYIE 3U78A 2HPLA 5HWXA 5HXRA 2C0SA 3I9YA 3JC6D 5LG4A 5LHIB 3L09A 5LCYA 4XAXB 1Z0PA 4EYUA 4HEAA 3C4XA 1BR1A 4JEHB 3EUHA 4ISTA 4HTEA 3Q5XA 4BJNA 4H9SE 5JVDE 5LXTE 3T8OA 4K0UA 3NBXX 4KMCA 4JEUB 4O2BE 2CA5A 3ANWB 2GK9A 3O1JA 2CLYC 3EVYA 2CWOA 3I0QA 3RC3A 2XASB 1QUUA 3OYXA 4I4TE 4OYJA 5LGNB 2YU1A 3HKEE 1LVKA 3OKQA 3FB2A 1HG5A 3MKDA 3SRZA 5HYAA 4QXHB 3RPUA 2UXXB 5L3DB 2CCQA 1WLXA 4U74A 2CM0A 5JRCB 2JMKA 4QKNA 4H63V 4L9IA 3KVBA 1WR6A 2CXLA 2KMFA 2BVMA 2WWUA 3ZN1B 5CB4E 3N9NA 2X68A 5LHHB 5FNVE 3B13A 2VK9A 4PK5A 4ZI3D 3N9MA 5FMNA 5LYJE 4L0RA 2D0UA 4IE4A 4DNDA 3HL6A 5DJQC 4X1IE 3N2KE 4AKIA 4YJ3E 3WAKA 4P0AA 4BA9A 3AA0B 2A72A 4GK0E 4MBQA 3QUJA 4IE6A 4CI1B 2LOSA 2RA1A 4PK6A 2K9AA 5JQGE 4UF0B 2LHRA 2CLYB 5J2TE 1ZEEA 3SWHA 4CQIA 2KNDA 4EIWA 5F8PA 1MMNA 2XHEB 4XZCA 3OJAA 4KP3C 4OHFA 3PUGA 5LNKA 2G0UA 5LBQB 4V1Av 3QC9A 1LKXA 2CMRA 3ETVA 1MMGA 4UXNB 3LBXA 4PJLA 1QSDA 2BDEA 2UXNB 3ONXA 2W61A 4C90A 1MNDA 4HGAA 5L3GB 3ETUA 4JUYA 3O1IA 2X0LB 2D0TA 3KVAA 1B7TA 2MTQA 2E9XA 4ZI7E 1S94A 3A5XA 5LHGB 3Q2MA 4H9NC 1V9DA 3SOLA 3ZYKA 3FHNA 2J1DG 1YKHB 4AXPA 4PFOA 3HKBE 5FXXA 4B6XA 3QK6A 5EZYE 5FP3A 3MZKB 5LGTB 3PUQA 4X20E 4X1YE 3ZMVB 5HWYA 2D2SA 2N1GA 4H63H 4PK4A 2A2FX 2V26A 1BR2A 2Z6EA 1US7B 1H7CA 2NTYA 2Y6XA 3PTRB 3OBVE 1KNZA 3C4WA 2Y48B 2KXPB 2Y8DA 2N9DA 2CEAA 2IC9A 1FEWA 3AA1B 3N9QA 2IW5B 1IJ6A 2WSSV 3Q9DA 2QGSA 2VB6A 4UV9B 5M4YA 4KUMB 1HG2A 3MK7C 4I55E 5DQVA 2ZM8A 2RP4A 3ZC0A 4DBQA 1MMAA 2OA5A 3RYCE 4QHOA 2XTLA 2YK0A 3U3IA 3B57A 5E0OA 1O3XA 4BAYB 4C91A 4EYYR 2EHOD 4CXYA 3GA8A 3ZMZB 5L3EB 3PUAA 3N9PA 4QWNB 3KINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXZ A;  1NWM X;  1YD8 G;  2N2N A;  1NAF A;  1WR6 A;  1X79 A;  1WRD A;  2N9D A;  1O3X A; 
#chains in the Genus database with same CATH topology
 1Z8U A;  3N9O A;  1UX4 A;  5FXZ A;  3S4U A;  3SS1 A;  3UUN A;  2BKN A;  2NOX A;  2VQF T;  3AA7 B;  4HE8 A;  4IGU A;  1HFA A;  3M65 A;  1FMV A;  4Z91 A;  3UU3 A;  2Q9Q C;  2VL0 A;  1YKE B;  1NEK A;  1UUS A;  2X9X A;  1Y64 B;  3VRA A;  5CA0 E;  5LGU B;  4DUZ T;  3DJB A;  4YXD A;  5LB7 B;  5LG3 A;  1N34 T;  3RIF A;  1XMQ T;  1W0A A;  5JDM A;  1VOM A;  4JI5 T;  3HKD E;  4LML A;  1HF8 A;  4TV9 E;  1BR0 A;  4YTM A;  4ZZB A;  4A5X A;  3NRX A;  2X9W A;  3VKH A;  2IDO B;  4F6R C;  5EK3 A;  1HR0 T;  3GWH A;  2I6H A;  1FJG T;  4AKL A;  4NXN T;  2X51 A;  1XWM A;  4EZH A;  3ZC1 A;  1HX1 B;  2FBW A;  4HFV A;  3CX6 B;  3KBU A;  2KWH A;  2L9Q A;  3HKC E;  4GYS A;  3H3A A;  2D9D A;  3NWI A;  4EGW A;  2YDR A;  4LMJ A;  4E7S A;  4ZHQ E;  5BMV E;  4AKH A;  2E9X B;  3H37 A;  2W00 A;  4JI0 T;  3RQW A;  4TV8 E;  3UU6 A;  2H7V C;  2HN2 A;  3NZQ A;  3CQX C;  4HFB A;  3ZST A;  2W66 A;  2V1D B;  