1O3XA

Crystal structure of human gga1 gat domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
AANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Molecular Mechanism of Membrane Recruitment of Gga by Arf in Lysosomal Protein Transport
pubmed doi rcsb
source organism Homo sapiens
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1o3xA00
1NAFA 1O3XA 2N2NA 1WR6A 2N9DA 1NWMX 1X79A 1WRDA 1OXZA 1YD8G
chains in the Genus database with same CATH superfamily
3ZT7A 5CJ5A 4OHFA 1WLXA 1UX4A 3AE5A 4EIWA 3PUWF 3CPZA 1MMAA 2D5UA 5AQHB 5FYMA 4JI1T 1JNZA 4YTNA 4BJNA 3NRXA 4AKHA 4G2AA 3E08A 2XQYA 3BQLA 3SS1A 2L3LA 4P09A 2AXDS 1VRBA 3ZEFB 2B76A 2WWUA 3VRBA 1FMWA 3HA4A 2BKOA 3X1DA 3JAFA 4CN6A 2V7IA 3CVRA 5JTGA 1T72A 4P0BA 2CLYB 3AE4A 3ETVA 4OK0A 4O2BE 4PJLA 3SFEA 5A1LA 2JJ9A 3ZT5A 4IREA 4LF5T 3Q5WA 2A72A 3AEBA 2BG9C 4DR3T 3EVYA 2VB6A 5EZYE 4UELA 2XAFB 5HXCA 4DV1T 2WDRA 3AE3A 4C90A 5LA6E 2EHOC 2CHOA 2NWBA 5L3GB 4A5XA 1T8BA 2MAWA 3KVBA 2E5LT 3B5MA 4YSZA 4IDQA 1ZKEA 4PJNA 3ZKRA 3JADA 1KNPA 3N9MA 1HR0T 1U5PA 5HAXA 2WS3A 3R6NA 2OA5A 4X1IE 5CGMA 3UUBA 4NXNT 1SA0E 4GKKT 5KXJA 5EK3A 3CX6B 1W09A 4U2YA 1US7B 4L0RA 5HXRA 4ZHQE 5AQIB 4EZ4A 2VQET 1WYBA 2UUAT 4WW0A 3QB5A 1MMNA 1MIWA 2FJEA 2KZ7B 3ETUA 2WZIA 2FJBA 3I9WA 4H63V 2NTXA 1NEKA 5FL1A 2NW7A 4O2AE 1HNZT 5DABA 2XQ6A 2NP9A 3VKHA 3JAEA 3D0TA 2CWOA 2FBWA 5L2LA 2Q9QC 2W4XA 2CBIA 2J62A 5EK2A 1KFYA 5FXXA 4JI0T 2ZMAA 1IJ5A 1QSDA 4AKGA 1ZHCA 4PJMA 2QRXA 2VK9A 2YEVC 1J1JA 4AKLA 3IEEA 4UV8B 5AQOB 2IHR1 4Z8XA 2X0HA 4YHHT 4QH4A 3KV4A 3TLSA 3SFDA 3UUXB 1YD8G 2ODUA 2E9XA 5JR9C 1DU2A 4YSYA 2DHRA 3HKBE 4E7ZA 2RP4A 4GK0E 3L09A 1HX1B 5LHGB 2BVLA 4UEMA 2C5JA 3EABA 4TWDA 2KINB 5JDLA 2WDQA 1ZOYA 5FXWA 1XZYA 4UVAB 5H6RB 3TLWA 1D1CA 2EHOD 1ZV4X 3B13A 4HWHA 4HN9A 3DP7A 1HF8A 3UUMA 4DV6T 3J7Yq 3OYXA 2HHHT 3HR0A 3ONJA 3WI3A 2OV9A 4HE8A 1J5WA 3MKDA 4YTMA 4X66T 4QX7B 3UT5E 4OYKA 2LKGA 4I50E 3T8OA 2V6YA 2WWVA 3EDVA 4JEUB 2A2FX 3BK9A 1UURA 4Z91A 2DCFA 5L4EA 1WCRA 3ABVA 2NW8A 4YXDA 2W66A 2V1DB 2E9XB 3PUZF 2WY2A 5KDMC 4HWFA 4LF7T 1HG5A 4LMJA 5AQKB 2PG8A 2VQFT 4I55E 4PK4A 1MNEA 5FXVA 4I0UA 5HEJA 1N36T 2MOZA 3ZCJA 5JH7E 3A8YC 1B7TA 3ZSTA 3AB3B 4ILCA 3NKZA 4I43B 1LKXA 2JPFA 5JDMA 4ZI2C 2Q9QD 4I4TE 2XAHB 2D9DA 2XUEA 2UXXB 4WBNE 1NAFA 4K0KT 4CI3B 4AQYT 3KDSE 4YHJA 2IMLA 3EI0A 2LSGA 2WU5A 3AVSA 4QX8B 3ZN0B 2CA5A 1KNZA 2V6YB 4CQIA 2L8KA 3S4UA 4TWHA 5J0ZA 3ZYLA 4UIGA 3DJBA 5FY0A 3IBPA 3ZJ1A 4EOZB 3UUNA 3PJAA 4H9PC 4A98A 2IAKA 2ACXA 4KP3C 2KXPB 2VKHA 5ABFA 2V7KA 3PDYA 3UU6A 3LSVA 2HN1A 3KFWX 3RF1A 3JC6D 4AIUA 4GKJT 3LK42 5HXHA 4ISTA 2X9WA 2ZM0A 5HEUA 5HEGA 2V5DA 2W67A 3ZC1A 2ZM8A 1OWAA 4ILAA 3LFMA 3GA8A 4UVBB 3HL6A 1YKHB 2LSKA 3A7MA 2P9BA 1GQEA 4IHJE 2BKNA 2BS4A 4X20E 2LM2A 2MPKA 2YINA 3LK2B 4DBQA 2FJDA 2L9QA 3AXJA 4FI5A 2WBLA 4CN4A 4MHCA 2IDOB 1O3XA 3UU4A 2R6GF 5LBMA 3RKGA 2WCAA 4ILUA 5AQNB 4LMLA 5IHYA 4YY3T 1JNRA 2LHNA 4HFCA 3CKDA 2XQ5A 1R8IA 4AQFC 3AE9A 4GOUA 5AQJB 4IL4A 4ILBA 1W9RA 3L8RA 2LSYA 2H88A 1W0AA 2H7OA 2WP9A 3N9NA 2X67A 4JV5T 4X1KE 3AAEB 4IDZA 4JBWF 1AJ3A 1N32T 1FEWA 5HXEA 5HCJA 3NZPA 3AA1B 4O4HE 2XSBA 5LGUB 2XQAA 5LCYA 5CA0E 3P50A 1W0BA 2MBGA 3AEEA 4XBFB 2BZBA 1I6ZA 5E0OA 3AXJB 3CIRA 4KHPT 3RQUA 5AQSB 1IBMT 4HFDA 3A5XA 4DO0A 4G63A 1XNRT 3P4RA 2QA7A 4PFPA 3FZHB 5L3CB 3K3NA 3PJAJ 1IBLT 4MFRA 4JI6T 3TLVA 2UUBT 3GWHA 4LF8T 3MZKB 5AQQB 2XAGB 4M1PA 5FY1A 3QC9A 4PNIA 3M3ZB 3J9X1 4AISA 2UXCT 2VVSA 4PFOA 2M6BA 4NXMT 2PFVA 3P4PA 4DMVA 4TZ4C 3RGLA 4ZXLA 3K3OA 1E2AA 2CLYC 5JDQA 3ZSSA 4GYRA 4CI2B 2CEAA 2IC9A 1OEDE 3ZYKA 2XSAA 3F2EA 3AA6B 4OFZA 3SOLA 3CX8B 4P1NA 2I59A 4O4JE 5LMNT 3ZLIA 2KSRA 3P7IA 4CXXA 4HFIA 4EAHA 4TX5A 2N9DA 1LVFA 3TLTA 4HGAA 4HWDA 2H7VC 4TUYE 1HNWT 4NUUA 1LVKA 2FJAA 5AQPB 4QWNB 2WDVA 2JMHA 5L3EB 4U74A 4NPPA 3TLUA 2VL8A 2W62A 3QNUA 2XM2A 3WAKA 4EV6A 4EEBA 1QLBA 2LM9A 4H9SE 1HS7A 4CI1B 1HTJF 5CB4E 3NBXX 3ZT6A 4QXBB 3ZMSB 4BJMA 5F5WA 3PUVF 3RIUA 1NENA 2I6HA 4WZXA 2XQ7A 3KV5A 2VL0A 4EB6E 4ZI3C 5LGTB 3ZMVB 3AE7A 1ZEEA 3OJAA 5FVKA 5FL0A 5LB7B 3Q2MA 2VVNA 3V5SA 3CK6A 1WR0A 3EUHA 3U3IA 4IE5A 3OYZA 2LRKA 2WZHA 5ABGA 2M67A 2WB5A 5LG4A 4TNWA 3C50A 2X51A 4DNDA 4JI3T 3ANWA 3C4XA 3AA7B 2DI4A 2JQ9A 4X1YE 4IIJE 4LF9T 4O8SA 2XQ9A 3NZQA 5LXTE 4DUYT 3C51A 3P4WA 2C0SA 