1O3XA

Crystal structure of human gga1 gat domain
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
112
structure length
112
Chain Sequence
AANKLIKEMVQEDQKRMEKISKRVNAIEEVNNNVKLLTEMVMSHSQGGAAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQANDNLTQVINLYKQLVRGEEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Mechanism of Membrane Recruitment of Gga by Arf in Lysosomal Protein Transport
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords ADP-ribosylation factor binding protein GGA1
total genus 41
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2003-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03127 GAT GAT domain
A PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1o3xA00
1WRDA 1YD8G 1WR6A 1NWMX 2N2NA 1OXZA 1NAFA 1X79A 2N9DA 1O3XA
chains in the Genus database with same CATH superfamily
1HNZT 1LVFA 3KDSE 2FJDA 2W2UA 4MALA 2LRLA 3BQIA 1HNXT 2WMOA 4JI7T 3LK2B 1HTJF 3QNUA 2BS4A 3FZFB 3RI5A 2BG9B 5FXVA 4HWFA 3P8CD 3ZC0A 1QLBA 3IA3A 2B76A 2KWIB 3N9OA 4HWHA 5HCMA 2EHOA 5LBMA 3ZCJA 4AQGA 5JQGE 1S94A 4H9QC 5LNKA 4OHFA 4ZEYA 4TNWA 1UX4A 3PUQA 5L47A 4CN4A 1SUMB 3LBXB 1FMWA 4PAGA 2K3WA 3OJAA 2BKNA 4IIJE 1X9BA 2JPFA 3O1HA 5HEGA 3ZPOA 4DMWA 3L8RA 4EZHA 5LG4A 5L4HA 5LGTB 2YU1A 2J47A 2AXDS 4LFCT 2MBGA 3VKHA 3AE9A 2XQ3A 2YINA 2CWYA 1O3XA 3UFGA 4QH5A 3AVRA 3BQKA 3RYIE 2A72A 2D5UA 2MAWA 1J5WA 3MXZA 3UTKA 5L4EA 1U5PA 2BKPA 3DP7A 2K48A 1SE7A 2VVSA 2NP9A 1Y64B 4DV1T 2JMKA 4I0UA 3CVRA 4IDQA 4KMCA 4TN7B 4PK6A 5FNVE 2VKOA 2X0HA 3SRZA 2E8IA 2LT3A 2A2FX 3KVAA 4HFBA 3ZYKA 3PJAA 3LFMA 2I59A 3DTOA 3JAEA 4P0AA 2F4VT 4WNKA 4DUYT 1LRZA 2V5DA 3E22E 1D1AA 1ZOYA 4QXBB 5AQUB 3UULA 1MMGA 2CHOA 4QH1A 4CN6A 4WBNE 4YSZA 3RC8A 1MMNA 3O1IA 4HE8A 5AQQB 5CJ5A 4ILCA 1W0AA 3R6NA 2CXFA 2BVLA 4A5XA 4CI2B 3C4ZA 1U4QA 2VVNA 2X51A 5HXHA 2ODUA 5ABFB 3RYFE 3UU4A 5J0ZA 3FZMB 5JDLA 1YKEB 3N2KE 4QXCB 1G73A 1Z8UA 3LK42 3RLFF 2SPCA 4C90A 2NW9A 2H3RA 5JDHA 3UQ7A 4EGWA 1WR6A 2XQ4A 3B5MA 3CPZA 2C0SA 2RA1A 5LBQB 2IAKA 2CEAA 3A7MA 4OYJA 2QRXA 2XPKA 4IDZA 3AE7A 3EABA 3P4PA 5C2TA 1OEDE 4DMVA 5HEJA 1HFAA 3WI3A 4X64T 4NXNT 3NZPA 2BS2A 2X0LB 2P9BA 3CQXC 5EK3A 2V8SV 4AKGA 1T98A 3CIRA 3N9LA 2V5CA 4O4IE 5FXXA 5J1GA 5L2LA 2L8KA 4HTEA 4IREA 4TV8E 4ZI2C 4B3ST 5IYZE 4X62T 3FZKB 1S35A 1AJ3A 2LLYA 1QSDA 4JI2T 3UU3A 3I0OA 4DR7T 1HR0T 4P1NA 5LYJE 2W62A 5LOVE 4HFVA 3HR0A 3KFWX 5DJQC 5HWXA 2Y48B 5AQJB 2UUBT 3V5UA 4ZZBA 3ONLC 2GK9A 5FP3A 1ZKEA 3RH3A 2LOSA 4DV4T 5J2UE 3A8YC 4KHZF 4AQYT 5IWAT 1KF6A 1T7SA 1VCSA 4TZ4C 5HYAA 2XY8B 1YKHB 2XQ8A 3PUZF 2KMFA 2NWBA 3QOFA 4XZCA 4AKIA 3JADA 2EHOB 4ADZA 2DWKA 3OYZA 1KNRA 5AQVB 1WRDA 4HGAA 2JQHA 1KK7A 4P0BA 4DNDA 3RRCA 1J5ET 3ZJ1A 2W00A 4UV9B 3AEAA 3EAMA 1XWMA 3KBUA 2Q9QA 3Q5WA 2KXPB 1WYCA 3L09A 4ZS2A 4UF0B 5ETWA 5ABEA 5JREA 1X79A 3AA7B 3FXEB 3GMIA 3ZMUB 4M1PA 4ZI2D 4GKKT 1HS7A 2BKOA 2YDRA 4KUMB 3AVSA 1QUUA 3A5XA 3HI2A 1NWMX 2WM9A 2Q9QC 3D0TA 3LSVA 3LG7A 4GYSA 4PNIA 4YJ3E 3RHWA 3T1HT 1N33T 2E5VA 4AISA 4PJJA 1B7TA 1M62A 3FB2A 2LOPA 2CXLA 2X66A 4UF0A 4HFHA 4EB6E 2LM9A 1G8XA 2IHR1 3ZKRA 3RF1A 3WAJA 5LGUB 2CE7A 5AQIB 4U2ZA 2X9HA 3R84B 1XZYA 4ISSA 4U72A 5LG3A 1XMQT 4PW8A 3AECA 3PUAA 2FJBA 2XAFB 3HKDE 5FVKA 4YT0A 3MA9A 2NTXA 3Q2MA 2XZEA 1US7B 1IZNB 2W66A 3I9YA 3V5SA 4C91A 1IBKT 4WW0A 2D9DA 1IJ6A 3KBTA 3NRXA 3UU6A 1D1CA 5AQRB 5JR9A 2HPJA 1MIVA 1SHZC 3IF8B 2JQKA 2PG8A 3EHZA 2XJ7A 3HL6A 3UFEA 4O4LE 2UXDT 2VASA 4PK4A 5HAXA 4EYUA 2CMRA 2C5KT 3J7Yq 4KI0F 2WBLA 3JCFA 4DR1T 4YLHA 5JRCA 2CA5A 1D0XA 3OBVE 3PJAJ 3S4UA 2IUBA 5FY1A 3ZT6A 5AFUL 5JR9B 5LB7B 3UT5E 2XAHB 3VHLA 4EV6A 2N2NA 2LKGA 1XNQT 4AQFC 5FMNA 3K3QC 4X5TA 3HKBE 2I0MA 3WAKA 3ZMVB 5LMNT 4V1Av 3P7IA 3O9XA 3N2OA 4HFEA 4H9RC 1E7PA 1ZHCA 2XQ9A 3MKDA 4FJOA 2LHRA 3PUWF 4IHJE 3RYHE 2IIUA 5KMGP 1N36T 3O1JA 3ABVA 2YKSA 2V26A 4ZS3A 5IUXA 4WBOA 5LJMA 5CB4E 1CUNA 3TLVA 3ZN0B 5J2TE 4TWHA 3K3NA 4B3TT 5DQWA 4KBMB 3ZEFB 2Y6XA 4K0KT 3K3OA 5JDGA 3ZN1B 4CQIA 5CGMA 3QK6A 1XNRT 4KHPT 3VRAA 4DR3T 4YTPA 2WWUA 4JI1T 4DR4T 2VB6A 3BK9A 4H9OC 1VCTA 2HN2A 2LSYA 3KINB 1R8IA 2K24A 3N5LA 1LKXA 4QH4A 2N1GA 3OVUA 3ANWB 2E9XC 4HWIB 1W9RA 1D0YA 4GOUA 4UIGA 3UU5A 5AQFB 2WS3A 2UXXB 4YTMA 3QC9A 5A1LA 4CI1B 3IHRA 3PDYA 3L3PA 5F8PA 3ZLIA 5JH7E 2HHHT 4WZXA 1Y01A 2H7VC 3H3AA 3ZJ2A 5LMUT 1BR0A 2Z6EA 3B13A 1HG5A 3ZT5A 