5C3J A;  3P4S A;  4JV5 T;  1ZHC A;  2W4X A;  2UUC T;  1HCI A;  2YN6 A;  3PUR A;  4DVD A;  4HWF A;  4EED A;  4ZI3 C;  2IML A;  5FY1 A;  3ZKR A;  3DP7 A;  1N32 T;  3OPC A;  4QXB B;  3UFG A;  4ANJ A;  5L4E A;  3OVU A;  4DMV A;  2UUB T;  3AEA A;  4GYR A;  5JDH A;  4WBO A;  3H3M A;  3AAI A;  4HFD A;  4HFC A;  4YHJ A;  3K3O A;  2CRB A;  2PBI A;  3PUV F;  5AQH B;  4AQF C;  1E2A A;  2L3L A;  4ZZC A;  5TAO A;  2HN1 A;  4YY3 T;  2VL8 A;  2WMN A;  2K5B B;  1VRB A;  1NWM X;  2BVL A;  2YEV C;  4U31 A;  4GKJ T;  5FXV A;  1HNZ T;  3L3P A;  2HH7 A;  2E8I A;  2VVN A;  5J0Z A;  1ZV4 X;  4J2C A;  5ABH A;  1D1A A;  3MA9 A;  2DWG A;  3ONJ A;  2LOP A;  2WDQ A;  5HAX A;  3J9X 1;  4NXM T;  1DU2 A;  1BR4 A;  2BKP A;  2C5K T;  3AEE A;  1YW0 A;  3AE1 A;  3CKD A;  4NPP A;  2X9H A;  1Y01 A;  2MPK A;  5AQU B;  4WBN E;  4B3S T;  2BG9 C;  4IE5 A;  2MBG A;  5JR9 C;  5L3C B;  3G06 A;  4CI3 B;  5JDG A;  5L3B B;  2DI4 A;  3BQL A;  3CWZ B;  4PJJ A;  3RHW A;  3ZJ1 A;  2LEH A;  3PE0 A;  1JNR A;  2YU2 A;  4HWC A;  4IRE A;  2YOE A;  3E22 E;  2H89 A;  2MYS A;  5LA6 E;  4CN6 A;  3PUZ F;  5CA1 E;  2LJL A;  2WU5 A;  5AQR B;  4NUU A;  3VR8 A;  5L3F B;  2BBJ A;  1WYC A;  3LJC A;  4X66 T;  3ZCI A;  1I94 T;  3BK9 A;  4U72 A;  5FYM A;  4ILC A;  4CI2 B;  3TKL B;  4OFZ A;  5DQW A;  3AE5 A;  4X62 T;  2K48 A;  3AA6 B;  2XAQ B;  2XQ6 A;  4ISS A;  4PW8 A;  1UGO A;  3RLF F;  5IWA T;  1T72 A;  2NW7 A;  5JDL A;  5HXC A;  2V8S V;  1D1B A;  1E1H B;  4K0K T;  3HR0 A;  4I50 E;  4ADZ A;  2KIN B;  3HI2 A;  2CHO A;  1I6Z A;  2ES0 A;  3BQK A;  5LP6 E;  4KHZ F;  4XBF B;  2KZ7 B;  2BG9 E;  3QOF A;  2UU9 T;  2PTF A;  3LFM A;  2XQY A;  2PJQ A;  4JLE A;  2OV9 A;  2WZI A;  4GK5 E;  3RGL A;  3PUX F;  1WRD A;  2JRK A;  5LJM A;  1D0Y A;  2J4G A;  5KX5 E;  3Q5W A;  4YT0 A;  4PJN A;  3RC8 A;  1D0X A;  3R6N A;  4WW0 A;  4H9P C;  3V5S A;  2V7J A;  4TNV A;  1D1C A;  2V5D A;  3ESL A;  5FL0 A;  4ZI2 C;  3IA3 A;  3LK3 B;  3EDV A;  3DTO A;  4QX7 B;  4YFS A;  2KSR A;  5IHY A;  5LOV E;  4COF A;  1HX8 A;  4IE7 A;  4JI2 T;  5IYZ E;  3CX8 B;  4ZS3 A;  5AQN B;  3R84 B;  3CQG B;  2RPA A;  1SA0 E;  2D5U A;  3W15 B;  2FJD A;  4NUV A;  4JYA T;  3GN5 B;  2IIU A;  1NEN A;  2WCA A;  4O4H E;  5AQS B;  1U4Q A;  2VKO A;  2XQ8 A;  4H9O C;  4HFE A;  4DUY T;  2ACX A;  3CK6 A;  2HPJ A;  4OYK A;  3ABV A;  2DNX A;  2WDR A;  2VKD A;  4H9Q C;  4NIQ A;  2WDV A;  3PV0 F;  4PJM A;  5C8Y E;  4ERR A;  4O4I E;  4DBR A;  2M6I A;  3UUL A;  4YTN A;  5JDN A;  4YHH T;  2IAK A;  3ZT5 A;  2E9X D;  3KV9 A;  1MIV A;  2V5C A;  1G8X A;  1UUR A;  4UVB B;  3EAM A;  1EZ3 A;  1ZKE A;  2V7M A;  2WB5 A;  2JPF A;  3K3N A;  3KFW X;  3N9L A;  3O4X E;  1D0Z A;  3QNU A;  4P0B