4L9IA 4YJ3E 3IF8B 4HWCA 1FMVA 2CE7A 2DLRA 2DWKA 1OEDA 2CCQA 3ZJ2A 1FJGT 4YJ2E 2YDRA 3UU5A 4PAGA 4HEAA 3JC6C 4U7YA 3HKEE 4WNKA 1D0XA 2CBJA 2AE9A 4OYJA 2DL1A 5DJQC 5C3JA 3RX6A 5DQVA 3CQCB 4O4IE 1G8XA 2YK0A 4A56A 4C91A 1BR4A 4X65T 1YXRA 2ZM6T 4U7IA 2CXDA 3LK3B 2XM1A 2LJLA 3ANWB 2E8IA 4GYSA 3QB5K 2UUCT 3AEFA 5HWXA 4DR7T 1WR6A 2YDSA 5J2UE 4PJJA 4EEDA 5JQGE 1IJ6A 3O1JA 4ZZCA 3RH3A 1YQ3A 3O4XE 1Z0PA 4UF0A 2E9XC 2X9XA 4DVDA 2OLTA 4HFHA 3ONXA 4ZI3D 3L3PA 2VURA 4B3MT 1UGOA 5BMVE 4DV4T 1OEDB 1S94A 2D0TA 3PU8A 5AQMB 3RYFE 4EXTA 1N34T 2QYWA 4AQGA 4AXPA 3UFGA 4JUYA 4IT4A 4FJOA 2N1GA 2IW5B 1D0YA 4CXYA 3Q5DA 1FIOA 5LNKA 5LP6E 1IBKT 3UTKA 2BDEA 4JI5T 2JIWA 3I0QA 5C2TA 2V7LA 4LFCT 2XZEA 4UVCB 4YTPA 2K24A 3FB2A 4F6RC 3ZN1B 4JLEA 3FXDB 5BR8T 1HNXT 2YKSA 2WSSV 2J4GA 3MXZA 1H7CA 4ZOLE 5FY7A 2JQHA 2V6XA 5JRCA 4UF0B 3MK7C 1XMQT 3MA9A 3VR8A 4IDNA 4NUVA 4HFBA 3E22E 3JCFA 5FXZA 2WAUA 2CWYA 3V5UA 4YLHA 1MIVA 2PTFA 2BG9E 1D1BA 1IZNB 3C64A 4HFVA 2PJQA 4XAXB 4ASKA 2W0GA 3MACA 3VRAA 3QOFA 5HYAA 4TN7B 1IAPA 3PTRB 4PK5A 4TV9E 2YDQA 2WMOA 3TKLB 3C4ZA 2XJ7A 3GN5A 2KLQA 2BS2A 4A97A 5H6QB 1CUNA 2X9YA 3IHRA 2V7MA 3L39A 3PUSA 5TAOA 2ZM2A 2WU2A 1U4QA 3RIFA 4Z90A 1WFDA 1MMGA 4IDOA 2E9XD 1XDPA 4GK5E 4CN1A 2A3DA 2LHRA 1MMDA 1I94T 2KNDA 2VKOA 5ABFB 2C5KT 2D2SA 3T1YT 2XQ3A 4IE6A 4JI7T 2KWHA 5AQGB 3MJXA 3KV6A 2RPAA 1XMOT 1BR2A 2E5VA 2XASB 4KBMB 3ZC0A 4IE0A 3AEDA 4ZI7E 1CHUA 3UFEA 4YFSA 3LG7A 3AECA 2LEHA 4DV7T 2YU1A 1T7SA 3PUAA 2ACZA 2XQ8A 1VOMA 1UX5A 3CQGB 3QUJA 3GN5B 4Q25A 2X68A 3PUQA 2GK9A 2KWIB 4COFA 2W00A 3I0OA 3BQKA 3FXEB 3DTOA 3P8CD 5F3JA 1BR0A 1KF6A 2CXLA 5AQVB 5CA1E 1VCSA 2CMRA 2Z6EA 3O9XA 3ONLC 4J2CA 2XAQB 4HWIB 3VKGA 4KMCA 4U3CA 2VKDA 3Q9DA 3QK6A 3SWHA 2N2NA 3U78A 3R84B 3Q5XA 2NR4A 1Z8UA 4JEHB 3O1IA 1M62A 3M65A 3NWIA 2CXFA 3AVRA 2ZLYA 1UK5A 3RYCE 2LLYA 4YT0A 2X9HA 2BG9A 4DV0T 5ETWA 1D0ZA 3RLFF 4DR2T 3EAMA 4QKNA 1M7KA 3FBZA 4IDPA 3RIAA 2JMKA 2EHOA 2WM9A 5IUXA 5LOVE 1HFAA 4DR6T 2K5BB 3KINB 4UR9A 4KI0F 4ZS2A 4MALA 2CPTA 4EZHA 3OTOT 1HCIA 3HKDE 3FZKB 2NW9A 2MTQA 3PV0F 3N9LA 4KUMB 3K1SA 1OXZA 4WYVA 4JYAT 5FMNA 2C5IT 5HWYA 5M4YA 2BVMA 2YN6A 1KK7A 3H3AA 5JDNA 1YQ4A 4IGUA 4H9OC 4HKAA 3VU7H 3IA3A 3RC8A 4LFAT 2IIUA 4WBOA 1NWMX 3CQXC 2PBIA 2KT9A 2UU9T 1MIYA 5L3BB 3VR9A 5AQTB 5LHHB 2X66A 4AKIA 1E7PA 2BG9B 3UU8A 1UCUA 2SPCA 2XAJB 2HN2A 4ERRA 4GIWA 2VKJA 2K3WA 5FNVE 2EHOB 1S35A 2D0UA 3PUYF 3N9OA 2Q9QA 1J5ET 2LOPA 2X0YA 1SE7A 1XDOA 3AE6A 2NTYA 1EZ3A 3RI5A 1V9DA 2JQKA 2J1DG 4KHZF 4OX9T 4H63H 4EYYR 3N9QA 4B3ST 3N9PA 5HEHA 3AA0B 4X62T 3LBXA 4UXNB 1KEYA 2X0LB 3C4WA 2K48A 3E0ZA 2K9AA 5AQLB 5JREA 4TV8E 5JR9A 1ZP0A 4DUZT 4V1Av 2BKPA 2RA1A 5HCMA 3AEGA 5FKYA 4QHOA 4DBRA 2CHNA 4LF4T 3H37A 5C8YE 3B57A 2W2UA 5JVDE 4DV5T 2DNXA 3AE1A 4L5GA 4E7SA 4JI2T 3KV9A 4O4LE 4CZZB 4H9NC 4LMKA 4DR1T 3RIUC 3UU3A 3I9YA 2I0MA 3AE2A 5LBQB 2LSIA 4DR5T 4ISSA 5LJMA 2XY8B 4X5TA 3GMIA 2HPLA 2Q9QB 2YU2A 5HXSA 1QUUA 3F57A 1KNRA 5EK4A 3ZCIA 4ADZA 4LF6T 1UUSA 3BQIA 5LMUT 1XNQT 4ANJA 3RC3A 5HEOA 5ABHA 3AE8A 3HKCE 3OBVE 2UXNB 3LBXB 4IL9A 1SUMB 3RPUA 4QXHB 2G0UA 3RQWA 2B1EA 4DV3T 2QGSA 2VWAA 4U33A 3ZPOA 5JR9B 2ES0A 2Y8DA 2CRBA 3H3MA 1G73A 3PUGA 2BBJA 2LT3A 2IC6A 3RKOA 4U72A 4PK6A 3Q5EA 5AFUL 4DV2T 1VCTA 2VASA 4ZEYA 4PW8A 1LRZA 3EHZA 2LOSA 3N2GE 3UQ4A 5J1GA 4BAYB 2V26A 1OEDC 3FZLB 3EDUA 3RRWA 5ADXL 5IWAT 1E1HB 2H89A 1BR1A 4B3RT 3HI2A 4AI6A 2A9UA 3W15B 1T98A 3ZMUB 4MBQA 4TWFA 5LG3A 5KMGP 3RYHE 2W63A 5AQUB 3N5LA 3WAJA 2V8SV 4AKRB 3UQ7A 3P4QA 3RHWA 5L47A 3CMLA 3KVAA 1SHZC 5FVLA 5LGNB 3C98B 4LFBT 1HX8A 5LYJE 4X64T 3I1AA 3KBUA 1X9BA 3ZMTB 3NVOA 5J2TE 3NRYA 5L3DB 1YW0A 2H3RA 3ZYMA 4K0UA 3VHLA 2M6IA 2BS3A 2NOXA 1XWMA 5LHIB 2MYSA 3KBTA 2V7JA 4DR4T 3AEAA 1X79A 3LDQB 5DQWA 4IE4A 4KX6A 2W61A 4TNVA 1N33T 4HTEA 4JI4T 2UXBT 4MLKA 3N2OA 2IUBA 2CM0A 4ZS3A 5AQRB 2HH7A 3SRZA 4AQFA 5JDHA 4UV9B 2LKHA 4QH1A 5AQFB 3T1HT 2BBHA 1YKEB 3AAIA 4DMWA 4H9QC 3PE0A 4P0AA 2UXDT 5ABEA 4U2ZA 4ZZBA 2YOEA 3ZMZB 2DWGA 4QXCB 4N78D 3ESLA 3CX7B 3FZFB 4NIQA 4DIDB 3OVUA 2XHEB 3P4SA 5JRCB 3PUXF 2XTLA 3PU3A 3F31A 5FP3A 3K3QC 3AAAB 5JDGA 2J47A 3UULA 4B3TT 2LSJA 2LRLA 2QVAA 4H9RC 3FBLA 2JRKA 4IE7A 5GONE 2F4VT 2E2AA 2Y48B 3CWZB 5L3FB 2LE8A 1Y64B 3RRCA 2HPJA 4JI8T 1MNDA 3K8PC 5IYZE 4U31A 4XZCA 1HG2A 2Y6XA 3FZMB 3OPCA 1D1AA 4EYUA 5LJNA 3LJCA 4EGWA 4ZI2D 2V5CA 4HFEA 2ODVA 3FHNA 2WMNA 3O1HA 4B6XA 2XQ4A 3PURA 4BA9A 4YSXA 2FUPA 2XPKA 3OKQA 3G06A 5KX5E 2KMFA 4QH5A 5CFBA 3RYIE 1L0VA 1WYCA 4CXWA 5L4HA 5F8PA 3N2KE 1WRDA 2WQYA 1Y01A 2JQQA 4F8HA 5JDFA
