1O3XA

Crystal structure of human gga1 gat domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
b'AANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor binding protein GGA1
publication title Molecular Mechanism of Membrane Recruitment of Gga by Arf in Lysosomal Protein Transport
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1o3xA00
1YD8G 1OXZA 1WRDA 1X79A 1WR6A 2N9DA 2N2NA 1O3XA 1NWMX 1NAFA
chains in the Genus database with same CATH superfamily
3ANWA 4MFRA 4ERRA 5L3DB 4X65T 2KWHA 4CI1B 5LG4A 2W4XA 5EK2A 3RLFF 2PBIA 1HTJF 1FIOA 4IIJE 3GA8A 3JADA 3ZYMA 5FNVE 2CBIA 3TLVA 1FMWA 3N9NA 2LHNA 5J1GA 4YXDA 3UU6A 4IDOA 5HEUA 3PJAJ 4HWDA 3HKCE 4JLEA 5LJNA 1O3XA 1LVKA 2LSKA 4QX7B 4O2AE 2XSAA 2CXLA 2LSYA 2VKHA 3P4PA 3VRAA 2V6YA 3ZKRA 4AQGA 4GIWA 4ZI2C 3B5MA 2D9DA 4QXCB 2I0MA 2VVNA 1XNQT 3RGLA 2W0GA 5ABFB 5ABGA 4COFA 4IL4A 1QSDA 3F31A 3M65A 1FMVA 3PUSA 5IHYA 2UXDT 4H9OC 1ZV4X 4YY3T 3PURA 3HL6A 4DR1T 3A7MA 5KX5E 3AE3A 3AE1A 1ZKEA 2HPLA 3N2KE 3PTRB 3AE7A 5JDGA 3AVSA 2ZM6T 4GKKT 3FXEB 4JI1T 4HN9A 4DVDA 5AQPB 3AE4A 3I9YA 4DV1T 3ZC0A 3AECA 4ZOLE 1OEDE 2QRXA 2LSIA 4I50E 1BR1A 4DV6T 2I59A 4ADZA 3D0TA 2DI4A 3NVOA 5ABHA 3UFGA 4ZEYA 2FJDA 5FY7A 4JI0T 4ZI3C 4EYUA 1ZHCA 2E9XB 2CLYB 4XAXB 5CJ5A 4C90A 2CXDA 3AVRA 5JREA 2ACZA 2MAWA 5L4EA 4TNWA 4P0BA 4JV5T 3KDSE 1DU2A 2JQQA 4HFEA 2UXBT 5LGTB 4H9RC 3VU7H 4HFIA 3EDVA 4PK6A 4CQIA 4PJJA 5M4YA 3ZMSB 5LA6E 5F3JA 5EK4A 2X0LB 3FHNA 3ZMTB 4X1KE 2CHOA 1HF8A 2LM9A 2L9QA 3IBPA 4UR9A 3RQWA 3CPZA 4UF0A 4TWDA 3AA7B 4H63V 5FKYA 4EAHA 2YU2A 1H7CA 2XQ8A 2X9XA 5AQHB 1X9BA 1MNDA 5ETWA 3Q5EA 5LHGB 1T72A 2YINA 5FVKA 2WZIA 5H6RB 4O4LE 5FY0A 2XAHB 2V1DB 4ZI7E 5HXEA 3MA9A 5AQKB 2JMHA 4ZHQE 3FZHB 2SPCA 2WDVA 2XASB 4GOUA 4A56A 2EHOC 2Z6EA 1HG2A 1W9RA 2V7MA 4DR6T 4OK0A 1YXRA 3ZEFB 1D1AA 4DBRA 3LDQB 2WU5A 4OX9T 4LF8T 2ZLYA 2BS3A 2HPJA 2J62A 2XY8B 3AAIA 1HG5A 3HKEE 2HN1A 1KK7A 5DABA 3L8RA 5JQGE 3QC9A 2Q9QD 3UQ7A 3VR9A 3NWIA 2XQAA 4EXTA 4LF7T 3RKGA 2WY2A 3RRWA 5JRCA 4B3MT 3ANWB 1EZ3A 4HKAA 3VHLA 4AISA 3TLTA 3PV0F 3NRYA 3VRBA 4JI2T 3ZT6A 4X1YE 3UU3A 2VKDA 2Q9QB 4FI5A 3ZJ1A 4X5TA 2M67A 2XM2A 3H3MA 2V5CA 1WR6A 2JQHA 4DR4T 4QH5A 1Y01A 2BG9E 2OA5A 1UK5A 4PW8A 1AJ3A 3JAFA 3EUHA 5AQMB 2V7JA 3H3AA 2V6YB 4ILUA 3FZKB 4NUUA 5LBQB 4EEDA 4DV5T 3UT5E 4H9NC 3RX6A 3BQIA 2QA7A 4QXBB 1G73A 2R6GF 2WBLA 5LMUT 5HAXA 4YHHT 2DWGA 3TLSA 3K3QC 1BR0A 4UVCB 4ZS3A 2WP9A 3EAMA 2XQ3A 2VURA 4LMLA 4J2CA 4TWFA 1UX5A 4ZXLA 4DR2T 5CGMA 1V9DA 4KHPT 1D0XA 4I55E 3CX7B 4H63H 4LMKA 3M3ZB 3RIUC 3PUYF 3UQ4A 4IE5A 1NEKA 3ZYKA 1WYCA 2OLTA 2IAKA 1U4QA 4ISTA 3NKZA 4BJNA 4EZ4A 2IC6A 2K48A 2YOEA 3UU4A 3ONXA 2XQ6A 2Y6XA 2NTXA 4PAGA 3PUGA 5LNKA 3PUAA 2DCFA 2D0TA 4JYAT 4HFHA 2BVLA 2J1DG 2RA1A 3FZFB 4U72A 1MIWA 4AKLA 4C91A 5KXJA 4EV6A 4TWHA 3QB5K 1FEWA 2CCQA 3ZC1A 4DV7T 2D5UA 1E1HB 2VK9A 4IT4A 2E9XC 2CLYC 4IDZA 4MLKA 2ZM8A 3MXZA 2WDRA 2WMOA 3KFWX 4PJMA 3RC8A 3CKDA 4UF0B 4FJOA 3U3IA 4EB6E 4AKGA 4TN7B 2LHRA 5JR9C 1W0BA 5HWXA 2KINB 5JDMA 4X62T 1N36T 5L3GB 4UELA 3CX6B 3RPUA 4LMJA 4TZ4C 2YDQA 5L3EB 3K8PC 3EDUA 2MYSA 3AE6A 2WDQA 4CZZB 3Q2MA 5FVLA 4X1IE 2C5KT 3K3OA 2CA5A 2CMRA 5IWAT 2Q9QA 4DBQA 3CVRA 4QH1A 2WAUA 2VWAA 2XQ9A 2XUEA 3ZMUB 4ILBA 2UXXB 2YDSA 5EZYE 2XQYA 2BVMA 5L2LA 1CHUA 5J0ZA 3KV9A 3MACA 2CXFA 4PJNA 2ZM0A 2W2UA 3AB3B 4GK5E 5DQWA 4K0UA 2BBJA 4P1NA 3GN5B 5LYJE 5FXZA 3CQCB 5HCJA 5FYMA 1Y64B 2W62A 1OEDC 3AEFA 3AEEA 5HEJA 2NW8A 4PK5A 3ZMVB 2DWKA 1IAPA 2NP9A 4X64T 3T1YT 3UU8A 5JRCB 2CBJA 3I9WA 5FXVA 4BA9A 4O4JE 4H9PC 2N2NA 3SWHA 4QH4A 3PU3A 5E0OA 4DR7T 2CRBA 2LOSA 2C5JA 5LXTE 3FXDB 5HXRA 3NZPA 2WZHA 2LT3A 2X68A 4TUYE 4PFOA 3GMIA 3EI0A 3RRCA 3PDYA 4JUYA 1N32T 5KMGP 5J2UE 4IDPA 3U78A 2QGSA 5BMVE 3F2EA 3SFEA 5LCYA 2J4GA 2M6BA 2W00A 1G8XA 3ZN0B 4ILAA 2EHOA 4YFSA 2V7KA 3LFMA 3N2OA 4KUMB 4HEAA 2WSSV 5HXSA 4PNIA 5L3FB 4EOZB 1HCIA 4OYJA 5AQGB 3ZJ2A 4A98A 4JI3T 4IDQA 2H89A 1YKHB 4JBWF 1WCRA 2CWOA 3ESLA 4AQYT 5CB4E 1D1CA 3JC6C 5JDLA 3SOLA 2G0UA 4WW0A 1UGOA 5HEGA 3HA4A 1HR0T 2JJ9A 5AQTB 3Q5WA 4GYRA 1LRZA 3MKDA 2ACXA 3E08A 3L39A 3V5SA 4DMWA 3AE2A 4JEUB 3HKDE 1D0YA 2VKJA 4O8SA 1KNRA 4HFVA 4HWFA 4IE7A 4N78D 4WBOA 2PJQA 1GQEA 2VL8A 4LFBT 5JDFA 4K0KT 3KV4A 2JQ9A 2DNXA 4GKJT 3Q5XA 2CEAA 4ZZCA 4DV3T 3RYHE 4ZI2D 2ES0A 3LK42 