A;  5AQQ B;  3ZT6 A;  2NW8 A;  4YSX A;  2BS3 A;  2SPC A;  2EHO B;  3KDS E;  3I0O A;  4M1P A;  4UR9 A;  3UUX B;  1OXZ A;  4IHJ E;  2ZLY A;  1L0V A;  4WNK A;  5AQF B;  2CXF A;  5H6Q B;  1HS7 A;  4G63 A;  5HXS A;  2NWB A;  4TNW A;  3UQ7 A;  5LBM A;  2J62 A;  1GQE A;  3AVS A;  2Q9Q A;  5C2T A;  2CE7 A;  3RH3 A;  3EDU A;  4HWD A;  3RIU C;  4HWH A;  2LSY A;  4HKA A;  4LF9 T;  3NVO A;  3AED A;  4TX5 A;  4AKR B;  3O9X A;  5ADX L;  2XY8 B;  1IBK T;  1UX5 A;  2ZMA A;  3MAC A;  1CHU A;  5HCJ A;  2XQ4 A;  2LLY A;  3FBZ A;  3IF8 B;  4TWF A;  2WAU A;  2CBI A;  2BG9 B;  4UV8 B;  4IL9 A;  3UQ4 A;  3AEF A;  5J1G A;  5HEJ A;  5JR9 B;  4LMK A;  4H9R C;  5JDF A;  2XSA A;  3AE3 A;  2V6X A;  2W63 A;  2YDQ A;  3P50 A;  4G2A A;  2X9Y A;  5JH7 E;  3WAJ A;  5JDQ A;  3ZYM A;  2IHR 1;  1W0B A;  4ZS2 A;  4DID B;  4B3T T;  4B3R T;  1UCU A;  3RYF E;  1M62 A;  2LHN A;  4LF6 T;  3RRC A;  4U33 A;  4E7Z A;  2L8K A;  2W67 A;  3ZYL A;  5F3J A;  3UTK A;  3AAE B;  2IUB A;  3EAB A;  2VKH A;  5L4H A;  2QVA A;  2QA7 A;  1M7K A;  1U5P A;  1YXR A;  4ASK A;  2V7K A;  2H7O A;  2JQK A;  3RQU A;  3BQI A;  3PU3 A;  4YJ2 E;  4L5G A;  1UK5 A;  4MAL A;  5HEU A;  3O1H A;  5FKY A;  5ABF B;  2JMH A;  1KNP A;  2XAH B;  3TLT A;  1FMW A;  2JIW A;  1IZN B;  2LSK A;  2LRL A;  3K8P C;  3UUM A;  3VU7 H;  3K1S A;  1IJ5 A;  2VUR A;  4AQF A;  2DCF A;  2VAS A;  3E0Z A;  3F2E A;  5HXE A;  2LSJ A;  1SE7 A;  2WZH A;  3TLU A;  3ZN0 B;  5L2L A;  1XZY A;  2JQQ A;  4IDQ A;  3C64 A;  2LSI A;  1WFD A;  3CIR A;  3FZH B;  3GMI A;  3ZMU B;  1SHZ C;  4ILA A;  3UFE A;  4O2A E;  3CX7 B;  2WM9 A;  2P9B A;  1WYB A;  4P09 A;  2XPK A;  2XM2 A;  3AB3 B;  1MNE A;  1WR0 A;  2IC6 A;  2MOZ A;  2XQ5 A;  3ONL C;  4DR3 T;  2ZM0 A;  4TWH A;  3UT5 E;  3RRW A;  4A98 A;  4DO0 A;  3TLW A;  2DLR A;  3WI3 A;  2CPT A;  4FI5 A;  1NAF A;  3ZSS A;  4OK0 A;  3VHL A;  3ZMS B;  5KDM C;  3F57 A;  2JJ9 A;  3J7Y q;  5KMG P;  3N5L A;  2NW9 A;  1LVF A;  4KHP T;  2E5L T;  2WMO A;  5AQK B;  1OED C;  1OED E;  1T7S A;  4ZXL A;  2LKH A;  5HXH A;  2K24 A;  4ZI2 D;  2BZB A;  3L39 A;  4DV0 T;  4ILU A;  4MLK A;  3C98 B;  1ZP0 A;  5FVK A;  5HEO A;  5AFU L;  5BR8 T;  2NTX A;  4DMW A;  2NP9 A;  5JRC A;  2H3R A;  3AXJ B;  4O8S A;  3SFE A;  4LF4 T;  4LFC T;  4EAH A;  1X79 A;  3PJA A;  1T98 A;  2Q9Q D;  1E7P A;  1HTJ F;  4DR7 T;  4CZZ B;  2X66 A;  2MAW A;  3AE9 A;  1YD8 G;  5GON E;  2C5J A;  3KV4 A;  3AEC A;  2UUA T;  2W2U A;  5JRE A;  2ZM2 A;  4QX8 B;  2M67 A;  2PFV A;  4PFP A;  2DWK A;  3JC6 C;  2NR4 A;  5CFB A;  5J2U E;  1YQ3 A;  2LE8 A;  3CQC B;  4JBW F;  4P1N A;  2CXD A;  3N2G E;  5EK4 A;  3FXD B;  4EB6 E;  3HA4 A;  3AEG A;  5FXW A;  3P7I A;  1T8B A;  1J5W A;  