4P09A

Crystal structure of hoip pub domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
177
structure length
177
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
total genus 68
structure length 177
sequence length 177
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p09A00
2HPLA 4P0BA 2CM0A 2CCQA 5LJNA 4P0AA 4OYJA 5LJMA 4JUYA 2D5UA 2HPJA 4OYKA 4P09A
chains in the Genus database with same CATH superfamily
4LFCT 4HE8A 2A9UA 5CB4E 3UU4A 4PJNA 4UF0B 2JQQA 1SUMB 2X51A 5CGMA 5LCYA 1YQ3A 3UTKA 5FXVA 3RIAA 5HXEA 4HEAA 3FBZA 1W9RA 5LXTE 5AFUL 4H9NC 3L39A 2ZM6T 5HEUA 4LF8T 2KXPB 4X1YE 1OEDB 2XQ9A 3P7IA 3M65A 3FZFB 5FMNA 5HWYA 2E9XA 2XQ5A 2UUAT 5IUXA 1H7CA 5AQKB 3T1HT 2YDRA 4K0UA 4KP3C 5FY1A 5FL1A 3ZC0A 2C5KT 4LMJA 3HA4A 5HAXA 4LF7T 4HFBA 4QWNB 5ADXL 4WBNE 2H7OA 4DR3T 1XNQT 4GK0E 1U5PA 3WAJA 1OXZA 3V5SA 1X9BA 2LSYA 2JMKA 4EYUA 4IE0A 1WFDA 4ZI3C 2C0SA 1KNPA 4Q25A 4UVBB 4UIGA 3DP7A 2UXBT 2ZM0A 3LK3B 4AKRB 2CXFA 2VKJA 2XJ7A 2XSAA 5L47A 2AXDS 2NR4A 2E8IA 4I50E 3UU5A 4G2AA 4MBQA 2BDEA 1XWMA 4UV9B 2AE9A 5HXHA 1QSDA 2WSSV 2CEAA 3AB3B 4GIWA 2WS3A 2WBLA 4QH1A 4UXNB 4HWIB 3LSVA 4PK6A 4COFA 4CN1A 1NENA 5JDNA 3OYZA 1ZV4X 2DL1A 2BS3A 2K24A 2M6IA 2MPKA 2DWKA 2EHOC 3F57A 4JI7T 2CHOA 2Q9QA 4U74A 4PW8A 4JI8T 2Q9QC 4EB6E 2LKGA 3EABA 4HKAA 4DR7T 3UULA 4U7IA 1QLBA 1HF8A 4QHOA 2UUBT 3ZN1B 1T7SA 4IDPA 4DMWA 3PUYF 4TN7B 1LRZA 2D0UA 4O2BE 5KDMC 2WU5A 1HNWT 4DR4T 4A97A 4ANJA 5F3JA 4AI6A 2N1GA 4DR2T 3J9X1 4PNIA 5LHGB 3QK6A 3NWIA 3NRYA 3VR9A 3OJAA 5CA1E 3HKBE 3L09A 3G06A 2CWYA 2FJDA 2K3WA 2VASA 2VKOA 2BG9B 2WQYA 3EDUA 5AQQB 3RPUA 4HWCA 1MMNA 2JQ9A 2FJAA 2XZEA 3A8YC 3PUAA 3NKZA 3Q5WA 2UXXB 4HWDA 2NW8A 2OLTA 2XY8B 3RYCE 5HWXA 1VOMA 1WR0A 2ODUA 2CWOA 2QVAA 4MALA 3U3IA 2ZLYA 5C2TA 2VL8A 3FZLB 5JH7E 4U3CA 1HNZT 4LF4T 1HS7A 5FXZA 2WZHA 4H63V 4GOUA 1D1CA 3P4PA 5LB7B 1QUUA 2WP9A 3RLFF 3BQKA 3JAEA 3KV4A 5FNVE 2NTYA 2PBIA 1M62A 4PFOA 2HH7A 1NAFA 2V7KA 3P4QA 3PUGA 4AXPA 3P8CD 4IE7A 3RIFA 3AE6A 4O4IE 3X1DA 4CXYA 2IHR1 3PE0A 4TUYE 2BVLA 1FMVA 3VRBA 1NWMX 3N9LA 3FB2A 3UU8A 2EHOD 2L8KA 2LHNA 4IGUA 4YJ3E 4HFDA 5F8PA 5LJNA 4NUVA 2CHNA 3HI2A 3RIUC 3JC6C 5L3BB 4HN9A 4YHJA 4DIDB 5ABHA 1IBMT 2W62A 4BA9A 2XAJB 4CXXA 2BZBA 4EXTA 1FIOA 1E2AA 3ZYMA 2CLYC 3DJBA 3B57A 2YDQA 3N9MA 4UV8B 1LVFA 1HR0T 3ZMTB 4ILBA 4AQYT 3GA8A 3VKGA 3ZYLA 3KDSE 4X64T 4TNVA 4FJOA 2Z6EA 4ZI3D 2CLYB 1VCTA 2X67A 2YU2A 3D0TA 2V26A 3EVYA 3RQUA 4EGWA 2CBIA 3CMLA 3ETVA 3U78A 4TWFA 3OBVE 5LG4A 4U72A 5J2TE 2VQFT 2HPJA 4MFRA 5JRCA 4IE5A 5HXCA 3IHRA 1UGOA 4DR1T 2NP9A 1VCSA 2RP4A 2XAQB 4I0UA 5BMVE 3PURA 4AQFC 3ZT6A 1US7B 4PJJA 5FVLA 4F8HA 3ANWB 4QXBB 2VQET 2L9QA 2EHOA 4AQFA 5L3CB 3QUJA 4H9PC 2XQYA 1XZYA 4YSZA 5JDGA 3EI0A 4OX9T 3SOLA 3W15B 4O2AE 2VK9A 4EEBA 3FXEB 4LF5T 2IC6A 3AAAB 4KBMB 4DUZT 4LMLA 4HGAA 4DV1T 3CQCB 5DQVA 4BJNA 5LYJE 3N9OA 4U2ZA 1MNEA 1BR2A 4IE6A 3UU6A 4DV3T 4DV5T 4JI2T 4ZHQE 3JC6D 2UXDT 4E7SA 2ZMAA 5H6RB 2IIUA 2A72A 3ZMUB 4DBQA 5LGNB 2VURA 4U2YA 2NW9A 1N32T 3AEGA 1OEDA 4H63H 4UEMA 4OHFA 4KUMB 2MYSA 5AQFB 5A1LA 5JVDE 2BVMA 4IT4A 4PK4A 4PAGA 4DR5T 4A98A 5JDLA 3LG7A 1MMGA 3GWHA 3AE8A 5AQPB 4DBRA 2V7MA 2KNDA 3N2KE 3NZQA 2K48A 5L3EB 3AXJA 3QB5A 1NEKA 4JI6T 2UXNB 4B3RT 5KX5E 4IIJE 1FJGT 2CXLA 4CI3B 3VKHA 1Z8UA 2RA1A 2LE8A 4DV7T 2E5VA 3ESLA 4U31A 1WYBA 5EZYE 4EOZB 4DUYT 5HCMA 2ES0A 3ZPOA 3DTOA 3CK6A 3B13A 4X5TA 5L4EA 2KT9A 2BG9C 2W0GA 1HG2A 2WMOA 4H9OC 1I6ZA 4YSXA 3ZT7A 5J0ZA 2X0LB 1T8BA 2LRKA 3HKCE 4YLHA 4JI3T 4X65T 4DV0T 3ZEFB 1HNXT 1JNRA 4WZXA 5L3GB 4LF6T 1VRBA 4I55E 3BQIA 3WAKA 2CCQA 4LFBT 3MKDA 2JJ9A 3H37A 4UR9A 3QC9A 1D1BA 3F2EA 3I9YA 1UX4A 1WR6A 3MA9A 3PU8A 3UUBA 1HX1B 4EZHA 5LP6E 4LMKA 3FHNA 2ACXA 2W63A 3QNUA 1DU2A 1IAPA 2XSBA 4GYRA 3P4RA 2V7IA 2CXDA 5JR9A 3P50A 5L3FB 3B5MA 3RHWA 4WNKA 2KWIB 2CM0A 3UT5E 1YKEB 2IC9A 5FL0A 3ONJA 5AQRB 3I1AA 3KV6A 2LSJA 2KSRA 2XAGB 3LFMA 4X1KE 3OPCA 5J2UE 5L2LA 2IW5B 2IUBA 3ZT5A 2HN2A 2YINA 1WYCA 3JCFA 4V1Av 3RRWA 4ILUA 2QA7A 2M6BA 4N78D 2PFVA 1SHZC 3LK2B 2BBHA 5C8YE 2LSIA 5KXJA 3AEEA 3E22E 4ZZBA 4PJLA 1G73A 4HWHA 4I4TE 4WW0A 4JEUB 1WLXA 3GMIA 2IDOB 4PK5A 3H3MA 4AKLA 5JTGA 5LMUT 1BR4A 3E08A 4ERRA 3Q9DA 5HCJA 4GKKT 5JRCB 4X66T 1FMWA 2MBGA 1XNRT 3PU3A 2X68A 5LBMA 1E7PA 2WWVA 3M3ZB 5ABEA 2V6YA 3FZKB 