3W15B 4X20E 2X51A 4EEBA 3BQKA 1WLXA 3P4RA 4PK4A 3L09A 2NW7A 3RHWA 3UUNA 4YTMA 4UV8B 3ZSSA 3CQGB 4U3CA 1VOMA 3QK6A 2YK0A 3IHRA 3LSVA 3AE8A 2UXNB 3AAEB 3HKBE 2CWYA 1YW0A 1UUSA 2L3LA 1MIVA 2X66A 2PG8A 3QUJA 2W61A 4LF5T 5LP6E 2XAFB 2NWBA 5JVDE 2VKOA 4ZZBA 1D0ZA 4B3RT 3GN5A 2IIUA 2RP4A 2E5LT 2XAQB 4YSZA 1SHZC 3P4QA 3ABVA 2KT9A 4PJLA 4UV9B 4HWIB 2V7LA 2BG9C 3KBTA 2IMLA 4O4HE 1J5WA 3B57A 3FZMB 4H9SE 4LF9T 3LK2B 4ZI3D 5AQNB 3N9MA 3TLUA 2LSGA 4U74A 3NBXX 5AQSB 4X66T 3ETUA 2K5BB 3N9OA 3NRXA 2IC9A 5JDHA 2UUBT 3CWZB 3DP7A 4A5XA 3CK6A 4DV0T 2LEHA 3MZKB 3RIFA 3JAEA 4IREA 1WR0A 5C2TA 1SUMB 4KBMB 4WNKA 3IEEA 2VB6A 3LK3B 4KI0F 3PUZF 2X9WA 3LJCA 2WB5A 1J5ET 4YHJA 4ANJA 3TKLB 4KHZF 3OTOT 2XAGB 1L0VA 2FJEA 2Y8DA 4M1PA 1XWMA 3T1HT 4DUYT 2DL1A 5F5WA 2KSRA 4CN6A 4L5GA 4IDNA 1IBLT 4F6RC 2LLYA 2WS3A 4IE0A 4DNDA 2BKPA 2XZEA 4JEHB 1HNZT 4DUZT 4P0AA 4XZCA 1VCTA 5LB7B 2V6XA 2WWUA 4AQFC 2EHOD 5JR9A 3N9QA 1KNZA 4IE4A 4YSYA 2L8KA 4G2AA 5L3BB 1MMGA 5AQOB 2C0SA 2HH7A 2E8IA 2XQ5A 3QB5A 3O4XE 2MOZA 1CUNA 4NIQA 4H9QC 5C8YE 1XDOA 3AEBA 2UUCT 3LBXA 3Q9DA 1ZEEA 3EHZA 5DQVA 3KVAA 2K3WA 2EHOB 5HCMA 2BBHA 1I94T 5HYAA 4DV4T 4UEMA 2X67A 3ZLIA 1UCUA 2RPAA 3AEDA 1J1JA 2D0UA 2WM9A 2JPFA 2PTFA 4AIUA 4LF6T 2LKHA 4U7IA 1IBKT 3WI3A 3C51A 5CA0E 3C4XA 3SFDA 3OYZA 3AAAB 2K9AA 1OEDA 4AKHA 2X9HA 3R84B 3C98B 4CI2B 4JI6T 2BZBA 3UU5A 3OVUA 3OYXA 4DR3T 4YJ2E 4QX8B 4AXPA 4WYVA 4NXMT 2LOPA 4L0RA 4HWHA 4QHOA 2XQ7A 3VKGA 4U7YA 3VR8A 2E5VA 3P4WA 3AA6B 3DTOA 3ETVA 5AQQB 2BS4A 4HTEA 4HWCA 1B7TA 1N33T 3AA1B 5EK3A 4I0UA 2P9BA 1R8IA 1IJ6A 5AFUL 4I4TE 4IE6A 1WFDA 4TV8E 1OXZA 1JNZA 3KBUA 1VRBA 3IA3A 4YTNA 3I0OA 4BAYB 4LF4T 1N34T 5DJQC 3RI5A 3IF8B 2IHR1 3HI2A 1OWAA 4IGUA 4IHJE 4MALA 4BJMA 2IDOB 3AA0B 1W09A 3RIAA 2CM0A 1LVFA 5FXXA 4AKRB 4Z91A 2VASA 4Q25A 3Q5DA 2IUBA 3PU8A 4JI4T 3RC3A 4ISSA 3FBLA 1VCSA 2XM1A 4WZXA 2V5DA 3AE9A 4MHCA 1IBMT 1MMNA 2KXPB 4UVBB 4HGAA 3RQUA 2Y48B 4NXNT 2D2SA 1QLBA 2ZM2A 4MBQA 3O1IA 1XMQT 1S94A 2MTQA 2KMFA 1HX1B 1HS7A 4U31A 3F57A 5LGNB 1W0AA 4YTPA 5AQFB 1UX4A 3PUVF 4E7ZA 2WCAA 2JRKA 5GONE 3N2GE 4NUVA 3ZSTA 3SS1A 3EVYA 4CI3B 3P50A 2DHRA 1MNEA 4UIGA 2W67A 5LJMA 3RYFE 4TV9E 4KX6A 3J9X1 5IUXA 5ADXL 3UUMA 5LG3A 5AQRB 3RKOA 2I6HA 3UFEA 2CHNA 5TAOA 3ZCIA 3VKHA 5JDQA 3AXJA 3CQXC 2E9XD 3O1JA 3PUWF 3N5LA 1M7KA 2FBWA 3J7Yq 5A1LA 5CA1E 3C4ZA 5HXHA 1WYBA 4TX5A 2UU9T 3SRZA 2WU2A 4CXXA 2Q9QC 5LGUB 3AE5A 2M6IA 2YEVC 4QWNB 3C4WA 1HNWT 2H7VC 4IL9A 4O2BE 1XDPA 1T8BA 1UURA 3ZT5A 4UVAB 5HEOA 4Z8XA 2WMNA 3UUBA 3ZMZB 3PJAA 5JTGA 4QKNA 2UXCT 3A5XA 5HEHA 3GWHA 1KNPA 1E7PA 2N9DA 2BG9A 5JR9B 3ZYLA 1JNRA 5ABEA 4KP3C 1MIYA 1KF6A 2GK9A 2XJ7A 5AQUB 2XQ4A 3ONLC 4U2ZA 4ASKA 4LFCT 4WBNE 2VQFT 2W66A 2KNDA 2N1GA 3LBXB 5AQLB 5CFBA 3BK9A 3PUQA 4OFZA 2V26A 4ILCA 4JI8T 2B1EA 4E7SA 5LHHB 2VL0A 3R6NA 2A2FX 2MBGA 2YU1A 3NZQA 1NWMX 3OPCA 3OJAA 4TNVA 1ZOYA 5H6QB 5L3CB 2KWIB 3QOFA 2JQKA 5L47A 3K3NA 1QUUA 2OV9A 4UXNB 3KV6A 4B6XA 3ZN1B 3KINB 3KV5A 2YN6A 1WRDA 3LG7A 3P8CD 4V1Av 5FP3A 2PFVA 1HNXT 3T8OA 1OEDB 3N9PA 3FB2A 4HE8A 2NW9A 3E0ZA 3TLWA 5FL1A 2BKNA 4AI6A 1BR4A 1MMDA 1NAFA 2KZ7B 3RH3A 4HFBA 4G63A 4CXWA 2MPKA 1XZYA 3L3PA 4YJ3E 4DO0A 4AQFA 3O1HA 4L9IA 3UULA 4ZS2A 1HFAA 4NPPA 5ABFA 1YD8G 3UUXB 5FL0A 3S4UA 2V7IA 2WWVA 5AQVB 4EGWA 4EYYR 3JC6D 3V5UA 5LBMA 2A3DA 2NOXA 2W63A 4A97A 2BDEA 3ONJA 3I0QA 4XBFB 2KLQA 3PUXF 3G06A 3RIUA 5HXCA 2VQET 4DIDB 2X0YA 5FMNA 3AEAA 2AE9A 3A8YC 2LJLA 5J2TE 3OBVE 4GK0E 3JCFA 1X79A 2QVAA 2XPKA 3CIRA 1FJGT 2X9YA 3O9XA 5LHIB 5LOVE 4CN1A 2AXDS 3RYIE 4CN4A 2A72A 5LMNT 5FY1A 1IZNB 4EIWA 2LM2A 3RF1A 1T7SA 2E2AA 3CMLA 4Z90A 2V8SV 4CXYA 1IJ5A 2FUPA 4YLHA 1ZP0A 3QNUA 2K24A 3P7IA 2E9XA 2XHEB 1HX8A 3ZT7A 1U5PA 1D1BA 2H88A 2LKGA 2LE8A 4P09A 1NENA 2XSBA 2ZMAA 2XTLA 3ZCJA 2CE7A 2FJBA 4F8HA 4PFPA 2XAJB 4U33A 5C3JA 2B76A 3B13A 1T98A 3AXJB 5HWYA 1Z8UA 2CPTA 4B3ST 5FXWA 4OYKA 3OKQA 1KEYA 4YT0A 3CX8B 4KMCA 1US7B 3EABA 2H3RA 1XMOT 3MJXA 1S35A 3P4SA 1Z0PA 2YKSA 2BS2A 2DLRA 1XNRT 2NR4A 2JMKA 2LRKA 2ODUA 2VVSA 1SA0E 4I43B 2ODVA 3HR0A 2WQYA 4DV2T 2H7OA 3H37A 1E2AA 2X0HA 3N9LA 4B3TT 2HN2A 3C64A 3PE0A 2LSJA 1MMAA 4LFAT 2IW5B 2BG9B 2NTYA 3BQLA 1YQ3A 4AKIA 4EZHA 5KDMC 3K1SA 3AEGA 5AQJB 2LRLA 3E22E 4YSXA 4O4IE 2F4VT 1M62A 3UTKA 1BR2A 5IYZE 1KFYA 2YDRA 2C5IT 4GYSA 4U2YA 3C50A 3DJBA 2QYWA 5BR8T 2FJAA 2J47A 4HFCA 3RYCE 3KVBA 4JI7T 2A9UA 2BKOA 3WAKA 4QXHB 3WAJA 1LKXA 3FZLB 4DR5T 3MK7C 1SE7A 4DMVA 5JH7E 2JIWA 1YKEB 4HFDA 4JI5T 5JDNA 2UUAT 3FBZA 3X1DA 2HHHT 5AQIB 1I6ZA 3I1AA 4OHFA 5F8PA 3ZPOA 1YQ4A 5L4HA