chains in the Genus database with same CATH topology
4PJJA 5JQGE 1IJ6A 3LFMA 1WLXA 3O1JA 3GA8A 4OHFA 4UVBB 1UX4A 3HL6A 1YKHB 3RH3A 2LSKA 3N9PA 3AA0B 4EIWA 2P9BA 4IHJE 3O4XE 1Z0PA 4UF0A 3CPZA 1MMAA 3LBXA 2D5UA 2E9XC 2X9XA 4UXNB 4DVDA 2X0LB 3C4WA 4X20E 5FYMA 2YINA 3LK2B 3ONXA 4BJNA 2K48A 4DBQA 3E0ZA 4ZI3D 2K9AA 3NRXA 2L9QA 5JREA 3L3PA 4TV8E 4AKHA 5JR9A 4FI5A 5BMVE 4G2AA 3E08A 2WBLA 4V1Av 4MHCA 2RA1A 1S94A 2D0TA 2XQYA 3BQLA 3PU8A 1O3XA 3SS1A 2L3LA 4P09A 4QHOA 4DBRA 5LBMA 3RYFE 4EXTA 1VRBA 4AQGA 4ILUA 3H37A 4AXPA 3B57A 5C8YE 3ZEFB 5IHYA 2WWUA 4JUYA 5JVDE 1FMWA 2DNXA 2LHNA 3HA4A 3CKDA 4FJOA 4L5GA 2N1GA 2IW5B 4E7SA 2V7IA 1D0YA 3CVRA 3KV9A 4O4LE 4CZZB 4H9NC 4AQFC 4CXYA 1FIOA 4P0BA 5LNKA 5LP6E 3I9YA 3UTKA 2CLYB 2BDEA 3I0QA 3ETVA 5LBQB 4OK0A 2LSIA 4GOUA 4ISSA 5LJMA 4O2BE 4PJLA 3GMIA 2V7LA 2HPLA 2Q9QB 2YU2A 5HXSA 5A1LA 1QUUA 3F57A 4UVCB 5EK4A 3ZCIA 2JJ9A 2K24A 2LSYA 3FB2A 4ADZA 4F6RC 2H7OA 3Q5WA 3ZN1B 4JLEA 2A72A 3BQIA 3N9NA 2X67A 3FXDB 3EVYA 4X1KE 3AAEB 2VB6A 2WSSV 4IDZA 5EZYE 4UELA 1AJ3A 4ANJA 2XAFB 3MXZA 5HXCA 1H7CA 4ZOLE 5FY7A 3RC3A 1FEWA 5HXEA 4C90A 5LA6E 3NZPA 2EHOC 3AA1B 4O4HE 5LGUB 5JRCA 3HKCE 3OBVE 4UF0B 5LCYA 2UXNB 2NWBA 5L3GB 3MK7C 3LBXB 5CA0E 3MA9A 3RPUA 3KVBA 2MBGA 4NUVA 4QXHB 2G0UA 2B1EA 3E22E 4XBFB 2BZBA 2QGSA 2VWAA 5E0OA 5FXZA 3ZPOA 5JR9B 2WAUA 1ZKEA 2ES0A 4PJNA 2Y8DA 2CWYA 3N9MA 4DO0A 3A5XA 3V5UA 1G73A 4G63A 1U5PA 4YLHA 5HAXA 3PUGA 1MIVA 3R6NA 3C64A 1D1BA 1IZNB 2LT3A 2OA5A 2QA7A 4HFVA 2IC6A 2PJQA 4PFPA 4X1IE 3K3NA 5L3CB 4XAXB 4ASKA 2W0GA 3RKOA 4MFRA 4U72A 3MACA 4PK6A 5AFUL 3GWHA 1SA0E 5HYAA 4TN7B 1IAPA 2VASA 3PTRB 4PW8A 1LRZA 5EK3A 2LOSA 3N2GE 4PK5A 4TV9E 3CX6B 5J1GA 2WMOA 1US7B 4L0RA 4BAYB 5HXRA 3TKLB 4ZHQE 3C4ZA 3MZKB 4EZ4A 2V26A 2XAGB 1WYBA 4M1PA 4WW0A 3GN5A 5FY1A 2KLQA 3QC9A 1MMNA 3EDUA 1MIWA 4PNIA 3RRWA 3J9X1 5ADXL 5H6QB 1CUNA 2X9YA 3IHRA 2V7MA 4PFOA 2PFVA 3PUSA 1E1HB 5TAOA 2KZ7B 4DMVA 2ZM2A 3ETUA 1BR1A 1U4QA 3I9WA 3HI2A 4H63V 4AI6A 2NTXA 4TZ4C 3W15B 1T98A 3ZMUB 2NW7A 4MBQA 4O2AE 3K3OA 1MMGA 2CLYC 5DABA 2NP9A 2E9XD 5KMGP 3VKHA 3RYHE 5JDQA 2W63A 4GYRA 3D0TA 2CWOA 4GK5E 5L2LA 4CI2B 2Q9QC 3N5LA 2A3DA 2LHRA 2CEAA 1MMDA 2IC9A 4AKRB 5EK2A 3WAJA 5FXXA 2KNDA 2ZMAA 1IJ5A 3CMLA 3KVAA 2VKOA 1SHZC 1QSDA 4AKGA 3ZYKA 3F2EA 5LGNB 3C98B 1ZHCA 3AA6B 4OFZA 4PJMA 1HX8A 3SOLA 3CX8B 5LYJE 2C5KT 3I1AA 2VK9A 2YEVC 2I59A 3KBUA 4O4JE 2D2SA 4AKLA 3ZMTB 4IE6A 3ZLIA 3IEEA 2KWHA 5J2TE 4UV8B 3MJXA 3NRYA 5L3DB 1YW0A 3P7IA 4CXXA 3KV6A 2H3RA 4Z8XA 4EAHA 4TX5A 3ZYMA 2N9DA 3KV4A 4K0UA 1LVFA 3VHLA 4HGAA 1BR2A 2XASB 4KBMB 2H7VC 3ZC0A 4IE0A 4ZI7E 4TUYE 2NOXA 3UUXB 4NUUA 1LVKA 3UFEA 1YD8G 4YFSA 3LG7A 2ODUA 2E9XA 2LEHA 5LHIB 2MYSA 2YU1A 4QWNB 3KBTA 2JMHA 3PUAA 1VOMA 2V7JA 5JR9C 5L3EB 4U74A 1UX5A 1X79A 3CQGB 2DHRA 2VL8A 3HKBE 3QUJA 3GN5B 5DQWA 2X68A 4E7ZA 2RP4A 4GK0E 3PUQA 2W62A 4IE4A 3L09A 5LHGB 2BVLA 2GK9A 4UEMA 2C5JA 2W61A 2KWIB 2KINB 5JDLA 3WAKA 2W00A 3I0OA 4HTEA 2LM9A 4H9SE 1HS7A 4MLKA 4CI1B 1HTJF 3BQKA 3N2OA 5FXWA 2CM0A 5CB4E 3NBXX 5H6RB 4UVAB 3FXEB 1D1CA 3DTOA 3P8CD 2EHOD 5F3JA 4ZS3A 1BR0A 1ZV4X 3B13A 2HH7A 4HN9A 3DP7A 2CXLA 5CA1E 1HF8A 4QXBB 3SRZA 3ZMSB 4BJMA 4AQFA 2CMRA 2Z6EA 5JDHA 4J2CA 3UUMA 2XAQB 3O9XA 4UV9B 3VKGA 4KMCA 2VKDA 3J7Yq 3Q9DA 3OYXA 3QK6A 3HR0A 3SWHA 2N2NA 3U78A 3KV5A 3R84B 1YKEB 4EB6E 3Q5XA 4ZI3C 3WI3A 5LGTB 3AAIA 4HE8A 4DMWA 3MKDA 4JEHB 3ZMVB 4H9QC 3O1IA 3PE0A 4QX7B 4P0AA 3M65A 1ZEEA 2CXFA 3OJAA 3AVRA 3UT5E 2ZLYA 4OYKA 3Q2MA 4I50E 3T8OA 3RYCE 3V5SA 2X9HA 3ZMZB 3EDVA 4JEUB 5ETWA 2DWGA 1D0ZA 2A2FX 3BK9A 3EUHA 4QXCB 4QKNA 3U3IA 4N78D 4IE5A 3FBZA 2DCFA 3ESLA 3CX7B 3OYZA 2JMKA 2EHOA 2NW8A 2WM9A 5LOVE 1HFAA 2K5BB 2V1DB 2XHEB 3KINB 2E9XB 2M67A 4ZS2A 5JRCB 5LG4A 5KDMC 2XTLA 4MALA 3C50A 2X51A 1HG5A 3PU3A 4EZHA 4DNDA 2PG8A 3ANWA 1HCIA 3HKDE 4I55E 3C4XA 4PK4A 3F31A 5FP3A 1MNEA 3K3QC 5FXVA 3AA7B 3AAAB 2DI4A 2NW9A 5JDGA 4X1YE 2MOZA 4IIJE 3ZCJA 3UULA 2LSJA 2MTQA 5JH7E 3N9LA 1B7TA 4KUMB 1OXZA 4H9RC 5FMNA 3AB3B 4O8SA 2C5IT 3FBLA 5HWYA 2JRKA 4I43B 