3GN5 A;  1KNR A;  3TLV A;  5IUX A;  2ODV A;  4Z8X A;  4BJM A;  3NZP A;  2XUE A;  2LM9 A;  3CML A;  3RKO A;  5FVL A;  1N33 T;  3LG7 A;  3ZMT B;  1FIO A;  4IDZ A;  4EOZ B;  4GIW A;  4U3C A;  4UEM A;  3PUW F;  4UF0 A;  4CXX A;  3UU4 A;  2VKJ A;  3JCF A;  3ANW A;  3I1A A;  4HN9 A;  5FY0 A;  3SFD A;  4DV6 T;  1OWA A;  2V6Y A;  3T1H T;  1VCT A;  3ZJ2 A;  5LMU T;  4DR6 T;  4CXW A;  2WBL A;  1KFY A;  3JAD A;  2FJA A;  4LFA T;  4PAG A;  2ZM6 T;  2E9X C;  4I43 B;  4HFI A;  2H88 A;  3CVR A;  3P8C D;  3RIU A;  3MXZ A;  2BS2 A;  3UUB A;  4DR5 T;  2KWI B;  4JI6 T;  2YIN A;  4JI7 T;  4AQG A;  3I9W A;  1XNR T;  3VKG A;  3LK2 B;  2EHO A;  2XQ3 A;  2A3D A;  2DHR A;  2XQ7 A;  3LBX B;  4IE0 A;  3OYZ A;  3PU8 A;  3MJX A;  3FBL A;  1KK7 A;  1MIW A;  4IIJ E;  4EZ4 A;  4TZ4 C;  5ABF A;  3AAA B;  2BBH A;  3KV5 A;  3UU5 A;  1WCR A;  5KXJ A;  1AJ3 A;  4QXC B;  2W62 A;  2XAJ B;  3KBT A;  5EK2 A;  4X65 T;  5A1L A;  1G73 A;  2M6B A;  2X67 A;  2V7L A;  3LK4 2;  1LRZ A;  3D0T A;  4KI0 F;  4MHC A;  2W0G A;  2Q9Q B;  2VWA A;  1X9B A;  5AQP B;  2CWY A;  5AQV B;  4GOU A;  3CPZ A;  2C5I T;  3RX6 A;  2WS3 A;  3FXE B;  3N2O A;  1S35 A;  2N2N A;  5DAB A;  3RYH E;  3C4Z A;  4PNI A;  2KT9 A;  1ZOY A;  3PJA J;  4WZX A;  2B1E A;  1MMD A;  5FL1 A;  2EHO C;  3C50 A;  4UEL A;  4O4L E;  3PDY A;  4ZOL E;  4JI8 T;  3ZLI A;  2KLQ A;  3KV6 A;  2ODU A;  4AI6 A;  2BG9 A;  2LT3 A;  5JR9 A;  4N78 D;  4I0U A;  4U2Y A;  4TUY E;  3ZCJ A;  4FJO A;  3P4P A;  3AVR A;  2PG8 A;  4O4J E;  3V5U A;  4X1K E;  4DV1 T;  4UVA B;  2AXD S;  4KBM B;  5AQM B;  3IBP A;  3E08 A;  3IEE A;  5ETW A;  1CUN A;  3NRY A;  4MFR A;  3C51 A;  3RI5 A;  5LJN A;  1IBL T;  3IHR A;  3AE4 A;  3ZPO A;  2XAG B;  1XDP A;  3AE7 A;  5AQG B;  5FY7 A;  4AKG A;  1KF6 A;  3K3Q C;  3RKG A;  3OTO T;  2QRX A;  1XMO T;  1HNW T;  1MIY A;  4TN7 B;  2I59 A;  3ZEF B;  2JQ9 A;  3AXJ A;  3F31 A;  2V7I A;  4UIG A;  1JNZ A;  1IAP A;  2XAF B;  4A56 A;  2E2A A;  3FZL B;  1N36 T;  4LF8 T;  3PUS A;  4UVC B;  4EXT A;  2LSG A;  4YLH A;  3UU8 A;  3TLS A;  3FZK B;  3RYI E;  3U78 A;  2HPL A;  5ABE A;  4CN4 A;  5HWX A;  2UXB T;  5HXR A;  2C0S A;  3I9Y A;  3JC6 D;  2J47 A;  3LDQ B;  5LG4 A;  1VCS A;  3PUY F;  5LHI B;  4DR4 T;  5AQJ B;  3L09 A;  5LCY A;  4XAX B;  5AQT B;  3RIA A;  4YSZ A;  2UXC T;  1Z0P A;  4AIU A;  4EYU A;  2JQH A;  4HEA A;  3A7M A;  1SUM B;  3C4X A;  1BR1 A;  4JEH B;  3Q5D A;  1R8I A;  3EUH A;  4IST A;  4HTE A;  3Q5X A;  4BJN A;  4H9S E;  5JVD E;  5LXT E;  3T8O A;  4ZEY A;  1KEY A;  4K0U A;  3NBX X;  4KMC A;  4DV7 T;  4JEU B;  4O2B E;  2CA5 A;  5H6R B;  1J5E T;  1W09 A;  1W9R A;  4U7I A;  3ANW B;  2GK9 A;  3O1J A;  4WYV A;  2HHH T;  2CLY C;  3EVY