chains in the Genus database with same CATH topology
3ANWA 4CXXA 4MFRA 1D0ZA 4ERRA 2Q9QC 5L3DB 3GN5A 2KWHA 3K3QC 5LGUB 4CI1B 2RP4A 2XAQB 1SHZC 2YEVC 5LG4A 1BR0A 4QWNB 5EK2A 3C4WA 2KT9A 4PJLA 2H7VC 4UV9B 4O2BE 4UVCB 2PBIA 2V7LA 4UVAB 4ZS3A 3KBTA 1HTJF 1FIOA 4O4HE 3B57A 4IIJE 4Z8XA 3GA8A 2WMNA 3ZYMA 5FNVE 4J2CA 1UX5A 1FMWA 4H9SE 3ZMZB 3N9NA 3LK2B 2LHNA 4ZI3D 4QKNA 5J1GA 3A5XA 1V9DA 3GWHA 1D0XA 3N9MA 2N9DA 4I55E 2LSGA 4U74A 3NBXX 5JR9B 3ZYLA 3CX7B 3ETUA 2K5BB 3HKCE 4H63H 4JLEA 5LJNA 1O3XA 4KP3C 1MIYA 1LVKA 4IE5A 3N9OA 3ZYKA 1WYCA 3NRXA 2IAKA 1U4QA 2GK9A 4ISTA 2LSKA 4QX7B 4O2AE 2IC9A 4BJNA 4EZ4A 2CXLA 2IC6A 5JDHA 3CWZB 3DP7A 2LSYA 2K48A 3ONXA 2VKHA 2Y6XA 4AQGA 4GIWA 2NTXA 4ZI2C 4PAGA 4QXCB 2LEHA 3PUGA 4ASKA 5LNKA 3MZKB 3PUAA 4WBNE 2KNDA 2N1GA 2DCFA 2D0TA 3LBXB 3BK9A 3PUQA 4KBMB 4WNKA 4OFZA 2W0GA 2V26A 3IEEA 2B1EA 2VB6A 2BVLA 3LK3B 2J1DG 2RA1A 1QSDA 4E7SA 5LHHB 3F31A 3M65A 4U72A 1FMVA 2X9WA 3LJCA 3PUSA 5IHYA 3R6NA 1MIWA 2A2FX 4H9OC 2MBGA 2YU1A 1ZV4X 3NZQA 4AKLA 4C91A 1NWMX 3PURA 4YHJA 3HL6A 4ANJA 3TKLB 3OJAA 1FEWA 5KX5E 2XAGB 1ZKEA 2CCQA 3ZC1A 2Y8DA 2HPLA 4M1PA 2D5UA 3N2KE 1E1HB 2VK9A 3PTRB 5H6QB 2KWIB 5L3CB 3K3NA 1QUUA 2E9XC 2CLYC 4IDZA 4MLKA 5JDGA 3AVSA 4UXNB 4L5GA 3KV6A 4B6XA 2ZM8A 3ZN1B 3MXZA 3FXEB 4F6RC 3KINB 4HN9A 4IE0A 3KV5A 1WRDA 2WMOA 3KFWX 4PJMA 4DNDA 4DVDA 3RC8A 3CKDA 4JEHB 4UF0B 4FJOA 3LG7A 3P8CD 3U3IA 4EB6E 4TN7B 4AKGA 4V1Av 2LHRA 4P0AA 5JR9C 3I9YA 4XZCA 5FP3A 5HWXA 2KINB 2PFVA 3ZC0A 4ZOLE 3T8OA 3N9PA 3FB2A 4HE8A 5JDMA 2NW9A 3E0ZA 5L3GB 2LSIA 4I50E 3CX6B 4UELA 2WWUA 3RPUA 1BR1A 4AI6A 1BR4A 4AQFC 2EHOD 1MMDA 4TZ4C 5JR9A 5L3EB 3N9QA 1NAFA 2I59A 2KZ7B 3EDUA 3K8PC 4ADZA 2MYSA 3D0TA 2DI4A 3RH3A 4G63A 1KNZA 4IE4A 4CZZB 3Q2MA 2L8KA 5FY7A 4G2AA 4X1IE 5L3BB 4CXWA 2C5KT 3K3OA 4ZI3C 2CA5A 1MMGA 2CMRA 2C0SA 2HH7A 3L3PA 1ZHCA 4EYUA 4YJ3E 2E8IA 4DO0A 2E9XB 2CLYB 2Q9QA 3O1HA 3O4XE 4L9IA 4XAXB 4AQFA 4C90A 4DBQA 2CXDA 3UULA 2MOZA 4ZS2A 1HFAA 3CVRA 1CUNA 2WAUA 2VWAA 4H9QC 5C8YE 3AVRA 2XUEA 5JREA 3ZMUB 2UXXB 3LBXA 5EZYE 4P0BA 3Q9DA 2XQYA 1ZEEA 5DQVA 1YD8G 3KDSE 3UUXB 2BVMA 5L2LA 2JQQA 3KVAA 5LGTB 3S4UA 2EHOB 3KV9A 2V7IA 4H9RC 3VU7H 4EYYR 5HYAA 3JC6D 3V5UA 3EDVA 4PK6A 3MACA 5LBMA 2CXFA 4PJNA 4CQIA 2A3DA 2NOXA 2ZM0A 4UEMA 4PJJA 3AB3B 2X67A 4GK5E 2W63A 3ZLIA 1UCUA 5DQWA 5M4YA 4K0UA 3ZMSB 5LA6E 2BDEA 5F3JA 5EK4A 3GN5B 5LYJE 3I0QA 2X0LB 4XBFB 2KLQA 3FHNA 5FXZA 5HXCA 3CQCB 2D0UA 2WM9A 5FYMA 2JPFA 3ZMTB 1Y64B 4X1KE 2W62A 5FMNA 1HF8A 2LM9A 2L9QA 2LJLA 5J2TE 3IBPA 3OBVE 4GK0E 2NW8A 3WI3A 4PK5A 3C51A 3ZMVB 3CPZA 4UF0A 1X79A 5CA0E 2DWKA 3C4XA 3AA7B 4H63V 3OYZA 1IAPA 3AAAB 2NP9A 4EAHA 2YU2A 1H7CA 2X9YA 2K9AA 4AKHA 2X9HA 3O9XA 3R84B 5JRCB 2X9XA 3I9WA 5FXVA 5LHIB 3C98B 4BA9A 5LOVE 4O4JE 4CI2B 1MNDA 3RYIE 2A72A 2BZBA 5ETWA 4H9PC 2N2NA 3SWHA 5JVDE 5LHGB 5E0OA 3PU3A 5FY1A 1IZNB 4EIWA 3OYXA 2YINA 4YJ2E 5H6RB 2LOSA 4O4LE 2C5JA 4QX8B 5LXTE 3FXDB 4AXPA 3CMLA 5FY0A 2LOPA 4L0RA 2XAHB 4QHOA 2V1DB 5HXRA 4ZI7E 5HXEA 3VKGA 4CXYA 1IJ5A 3MA9A 3NZPA 4YLHA 2JMHA 3AA6B 2K24A 3DTOA 2LT3A 3ETVA 3P7IA 4ZHQE 2E9XA 2SPCA 2X68A 2XASB 2XHEB 4TUYE 1HX8A 4GOUA 2EHOC 1B7TA 2Z6EA 1HG2A 4HTEA 4PFOA 4A56A 3AA1B 3GMIA 5EK3A 2V7MA 1U5PA 3RRCA 1D1BA 4OK0A 2P9BA 3PDYA 4JUYA 5KMGP 3ZEFB 1D1AA 5J2UE 4DBRA 3U78A 2QGSA 5BMVE 1IJ6A 2LE8A 3F2EA 5AFUL 4I4TE 5LCYA 4IE6A 2W00A 4P09A 1G8XA 4TV8E 3ZN0B 2ZMAA 2EHOA 1OXZA 4YFSA 2V7KA 3LFMA 2XTLA 3KBUA 3N2OA 3ZCJA 1VRBA 2CE7A 4KUMB 4HEAA 2WSSV 5HXSA 4PNIA 5L3FB 4EOZB 2ZLYA 1HCIA 3I0OA 2HPJA 4OYJA 4BAYB 3ZJ2A 4PFPA 5DJQC 1YKHB 2XAJB 3IF8B 3HI2A 2CWOA 3ESLA 3AAIA 1HG5A 3HKEE 1OWAA 4IGUA 3B13A 4IHJE 5CB4E 1D1CA 1KK7A 4MALA 5DABA 1T98A 4BJMA 3AA0B 3JC6C 5JQGE 5JDLA 2CM0A 3QC9A 5HWYA 3SOLA 2G0UA 2Q9QD 4WW0A 1LVFA 5FXXA 4AKRB 5FXWA 4OYKA 3OKQA 4EXTA 2VASA 3HA4A 2JJ9A 3CX8B 4KMCA 3Q5WA 1US7B 4GYRA 1LRZA 2H3RA 3MKDA 3PU8A 3RC3A 3RRWA 2ACXA 3MJXA 4ISSA 1S35A 3E08A 5JRCA 3ANWB 3FBLA 1Z0PA 3V5SA 4DMWA 2DLRA 1EZ3A 4JEUB 3HKDE 2JMKA 1D0YA 4HKAA 2VKJA 4MHCA 3VHLA 