1LKXA 4IE7A 2JPFA 3NZQA 2BVMA 5M4YA 5LXTE 1KK7A 5GONE 3H3AA 5JDMA 5JDNA 4ZI2C 4IGUA 2Q9QD 3C51A 4H9OC 4I4TE 2XAHB 2C0SA 4L9IA 2Y48B 4YJ3E 4HKAA 3VU7H 3IF8B 2XUEA 1FMVA 2UXXB 4WBNE 3RC8A 2CE7A 3CWZB 1NAFA 4WBOA 2DLRA 5L3FB 2DWKA 4CI3B 2CCQA 1NWMX 2LE8A 3KDSE 3ZJ2A 3CQXC 1Y64B 3RRCA 2HPJA 4YJ2E 4YHJA 1MNDA 2PBIA 3K8PC 2KT9A 4PAGA 5IYZE 1MIYA 2LSGA 4HEAA 5L3BB 3JC6C 4XZCA 1HG2A 2Y6XA 3AVSA 3HKEE 4WNKA 4QX8B 5LHHB 3ZN0B 1D0XA 2X66A 4AKIA 2CA5A 4OYJA 1KNZA 1D1AA 4CQIA 2L8KA 4EYUA 3S4UA 5LJNA 3LJCA 5DJQC 1UCUA 4ZI2D 3RX6A 5DQVA 3CQCB 3ZYLA 4UIGA 4O4IE 2ODVA 3DJBA 2WMNA 3FHNA 3O1HA 2SPCA 3IBPA 5FY0A 3ZJ1A 4B6XA 2XAJB 4ERRA 4EOZB 3UUNA 4H9PC 4GIWA 3PURA 4BA9A 1G8XA 2IAKA 2VKJA 2ACXA 2YK0A 4KP3C 2EHOB 2KXPB 5FNVE 1S35A 2VKHA 2D0UA 4A56A 2V7KA 4C91A 3PDYA 3N9OA 3OKQA 5KX5E 2Q9QA 2KMFA 3KFWX 3JC6D 1BR4A 2LOPA 3RYIE 3LK42 1WYCA 2CXDA 3LK3B 4CXWA 2NTYA 2LJLA 5HXHA 4ISTA 1EZ3A 3ANWB 2X9WA 2ZM0A 2E8IA 4GYSA 5F8PA 3N2KE 1WRDA 1V9DA 2J1DG 5HWXA 4H63H 4EYYR 1WR6A 3ZC1A 2JQQA 3N9QA 5J2UE 5JDFA 2ZM8A 1OWAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAF A;  1O3X A;  2N2N A;  1WR6 A;  2N9D A;  1NWM X;  1X79 A;  1WRD A;  1OXZ A;  1YD8 G; 
#chains in the Genus database with same CATH topology
 3ZT7 A;  5CJ5 A;  4OHF A;  1WLX A;  1UX4 A;  3AE5 A;  4EIW A;  3PUW F;  3CPZ A;  1MMA A;  2D5U A;  5AQH B;  5FYM A;  4JI1 T;  1JNZ A;  4YTN A;  4BJN A;  3NRX A;  4AKH A;  4G2A A;  3E08 A;  2XQY A;  3BQL A;  3SS1 A;  2L3L A;  4P09 A;  2AXD S;  1VRB A;  3ZEF B;  2B76 A;  2WWU A;  3VRB A;  1FMW A;  3HA4 A;  2BKO A;  3X1D A;  3JAF A;  4CN6 A;  2V7I A;  3CVR A;  5JTG A;  1T72 A;  4P0B A;  2CLY B;  3AE4 A;  3ETV A;  4OK0 A;  4O2B E;  4PJL A;  3SFE A;  5A1L A;  2JJ9 A;  3ZT5 A;  4IRE A;  4LF5 T;  3Q5W A;  2A72 A;  3AEB A;  2BG9 C;  4DR3 T;  3EVY A;  2VB6 A;  5EZY E;  4UEL A;  2XAF B;  5HXC A;  4DV1 T;  2WDR A;  3AE3 A;  4C90 A;  5LA6 E;  2EHO C;  2CHO A;  2NWB A;  5L3G B;  4A5X A;  1T8B A;  2MAW A;  3KVB A;  2E5L T;  3B5M A;  4YSZ A;  4IDQ A;  1ZKE A;  4PJN A;  3ZKR A;  3JAD A;  1KNP A;  3N9M A;  1HR0 T;  1U5P A;  5HAX A;  2WS3 A;  3R6N A;  2OA5 A;  4X1I E;  5CGM A;  3UUB A;  4NXN T;  1SA0 E;  4GKK T;  5KXJ A;  5EK3 A;  3CX6 B;  1W09 A;  4U2Y A;  1US7 B;  4L0R A;  5HXR A;  4ZHQ E;  5AQI B;  4EZ4 A;  2VQE T;  1WYB A;  2UUA T;  4WW0 A;  3QB5 A;  1MMN A;  1MIW A;  2FJE A;  2KZ7 B;  3ETU A;  2WZI A;  2FJB A;  3I9W A;  4H63 V;  2NTX A;  1NEK A;  5FL1 A;  2NW7 A;  4O2A E;  1HNZ T;  5DAB A;  2XQ6 A;  2NP9 A;  3VKH A;  3JAE A;  3D0T A;  2CWO A;  2FBW A;  5L2L A;  2Q9Q C;  2W4X A;  2CBI A;  2J62 A;  5EK2 A;  1KFY A;  5FXX A;  4JI0 T;  2ZMA A;  1IJ5 A;  1QSD A;  4AKG A;  1ZHC A;  4PJM A;  2QRX A;  2VK9 A;  2YEV C;  1J1J A;  4AKL A;  3IEE A;  4UV8 B;  5AQO B;  2IHR 1;  4Z8X A;  2X0H A;  4YHH T;  4QH4 A;  3KV4 A;  3TLS A;  3SFD A;  3UUX B;  1YD8 G;  2ODU A;  2E9X A;  5JR9 C;  1DU2 A;  4YSY A;  2DHR A;  3HKB E;  4E7Z A;  2RP4 A;  4GK0 E;  3L09 A;  1HX1 B;  5LHG B;  2BVL A;  4UEM A;  2C5J A;  3EAB A;  4TWD A;  2KIN B;  5JDL A;  2WDQ A;  1ZOY A;  5FXW A;  1XZY A;  4UVA B;  5H6R B;  3TLW A;  1D1C A;  2EHO D;  1ZV4 X;  3B13 A;  4HWH A;  4HN9 A;  3DP7 A;  1HF8 A;  3UUM A;  4DV6 T;  3J7Y q;  3OYX A;  2HHH T;  3HR0 A;  3ONJ A;  3WI3 A;  2OV9 A;  4HE8 A;  1J5W A;  3MKD A;  4YTM A;  4X66 T;  4QX7 B;  3UT5 E;  4OYK A;  2LKG A;  4I50 E;  3T8O A;  2V6Y A;  2WWV A;  3EDV A;  4JEU B;  2A2F X;  3BK9 A;  1UUR A;  4Z91 A;  2DCF A;  5L4E A;  1WCR A;  3ABV A;  2NW8 A;  4YXD A;  2W66 A;  2V1D B;  2E9X B;  3PUZ F;  2WY2 A;  5KDM C;  4HWF A;  4LF7 T;  1HG5 A;  4LMJ A;  5AQK B;  2PG8 A;  2VQF T;  4I55 E;  4PK4 A;  1MNE A;  5FXV A;  4I0U A;  5HEJ A;  1N36 T;  2MOZ A;  3ZCJ A;  5JH7 E;  3A8Y C;  1B7T A;  3ZST A;  3AB3 B;  4ILC A;  3NKZ A;  4I43 B;  1LKX A;  2JPF A;  5JDM A;  4ZI2 C;  2Q9Q D;  4I4T E;  2XAH B;  2D9D A;  2XUE A;  2UXX B;  4WBN E;  1NAF A;  4K0K T;  4CI3 B;  4AQY T;  3KDS E;  4YHJ A;  2IML A;  3EI0 A;  2LSG A;  2WU5 A;  3AVS A;  4QX8 B;  3ZN0 B;  2CA5 A;  1KNZ A;  2V6Y B;  4CQI A;  2L8K A;  3S4U A;  4TWH A;  5J0Z A;  3ZYL A;  4UIG A;  3DJB A;  5FY0 A;  3IBP A;  3ZJ1 A;  4EOZ B;  3UUN A;  3PJA A;  4H9P C;  4A98 A;  2IAK A;  