2K5BB 2Q9QD 2KZ7B 2LM9A 5EK3A 3QOFA 4PJMA 5EK4A 2E5LT 5AQMB 2WMNA 1XDPA 4CN4A 3AVSA 3MACA 4Z90A 1KF6A 2B1EA 3ETUA 1EZ3A 3Q5XA 4O4HE 5H6QB 5FY7A 3UFEA 1YKHB 3KFWX 3ZCJA 5ABFA 2V7JA 1BR1A 2BKPA 5DJQC 3SFDA 3UUMA 2F4VT 4AKHA 4UVAB 1IJ5A 3HL6A 3CIRA 5JDHA 4KX6A 4MLKA 4QXCB 2E9XD 4IE4A 2KWHA 3KVBA 2YOEA 4QH5A 3O4XE 3PUWF 2W2UA 4JBWF 5L3DB 4OFZA 5AQSB 3S4UA 3FBLA 5FXXA 3N5LA 5AQVB 3SFEA 2NOXA 1W09A 3KBTA 3N2GE 4TV9E 1R8IA 3PJAA 1Y01A 3HKEE 2DLRA 1KK7A 3RX6A 2FJEA 1T72A 3CX6B 3JAFA 4GYSA 5AQNB 5F5WA 3K3QC 5CA0E 4AKIA 3RF1A 2MTQA 2B76A 3AE1A 3O1JA 4O4JE 4XBFB 3JADA 1HG5A 1B7TA 1OEDE 2X66A 3AEFA 3I0QA 3KVAA 5FVKA 4JV5T 4H9QC 2HPLA 3AE5A 3V5UA 3K3NA 2LOSA 4HFEA 2W4XA 4IDNA 4JI5T 2D9DA 3O9XA 2VKHA 3ZJ2A 4CI2B 3CPZA 2DCFA 3PUVF 5E0OA 3HR0A 2SPCA 3OVUA 3C4ZA 4QH4A 4C90A 5JR9C 1L0VA 4IL4A 3SRZA 1GQEA 2UU9T 4JI1T 4XAXB 4B6XA 4YY3T 1N36T 5AQHB 1IBKT 1S35A 2XQ8A 4O4LE 2XQ3A 3EDVA 2BBJA 2H88A 2ACZA 1MIYA 3LJCA 2XPKA 3T1YT 1CHUA 1HX8A 1MNDA 3CQGB 4JI4T 3CX7B 3BK9A 3Q5EA 2CRBA 3I0OA 3IBPA 3RKGA 3EUHA 4ILAA 4H9SE 1SA0E 4TNWA 2YKSA 2DHRA 4X20E 3RH3A 5DABA 5FXWA 4J2CA 2PJQA 1CUNA 2WU2A 2VL0A 3N9QA 4HFCA 4XZCA 2LT3A 3ZSSA 3AE9A 4CXWA 4Z91A 4DNDA 4E7ZA 2JMHA 2X0HA 5HXSA 4DV4T 2BS2A 3CQXC 2H3RA 2VVNA 2YDSA 4JUYA 1T98A 2BKNA 5LA6E 2LRLA 4A56A 1XDOA 3T8OA 2BG9E 4TX5A 1UUSA 4UELA 5IYZE 3TLUA 4K0KT 5C3JA 3PTRB 5HEOA 4ZI2D 2V6YB 2W00A 3I9WA 2UXCT 3P4WA 2LEHA 2MOZA 3K1SA 3TLWA 4NXMT 5EK2A 3AEDA 2VKDA 3KV5A 2XQ4A 3AA0B 2BKOA 3IA3A 4ILCA 3ZC1A 4AQGA 4B3TT 4CN6A 3IEEA 3GN5A 2I59A 5FYMA 3NVOA 2LJLA 2W61A 3CVRA 4OK0A 2JQHA 3CKDA 3KV9A 5ABFB 1LVKA 3BQLA 3N9NA 3WI3A 3AE3A 2VB6A 3UUXB 2CPTA 2YK0A 5AQLB 1MMAA 2NW7A 2DNXA 4MHCA 2BS4A 3RC3A 2E2AA 3LBXB 4ZI7E 3C4WA 2V8SV 4I43B 2G0UA 5LNKA 4HFIA 2NTXA 1D0ZA 4WYVA 2IMLA 4JEHB 5L4HA 4IHJE 3ZCIA 2X9YA 4HWFA 2N2NA 1IBLT 1O3XA 1MIVA 4O8SA 3AAEB 4Z8XA 4IREA 2LSKA 5FY0A 4EZ4A 5HYAA 3MJXA 4H9RC 5DQWA 3UFGA 4EYYR 2KINB 2LHRA 3C51A 3MXZA 3ONLC 4HFVA 1M7KA 4NIQA 4DR6T 4ZEYA 5JREA 5JDFA 3NZPA 2OV9A 2PG8A 3R84B 5LGUB 3UQ7A 3QB5K 2V1DB 2XAFB 3AE2A 3EHZA 2FJBA 2RPAA 2JRKA 2CBJA 2R6GF 1IZNB 2X0YA 4WBOA 1U4QA 1YXRA 2PTFA 3A5XA 4QX8B 5AQJB 2WDQA 1BR0A 4JI0T 2LOPA 1UCUA 2KMFA 4KHZF 4QXHB 4YT0A 1S94A 2X9WA 4ADZA 5HXRA 4BAYB 2LSGA 5FP3A 3A7MA 1HCIA 4OYKA 2ZM2A 4EIWA 4AKGA 3LK42 2FBWA 2A3DA 4IDZA 3AEAA 3TLVA 1D1AA 2LM2A 4X1IE 2YU1A 3L3PA 4ISTA 5JR9B 4X62T 1XMQT 3RC8A 3ZN0B 3RYFE 4HTEA 5HEHA 2LKHA 4EV6A 5LHHB 3MK7C 5IWAT 3RGLA 2I6HA 5JDQA 1UK5A 2GK9A 2YN6A 3OTOT 4KHPT 2A2FX 1D0XA 3R6NA 3HKDE 3ONXA 3C98B 3SWHA 4CZZB 2H7VC 2XAHB 2VWAA 3RQWA 5AQOB 4M1PA 3GN5B 4L5GA 2WZIA 4LFAT 1KFYA 1UURA 1YD8G 2E9XB 2J4GA 1FEWA 2FUPA 2WDVA 3VHLA 3ZMVB 5GONE 3N2OA 2M67A 4IDOA 5HEJA 3EAMA 4P09A 5HEGA 3NBXX 3LBXA 1LKXA 3ZYKA 4ZXLA 1G8XA 2E9XC 4NUUA 4YTNA 4P0AA 2V5DA 4ASKA 1KEYA 1ZOYA 3CWZB 4TZ4C 2D5UA 2K9AA 3PUZF 4QX7B 3FZMB 2KLQA 3Q2MA 4F6RC 4EEDA 4DVDA 3ABVA 1HFAA 3H3AA 4A5XA 1J1JA 2I0MA 4P1NA 3FZHB 1ZKEA 4B3ST 1MIWA 3Q5DA 1OEDC 4KI0F 4ZOLE 1ZHCA 3FXDB 4AIUA 2XHEB 2UUCT 1UX5A 3CX8B 5IHYA 3ZKRA 1W0AA 4JYAT 5M4YA 4DO0A 3RYIE 1IJ6A 1YQ4A 3AA6B 2X9XA 2CA5A 4GK5E 3F31A 5AQIB 4PFPA 2JPFA 4DV6T 3AA7B 3O1HA 3OKQA 2CE7A 4OYJA 3AECA 2DWGA 2WDRA 2D0TA 2CMRA 2L3LA 3PUXF 4JLEA 5AQTB 3VU7H 4UF0A 3RYHE 1WCRA 2YEVC 4U7YA 1KNRA 2V7LA 5LG3A 3SS1A 3RIUA 2BG9A 4ZS3A 2DI4A 2Y6XA 2ODVA 2ZM8A 5LOVE 4CQIA 2Y8DA 3TKLB 3O1IA 3L8RA 4BJMA 1D0YA 4FI5A 4L0RA 4TV8E 2V5CA 1J5ET 3J7Yq 2WAUA 4NPPA 5FKYA 4NXNT 2QGSA 2MAWA 3PUSA 4L9IA 3C64A 1E1HB 4YTMA 5JQGE 5BR8T 1N34T 2C5IT 2HHHT 4G63A 4QKNA 2XUEA 2HN1A 3UQ4A 4YTPA 1MMDA 3PUQA 2Q9QB 3KBUA 2N9DA 4IL9A 4CI1B 4C91A 5JDMA 4YFSA 5ABGA 5AQUB 3UUNA 4ISSA 4ZZCA 2NWBA 1SE7A 1ZEEA 5KMGP 4ZS2A 1AJ3A 4ZI2C 3K8PC 3OYXA 3ZMZB 3MZKB 4KMCA 5LJMA 2J62A 3ZJ1A 3AVRA 4HFHA 4IDQA 5J1GA 3TLSA 2C5JA 3AE7A 2XTLA 4AISA 2WCAA 5LMNT 3AAIA 3NRXA 1HTJF 2W66A 3PV0F 2XM2A 2EHOB 4UVCB 5LGTB 4DV2T 2WY2A 5LHIB 4YXDA 3P4SA 3VR8A 3ZMSB 5CJ5A 2H89A 1KNZA 2J1DG 3IF8B 1WRDA 4YSYA 1ZP0A 4U33A 3AE4A 2W67A 1JNZA 3C50A 1XMOT 5AQGB 2WM9A 2IAKA 1I94T 3E0ZA 2XQ6A 4DMVA 2XM1A 3AXJB 3ZSTA 2VVSA 4YJ2E 3AA1B 3ZLIA 1W0BA 3LDQB 1OWAA 2Y48B 3RI5A 1V9DA 3ANWA 4TWHA 3N9PA 2J47A 2JQKA 3AEBA 3RKOA 4LF9T 4GKJT 2QRXA 1Z0PA 2XQAA 2QYWA 5ETWA 3RRCA 2P9BA 2WWUA 5CFBA 3PJAJ 1X79A 1Y64B 4P0BA 2JIWA 2V6XA 2OA5A 3KINB 3TLTA 1J5WA 3PDYA 3UU3A 4B3MT 2XQ7A 3K3OA 3C4XA 5LBQB 5TAOA 2XASB 4EAHA 4TWDA 3VRAA 4YHHT 2X9HA 2WB5A 2D2SA 1YW0A 2LLYA 1N33T