4O8SA 1MMNA 2KXPB 4UVBB 3NRYA 2ODUA 4HFVA 4HGAA 4X1YE 1SA0E 4IE7A 2Y48B 2D2SA 4N78D 4I43B 2ODVA 2ZM2A 3HR0A 4WBOA 4MBQA 2PJQA 2VKDA 2Q9QB 2VL8A 3O1IA 1S94A 2H7OA 4FI5A 5JDFA 3ZJ1A 2MTQA 3H37A 2KMFA 2M67A 3KV4A 2DNXA 1HS7A 3F57A 3N9LA 3C64A 3Q5XA 5LGNB 3PE0A 1UX4A 1MMAA 2CEAA 2LSJA 4E7ZA 2IW5B 1WR6A 2JRKA 2NTYA 3BQLA 3N2GE 4NUVA 5GONE 4AKIA 4EZHA 3RYHE 3SS1A 4ZI2D 2ES0A 3EVYA 3LK42 3W15B 5KDMC 4X20E 4CI3B 3E22E 2OA5A 2X51A 4O4IE 3UTKA 2DHRA 4PW8A 1BR2A 5IYZE 3BQKA 1MNEA 1WLXA 4UIGA 5LJMA 4PK4A 1AJ3A 3L09A 3RYFE 2NW7A 3EUHA 2C5IT 2V7JA 4GYSA 3H3AA 4TV9E 3J9X1 3C50A 3UUNA 3DJBA 5ADXL 3UUMA 4UV8B 3CQGB 4ILUA 1VOMA 3RYCE 3RKOA 4NUUA 5LBQB 3QK6A 3KVBA 3UFEA 3ZCIA 5TAOA 3WAKA 4QXHB 3VKHA 3WAJA 1LKXA 2YK0A 3IHRA 5JDQA 3UT5E 3MK7C 4H9NC 3RX6A 2UXNB 3AAEB 3BQIA 3CQXC 2E9XD 3O1JA 4DMVA 5JH7E 3N5LA 2QA7A 3HKBE 2CWYA 1YKEB 4QXBB 1YW0A 2L3LA 3J7Yq 5A1LA 1MIVA 1G73A 5JDNA 2X66A 2PG8A 3FBZA 5CA1E 3C4ZA 5HXHA 3QUJA 1WYBA 2W61A 3I1AA 4TX5A 2WBLA 4OHFA 5HAXA 5LP6E 2XAFB 5F8PA 3ZPOA 2NWBA 2DWGA 2VKOA 3SRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YD8 G;  1OXZ A;  1WRD A;  1X79 A;  1WR6 A;  2N9D A;  2N2N A;  1O3X A;  1NWM X;  1NAF A; 
#chains in the Genus database with same CATH topology
 3ANW A;  4MFR A;  4ERR A;  5L3D B;  4X65 T;  2KWH A;  4CI1 B;  5LG4 A;  2W4X A;  5EK2 A;  3RLF F;  2PBI A;  1HTJ F;  1FIO A;  4IIJ E;  3GA8 A;  3JAD A;  3ZYM A;  5FNV E;  2CBI A;  3TLV A;  1FMW A;  3N9N A;  2LHN A;  5J1G A;  4YXD A;  3UU6 A;  4IDO A;  5HEU A;  3PJA J;  4HWD A;  3HKC E;  4JLE A;  5LJN A;  1O3X A;  1LVK A;  2LSK A;  4QX7 B;  4O2A E;  2XSA A;  2CXL A;  2LSY A;  2VKH A;  3P4P A;  3VRA A;  2V6Y A;  3ZKR A;  4AQG A;  4GIW A;  4ZI2 C;  3B5M A;  2D9D A;  4QXC B;  2I0M A;  2VVN A;  1XNQ T;  3RGL A;  2W0G A;  5ABF B;  5ABG A;  4COF A;  4IL4 A;  1QSD A;  3F31 A;  3M65 A;  1FMV A;  3PUS A;  5IHY A;  2UXD T;  4H9O C;  1ZV4 X;  4YY3 T;  3PUR A;  3HL6 A;  4DR1 T;  3A7M A;  5KX5 E;  3AE3 A;  3AE1 A;  1ZKE A;  2HPL A;  3N2K E;  3PTR B;  3AE7 A;  5JDG A;  3AVS A;  2ZM6 T;  4GKK T;  3FXE B;  4JI1 T;  4HN9 A;  4DVD A;  5AQP B;  3AE4 A;  3I9Y A;  4DV1 T;  3ZC0 A;  3AEC A;  4ZOL E;  1OED E;  2QRX A;  2LSI A;  4I50 E;  1BR1 A;  4DV6 T;  2I59 A;  4ADZ A;  3D0T A;  2DI4 A;  3NVO A;  5ABH A;  3UFG A;  4ZEY A;  2FJD A;  5FY7 A;  4JI0 T;  4ZI3 C;  4EYU A;  1ZHC A;  2E9X B;  2CLY B;  4XAX B;  5CJ5 A;  4C90 A;  2CXD A;  3AVR A;  5JRE A;  2ACZ A;  2MAW A;  5L4E A;  4TNW A;  4P0B A;  4JV5 T;  3KDS E;  1DU2 A;  2JQQ A;  4HFE A;  2UXB T;  5LGT B;  4H9R C;  3VU7 H;  4HFI A;  3EDV A;  4PK6 A;  4CQI A;  4PJJ A;  5M4Y A;  3ZMS B;  5LA6 E;  5F3J A;  5EK4 A;  2X0L B;  3FHN A;  3ZMT B;  4X1K E;  2CHO A;  1HF8 A;  2LM9 A;  2L9Q A;  3IBP A;  4UR9 A;  3RQW A;  3CPZ A;  4UF0 A;  4TWD A;  3AA7 B;  4H63 V;  5FKY A;  4EAH A;  2YU2 A;  1H7C A;  2XQ8 A;  2X9X A;  5AQH B;  1X9B A;  1MND A;  5ETW A;  3Q5E A;  5LHG B;  1T72 A;  2YIN A;  5FVK A;  2WZI A;  5H6R B;  4O4L E;  5FY0 A;  2XAH B;  2V1D B;  4ZI7 E;  5HXE A;  3MA9 A;  5AQK B;  2JMH A;  4ZHQ E;  3FZH B;  2SPC A;  2WDV A;  2XAS B;  4GOU A;  4A56 A;  2EHO C;  2Z6E A;  1HG2 A;  1W9R A;  2V7M A;  4DR6 T;  4OK0 A;  1YXR A;  3ZEF B;  1D1A A;  4DBR A;  3LDQ B;  2WU5 A;  4OX9 T;  4LF8 T;  2ZLY A;  2BS3 A;  2HPJ A;  2J62 A;  2XY8 B;  3AAI A;  1HG5 A;  3HKE E;  2HN1 A;  1KK7 A;  5DAB A;  3L8R A;  5JQG E;  3QC9 A;  2Q9Q D;  3UQ7 A;  3VR9 A;  3NWI A;  2XQA A;  4EXT A;  4LF7 T;  3RKG A;  2WY2 A;  3RRW A;  5JRC A;  4B3M T;  3ANW B;  1EZ3 A;  4HKA A;  3VHL A;  4AIS A;  3TLT A;  3PV0 F;  3NRY A;  3VRB A;  4JI2 T;  3ZT6 A;  4X1Y E;  3UU3 A;  2VKD A;  2Q9Q B;  4FI5 A;  3ZJ1 A;  4X5T A;  2M67 A;  2XM2 A;  3H3M A;  2V5C A;  1WR6 A;  2JQH A;  4DR4 T;  4QH5 A;  1Y01 A;  2BG9 E;  2OA5 A;  1UK5 A;  4PW8 A;  1AJ3 A;  3JAF A;  3EUH A;  5AQM B;  2V7J A;  3H3A A;  2V6Y B;  4ILU A;  3FZK B;  4NUU A;  5LBQ B;  4EED A;  4DV5 T;  3UT5 E;  4H9N C;  3RX6 A;  3BQI A;  2QA7 A;  4QXB B;  1G73 A;  2R6G F;  2WBL A;  5LMU T;  5HAX A;  4YHH T;  2DWG A;  3TLS A;  3K3Q C;  1BR0 A;  4UVC B;  4ZS3 A;  2WP9 A;  3EAM A;  2XQ3 A;  2VUR A;  4LML A;  4J2C A;  4TWF A;  1UX5 A;  4ZXL A;  4DR2 T;  5CGM A;  1V9D A;  4KHP T;  