2ACX A;  4KP3 C;  2KXP B;  2VKH A;  5ABF A;  2V7K A;  3PDY A;  3UU6 A;  3LSV A;  2HN1 A;  3KFW X;  3RF1 A;  3JC6 D;  4AIU A;  4GKJ T;  3LK4 2;  5HXH A;  4IST A;  2X9W A;  2ZM0 A;  5HEU A;  5HEG A;  2V5D A;  2W67 A;  3ZC1 A;  2ZM8 A;  1OWA A;  4ILA A;  3LFM A;  3GA8 A;  4UVB B;  3HL6 A;  1YKH B;  2LSK A;  3A7M A;  2P9B A;  1GQE A;  4IHJ E;  2BKN A;  2BS4 A;  4X20 E;  2LM2 A;  2MPK A;  2YIN A;  3LK2 B;  4DBQ A;  2FJD A;  2L9Q A;  3AXJ A;  4FI5 A;  2WBL A;  4CN4 A;  4MHC A;  2IDO B;  1O3X A;  3UU4 A;  2R6G F;  5LBM A;  3RKG A;  2WCA A;  4ILU A;  5AQN B;  4LML A;  5IHY A;  4YY3 T;  1JNR A;  2LHN A;  4HFC A;  3CKD A;  2XQ5 A;  1R8I A;  4AQF C;  3AE9 A;  4GOU A;  5AQJ B;  4IL4 A;  4ILB A;  1W9R A;  3L8R A;  2LSY A;  2H88 A;  1W0A A;  2H7O A;  2WP9 A;  3N9N A;  2X67 A;  4JV5 T;  4X1K E;  3AAE B;  4IDZ A;  4JBW F;  1AJ3 A;  1N32 T;  1FEW A;  5HXE A;  5HCJ A;  3NZP A;  3AA1 B;  4O4H E;  2XSB A;  5LGU B;  2XQA A;  5LCY A;  5CA0 E;  3P50 A;  1W0B A;  2MBG A;  3AEE A;  4XBF B;  2BZB A;  1I6Z A;  5E0O A;  3AXJ B;  3CIR A;  4KHP T;  3RQU A;  5AQS B;  1IBM T;  4HFD A;  3A5X A;  4DO0 A;  4G63 A;  1XNR T;  3P4R A;  2QA7 A;  4PFP A;  3FZH B;  5L3C B;  3K3N A;  3PJA J;  1IBL T;  4MFR A;  4JI6 T;  3TLV A;  2UUB T;  3GWH A;  4LF8 T;  3MZK B;  5AQQ B;  2XAG B;  4M1P A;  5FY1 A;  3QC9 A;  4PNI A;  3M3Z B;  3J9X 1;  4AIS A;  2UXC T;  2VVS A;  4PFO A;  2M6B A;  4NXM T;  2PFV A;  3P4P A;  4DMV A;  4TZ4 C;  3RGL A;  4ZXL A;  3K3O A;  1E2A A;  2CLY C;  5JDQ A;  3ZSS A;  4GYR A;  4CI2 B;  2CEA A;  2IC9 A;  1OED E;  3ZYK A;  2XSA A;  3F2E A;  3AA6 B;  4OFZ A;  3SOL A;  3CX8 B;  4P1N A;  2I59 A;  4O4J E;  5LMN T;  3ZLI A;  2KSR A;  3P7I A;  4CXX A;  4HFI A;  4EAH A;  4TX5 A;  2N9D A;  1LVF A;  3TLT A;  4HGA A;  4HWD A;  2H7V C;  4TUY E;  1HNW T;  4NUU A;  1LVK A;  2FJA A;  5AQP B;  4QWN B;  2WDV A;  2JMH A;  5L3E B;  4U74 A;  4NPP A;  3TLU A;  2VL8 A;  2W62 A;  3QNU A;  2XM2 A;  3WAK A;  4EV6 A;  4EEB A;  1QLB A;  2LM9 A;  4H9S E;  1HS7 A;  4CI1 B;  1HTJ F;  5CB4 E;  3NBX X;  3ZT6 A;  4QXB B;  3ZMS B;  4BJM A;  5F5W A;  3PUV F;  3RIU A;  1NEN A;  2I6H A;  4WZX A;  2XQ7 A;  3KV5 A;  2VL0 A;  4EB6 E;  4ZI3 C;  5LGT B;  3ZMV B;  3AE7 A;  1ZEE A;  3OJA A;  5FVK A;  5FL0 A;  5LB7 B;  3Q2M A;  2VVN A;  3V5S A;  3CK6 A;  1WR0 A;  3EUH A;  3U3I A;  4IE5 A;  3OYZ A;  2LRK A;  2WZH A;  5ABG A;  2M67 A;  2WB5 A;  5LG4 A;  4TNW A;  3C50 A;  2X51 A;  4DND A;  4JI3 T;  3ANW A;  3C4X A;  3AA7 B;  2DI4 A;  2JQ9 A;  4X1Y E;  4IIJ E;  4LF9 T;  4O8S A;  2XQ9 A;  3NZQ A;  5LXT E;  4DUY T;  3C51 A;  3P4W A;  2C0S A;  4L9I A;  4YJ3 E;  3IF8 B;  4HWC A;  1FMV A;  2CE7 A;  2DLR A;  2DWK A;  1OED A;  2CCQ A;  3ZJ2 A;  1FJG T;  4YJ2 E;  2YDR A;  3UU5 A;  4PAG A;  4HEA A;  3JC6 C;  4U7Y A;  3HKE E;  4WNK A;  1D0X A;  2CBJ A;  2AE9 A;  4OYJ A;  2DL1 A;  5DJQ C;  5C3J A;  3RX6 A;  5DQV A;  3CQC B;  4O4I E;  1G8X A;  2YK0 A;  4A56 A;  4C91 A;  1BR4 A;  4X65 T;  1YXR A;  2ZM6 T;  4U7I A;  2CXD A;  3LK3 B;  2XM1 A;  2LJL A;  3ANW B;  2E8I A;  4GYS A;  3QB5 K;  2UUC T;  3AEF A;  5HWX A;  4DR7 T;  1WR6 A;  2YDS A;  5J2U E;  4PJJ A;  4EED A;  5JQG E;  1IJ6 A;  3O1J A;  4ZZC A;  3RH3 A;  1YQ3 A;  3O4X E;  1Z0P A;  4UF0 A;  2E9X C;  2X9X A;  4DVD A;  2OLT A;  4HFH A;  3ONX A;  4ZI3 D;  3L3P A;  2VUR A;  4B3M T;  1UGO A;  5BMV E;  4DV4 T;  1OED B;  1S94 A;  2D0T A;  3PU8 A;  5AQM B;  3RYF E;  4EXT A;  1N34 T;  2QYW A;  4AQG A;  4AXP A;  3UFG A;  4JUY A;  4IT4 A;  4FJO A;  2N1G A;  2IW5 B;  1D0Y A;  4CXY A;  3Q5D A;  1FIO A;  5LNK A;  5LP6 E;  1IBK T;  3UTK A;  2BDE A;  4JI5 T;  2JIW A;  3I0Q A;  5C2T A;  2V7L A;  4LFC T;  2XZE A;  4UVC B;  4YTP A;  2K24 A;  3FB2 A;  4F6R C;  3ZN1 B;  4JLE A;  3FXD B;  5BR8 T;  1HNX T;  2YKS A;  2WSS V;  2J4G A;  3MXZ A;  1H7C A;  4ZOL E;  5FY7 A;  2JQH A;  2V6X A;  5JRC A;  4UF0 B;  3MK7 C;  1XMQ T;  3MA9 A;  3VR8 A;  4IDN A;  4NUV A;  4HFB A;  3E22 E;  3JCF A;  5FXZ A;  2WAU A;  2CWY A;  3V5U A;  4YLH A;  1MIV A;  2PTF A;  2BG9 E;  1D1B A;  1IZN B;  3C64 A;  4HFV A;  2PJQ A;  4XAX B;  4ASK A;  2W0G A;  3MAC A;  3VRA A;  3QOF A;  5HYA A;  4TN7 B;  1IAP A;  3PTR B;  4PK5 A;  4TV9 E;  2YDQ A;  2WMO