3G06A 4EYYR 3F31A 2QA7A 4HWCA 3W15B 4E7ZA 2C5IT 5E0OA 2VKJA 5JDNA 4U74A 2ZM8A 3T8OA 4DV2T 2X0YA 4AKRB 4H9SE 4F6RC 3RIFA 4AKLA 3ZCIA 3Q5XA 3VR9A 2X67A 2L9QA 4CN1A 4GKJT 1MMAA 2DWGA 2MTQA 4CXWA 1NENA 2QGSA 3H3MA 2WDVA 3ZT7A 3NWIA 5CA0E 1N34T 4ERRA 4YSYA 4N78D 5FVLA 2CRBA 5HEHA 5JVDE 3AEDA 4QWNB 3I1AA 4TNVA 2CPTA 2W63A 2C5JA 2PFVA 4MBQA 1YQ4A 2UU9T 2EHOC 3GA8A 3CX7B 2JRKA 3PUXF 2BBHA 4HEAA 1SA0E 4O2AE 3AXJA 3LK3B 5L3FB 1T8BA 1WFDA 2UXNB 2JQQA 1Z0PA 1VOMA 2XHEB 1YXRA 3Q5DA 2V7JA 2V6XA 2YU2A 1KFYA 1UURA 2HH7A 4LF7T 1OWAA 3RQUA 3AE1A 1MNDA 2R6GF 4GIWA 3CQGB 2PJQA 4X20E 3F2EA 2BBJA 1J1JA 2W61A 1W0BA 3CX6B 5AQKB 1L0VA 4ISTA 3P4QA 4TUYE 4EIWA 4ZI3D 4YHJA 4I43B 4IL9A 2VL8A 4U7IA 2CLYC 2EHOD 2XSAA 3CMLA 2IDOB 4IDPA 1OXZA 1E1HB 2VKDA 2BG9C 3AB3B 3ETVA 5F5WA 3RPUA 3ONJA 3L39A 2WU5A 4ILUA 5HXCA 3PU3A 4BAYB 1IBMT 2QVAA 2XQ5A 5KXJA 4U33A 1UGOA 2X9YA 3BQLA 3RKGA 4G63A 1GQEA 2CXDA 4JI8T 4EEBA 5ABGA 4LFBT 3C64A 4YSXA 5FL1A 3EVYA 3O4XE 5LXTE 1HG2A 3PUGA 5FL0A 3C98B 2LHNA 2VWAA 2XUEA 4HN9A 4ILAA 5HWYA 3RQWA 3JC6C 4LF8T 4JV5T 3PTRB 3AE4A 4H63H 1BR2A 2LJLA 1N32T 3SFDA 4L0RA 4QKNA 3UUNA 5LHIB 4H9PC 3AA1B 4QXHB 3EDUA 4X1IE 3AEGA 3OKQA 5AQLB 3AA0B 4DIDB 3CKDA 1M7KA 3TKLB 4IGUA 2IMLA 1HX8A 4DBRA 1OEDA 2ODVA 2XAGB 3ONXA 4IE4A 5EZYE 2RPAA 3MK7C 3SS1A 1XMOT 2JQ9A 4EXTA 3UUMA 2UXBT 5CA1E 4J2CA 2D2SA 2LM2A 1D1BA 3N9NA 4TX5A 4PJMA 3KVBA 5DQVA 2H7OA 3CQCB 3P4WA 2CWOA 3I0QA 5L3BB 1NEKA 4I50E 4K0UA 4UVBB 1MMDA 3LDQB 3C4XA 3FZLB 5H6QB 3FXDB 4JYAT 3VKGA 4HFDA 2ZM0A 1LVKA 2N9DA 3ETUA 3FHNA 4UELA 2V7MA 4JEUB 2HN1A 4O4JE 3RC3A 4FI5A 2UUCT 3AXJB 2NTYA 3K8PC 2LKHA 4HFIA 4EAHA 2JIWA 2OLTA 2WSSV 4JEHB 4JUYA 4KX6A 4JBWF 3RX6A 3PU8A 5GONE 4EZ4A 4DUZT 4NXMT 3P4SA 1T72A 4U31A 1YQ3A 4E7SA 2NW8A 5LHHB 3KV5A 1KEYA 1V9DA 2CBJA 4HKAA 2BVMA 5HEUA 4L9IA 4DO0A 4Q25A 3UU8A 1XDPA 2XQ6A 3GN5B 4LF6T 3RIAA 2IC6A 4TWDA 4LMLA 2H89A 4XAXB 1H7CA 5ABFA 2OV9A 4NUUA 4DV5T 1BR4A 4OX9T 3AAAB 4PFOA 4DV0T 2YDSA 2ZM2A 3SOLA 3AE3A 3FZHB 4G2AA 4BJNA 1HCIA 3SWHA 4DV6T 4MHCA 4I4TE 4ASKA 4ZOLE 1KNZA 4Z91A 4ANJA 1WYBA 4DVDA 4GK5E 4LMKA 5C8YE 3PV0F 4A97A 1UUSA 1FEWA 1HX1B 2V1DB 4JI5T 5HXSA 3OPCA 3AE2A 4B6XA 3HKEE 4COFA 3NVOA 4CXXA 2AE9A 3JAFA 3E08A 3NBXX 2XQAA 4IT4A 3RIUC 4X65T 2WDQA 1ZEEA 3RKOA 4JI4T 2E5LT 4LMJA 4UVCB 4MLKA 3CWZB 3M3ZB 1UK5A 4PFPA 5FXZA 4TV9E 4PK5A 3EI0A 2NR4A 5JTGA 2M6BA 3KV6A 3RRWA 2YEVC 3CX8B 4P09A 2JJ9A 3F57A 2L3LA 5LJNA 2BZBA 3RGLA 4A56A 4NPPA 5FKYA 4IE6A 3TLUA 2I6HA 2WDRA 4DBQA 5ADXL 3U78A 4AKHA 4HFCA 2E9XA 3AE6A 2DHRA 2G0UA 2WU2A 5H6RB 3CK6A 4YTNA 2E2AA 1D0ZA 2OA5A 3TLTA 2PTFA 2BG9E 3ANWA 4QX8B 4H9NC 4U2YA 3TLSA 3PURA 3HKCE 4O2BE 4JI6T 5JRCB 5C3JA 2XAQB 3GWHA 3AAEB 5KX5E 1I94T 3N2GE 4X1YE 3PUSA 3SFEA 1UCUA 1OEDB 2CBIA 5LGNB 4OK0A 3N9PA 2ACXA 1YW0A 2MYSA 2VKHA 3EDVA 4WYVA 3AAIA 4BA9A 3E0ZA 2K5BB 4DR2T 4LF9T 1HNWT 3ZSTA 1MIYA 3PUYF 2VQET 2KWHA 5L3DB 2YDQA 1MNEA 1VRBA 2WCAA 4TWFA 5JDMA 2FBWA 3I9WA 2IW5B 3LBXA 2ES0A 5ABHA 4QHOA 1MIWA 2V7LA 2WQYA 1I6ZA 1BR1A 4H63V 4OFZA 2LSIA 2V7IA 2YOEA 3KV4A 3C4WA 4AIUA 4JLEA 5KDMC 2ZMAA 3FBLA 4O8SA 1FIOA 2FUPA 4IDNA 2X68A 5AQOB 3IBPA 3ZMSB 1WCRA 2FJAA 3JC6D 3DJBA 5JDQA 2LEHA 2KINB 2VURA 2A9UA 2J1DG 3P50A 2KNDA 1E2AA 2LSJA 3RIUA 5L3CB 3VRBA 5LA6E 4NUVA 4O4HE 5HCJA 3N9MA 2DNXA 2WZHA 3ESLA 5EK4A 4Z90A 4CI3B 5JR9C 2VQFT 2CCQA 2KSRA 4ILBA 3PUVF 4X1KE 2MOZA 4YY3T 3MJXA 4OYKA 3RYCE 2KLQA 5HEOA 4ZI3C 4B3MT 4AXPA 2W4XA 1IJ5A 2D0TA 2VL0A 2DLRA 4U7YA 4ZXLA 5HXRA 2A3DA 3ZMZB 5M4YA 3VR8A 3HA4A 1IAPA 2H88A 1CHUA 4L5GA 2K9AA 2WWVA 4HWDA 2M6IA 4ZI7E 3ZC1A 4IL4A 2W67A 4DR6T 3AA6B 2V6YA 3ZYMA 2LE8A 4LFAT 4AI6A 4EEDA 5EK2A 2XM2A 2WAUA 2RP4A 1W09A 2WY2A 2XM1A 3PE0A 4IE7A 4KP3C 4GK0E 5AQMB 5AQNB 2XQ7A 5HXEA 2UXCT 2LSGA 2JMHA 3IEEA 4UR9A 5AQHB 5AQPB 3C51A 4UEMA 2FJEA 2XASB 2UUAT 1DU2A 2NOXA 3AE8A 3AE5A 3AEBA 1XDOA 3KV9A 5AQGB 3ZSSA 1WLXA 2J4GA 2Q9QB 3GN5A 2CLYB 3ZYLA 3N9QA 4UV8B 4ZZCA 1IBLT 2MPKA 4UXNB 4B3RT 2W0GA 2WZIA 2YK0A 4Z8XA 4IE0A 1UX5A 3LJCA 4IDOA 3MZKB 1FMVA 1HF8A 5AQSB 1ZP0A 2D0UA 1YD8G 2E9XB 2IC9A 2V7KA 4YFSA 4EOZB 5L3EB 1EZ3A 1JNRA 5FXWA 5LCYA 3X1DA 3T1YT 1NAFA 4JI0T 2Q9QD 4DR5T 4YXDA 5IHYA 3TLWA 3UUXB 2CM0A 2WP9A 3NKZA 2J62A 2XAJB 2XTLA 4AQFA 2B1EA 4CZZB 3FBZA 2LRKA 2WB5A 1OEDC 4NIQA 3NRYA 2KT9A 5FY7A 2YN6A 4ZHQE 3H37A 2M67A 2KZ7B 4MFRA 1FJGT 3C50A 3AEFA 3QB5A 5BMVE 2E9XD 4X66T 2VK9A 3Q9DA 5JDFA 1WR0A 4XBFB 2ZLYA 3M65A 3EUHA 2V6YB 4PJLA 1ZV4X 4BJMA 5BR8T 3UQ4A 3VU7H 3OYXA 4CXYA 5FY0A 4PJNA 1JNZA 3K1SA 4U3CA 4IE5A 5CFBA 2Y8DA 2X9WA 2BS3A 2WMNA 3QUJA 4A98A 3J9X1 4YHHT 5DABA 5TAOA 5LHGB 2HPLA 2DCFA 2BDEA 4YJ2E 1KNPA 4DV7T 2DI4A 2BG9A 5AQTB 4F8HA 2PBIA 2CHNA 2LSKA 2XQYA 4UVAB 5FYMA 4LF4T 3Q5EA 4JI3T 3QB5K 4QX7B 2XSBA 3ZMTB 2NW7A 5L3GB 4GYRA 3U3IA 5LP6E 2X9XA 3AEEA 3NZQA 3MACA 3UUBA 5F3JA 2ZM6T 4DV3T 3OTOT 3B57A 4LF5T 4I55E 2ACZA 3P4RA 2DL1A 2QYWA
