4P09A

Crystal structure of hoip pub domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
177
structure length
177
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 68
structure length 177
sequence length 177
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p09A00
4OYKA 4OYJA 5LJMA 2D5UA 2CM0A 4JUYA 2HPLA 4P0AA 2HPJA 4P09A 5LJNA 4P0BA 2CCQA
chains in the Genus database with same CATH superfamily
2YDRA 5LMNT 2I6HA 2W4XA 2QVAA 2BKOA 2KLQA 3RX6A 2WQYA 3I0OA 4P1NA 5DJQC 4WYVA 4J2CA 5L3DB 3PTRB 3V5SA 5HXCA 3ESLA 2XQ5A 3ZN0B 2ACXA 3ZMVB 3RRCA 1J5ET 4DO0A 3RIAA 4HWHA 2CLYB 2D2SA 4COFA 2JPFA 1M62A 2QA7A 5LHGB 5H6RB 2LRKA 3AEBA 3Q9DA 5F3JA 2VKHA 3AVSA 2W2UA 3ZYMA 5JRCB 3CX7B 4HFBA 3W15B 3ZT5A 1OWAA 3OKQA 4IT4A 5FXZA 2M6BA 3O4XE 5LGUB 2N1GA 3RQUA 3C98B 3M3ZB 1MIYA 3IEEA 4YY3T 5DABA 2BG9A 1IJ6A 3I9YA 2XQYA 4DR2T 2F4VT 3ZN1B 3ZCIA 5FXWA 2XUEA 3DJBA 4C91A 2LOPA 3ZMUB 1WCRA 3F57A 5JDLA 2GK9A 3HI2A 2EHOB 2XAQB 3WAJA 4DV7T 3RIFA 2W62A 3MZKB 3P8CD 3RC3A 3AA7B 4QHOA 2XSBA 4NXNT 2IC6A 4OYJA 2JIWA 2WMOA 2VKOA 4U3CA 5FXVA 2E2AA 4ZI3D 2MYSA 4H63V 1XNQT 3ABVA 4B3MT 4O2AE 2RPAA 2YU2A 4X1IE 5H6QB 3RYHE 3N9QA 2HPLA 5AQGB 4UXNB 3RIUA 3CWZB 2X67A 2XJ7A 5HWYA 3PURA 1XMQT 1WYCA 3QB5A 4KBMB 2UU9T 4HFDA 3ANWB 3PUGA 1HNWT 1JNZA 4IE5A 1Z8UA 1HG2A 3ZT6A 4OYKA 4A98A 1D1CA 5ADXL 1US7B 4JEUB 2BS2A 2I0MA 3X1DA 1MMDA 4JEHB 3MKDA 4YJ2E 2P9BA 1L0VA 4YHHT 3RH3A 2A72A 5LJMA 4DNDA 3MA9A 2Y6XA 2BS4A 3BK9A 4IGUA 3I0QA 3N9PA 5AQHB 1W0AA 4KX6A 2BVLA 3TLSA 3AA6B 2NTYA 3KINB 3LDQB 3UQ7A 3FHNA 1KNRA 4NUVA 5GONE 5HXEA 5DQVA 2L9QA 1MIVA 1LRZA 1W0BA 4DV0T 3Q2MA 4HEAA 2ZM6T 1IBMT 2BZBA 4TZ4C 2PFVA 4HFEA 2KMFA 4KMCA 4IHJE 5LGNB 5JDMA 5AQPB 3UT5E 1HNXT 4U2YA 2XQ7A 3ZMZB 5DQWA 4ZI3C 1S35A 2X9WA 3SRZA 4YSYA 3AAIA 3C51A 1E1HB 5HYAA 4I4TE 1T8BA 4QH4A 3CPZA 4ZHQE 2BS3A 1Y64B 2NTXA 2PJQA 3RKOA 3RRWA 2NP9A 3LBXB 3BQKA 3A8YC 3HKCE 4ZOLE 4EV6A 5LYJE 1GQEA 2UUCT 5LOVE 2IHR1 4HWDA 4AKHA 5FYMA 3KV5A 5LMUT 2A9UA 3AEGA 2BG9C 3PUVF 3AE4A 3CVRA 2NW8A 4U74A 3C50A 2UXBT 2G0UA 2K24A 4JI6T 1OEDB 2LKHA 4L9IA 1MMGA 3SOLA 3UFEA 4KI0F 5LXTE 2KT9A 4DBRA 2J47A 4QXCB 2WP9A 2XM2A 4LF4T 3CX8B 3PJAJ 5JREA 4PAGA 2YU1A 4DV5T 1KF6A 1G73A 2WS3A 1UX4A 4TX5A 5JRCA 4OK0A 4IDZA 4QXBB 2XAJB 2W61A 3UTKA 3RIUC 4HFHA 2FJBA 4X5TA 2QYWA 3UQ4A 4P0AA 3P4RA 4MLKA 5AQUB 3UU3A 4QWNB 3VRBA 4BA9A 1M7KA 2C0SA 1IZNB 4DUZT 1D0YA 4ASKA 3IA3A 3NZPA 3KV4A 4GIWA 2WDVA 4ANJA 4I50E 3R84B 3O1IA 4ILCA 4TWHA 4YSZA 4EGWA 2LEHA 3E0ZA 4DMWA 4UEMA 2EHOA 1YD8G 3RYFE 2FJAA 3LG7A 5J2TE 2VASA 5FKYA 3FZKB 3LFMA 3RI5A 5L3BB 5LG3A 3B13A 2VVNA 4WNKA 4OX9T 5AQLB 2CM0A 3UU5A 2D0TA 5HEHA 4B3ST 4UR9A 1HR0T 3SFEA 4YHJA 3ZJ1A 1HCIA 5BR8T 1JNRA 2XQ4A 4DV4T 5FMNA 3P4WA 3QOFA 2HN2A 3EDUA 4ILBA 4AQYT 2IC9A 2BG9E 4CN1A 3ANWA 4IDNA 4E7SA 3UFGA 5CA0E 2VWAA 4O2BE 1Z0PA 2SPCA 4UVBB 4E7ZA 3F2EA 1BR0A 3MK7C 5FL1A 4O4LE 4EOZB 1FIOA 5KDMC 4PW8A 5LHHB 2KXPB 3RHWA 3QUJA 2X51A 1HG5A 3OJAA 5AQFB 1MNEA 3ONJA 1AJ3A 5AQJB 4UVAB 3VU7H 4IE7A 4ISTA 3Q5DA 4HE8A 2DLRA 5IYZE 3FXDB 2EHOD 2ODVA 1T72A 4NPPA 2JQKA 2WY2A 5E0OA 4DR3T 4HKAA 1NENA 3QNUA 3UUBA 2D0UA 2YDSA 4F6RC 1S94A 2VL8A 3AXJB 1NAFA 5JH7E 3NRXA 1V9DA 1XZYA 3B57A 4QX8B 5AQOB 5LB7B 4LFCT 2VURA 3EUHA 3AE3A 2YEVC 1XDOA 4WBNE 2ZM8A 2DCFA 2B76A 3UULA 2CMRA 3K3OA 5FNVE 3PUQA 2HHHT 3KVAA 3T8OA 4AQGA 1Y01A 2BBHA 4EAHA 1BR1A 4PK5A 5F8PA 2IMLA 4AKLA 2WWUA 3N9MA 3K3NA 3Q5WA 4HFIA 4U7IA 2IDOB 2LHRA 4YJ3E 2CLYC 2CWYA 2MAWA 3EAMA 4WW0A 1KNZA 3TLUA 4U2ZA 4MFRA 3RYIE 4DR4T 3ZC1A 4YTNA 2KINB 2A2FX 2YKSA 2HPJA 3FZLB 4P09A 4FI5A 3C4XA 3PU3A 2WDRA 2LLYA 2LSIA 3N9NA 3HKEE 4PJMA 5BMVE 2A3DA 5EK4A 2VQFT 4YFSA 2KNDA 4X66T 2NWBA 4IL9A 5LJNA 4XZCA 4YXDA 3EABA 5FY1A 5M4YA 2YDQA 3CX6B 2EHOC 4NUUA 4O4HE 5CJ5A 1OEDA 3TKLB 4AKRB 3OYXA 5F5WA 3FBLA 4JI5T 4DR7T 1G8XA 4HFVA 4LF5T 3L8RA 1FJGT 4X1YE 3IHRA 5ABFB 4LMJA 3VHLA 2VK9A 3M65A 2V7MA 4LMLA 4HGAA 3JAFA 3UUXB 2VKDA 2CXLA 2E5VA 4GKKT 2E9XB 2FUPA 1D0ZA 4AQFA 3ZYKA 5FL0A 3HR0A 2XASB 1WRDA 1YKHB 2V6YB 2XAHB 3N9OA 2FJDA 4AI6A 2XQ6A 2WU5A 3K3QC 2ACZA 3SS1A 3DP7A 3EHZA 3RC8A 3GMIA 1LVKA 2H7VC 4IE6A 3UUMA 4C90A 1VCTA 1CUNA 4F8HA 3A5XA 4HWFA 4IIJE 4BJNA 4PK6A 2V7LA 3CK6A 1I6ZA 3AE2A 5FVLA 5ETWA 4A97A 4BJMA 4EZ4A 2CHNA 5HEGA 3ONLC 1J1JA 3FZMB 