chains in the Genus database with same CATH topology
4HE8A 5CB4E 4PJNA 4UF0B 2JQQA 2X51A 5LCYA 3UTKA 5FXVA 5HXEA 5LXTE 4HEAA 3FBZA 5AFUL 4H9NC 2KXPB 4X1YE 3P7IA 3M65A 5FMNA 5HWYA 2E9XA 1H7CA 4K0UA 4KP3C 5FY1A 3ZC0A 2C5KT 3HA4A 5HAXA 4QWNB 5ADXL 4WBNE 2H7OA 4GK0E 1U5PA 3WAJA 1OXZA 3V5SA 2LSYA 2JMKA 4EYUA 4IE0A 4ZI3C 2C0SA 4UVBB 4UIGA 3DP7A 2ZM0A 3LK3B 4AKRB 2CXFA 2VKJA 2E8IA 4I50E 4G2AA 4MBQA 2BDEA 4UV9B 5HXHA 1QSDA 2WSSV 2CEAA 3AB3B 4GIWA 2WBLA 4UXNB 4PK6A 5JDNA 3OYZA 1ZV4X 2K24A 2DWKA 2EHOC 3F57A 2Q9QA 4U74A 4PW8A 2Q9QC 4EB6E 4HKAA 3UULA 1HF8A 4QHOA 3ZN1B 4DMWA 4TN7B 1LRZA 2D0UA 4O2BE 5KDMC 4AI6A 4ANJA 5F3JA 2N1GA 3J9X1 4PNIA 5LHGB 3QK6A 3NRYA 3OJAA 5CA1E 3HKBE 3L09A 4CI3B 2CWYA 2VASA 3EDUA 3RPUA 2VKOA 5EK2A 1MMNA 3PUAA 3Q5WA 2UXXB 2NW8A 3RYCE 5HWXA 1VOMA 2ODUA 4MALA 2CWOA 3U3IA 2ZLYA 2VL8A 5JH7E 1HS7A 5FXZA 4H63V 4GOUA 1D1CA 1QUUA 3BQKA 3KV4A 5FNVE 2NTYA 2PBIA 4PFOA 2HH7A 1NAFA 2V7KA 3PUGA 4AXPA 3P8CD 4IE7A 4O4IE 4CXYA 3PE0A 4TUYE 2BVLA 1FMVA 1NWMX 3N9LA 3FB2A 2EHOD 2L8KA 2LHNA 4IGUA 4YJ3E 5F8PA 5LJNA 4NUVA 3HI2A 3JC6C 5L3BB 4HN9A 4YHJA 2W62A 4BA9A 2XAJB 4CXXA 2BZBA 4EXTA 1FIOA 3ZYMA 2CLYC 3DJBA 3B57A 3N9MA 4UV8B 1LVFA 3ZMTB 3GA8A 3VKGA 3ZYLA 3KDSE 4FJOA 2Z6EA 4ZI3D 2CLYB 2X67A 2YU2A 3D0TA 2V26A 3EVYA 3CMLA 3ETVA 3U78A 5LG4A 3OBVE 5J2TE 4U72A 5JRCA 2HPJA 4MFRA 4IE5A 5HXCA 3IHRA 2NP9A 2RP4A 2XAQB 5BMVE 3PURA 4AQFC 1US7B 4PJJA 3ANWB 4QXBB 2L9QA 2EHOA 4AQFA 5L3CB 3QUJA 4H9PC 2XQYA 5JDGA 3SOLA 3W15B 4O2AE 2VK9A 3FXEB 2IC6A 3AAAB 4KBMB 4HGAA 3CQCB 5DQVA 4BJNA 5LYJE 3N9OA 1MNEA 1BR2A 4IE6A 4ZHQE 3JC6D 4E7SA 2ZMAA 5H6RB 4DBQA 2A72A 3ZMUB 5LGNB 2NW9A 4H63H 4UEMA 4OHFA 4KUMB 2MYSA 5A1LA 5JVDE 2BVMA 4PK4A 4PAGA 5JDLA 3LG7A 1MMGA 3GWHA 2V7MA 2KNDA 3N2KE 3NZQA 2K48A 5L3EB 2UXNB 5KX5E 4IIJE 2CXLA 3VKHA 2RA1A 2LE8A 3ESLA 5EZYE 1WYBA 4EOZB 3ZPOA 2ES0A 3DTOA 3B13A 2KT9A 2W0GA 2WMOA 1HG2A 4H9OC 2X0LB 3HKCE 4YLHA 3ZEFB 5L3GB 1VRBA 4I55E 3BQIA 3WAKA 2CCQA 3MKDA 2JJ9A 3H37A 3QC9A 1D1BA 3F2EA 3I9YA 1UX4A 1WR6A 3MA9A 3PU8A 4EZHA 5LP6E 3FHNA 2ACXA 2W63A 1IAPA 4GYRA 2V7IA 2CXDA 5JR9A 5L3FB 4WNKA 2KWIB 2CM0A 3UT5E 1YKEB 2IC9A 3I1AA 3KV6A 2LSJA 4X1KE 2XAGB 3LFMA 5J2UE 5L2LA 2IW5B 2YINA 4V1Av 1WYCA 3RRWA 4ILUA 2QA7A 4N78D 2PFVA 1SHZC 3LK2B 5C8YE 2LSIA 3E22E 4PJLA 1G73A 4I4TE 4WW0A 4JEUB 1WLXA 3GMIA 4PK5A 4AKLA 1BR4A 3E08A 4ERRA 3Q9DA 5JRCB 1FMWA 2MBGA 3PU3A 2X68A 5LBMA 2K5BB 2Q9QD 2KZ7B 2LM9A 5EK3A 4PJMA 5EK4A 2WMNA 3AVSA 3MACA 3Q5XA 2B1EA 3ETUA 1EZ3A 4O4HE 5H6QB 3UFEA 5FY7A 1YKHB 3KFWX 3ZCJA 2V7JA 1BR1A 5DJQC 4AKHA 3UUMA 4UVAB 1IJ5A 3HL6A 5JDHA 4MLKA 4QXCB 2E9XD 4IE4A 2KWHA 3KVBA 3O4XE 5L3DB 4OFZA 3S4UA 3FBLA 5FXXA 3N5LA 2NOXA 3KBTA 3N2GE 4TV9E 3HKEE 2DLRA 1KK7A 3RX6A 3CX6B 4GYSA 4AKIA 5CA0E 3K3QC 2MTQA 3O1JA 4O4JE 4XBFB 1HG5A 1B7TA 2X66A 3I0QA 3KVAA 4H9QC 2HPLA 3V5UA 3K3NA 2LOSA 3O9XA 2VKHA 3ZJ2A 4CI2B 3CPZA 2DCFA 5E0OA 3HR0A 2SPCA 3C4ZA 4C90A 5JR9C 3SRZA 4XAXB 4B6XA 1S35A 4O4LE 3EDVA 3LJCA 1MIYA 1HX8A 1MNDA 3CQGB 3CX7B 3BK9A 3I0OA 3IBPA 3EUHA 4X20E 4H9SE 1SA0E 2DHRA 3RH3A 5DABA 5FXWA 4J2CA 2PJQA 1CUNA 4XZCA 3N9QA 4CXWA 2LT3A 4E7ZA 5HXSA 4DNDA 2JMHA 3CQXC 2H3RA 4JUYA 4A56A 5LA6E 1T98A 4DBRA 3T8OA 4UELA 4TX5A 5IYZE 3PTRB 4ZI2D 2W00A 3I9WA 2LEHA 2MOZA 2VKDA 3KV5A 3AA0B 4AQGA 3ZC1A 3IEEA 3GN5A 2I59A 5FYMA 2LJLA 2W61A 3CVRA 4OK0A 3CKDA 3KV9A 1LVKA 3BQLA 3N9NA 3WI3A 2VB6A 3UUXB 2YK0A 1MMAA 2NW7A 2DNXA 4MHCA 3RC3A 4ZI7E 3LBXB 5LNKA 3C4WA 4I43B 2G0UA 2NTXA 1D0ZA 3ZCIA 4JEHB 4IHJE 2X9YA 2N2NA 1O3XA 1MIVA 4O8SA 3AAEB 4Z8XA 2LSKA 5FY0A 4EZ4A 5HYAA 3MJXA 4H9RC 5DQWA 4EYYR 4AKGA 2KINB 2LHRA 3C51A 3MXZA 4HFVA 5JREA 5JDFA 3NZPA 3R84B 2PG8A 5LGUB 2V1DB 2XAFB 2JRKA 1IZNB 4WBOA 1U4QA 3A5XA 4QX8B 1BR0A 2LOPA 1UCUA 2KMFA 4QXHB 1S94A 2X9WA 4ADZA 5HXRA 4BAYB 2LSGA 5FP3A 1HCIA 4OYKA 2ZM2A 4EIWA 3LK42 2A3DA 4IDZA 1D1AA 4X1IE 3RC8A 2YU1A 3L3PA 4ISTA 5JR9B 3ZN0B 3RYFE 4HTEA 5LHHB 3MK7C 5JDQA 2GK9A 2A2FX 1D0XA 3R6NA 3HKDE 3ONXA 3C98B 3SWHA 4CZZB 2H7VC 2XAHB 2VWAA 4M1PA 3GN5B 4L5GA 1KNZA 1YD8G 2E9XB 3VHLA 1FEWA 3ZMVB 