chains in the Genus database with same CATH topology
1LVFA 3KDSE 4MALA 3BQIA 2WMOA 3LK2B 1HTJF 3ZC0A 5FXVA 3P8CD 3N9OA 2KWIB 4AQGA 5LBMA 5JQGE 2EHOA 3ZCJA 5LNKA 1S94A 4H9QC 4OHFA 1UX4A 3PUQA 3LBXB 1FMWA 4PAGA 3OJAA 4IIJE 3ZPOA 2JPFA 4EZHA 3O1HA 5LG4A 4DMWA 5LGTB 2YU1A 2MBGA 3VKHA 2YINA 2CWYA 1O3XA 4P0AA 3AVRA 3BQKA 3RYIE 2A72A 2D5UA 3MXZA 3UTKA 1U5PA 3DP7A 2K48A 2NP9A 1Y64B 2JMKA 3CVRA 4KMCA 4TN7B 5FNVE 4PK6A 3SRZA 2VKOA 2E8IA 2LT3A 2A2FX 3KVAA 3ZYKA 3LFMA 2I59A 3DTOA 4WNKA 1LRZA 3E22E 1D1AA 4QXBB 5HYAA 3UULA 4WBNE 1MMGA 3RC8A 1MMNA 3O1IA 4HE8A 3R6NA 2CXFA 2BVLA 4CI2B 3C4ZA 1U4QA 2X51A 5HXHA 2ODUA 3RYFE 5JDLA 1YKEB 3N2KE 4QXCB 1G73A 3LK42 4C90A 2SPCA 2NW9A 2H3RA 5JDHA 1WR6A 3CPZA 2C0SA 2RA1A 5LBQB 2IAKA 2CEAA 4OYJA 4IDZA 4DMVA 1HFAA 3WI3A 3NZPA 2X0LB 2P9BA 3CQXC 5EK3A 4AKGA 1T98A 3N9LA 4O4IE 5J1GA 5FXXA 5L2LA 4AKIA 2L8KA 4HTEA 4TV8E 4ZI2C 5IYZE 1S35A 1AJ3A 1QSDA 3I0OA 5LYJE 2W62A 5LOVE 4HFVA 3HR0A 3KFWX 5DJQC 5HWXA 2Y48B 3V5UA 2GK9A 5FP3A 1ZKEA 3RH3A 2LOSA 5J2UE 4TZ4C 1YKHB 2KMFA 2NWBA 4XZCA 2EHOB 4ADZA 2DWKA 3OYZA 1WRDA 4HGAA 4DNDA 1KK7A 4P0BA 3RRCA 3ZJ1A 2W00A 4UV9B 3KBUA 4ZS2A 2Q9QA 3Q5WA 2KXPB 1WYCA 3L09A 4UF0B 5ETWA 5JREA 1X79A 3AA7B 3FXEB 3GMIA 3ZMUB 4M1PA 4ZI2D 4KUMB 3AVSA 1QUUA 3A5XA 3HI2A 1NWMX 2WM9A 2Q9QC 3D0TA 4GYSA 3LG7A 4PNIA 4YJ3E 4PJJA 1B7TA 3FB2A 2LOPA 2CXLA 2X66A 4UF0A 4EB6E 2LM9A 1G8XA 3WAJA 5LGUB 2CE7A 2X9HA 3R84B 4ISSA 4U72A 4PW8A 3PUAA 2XAFB 3HKDE 3MA9A 2NTXA 3Q2MA 4C91A 1US7B 1IZNB 3I9YA 3V5SA 4WW0A 1IJ6A 3KBTA 3NRXA 1D1CA 5JR9A 2HPJA 1MIVA 1SHZC 3IF8B 2PG8A 3UFEA 3HL6A 4O4LE 2VASA 4PK4A 5HAXA 4EYUA 2CMRA 2C5KT 3J7Yq 2WBLA 4YLHA 5JRCA 2CA5A 1D0XA 3OBVE 5JR9B 3S4UA 5AFUL 5FY1A 3UT5E 2XAHB 3VHLA 2N2NA 4AQFC 5FMNA 3K3QC 3HKBE 3WAKA 3ZMVB 4V1Av 3P7IA 3O9XA 3N2OA 4H9RC 1ZHCA 3MKDA 3RYHE 4FJOA 2LHRA 4IHJE 5KMGP 3O1JA 2V26A 4ZS3A 4WBOA 5CB4E 1CUNA 3ZN0B 5J2TE 5DQWA 4KBMB 3ZEFB 2Y6XA 3K3OA 5JDGA 3ZN1B 4CQIA 3QK6A 2WWUA 2VB6A 3BK9A 4H9OC 2LSYA 3KINB 2K24A 3N5LA 1LKXA 2N1GA 3ANWB 2E9XC 4GOUA 1D0YA 4UIGA 2UXXB 5A1LA 3QC9A 4CI1B 3IHRA 3PDYA 3L3PA 5F8PA 3ZLIA 5JH7E 2H7VC 3H3AA 3ZJ2A 1BR0A 2Z6EA 3B13A 1HG5A 4EYYR 3F31A 2QA7A 3W15B 4E7ZA 2C5IT 5E0OA 2VKJA 5JDNA 4U74A 2ZM8A 3T8OA 4AKRB 4H9SE 4F6RC 4AKLA 3ZCIA 3Q5XA 2X67A 2L9QA 1MMAA 2DWGA 2MTQA 4CXWA 2QGSA 5CA0E 4ERRA 4N78D 5JVDE 4QWNB 3I1AA 2W63A 2C5JA 2PFVA 4MBQA 2EHOC 3GA8A 3CX7B 2JRKA 4HEAA 1SA0E 4O2AE 3LK3B 5L3FB 2JQQA 2UXNB 1Z0PA 1VOMA 2XHEB 2V7JA 2YU2A 2HH7A 1OWAA 1MNDA 4GIWA 3CQGB 2PJQA 4X20E 3F2EA 2W61A 3CX6B 4ISTA 4ZI3D 4TUYE 4EIWA 4YHJA 4I43B 2VL8A 2CLYC 2EHOD 1HS7A 3CMLA 1OXZA 1E1HB 3ETVA 2VKDA 3AB3B 3RPUA 4ILUA 5HXCA 3PU3A 4BAYB 2X9YA 3BQLA 4G63A 2CXDA 3C64A 3EVYA 3O4XE 5LXTE 1HG2A 3PUGA 3C98B 2LHNA 2VWAA 2XUEA 4HN9A 5HWYA 3JC6C 3PTRB 4H63H 1BR2A 2LJLA 4L0RA 4QKNA 3UUNA 5LHIB 4H9PC 3AA1B 4QXHB 3EDUA 4X1IE 3OKQA 3AA0B 3CKDA 3TKLB 4IGUA 4DBRA 1HX8A 2ODVA 2XAGB 3ONXA 4IE4A 5EZYE 3SS1A 3MK7C 4EXTA 3UUMA 5CA1E 4J2CA 2D2SA 3N9NA 1D1BA 4TX5A 4PJMA 3KVBA 5DQVA 2H7OA 3CQCB 2CWOA 3I0QA 5L3BB 4I50E 5H6QB 4K0UA 4UVBB 1MMDA 3VKGA 3C4XA 3FXDB 2ZM0A 1LVKA 2N9DA 3ETUA 3FHNA 4UELA 2V7MA 4JEUB 4O4JE 3RC3A 4FI5A 2NTYA 3K8PC 4EAHA 4JUYA 4JEHB 2WSSV 3RX6A 4EZ4A 3PU8A 5GONE 4E7SA 2NW8A 5LHHB 3KV5A 1V9DA 4HKAA 2BVMA 4DO0A 4L9IA 3GN5B 2IC6A 4XAXB 1H7CA 4NUUA 1BR4A 3AAAB 4PFOA 2ZM2A 3SOLA 4BJNA 4G2AA 1HCIA 3SWHA 4MHCA 4I4TE 4ASKA 4ZOLE 1KNZA 4DVDA 4ANJA 1WYBA 4GK5E 5C8YE 1FEWA 2V1DB 5HXSA 4B6XA 3HKEE 4CXXA 3NBXX 3E08A 1ZEEA 3RKOA 4UVCB 4MLKA 3CWZB 4PFPA 5FXZA 4TV9E 4PK5A 3RRWA 3KV6A 2YEVC 3CX8B 4P09A 2JJ9A 3F57A 2L3LA 5LJNA 2BZBA 4A56A 5LJMA 4AKHA 4IE6A 4DBQA 5ADXL 3U78A 2E9XA 2DHRA 2G0UA 5H6RB 1D0ZA 2OA5A 3ANWA 4QX8B 4H9NC 3PURA 3HKCE 4O2BE 5JRCB 2XAQB 3GWHA 3AAEB 