4OHFA 3PUZF 5C3JA 4TNWA 2JRKA 3Q5XA 1ZHCA 1J5WA 2XSAA 2PG8A 4I0UA 3NWIA 2V7IA 5L4HA 1YKEB 2BDEA 2W0GA 1NWMX 4IDOA 1LVFA 1SE7A 2X9YA 1WLXA 3GN5B 2V7JA 3IBPA 3AVRA 4AISA 2IIUA 4JBWF 5CA1E 4UF0A 1H7CA 3FZHB 3LK3B 3AA1B 3OVUA 5JDNA 4U7YA 5FY0A 3FB2A 2IUBA 5HXHA 3G06A 2W00A 2CXFA 2N9DA 1ZV4X 5CGMA 4B3TT 2WDQA 2XQ3A 5HEOA 2X0YA 1SA0E 4IREA 3SFDA 2H7OA 4ZZCA 2XAGB 4ZXLA 3RPUA 4JI8T 4JYAT 3E08A 5LBQB 4H9PC 5HXRA 4L0RA 3ETUA 4I43B 1WR0A 3GWHA 3EVYA 1KNPA 2V1DB 3N5LA 1YXRA 4HN9A 5LBMA 4DMVA 2IAKA 3RQWA 4EXTA 4YLHA 5HCMA 3FXEB 5HWXA 3AECA 4GYSA 2BVMA 4TWDA 3O1JA 5KXJA 3AXJA 3TLTA 1XMOT 2Y8DA 2CE7A 2L3LA 3WAKA 3ZSTA 2C5KT 4CXXA 1W9RA 4ISSA 1X9BA 2JQQA 2MOZA 1XWMA 3FZFB 4HWIB 3P7IA 3S4UA 1FEWA 4U33A 1FMWA 2WAUA 1OEDC 3KDSE 4AKIA 3ZEFB 1XDPA 3KFWX 4JUYA 2W67A 5L3CB 1HFAA 3PJAA 5L4EA 4QH5A 1N36T 4TUYE 2ZMAA 3P4QA 4H9RC 3DTOA 5JVDE 2L8KA 3AE7A 4P0BA 1HS7A 2XHEB 2CCQA 2UUAT 4PJLA 3QK6A 4AQFC 3AE9A 1SUMB 4HFCA 3U3IA 4IL4A 5LHIB 4PJNA 2DHRA 1WYBA 1QSDA 3AE6A 3LSVA 2W63A 2H3RA 3JADA 3EI0A 4WBOA 2ZM0A 3ZSSA 2V5CA 4Z8XA 4YTPA 3B5MA 4K0KT 2Q9QB 1MIWA 1T98A 2PBIA 3PU8A 2CEAA 1UUSA 4JV5T 2CRBA 4AKGA 3CQXC 3N9LA 2W66A 2CHOA 2XY8B 2D5UA 2LRLA 3AEAA 2UUBT 1I94T 1NEKA 2XM1A 5ABFA 5L3FB 5AQMB 2HN1A 2KSRA 3AE1A 4KHPT 2WB5A 3CMLA 5HEUA 5JR9B 2WCAA 2LSGA 3T1YT 4Z90A 2LOSA 2E9XA 1DU2A 2OA5A 3O1HA 4JI7T 4BAYB 1D1BA 2KWHA 3UU4A 2V6YA 3ZPOA 2J4GA 2WZIA 3AB3B 1SHZC 5HAXA 1CHUA 3TLWA 1BR2A 1UX5A 3PUWF 3AEDA 4DR6T 2RA1A 3I9WA 5C2TA 4MHCA 1YQ3A 1OEDE 2UXXB 2AXDS 4Q25A 3H3AA 2JQHA 4DBQA 3PE0A 5FXXA 2UXNB 1VRBA 2JMHA 3ZMTB 2DI4A 4HWCA 3K1SA 4EEBA 4GK0E 3OPCA 5IHYA 2LKGA 2X66A 1ZKEA 5LCYA 1WFDA 4ILAA 1B7TA 4B6XA 4JLEA 2M67A 4XAXB 4ZS2A 2Y48B 2CBJA 2RP4A 1D1AA 5AQTB 4AIUA 1VCSA 2V7KA 3OBVE 4GYRA 4TNVA 5AQNB 4LF8T 3MJXA 4N78D 4CI1B 1N33T 3ZYLA 1FMVA 3GA8A 2PTFA 4I55E 4X1KE 3OTOT 1UGOA 3AE8A 4EZHA 4IE4A 3MACA 4CZZB 1HX8A 3H3MA 4XBFB 3GN5A 4UELA 4DR1T 4H9OC 2XZEA 3NZQA 3KV6A 4ERRA 5AFUL 1YQ4A 3ZLIA 2QRXA 5KMGP 5HXSA 4DV1T 1EZ3A 2E9XD 2YOEA 4LF7T 3L09A 2HH7A 5ABGA 4DR5T 2XQAA 2VVSA 2LSYA 5JTGA 3LBXA 3RKGA 4UIGA 4O4JE 4ADZA 4L5GA 3E22E 2Z6EA 2FJEA 4IDQA 4ZI2D 4KUMB 5JDHA 2C5IT 2ES0A 1N32T 2XQ8A 2NW9A 3ZKRA 4QX7B 5LA6E 2MBGA 5EZYE 1IJ5A 3P50A 5LG4A 2J1DG 4CXWA 2WMNA 4QXHB 2UXCT 5FY7A 3UU8A 4JI0T 4WZXA 1QUUA 3N2GE 1YW0A 1UCUA 5ABEA 2LHNA 2MTQA 3AA0B 3VKGA 4YTMA 4DV6T 4H63H 2VKJA 5LGTB 3RYCE 2B1EA 4GOUA 5J0ZA 3KVBA 1R8IA 1WR6A 2ZM2A 4PFPA 1X79A 2YN6A 4DV2T 4QKNA 1U5PA 2WZHA 2VB6A 3UUNA 2DWKA 5AQSB 4NIQA 3ZT7A 3LJCA 4M1PA 3A7MA 4FJOA 3AE5A 4PK4A 3NVOA 4TN7B 3CQCB 3IF8B 3RLFF 5JDFA 5C8YE 4DVDA 4PJJA 3NBXX 3WI3A 3ZMSB 2IW5B 3NRYA 2E9XC 1T7SA 3P4SA 4JI1T 2XTLA 1VOMA 3HKDE 4EEDA 2V26A 3PUXF 3AEFA 4G63A 1MMAA 1HTJF 4UV8B 2H89A 2NOXA 4LF9T 2LT3A 4ZI2C 2DL1A 3KV9A 2CA5A 4IE0A 4HTEA 2Q9QA 4ZEYA 2I59A 1MNDA 5AQIB 4CI2B 5AQKB 2M6IA 4EIWA 1KFYA 5CB4E 2V8SV 5EK3A 3QB5K 3I1AA 4A56A 4B3RT 1HF8A 3AEEA 3PUSA 1O3XA 2N2NA 4DV3T 5EK2A 4PNIA 3LK2B 2X9HA 2BKNA 5TAOA 3R6NA 1HNZT 2OLTA 3T1HT 3JC6D 4CN4A 4K0UA 1D0XA 5JR9A 2K9AA 4TV8E 5JDGA 3CKDA 3HKBE 1QLBA 3J9X1 4LFBT 4MBQA 3Q5EA 3KBTA 2LE8A 2BG9B 1HX1B 5HCJA 4JI4T 3ZC0A 2XAFB 5LP6E 1MMNA 5IUXA 4MALA 2VL0A 2K5BB 2JJ9A 2CPTA 4LMKA 4TV9E 4LF6T 4H9NC 5J2UE 2R6GF 1OXZA 3ZCJA 3UU6A 4V1Av 1XNRT 2JQ9A 2X9XA 3ETVA 3N2KE 5FVKA 5L3EB 3NKZA 2BBJA 3VR9A 3O9XA 2QGSA 2LM2A 3BQIA 4IDPA 4UV9B 2X0HA 4EYYR 2Q9QD 4YSXA 4KHZF 4X62T 4ZS3A 2K48A 4X64T 4JI2T 2KWIB 5AQRB 5L2LA 4Z91A 2DWGA 2LSKA 4GKJT 3ZJ2A 1U4QA 3C4WA 4DUYT 2V6XA 3CQGB 3EDVA 2OV9A 1ZP0A 2J62A 2FBWA 3QC9A 2LSJA 2WBLA 2NW7A 3VKHA 2DNXA 2CXDA 2XQ9A 4O4IE 3L3PA 4X65T 4TWFA 2KZ7B 2E8IA 4X20E 3JCFA 3KBUA 3PUYF 1LKXA 2LM9A 2ODUA 5CFBA 3H37A 1E2AA 1KK7A 3JC6C 5AQQB 4QH1A 3MXZA 4A5XA 1E7PA 2V5DA 3C64A 2C5JA 3VRAA 3TLVA 5A1LA 3P4PA 3U78A 1UURA 3JAEA 3HA4A 3BQLA 4KP3C 5HEJA 3AAEB 4CN6A 4ZI7E 2AE9A 2UXDT 3D0TA 4GK5E 5JQGE 3OYZA 3RGLA 2H88A 5J1GA 4CXYA 3N2OA 4CI3B 2LJLA 1W09A 2WM9A 2D9DA 3PDYA 3RF1A 1ZOYA 4U31A 3J7Yq 3VR8A 3V5UA 1N34T 3LK42 3CIRA 2CWOA 5IWAT 2K3WA 4H9SE 3K8PC 2ZLYA 4PFOA 3L39A 4AXPA 2Q9QC 3PUAA 5FP3A 4O8SA 5KX5E 5JDQA 4OFZA 4EB6E 5AQVB 2X68A 5ABHA 4LFAT 4JI3T 3PV0F 3AAAB 2XPKA 4UVCB 4UF0B 4G2AA 2WU2A 1IBKT 4YT0A 4EYUA 4ILUA 1IAPA 4H9QC 2E5LT 2CBIA 3ONXA 3F31A 2WSSV 5JR9C 5LNKA 1ZEEA 1IBLT 4NXMT 5L47A 2X0LB 3HL6A 3SWHA 4ZZBA 4CQIA 2WWVA 2VQET 2JMKA 2YK0A 2BKPA 3FBZA 1BR4A 2MPKA 3C4ZA 4U72A 1UK5A 4DIDB 2NR4A 1KEYA 2YINA 5L3GB