5GONE 3N2OA 2M67A 4P09A 3NBXX 3LBXA 1LKXA 3ZYKA 4P0AA 1G8XA 2E9XC 4NUUA 4ASKA 3CWZB 4TZ4C 2D5UA 2K9AA 4QX7B 2KLQA 4F6RC 4DVDA 1HFAA 3H3AA 1ZKEA 1MIWA 4ZOLE 1ZHCA 3FXDB 2XHEB 1UX5A 3CX8B 5IHYA 5M4YA 4DO0A 3RYIE 1IJ6A 3AA6B 2X9XA 2CA5A 4GK5E 3F31A 4PFPA 2JPFA 3AA7B 3O1HA 3OKQA 2CE7A 4OYJA 2DWGA 4JLEA 2D0TA 2CMRA 2L3LA 3VU7H 4UF0A 3RYHE 2YEVC 2V7LA 3SS1A 4ZS3A 2DI4A 2Y6XA 2ODVA 2ZM8A 5LOVE 4CQIA 2Y8DA 3TKLB 3O1IA 4BJMA 1D0YA 4FI5A 4L0RA 4TV8E 3J7Yq 2WAUA 2QGSA 3PUSA 4L9IA 3C64A 1E1HB 5JQGE 2C5IT 4G63A 4QKNA 2XUEA 1MMDA 3PUQA 2Q9QB 3KBUA 2N9DA 4CI1B 4C91A 5JDMA 4YFSA 3UUNA 4ISSA 2NWBA 1ZEEA 5KMGP 4ZS2A 4ZI2C 3K8PC 3OYXA 3ZMZB 3MZKB 4KMCA 5LJMA 3ZJ1A 3AVRA 5J1GA 2C5JA 2XTLA 3AAIA 3NRXA 1HTJF 4UVCB 2EHOB 5LGTB 5LHIB 3ZMSB 2J1DG 3IF8B 1WRDA 3C50A 2WM9A 2IAKA 3E0ZA 4DMVA 4YJ2E 3AA1B 3ZLIA 1OWAA 2Y48B 1V9DA 3ANWA 3N9PA 3RKOA 1Z0PA 5ETWA 3RRCA 2P9BA 2WWUA 1X79A 1Y64B 4P0BA 2OA5A 3KINB 1AJ3A 3PDYA 3K3OA 5LBQB 3C4XA 5TAOA 2XASB 4EAHA 2X9HA 3Q2MA 2D2SA 1YW0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPL A;  4P0B A;  2CM0 A;  2CCQ A;  5LJN A;  4P0A A;  4OYJ A;  5LJM A;  4JUY A;  2D5U A;  2HPJ A;  4OYK A;  4P09 A; 
#chains in the Genus database with same CATH topology
 4LFC T;  4HE8 A;  2A9U A;  5CB4 E;  3UU4 A;  4PJN A;  4UF0 B;  2JQQ A;  1SUM B;  2X51 A;  5CGM A;  5LCY A;  1YQ3 A;  3UTK A;  5FXV A;  3RIA A;  5HXE A;  4HEA A;  3FBZ A;  1W9R A;  5LXT E;  5AFU L;  4H9N C;  3L39 A;  2ZM6 T;  5HEU A;  4LF8 T;  2KXP B;  4X1Y E;  1OED B;  2XQ9 A;  3P7I A;  3M65 A;  3FZF B;  5FMN A;  5HWY A;  2E9X A;  2XQ5 A;  2UUA T;  5IUX A;  1H7C A;  5AQK B;  3T1H T;  2YDR A;  4K0U A;  4KP3 C;  5FY1 A;  5FL1 A;  3ZC0 A;  2C5K T;  4LMJ A;  3HA4 A;  5HAX A;  4LF7 T;  4HFB A;  4QWN B;  5ADX L;  4WBN E;  2H7O A;  4DR3 T;  1XNQ T;  4GK0 E;  1U5P A;  3WAJ A;  1OXZ A;  3V5S A;  1X9B A;  2LSY A;  2JMK A;  4EYU A;  4IE0 A;  1WFD A;  4ZI3 C;  2C0S A;  1KNP A;  4Q25 A;  4UVB B;  4UIG A;  3DP7 A;  2UXB T;  2ZM0 A;  3LK3 B;  4AKR B;  2CXF A;  2VKJ A;  2XJ7 A;  2XSA A;  5L47 A;  2AXD S;  2NR4 A;  2E8I A;  4I50 E;  3UU5 A;  4G2A A;  4MBQ A;  2BDE A;  1XWM A;  4UV9 B;  2AE9 A;  5HXH A;  1QSD A;  2WSS V;  2CEA A;  3AB3 B;  4GIW A;  2WS3 A;  2WBL A;  4QH1 A;  4UXN B;  4HWI B;  3LSV A;  4PK6 A;  4COF A;  4CN1 A;  1NEN A;  5JDN A;  3OYZ A;  1ZV4 X;  2DL1 A;  2BS3 A;  2K24 A;  2M6I A;  2MPK A;  2DWK A;  2EHO C;  3F57 A;  4JI7 T;  2CHO A;  2Q9Q A;  4U74 A;  4PW8 A;  4JI8 T;  2Q9Q C;  4EB6 E;  2LKG A;  3EAB A;  4HKA A;  4DR7 T;  3UUL A;  4U7I A;  1QLB A;  1HF8 A;  4QHO A;  2UUB T;  3ZN1 B;  1T7S A;  4IDP A;  4DMW A;  3PUY F;  4TN7 B;  1LRZ A;  2D0U A;  4O2B E;  5KDM C;  2WU5 A;  1HNW T;  4DR4 T;  4A97 A;  4ANJ A;  5F3J A;  4AI6 A;  2N1G A;  4DR2 T;  3J9X 1;  4PNI A;  5LHG B;  3QK6 A;  3NWI A;  3NRY A;  3VR9 A;  3OJA A;  5CA1 E;  3HKB E;  3L09 A;  3G06 A;  2CWY A;  2FJD A;  2K3W A;  2VAS A;  2VKO A;  2BG9 B;  2WQY A;  3EDU A;  5AQQ B;  3RPU A;  4HWC A;  1MMN A;  2JQ9 A;  2FJA A;  2XZE A;  3A8Y C;  3PUA A;  3NKZ A;  3Q5W A;  2UXX B;  4HWD A;  2NW8 A;  2OLT A;  2XY8 B;  3RYC E;  5HWX A;  1VOM A;  1WR0 A;  2ODU A;  2CWO A;  2QVA A;  4MAL A;  3U3I A;  2ZLY A;  5C2T A;  2VL8 A;  3FZL B;  5JH7 E;  4U3C A;  1HNZ T;  4LF4 T;  1HS7 A;  5FXZ A;  2WZH A;  4H63 V;  4GOU A;  1D1C A;  3P4P A;  5LB7 B;  1QUU A;  2WP9 A;  3RLF F;  3BQK A;  3JAE A;  3KV4 A;  5FNV E;  2NTY A;  2PBI A;  1M62 A;  4PFO A;  2HH7 A;  1NAF A;  2V7K A;  3P4Q A;  3PUG A;  4AXP A;  3P8C D;  4IE7 A;  3RIF A;  3AE6 A;  4O4I E;  3X1D A;  4CXY A;  2IHR 1;  3PE0 A;  4TUY E;  2BVL A;  1FMV A;  3VRB A;  1NWM X;  3N9L A;  3FB2 A;  3UU8 A;  2EHO D;  2L8K A;  2LHN A;  4IGU A;  4YJ3 E;  4HFD A;  5F8P A;  5LJN A;  4NUV A;  2CHN A;  3HI2 A;  3RIU C;  3JC6 C;  5L3B B;  4HN9 A;  4YHJ A;  4DID B;  5ABH A;  1IBM T;  2W62 A;  4BA9 A;  2XAJ B;  4CXX A;  2BZB A;  4EXT A;  1FIO A;  1E2A A;  3ZYM A;  2CLY C;  3DJB A;  3B57 A;  2YDQ A;  3N9M A;  4UV8 B;  1LVF A;  1HR0 T;  3ZMT B;  4ILB A;  4AQY T;  3GA8 A;  3VKG A;  3ZYL A;  3KDS E;  4X64 T;  4TNV A;  4FJO A;  2Z6E A;  4ZI3 D;  2CLY B;  1VCT A;  2X67 A;  2YU2 A;  3D0T A;  2V26 A;  3EVY A;  3RQU A;  4EGW A;  2CBI A;  3CML A;  