A;  3TKL B;  3C4Z A;  2XJ7 A;  3GN5 A;  2KLQ A;  2BS2 A;  4A97 A;  5H6Q B;  1CUN A;  2X9Y A;  3IHR A;  2V7M A;  3L39 A;  3PUS A;  5TAO A;  2ZM2 A;  2WU2 A;  1U4Q A;  3RIF A;  4Z90 A;  1WFD A;  1MMG A;  4IDO A;  2E9X D;  1XDP A;  4GK5 E;  4CN1 A;  2A3D A;  2LHR A;  1MMD A;  1I94 T;  2KND A;  2VKO A;  5ABF B;  2C5K T;  2D2S A;  3T1Y T;  2XQ3 A;  4IE6 A;  4JI7 T;  2KWH A;  5AQG B;  3MJX A;  3KV6 A;  2RPA A;  1XMO T;  1BR2 A;  2E5V A;  2XAS B;  4KBM B;  3ZC0 A;  4IE0 A;  3AED A;  4ZI7 E;  1CHU A;  3UFE A;  4YFS A;  3LG7 A;  3AEC A;  2LEH A;  4DV7 T;  2YU1 A;  1T7S A;  3PUA A;  2ACZ A;  2XQ8 A;  1VOM A;  1UX5 A;  3CQG B;  3QUJ A;  3GN5 B;  4Q25 A;  2X68 A;  3PUQ A;  2GK9 A;  2KWI B;  4COF A;  2W00 A;  3I0O A;  3BQK A;  3FXE B;  3DTO A;  3P8C D;  5F3J A;  1BR0 A;  1KF6 A;  2CXL A;  5AQV B;  5CA1 E;  1VCS A;  2CMR A;  2Z6E A;  3O9X A;  3ONL C;  4J2C A;  2XAQ B;  4HWI B;  3VKG A;  4KMC A;  4U3C A;  2VKD A;  3Q9D A;  3QK6 A;  3SWH A;  2N2N A;  3U78 A;  3R84 B;  3Q5X A;  2NR4 A;  1Z8U A;  4JEH B;  3O1I A;  1M62 A;  3M65 A;  3NWI A;  2CXF A;  3AVR A;  2ZLY A;  1UK5 A;  3RYC E;  2LLY A;  4YT0 A;  2X9H A;  2BG9 A;  4DV0 T;  5ETW A;  1D0Z A;  3RLF F;  4DR2 T;  3EAM A;  4QKN A;  1M7K A;  3FBZ A;  4IDP A;  3RIA A;  2JMK A;  2EHO A;  2WM9 A;  5IUX A;  5LOV E;  1HFA A;  4DR6 T;  2K5B B;  3KIN B;  4UR9 A;  4KI0 F;  4ZS2 A;  4MAL A;  2CPT A;  4EZH A;  3OTO T;  1HCI A;  3HKD E;  3FZK B;  2NW9 A;  2MTQ A;  3PV0 F;  3N9L A;  4KUM B;  3K1S A;  1OXZ A;  4WYV A;  4JYA T;  5FMN A;  2C5I T;  5HWY A;  5M4Y A;  2BVM A;  2YN6 A;  1KK7 A;  3H3A A;  5JDN A;  1YQ4 A;  4IGU A;  4H9O C;  4HKA A;  3VU7 H;  3IA3 A;  3RC8 A;  4LFA T;  2IIU A;  4WBO A;  1NWM X;  3CQX C;  2PBI A;  2KT9 A;  2UU9 T;  1MIY A;  5L3B B;  3VR9 A;  5AQT B;  5LHH B;  2X66 A;  4AKI A;  1E7P A;  2BG9 B;  3UU8 A;  1UCU A;  2SPC A;  2XAJ B;  2HN2 A;  4ERR A;  4GIW A;  2VKJ A;  2K3W A;  5FNV E;  2EHO B;  1S35 A;  2D0U A;  3PUY F;  3N9O A;  2Q9Q A;  1J5E T;  2LOP A;  2X0Y A;  1SE7 A;  1XDO A;  3AE6 A;  2NTY A;  1EZ3 A;  3RI5 A;  1V9D A;  2JQK A;  2J1D G;  4KHZ F;  4OX9 T;  4H63 H;  4EYY R;  3N9Q A;  4B3S T;  3N9P A;  5HEH A;  3AA0 B;  4X62 T;  3LBX A;  4UXN B;  1KEY A;  2X0L B;  3C4W A;  2K48 A;  3E0Z A;  2K9A A;  5AQL B;  5JRE A;  4TV8 E;  5JR9 A;  1ZP0 A;  4DUZ T;  4V1A v;  2BKP A;  2RA1 A;  5HCM A;  3AEG A;  5FKY A;  4QHO A;  4DBR A;  2CHN A;  4LF4 T;  3H37 A;  5C8Y E;  3B57 A;  2W2U A;  5JVD E;  4DV5 T;  2DNX A;  3AE1 A;  4L5G A;  4E7S A;  4JI2 T;  3KV9 A;  4O4L E;  4CZZ B;  4H9N C;  4LMK A;  4DR1 T;  3RIU C;  3UU3 A;  3I9Y A;  2I0M A;  3AE2 A;  5LBQ B;  2LSI A;  4DR5 T;  4ISS A;  5LJM A;  2XY8 B;  4X5T A;  3GMI A;  2HPL A;  2Q9Q B;  2YU2 A;  5HXS A;  1QUU A;  3F57 A;  1KNR A;  5EK4 A;  3ZCI A;  4ADZ A;  4LF6 T;  1UUS A;  3BQI A;  5LMU T;  1XNQ T;  4ANJ A;  3RC3 A;  5HEO A;  5ABH A;  3AE8 A;  3HKC E;  3OBV E;  2UXN B;  3LBX B;  4IL9 A;  1SUM B;  3RPU A;  4QXH B;  2G0U A;  3RQW A;  2B1E A;  4DV3 T;  2QGS A;  2VWA A;  4U33 A;  3ZPO A;  5JR9 B;  2ES0 A;  2Y8D A;  2CRB A;  3H3M A;  1G73 A;  3PUG A;  2BBJ A;  2LT3 A;  2IC6 A;  3RKO A;  4U72 A;  4PK6 A;  3Q5E A;  5AFU L;  4DV2 T;  1VCT A;  2VAS A;  4ZEY A;  4PW8 A;  1LRZ A;  3EHZ A;  2LOS A;  3N2G E;  3UQ4 A;  5J1G A;  4BAY B;  2V26 A;  1OED C;  3FZL B;  3EDU A;  3RRW A;  5ADX L;  5IWA T;  1E1H B;  2H89 A;  1BR1 A;  4B3R T;  3HI2 A;  4AI6 A;  2A9U A;  3W15 B;  1T98 A;  3ZMU B;  4MBQ A;  4TWF A;  5LG3 A;  5KMG P;  3RYH E;  2W63 A;  5AQU B;  3N5L A;  3WAJ A;  2V8S V;  4AKR B;  3UQ7 A;  3P4Q A;  3RHW A;  5L47 A;  3CML A;  3KVA A;  1SHZ C;  5FVL A;  5LGN B;  3C98 B;  4LFB T;  1HX8 A;  5LYJ E;  4X64 T;  3I1A A;  3KBU A;  1X9B A;  3ZMT B;  3NVO A;  5J2T E;  3NRY A;  5L3D B;  1YW0 A;  2H3R A;  3ZYM A;  4K0U A;  3VHL A;  2M6I A;  2BS3 A;  2NOX A;  1XWM A;  5LHI B;  2MYS A;  3KBT A;  2V7J A;  4DR4 T;  3AEA A;  1X79 A;  3LDQ B;  5DQW A;  4IE4 A;  4KX6 A;  2W61 A;  4TNV A;  1N33 T;  4HTE A;  4JI4 T;  2UXB T;  4MLK A;  3N2O A;  2IUB A;  2CM0 A;  4ZS3 A;  5AQR B;  2HH7 A;  3SRZ A;  4AQF A;  5JDH A;  4UV9 B;  2LKH A;  4QH1 A;  5AQF B;  3T1H T;  2BBH A;  1YKE B;  3AAI A;  4DMW A;  4H9Q C;  3PE0 A;  4P0A