chains in the Genus database with same CATH topology
3VKGA 3LK3B 4ASKA 3AA1B 3NZPA 4H63H 3KV4A 4GIWA 2VKJA 5JDNA 5LGTB 3RYCE 2B1EA 4GOUA 5FY0A 3FB2A 4ANJA 5HXHA 4I50E 3R84B 3O1IA 2W00A 2CXFA 2KLQA 2N9DA 3RX6A 3KVBA 1WR6A 1ZV4X 2LEHA 2ZM2A 3E0ZA 4PFPA 3I0OA 4DMWA 4UEMA 2EHOA 1YD8G 3RYFE 1X79A 5DJQC 3LG7A 4J2CA 5J2TE 1SA0E 5L3DB 3PTRB 3V5SA 2VASA 3ESLA 2H7OA 5HXCA 4QKNA 3ZN0B 2ACXA 3LFMA 3ZMVB 2XAGB 1U5PA 2VB6A 3UUNA 5L3BB 2DWKA 3RPUA 3B13A 3E08A 5LBQB 3LJCA 4H9PC 5HXRA 4M1PA 4WNKA 4L0RA 4FJOA 3RRCA 3ETUA 4I43B 4PK4A 4DO0A 4TN7B 2CM0A 3CQCB 2D0TA 3EVYA 3GWHA 2CLYB 2D2SA 3IF8B 2JPFA 2V1DB 3N5LA 4HN9A 2QA7A 5LBMA 4DMVA 5JDFA 2IAKA 5H6RB 5LHGB 5C8YE 3Q9DA 4YHJA 5F3JA 4EXTA 4YLHA 4DVDA 3ZJ1A 1HCIA 3NBXX 4PJJA 3WI3A 3FXEB 2VKHA 3AVSA 3ZMSB 5HWXA 2IW5B 3NRYA 4GYSA 3ZYMA 2BVMA 5JRCB 2E9XC 3O1JA 5FMNA 3CX7B 3EDUA 3W15B 2XTLA 1VOMA 3HKDE 2Y8DA 2CE7A 2IC9A 2L3LA 1OWAA 3OKQA 2V26A 3WAKA 4G63A 5FXZA 3O4XE 1MMAA 1HTJF 2C5KT 3ANWA 5LGUB 2N1GA 4E7SA 3C98B 1MIYA 4UV8B 5CA0E 3IEEA 2VWAA 4O2BE 5DABA 4CXXA 1IJ6A 3I9YA 1Z0PA 4ISSA 2XQYA 2SPCA 2JQQA 4UVBB 3ZN1B 3ZCIA 4E7ZA 5FXWA 2MOZA 2NOXA 2XUEA 3F2EA 1BR0A 3MK7C 2LT3A 3DJBA 4O4LE 4ZI2C 4EOZB 1FIOA 4C91A 5KDMC 4PW8A 3KV9A 2LOPA 2CA5A 4IE0A 4HTEA 3ZMUB 2Q9QA 3P7IA 3S4UA 3F57A 5JDLA 1FEWA 2I59A 2GK9A 5LHHB 1MNDA 1FMWA 3HI2A 2EHOB 2XAQB 4CI2B 3WAJA 2KXPB 2WAUA 3QUJA 2X51A 2W62A 3KDSE 4AKIA 1HG5A 3OJAA 3ZEFB 3MZKB 3P8CD 3KFWX 4JUYA 4EIWA 5L3CB 1MNEA 3RC3A 3AA7B 1AJ3A 5CB4E 5EK3A 3I1AA 4QHOA 1HFAA 4A56A 4UVAB 3VU7H 4IE7A 4ISTA 2IC6A 4HE8A 1HF8A 4OYJA 2DLRA 3PUSA 1O3XA 2N2NA 2WMOA 5EK2A 2VKOA 4PNIA 5FXVA 3LK2B 5IYZE 4TUYE 2X9HA 2ZMAA 5TAOA 3R6NA 4H9RC 3FXDB 4ZI3D 2MYSA 4H63V 2EHOD 2ODVA 3JC6D 3DTOA 5JVDE 4K0UA 2L8KA 1D0XA 5JR9A 4P0BA 4O2AE 1HS7A 5E0OA 2YU2A 4HKAA 2XHEB 4X1IE 2D0UA 5H6QB 2K9AA 3RYHE 3N9QA 2CCQA 2HPLA 4F6RC 1S94A 4PJLA 4TV8E 3QK6A 4UXNB 3CKDA 2VL8A 4AQFC 5JDGA 3HKBE 3CWZB 1NAFA 5JH7E 2X67A 3NRXA 1V9DA 5HWYA 3J9X1 3U3IA 3PURA 5LHIB 1WYCA 4PJNA 2DHRA 3B57A 4KBMB 1WYBA 1QSDA 4QX8B 4MBQA 3ANWB 2W63A 2H3RA 3EUHA 2YEVC 3PUGA 4WBNE 3KBTA 2LE8A 2ZM8A 4WBOA 2ZM0A 4IE5A 4Z8XA 1HG2A 2DCFA 3UULA 2CMRA 3ZC0A 3K3OA 2XAFB 5LP6E 1MMNA 4MALA 5FNVE 3PUQA 2K5BB 2JJ9A 2Q9QB 4OYKA 3KVAA 3T8OA 4TV9E 1D1CA 5ADXL 4H9NC 1MIWA 1US7B 4JEUB 4AQGA 4EAHA 1T98A 5J2UE 2PBIA 3PU8A 2CEAA 1BR1A 4PK5A 5F8PA 4AKGA 1MMDA 4JEHB 3MKDA 3CQXC 1OXZA 3N9LA 3ZCJA 4V1Av 2P9BA 4AKLA 2WWUA 3N9MA 4YJ2E 3K3NA 2X9XA 3ETVA 3N2KE 3Q5WA 5L3EB 3RH3A 2A72A 5LJMA 2D5UA 4DNDA 2QGSA 3MA9A 3O9XA 2Y6XA 3BQIA 3BK9A 2LHRA 4IGUA 4YJ3E 2CLYC 4UV9B 5L3FB 2CWYA 4EYYR 2Q9QD 3I0QA 3N9PA 4WW0A 1KNZA 4ZS3A 2K48A 4MFRA 3CMLA 2KWIB 5JR9B 5L2LA 2BVLA 3RYIE 2LSGA 2DWGA 2LSKA 3AA6B 2LOSA 2E9XA 3ZC1A 2NTYA 3ZJ2A 2OA5A 1U4QA 3KINB 3O1HA 3C4WA 2KINB 4BAYB 1D1BA 2A2FX 2KWHA 3FHNA 2HPJA 4NUVA 4P09A 5GONE 5HXEA 3CQGB 3EDVA 5DQVA 4FI5A 3ZPOA 3C4XA 2L9QA 1MIVA 1LRZA 3PU3A 3QC9A 3AB3B 2LSJA 2WBLA 2NW7A 3VKHA 3Q2MA 4HEAA 1SHZC 2LSIA 5HAXA 2BZBA 4TZ4C 2DNXA 2PFVA 1BR2A 3HKEE 3N9NA 2CXDA 4PJMA 1UX5A 4O4IE 2KMFA 3L3PA 4KMCA 5BMVE 2KZ7B 2A3DA 5L3GB 2E8IA 4X20E 5EK4A 4YFSA 2KNDA 2RA1A 4IHJE 2NWBA 3I9WA 5JDMA 5LGNB 4MHCA 2UXXB 5LJNA 3KBUA 3UT5E 4XZCA 3H3AA 1LKXA 2LM9A 2ODUA 5FY1A 3ZMZB 3H37A 5DQWA 5M4YA 4ZI3C 4DBQA 1S35A 3CX6B 2EHOC 1KK7A 3PE0A 5FXXA 2X9WA 3JC6C 4NUUA 3SRZA 4O4HE 3MXZA 2UXNB 1VRBA 3TKLB 4AKRB 3AAIA 2JMHA 3OYXA 3C64A 3C51A 1E1HB 2C5JA 5HYAA 4I4TE 3FBLA 3ZMTB 2DI4A 5A1LA 1G8XA 4HFVA 4GK0E 3U78A 3CPZA 5IHYA 4X1YE 2X66A 4ZHQE 1ZKEA 3HA4A 5LCYA 3IHRA 1Y64B 3BQLA 4KP3C 2NTXA 2PJQA 1B7TA 3VHLA 4B6XA 2VK9A 3M65A 3RKOA 3AAEB 3RRWA 2V7MA 4JLEA 2M67A 4ZI7E 4XAXB 2NP9A 4HGAA 4ZS2A 2Y48B 3D0TA 2VKDA 4GK5E 3UUXB 2RP4A 3LBXB 1D1AA 2CXLA 3BQKA 2E9XB 2V7KA 3OBVE 4GYRA 5JQGE 3OYZA 1D0ZA 3MJXA 4N78D 4AQFA 3ZYKA 5J1GA 4CI1B 4CXYA 3HR0A 3ZYLA 1FMVA 2XASB 3GA8A 3N2OA 4I55E 3HKCE 4X1KE 1WRDA 4CI3B 4ZOLE 1YKHB 2LJLA 4EZHA 2XAHB 4IE4A 3MACA 4CZZB 3N9OA 4AI6A 5LYJE 1HX8A 2WM9A 3PDYA 4XBFB 3GN5A 4UELA 3K3QC 5LOVE 3SS1A 4H9OC 3J7Yq 3NZQA 