5KX5E 3N2GE 4X1YE 3PUSA 1UCUA 5LGNB 4OK0A 3N9PA 2ACXA 1YW0A 2MYSA 2VKHA 3EDVA 4BA9A 3AAIA 3E0ZA 2K5BB 1MIYA 2KWHA 5L3DB 1MNEA 1VRBA 5JDMA 3I9WA 2IW5B 3LBXA 2ES0A 4QHOA 1MIWA 2V7LA 1BR1A 4H63V 4OFZA 2LSIA 2V7IA 3KV4A 3C4WA 4JLEA 5KDMC 2ZMAA 3FBLA 4O8SA 1FIOA 3ZMSB 2X68A 3IBPA 3JC6D 3DJBA 5JDQA 2LEHA 2KINB 2J1DG 2KNDA 2LSJA 5L3CB 5LA6E 4NUVA 4O4HE 3N9MA 2DNXA 3ESLA 5EK4A 5JR9C 4CI3B 2CCQA 4X1KE 2MOZA 3MJXA 4OYKA 3RYCE 2KLQA 4ZI3C 4AXPA 1IJ5A 2D0TA 2DLRA 5HXRA 2A3DA 3ZMZB 5M4YA 3HA4A 1IAPA 4L5GA 4ZI7E 2K9AA 3ZC1A 3AA6B 3ZYMA 2LE8A 4AI6A 5EK2A 2WAUA 2RP4A 4IE7A 5HXEA 3PE0A 4KP3C 4GK0E 2LSGA 2JMHA 3IEEA 3C51A 4UEMA 2XASB 2NOXA 3KV9A 1WLXA 2Q9QB 3GN5A 3ZYLA 2CLYB 3N9QA 4UV8B 4UXNB 2W0GA 2YK0A 4Z8XA 4IE0A 1UX5A 3LJCA 3MZKB 1FMVA 1HF8A 2E9XB 2D0UA 1YD8G 2IC9A 2V7KA 4YFSA 4EOZB 5L3EB 1EZ3A 5FXWA 5LCYA 1NAFA 2Q9QD 5IHYA 3UUXB 2CM0A 2XAJB 2XTLA 4AQFA 2B1EA 4CZZB 3FBZA 3NRYA 2KT9A 5FY7A 4ZHQE 3H37A 2M67A 2KZ7B 4MFRA 3C50A 5BMVE 2E9XD 4XBFB 2VK9A 3Q9DA 5JDFA 2ZLYA 3M65A 3EUHA 4PJLA 1ZV4X 4BJMA 3VU7H 3OYXA 4CXYA 5FY0A 4PJNA 4IE5A 2Y8DA 2X9WA 2WMNA 3QUJA 3J9X1 5DABA 5TAOA 5LHGB 2HPLA 2DCFA 2BDEA 4YJ2E 2DI4A 2PBIA 2LSKA 2XQYA 4UVAB 5FYMA 4QX7B 3ZMTB 2NW7A 5L3GB 4GYRA 3U3IA 5LP6E 2X9XA 3NZQA 3MACA 5F3JA 3B57A 4I55E 3K3NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRD A;  1YD8 G;  1WR6 A;  1NWM X;  2N2N A;  1OXZ A;  1NAF A;  1X79 A;  2N9D A;  1O3X A; 
#chains in the Genus database with same CATH topology
 1HNZ T;  1LVF A;  3KDS E;  2FJD A;  2W2U A;  4MAL A;  2LRL A;  3BQI A;  1HNX T;  2WMO A;  4JI7 T;  3LK2 B;  1HTJ F;  3QNU A;  2BS4 A;  3FZF B;  3RI5 A;  2BG9 B;  5FXV A;  4HWF A;  3P8C D;  3ZC0 A;  1QLB A;  3IA3 A;  2B76 A;  2KWI B;  3N9O A;  4HWH A;  5HCM A;  2EHO A;  5LBM A;  3ZCJ A;  4AQG A;  5JQG E;  1S94 A;  4H9Q C;  5LNK A;  4OHF A;  4ZEY A;  4TNW A;  1UX4 A;  3PUQ A;  5L47 A;  4CN4 A;  1SUM B;  3LBX B;  1FMW A;  4PAG A;  2K3W A;  3OJA A;  2BKN A;  4IIJ E;  1X9B A;  2JPF A;  3O1H A;  5HEG A;  3ZPO A;  4DMW A;  3L8R A;  4EZH A;  5LG4 A;  5L4H A;  5LGT B;  2YU1 A;  2J47 A;  2AXD S;  4LFC T;  2MBG A;  3VKH A;  3AE9 A;  2XQ3 A;  2YIN A;  2CWY A;  1O3X A;  3UFG A;  4QH5 A;  3AVR A;  3BQK A;  3RYI E;  2A72 A;  2D5U A;  2MAW A;  1J5W A;  3MXZ A;  3UTK A;  5L4E A;  1U5P A;  2BKP A;  3DP7 A;  2K48 A;  1SE7 A;  2VVS A;  2NP9 A;  1Y64 B;  4DV1 T;  2JMK A;  4I0U A;  3CVR A;  4IDQ A;  4KMC A;  4TN7 B;  4PK6 A;  5FNV E;  2VKO A;  2X0H A;  3SRZ A;  2E8I A;  2LT3 A;  2A2F X;  3KVA A;  4HFB A;  3ZYK A;  3PJA A;  3LFM A;  2I59 A;  3DTO A;  3JAE A;  4P0A A;  2F4V T;  4WNK A;  4DUY T;  1LRZ A;  2V5D A;  3E22 E;  1D1A A;  1ZOY A;  4QXB B;  5AQU B;  3UUL A;  1MMG A;  2CHO A;  4QH1 A;  4CN6 A;  4WBN E;  4YSZ A;  3RC8 A;  1MMN A;  3O1I A;  4HE8 A;  5AQQ B;  5CJ5 A;  4ILC A;  1W0A A;  3R6N A;  2CXF A;  2BVL A;  4A5X A;  4CI2 B;  3C4Z A;  1U4Q A;  2VVN A;  2X51 A;  5HXH A;  2ODU A;  5ABF B;  3RYF E;  3UU4 A;  5J0Z A;  3FZM B;  5JDL A;  1YKE B;  3N2K E;  4QXC B;  1G73 A;  1Z8U A;  3LK4 2;  3RLF F;  2SPC A;  4C90 A;  2NW9 A;  2H3R A;  5JDH A;  3UQ7 A;  4EGW A;  1WR6 A;  2XQ4 A;  3B5M A;  3CPZ A;  2C0S A;  2RA1 A;  5LBQ B;  2IAK A;  2CEA A;  3A7M A;  4OYJ A;  2QRX A;  2XPK A;  4IDZ A;  3AE7 A;  3EAB A;  3P4P A;  5C2T A;  1OED E;  4DMV A;  5HEJ A;  1HFA A;  3WI3 A;  4X64 T;  4NXN T;  3NZP A;  2BS2 A;  2X0L B;  2P9B A;  3CQX C;  5EK3 A;  2V8S V;  4AKG A;  1T98 A;  3CIR A;  3N9L A;  2V5C A;  4O4I E;  5FXX A;  5J1G A;  5L2L A;  2L8K A;  4HTE A;  4IRE A;  4TV8 E;  4ZI2 C;  4B3S T;  5IYZ E;  4X62 T;  3FZK B;  1S35 A;  1AJ3 A;  2LLY A;  1QSD A;  4JI2 T;  3UU3 A;  3I0O A;  4DR7 T;  1HR0 T;  4P1N A;  5LYJ E;  2W62 A;  5LOV E;  4HFV A;  3HR0 A;  3KFW X;  5DJQ C;  5HWX A;  2Y48 B;  5AQJ B;  2UUB T;  3V5U A;  4ZZB A;  3ONL C;  2GK9 A;  5FP3 A;  1ZKE A;  3RH3 A;  2LOS A;  4DV4 T;  5J2U E;  3A8Y C;  4KHZ F;  4AQY T;  5IWA T;  1KF6 A;  1T7S A;  1VCS A;  4TZ4 C;  5HYA A;  2XY8 B;  1YKH B;  2XQ8 A;  3PUZ F;  2KMF A;  2NWB A;  3QOF A;  4XZC A;  4AKI A;  3JAD A;  2EHO B;  4ADZ A;  2DWK A;  3OYZ A;  1KNR A;  5AQV B;  1WRD A;  4HGA A;  2JQH A;  1KK7 A;  4P0B A;  4DND A;  3RRC A;  1J5E T;  3ZJ1 A;  2W00 A;  4UV9 B;  3AEA A;  3EAM A;  1XWM A;  3KBU A;  2Q9Q A;  