1D0X A;  4I55 E;  3CX7 B;  4H63 H;  4LMK A;  3M3Z B;  3RIU C;  3PUY F;  3UQ4 A;  4IE5 A;  1NEK A;  3ZYK A;  1WYC A;  2OLT A;  2IAK A;  1U4Q A;  4IST A;  3NKZ A;  4BJN A;  4EZ4 A;  2IC6 A;  2K48 A;  2YOE A;  3UU4 A;  3ONX A;  2XQ6 A;  2Y6X A;  2NTX A;  4PAG A;  3PUG A;  5LNK A;  3PUA A;  2DCF A;  2D0T A;  4JYA T;  4HFH A;  2BVL A;  2J1D G;  2RA1 A;  3FZF B;  4U72 A;  1MIW A;  4AKL A;  4C91 A;  5KXJ A;  4EV6 A;  4TWH A;  3QB5 K;  1FEW A;  2CCQ A;  3ZC1 A;  4DV7 T;  2D5U A;  1E1H B;  2VK9 A;  4IT4 A;  2E9X C;  2CLY C;  4IDZ A;  4MLK A;  2ZM8 A;  3MXZ A;  2WDR A;  2WMO A;  3KFW X;  4PJM A;  3RC8 A;  3CKD A;  4UF0 B;  4FJO A;  3U3I A;  4EB6 E;  4AKG A;  4TN7 B;  2LHR A;  5JR9 C;  1W0B A;  5HWX A;  2KIN B;  5JDM A;  4X62 T;  1N36 T;  5L3G B;  4UEL A;  3CX6 B;  3RPU A;  4LMJ A;  4TZ4 C;  2YDQ A;  5L3E B;  3K8P C;  3EDU A;  2MYS A;  3AE6 A;  2WDQ A;  4CZZ B;  3Q2M A;  5FVL A;  4X1I E;  2C5K T;  3K3O A;  2CA5 A;  2CMR A;  5IWA T;  2Q9Q A;  4DBQ A;  3CVR A;  4QH1 A;  2WAU A;  2VWA A;  2XQ9 A;  2XUE A;  3ZMU B;  4ILB A;  2UXX B;  2YDS A;  5EZY E;  2XQY A;  2BVM A;  5L2L A;  1CHU A;  5J0Z A;  3KV9 A;  3MAC A;  2CXF A;  4PJN A;  2ZM0 A;  2W2U A;  3AB3 B;  4GK5 E;  5DQW A;  4K0U A;  2BBJ A;  4P1N A;  3GN5 B;  5LYJ E;  5FXZ A;  3CQC B;  5HCJ A;  5FYM A;  1Y64 B;  2W62 A;  1OED C;  3AEF A;  3AEE A;  5HEJ A;  2NW8 A;  4PK5 A;  3ZMV B;  2DWK A;  1IAP A;  2NP9 A;  4X64 T;  3T1Y T;  3UU8 A;  5JRC B;  2CBJ A;  3I9W A;  5FXV A;  4BA9 A;  4O4J E;  4H9P C;  2N2N A;  3SWH A;  4QH4 A;  3PU3 A;  5E0O A;  4DR7 T;  2CRB A;  2LOS A;  2C5J A;  5LXT E;  3FXD B;  5HXR A;  3NZP A;  2WZH A;  2LT3 A;  2X68 A;  4TUY E;  4PFO A;  3GMI A;  3EI0 A;  3RRC A;  3PDY A;  4JUY A;  1N32 T;  5KMG P;  5J2U E;  4IDP A;  3U78 A;  2QGS A;  5BMV E;  3F2E A;  3SFE A;  5LCY A;  2J4G A;  2M6B A;  2W00 A;  1G8X A;  3ZN0 B;  4ILA A;  2EHO A;  4YFS A;  2V7K A;  3LFM A;  3N2O A;  4KUM B;  4HEA A;  2WSS V;  5HXS A;  4PNI A;  5L3F B;  4EOZ B;  1HCI A;  4OYJ A;  5AQG B;  3ZJ2 A;  4A98 A;  4JI3 T;  4IDQ A;  2H89 A;  1YKH B;  4JBW F;  1WCR A;  2CWO A;  3ESL A;  4AQY T;  5CB4 E;  1D1C A;  3JC6 C;  5JDL A;  3SOL A;  2G0U A;  4WW0 A;  1UGO A;  5HEG A;  3HA4 A;  1HR0 T;  2JJ9 A;  5AQT B;  3Q5W A;  4GYR A;  1LRZ A;  3MKD A;  2ACX A;  3E08 A;  3L39 A;  3V5S A;  4DMW A;  3AE2 A;  4JEU B;  3HKD E;  1D0Y A;  2VKJ A;  4O8S A;  1KNR A;  4HFV A;  4HWF A;  4IE7 A;  4N78 D;  4WBO A;  2PJQ A;  1GQE A;  2VL8 A;  4LFB T;  5JDF A;  4K0K T;  3KV4 A;  2JQ9 A;  2DNX A;  4GKJ T;  3Q5X A;  2CEA A;  4ZZC A;  4DV3 T;  3RYH E;  4ZI2 D;  2ES0 A;  3LK4 2;  3W15 B;  4X20 E;  2X51 A;  4EEB A;  3BQK A;  1WLX A;  3P4R A;  4PK4 A;  3L09 A;  2NW7 A;  3RHW A;  3UUN A;  4YTM A;  4UV8 B;  3ZSS A;  3CQG B;  4U3C A;  1VOM A;  3QK6 A;  2YK0 A;  3IHR A;  3LSV A;  3AE8 A;  2UXN B;  3AAE B;  3HKB E;  2CWY A;  1YW0 A;  1UUS A;  2L3L A;  1MIV A;  2X66 A;  2PG8 A;  3QUJ A;  2W61 A;  4LF5 T;  5LP6 E;  2XAF B;  2NWB A;  5JVD E;  2VKO A;  4ZZB A;  1D0Z A;  4B3R T;  3GN5 A;  2IIU A;  2RP4 A;  2E5L T;  2XAQ B;  4YSZ A;  1SHZ C;  3P4Q A;  3ABV A;  2KT9 A;  4PJL A;  4UV9 B;  4HWI B;  2V7L A;  2BG9 C;  3KBT A;  2IML A;  4O4H E;  1J5W A;  3B57 A;  3FZM B;  4H9S E;  4LF9 T;  3LK2 B;  4ZI3 D;  5AQN B;  3N9M A;  3TLU A;  2LSG A;  4U74 A;  3NBX X;  5AQS B;  4X66 T;  3ETU A;  2K5B B;  3N9O A;  3NRX A;  2IC9 A;  5JDH A;  2UUB T;  3CWZ B;  3DP7 A;  4A5X A;  3CK6 A;  4DV0 T;  2LEH A;  3MZK B;  3RIF A;  3JAE A;  4IRE A;  1WR0 A;  5C2T A;  1SUM B;  4KBM B;  4WNK A;  3IEE A;  2VB6 A;  3LK3 B;  4KI0 F;  3PUZ F;  2X9W A;  3LJC A;  2WB5 A;  1J5E T;  4YHJ A;  4ANJ A;  3TKL B;  4KHZ F;  3OTO T;  2XAG B;  1L0V A;  2FJE A;  2Y8D A;  4M1P A;  1XWM A;  3T1H T;  4DUY T;  2DL1 A;  5F5W A;  2KSR A;  4CN6 A;  4L5G A;  4IDN A;  1IBL T;  4F6R C;  2LLY A;  2WS3 A;  4IE0 A;  4DND A;  2BKP A;  2XZE A;  4JEH B;  1HNZ T;  4DUZ T;  4P0A A;  4XZC A;  1VCT A;  5LB7 B;  2V6X A;  2WWU A;  4AQF C;  2EHO D;  5JR9 A;  3N9Q A;  1KNZ A;  4IE4 A;  4YSY A;  2L8K A;  4G2A A;  5L3B B;  1MMG A;  5AQO B;  2C0S A;  2HH7 A;  2E8I A;  2XQ5 A;  3QB5 A;  3O4X E;  2MOZ A;  1CUN A;  4NIQ A;  4H9Q C;  5C8Y E;  1XDO A;  3AEB A;  2UUC