3KV6A 4ERRA 5AFUL 4AKHA 3DP7A 3V5UA 3ZLIA 5FYMA 3LK42 5KMGP 3KV5A 5HXSA 2CWOA 3RC8A 4H9SE 1EZ3A 3GMIA 2E9XD 3K8PC 1LVKA 2H7VC 2ZLYA 3L09A 4PFOA 4IE6A 2HH7A 3UUMA 3CVRA 4C90A 1CUNA 2NW8A 4U74A 3A5XA 4AXPA 2Q9QC 4IIJE 2LSYA 4BJNA 4PK6A 2V7LA 3C50A 3LBXA 3PUAA 5FP3A 4O8SA 2G0UA 5KX5E 2K24A 4UIGA 4OFZA 4EB6E 5JDQA 4O4JE 2X68A 4ADZA 4L9IA 5ETWA 1MMGA 3SOLA 4L5GA 3UFEA 4BJMA 3AAAB 4UVCB 3E22E 4EZ4A 5LXTE 4UF0B 2KT9A 4DBRA 4G2AA 4OHFA 4QXCB 2Z6EA 4EYUA 3CX8B 4ZI2D 4ILUA 2JRKA 4KUMB 3Q5XA 1ZHCA 5JDHA 1IAPA 4H9QC 5JREA 2C5IT 2ES0A 4PAGA 2YU1A 2NW9A 3ONXA 3F31A 2WSSV 4QX7B 5LA6E 2PG8A 2MBGA 5EZYE 1IJ5A 1G73A 5LG4A 2J1DG 4CXWA 1ZEEA 5JR9C 5LNKA 2WMNA 4QXHB 1UX4A 5FY7A 2V7IA 4TX5A 5JRCA 2X0LB 4OK0A 4IDZA 4QXBB 2XAJB 1YKEB 2W61A 3UTKA 3HL6A 3SWHA 4CQIA 2BDEA 2W0GA 1NWMX 1QUUA 1LVFA 2JMKA 2X9YA 1WLXA 3N2GE 2YK0A 1YW0A 3FBZA 4P0AA 1BR4A 3GN5B 2V7JA 3IBPA 3AVRA 1UCUA 3C4ZA 4MLKA 4U72A 4QWNB 2LHNA 2MTQA 5CA1E 4UF0A 4BA9A 2YINA 2C0SA 1H7CA 1IZNB 3AA0B 1D0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OYK A;  4OYJ A;  5LJM A;  2D5U A;  2CM0 A;  4JUY A;  2HPL A;  4P0A A;  2HPJ A;  4P09 A;  5LJN A;  4P0B A;  2CCQ A; 
#chains in the Genus database with same CATH topology
 2YDR A;  5LMN T;  2I6H A;  2W4X A;  2QVA A;  2BKO A;  2KLQ A;  3RX6 A;  2WQY A;  3I0O A;  4P1N A;  5DJQ C;  4WYV A;  4J2C A;  5L3D B;  3PTR B;  3V5S A;  5HXC A;  3ESL A;  2XQ5 A;  3ZN0 B;  2ACX A;  3ZMV B;  3RRC A;  1J5E T;  4DO0 A;  3RIA A;  4HWH A;  2CLY B;  2D2S A;  4COF A;  2JPF A;  1M62 A;  2QA7 A;  5LHG B;  5H6R B;  2LRK A;  3AEB A;  3Q9D A;  5F3J A;  2VKH A;  3AVS A;  2W2U A;  3ZYM A;  5JRC B;  3CX7 B;  4HFB A;  3W15 B;  3ZT5 A;  1OWA A;  3OKQ A;  4IT4 A;  5FXZ A;  2M6B A;  3O4X E;  5LGU B;  2N1G A;  3RQU A;  3C98 B;  3M3Z B;  1MIY A;  3IEE A;  4YY3 T;  5DAB A;  2BG9 A;  1IJ6 A;  3I9Y A;  2XQY A;  4DR2 T;  2F4V T;  3ZN1 B;  3ZCI A;  5FXW A;  2XUE A;  3DJB A;  4C91 A;  2LOP A;  3ZMU B;  1WCR A;  3F57 A;  5JDL A;  2GK9 A;  3HI2 A;  2EHO B;  2XAQ B;  3WAJ A;  4DV7 T;  3RIF A;  2W62 A;  3MZK B;  3P8C D;  3RC3 A;  3AA7 B;  4QHO A;  2XSB A;  4NXN T;  2IC6 A;  4OYJ A;  2JIW A;  2WMO A;  2VKO A;  4U3C A;  5FXV A;  2E2A A;  4ZI3 D;  2MYS A;  4H63 V;  1XNQ T;  3ABV A;  4B3M T;  4O2A E;  2RPA A;  2YU2 A;  4X1I E;  5H6Q B;  3RYH E;  3N9Q A;  2HPL A;  5AQG B;  4UXN B;  3RIU A;  3CWZ B;  2X67 A;  2XJ7 A;  5HWY A;  3PUR A;  1XMQ T;  1WYC A;  3QB5 A;  4KBM B;  2UU9 T;  4HFD A;  3ANW B;  3PUG A;  1HNW T;  1JNZ A;  4IE5 A;  1Z8U A;  1HG2 A;  3ZT6 A;  4OYK A;  4A98 A;  1D1C A;  5ADX L;  1US7 B;  4JEU B;  2BS2 A;  2I0M A;  3X1D A;  1MMD A;  4JEH B;  3MKD A;  4YJ2 E;  2P9B A;  1L0V A;  4YHH T;  3RH3 A;  2A72 A;  5LJM A;  4DND A;  3MA9 A;  2Y6X A;  2BS4 A;  3BK9 A;  4IGU A;  3I0Q A;  3N9P A;  5AQH B;  1W0A A;  4KX6 A;  2BVL A;  3TLS A;  3AA6 B;  2NTY A;  3KIN B;  3LDQ B;  3UQ7 A;  3FHN A;  1KNR A;  4NUV A;  5GON E;  5HXE A;  5DQV A;  2L9Q A;  1MIV A;  1LRZ A;  1W0B A;  4DV0 T;  3Q2M A;  4HEA A;  2ZM6 T;  1IBM T;  2BZB A;  4TZ4 C;  2PFV A;  4HFE A;  2KMF A;  4KMC A;  4IHJ E;  5LGN B;  5JDM A;  5AQP B;  3UT5 E;  1HNX T;  4U2Y A;  2XQ7 A;  3ZMZ B;  5DQW A;  4ZI3 C;  1S35 A;  2X9W A;  3SRZ A;  4YSY A;  3AAI A;  3C51 A;  1E1H B;  5HYA A;  4I4T E;  1T8B A;  4QH4 A;  3CPZ A;  4ZHQ E;  2BS3 A;  1Y64 B;  2NTX A;  2PJQ A;  3RKO A;  3RRW A;  2NP9 A;  3LBX B;  3BQK A;  3A8Y C;  3HKC E;  4ZOL E;  4EV6 A;  5LYJ E;  1GQE A;  2UUC T;  5LOV E;  2IHR 1;  4HWD A;  4AKH A;  5FYM A;  3KV5 A;  5LMU T;  2A9U A;  3AEG A;  2BG9 C;  3PUV F;  3AE4 A;  3CVR A;  2NW8 A;  4U74 A;  3C50 A;  2UXB T;  2G0U A;  2K24 A;  4JI6 T;  1OED B;  2LKH A;  4L9I A;  1MMG A;  3SOL A;  3UFE A;  4KI0 F;  5LXT E;  2KT9 A;  4DBR A;  2J47 A;  4QXC B;  2WP9 A;  2XM2 A;  4LF4 T;  3CX8 B;  3PJA J;  5JRE A;  4PAG A;  2YU1 A;  4DV5 T;  1KF6 A;  1G73 A;  2WS3 A;  1UX4 A;  4TX5 A;  5JRC A;  4OK0 A;  4IDZ A;  4QXB B;  2XAJ B;  2W61 A;  3UTK A;  3RIU C;  4HFH A;  2FJB A;  4X5T A;  2QYW A;  3UQ4 A;  4P0A A;  3P4R A;  4MLK A;  5AQU B;  3UU3 A;  4QWN B;  3VRB A;  4BA9 A;  1M7K A;  2C0S A;  1IZN B;  4DUZ T;  1D0Y A;  4ASK A;  3IA3 A;  3NZP A;  3KV4 A;  4GIW A;  2WDV A;  4ANJ A;  4I50 