A;  2CWO A;  3I0Q A;  3RC3 A;  2XQ9 A;  2F4V T;  2XAS B;  1QUU A;  3OYX A;  2CHN A;  2XJ7 A;  4I4T E;  4OYJ A;  5LGN B;  4DV4 T;  4JI4 T;  2YU1 A;  3HKE E;  1LVK A;  3OKQ A;  3FB2 A;  1HG5 A;  3MKD A;  3P4Q A;  4IT4 A;  3SRZ A;  4QXH B;  3RF1 A;  3RPU A;  5HYA A;  2UXX B;  2X0Y A;  3QB5 K;  4JI3 T;  5L3D B;  2CCQ A;  4AQY T;  4QH5 A;  1WLX A;  4U74 A;  2CM0 A;  5JRC B;  2JMK A;  4F8H A;  4QKN A;  4U2Z A;  4H63 V;  3VR9 A;  2E5V A;  4L9I A;  5CJ5 A;  3AE6 A;  1WR6 A;  2XM1 A;  3KVB A;  4DV5 T;  2CXL A;  2KMF A;  4A97 A;  4AIS A;  2BVM A;  2WWU A;  3ZN1 B;  5CB4 E;  4IDO A;  3N9N A;  2X68 A;  5LHH B;  5FNV E;  5CGM A;  1HNX T;  1OED B;  2WU2 A;  2VK9 A;  3B13 A;  3NKZ A;  3EHZ A;  3JAE A;  3N9M A;  4PK5 A;  5FMN A;  4ZI3 D;  5L47 A;  4L0R A;  5LYJ E;  2D0U A;  4X64 T;  4LF7 T;  4IE4 A;  3M3Z B;  4DND A;  5ABG A;  2FUP A;  3HL6 A;  3P4W A;  4U7Y A;  4X1I E;  3N2K E;  5DJQ C;  3ZT7 A;  2VQE T;  4OX9 T;  4AKI A;  2K3W A;  4DV2 T;  2XZE A;  3QB5 A;  4YJ3 E;  3WAK A;  4P0A A;  1XNQ T;  4BA9 A;  3AA0 B;  2A72 A;  3JAF A;  3Q5E A;  4GK0 E;  4MBQ A;  3QUJ A;  4IE6 A;  4CI1 B;  2VVS A;  4LFB T;  2LOS A;  2RA1 A;  4PK6 A;  2K9A A;  5JQG E;  4UF0 B;  2LHR A;  4GKK T;  2BS4 A;  2CLY B;  5J2T E;  1ZEE A;  4IL4 A;  3SWH A;  4LF5 T;  4CQI A;  2KND A;  4EIW A;  5F8P A;  1MMN A;  2V6Y B;  2XHE B;  4XZC A;  3B5M A;  3OJA A;  4CN1 A;  5F5W A;  3FZM B;  2DL1 A;  4KP3 C;  4OHF A;  3PUG A;  5LNK A;  2G0U A;  4Z90 A;  5LBQ B;  2LRK A;  2R6G F;  4Q25 A;  3QC9 A;  4V1A v;  5JTG A;  1LKX A;  2CMR A;  3ETV A;  4X5T A;  1MMG A;  4UXN B;  3LBX A;  4DV3 T;  4PJL A;  1QSD A;  4IDP A;  2BDE A;  2UXN B;  1IBM T;  3ONX A;  2W61 A;  4C90 A;  1MND A;  4HGA A;  2FJE A;  5LMN T;  5L3G B;  3ETU A;  4JUY A;  4EEB A;  3T1Y T;  3O1I A;  2X0L B;  3L8R A;  2D0T A;  3KVA A;  5HEG A;  2WP9 A;  1B7T A;  2AE9 A;  2MTQ A;  2E9X A;  4ZI7 E;  1S94 A;  3A5X A;  5LHG B;  1XDO A;  2XSB A;  3Q2M A;  4H9N C;  1V9D A;  3SOL A;  4DR2 T;  3ZYK A;  1QLB A;  2YKS A;  3FHN A;  2J1D G;  1YKH B;  3VRB A;  4PFO A;  4AXP A;  2WWV A;  5AQI B;  3HKB E;  5FXX A;  4B6X A;  3QK6 A;  5AQO B;  5EZY E;  5FP3 A;  2WY2 A;  3MZK B;  5LGT B;  3PUQ A;  4HFH A;  4X20 E;  4X1Y E;  4EV6 A;  3ZMV B;  4JI1 T;  5HWY A;  2D2S A;  5HCM A;  2N1G A;  2OLT A;  3AE2 A;  4H63 H;  2LM2 A;  4PK4 A;  2A2F X;  2B76 A;  1BR2 A;  2V26 A;  2Z6E A;  4ILB A;  4QH4 A;  4YSY A;  1US7 B;  1H7C A;  2NTY A;  2Y6X A;  3PTR B;  3OBV E;  1KNZ A;  2A9U A;  3A8Y C;  3C4W A;  3EI0 A;  2XQA A;  2Y48 B;  4YTP A;  2KXP B;  2Y8D A;  2N9D A;  2CEA A;  1J1J A;  4QH1 A;  4TWD A;  2IC9 A;  1FEW A;  4HWI B;  3AA1 B;  2FJB A;  3N9Q A;  1IJ6 A;  2WSS V;  2IW5 B;  