A;  2UXD T;  5ABE A;  4U2Z A;  4ZZB A;  2YOE A;  3ZMZ B;  2DWG A;  4QXC B;  4N78 D;  3ESL A;  3CX7 B;  3FZF B;  4NIQ A;  4DID B;  3OVU A;  2XHE B;  3P4S A;  5JRC B;  3PUX F;  2XTL A;  3PU3 A;  3F31 A;  5FP3 A;  3K3Q C;  3AAA B;  5JDG A;  2J47 A;  3UUL A;  4B3T T;  2LSJ A;  2LRL A;  2QVA A;  4H9R C;  3FBL A;  2JRK A;  4IE7 A;  5GON E;  2F4V T;  2E2A A;  2Y48 B;  3CWZ B;  5L3F B;  2LE8 A;  1Y64 B;  3RRC A;  2HPJ A;  4JI8 T;  1MND A;  3K8P C;  5IYZ E;  4U31 A;  4XZC A;  1HG2 A;  2Y6X A;  3FZM B;  3OPC A;  1D1A A;  4EYU A;  5LJN A;  3LJC A;  4EGW A;  4ZI2 D;  2V5C A;  4HFE A;  2ODV A;  3FHN A;  2WMN A;  3O1H A;  4B6X A;  2XQ4 A;  3PUR A;  4BA9 A;  4YSX A;  2FUP A;  2XPK A;  3OKQ A;  3G06 A;  5KX5 E;  2KMF A;  4QH5 A;  5CFB A;  3RYI E;  1L0V A;  1WYC A;  4CXW A;  5L4H A;  5F8P A;  3N2K E;  1WRD A;  2WQY A;  1Y01 A;  2JQQ A;  4F8H A;  5JDF A; 
#chains in the Genus database with same CATH homology
 4PJJ A;  5JQG E;  1IJ6 A;  3LFM A;  1WLX A;  3O1J A;  3GA8 A;  4OHF A;  4UVB B;  1UX4 A;  3HL6 A;  1YKH B;  3RH3 A;  2LSK A;  3N9P A;  3AA0 B;  4EIW A;  2P9B A;  4IHJ E;  3O4X E;  1Z0P A;  4UF0 A;  3CPZ A;  1MMA A;  3LBX A;  2D5U A;  2E9X C;  2X9X A;  4UXN B;  4DVD A;  2X0L B;  3C4W A;  4X20 E;  5FYM A;  2YIN A;  3LK2 B;  3ONX A;  4BJN A;  2K48 A;  4DBQ A;  3E0Z A;  4ZI3 D;  2K9A A;  3NRX A;  2L9Q A;  5JRE A;  3L3P A;  4TV8 E;  4AKH A;  5JR9 A;  4FI5 A;  5BMV E;  4G2A A;  3E08 A;  2WBL A;  4V1A v;  4MHC A;  2RA1 A;  1S94 A;  2D0T A;  2XQY A;  3BQL A;  3PU8 A;  1O3X A;  3SS1 A;  2L3L A;  4P09 A;  4QHO A;  4DBR A;  5LBM A;  3RYF E;  4EXT A;  1VRB A;  4AQG A;  4ILU A;  3H37 A;  4AXP A;  3B57 A;  5C8Y E;  3ZEF B;  5IHY A;  2WWU A;  4JUY A;  5JVD E;  1FMW A;  2DNX A;  2LHN A;  3HA4 A;  3CKD A;  4FJO A;  4L5G A;  2N1G A;  2IW5 B;  4E7S A;  2V7I A;  1D0Y A;  3CVR A;  3KV9 A;  4O4L E;  4CZZ B;  4H9N C;  4AQF C;  4CXY A;  1FIO A;  4P0B A;  5LNK A;  5LP6 E;  3I9Y A;  3UTK A;  2CLY B;  2BDE A;  3I0Q A;  3ETV A;  5LBQ B;  4OK0 A;  2LSI A;  4GOU A;  4ISS A;  5LJM A;  4O2B E;  4PJL A;  3GMI A;  2V7L A;  2HPL A;  2Q9Q B;  2YU2 A;  5HXS A;  5A1L A;  1QUU A;  3F57 A;  4UVC B;  5EK4 A;  3ZCI A;  2JJ9 A;  2K24 A;  2LSY A;  3FB2 A;  4ADZ A;  4F6R C;  2H7O A;  3Q5W A;  3ZN1 B;  4JLE A;  2A72 A;  3BQI A;  3N9N A;  2X67 A;  3FXD B;  3EVY A;  4X1K E;  3AAE B;  2VB6 A;  2WSS V;  4IDZ A;  5EZY E;  4UEL A;  1AJ3 A;  4ANJ A;  2XAF B;  3MXZ A;  5HXC A;  1H7C A;  4ZOL E;  5FY7 A;  3RC3 A;  1FEW A;  5HXE A;  4C90 A;  5LA6 E;  3NZP A;  2EHO C;  3AA1 B;  4O4H E;  5LGU B;  5JRC A;  3HKC E;  3OBV E;  4UF0 B;  5LCY A;  2UXN B;  2NWB A;  5L3G B;  3MK7 C;  3LBX B;  5CA0 E;  3MA9 A;  3RPU A;  3KVB A;  2MBG A;  4NUV A;  4QXH B;  2G0U A;  2B1E A;  3E22 E;  4XBF B;  2BZB A;  2QGS A;  2VWA A;  5E0O A;  5FXZ A;  3ZPO A;  5JR9 B;  2WAU A;  1ZKE A;  2ES0 A;  4PJN A;  2Y8D A;  2CWY A;  3N9M A;  4DO0 A;  3A5X A;  3V5U A;  1G73 A;  4G63 A;  1U5P A;  4YLH A;  5HAX A;  3PUG A;  1MIV A;  3R6N A;  3C64 A;  1D1B A;  1IZN B;  2LT3 A;  2OA5 A;  2QA7 A;  4HFV A;  2IC6 A;  2PJQ A;  4PFP A;  4X1I E;  3K3N A;  5L3C B;  4XAX B;  4ASK A;  2W0G A;  3RKO A;  4MFR A;  4U72 A;  3MAC A;  4PK6 A;  5AFU L;  3GWH A;  1SA0 E;  5HYA A;  4TN7 B;  1IAP A;  2VAS A;  3PTR B;  4PW8 A;  1LRZ A;  5EK3 A;  2LOS A;  3N2G E;  4PK5 A;  4TV9 E;  3CX6 B;  5J1G A;  2WMO A;  1US7 B;  4L0R A;  4BAY B;  5HXR A;  3TKL B;  4ZHQ E;  3C4Z A;  3MZK B;  4EZ4 A;  2V26 A;  2XAG B;  1WYB A;  4M1P A;  4WW0 A;  3GN5 A;  5FY1 A;  2KLQ A;  3QC9 A;  1MMN A;  3EDU A;  1MIW A;  4PNI A;  3RRW A;  3J9X 1;  5ADX L;  5H6Q B;  1CUN A;  2X9Y A;  3IHR A;  2V7M A;  4PFO A;  2PFV A;  3PUS A;  1E1H B;  5TAO A;  2KZ7 B;  4DMV A;  2ZM2 A;  3ETU A;  1BR1 A;  1U4Q A;  3I9W A;  3HI2 A;  4H63 V;  4AI6 A;  2NTX A;  4TZ4 C;  3W15 B;  1T98 A;  3ZMU B;  2NW7 A;  4MBQ A;  4O2A E;  3K3O A;  1MMG A;  2CLY C;  5DAB A;  2NP9 A;  2E9X D;  5KMG P;  3VKH A;  3RYH E;  5JDQ A;  2W63 A;  4GYR A;  3D0T A;  2CWO A;  4GK5 E;  5L2L A;  4CI2 B;  2Q9Q C;  3N5L A;  2A3D A;  2LHR A;  2CEA A;  1MMD A;  2IC9 A;  4AKR B;  5EK2 A;  3WAJ A;  5FXX A;  2KND A;  2ZMA A;  1IJ5 A;  3CML A;  3KVA A;  2VKO A;  1SHZ C;  1QSD A;  