3ETV A;  3U78 A;  4TWF A;  3OBV E;  5LG4 A;  4U72 A;  5J2T E;  2VQF T;  2HPJ A;  4MFR A;  5JRC A;  4IE5 A;  5HXC A;  3IHR A;  1UGO A;  4DR1 T;  2NP9 A;  1VCS A;  2RP4 A;  2XAQ B;  4I0U A;  5BMV E;  3PUR A;  4AQF C;  3ZT6 A;  1US7 B;  4PJJ A;  5FVL A;  4F8H A;  3ANW B;  4QXB B;  2VQE T;  2L9Q A;  2EHO A;  4AQF A;  5L3C B;  3QUJ A;  4H9P C;  2XQY A;  1XZY A;  4YSZ A;  5JDG A;  3EI0 A;  4OX9 T;  3SOL A;  3W15 B;  4O2A E;  2VK9 A;  4EEB A;  3FXE B;  4LF5 T;  2IC6 A;  3AAA B;  4KBM B;  4DUZ T;  4LML A;  4HGA A;  4DV1 T;  3CQC B;  5DQV A;  4BJN A;  5LYJ E;  3N9O A;  4U2Z A;  1MNE A;  1BR2 A;  4IE6 A;  3UU6 A;  4DV3 T;  4DV5 T;  4JI2 T;  4ZHQ E;  3JC6 D;  2UXD T;  4E7S A;  2ZMA A;  5H6R B;  2IIU A;  2A72 A;  3ZMU B;  4DBQ A;  5LGN B;  2VUR A;  4U2Y A;  2NW9 A;  1N32 T;  3AEG A;  1OED A;  4H63 H;  4UEM A;  4OHF A;  4KUM B;  2MYS A;  5AQF B;  5A1L A;  5JVD E;  2BVM A;  4IT4 A;  4PK4 A;  4PAG A;  4DR5 T;  4A98 A;  5JDL A;  3LG7 A;  1MMG A;  3GWH A;  3AE8 A;  5AQP B;  4DBR A;  2V7M A;  2KND A;  3N2K E;  3NZQ A;  2K48 A;  5L3E B;  3AXJ A;  3QB5 A;  1NEK A;  4JI6 T;  2UXN B;  4B3R T;  5KX5 E;  4IIJ E;  1FJG T;  2CXL A;  4CI3 B;  3VKH A;  1Z8U A;  2RA1 A;  2LE8 A;  4DV7 T;  2E5V A;  3ESL A;  4U31 A;  1WYB A;  5EZY E;  4EOZ B;  4DUY T;  5HCM A;  2ES0 A;  3ZPO A;  3DTO A;  3CK6 A;  3B13 A;  4X5T A;  5L4E A;  2KT9 A;  2BG9 C;  2W0G A;  1HG2 A;  2WMO A;  4H9O C;  1I6Z A;  4YSX A;  3ZT7 A;  5J0Z A;  2X0L B;  1T8B A;  2LRK A;  3HKC E;  4YLH A;  4JI3 T;  4X65 T;  4DV0 T;  3ZEF B;  1HNX T;  1JNR A;  4WZX A;  5L3G B;  4LF6 T;  1VRB A;  4I55 E;  3BQI A;  3WAK A;  2CCQ A;  4LFB T;  3MKD A;  2JJ9 A;  3H37 A;  4UR9 A;  3QC9 A;  1D1B A;  3F2E A;  3I9Y A;  1UX4 A;  1WR6 A;  3MA9 A;  3PU8 A;  3UUB A;  1HX1 B;  4EZH A;  5LP6 E;  4LMK A;  3FHN A;  2ACX A;  2W63 A;  3QNU A;  1DU2 A;  1IAP A;  2XSB A;  4GYR A;  3P4R A;  2V7I A;  2CXD A;  5JR9 A;  3P50 A;  5L3F B;  3B5M A;  3RHW A;  4WNK A;  2KWI B;  2CM0 A;  3UT5 E;  1YKE B;  2IC9 A;  5FL0 A;  3ONJ A;  5AQR B;  3I1A A;  3KV6 A;  2LSJ A;  2KSR A;  2XAG B;  3LFM A;  4X1K E;  3OPC A;  5J2U E;  5L2L A;  2IW5 B;  2IUB A;  3ZT5 A;  2HN2 A;  2YIN A;  1WYC A;  3JCF A;  4V1A v;  3RRW A;  4ILU A;  2QA7 A;  2M6B A;  4N78 D;  2PFV A;  1SHZ C;  3LK2 B;  2BBH A;  5C8Y E;  2LSI A;  5KXJ A;  3AEE A;  3E22 E;  4ZZB A;  4PJL A;  1G73 A;  4HWH A;  4I4T E;  4WW0 A;  4JEU B;  1WLX A;  3GMI A;  2IDO B;  4PK5 A;  3H3M A;  4AKL A;  5JTG A;  5LMU T;  1BR4 A;  3E08 A;  4ERR A;  3Q9D A;  5HCJ A;  4GKK T;  5JRC B;  4X66 T;  1FMW A;  2MBG A;  1XNR T;  3PU3 A;  2X68 A;  5LBM A;  1E7P A;  2WWV A;  3M3Z B;  5ABE A;  2V6Y A;  3FZK B;  2K5B B;  2Q9Q D;  2KZ7 B;  2LM9 A;  5EK3 A;  3QOF A;  4PJM A;  5EK4 A;  2E5L T;  5AQM B;  2WMN A;  1XDP A;  4CN4 A;  3AVS A;  3MAC A;  4Z90 A;  1KF6 A;  2B1E A;  3ETU A;  1EZ3 A;  3Q5X A;  4O4H E;  5H6Q B;  5FY7 A;  3UFE A;  1YKH B;  3KFW X;  3ZCJ A;  5ABF A;  2V7J A;  1BR1 A;  2BKP A;  5DJQ C;  3SFD A;  3UUM A;  2F4V T;  4AKH A;  4UVA B;  1IJ5 A;  3HL6 A;  3CIR A;  5JDH A;  4KX6 A;  4MLK A;  4QXC B;  2E9X D;  4IE4 A;  2KWH A;  3KVB A;  2YOE A;  4QH5 A;  3O4X E;  3PUW F;  2W2U A;  4JBW F;  5L3D B;  4OFZ A;  5AQS B;  3S4U A;  3FBL A;  5FXX A;  3N5L A;  5AQV B;  3SFE A;  2NOX A;  1W09 A;  3KBT A;  3N2G E;  4TV9 E;  1R8I A;  3PJA A;  1Y01 A;  3HKE E;  2DLR A;  1KK7 A;  3RX6 A;  2FJE A;  1T72 A;  3CX6 B;  3JAF A;  4GYS A;  5AQN B;  5F5W A;  3K3Q C;  5CA0 E;  4AKI A;  3RF1 A;  2MTQ A;  2B76 A;  3AE1 A;  3O1J A;  4O4J E;  4XBF B;  3JAD A;  1HG5 A;  1B7T A;  1OED E;  2X66 A;  3AEF A;  3I0Q A;  3KVA A;  5FVK A;  4JV5 T;  4H9Q C;  2HPL A;  3AE5 A;  3V5U A;  3K3N A;  2LOS A;  4HFE A;  2W4X A;  4IDN A;  4JI5 T;  2D9D A;  3O9X A;  2VKH A;  3ZJ2 A;  4CI2 B;  3CPZ A;  2DCF A;  3PUV F;  5E0O A;  3HR0 A;  2SPC A;  3OVU A;  3C4Z A;  4QH4 A;  4C90 A;  5JR9 C;  1L0V A;  4IL4 A;  3SRZ A;  1GQE A;  2UU9 T;  4JI1 T;  4XAX B;  4B6X A;  4YY3 T;  1N36 T;  5AQH B;  1IBK T;  1S35 A;  2XQ8 A;  4O4L E;  2XQ3 A;  3EDV A;  2BBJ A;  2H88 A;  2ACZ A;  1MIY A;  3LJC A;  2XPK A;  3T1Y T;  1CHU A;  1HX8 A;  1MND A;  3CQG B;  4JI4 T;  3CX7 B;  3BK9 A;  3Q5E A;  2CRB A;  3I0O A;  3IBP