T;  3LBX A;  3Q9D A;  1ZEE A;  3EHZ A;  5DQV A;  3KVA A;  2K3W A;  2EHO B;  5HCM A;  2BBH A;  1I94 T;  5HYA A;  4DV4 T;  4UEM A;  2X67 A;  3ZLI A;  1UCU A;  2RPA A;  3AED A;  1J1J A;  2D0U A;  2WM9 A;  2JPF A;  2PTF A;  4AIU A;  4LF6 T;  2LKH A;  4U7I A;  1IBK T;  3WI3 A;  3C51 A;  5CA0 E;  3C4X A;  3SFD A;  3OYZ A;  3AAA B;  2K9A A;  1OED A;  4AKH A;  2X9H A;  3R84 B;  3C98 B;  4CI2 B;  4JI6 T;  2BZB A;  3UU5 A;  3OVU A;  3OYX A;  4DR3 T;  4YJ2 E;  4QX8 B;  4AXP A;  4WYV A;  4NXM T;  2LOP A;  4L0R A;  4HWH A;  4QHO A;  2XQ7 A;  3VKG A;  4U7Y A;  3VR8 A;  2E5V A;  3P4W A;  3AA6 B;  3DTO A;  3ETV A;  5AQQ B;  2BS4 A;  4HTE A;  4HWC A;  1B7T A;  1N33 T;  3AA1 B;  5EK3 A;  4I0U A;  2P9B A;  1R8I A;  1IJ6 A;  5AFU L;  4I4T E;  4IE6 A;  1WFD A;  4TV8 E;  1OXZ A;  1JNZ A;  3KBU A;  1VRB A;  3IA3 A;  4YTN A;  3I0O A;  4BAY B;  4LF4 T;  1N34 T;  5DJQ C;  3RI5 A;  3IF8 B;  2IHR 1;  3HI2 A;  1OWA A;  4IGU A;  4IHJ E;  4MAL A;  4BJM A;  2IDO B;  3AA0 B;  1W09 A;  3RIA A;  2CM0 A;  1LVF A;  5FXX A;  4AKR B;  4Z91 A;  2VAS A;  4Q25 A;  3Q5D A;  2IUB A;  3PU8 A;  4JI4 T;  3RC3 A;  4ISS A;  3FBL A;  1VCS A;  2XM1 A;  4WZX A;  2V5D A;  3AE9 A;  4MHC A;  1IBM T;  1MMN A;  2KXP B;  4UVB B;  4HGA A;  3RQU A;  2Y48 B;  4NXN T;  2D2S A;  1QLB A;  2ZM2 A;  4MBQ A;  3O1I A;  1XMQ T;  1S94 A;  2MTQ A;  2KMF A;  1HX1 B;  1HS7 A;  4U31 A;  3F57 A;  5LGN B;  1W0A A;  4YTP A;  5AQF B;  1UX4 A;  3PUV F;  4E7Z A;  2WCA A;  2JRK A;  5GON E;  3N2G E;  4NUV A;  3ZST A;  3SS1 A;  3EVY A;  4CI3 B;  3P50 A;  2DHR A;  1MNE A;  4UIG A;  2W67 A;  5LJM A;  3RYF E;  4TV9 E;  4KX6 A;  3J9X 1;  5IUX A;  5ADX L;  3UUM A;  5LG3 A;  5AQR B;  3RKO A;  2I6H A;  3UFE A;  2CHN A;  5TAO A;  3ZCI A;  3VKH A;  5JDQ A;  3AXJ A;  3CQX C;  2E9X D;  3O1J A;  3PUW F;  3N5L A;  1M7K A;  2FBW A;  3J7Y q;  5A1L A;  5CA1 E;  3C4Z A;  5HXH A;  1WYB A;  4TX5 A;  2UU9 T;  3SRZ A;  2WU2 A;  4CXX A;  2Q9Q C;  5LGU B;  3AE5 A;  2M6I A;  2YEV C;  4QWN B;  3C4W A;  1HNW T;  2H7V C;  4IL9 A;  4O2B E;  1XDP A;  1T8B A;  1UUR A;  3ZT5 A;  4UVA B;  5HEO A;  4Z8X A;  2WMN A;  3UUB A;  3ZMZ B;  3PJA A;  5JTG A;  4QKN A;  2UXC T;  3A5X A;  5HEH A;  3GWH A;  1KNP A;  1E7P A;  2N9D A;  2BG9 A;  5JR9 B;  3ZYL A;  1JNR A;  5ABE A;  4KP3 C;  1MIY A;  1KF6 A;  2GK9 A;  2XJ7 A;  5AQU B;  2XQ4 A;  3ONL C;  4U2Z A;  4ASK A;  4LFC T;  4WBN E;  2VQF T;  2W66 A;  2KND A;  2N1G A;  3LBX B;  5AQL B;  5CFB A;  3BK9 A;  3PUQ A;  4OFZ A;  2V26 A;  4ILC A;  4JI8 T;  2B1E A;  4E7S A;  5LHH B;  2VL0 A;  3R6N A;  2A2F X;  2MBG A;  2YU1 A;  3NZQ A;  1NWM X;  3OPC A;  3OJA A;  4TNV A;  1ZOY A;  5H6Q B;  5L3C B;  2KWI B;  3QOF A;  2JQK A;  5L47 A;  3K3N A;  1QUU A;  2OV9 A;  4UXN B;  3KV6 A;  4B6X A;  3ZN1 B;  3KIN B;  3KV5 A;  2YN6 A;  1WRD A;  3LG7 A;  3P8C D;  4V1A v;  5FP3 A;  2PFV A;  1HNX T;  3T8O A;  1OED B;  3N9P A;  3FB2 A;  4HE8 A;  2NW9 A;  3E0Z A;  3TLW A;  5FL1 A;  2BKN A;  4AI6 A;  1BR4 A;  1MMD A;  1NAF A;  2KZ7 B;  3RH3 A;  4HFB A;  4G63 A;  4CXW A;  2MPK A;  1XZY A;  3L3P A;  4YJ3 E;  4DO0 A;  4AQF A;  3O1H A;  4L9I A;  3UUL A;  4ZS2 A;  1HFA A;  4NPP A;  5ABF A;  1YD8 G;  3UUX B;  5FL0 A;  3S4U A;  2V7I A;  2WWV A;  5AQV B;  4EGW A;  4EYY R;  3JC6 D;  3V5U A;  5LBM A;  2A3D A;  2NOX A;  2W63 A;  4A97 A;  2BDE A;  3ONJ A;  3I0Q A;  4XBF B;  2KLQ A;  3PUX F;  3G06 A;  3RIU A;  5HXC A;  2VQE T;  4DID B;  2X0Y A;  5FMN A;  3AEA A;  2AE9 A;  3A8Y C;  2LJL A;  5J2T E;  3OBV E;  4GK0 E;  3JCF A;  1X79 A;  2QVA A;  2XPK A;  3CIR A;  1FJG T;  2X9Y A;  3O9X A;  5LHI B;  5LOV E;  4CN1 A;  2AXD S;  3RYI E;  4CN4 A;  2A72 A;  5LMN T;  5FY1 A;  1IZN B;  4EIW A;  2LM2 A;  3RF1 A;  1T7S A;  2E2A A;  3CML A;  4Z90 A;  2V8S V;  4CXY A;  1IJ5 A;  2FUP A;  4YLH A;  1ZP0 A;  3QNU A;  2K24 A;  3P7I A;  2E9X A;  2XHE B;  1HX8 A;  3ZT7 A;  1U5P A;  1D1B A;  2H88 A;  2LKG A;  2LE8 A;  4P09 A;  1NEN A;  2XSB A;  2ZMA A;  2XTL A;  3ZCJ A;  2CE7 A;  2FJB A;  4F8H A;  4PFP A;  2XAJ B;  4U33 A;  5C3J A;  2B76 A;  3B13 A;  1T98 A;  3AXJ B;  5HWY A;  1Z8U A;  2CPT A;  4B3S T;  5FXW A;  4OYK A;  3OKQ A;  1KEY A;  4YT0 A;  3CX8 B;  4KMC A;  1US7 B;  3EAB A;  2H3R A;  1XMO T;  3MJX