3Q5W A;  2KXP B;  1WYC A;  3L09 A;  4ZS2 A;  4UF0 B;  5ETW A;  5ABE A;  5JRE A;  1X79 A;  3AA7 B;  3FXE B;  3GMI A;  3ZMU B;  4M1P A;  4ZI2 D;  4GKK T;  1HS7 A;  2BKO A;  2YDR A;  4KUM B;  3AVS A;  1QUU A;  3A5X A;  3HI2 A;  1NWM X;  2WM9 A;  2Q9Q C;  3D0T A;  3LSV A;  3LG7 A;  4GYS A;  4PNI A;  4YJ3 E;  3RHW A;  3T1H T;  1N33 T;  2E5V A;  4AIS A;  4PJJ A;  1B7T A;  1M62 A;  3FB2 A;  2LOP A;  2CXL A;  2X66 A;  4UF0 A;  4HFH A;  4EB6 E;  2LM9 A;  1G8X A;  2IHR 1;  3ZKR A;  3RF1 A;  3WAJ A;  5LGU B;  2CE7 A;  5AQI B;  4U2Z A;  2X9H A;  3R84 B;  1XZY A;  4ISS A;  4U72 A;  5LG3 A;  1XMQ T;  4PW8 A;  3AEC A;  3PUA A;  2FJB A;  2XAF B;  3HKD E;  5FVK A;  4YT0 A;  3MA9 A;  2NTX A;  3Q2M A;  2XZE A;  1US7 B;  1IZN B;  2W66 A;  3I9Y A;  3V5S A;  4C91 A;  1IBK T;  4WW0 A;  2D9D A;  1IJ6 A;  3KBT A;  3NRX A;  3UU6 A;  1D1C A;  5AQR B;  5JR9 A;  2HPJ A;  1MIV A;  1SHZ C;  3IF8 B;  2JQK A;  2PG8 A;  3EHZ A;  2XJ7 A;  3HL6 A;  3UFE A;  4O4L E;  2UXD T;  2VAS A;  4PK4 A;  5HAX A;  4EYU A;  2CMR A;  2C5K T;  3J7Y q;  4KI0 F;  2WBL A;  3JCF A;  4DR1 T;  4YLH A;  5JRC A;  2CA5 A;  1D0X A;  3OBV E;  3PJA J;  3S4U A;  2IUB A;  5FY1 A;  3ZT6 A;  5AFU L;  5JR9 B;  5LB7 B;  3UT5 E;  2XAH B;  3VHL A;  4EV6 A;  2N2N A;  2LKG A;  1XNQ T;  4AQF C;  5FMN A;  3K3Q C;  4X5T A;  3HKB E;  2I0M A;  3WAK A;  3ZMV B;  5LMN T;  4V1A v;  3P7I A;  3O9X A;  3N2O A;  4HFE A;  4H9R C;  1E7P A;  1ZHC A;  2XQ9 A;  3MKD A;  4FJO A;  2LHR A;  3PUW F;  4IHJ E;  3RYH E;  2IIU A;  5KMG P;  1N36 T;  3O1J A;  3ABV A;  2YKS A;  2V26 A;  4ZS3 A;  5IUX A;  4WBO A;  5LJM A;  5CB4 E;  1CUN A;  3TLV A;  3ZN0 B;  5J2T E;  4TWH A;  3K3N A;  4B3T T;  5DQW A;  4KBM B;  3ZEF B;  2Y6X A;  4K0K T;  3K3O A;  5JDG A;  3ZN1 B;  4CQI A;  5CGM A;  3QK6 A;  1XNR T;  4KHP T;  3VRA A;  4DR3 T;  4YTP A;  2WWU A;  4JI1 T;  4DR4 T;  2VB6 A;  3BK9 A;  4H9O C;  1VCT A;  2HN2 A;  2LSY A;  3KIN B;  1R8I A;  2K24 A;  3N5L A;  1LKX A;  4QH4 A;  2N1G A;  3OVU A;  3ANW B;  2E9X C;  4HWI B;  1W9R A;  1D0Y A;  4GOU A;  4UIG A;  3UU5 A;  5AQF B;  2WS3 A;  2UXX B;  4YTM A;  3QC9 A;  5A1L A;  4CI1 B;  3IHR A;  3PDY A;  3L3P A;  5F8P A;  3ZLI A;  5JH7 E;  2HHH T;  4WZX A;  1Y01 A;  2H7V C;  3H3A A;  3ZJ2 A;  5LMU T;  1BR0 A;  2Z6E A;  3B13 A;  1HG5 A;  3ZT5 A;  3G06 A;  4EYY R;  3F31 A;  2QA7 A;  4HWC A;  3W15 B;  4E7Z A;  2C5I T;  5E0O A;  2VKJ A;  5JDN A;  4U74 A;  2ZM8 A;  3T8O A;  4DV2 T;  2X0Y A;  4AKR B;  4H9S E;  4F6R C;  3RIF A;  4AKL A;  3ZCI A;  3Q5X A;  3VR9 A;  2X67 A;  2L9Q A;  4CN1 A;  4GKJ T;  1MMA A;  2DWG A;  2MTQ A;  4CXW A;  1NEN A;  2QGS A;  3H3M A;  2WDV A;  3ZT7 A;  3NWI A;  5CA0 E;  1N34 T;  4ERR A;  4YSY A;  4N78 D;  5FVL A;  2CRB A;  5HEH A;  5JVD E;  3AED A;  4QWN B;  3I1A A;  4TNV A;  2CPT A;  2W63 A;  2C5J A;  2PFV A;  4MBQ A;  1YQ4 A;  2UU9 T;  2EHO C;  3GA8 A;  3CX7 B;  2JRK A;  3PUX F;  2BBH A;  4HEA A;  1SA0 E;  4O2A E;  3AXJ A;  3LK3 B;  5L3F B;  1T8B A;  1WFD A;  2UXN B;  2JQQ A;  1Z0P A;  1VOM A;  2XHE B;  1YXR A;  3Q5D A;  2V7J A;  2V6X A;  2YU2 A;  1KFY A;  1UUR A;  2HH7 A;  4LF7 T;  1OWA A;  3RQU A;  3AE1 A;  1MND A;  2R6G F;  4GIW A;  3CQG B;  2PJQ A;  4X20 E;  3F2E A;  2BBJ A;  1J1J A;  2W61 A;  1W0B A;  3CX6 B;  5AQK B;  1L0V A;  4IST A;  3P4Q A;  4TUY E;  4EIW A;  4ZI3 D;  4YHJ A;  4I43 B;  4IL9 A;  2VL8 A;  4U7I A;  2CLY C;  2EHO D;  2XSA A;  3CML A;  2IDO B;  4IDP A;  1OXZ A;  1E1H B;  2VKD A;  2BG9 C;  3AB3 B;  3ETV A;  5F5W A;  3RPU A;  3ONJ A;  3L39 A;  2WU5 A;  4ILU A;  5HXC A;  3PU3 A;  4BAY B;  1IBM T;  2QVA A;  2XQ5 A;  5KXJ A;  4U33 A;  1UGO A;  2X9Y A;  3BQL A;  3RKG A;  4G63 A;  1GQE A;  2CXD A;  4JI8 T;  4EEB A;  5ABG A;  4LFB T;  3C64 A;  4YSX A;  5FL1 A;  3EVY A;  3O4X E;  5LXT E;  1HG2 A;  3PUG A;  5FL0 A;  3C98 B;  2LHN A;  2VWA A;  2XUE A;  4HN9 A;  4ILA A;  5HWY A;  3RQW A;  3JC6 C;  4LF8 T;  4JV5 T;  3PTR B;  3AE4 A;  4H63 H;  1BR2 A;  2LJL A;  1N32 T;  3SFD A;  4L0R A;  4QKN A;  3UUN A;  5LHI B;  4H9P C;  3AA1 B;  4QXH B;  3EDU A;  4X1I E;  3AEG A;  3OKQ A;  5AQL B;  3AA0 B;  4DID B;  3CKD A;  1M7K A;  3TKL B;  4IGU A;  2IML A;  1HX8 A;  4DBR A;  1OED A;  2ODV A;  2XAG B;  3ONX A;  4IE4 A;  5EZY E;  2RPA A;  3MK7 C;  3SS1 A;  1XMO