A;  3RKG A;  3EUH A;  4ILA A;  4H9S E;  1SA0 E;  4TNW A;  2YKS A;  2DHR A;  4X20 E;  3RH3 A;  5DAB A;  5FXW A;  4J2C A;  2PJQ A;  1CUN A;  2WU2 A;  2VL0 A;  3N9Q A;  4HFC A;  4XZC A;  2LT3 A;  3ZSS A;  3AE9 A;  4CXW A;  4Z91 A;  4DND A;  4E7Z A;  2JMH A;  2X0H A;  5HXS A;  4DV4 T;  2BS2 A;  3CQX C;  2H3R A;  2VVN A;  2YDS A;  4JUY A;  1T98 A;  2BKN A;  5LA6 E;  2LRL A;  4A56 A;  1XDO A;  3T8O A;  2BG9 E;  4TX5 A;  1UUS A;  4UEL A;  5IYZ E;  3TLU A;  4K0K T;  5C3J A;  3PTR B;  5HEO A;  4ZI2 D;  2V6Y B;  2W00 A;  3I9W A;  2UXC T;  3P4W A;  2LEH A;  2MOZ A;  3K1S A;  3TLW A;  4NXM T;  5EK2 A;  3AED A;  2VKD A;  3KV5 A;  2XQ4 A;  3AA0 B;  2BKO A;  3IA3 A;  4ILC A;  3ZC1 A;  4AQG A;  4B3T T;  4CN6 A;  3IEE A;  3GN5 A;  2I59 A;  5FYM A;  3NVO A;  2LJL A;  2W61 A;  3CVR A;  4OK0 A;  2JQH A;  3CKD A;  3KV9 A;  5ABF B;  1LVK A;  3BQL A;  3N9N A;  3WI3 A;  3AE3 A;  2VB6 A;  3UUX B;  2CPT A;  2YK0 A;  5AQL B;  1MMA A;  2NW7 A;  2DNX A;  4MHC A;  2BS4 A;  3RC3 A;  2E2A A;  3LBX B;  4ZI7 E;  3C4W A;  2V8S V;  4I43 B;  2G0U A;  5LNK A;  4HFI A;  2NTX A;  1D0Z A;  4WYV A;  2IML A;  4JEH B;  5L4H A;  4IHJ E;  3ZCI A;  2X9Y A;  4HWF A;  2N2N A;  1IBL T;  1O3X A;  1MIV A;  4O8S A;  3AAE B;  4Z8X A;  4IRE A;  2LSK A;  5FY0 A;  4EZ4 A;  5HYA A;  3MJX A;  4H9R C;  5DQW A;  3UFG A;  4EYY R;  2KIN B;  2LHR A;  3C51 A;  3MXZ A;  3ONL C;  4HFV A;  1M7K A;  4NIQ A;  4DR6 T;  4ZEY A;  5JRE A;  5JDF A;  3NZP A;  2OV9 A;  2PG8 A;  3R84 B;  5LGU B;  3UQ7 A;  3QB5 K;  2V1D B;  2XAF B;  3AE2 A;  3EHZ A;  2FJB A;  2RPA A;  2JRK A;  2CBJ A;  2R6G F;  1IZN B;  2X0Y A;  4WBO A;  1U4Q A;  1YXR A;  2PTF A;  3A5X A;  4QX8 B;  5AQJ B;  2WDQ A;  1BR0 A;  4JI0 T;  2LOP A;  1UCU A;  2KMF A;  4KHZ F;  4QXH B;  4YT0 A;  1S94 A;  2X9W A;  4ADZ A;  5HXR A;  4BAY B;  2LSG A;  5FP3 A;  3A7M A;  1HCI A;  4OYK A;  2ZM2 A;  4EIW A;  4AKG A;  3LK4 2;  2FBW A;  2A3D A;  4IDZ A;  3AEA A;  3TLV A;  1D1A A;  2LM2 A;  4X1I E;  2YU1 A;  3L3P A;  4IST A;  5JR9 B;  4X62 T;  1XMQ T;  3RC8 A;  3ZN0 B;  3RYF E;  4HTE A;  5HEH A;  2LKH A;  4EV6 A;  5LHH B;  3MK7 C;  5IWA T;  3RGL A;  2I6H A;  5JDQ A;  1UK5 A;  2GK9 A;  2YN6 A;  3OTO T;  4KHP T;  2A2F X;  1D0X A;  3R6N A;  3HKD E;  3ONX A;  3C98 B;  3SWH A;  4CZZ B;  2H7V C;  2XAH B;  2VWA A;  3RQW A;  5AQO B;  4M1P A;  3GN5 B;  4L5G A;  2WZI A;  4LFA T;  1KFY A;  1UUR A;  1YD8 G;  2E9X B;  2J4G A;  1FEW A;  2FUP A;  2WDV A;  3VHL A;  3ZMV B;  5GON E;  3N2O A;  2M67 A;  4IDO A;  5HEJ A;  3EAM A;  4P09 A;  5HEG A;  3NBX X;  3LBX A;  1LKX A;  3ZYK A;  4ZXL A;  1G8X A;  2E9X C;  4NUU A;  4YTN A;  4P0A A;  2V5D A;  4ASK A;  1KEY A;  1ZOY A;  3CWZ B;  4TZ4 C;  2D5U A;  2K9A A;  3PUZ F;  4QX7 B;  3FZM B;  2KLQ A;  3Q2M A;  4F6R C;  4EED A;  4DVD A;  3ABV A;  1HFA A;  3H3A A;  4A5X A;  1J1J A;  2I0M A;  4P1N A;  3FZH B;  1ZKE A;  4B3S T;  1MIW A;  3Q5D A;  1OED C;  4KI0 F;  4ZOL E;  1ZHC A;  3FXD B;  4AIU A;  2XHE B;  2UUC T;  1UX5 A;  3CX8 B;  5IHY A;  3ZKR A;  1W0A A;  4JYA T;  5M4Y A;  4DO0 A;  3RYI E;  1IJ6 A;  1YQ4 A;  3AA6 B;  2X9X A;  2CA5 A;  4GK5 E;  3F31 A;  5AQI B;  4PFP A;  2JPF A;  4DV6 T;  3AA7 B;  3O1H A;  3OKQ A;  2CE7 A;  4OYJ A;  3AEC A;  2DWG A;  2WDR A;  2D0T A;  2CMR A;  2L3L A;  3PUX F;  4JLE A;  5AQT B;  3VU7 H;  4UF0 A;  3RYH E;  1WCR A;  2YEV C;  4U7Y A;  1KNR A;  2V7L A;  5LG3 A;  3SS1 A;  3RIU A;  2BG9 A;  4ZS3 A;  2DI4 A;  2Y6X A;  2ODV A;  2ZM8 A;  5LOV E;  4CQI A;  2Y8D A;  3TKL B;  3O1I A;  3L8R A;  4BJM A;  1D0Y A;  4FI5 A;  4L0R A;  4TV8 E;  2V5C A;  1J5E T;  3J7Y q;  2WAU A;  4NPP A;  5FKY A;  4NXN T;  2QGS A;  2MAW A;  3PUS A;  4L9I A;  3C64 A;  1E1H B;  4YTM A;  5JQG E;  5BR8 T;  1N34 T;  2C5I T;  2HHH T;  4G63 A;  4QKN A;  2XUE A;  2HN1 A;  3UQ4 A;  4YTP A;  1MMD A;  3PUQ A;  2Q9Q B;  3KBU A;  2N9D A;  4IL9 A;  4CI1 B;  4C91 A;  5JDM A;  4YFS A;  5ABG A;  5AQU B;  3UUN A;  4ISS A;  4ZZC A;  2NWB A;  1SE7 A;  1ZEE A;  5KMG P;  4ZS2 A;  1AJ3 A;  4ZI2 C;  3K8P C;  3OYX A;  3ZMZ B;  3MZK B;  4KMC A;  5LJM A;  2J62 A;  3ZJ1 A;  3AVR A;  4HFH A;  4IDQ A;  5J1G A;  3TLS A;  2C5J A;  3AE7 A;  2XTL A;  4AIS A;  2WCA A;  5LMN T;  3AAI A;  3NRX A;  1HTJ F;  