A;  1S35 A;  3P4S A;  1Z0P A;  2YKS A;  2BS2 A;  2DLR A;  1XNR T;  2NR4 A;  2JMK A;  2LRK A;  2ODU A;  2VVS A;  1SA0 E;  4I43 B;  2ODV A;  3HR0 A;  2WQY A;  4DV2 T;  2H7O A;  3H37 A;  1E2A A;  2X0H A;  3N9L A;  4B3T T;  2HN2 A;  3C64 A;  3PE0 A;  2LSJ A;  1MMA A;  4LFA T;  2IW5 B;  2BG9 B;  2NTY A;  3BQL A;  1YQ3 A;  4AKI A;  4EZH A;  5KDM C;  3K1S A;  3AEG A;  5AQJ B;  2LRL A;  3E22 E;  4YSX A;  4O4I E;  2F4V T;  1M62 A;  3UTK A;  1BR2 A;  5IYZ E;  1KFY A;  2YDR A;  2C5I T;  4GYS A;  4U2Y A;  3C50 A;  3DJB A;  2QYW A;  5BR8 T;  2FJA A;  2J47 A;  4HFC A;  3RYC E;  3KVB A;  4JI7 T;  2A9U A;  2BKO A;  3WAK A;  4QXH B;  3WAJ A;  1LKX A;  3FZL B;  4DR5 T;  3MK7 C;  1SE7 A;  4DMV A;  5JH7 E;  2JIW A;  1YKE B;  4HFD A;  4JI5 T;  5JDN A;  2UUA T;  3FBZ A;  3X1D A;  2HHH T;  5AQI B;  1I6Z A;  3I1A A;  4OHF A;  5F8P A;  3ZPO A;  1YQ4 A;  5L4H A; 
#chains in the Genus database with same CATH homology
 3ANW A;  4CXX A;  4MFR A;  1D0Z A;  4ERR A;  2Q9Q C;  5L3D B;  3GN5 A;  2KWH A;  3K3Q C;  5LGU B;  4CI1 B;  2RP4 A;  2XAQ B;  1SHZ C;  2YEV C;  5LG4 A;  1BR0 A;  4QWN B;  5EK2 A;  3C4W A;  2KT9 A;  4PJL A;  2H7V C;  4UV9 B;  4O2B E;  4UVC B;  2PBI A;  2V7L A;  4UVA B;  4ZS3 A;  3KBT A;  1HTJ F;  1FIO A;  4O4H E;  3B57 A;  4IIJ E;  4Z8X A;  3GA8 A;  2WMN A;  3ZYM A;  5FNV E;  4J2C A;  1UX5 A;  1FMW A;  4H9S E;  3ZMZ B;  3N9N A;  3LK2 B;  2LHN A;  4ZI3 D;  4QKN A;  5J1G A;  3A5X A;  1V9D A;  3GWH A;  1D0X A;  3N9M A;  2N9D A;  4I55 E;  2LSG A;  4U74 A;  3NBX X;  5JR9 B;  3ZYL A;  3CX7 B;  3ETU A;  2K5B B;  3HKC E;  4H63 H;  4JLE A;  5LJN A;  1O3X A;  4KP3 C;  1MIY A;  1LVK A;  4IE5 A;  3N9O A;  3ZYK A;  1WYC A;  3NRX A;  2IAK A;  1U4Q A;  2GK9 A;  4IST A;  2LSK A;  4QX7 B;  4O2A E;  2IC9 A;  4BJN A;  4EZ4 A;  2CXL A;  2IC6 A;  5JDH A;  3CWZ B;  3DP7 A;  2LSY A;  2K48 A;  3ONX A;  2VKH A;  2Y6X A;  4AQG A;  4GIW A;  2NTX A;  4ZI2 C;  4PAG A;  4QXC B;  2LEH A;  3PUG A;  4ASK A;  5LNK A;  3MZK B;  3PUA A;  4WBN E;  2KND A;  2N1G A;  2DCF A;  2D0T A;  3LBX B;  3BK9 A;  3PUQ A;  4KBM B;  4WNK A;  4OFZ A;  2W0G A;  2V26 A;  3IEE A;  2B1E A;  2VB6 A;  2BVL A;  3LK3 B;  2J1D G;  2RA1 A;  1QSD A;  4E7S A;  5LHH B;  3F31 A;  3M65 A;  4U72 A;  1FMV A;  2X9W A;  3LJC A;  3PUS A;  5IHY A;  3R6N A;  1MIW A;  2A2F X;  4H9O C;  2MBG A;  2YU1 A;  1ZV4 X;  3NZQ A;  4AKL A;  4C91 A;  1NWM X;  3PUR A;  4YHJ A;  3HL6 A;  4ANJ A;  3TKL B;  3OJA A;  1FEW A;  5KX5 E;  2XAG B;  1ZKE A;  2CCQ A;  3ZC1 A;  2Y8D A;  2HPL A;  4M1P A;  2D5U A;  3N2K E;  1E1H B;  2VK9 A;  3PTR B;  5H6Q B;  2KWI B;  5L3C B;  3K3N A;  1QUU A;  2E9X C;  2CLY C;  4IDZ A;  4MLK A;  5JDG A;  3AVS A;  4UXN B;  4L5G A;  3KV6 A;  4B6X A;  2ZM8 A;  3ZN1 B;  3MXZ A;  3FXE B;  4F6R C;  3KIN B;  4HN9 A;  4IE0 A;  3KV5 A;  1WRD A;  2WMO A;  3KFW X;  4PJM A;  4DND A;  4DVD A;  3RC8 A;  3CKD A;  4JEH B;  4UF0 B;  4FJO A;  3LG7 A;  3P8C D;  3U3I A;  4EB6 E;  4TN7 B;  4AKG A;  4V1A v;  2LHR A;  4P0A A;  5JR9 C;  3I9Y A;  4XZC A;  5FP3 A;  5HWX A;  2KIN B;  2PFV A;  3ZC0 A;  4ZOL E;  3T8O A;  3N9P A;  3FB2 A;  4HE8 A;  5JDM A;  2NW9 A;  3E0Z A;  5L3G B;  2LSI A;  4I50 E;  3CX6 B;  4UEL A;  2WWU A;  3RPU A;  1BR1 A;  4AI6 A;  1BR4 A;  4AQF C;  2EHO D;  1MMD A;  4TZ4 C;  5JR9 A;  5L3E B;  3N9Q A;  1NAF A;  2I59 A;  2KZ7 B;  3EDU A;  3K8P C;  4ADZ A;  2MYS A;  3D0T A;  2DI4 A;  3RH3 A;  4G63 A;  1KNZ A;  4IE4 A;  4CZZ B;  3Q2M A;  2L8K A;  5FY7 A;  4G2A A;  4X1I E;  5L3B B;  4CXW A;  2C5K T;  3K3O A;  4ZI3 C;  2CA5 A;  1MMG A;  2CMR A;  2C0S A;  2HH7 A;  3L3P A;  1ZHC A;  4EYU A;  4YJ3 E;  2E8I A;  4DO0 A;  2E9X B;  2CLY B;  2Q9Q A;  3O1H A;  3O4X E;  4L9I A;  4XAX B;  4AQF A;  4C90 A;  4DBQ A;  2CXD A;  3UUL A;  2MOZ A;  4ZS2 A;  1HFA A;  3CVR A;  1CUN A;  2WAU A;  2VWA A;  4H9Q C;  5C8Y E;  3AVR A;  2XUE A;  5JRE A;  3ZMU B;  2UXX B;  3LBX A;  5EZY E;  4P0B A;  3Q9D A;  2XQY A;  1ZEE A;  5DQV A;  1YD8 G;  3KDS E;  3UUX B;  2BVM A;  5L2L A;  2JQQ A;  3KVA A;  5LGT B;  3S4U A;  2EHO B;  3KV9 A;  2V7I A;  4H9R C;  3VU7 H;  4EYY R;  5HYA A;  3JC6 D;  3V5U A;  3EDV A;  4PK6 A;  3MAC A;  5LBM A;  2CXF A;  4PJN A;  4CQI A;  2A3D A;  2NOX A;  2ZM0 A;  