E;  3R84 B;  3O1I A;  4ILC A;  4TWH A;  4YSZ A;  4EGW A;  2LEH A;  3E0Z A;  4DMW A;  4UEM A;  2EHO A;  1YD8 G;  3RYF E;  2FJA A;  3LG7 A;  5J2T E;  2VAS A;  5FKY A;  3FZK B;  3LFM A;  3RI5 A;  5L3B B;  5LG3 A;  3B13 A;  2VVN A;  4WNK A;  4OX9 T;  5AQL B;  2CM0 A;  3UU5 A;  2D0T A;  5HEH A;  4B3S T;  4UR9 A;  1HR0 T;  3SFE A;  4YHJ A;  3ZJ1 A;  1HCI A;  5BR8 T;  1JNR A;  2XQ4 A;  4DV4 T;  5FMN A;  3P4W A;  3QOF A;  2HN2 A;  3EDU A;  4ILB A;  4AQY T;  2IC9 A;  2BG9 E;  4CN1 A;  3ANW A;  4IDN A;  4E7S A;  3UFG A;  5CA0 E;  2VWA A;  4O2B E;  1Z0P A;  2SPC A;  4UVB B;  4E7Z A;  3F2E A;  1BR0 A;  3MK7 C;  5FL1 A;  4O4L E;  4EOZ B;  1FIO A;  5KDM C;  4PW8 A;  5LHH B;  2KXP B;  3RHW A;  3QUJ A;  2X51 A;  1HG5 A;  3OJA A;  5AQF B;  1MNE A;  3ONJ A;  1AJ3 A;  5AQJ B;  4UVA B;  3VU7 H;  4IE7 A;  4IST A;  3Q5D A;  4HE8 A;  2DLR A;  5IYZ E;  3FXD B;  2EHO D;  2ODV A;  1T72 A;  4NPP A;  2JQK A;  2WY2 A;  5E0O A;  4DR3 T;  4HKA A;  1NEN A;  3QNU A;  3UUB A;  2D0U A;  2YDS A;  4F6R C;  1S94 A;  2VL8 A;  3AXJ B;  1NAF A;  5JH7 E;  3NRX A;  1V9D A;  1XZY A;  3B57 A;  4QX8 B;  5AQO B;  5LB7 B;  4LFC T;  2VUR A;  3EUH A;  3AE3 A;  2YEV C;  1XDO A;  4WBN E;  2ZM8 A;  2DCF A;  2B76 A;  3UUL A;  2CMR A;  3K3O A;  5FNV E;  3PUQ A;  2HHH T;  3KVA A;  3T8O A;  4AQG A;  1Y01 A;  2BBH A;  4EAH A;  1BR1 A;  4PK5 A;  5F8P A;  2IML A;  4AKL A;  2WWU A;  3N9M A;  3K3N A;  3Q5W A;  4HFI A;  4U7I A;  2IDO B;  2LHR A;  4YJ3 E;  2CLY C;  2CWY A;  2MAW A;  3EAM A;  4WW0 A;  1KNZ A;  3TLU A;  4U2Z A;  4MFR A;  3RYI E;  4DR4 T;  3ZC1 A;  4YTN A;  2KIN B;  2A2F X;  2YKS A;  2HPJ A;  3FZL B;  4P09 A;  4FI5 A;  3C4X A;  3PU3 A;  2WDR A;  2LLY A;  2LSI A;  3N9N A;  3HKE E;  4PJM A;  5BMV E;  2A3D A;  5EK4 A;  2VQF T;  4YFS A;  2KND A;  4X66 T;  2NWB A;  4IL9 A;  5LJN A;  4XZC A;  4YXD A;  3EAB A;  5FY1 A;  5M4Y A;  2YDQ A;  3CX6 B;  2EHO C;  4NUU A;  4O4H E;  5CJ5 A;  1OED A;  3TKL B;  4AKR B;  3OYX A;  5F5W A;  3FBL A;  4JI5 T;  4DR7 T;  1G8X A;  4HFV A;  4LF5 T;  3L8R A;  1FJG T;  4X1Y E;  3IHR A;  5ABF B;  4LMJ A;  3VHL A;  2VK9 A;  3M65 A;  2V7M A;  4LML A;  4HGA A;  3JAF A;  3UUX B;  2VKD A;  2CXL A;  2E5V A;  4GKK T;  2E9X B;  2FUP A;  1D0Z A;  4AQF A;  3ZYK A;  5FL0 A;  3HR0 A;  2XAS B;  1WRD A;  1YKH B;  2V6Y B;  2XAH B;  3N9O A;  2FJD A;  4AI6 A;  2XQ6 A;  2WU5 A;  3K3Q C;  2ACZ A;  3SS1 A;  3DP7 A;  3EHZ A;  3RC8 A;  3GMI A;  1LVK A;  2H7V C;  4IE6 A;  3UUM A;  4C90 A;  1VCT A;  1CUN A;  4F8H A;  3A5X A;  4HWF A;  4IIJ E;  4BJN A;  4PK6 A;  2V7L A;  3CK6 A;  1I6Z A;  3AE2 A;  5FVL A;  5ETW A;  4A97 A;  4BJM A;  4EZ4 A;  2CHN A;  5HEG A;  3ONL C;  1J1J A;  3FZM B;  4OHF A;  3PUZ F;  5C3J A;  4TNW A;  2JRK A;  3Q5X A;  1ZHC A;  1J5W A;  2XSA A;  2PG8 A;  4I0U A;  3NWI A;  2V7I A;  5L4H A;  1YKE B;  2BDE A;  2W0G A;  1NWM X;  4IDO A;  1LVF A;  1SE7 A;  2X9Y A;  1WLX A;  3GN5 B;  2V7J A;  3IBP A;  3AVR A;  4AIS A;  2IIU A;  4JBW F;  5CA1 E;  4UF0 A;  1H7C A;  3FZH B;  3LK3 B;  3AA1 B;  3OVU A;  5JDN A;  4U7Y A;  5FY0 A;  3FB2 A;  2IUB A;  5HXH A;  3G06 A;  2W00 A;  2CXF A;  2N9D A;  1ZV4 X;  5CGM A;  4B3T T;  2WDQ A;  2XQ3 A;  5HEO A;  2X0Y A;  1SA0 E;  4IRE A;  3SFD A;  2H7O A;  4ZZC A;  2XAG B;  4ZXL A;  3RPU A;  4JI8 T;  4JYA T;  3E08 A;  5LBQ B;  4H9P C;  5HXR A;  4L0R A;  3ETU A;  4I43 B;  1WR0 A;  3GWH A;  3EVY A;  1KNP A;  2V1D B;  3N5L A;  1YXR A;  4HN9 A;  5LBM A;  4DMV A;  2IAK A;  3RQW A;  4EXT A;  4YLH A;  5HCM A;  3FXE B;  5HWX A;  3AEC A;  4GYS A;  2BVM A;  4TWD A;  3O1J A;  5KXJ A;  3AXJ A;  3TLT A;  1XMO T;  2Y8D A;  2CE7 A;  2L3L A;  3WAK A;  3ZST A;  2C5K T;  4CXX A;  1W9R A;  4ISS A;  1X9B A;  2JQQ A;  2MOZ A;  1XWM A;  3FZF B;  4HWI B;  3P7I A;  3S4U A;  1FEW A;  4U33 A;  1FMW A;  2WAU A;  1OED C;  3KDS E;  4AKI A;  3ZEF B;  1XDP A;  3KFW X;  4JUY A;  2W67 A;  5L3C B;  1HFA A;  3PJA A;  5L4E A;  4QH5 A;  1N36 T;  4TUY E;  2ZMA A;  3P4Q A;  4H9R C;  3DTO A;  5JVD E;  2L8K A;  3AE7 A;  4P0B A;  1HS7 A;  2XHE B;  2CCQ A;  2UUA T;  4PJL A;  3QK6 A;  4AQF C;  3AE9 A;  1SUM B;  4HFC A;  3U3I A;  4IL4 A;  5LHI B;  4PJN A;  2DHR A;  1WYB A;  1QSD A;  3AE6 A;  3LSV A;  2W63 A;  2H3R A;  3JAD A;  3EI0 A;  4WBO A;  2ZM0 A;  3ZSS A;  2V5C A;  4Z8X A;  4YTP A;  3B5M A;  4K0K T;  2Q9Q B;  1MIW A;  1T98 A;  2PBI A;  3PU8 A;  2CEA A;  1UUS A;  4JV5 T;  2CRB A;  4AKG A;  3CQX C;  3N9L A;  2W66 A;  2CHO A;  2XY8 B;  2D5U A;  2LRL A;  3AEA A;  2UUB T;  1I94 T;  1NEK A;  2XM1 A;  5ABF A;  5L3F B;  5AQM B;  2HN1 A;  2KSR A;  3AE1 A;  4KHP T;  2WB5 A;  3CML A;  5HEU A;  5JR9 B;  2WCA A;  2LSG A;  3T1Y T;  4Z90 A;  2LOS A;  2E9X A;  1DU2 A;  2OA5 A;  3O1H A;  4JI7 T;  4BAY B;  1D1B A;  2KWH A;  3UU4 A;  2V6Y A;  3ZPO A;  2J4G A;  2WZI A;  3AB3 B;  1SHZ C;  5HAX A;  1CHU A;  3TLW A;  1BR2 A;  1UX5 A;  3PUW F;  3AED A;  4DR6 T;  2RA1 A;  3I9W A;  5C2T A;  4MHC A;  1YQ3 A;  1OED E;  2UXX B;  2AXD S;  4Q25 A;  3H3A A;  2JQH A;  4DBQ A;  3PE0 A;  5FXX A;  2UXN B;  1VRB A;  2JMH A;  3ZMT B;  2DI4 A;  4HWC A;  3K1S A;  4EEB A;  4GK0 E;  3OPC A;  5IHY A;  2LKG A;  2X66 A;  1ZKE A;  5LCY A;  1WFD A;  4ILA A;  1B7T A;  4B6X A;  4JLE A;  2M67 A;  4XAX B;  4ZS2 A;  2Y48 B;  2CBJ A;  2RP4 A;  1D1A A;  5AQT B;  4AIU A;  1VCS A;  2V7K A;  3OBV E;  4GYR A;  4TNV A;  5AQN B;  4LF8 T;  3MJX A;  4N78 D;  4CI1 B;  1N33 T;  3ZYL A;  1FMV A;  3GA8 A;  2PTF A;  4I55 E;  4X1K E;  3OTO T;  1UGO A;  3AE8 A;  4EZH A;  4IE4 A;  3MAC A;  4CZZ B;  1HX8 A;  3H3M A;  4XBF B;  3GN5 A;  4UEL A;  4DR1 T;  4H9O C;  2XZE A;  3NZQ A;  3KV6 A;  4ERR A;  5AFU L;  1YQ4 A;  3ZLI A;  2QRX A;  5KMG P;  5HXS A;  4DV1 T;  1EZ3 A;  2E9X D;  2YOE A;  4LF7 T;  3L09 A;  2HH7 A;  5ABG A;  4DR5 T;  2XQA A;  2VVS A;  2LSY A;  5JTG A;  3LBX A;  3RKG A;  4UIG A;  4O4J E;  4ADZ A;  4L5G A;  3E22 E;  2Z6E A;  2FJE A;  4IDQ A;  4ZI2 D;  4KUM B;  5JDH A;  2C5I T;  2ES0 A;  1N32 T;  2XQ8 A;  2NW9 A;  3ZKR A;  4QX7 B;  5LA6 E;  2MBG A;  5EZY E;  1IJ5 A;  3P50 A;  5LG4 A;  2J1D G;  4CXW A;  2WMN A;  4QXH B;  2UXC T;  5FY7 A;  3UU8 A;  4JI0 T;  4WZX A;  1QUU A;  3N2G E;  1YW0 A;  1UCU A;  5ABE A;  2LHN A;  2MTQ A;  3AA0 B;  3VKG A;  4YTM A;  4DV6 T;  4H63 H;  2VKJ A;  5LGT B;  3RYC E;  2B1E A;  4GOU A;  5J0Z A;  3KVB A;  1R8I A;  1WR6 A;  2ZM2 A;  4PFP A;  1X79 A;  2YN6 A;  4DV2 T;  4QKN A;  1U5P A;  2WZH A;  2VB6 A;  3UUN A;  2DWK A;  5AQS B;  4NIQ A;  3ZT7 A;  3LJC A;  4M1P A;  3A7M A;  4FJO A;  3AE5 A;  4PK4 A;  3NVO A;  4TN7 B;  3CQC B;  3IF8 B;  3RLF F;  5JDF A;  5C8Y E;  4DVD A;  4PJJ A;  3NBX X;  3WI3 A;  3ZMS B;  2IW5 B;  3NRY A;  2E9X C;  1T7S A;  3P4S A;  4JI1 T;  2XTL A;  1VOM A;  3HKD E;  4EED A;  2V26 A;  3PUX F;  3AEF A;  4G63 A;  1MMA A;  1HTJ F;  4UV8 B;  2H89 A;  2NOX A;  4LF9 T;  2LT3 A;  4ZI2 C;  2DL1 A;  3KV9 A;  2CA5 A;  4IE0 A;  4HTE A;  2Q9Q A;  4ZEY A;  2I59 A;  1MND A;  5AQI B;  4CI2 B;  5AQK B;  2M6I A;  4EIW A;  1KFY A;  5CB4 E;  2V8S V;  5EK3 A;  3QB5 K;  3I1A A;  4A56 A;  4B3R T;  1HF8 A;  3AEE A;  3PUS A;  1O3X A;  2N2N A;  4DV3 T;  5EK2 A;  4PNI A;  3LK2 B;  2X9H A;  2BKN A;  5TAO A;  3R6N A;  1HNZ T;  2OLT A;  3T1H T;  3JC6 D;  4CN4 A;  4K0U A;  1D0X A;  5JR9 A;  2K9A A;  4TV8 E;  5JDG A;  3CKD A;  3HKB E;  1QLB A;  3J9X 1;  4LFB T;  4MBQ A;  3Q5E A;  3KBT A;  2LE8 A;  2BG9 B;  1HX1 B;  5HCJ A;  4JI4 T;  3ZC0 A;  2XAF B;  5LP6 E;  1MMN A;  5IUX A;  4MAL A;  2VL0 A;  2K5B B;  2JJ9 A;  2CPT A;  4LMK A;  4TV9 E;  4LF6 T;  4H9N C;  5J2U E;  2R6G F;  1OXZ A;  3ZCJ A;  3UU6 A;  4V1A v;  1XNR T;  2JQ9 A;  2X9X A;  3ETV A;  3N2K E;  5FVK A;  5L3E B;  3NKZ A;  2BBJ A;  3VR9 A;  3O9X A;  2QGS A;  2LM2 A;  3BQI A;  4IDP A;  4UV9 B;  2X0H A;  4EYY R;  2Q9Q D;  4YSX A;  4KHZ F;  4X62 T;  4ZS3 A;  2K48 A;  4X64 T;  4JI2 T;  2KWI B;  5AQR B;  5L2L A;  4Z91 A;  2DWG A;  2LSK A;  4GKJ T;  3ZJ2 A;  1U4Q A;  3C4W A;  4DUY T;  2V6X A;  3CQG B;  3EDV A;  2OV9 A;  1ZP0 A;  2J62 A;  2FBW A;  3QC9 A;  2LSJ A;  2WBL A;  2NW7 A;  3VKH A;  2DNX A;  2CXD A;  2XQ9 A;  4O4I E;  3L3P A;  4X65 T;  4TWF A;  2KZ7 B;  2E8I A;  4X20 E;  3JCF A;  3KBU A;  3PUY F;  1LKX A;  2LM9 A;  2ODU A;  5CFB A;  3H37 A;  1E2A A;  1KK7 A;  3JC6 C;  5AQQ B;  4QH1 A;  3MXZ A;  4A5X A;  1E7P A;  2V5D A;  3C64 A;  2C5J A;  3VRA A;  3TLV A;  5A1L A;  3P4P A;  3U78 A;  1UUR A;  3JAE A;  3HA4 A;  3BQL A;  4KP3 C;  5HEJ A;  3AAE B;  4CN6 A;  