2W66 A;  3PV0 F;  2XM2 A;  2EHO B;  4UVC B;  5LGT B;  4DV2 T;  2WY2 A;  5LHI B;  4YXD A;  3P4S A;  3VR8 A;  3ZMS B;  5CJ5 A;  2H89 A;  1KNZ A;  2J1D G;  3IF8 B;  1WRD A;  4YSY A;  1ZP0 A;  4U33 A;  3AE4 A;  2W67 A;  1JNZ A;  3C50 A;  1XMO T;  5AQG B;  2WM9 A;  2IAK A;  1I94 T;  3E0Z A;  2XQ6 A;  4DMV A;  2XM1 A;  3AXJ B;  3ZST A;  2VVS A;  4YJ2 E;  3AA1 B;  3ZLI A;  1W0B A;  3LDQ B;  1OWA A;  2Y48 B;  3RI5 A;  1V9D A;  3ANW A;  4TWH A;  3N9P A;  2J47 A;  2JQK A;  3AEB A;  3RKO A;  4LF9 T;  4GKJ T;  2QRX A;  1Z0P A;  2XQA A;  2QYW A;  5ETW A;  3RRC A;  2P9B A;  2WWU A;  5CFB A;  3PJA J;  1X79 A;  1Y64 B;  4P0B A;  2JIW A;  2V6X A;  2OA5 A;  3KIN B;  3TLT A;  1J5W A;  3PDY A;  3UU3 A;  4B3M T;  2XQ7 A;  3K3O A;  3C4X A;  5LBQ B;  5TAO A;  2XAS B;  4EAH A;  4TWD A;  3VRA A;  4YHH T;  2X9H A;  2WB5 A;  2D2S A;  1YW0 A;  2LLY A;  1N33 T; 
#chains in the Genus database with same CATH homology
 4HE8 A;  5CB4 E;  4PJN A;  4UF0 B;  2JQQ A;  2X51 A;  5LCY A;  3UTK A;  5FXV A;  5HXE A;  5LXT E;  4HEA A;  3FBZ A;  5AFU L;  4H9N C;  2KXP B;  4X1Y E;  3P7I A;  3M65 A;  5FMN A;  5HWY A;  2E9X A;  1H7C A;  4K0U A;  4KP3 C;  5FY1 A;  3ZC0 A;  2C5K T;  3HA4 A;  5HAX A;  4QWN B;  5ADX L;  4WBN E;  2H7O A;  4GK0 E;  1U5P A;  3WAJ A;  1OXZ A;  3V5S A;  2LSY A;  2JMK A;  4EYU A;  4IE0 A;  4ZI3 C;  2C0S A;  4UVB B;  4UIG A;  3DP7 A;  2ZM0 A;  3LK3 B;  4AKR B;  2CXF A;  2VKJ A;  2E8I A;  4I50 E;  4G2A A;  4MBQ A;  2BDE A;  4UV9 B;  5HXH A;  1QSD A;  2WSS V;  2CEA A;  3AB3 B;  4GIW A;  2WBL A;  4UXN B;  4PK6 A;  5JDN A;  3OYZ A;  1ZV4 X;  2K24 A;  2DWK A;  2EHO C;  3F57 A;  2Q9Q A;  4U74 A;  4PW8 A;  2Q9Q C;  4EB6 E;  4HKA A;  3UUL A;  1HF8 A;  4QHO A;  3ZN1 B;  4DMW A;  4TN7 B;  1LRZ A;  2D0U A;  4O2B E;  5KDM C;  4AI6 A;  4ANJ A;  5F3J A;  2N1G A;  3J9X 1;  4PNI A;  5LHG B;  3QK6 A;  3NRY A;  3OJA A;  5CA1 E;  3HKB E;  3L09 A;  4CI3 B;  2CWY A;  2VAS A;  3EDU A;  3RPU A;  2VKO A;  5EK2 A;  1MMN A;  3PUA A;  3Q5W A;  2UXX B;  2NW8 A;  3RYC E;  5HWX A;  1VOM A;  2ODU A;  4MAL A;  2CWO A;  3U3I A;  2ZLY A;  2VL8 A;  5JH7 E;  1HS7 A;  5FXZ A;  4H63 V;  4GOU A;  1D1C A;  1QUU A;  3BQK A;  3KV4 A;  5FNV E;  2NTY A;  2PBI A;  4PFO A;  2HH7 A;  1NAF A;  2V7K A;  3PUG A;  4AXP A;  3P8C D;  4IE7 A;  4O4I E;  4CXY A;  3PE0 A;  4TUY E;  2BVL A;  1FMV A;  1NWM X;  3N9L A;  3FB2 A;  2EHO D;  2L8K A;  2LHN A;  4IGU A;  4YJ3 E;  5F8P A;  5LJN A;  4NUV A;  3HI2 A;  3JC6 C;  5L3B B;  4HN9 A;  4YHJ A;  2W62 A;  4BA9 A;  2XAJ B;  4CXX A;  2BZB A;  4EXT A;  1FIO A;  3ZYM A;  2CLY C;  3DJB A;  3B57 A;  3N9M A;  4UV8 B;  1LVF A;  3ZMT B;  3GA8 A;  3VKG A;  3ZYL A;  3KDS E;  4FJO A;  2Z6E A;  4ZI3 D;  2CLY B;  2X67 A;  2YU2 A;  3D0T A;  2V26 A;  3EVY A;  3CML A;  3ETV A;  3U78 A;  5LG4 A;  3OBV E;  5J2T E;  4U72 A;  5JRC A;  2HPJ A;  4MFR A;  4IE5 A;  5HXC A;  3IHR A;  2NP9 A;  2RP4 A;  2XAQ B;  5BMV E;  3PUR A;  4AQF C;  1US7 B;  4PJJ A;  3ANW B;  4QXB B;  2L9Q A;  2EHO A;  4AQF A;  5L3C B;  3QUJ A;  4H9P C;  2XQY A;  5JDG A;  3SOL A;  3W15 B;  4O2A E;  2VK9 A;  3FXE B;  2IC6 A;  3AAA B;  4KBM B;  4HGA A;  3CQC B;  5DQV A;  4BJN A;  5LYJ E;  3N9O A;  1MNE A;  1BR2 A;  4IE6 A;  4ZHQ E;  3JC6 D;  4E7S A;  2ZMA A;  5H6R B;  4DBQ A;  2A72 A;  3ZMU B;  5LGN B;  2NW9 A;  4H63 H;  4UEM A;  4OHF A;  4KUM B;  2MYS A;  5A1L A;  5JVD E;  2BVM A;  4PK4 A;  4PAG A;  5JDL A;  3LG7 A;  1MMG A;  3GWH A;  2V7M A;  2KND A;  3N2K E;  3NZQ A;  2K48 A;  5L3E B;  2UXN B;  5KX5 E;  4IIJ E;  2CXL A;  3VKH A;  2RA1 A;  2LE8 A;  3ESL A;  5EZY E;  1WYB A;  4EOZ B;  3ZPO A;  2ES0 A;  3DTO A;  3B13 A;  2KT9 A;  2W0G A;  2WMO A;  1HG2 A;  4H9O C;  2X0L B;  3HKC E;  4YLH A;  3ZEF B;  5L3G B;  1VRB A;  4I55 E;  3BQI A;  3WAK A;  2CCQ A;  3MKD A;  2JJ9 A;  3H37 A;  3QC9 A;  1D1B A;  3F2E A;  3I9Y A;  1UX4 A;  1WR6 A;  3MA9 A;  3PU8 A;  4EZH A;  5LP6 E;  3FHN A;  2ACX A;  2W63 A;  1IAP A;  4GYR A;  2V7I A;  2CXD A;  5JR9 A;  5L3F B;  4WNK A;  2KWI B;  2CM0 A;  3UT5 E;  1YKE B;  2IC9 A;  3I1A A;  3KV6 A;  2LSJ A;  4X1K E;  2XAG B;  3LFM A;  5J2U E;  5L2L A;  2IW5 B;  2YIN A;  4V1A v;  1WYC A;  3RRW A;  4ILU A;  2QA7 A;  4N78 D;  2PFV A;  