4UEM A;  4PJJ A;  3AB3 B;  2X67 A;  4GK5 E;  2W63 A;  3ZLI A;  1UCU A;  5DQW A;  5M4Y A;  4K0U A;  3ZMS B;  5LA6 E;  2BDE A;  5F3J A;  5EK4 A;  3GN5 B;  5LYJ E;  3I0Q A;  2X0L B;  4XBF B;  2KLQ A;  3FHN A;  5FXZ A;  5HXC A;  3CQC B;  2D0U A;  2WM9 A;  5FYM A;  2JPF A;  3ZMT B;  1Y64 B;  4X1K E;  2W62 A;  5FMN A;  1HF8 A;  2LM9 A;  2L9Q A;  2LJL A;  5J2T E;  3IBP A;  3OBV E;  4GK0 E;  2NW8 A;  3WI3 A;  4PK5 A;  3C51 A;  3ZMV B;  3CPZ A;  4UF0 A;  1X79 A;  5CA0 E;  2DWK A;  3C4X A;  3AA7 B;  4H63 V;  3OYZ A;  1IAP A;  3AAA B;  2NP9 A;  4EAH A;  2YU2 A;  1H7C A;  2X9Y A;  2K9A A;  4AKH A;  2X9H A;  3O9X A;  3R84 B;  5JRC B;  2X9X A;  3I9W A;  5FXV A;  5LHI B;  3C98 B;  4BA9 A;  5LOV E;  4O4J E;  4CI2 B;  1MND A;  3RYI E;  2A72 A;  2BZB A;  5ETW A;  4H9P C;  2N2N A;  3SWH A;  5JVD E;  5LHG B;  5E0O A;  3PU3 A;  5FY1 A;  1IZN B;  4EIW A;  3OYX A;  2YIN A;  4YJ2 E;  5H6R B;  2LOS A;  4O4L E;  2C5J A;  4QX8 B;  5LXT E;  3FXD B;  4AXP A;  3CML A;  5FY0 A;  2LOP A;  4L0R A;  2XAH B;  4QHO A;  2V1D B;  5HXR A;  4ZI7 E;  5HXE A;  3VKG A;  4CXY A;  1IJ5 A;  3MA9 A;  3NZP A;  4YLH A;  2JMH A;  3AA6 B;  2K24 A;  3DTO A;  2LT3 A;  3ETV A;  3P7I A;  4ZHQ E;  2E9X A;  2SPC A;  2X68 A;  2XAS B;  2XHE B;  4TUY E;  1HX8 A;  4GOU A;  2EHO C;  1B7T A;  2Z6E A;  1HG2 A;  4HTE A;  4PFO A;  4A56 A;  3AA1 B;  3GMI A;  5EK3 A;  2V7M A;  1U5P A;  3RRC A;  1D1B A;  4OK0 A;  2P9B A;  3PDY A;  4JUY A;  5KMG P;  3ZEF B;  1D1A A;  5J2U E;  4DBR A;  3U78 A;  2QGS A;  5BMV E;  1IJ6 A;  2LE8 A;  3F2E A;  5AFU L;  4I4T E;  5LCY A;  4IE6 A;  2W00 A;  4P09 A;  1G8X A;  4TV8 E;  3ZN0 B;  2ZMA A;  2EHO A;  1OXZ A;  4YFS A;  2V7K A;  3LFM A;  2XTL A;  3KBU A;  3N2O A;  3ZCJ A;  1VRB A;  2CE7 A;  4KUM B;  4HEA A;  2WSS V;  5HXS A;  4PNI A;  5L3F B;  4EOZ B;  2ZLY A;  1HCI A;  3I0O A;  2HPJ A;  4OYJ A;  4BAY B;  3ZJ2 A;  4PFP A;  5DJQ C;  1YKH B;  2XAJ B;  3IF8 B;  3HI2 A;  2CWO A;  3ESL A;  3AAI A;  1HG5 A;  3HKE E;  1OWA A;  4IGU A;  3B13 A;  4IHJ E;  5CB4 E;  1D1C A;  1KK7 A;  4MAL A;  5DAB A;  1T98 A;  4BJM A;  3AA0 B;  3JC6 C;  5JQG E;  5JDL A;  2CM0 A;  3QC9 A;  5HWY A;  3SOL A;  2G0U A;  2Q9Q D;  4WW0 A;  1LVF A;  5FXX A;  4AKR B;  5FXW A;  4OYK A;  3OKQ A;  4EXT A;  2VAS A;  3HA4 A;  2JJ9 A;  3CX8 B;  4KMC A;  3Q5W A;  1US7 B;  4GYR A;  1LRZ A;  2H3R A;  3MKD A;  3PU8 A;  3RC3 A;  3RRW A;  2ACX A;  3MJX A;  4ISS A;  1S35 A;  3E08 A;  5JRC A;  3ANW B;  3FBL A;  1Z0P A;  3V5S A;  4DMW A;  2DLR A;  1EZ3 A;  4JEU B;  3HKD E;  2JMK A;  1D0Y A;  4HKA A;  2VKJ A;  4MHC A;  3VHL A;  4O8S A;  1MMN A;  2KXP B;  4UVB B;  3NRY A;  2ODU A;  4HFV A;  4HGA A;  4X1Y E;  1SA0 E;  4IE7 A;  2Y48 B;  2D2S A;  4N78 D;  4I43 B;  2ODV A;  2ZM2 A;  3HR0 A;  4WBO A;  4MBQ A;  2PJQ A;  2VKD A;  2Q9Q B;  2VL8 A;  3O1I A;  1S94 A;  2H7O A;  4FI5 A;  5JDF A;  3ZJ1 A;  2MTQ A;  3H37 A;  2KMF A;  2M67 A;  3KV4 A;  2DNX A;  1HS7 A;  3F57 A;  3N9L A;  3C64 A;  3Q5X A;  5LGN B;  3PE0 A;  1UX4 A;  1MMA A;  2CEA A;  2LSJ A;  4E7Z A;  2IW5 B;  1WR6 A;  2JRK A;  2NTY A;  3BQL A;  3N2G E;  4NUV A;  5GON E;  4AKI A;  4EZH A;  3RYH E;  3SS1 A;  4ZI2 D;  2ES0 A;  3EVY A;  3LK4 2;  3W15 B;  5KDM C;  4X20 E;  4CI3 B;  3E22 E;  2OA5 A;  2X51 A;  4O4I E;  3UTK A;  2DHR A;  4PW8 A;  1BR2 A;  5IYZ E;  3BQK A;  1MNE A;  1WLX A;  4UIG A;  5LJM A;  4PK4 A;  1AJ3 A;  3L09 A;  3RYF E;  2NW7 A;  3EUH A;  2C5I T;  2V7J A;  4GYS A;  3H3A A;  4TV9 E;  3J9X 1;  3C50 A;  3UUN A;  3DJB A;  5ADX L;  3UUM A;  4UV8 B;  3CQG B;  4ILU A;  1VOM A;  3RYC E;  3RKO A;  4NUU A;  5LBQ B;  3QK6 A;  3KVB A;  3UFE A;  3ZCI A;  5TAO A;  3WAK A;  4QXH B;  3VKH A;  3WAJ A;  1LKX A;  2YK0 A;  3IHR A;  5JDQ A;  3UT5 E;  3MK7 C;  4H9N C;  3RX6 A;  2UXN B;  3AAE B;  3BQI A;  3CQX C;  2E9X D;  3O1J A;  4DMV A;  5JH7 E;  3N5L A;  2QA7 A;  3HKB E;  2CWY A;  1YKE B;  4QXB B;  1YW0 A;  2L3L A;  3J7Y q;  5A1L A;  1MIV A;  1G73 A;  5JDN A;  2X66 A;  2PG8 A;  3FBZ A;  5CA1 E;  3C4Z A;  5HXH A;  3QUJ A;  1WYB A;  2W61 A;  3I1A A;  4TX5 A;  2WBL A;  4OHF A;  5HAX A;  5LP6 E;  2XAF B;  5F8P A;  3ZPO A;  2NWB A;  2DWG A;  2VKO A;  3SRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...