4ZI7 E;  2AE9 A;  2UXD T;  3D0T A;  4GK5 E;  5JQG E;  3OYZ A;  3RGL A;  2H88 A;  5J1G A;  4CXY A;  3N2O A;  4CI3 B;  2LJL A;  1W09 A;  2WM9 A;  2D9D A;  3PDY A;  3RF1 A;  1ZOY A;  4U31 A;  3J7Y q;  3VR8 A;  3V5U A;  1N34 T;  3LK4 2;  3CIR A;  2CWO A;  5IWA T;  2K3W A;  4H9S E;  3K8P C;  2ZLY A;  4PFO A;  3L39 A;  4AXP A;  2Q9Q C;  3PUA A;  5FP3 A;  4O8S A;  5KX5 E;  5JDQ A;  4OFZ A;  4EB6 E;  5AQV B;  2X68 A;  5ABH A;  4LFA T;  4JI3 T;  3PV0 F;  3AAA B;  2XPK A;  4UVC B;  4UF0 B;  4G2A A;  2WU2 A;  1IBK T;  4YT0 A;  4EYU A;  4ILU A;  1IAP A;  4H9Q C;  2E5L T;  2CBI A;  3ONX A;  3F31 A;  2WSS V;  5JR9 C;  5LNK A;  1ZEE A;  1IBL T;  4NXM T;  5L47 A;  2X0L B;  3HL6 A;  3SWH A;  4ZZB A;  4CQI A;  2WWV A;  2VQE T;  2JMK A;  2YK0 A;  2BKP A;  3FBZ A;  1BR4 A;  2MPK A;  3C4Z A;  4U72 A;  1UK5 A;  4DID B;  2NR4 A;  1KEY A;  2YIN A;  5L3G B; 
#chains in the Genus database with same CATH homology
 3VKG A;  3LK3 B;  4ASK A;  3AA1 B;  3NZP A;  4H63 H;  3KV4 A;  4GIW A;  2VKJ A;  5JDN A;  5LGT B;  3RYC E;  2B1E A;  4GOU A;  5FY0 A;  3FB2 A;  4ANJ A;  5HXH A;  4I50 E;  3R84 B;  3O1I A;  2W00 A;  2CXF A;  2KLQ A;  2N9D A;  3RX6 A;  3KVB A;  1WR6 A;  1ZV4 X;  2LEH A;  2ZM2 A;  3E0Z A;  4PFP A;  3I0O A;  4DMW A;  4UEM A;  2EHO A;  1YD8 G;  3RYF E;  1X79 A;  5DJQ C;  3LG7 A;  4J2C A;  5J2T E;  1SA0 E;  5L3D B;  3PTR B;  3V5S A;  2VAS A;  3ESL A;  2H7O A;  5HXC A;  4QKN A;  3ZN0 B;  2ACX A;  3LFM A;  3ZMV B;  2XAG B;  1U5P A;  2VB6 A;  3UUN A;  5L3B B;  2DWK A;  3RPU A;  3B13 A;  3E08 A;  5LBQ B;  3LJC A;  4H9P C;  5HXR A;  4M1P A;  4WNK A;  4L0R A;  4FJO A;  3RRC A;  3ETU A;  4I43 B;  4PK4 A;  4DO0 A;  4TN7 B;  2CM0 A;  3CQC B;  2D0T A;  3EVY A;  3GWH A;  2CLY B;  2D2S A;  3IF8 B;  2JPF A;  2V1D B;  3N5L A;  4HN9 A;  2QA7 A;  5LBM A;  4DMV A;  5JDF A;  2IAK A;  5H6R B;  5LHG B;  5C8Y E;  3Q9D A;  4YHJ A;  5F3J A;  4EXT A;  4YLH A;  4DVD A;  3ZJ1 A;  1HCI A;  3NBX X;  4PJJ A;  3WI3 A;  3FXE B;  2VKH A;  3AVS A;  3ZMS B;  5HWX A;  2IW5 B;  3NRY A;  4GYS A;  3ZYM A;  2BVM A;  5JRC B;  2E9X C;  3O1J A;  5FMN A;  3CX7 B;  3EDU A;  3W15 B;  2XTL A;  1VOM A;  3HKD E;  2Y8D A;  2CE7 A;  2IC9 A;  2L3L A;  1OWA A;  3OKQ A;  2V26 A;  3WAK A;  4G63 A;  5FXZ A;  3O4X E;  1MMA A;  1HTJ F;  2C5K T;  3ANW A;  5LGU B;  2N1G A;  4E7S A;  3C98 B;  1MIY A;  4UV8 B;  5CA0 E;  3IEE A;  2VWA A;  4O2B E;  5DAB A;  4CXX A;  1IJ6 A;  3I9Y A;  1Z0P A;  4ISS A;  2XQY A;  2SPC A;  2JQQ A;  4UVB B;  3ZN1 B;  3ZCI A;  4E7Z A;  5FXW A;  2MOZ A;  2NOX A;  2XUE A;  3F2E A;  1BR0 A;  3MK7 C;  2LT3 A;  3DJB A;  4O4L E;  4ZI2 C;  4EOZ B;  1FIO A;  4C91 A;  5KDM C;  4PW8 A;  3KV9 A;  2LOP A;  2CA5 A;  4IE0 A;  4HTE A;  3ZMU B;  2Q9Q A;  3P7I A;  3S4U A;  3F57 A;  5JDL A;  1FEW A;  2I59 A;  2GK9 A;  5LHH B;  1MND A;  1FMW A;  3HI2 A;  2EHO B;  2XAQ B;  4CI2 B;  3WAJ A;  2KXP B;  2WAU A;  3QUJ A;  2X51 A;  2W62 A;  3KDS E;  4AKI A;  1HG5 A;  3OJA A;  3ZEF B;  3MZK B;  3P8C D;  3KFW X;  4JUY A;  4EIW A;  5L3C B;  1MNE A;  3RC3 A;  3AA7 B;  1AJ3 A;  5CB4 E;  5EK3 A;  3I1A A;  4QHO A;  1HFA A;  4A56 A;  4UVA B;  3VU7 H;  4IE7 A;  4IST A;  2IC6 A;  4HE8 A;  1HF8 A;  4OYJ A;  2DLR A;  3PUS A;  1O3X A;  2N2N A;  2WMO A;  5EK2 A;  2VKO A;  4PNI A;  5FXV A;  3LK2 B;  5IYZ E;  4TUY E;  2X9H A;  2ZMA A;  5TAO A;  3R6N A;  4H9R C;  3FXD B;  4ZI3 D;  2MYS A;  4H63 V;  2EHO D;  2ODV A;  3JC6 D;  3DTO A;  5JVD E;  4K0U A;  2L8K A;  1D0X A;  5JR9 A;  4P0B A;  4O2A E;  1HS7 A;  5E0O A;  2YU2 A;  4HKA A;  2XHE B;  4X1I E;  2D0U A;  5H6Q B;  2K9A A;  3RYH E;  3N9Q A;  2CCQ A;  2HPL A;  4F6R C;  1S94 A;  4PJL A;  4TV8 E;  3QK6 A;  4UXN B;  3CKD A;  2VL8 A;  4AQF C;  5JDG A;  3HKB E;  3CWZ B;  1NAF A;  5JH7 E;  2X67 A;  3NRX A;  1V9D A;  5HWY A;  3J9X 1;  3U3I A;  3PUR A;  5LHI B;  1WYC A;  4PJN A;  2DHR A;  3B57 A;  4KBM B;  1WYB A;  1QSD A;  4QX8 B;  4MBQ A;  3ANW B;  2W63 A;  2H3R A;  3EUH A;  2YEV C;  3PUG A;  4WBN E;  3KBT A;  2LE8 A;  2ZM8 A;  4WBO A;  2ZM0 A;  4IE5 A;  4Z8X A;  1HG2 A;  2DCF A;  3UUL A;  2CMR A;  3ZC0 A;  3K3O A;  2XAF B;  5LP6 E;  1MMN A;  4MAL A;  5FNV E;  3PUQ A;  2K5B B;  2JJ9 A;  2Q9Q B;  4OYK A;  3KVA A;  3T8O