T;  2JQ9 A;  4EXT A;  3UUM A;  2UXB T;  5CA1 E;  4J2C A;  2D2S A;  2LM2 A;  1D1B A;  3N9N A;  4TX5 A;  4PJM A;  3KVB A;  5DQV A;  2H7O A;  3CQC B;  3P4W A;  2CWO A;  3I0Q A;  5L3B B;  1NEK A;  4I50 E;  4K0U A;  4UVB B;  1MMD A;  3LDQ B;  3C4X A;  3FZL B;  5H6Q B;  3FXD B;  4JYA T;  3VKG A;  4HFD A;  2ZM0 A;  1LVK A;  2N9D A;  3ETU A;  3FHN A;  4UEL A;  2V7M A;  4JEU B;  2HN1 A;  4O4J E;  3RC3 A;  4FI5 A;  2UUC T;  3AXJ B;  2NTY A;  3K8P C;  2LKH A;  4HFI A;  4EAH A;  2JIW A;  2OLT A;  2WSS V;  4JEH B;  4JUY A;  4KX6 A;  4JBW F;  3RX6 A;  3PU8 A;  5GON E;  4EZ4 A;  4DUZ T;  4NXM T;  3P4S A;  1T72 A;  4U31 A;  1YQ3 A;  4E7S A;  2NW8 A;  5LHH B;  3KV5 A;  1KEY A;  1V9D A;  2CBJ A;  4HKA A;  2BVM A;  5HEU A;  4L9I A;  4DO0 A;  4Q25 A;  3UU8 A;  1XDP A;  2XQ6 A;  3GN5 B;  4LF6 T;  3RIA A;  2IC6 A;  4TWD A;  4LML A;  2H89 A;  4XAX B;  1H7C A;  5ABF A;  2OV9 A;  4NUU A;  4DV5 T;  1BR4 A;  4OX9 T;  3AAA B;  4PFO A;  4DV0 T;  2YDS A;  2ZM2 A;  3SOL A;  3AE3 A;  3FZH B;  4G2A A;  4BJN A;  1HCI A;  3SWH A;  4DV6 T;  4MHC A;  4I4T E;  4ASK A;  4ZOL E;  1KNZ A;  4Z91 A;  4ANJ A;  1WYB A;  4DVD A;  4GK5 E;  4LMK A;  5C8Y E;  3PV0 F;  4A97 A;  1UUS A;  1FEW A;  1HX1 B;  2V1D B;  4JI5 T;  5HXS A;  3OPC A;  3AE2 A;  4B6X A;  3HKE E;  4COF A;  3NVO A;  4CXX A;  2AE9 A;  3JAF A;  3E08 A;  3NBX X;  2XQA A;  4IT4 A;  3RIU C;  4X65 T;  2WDQ A;  1ZEE A;  3RKO A;  4JI4 T;  2E5L T;  4LMJ A;  4UVC B;  4MLK A;  3CWZ B;  3M3Z B;  1UK5 A;  4PFP A;  5FXZ A;  4TV9 E;  4PK5 A;  3EI0 A;  2NR4 A;  5JTG A;  2M6B A;  3KV6 A;  3RRW A;  2YEV C;  3CX8 B;  4P09 A;  2JJ9 A;  3F57 A;  2L3L A;  5LJN A;  2BZB A;  3RGL A;  4A56 A;  4NPP A;  5FKY A;  4IE6 A;  3TLU A;  2I6H A;  2WDR A;  4DBQ A;  5ADX L;  3U78 A;  4AKH A;  4HFC A;  2E9X A;  3AE6 A;  2DHR A;  2G0U A;  2WU2 A;  5H6R B;  3CK6 A;  4YTN A;  2E2A A;  1D0Z A;  2OA5 A;  3TLT A;  2PTF A;  2BG9 E;  3ANW A;  4QX8 B;  4H9N C;  4U2Y A;  3TLS A;  3PUR A;  3HKC E;  4O2B E;  4JI6 T;  5JRC B;  5C3J A;  2XAQ B;  3GWH A;  3AAE B;  5KX5 E;  1I94 T;  3N2G E;  4X1Y E;  3PUS A;  3SFE A;  1UCU A;  1OED B;  2CBI A;  5LGN B;  4OK0 A;  3N9P A;  2ACX A;  1YW0 A;  2MYS A;  2VKH A;  3EDV A;  4WYV A;  3AAI A;  4BA9 A;  3E0Z A;  2K5B B;  4DR2 T;  4LF9 T;  1HNW T;  3ZST A;  1MIY A;  3PUY F;  2VQE T;  2KWH A;  5L3D B;  2YDQ A;  1MNE A;  1VRB A;  2WCA A;  4TWF A;  5JDM A;  2FBW A;  3I9W A;  2IW5 B;  3LBX A;  2ES0 A;  5ABH A;  4QHO A;  1MIW A;  2V7L A;  2WQY A;  1I6Z A;  1BR1 A;  4H63 V;  4OFZ A;  2LSI A;  2V7I A;  2YOE A;  3KV4 A;  3C4W A;  4AIU A;  4JLE A;  5KDM C;  2ZMA A;  3FBL A;  4O8S A;  1FIO A;  2FUP A;  4IDN A;  2X68 A;  5AQO B;  3IBP A;  3ZMS B;  1WCR A;  2FJA A;  3JC6 D;  3DJB A;  5JDQ A;  2LEH A;  2KIN B;  2VUR A;  2A9U A;  2J1D G;  3P50 A;  2KND A;  1E2A A;  2LSJ A;  3RIU A;  5L3C B;  3VRB A;  5LA6 E;  4NUV A;  4O4H E;  5HCJ A;  3N9M A;  2DNX A;  2WZH A;  3ESL A;  5EK4 A;  4Z90 A;  4CI3 B;  5JR9 C;  2VQF T;  2CCQ A;  2KSR A;  4ILB A;  3PUV F;  4X1K E;  2MOZ A;  4YY3 T;  3MJX A;  4OYK A;  3RYC E;  2KLQ A;  5HEO A;  4ZI3 C;  4B3M T;  4AXP A;  2W4X A;  1IJ5 A;  2D0T A;  2VL0 A;  2DLR A;  4U7Y A;  4ZXL A;  5HXR A;  2A3D A;  3ZMZ B;  5M4Y A;  3VR8 A;  3HA4 A;  1IAP A;  2H88 A;  1CHU A;  4L5G A;  2K9A A;  2WWV A;  4HWD A;  2M6I A;  4ZI7 E;  3ZC1 A;  4IL4 A;  2W67 A;  4DR6 T;  3AA6 B;  2V6Y A;  3ZYM A;  2LE8 A;  4LFA T;  4AI6 A;  4EED A;  5EK2 A;  2XM2 A;  2WAU A;  2RP4 A;  1W09 A;  2WY2 A;  2XM1 A;  3PE0 A;  4IE7 A;  4KP3 C;  4GK0 E;  5AQM B;  5AQN B;  2XQ7 A;  5HXE A;  2UXC T;  2LSG A;  2JMH A;  3IEE A;  4UR9 A;  5AQH B;  5AQP B;  3C51 A;  4UEM A;  2FJE A;  2XAS B;  2UUA T;  1DU2 A;  2NOX A;  3AE8 A;  3AE5 A;  3AEB A;  1XDO A;  3KV9 A;  5AQG B;  3ZSS A;  1WLX A;  2J4G A;  2Q9Q B;  3GN5 A;  2CLY B;  3ZYL A;  3N9Q A;  4UV8 B;  4ZZC A;  1IBL T;  2MPK A;  4UXN B;  4B3R T;  2W0G A;  2WZI A;  2YK0 A;  4Z8X A;  4IE0 A;  1UX5 A;  3LJC A;  4IDO A;  3MZK B;  1FMV A;  1HF8 A;  5AQS B;  1ZP0 A;  2D0U A;  1YD8 G;  2E9X B;  2IC9 A;  2V7K A;  4YFS A;  4EOZ B;  5L3E B;  1EZ3 A;  1JNR A;  5FXW A;  5LCY A;  3X1D A;  3T1Y T;  1NAF A;  4JI0 T;  2Q9Q D;  4DR5 T;  4YXD A;  5IHY A;  3TLW A;  3UUX B;  2CM0 A;  2WP9 A;  3NKZ A;  2J62 A;  2XAJ B;  2XTL A;  4AQF A;  2B1E A;  4CZZ B;  3FBZ A;  2LRK A;  2WB5 A;  1OED C;  4NIQ A;  3NRY A;  2KT9 A;  5FY7 A;  2YN6 A;  4ZHQ E;  3H37 A;  2M67 A;  2KZ7 B;  4MFR A;  1FJG T;  3C50 A;  3AEF A;  3QB5 A;  5BMV E;  2E9X D;  4X66 T;  2VK9 A;  3Q9D A;  5JDF A;  1WR0 A;  4XBF B;  2ZLY A;  3M65 A;  3EUH A;  2V6Y B;  4PJL A;  1ZV4 X;  4BJM A;  5BR8 T;  3UQ4 A;  3VU7 H;  3OYX A;  4CXY A;  5FY0 A;  4PJN A;  1JNZ A;  3K1S A;  4U3C A;  4IE5 A;  5CFB A;  2Y8D A;  2X9W A;  2BS3 A;  2WMN A;  3QUJ A;  4A98 A;  3J9X 1;  4YHH T;  5DAB A;  5TAO A;  5LHG B;  2HPL A;  2DCF A;  2BDE A;  4YJ2 E;  1KNP A;  4DV7 T;  2DI4 A;  2BG9 A;  5AQT B;  4F8H A;  2PBI A;  2CHN A;  2LSK A;  2XQY A;  4UVA B;  5FYM A;  4LF4 T;  3Q5E A;  4JI3 T;  3QB5 K;  4QX7 B;  2XSB A;  3ZMT B;  2NW7 A;  5L3G B;  4GYR A;  3U3I A;  5LP6 E;  2X9X A;  3AEE A;  3NZQ A;  3MAC A;  3UUB A;  5F3J A;  2ZM6 T;  4DV3 T;  3OTO T;  3B57 A;  4LF5 T;  4I55 E;  2ACZ A;  3P4R A;  2DL1 A;  2QYW A; 
#chains in the Genus database with same CATH homology
 1LVF A;  3KDS E;  4MAL A;  3BQI A;  2WMO A;  3LK2 B;  1HTJ F;  3ZC0 A;  5FXV A;  3P8C D;  3N9O A;  2KWI B;  4AQG A;  5LBM A;  5JQG E;  2EHO A;  3ZCJ A;  5LNK A;  1S94 A;  4H9Q C;  4OHF A;  1UX4 A;  3PUQ A;  3LBX B;  1FMW A;  4PAG A;  3OJA A;  4IIJ E;  3ZPO A;  2JPF A;  4EZH A;  3O1H A;  5LG4 A;  4DMW A;  5LGT B;  2YU1 A;  2MBG A;  3VKH A;  2YIN A;  2CWY A;  1O3X A;  4P0A A;  3AVR A;  3BQK A;  3RYI E;  2A72 A;  2D5U A;  3MXZ A;  3UTK A;  1U5P A;  3DP7 A;  2K48 A;  2NP9 A;  1Y64 B;  2JMK A;  3CVR A;  4KMC A;  4TN7 B;  5FNV E;  4PK6 A;  3SRZ A;  2VKO A;  2E8I A;  2LT3 A;  2A2F X;  3KVA A;  3ZYK A;  3LFM A;  2I59 A;  3DTO A;  4WNK A;  1LRZ A;  3E22 E;  1D1A A;  4QXB B;  5HYA A;  3UUL A;  4WBN E;  1MMG A;  3RC8 A;  1MMN A;  3O1I A;  4HE8 A;  3R6N A;  2CXF A;  2BVL A;  4CI2 B;  3C4Z A;  1U4Q A;  2X51 A;  5HXH A;  2ODU A;  3RYF E;  5JDL A;  1YKE B;  3N2K E;  4QXC B;  1G73 A;  3LK4 2;  4C90 A;  2SPC A;  2NW9 A;  2H3R A;  5JDH A;  1WR6 A;  3CPZ A;  2C0S A;  2RA1 A;  5LBQ B;  2IAK A;  2CEA A;  4OYJ A;  4IDZ A;  4DMV A;  1HFA A;  3WI3 A;  3NZP A;  2X0L B;  2P9B A;  3CQX C;  5EK3 A;  4AKG A;  1T98 A;  3N9L A;  4O4I E;  5J1G A;  5FXX A;  5L2L A;  4AKI A;  2L8K A;  4HTE A;  4TV8 E;  4ZI2 C;  5IYZ E;  1S35 A;  1AJ3 A;  1QSD A;  3I0O A;  5LYJ E;  2W62 A;  5LOV E;  4HFV A;  3HR0 A;  3KFW X;  5DJQ C;  5HWX A;  2Y48 B;  3V5U A;  2GK9 A;  5FP3 A;  1ZKE A;  3RH3 A;  2LOS A;  5J2U E;  4TZ4 C;  1YKH B;  2KMF A;  2NWB A;  4XZC A;  2EHO B;  4ADZ A;  2DWK A;  3OYZ A;  1WRD A;  4HGA A;  4DND A;  1KK7 A;  4P0B A;  3RRC A;  3ZJ1 A;  2W00 A;  4UV9 B;  3KBU A;  4ZS2 A;  2Q9Q A;  3Q5W A;  2KXP B;  1WYC A;  3L09 A;  4UF0 B;  5ETW A;  5JRE A;  1X79 A;  3AA7 B;  3FXE B;  3GMI A;  3ZMU B;  4M1P A;  4ZI2 D;  4KUM B;  3AVS A;  1QUU A;  3A5X A;  3HI2 A;  1NWM X;  2WM9 A;  2Q9Q C;  3D0T A;  4GYS A;  3LG7 A;  4PNI A;  4YJ3 E;  4PJJ A;  1B7T A;  3FB2 A;  2LOP A;  2CXL A;  2X66 A;  4UF0 A;  4EB6 E;  2LM9 A;  1G8X A;  3WAJ A;  5LGU B;  2CE7 A;  2X9H A;  3R84 B;  4ISS A;  4U72 A;  4PW8 A;  3PUA A;  2XAF B;  3HKD E;  3MA9 A;  2NTX A;  3Q2M A;  4C91 A;  1US7 B;  1IZN B;  3I9Y A;  3V5S A;  4WW0 A;  1IJ6 A;  3KBT A;  3NRX A;  1D1C A;  5JR9 A;  2HPJ A;  1MIV A;  1SHZ C;  3IF8 B;  2PG8 A;  3UFE A;  3HL6 A;  4O4L E;  2VAS A;  4PK4 A;  5HAX A;  4EYU A;  2CMR A;  2C5K T;  3J7Y q;  2WBL A;  4YLH A;  5JRC A;  2CA5 A;  1D0X A;  3OBV E;  5JR9 B;  3S4U A;  5AFU L;  5FY1 A;  3UT5 E;  2XAH B;  3VHL A;  2N2N A;  4AQF C;  5FMN A;  3K3Q C;  3HKB E;  3WAK A;  3ZMV B;  4V1A v;  3P7I A;  3O9X A;  3N2O A;  4H9R C;  1ZHC A;  3MKD A;  3RYH E;  4FJO A;  2LHR A;  4IHJ E;  5KMG P;  3O1J A;  2V26 A;  4ZS3 A;  4WBO A;  5CB4 E;  1CUN A;  3ZN0 B;  5J2T E;  5DQW A;  4KBM B;  3ZEF B;  2Y6X A;  3K3O A;  5JDG A;  3ZN1 B;  4CQI A;  3QK6 A;  2WWU A;  2VB6 A;  3BK9 A;  4H9O C;  2LSY A;  3KIN B;  2K24 A;  3N5L A;  1LKX A;  2N1G A;  3ANW B;  2E9X C;  4GOU A;  1D0Y A;  4UIG A;  2UXX B;  5A1L A;  3QC9 A;  4CI1 B;  3IHR A;  3PDY A;  3L3P A;  5F8P A;  3ZLI A;  5JH7 E;  2H7V C;  3H3A A;  3ZJ2 A;  1BR0 A;  2Z6E A;  3B13 A;  1HG5 A;  4EYY R;  3F31 A;  2QA7 A;  3W15 B;  4E7Z A;  2C5I T;  5E0O A;  2VKJ A;  5JDN A;  4U74 A;  