3Q9D A;  2QGS A;  2CBJ A;  2VB6 A;  2I0M A;  4KUM B;  4UV9 B;  5M4Y A;  2YDS A;  1HG2 A;  3MK7 C;  4I55 E;  5DQV A;  2ZM8 A;  2RP4 A;  3ZC0 A;  4DBQ A;  1YQ4 A;  1OED A;  4B3M T;  3P4R A;  1MMA A;  2ACZ A;  2QYW A;  2OA5 A;  3RYC E;  2LKG A;  4QHO A;  2XTL A;  2YK0 A;  3LSV A;  5HEH A;  3AE8 A;  3B57 A;  3U3I A;  4IDN A;  5E0O A;  4DR1 T;  1O3X A;  4BAY B;  2X0H A;  4C91 A;  2EHO D;  4EYY R;  4CXY A;  2WQY A;  3GA8 A;  2BKO A;  3X1D A;  4KX6 A;  3ZMZ B;  5L3E B;  3PUA A;  3AEB A;  3FZF B;  3N9P A;  4QWN B;  2UXD T;  5AQL B;  3KIN B; 
#chains in the Genus database with same CATH homology
 3N9O A;  1UX4 A;  5FXZ A;  3S4U A;  3SS1 A;  3UUN A;  2NOX A;  3AA7 B;  4HE8 A;  4IGU A;  1HFA A;  3M65 A;  1FMV A;  2Q9Q C;  1YKE B;  2X9X A;  5CA0 E;  5LGU B;  1Y64 B;  3DJB A;  1VOM A;  3HKD E;  4TV9 E;  1HF8 A;  1BR0 A;  3NRX A;  2X9W A;  3VKH A;  4F6R C;  5EK3 A;  3GWH A;  4AKL A;  2X51 A;  4EZH A;  3ZC1 A;  4HFV A;  3CX6 B;  3KBU A;  2KWH A;  2L9Q A;  3HKC E;  4GYS A;  3H3A A;  4E7S A;  4ZHQ E;  5BMV E;  4AKH A;  2E9X B;  3H37 A;  2W00 A;  4TV8 E;  2H7V C;  3NZQ A;  3CQX C;  2V1D B;  1ZHC A;  1HCI A;  3PUR A;  4DVD A;  4ZI3 C;  5FY1 A;  3DP7 A;  4QXB B;  4ANJ A;  4DMV A;  4GYR A;  5JDH A;  4WBO A;  3AAI A;  4YHJ A;  4AQF C;  3K3O A;  2PBI A;  5JDM A;  2L3L A;  5TAO A;  2VL8 A;  2WMN A;  2K5B B;  1VRB A;  1NWM X;  2BVL A;  2YEV C;  5FXV A;  3L3P A;  2HH7 A;  2E8I A;  1ZV4 X;  4J2C A;  1D1A A;  3MA9 A;  2DWG A;  3J9X 1;  2LOP A;  5HAX A;  1BR4 A;  2C5K T;  3CKD A;  1YW0 A;  2X9H A;  4WBN E;  2MBG A;  4IE5 A;  5JR9 C;  5L3C B;  5JDG A;  4CI3 B;  5L3B B;  2DI4 A;  3BQL A;  3CWZ B;  4PJJ A;  3ZJ1 A;  2LEH A;  3PE0 A;  2YU2 A;  5LA6 E;  3E22 E;  2MYS A;  5CA1 E;  2LJL A;  4NUU A;  5L3F B;  3LJC A;  1WYC A;  3ZCI A;  3BK9 A;  4U72 A;  5FYM A;  4CI2 B;  3TKL B;  4OFZ A;  5DQW A;  2K48 A;  3AA6 B;  2XAQ B;  4ISS A;  4PW8 A;  2NW7 A;  5JDL A;  5HXC A;  1D1B A;  1E1H B;  3HR0 A;  4I50 E;  4ADZ A;  2KIN B;  3HI2 A;  2ES0 A;  3BQK A;  5LP6 E;  4XBF B;  2KZ7 B;  3LFM A;  2XQY A;  2PJQ A;  4JLE A;  4GK5 E;  1WRD A;  2JRK A;  5LJM A;  1D0Y A;  5KX5 E;  3Q5W A;  3RC8 A;  4PJN A;  1D0X A;  3R6N A;  4WW0 A;  4H9P C;  3V5S A;  2V7J A;  1D1C A;  3ESL A;  4ZI2 C;  3LK3 B;  4QX7 B;  3EDV A;  3DTO A;  4YFS A;  5IHY A;  5LOV E;  5EK2 A;  1HX8 A;  4IE7 A;  5IYZ E;  3CX8 B;  4ZS3 A;  3R84 B;  3CQG B;  1SA0 E;  2D5U A;  3W15 B;  4NUV A;  3GN5 B;  4O4H E;  1U4Q A;  2VKO A;  4H9O C;  2ACX A;  2HPJ A;  4OYK A;  4H9Q C;  2DNX A;  4PJM A;  2VKD A;  5C8Y E;  4ERR A;  4O4I E;  4DBR A;  3UUL A;  5JDN A;  2IAK A;  2E9X D;  3KV9 A;  1MIV A;  1G8X A;  4UVB B;  1EZ3 A;  1ZKE A;  2V7M A;  3K3N