A;  4TV9 E;  1D1C A;  5ADX L;  4H9N C;  1MIW A;  1US7 B;  4JEU B;  4AQG A;  4EAH A;  1T98 A;  5J2U E;  2PBI A;  3PU8 A;  2CEA A;  1BR1 A;  4PK5 A;  5F8P A;  4AKG A;  1MMD A;  4JEH B;  3MKD A;  3CQX C;  1OXZ A;  3N9L A;  3ZCJ A;  4V1A v;  2P9B A;  4AKL A;  2WWU A;  3N9M A;  4YJ2 E;  3K3N A;  2X9X A;  3ETV A;  3N2K E;  3Q5W A;  5L3E B;  3RH3 A;  2A72 A;  5LJM A;  2D5U A;  4DND A;  2QGS A;  3MA9 A;  3O9X A;  2Y6X A;  3BQI A;  3BK9 A;  2LHR A;  4IGU A;  4YJ3 E;  2CLY C;  4UV9 B;  5L3F B;  2CWY A;  4EYY R;  2Q9Q D;  3I0Q A;  3N9P A;  4WW0 A;  1KNZ A;  4ZS3 A;  2K48 A;  4MFR A;  3CML A;  2KWI B;  5JR9 B;  5L2L A;  2BVL A;  3RYI E;  2LSG A;  2DWG A;  2LSK A;  3AA6 B;  2LOS A;  2E9X A;  3ZC1 A;  2NTY A;  3ZJ2 A;  2OA5 A;  1U4Q A;  3KIN B;  3O1H A;  3C4W A;  2KIN B;  4BAY B;  1D1B A;  2A2F X;  2KWH A;  3FHN A;  2HPJ A;  4NUV A;  4P09 A;  5GON E;  5HXE A;  3CQG B;  3EDV A;  5DQV A;  4FI5 A;  3ZPO A;  3C4X A;  2L9Q A;  1MIV A;  1LRZ A;  3PU3 A;  3QC9 A;  3AB3 B;  2LSJ A;  2WBL A;  2NW7 A;  3VKH A;  3Q2M A;  4HEA A;  1SHZ C;  2LSI A;  5HAX A;  2BZB A;  4TZ4 C;  2DNX A;  2PFV A;  1BR2 A;  3HKE E;  3N9N A;  2CXD A;  4PJM A;  1UX5 A;  4O4I E;  2KMF A;  3L3P A;  4KMC A;  5BMV E;  2KZ7 B;  2A3D A;  5L3G B;  2E8I A;  4X20 E;  5EK4 A;  4YFS A;  2KND A;  2RA1 A;  4IHJ E;  2NWB A;  3I9W A;  5JDM A;  5LGN B;  4MHC A;  2UXX B;  5LJN A;  3KBU A;  3UT5 E;  4XZC A;  3H3A A;  1LKX A;  2LM9 A;  2ODU A;  5FY1 A;  3ZMZ B;  3H37 A;  5DQW A;  5M4Y A;  4ZI3 C;  4DBQ A;  1S35 A;  3CX6 B;  2EHO C;  1KK7 A;  3PE0 A;  5FXX A;  2X9W A;  3JC6 C;  4NUU A;  3SRZ A;  4O4H E;  3MXZ A;  2UXN B;  1VRB A;  3TKL B;  4AKR B;  3AAI A;  2JMH A;  3OYX A;  3C64 A;  3C51 A;  1E1H B;  2C5J A;  5HYA A;  4I4T E;  3FBL A;  3ZMT B;  2DI4 A;  5A1L A;  1G8X A;  4HFV A;  4GK0 E;  3U78 A;  3CPZ A;  5IHY A;  4X1Y E;  2X66 A;  4ZHQ E;  1ZKE A;  3HA4 A;  5LCY A;  3IHR A;  1Y64 B;  3BQL A;  4KP3 C;  2NTX A;  2PJQ A;  1B7T A;  3VHL A;  4B6X A;  2VK9 A;  3M65 A;  3RKO A;  3AAE B;  3RRW A;  2V7M A;  4JLE A;  2M67 A;  4ZI7 E;  4XAX B;  2NP9 A;  4HGA A;  4ZS2 A;  2Y48 B;  3D0T A;  2VKD A;  4GK5 E;  3UUX B;  2RP4 A;  3LBX B;  1D1A A;  2CXL A;  3BQK A;  2E9X B;  2V7K A;  3OBV E;  4GYR A;  5JQG E;  3OYZ A;  1D0Z A;  3MJX A;  4N78 D;  4AQF A;  3ZYK A;  5J1G A;  4CI1 B;  4CXY A;  3HR0 A;  3ZYL A;  1FMV A;  2XAS B;  3GA8 A;  3N2O A;  4I55 E;  3HKC E;  4X1K E;  1WRD A;  4CI3 B;  4ZOL E;  1YKH B;  2LJL A;  4EZH A;  2XAH B;  4IE4 A;  3MAC A;  4CZZ B;  3N9O A;  4AI6 A;  5LYJ E;  1HX8 A;  2WM9 A;  3PDY A;  4XBF B;  3GN5 A;  4UEL A;  3K3Q C;  5LOV E;  3SS1 A;  4H9O C;  3J7Y q;  3NZQ A;  3KV6 A;  4ERR A;  5AFU L;  4AKH A;  3DP7 A;  3V5U A;  3ZLI A;  5FYM A;  3LK4 2;  5KMG P;  3KV5 A;  5HXS A;  2CWO A;  3RC8 A;  4H9S E;  1EZ3 A;  3GMI A;  2E9X D;  3K8P C;  1LVK A;  2H7V C;  2ZLY A;  3L09 A;  4PFO A;  4IE6 A;  2HH7 A;  3UUM A;  3CVR A;  4C90 A;  1CUN A;  2NW8 A;  4U74 A;  3A5X A;  4AXP A;  2Q9Q C;  4IIJ E;  2LSY A;  4BJN A;  4PK6 A;  2V7L A;  3C50 A;  3LBX A;  3PUA A;  5FP3 A;  4O8S A;  2G0U A;  5KX5 E;  2K24 A;  4UIG A;  4OFZ A;  4EB6 E;  5JDQ A;  4O4J E;  2X68 A;  4ADZ A;  4L9I A;  5ETW A;  1MMG A;  3SOL A;  4L5G A;  3UFE A;  4BJM A;  3AAA B;  4UVC B;  3E22 E;  4EZ4 A;  5LXT E;  4UF0 B;  2KT9 A;  4DBR A;  4G2A A;  4OHF A;  4QXC B;  2Z6E A;  4EYU A;  3CX8 B;  4ZI2 D;  4ILU A;  2JRK A;  4KUM B;  3Q5X A;  1ZHC A;  5JDH A;  1IAP A;  4H9Q C;  5JRE A;  2C5I T;  2ES0 A;  4PAG A;  2YU1 A;  2NW9 A;  3ONX A;  3F31 A;  2WSS V;  4QX7 B;  5LA6 E;  2PG8 A;  2MBG A;  5EZY E;  1IJ5 A;  1G73 A;  5LG4 A;  2J1D G;  4CXW A;  1ZEE A;  5JR9 C;  5LNK A;  2WMN A;  4QXH B;  1UX4 A;  5FY7 A;  2V7I A;  4TX5 A;  5JRC A;  2X0L B;  4OK0 A;  4IDZ A;  4QXB B;  2XAJ B;  1YKE B;  2W61 A;  3UTK A;  3HL6 A;  3SWH A;  4CQI A;  2BDE A;  2W0G A;  1NWM X;  1QUU A;  1LVF A;  2JMK A;  2X9Y A;  1WLX A;  3N2G E;  2YK0 A;  1YW0 A;  3FBZ A;  4P0A A;  1BR4 A;  3GN5 B;  2V7J A;  3IBP A;  3AVR A;  1UCU A;  3C4Z A;  4MLK A;  4U72 A;  4QWN B;  2LHN A;  2MTQ A;  5CA1 E;  4UF0 A;  4BA9 A;  2YIN A;  2C0S A;  1H7C A;  1IZN B;  3AA0 B;  1D0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...