2ZM8 A;  3T8O A;  4AKR B;  4H9S E;  4F6R C;  4AKL A;  3ZCI A;  3Q5X A;  2X67 A;  2L9Q A;  1MMA A;  2DWG A;  2MTQ A;  4CXW A;  2QGS A;  5CA0 E;  4ERR A;  4N78 D;  5JVD E;  4QWN B;  3I1A A;  2W63 A;  2C5J A;  2PFV A;  4MBQ A;  2EHO C;  3GA8 A;  3CX7 B;  2JRK A;  4HEA A;  1SA0 E;  4O2A E;  3LK3 B;  5L3F B;  2JQQ A;  2UXN B;  1Z0P A;  1VOM A;  2XHE B;  2V7J A;  2YU2 A;  2HH7 A;  1OWA A;  1MND A;  4GIW A;  3CQG B;  2PJQ A;  4X20 E;  3F2E A;  2W61 A;  3CX6 B;  4IST A;  4ZI3 D;  4TUY E;  4EIW A;  4YHJ A;  4I43 B;  2VL8 A;  2CLY C;  2EHO D;  1HS7 A;  3CML A;  1OXZ A;  1E1H B;  3ETV A;  2VKD A;  3AB3 B;  3RPU A;  4ILU A;  5HXC A;  3PU3 A;  4BAY B;  2X9Y A;  3BQL A;  4G63 A;  2CXD A;  3C64 A;  3EVY A;  3O4X E;  5LXT E;  1HG2 A;  3PUG A;  3C98 B;  2LHN A;  2VWA A;  2XUE A;  4HN9 A;  5HWY A;  3JC6 C;  3PTR B;  4H63 H;  1BR2 A;  2LJL A;  4L0R A;  4QKN A;  3UUN A;  5LHI B;  4H9P C;  3AA1 B;  4QXH B;  3EDU A;  4X1I E;  3OKQ A;  3AA0 B;  3CKD A;  3TKL B;  4IGU A;  4DBR A;  1HX8 A;  2ODV A;  2XAG B;  3ONX A;  4IE4 A;  5EZY E;  3SS1 A;  3MK7 C;  4EXT A;  3UUM A;  5CA1 E;  4J2C A;  2D2S A;  3N9N A;  1D1B A;  4TX5 A;  4PJM A;  3KVB A;  5DQV A;  2H7O A;  3CQC B;  2CWO A;  3I0Q A;  5L3B B;  4I50 E;  5H6Q B;  4K0U A;  4UVB B;  1MMD A;  3VKG A;  3C4X A;  3FXD B;  2ZM0 A;  1LVK A;  2N9D A;  3ETU A;  3FHN A;  4UEL A;  2V7M A;  4JEU B;  4O4J E;  3RC3 A;  4FI5 A;  2NTY A;  3K8P C;  4EAH A;  4JUY A;  4JEH B;  2WSS V;  3RX6 A;  4EZ4 A;  3PU8 A;  5GON E;  4E7S A;  2NW8 A;  5LHH B;  3KV5 A;  1V9D A;  4HKA A;  2BVM A;  4DO0 A;  4L9I A;  3GN5 B;  2IC6 A;  4XAX B;  1H7C A;  4NUU A;  1BR4 A;  3AAA B;  4PFO A;  2ZM2 A;  3SOL A;  4BJN A;  4G2A A;  1HCI A;  3SWH A;  4MHC A;  4I4T E;  4ASK A;  4ZOL E;  1KNZ A;  4DVD A;  4ANJ A;  1WYB A;  4GK5 E;  5C8Y E;  1FEW A;  2V1D B;  5HXS A;  4B6X A;  3HKE E;  4CXX A;  3NBX X;  3E08 A;  1ZEE A;  3RKO A;  4UVC B;  4MLK A;  3CWZ B;  4PFP A;  5FXZ A;  4TV9 E;  4PK5 A;  3RRW A;  3KV6 A;  2YEV C;  3CX8 B;  4P09 A;  2JJ9 A;  3F57 A;  2L3L A;  5LJN A;  2BZB A;  4A56 A;  5LJM A;  4AKH A;  4IE6 A;  4DBQ A;  5ADX L;  3U78 A;  2E9X A;  2DHR A;  2G0U A;  5H6R B;  1D0Z A;  2OA5 A;  3ANW A;  4QX8 B;  4H9N C;  3PUR A;  3HKC E;  4O2B E;  5JRC B;  2XAQ B;  3GWH A;  3AAE B;  5KX5 E;  3N2G E;  4X1Y E;  3PUS A;  1UCU A;  5LGN B;  4OK0 A;  3N9P A;  2ACX A;  1YW0 A;  2MYS A;  2VKH A;  3EDV A;  4BA9 A;  3AAI A;  3E0Z A;  2K5B B;  1MIY A;  2KWH A;  5L3D B;  1MNE A;  1VRB A;  5JDM A;  3I9W A;  2IW5 B;  3LBX A;  2ES0 A;  4QHO A;  1MIW A;  2V7L A;  1BR1 A;  4H63 V;  4OFZ A;  2LSI A;  2V7I A;  3KV4 A;  3C4W A;  4JLE A;  5KDM C;  2ZMA A;  3FBL A;  4O8S A;  1FIO A;  3ZMS B;  2X68 A;  3IBP A;  3JC6 D;  3DJB A;  5JDQ A;  2LEH A;  2KIN B;  2J1D G;  2KND A;  2LSJ A;  5L3C B;  5LA6 E;  4NUV A;  4O4H E;  3N9M A;  2DNX A;  3ESL A;  5EK4 A;  5JR9 C;  4CI3 B;  2CCQ A;  4X1K E;  2MOZ A;  3MJX A;  4OYK A;  3RYC E;  2KLQ A;  4ZI3 C;  4AXP A;  1IJ5 A;  2D0T A;  2DLR A;  5HXR A;  2A3D A;  3ZMZ B;  5M4Y A;  3HA4 A;  1IAP A;  4L5G A;  4ZI7 E;  2K9A A;  3ZC1 A;  3AA6 B;  3ZYM A;  2LE8 A;  4AI6 A;  5EK2 A;  2WAU A;  2RP4 A;  4IE7 A;  5HXE A;  3PE0 A;  4KP3 C;  4GK0 E;  2LSG A;  2JMH A;  3IEE A;  3C51 A;  4UEM A;  2XAS B;  2NOX A;  3KV9 A;  1WLX A;  2Q9Q B;  3GN5 A;  3ZYL A;  2CLY B;  3N9Q A;  4UV8 B;  4UXN B;  2W0G A;  2YK0 A;  4Z8X A;  4IE0 A;  1UX5 A;  3LJC A;  3MZK B;  1FMV A;  1HF8 A;  2E9X B;  2D0U A;  1YD8 G;  2IC9 A;  2V7K A;  4YFS A;  4EOZ B;  5L3E B;  1EZ3 A;  5FXW A;  5LCY A;  1NAF A;  2Q9Q D;  5IHY A;  3UUX B;  2CM0 A;  2XAJ B;  2XTL A;  4AQF A;  2B1E A;  4CZZ B;  3FBZ A;  3NRY A;  2KT9 A;  5FY7 A;  4ZHQ E;  3H37 A;  2M67 A;  2KZ7 B;  4MFR A;  3C50 A;  5BMV E;  2E9X D;  4XBF B;  2VK9 A;  3Q9D A;  5JDF A;  2ZLY A;  3M65 A;  3EUH A;  4PJL A;  1ZV4 X;  4BJM A;  3VU7 H;  3OYX A;  4CXY A;  5FY0 A;  4PJN A;  4IE5 A;  2Y8D A;  2X9W A;  2WMN A;  3QUJ A;  3J9X 1;  5DAB A;  5TAO A;  5LHG B;  2HPL A;  2DCF A;  2BDE A;  4YJ2 E;  2DI4 A;  2PBI A;  2LSK A;  2XQY A;  4UVA B;  5FYM A;  4QX7 B;  3ZMT B;  2NW7 A;  5L3G B;  4GYR A;  3U3I A;  5LP6 E;  2X9X A;  3NZQ A;  3MAC A;  5F3J A;  3B57 A;  4I55 E;  3K3N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...