A;  2JPF A;  3KFW X;  3N9L A;  3O4X E;  4P0B A;  1D0Z A;  3RYH E;  2NW8 A;  2SPC A;  3KDS E;  2EHO B;  3I0O A;  4M1P A;  3UUX B;  1OXZ A;  4IHJ E;  2ZLY A;  4WNK A;  2CXF A;  5H6Q B;  1HS7 A;  4G63 A;  5HXS A;  2NWB A;  5LBM A;  3AVS A;  2Q9Q A;  2CE7 A;  3RH3 A;  3EDU A;  2LSY A;  4HKA A;  4TX5 A;  4AKR B;  3O9X A;  5ADX L;  1UX5 A;  2ZMA A;  3MAC A;  3FBZ A;  3IF8 B;  2WAU A;  4UV8 B;  5JR9 B;  5J1G A;  4H9R C;  5JDF A;  2W63 A;  4G2A A;  2X9Y A;  5JH7 E;  3WAJ A;  5JDQ A;  3ZYM A;  4ZS2 A;  1UCU A;  3RYF E;  2LHN A;  3RRC A;  4E7Z A;  2L8K A;  3ZYL A;  5F3J A;  3UTK A;  3AAE B;  2VKH A;  2QA7 A;  1U5P A;  4ASK A;  2V7K A;  2H7O A;  4YJ2 E;  3BQI A;  3PU3 A;  4L5G A;  4MAL A;  3O1H A;  2JMH A;  2XAH B;  1FMW A;  3VU7 H;  1IZN B;  2LSK A;  3K8P C;  3UUM A;  1IJ5 A;  4AQF A;  3E0Z A;  2DCF A;  2VAS A;  3F2E A;  5HXE A;  2LSJ A;  3ZN0 B;  5L2L A;  2JQQ A;  3ZMU B;  3C64 A;  2LSI A;  3GMI A;  1SHZ C;  3UFE A;  4O2A E;  3CX7 B;  2WM9 A;  2P9B A;  1WYB A;  4P09 A;  3AB3 B;  1MNE A;  2IC6 A;  2MOZ A;  2ZM0 A;  3UT5 E;  4DO0 A;  3RRW A;  2DLR A;  3WI3 A;  4FI5 A;  1NAF A;  4OK0 A;  3VHL A;  3ZMS B;  5KDM C;  3F57 A;  2JJ9 A;  5KMG P;  3N5L A;  2NW9 A;  1LVF A;  2WMO A;  5HXH A;  2K24 A;  4ZI2 D;  2BZB A;  4ILU A;  4MLK A;  3C98 B;  5AFU L;  2NTX A;  4DMW A;  2NP9 A;  5JRC A;  2H3R A;  4O8S A;  4EAH A;  1X79 A;  1T98 A;  2Q9Q D;  1HTJ F;  4CZZ B;  2X66 A;  1YD8 G;  5GON E;  2C5J A;  3KV4 A;  5JRE A;  2ZM2 A;  4QX8 B;  2M67 A;  2PFV A;  4PFP A;  2DWK A;  3JC6 C;  5J2U E;  2LE8 A;  3CQC B;  2CXD A;  3N2G E;  5EK4 A;  3FXD B;  4EB6 E;  3HA4 A;  5FXW A;  3P7I A;  3GN5 A;  2ODV A;  4Z8X A;  4BJM A;  3NZP A;  2XUE A;  2LM9 A;  3CML A;  3RKO A;  3LG7 A;  3ZMT B;  1FIO A;  4IDZ A;  4EOZ B;  4GIW A;  4UEM A;  4UF0 A;  4CXX A;  2VKJ A;  3ANW A;  3I1A A;  4HN9 A;  5FY0 A;  1OWA A;  3ZJ2 A;  4CXW A;  2WBL A;  4PAG A;  2E9X C;  4I43 B;  3CVR A;  3P8C D;  3MXZ A;  2KWI B;  2YIN A;  4AQG A;  3I9W A;  3VKG A;  3LK2 B;  2EHO A;  5H6R B;  2A3D A;  2DHR A;  3LBX B;  4IE0 A;  3OYZ A;  3PU8 A;  3MJX A;  3FBL A;  1KK7 A;  1MIW A;  4IIJ E;  4EZ4 A;  4TZ4 C;  3AAA B;  3KV5 A;  1AJ3 A;  4QXC B;  2W62 A;  2XAJ B;  3KBT A;  5A1L A;  1G73 A;  2X67 A;  3LK4 2;  2V7L A;  1LRZ A;  3D0T A;  4MHC A;  2W0G A;  2Q9Q B;  2VWA A;  2CWY A;  4GOU A;  3CPZ A;  2C5I T;  3RX6 A;  3N2O A;  3FXE B;  5DAB A;  1S35 A;  2N2N A;  3J7Y q;  3C4Z A;  4PNI A;  2KT9 A;  2B1E A;  1MMD A;  2EHO C;  3C50 A;  4UEL A;  4O4L E;  3PDY A;  4ZOL E;  3ZLI A;  2KLQ A;  3KV6 A;  2ODU A;  4AI6 A;  2LT3 A;  5JR9 A;  4N78 D;  4TUY E;  3ZCJ A;  4FJO A;  3V5U A;  3AVR A;  2PG8 A;  4O4J E;  4X1K E;  4UVA B;  4KBM B;  