1SHZ C;  3LK2 B;  5C8Y E;  2LSI A;  3E22 E;  4PJL A;  1G73 A;  4I4T E;  4WW0 A;  4JEU B;  1WLX A;  3GMI A;  4PK5 A;  4AKL A;  1BR4 A;  3E08 A;  4ERR A;  3Q9D A;  5JRC B;  1FMW A;  2MBG A;  3PU3 A;  2X68 A;  5LBM A;  2K5B B;  2Q9Q D;  2KZ7 B;  2LM9 A;  5EK3 A;  4PJM A;  5EK4 A;  2WMN A;  3AVS A;  3MAC A;  3Q5X A;  2B1E A;  3ETU A;  1EZ3 A;  4O4H E;  5H6Q B;  3UFE A;  5FY7 A;  1YKH B;  3KFW X;  3ZCJ A;  2V7J A;  1BR1 A;  5DJQ C;  4AKH A;  3UUM A;  4UVA B;  1IJ5 A;  3HL6 A;  5JDH A;  4MLK A;  4QXC B;  2E9X D;  4IE4 A;  2KWH A;  3KVB A;  3O4X E;  5L3D B;  4OFZ A;  3S4U A;  3FBL A;  5FXX A;  3N5L A;  2NOX A;  3KBT A;  3N2G E;  4TV9 E;  3HKE E;  2DLR A;  1KK7 A;  3RX6 A;  3CX6 B;  4GYS A;  4AKI A;  5CA0 E;  3K3Q C;  2MTQ A;  3O1J A;  4O4J E;  4XBF B;  1HG5 A;  1B7T A;  2X66 A;  3I0Q A;  3KVA A;  4H9Q C;  2HPL A;  3V5U A;  3K3N A;  2LOS A;  3O9X A;  2VKH A;  3ZJ2 A;  4CI2 B;  3CPZ A;  2DCF A;  5E0O A;  3HR0 A;  2SPC A;  3C4Z A;  4C90 A;  5JR9 C;  3SRZ A;  4XAX B;  4B6X A;  1S35 A;  4O4L E;  3EDV A;  3LJC A;  1MIY A;  1HX8 A;  1MND A;  3CQG B;  3CX7 B;  3BK9 A;  3I0O A;  3IBP A;  3EUH A;  4X20 E;  4H9S E;  1SA0 E;  2DHR A;  3RH3 A;  5DAB A;  5FXW A;  4J2C A;  2PJQ A;  1CUN A;  4XZC A;  3N9Q A;  4CXW A;  2LT3 A;  4E7Z A;  5HXS A;  4DND A;  2JMH A;  3CQX C;  2H3R A;  4JUY A;  4A56 A;  5LA6 E;  1T98 A;  4DBR A;  3T8O A;  4UEL A;  4TX5 A;  5IYZ E;  3PTR B;  4ZI2 D;  2W00 A;  3I9W A;  2LEH A;  2MOZ A;  2VKD A;  3KV5 A;  3AA0 B;  4AQG A;  3ZC1 A;  3IEE A;  3GN5 A;  2I59 A;  5FYM A;  2LJL A;  2W61 A;  3CVR A;  4OK0 A;  3CKD A;  3KV9 A;  1LVK A;  3BQL A;  3N9N A;  3WI3 A;  2VB6 A;  3UUX B;  2YK0 A;  1MMA A;  2NW7 A;  2DNX A;  4MHC A;  3RC3 A;  4ZI7 E;  3LBX B;  5LNK A;  3C4W A;  4I43 B;  2G0U A;  2NTX A;  1D0Z A;  3ZCI A;  4JEH B;  4IHJ E;  2X9Y A;  2N2N A;  1O3X A;  1MIV A;  4O8S A;  3AAE B;  4Z8X A;  2LSK A;  5FY0 A;  4EZ4 A;  5HYA A;  3MJX A;  4H9R C;  5DQW A;  4EYY R;  4AKG A;  2KIN B;  2LHR A;  3C51 A;  3MXZ A;  4HFV A;  5JRE A;  5JDF A;  3NZP A;  3R84 B;  2PG8 A;  5LGU B;  2V1D B;  2XAF B;  2JRK A;  1IZN B;  4WBO A;  1U4Q A;  3A5X A;  4QX8 B;  1BR0 A;  2LOP A;  1UCU A;  2KMF A;  4QXH B;  1S94 A;  2X9W A;  4ADZ A;  5HXR A;  4BAY B;  2LSG A;  5FP3 A;  1HCI A;  4OYK A;  2ZM2 A;  4EIW A;  3LK4 2;  2A3D A;  4IDZ A;  1D1A A;  4X1I E;  3RC8 A;  2YU1 A;  3L3P A;  4IST A;  5JR9 B;  3ZN0 B;  3RYF E;  4HTE A;  5LHH B;  3MK7 C;  5JDQ A;  2GK9 A;  2A2F X;  1D0X A;  3R6N A;  3HKD E;  3ONX A;  3C98 B;  3SWH A;  4CZZ B;  2H7V C;  2XAH B;  2VWA A;  4M1P A;  3GN5 B;  4L5G A;  1KNZ A;  1YD8 G;  2E9X B;  3VHL A;  1FEW A;  3ZMV B;  5GON E;  3N2O A;  2M67 A;  4P09 A;  3NBX X;  3LBX A;  1LKX A;  3ZYK A;  4P0A A;  1G8X A;  2E9X C;  4NUU A;  4ASK A;  3CWZ B;  4TZ4 C;  2D5U A;  2K9A A;  4QX7 B;  2KLQ A;  4F6R C;  4DVD A;  1HFA A;  3H3A A;  1ZKE A;  1MIW A;  4ZOL E;  1ZHC A;  3FXD B;  2XHE B;  1UX5 A;  3CX8 B;  5IHY A;  5M4Y A;  4DO0 A;  3RYI E;  1IJ6 A;  3AA6 B;  2X9X A;  2CA5 A;  4GK5 E;  3F31 A;  4PFP A;  2JPF A;  3AA7 B;  3O1H A;  3OKQ A;  2CE7 A;  4OYJ A;  2DWG A;  4JLE A;  2D0T A;  2CMR A;  2L3L A;  3VU7 H;  4UF0 A;  3RYH E;  2YEV C;  2V7L A;  3SS1 A;  4ZS3 A;  2DI4 A;  2Y6X A;  2ODV A;  2ZM8 A;  5LOV E;  4CQI A;  2Y8D A;  3TKL B;  3O1I A;  4BJM A;  1D0Y A;  4FI5 A;  4L0R A;  4TV8 E;  3J7Y q;  2WAU A;  2QGS A;  3PUS A;  4L9I A;  3C64 A;  1E1H B;  5JQG E;  2C5I T;  4G63 A;  4QKN A;  2XUE A;  1MMD A;  3PUQ A;  2Q9Q B;  3KBU A;  2N9D A;  4CI1 B;  4C91 A;  5JDM A;  4YFS A;  3UUN A;  4ISS A;  2NWB A;  1ZEE A;  5KMG P;  4ZS2 A;  4ZI2 C;  3K8P C;  3OYX A;  3ZMZ B;  3MZK B;  4KMC A;  5LJM A;  3ZJ1 A;  3AVR A;  5J1G A;  2C5J A;  2XTL A;  3AAI A;  3NRX A;  1HTJ F;  4UVC B;  2EHO B;  5LGT B;  5LHI B;  3ZMS B;  2J1D G;  3IF8 B;  1WRD A;  3C50 A;  2WM9 A;  2IAK A;  3E0Z A;  4DMV A;  4YJ2 E;  3AA1 B;  3ZLI A;  1OWA A;  2Y48 B;  1V9D A;  3ANW A;  3N9P A;  3RKO A;  1Z0P A;  5ETW A;  3RRC A;  2P9B A;  2WWU A;  1X79 A;  1Y64 B;  4P0B A;  2OA5 A;  3KIN B;  1AJ3 A;  3PDY A;  3K3O A;  5LBQ B;  3C4X A;  5TAO A;  2XAS B;  4EAH A;  2X9H A;  3Q2M A;  2D2S A;  1YW0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...