4AKG A;  3ZYK A;  3F2E A;  5LGN B;  3C98 B;  1ZHC A;  3AA6 B;  4OFZ A;  4PJM A;  1HX8 A;  3SOL A;  3CX8 B;  5LYJ E;  2C5K T;  3I1A A;  2VK9 A;  2YEV C;  2I59 A;  3KBU A;  4O4J E;  2D2S A;  4AKL A;  3ZMT B;  4IE6 A;  3ZLI A;  3IEE A;  2KWH A;  5J2T E;  4UV8 B;  3MJX A;  3NRY A;  5L3D B;  1YW0 A;  3P7I A;  4CXX A;  3KV6 A;  2H3R A;  4Z8X A;  4EAH A;  4TX5 A;  3ZYM A;  2N9D A;  3KV4 A;  4K0U A;  1LVF A;  3VHL A;  4HGA A;  1BR2 A;  2XAS B;  4KBM B;  2H7V C;  3ZC0 A;  4IE0 A;  4ZI7 E;  4TUY E;  2NOX A;  3UUX B;  4NUU A;  1LVK A;  3UFE A;  1YD8 G;  4YFS A;  3LG7 A;  2ODU A;  2E9X A;  2LEH A;  5LHI B;  2MYS A;  2YU1 A;  4QWN B;  3KBT A;  2JMH A;  3PUA A;  1VOM A;  2V7J A;  5JR9 C;  5L3E B;  4U74 A;  1UX5 A;  1X79 A;  3CQG B;  2DHR A;  2VL8 A;  3HKB E;  3QUJ A;  3GN5 B;  5DQW A;  2X68 A;  4E7Z A;  2RP4 A;  4GK0 E;  3PUQ A;  2W62 A;  4IE4 A;  3L09 A;  5LHG B;  2BVL A;  2GK9 A;  4UEM A;  2C5J A;  2W61 A;  2KWI B;  2KIN B;  5JDL A;  3WAK A;  2W00 A;  3I0O A;  4HTE A;  2LM9 A;  4H9S E;  1HS7 A;  4MLK A;  4CI1 B;  1HTJ F;  3BQK A;  3N2O A;  5FXW A;  2CM0 A;  5CB4 E;  3NBX X;  5H6R B;  4UVA B;  3FXE B;  1D1C A;  3DTO A;  3P8C D;  2EHO D;  5F3J A;  4ZS3 A;  1BR0 A;  1ZV4 X;  3B13 A;  2HH7 A;  4HN9 A;  3DP7 A;  2CXL A;  5CA1 E;  1HF8 A;  4QXB B;  3SRZ A;  3ZMS B;  4BJM A;  4AQF A;  2CMR A;  2Z6E A;  5JDH A;  4J2C A;  3UUM A;  2XAQ B;  3O9X A;  4UV9 B;  3VKG A;  4KMC A;  2VKD A;  3J7Y q;  3Q9D A;  3OYX A;  3QK6 A;  3HR0 A;  3SWH A;  2N2N A;  3U78 A;  3KV5 A;  3R84 B;  1YKE B;  4EB6 E;  3Q5X A;  4ZI3 C;  3WI3 A;  5LGT B;  3AAI A;  4HE8 A;  4DMW A;  3MKD A;  4JEH B;  3ZMV B;  4H9Q C;  3O1I A;  3PE0 A;  4QX7 B;  4P0A A;  3M65 A;  1ZEE A;  2CXF A;  3OJA A;  3AVR A;  3UT5 E;  2ZLY A;  4OYK A;  3Q2M A;  4I50 E;  3T8O A;  3RYC E;  3V5S A;  2X9H A;  3ZMZ B;  3EDV A;  4JEU B;  5ETW A;  2DWG A;  1D0Z A;  2A2F X;  3BK9 A;  3EUH A;  4QXC B;  4QKN A;  3U3I A;  4N78 D;  4IE5 A;  3FBZ A;  2DCF A;  3ESL A;  3CX7 B;  3OYZ A;  2JMK A;  2EHO A;  2NW8 A;  2WM9 A;  5LOV E;  1HFA A;  2K5B B;  2V1D B;  2XHE B;  3KIN B;  2E9X B;  2M67 A;  4ZS2 A;  5JRC B;  5LG4 A;  5KDM C;  2XTL A;  4MAL A;  3C50 A;  2X51 A;  1HG5 A;  3PU3 A;  4EZH A;  4DND A;  2PG8 A;  3ANW A;  1HCI A;  3HKD E;  4I55 E;  3C4X A;  4PK4 A;  3F31 A;  5FP3 A;  1MNE A;  3K3Q C;  5FXV A;  3AA7 B;  3AAA B;  2DI4 A;  2NW9 A;  5JDG A;  4X1Y E;  2MOZ A;  4IIJ E;  3ZCJ A;  3UUL A;  2LSJ A;  2MTQ A;  5JH7 E;  3N9L A;  1B7T A;  4KUM B;  1OXZ A;  4H9R C;  5FMN A;  3AB3 B;  4O8S A;  2C5I T;  3FBL A;  5HWY A;  2JRK A;  4I43 B;  1LKX A;  4IE7 A;  2JPF A;  3NZQ A;  2BVM A;  5M4Y A;  5LXT E;  1KK7 A;  5GON E;  3H3A A;  5JDM A;  5JDN A;  4ZI2 C;  4IGU A;  2Q9Q D;  3C51 A;  4H9O C;  4I4T E;  2XAH B;  2C0S A;  4L9I A;  2Y48 B;  4YJ3 E;  4HKA A;  3VU7 H;  3IF8 B;  2XUE A;  1FMV A;  2UXX B;  4WBN E;  3RC8 A;  2CE7 A;  3CWZ B;  1NAF A;  4WBO A;  2DLR A;  5L3F B;  2DWK A;  4CI3 B;  2CCQ A;  1NWM X;  2LE8 A;  3KDS E;  3ZJ2 A;  3CQX C;  1Y64 B;  3RRC A;  2HPJ A;  4YJ2 E;  4YHJ A;  1MND A;  2PBI A;  3K8P C;  2KT9 A;  4PAG A;  5IYZ E;  1MIY A;  2LSG A;  4HEA A;  5L3B B;  3JC6 C;  4XZC A;  1HG2 A;  2Y6X A;  3AVS A;  3HKE E;  4WNK A;  4QX8 B;  5LHH B;  3ZN0 B;  1D0X A;  2X66 A;  4AKI A;  2CA5 A;  4OYJ A;  1KNZ A;  1D1A A;  4CQI A;  2L8K A;  4EYU A;  3S4U A;  5LJN A;  3LJC A;  5DJQ C;  1UCU A;  4ZI2 D;  3RX6 A;  5DQV A;  3CQC B;  3ZYL A;  4UIG A;  4O4I E;  2ODV A;  3DJB A;  2WMN A;  3FHN A;  3O1H A;  2SPC A;  3IBP A;  5FY0 A;  3ZJ1 A;  4B6X A;  2XAJ B;  4ERR A;  4EOZ B;  3UUN A;  4H9P C;  4GIW A;  3PUR A;  4BA9 A;  1G8X A;  2IAK A;  2VKJ A;  2ACX A;  2YK0 A;  4KP3 C;  2EHO B;  2KXP B;  5FNV E;  1S35 A;  2VKH A;  2D0U A;  4A56 A;  2V7K A;  4C91 A;  3PDY A;  3N9O A;  3OKQ A;  5KX5 E;  2Q9Q A;  2KMF A;  3KFW X;  3JC6 D;  1BR4 A;  2LOP A;  3RYI E;  3LK4 2;  1WYC A;  2CXD A;  3LK3 B;  4CXW A;  2NTY A;  2LJL A;  5HXH A;  4IST A;  1EZ3 A;  3ANW B;  2X9W A;  2ZM0 A;  2E8I A;  4GYS A;  5F8P A;  3N2K E;  1WRD A;  1V9D A;  2J1D G;  5HWX A;  4H63 H;  4EYY R;  1WR6 A;  3ZC1 A;  2JQQ A;  3N9Q A;  5J2U E;  5JDF A;  2ZM8 A;  1OWA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...