3IBP A;  3E08 A;  3IEE A;  5ETW A;  1CUN A;  3NRY A;  4MFR A;  3C51 A;  5LJN A;  3IHR A;  3ZPO A;  2XAG B;  5FY7 A;  4AKG A;  3K3Q C;  1MIY A;  4TN7 B;  2I59 A;  3ZEF B;  3F31 A;  2V7I A;  4UIG A;  2XAF B;  1IAP A;  4A56 A;  3PUS A;  4UVC B;  4EXT A;  2LSG A;  4YLH A;  3RYI E;  3U78 A;  2HPL A;  5HWX A;  5HXR A;  2C0S A;  3I9Y A;  3JC6 D;  5LG4 A;  5LHI B;  3L09 A;  5LCY A;  4XAX B;  1Z0P A;  4EYU A;  4HEA A;  3C4X A;  1BR1 A;  4JEH B;  3EUH A;  4IST A;  4HTE A;  3Q5X A;  4BJN A;  4H9S E;  5JVD E;  5LXT E;  3T8O A;  4K0U A;  3NBX X;  4KMC A;  4JEU B;  4O2B E;  2CA5 A;  3ANW B;  2GK9 A;  3O1J A;  2CLY C;  3EVY A;  2CWO A;  3I0Q A;  3RC3 A;  2XAS B;  1QUU A;  3OYX A;  4I4T E;  4OYJ A;  5LGN B;  2YU1 A;  3HKE E;  1LVK A;  3OKQ A;  3FB2 A;  1HG5 A;  3MKD A;  3SRZ A;  5HYA A;  4QXH B;  3RPU A;  2UXX B;  5L3D B;  2CCQ A;  1WLX A;  4U74 A;  2CM0 A;  5JRC B;  2JMK A;  4QKN A;  4H63 V;  4L9I A;  3KVB A;  1WR6 A;  2CXL A;  2KMF A;  2BVM A;  2WWU A;  3ZN1 B;  5CB4 E;  3N9N A;  2X68 A;  5LHH B;  5FNV E;  3B13 A;  2VK9 A;  4PK5 A;  4ZI3 D;  3N9M A;  5FMN A;  5LYJ E;  4L0R A;  2D0U A;  4IE4 A;  4DND A;  3HL6 A;  5DJQ C;  4X1I E;  3N2K E;  4AKI A;  4YJ3 E;  3WAK A;  4P0A A;  4BA9 A;  3AA0 B;  2A72 A;  4GK0 E;  4MBQ A;  3QUJ A;  4IE6 A;  4CI1 B;  2LOS A;  2RA1 A;  4PK6 A;  2K9A A;  5JQG E;  4UF0 B;  2LHR A;  2CLY B;  5J2T E;  1ZEE A;  3SWH A;  4CQI A;  2KND A;  4EIW A;  5F8P A;  1MMN A;  2XHE B;  4XZC A;  3OJA A;  4KP3 C;  4OHF A;  3PUG A;  5LNK A;  2G0U A;  5LBQ B;  4V1A v;  3QC9 A;  1LKX A;  2CMR A;  3ETV A;  1MMG A;  4UXN B;  3LBX A;  4PJL A;  1QSD A;  2BDE A;  2UXN B;  3ONX A;  2W61 A;  4C90 A;  1MND A;  4HGA A;  5L3G B;  3ETU A;  4JUY A;  3O1I A;  2X0L B;  2D0T A;  3KVA A;  1B7T A;  2MTQ A;  2E9X A;  4ZI7 E;  1S94 A;  3A5X A;  5LHG B;  3Q2M A;  4H9N C;  1V9D A;  3SOL A;  3ZYK A;  3FHN A;  2J1D G;  1YKH B;  4AXP A;  4PFO A;  3HKB E;  5FXX A;  4B6X A;  3QK6 A;  5EZY E;  5FP3 A;  3MZK B;  5LGT B;  3PUQ A;  4X20 E;  4X1Y E;  3ZMV B;  5HWY A;  2D2S A;  2N1G A;  4H63 H;  4PK4 A;  2A2F X;  2V26 A;  1BR2 A;  2Z6E A;  1US7 B;  1H7C A;  2NTY A;  2Y6X A;  3PTR B;  3OBV E;  1KNZ A;  3C4W A;  2Y48 B;  2KXP B;  2Y8D A;  2N9D A;  2CEA A;  2IC9 A;  1FEW A;  3AA1 B;  3N9Q A;  2IW5 B;  1IJ6 A;  2WSS V;  3Q9D A;  2QGS A;  2VB6 A;  4UV9 B;  5M4Y A;  4KUM B;  1HG2 A;  3MK7 C;  4I55 E;  5DQV A;  2ZM8 A;  2RP4 A;  3ZC0 A;  4DBQ A;  1MMA A;  2OA5 A;  3RYC E;  4QHO A;  2XTL A;  2YK0 A;  3U3I A;  3B57 A;  5E0O A;  1O3X A;  4BAY B;  4C91 A;  4EYY R;  2EHO D;  4CXY A;  3GA8 A;  3ZMZ B;  5L3E B;  3PUA A;  3N9P A;  4QWN B;  3KIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...