4P09A

Crystal structure of hoip pub domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
177
structure length
177
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 68
structure length 177
sequence length 177
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p09A00
2D5UA 4P0AA 4JUYA 4OYJA 5LJMA 2HPLA 4OYKA 4P09A 4P0BA 2HPJA 2CM0A 5LJNA 2CCQA
chains in the Genus database with same CATH superfamily
1D1AA 2WWUA 5FXXA 2NOXA 4N78D 5LBQB 4QXBB 4DBQA 4JI5T 2XM1A 2FJEA 1G73A 4ZZBA 1HG2A 1UK5A 2LHRA 1MIVA 4KX6A 2WWVA 5AQIB 4JV5T 5DABA 5KDMC 3ZCIA 5CA0E 2WM9A 2NTXA 5HEJA 1OEDB 5JH7E 5J2UE 3J7Yq 1T7SA 1US7B 2XAJB 2OA5A 5L3GB 1KNRA 2DLRA 5J2TE 2NWBA 2CPTA 3AA7B 2A9UA 5L3DB 4LF7T 4UVCB 3I9YA 4QKNA 2IHR1 4KHZF 3KV6A 3UUMA 4PK6A 4NPPA 5LGTB 2LM9A 5AQFB 3T8OA 4L5GA 4ZXLA 4X65T 2DI4A 3C51A 5L47A 4HN9A 2JQ9A 2K5BB 3E0ZA 1U5PA 2VL8A 3UU3A 3U78A 2K9AA 3EI0A 4TV9E 2V6YB 2M67A 3AE2A 4Q25A 5GONE 5JR9B 4JI8T 2W2UA 1MNDA 3ZMUB 3EDUA 4JI1T 2CE7A 4L0RA 4EOZB 1QLBA 2YEVC 5F5WA 3T1YT 4F8HA 1YKHB 4IE6A 3MK7C 4ZS3A 1D0XA 5BMVE 4COFA 4JI6T 3FB2A 2LHNA 3CIRA 3RKGA 1ZKEA 3AXJA 2HPLA 3ABVA 5ABFB 2XQ7A 1HR0T 3FZHB 3I9WA 1MIYA 2JMKA 2DNXA 3E22E 3KV5A 2D0TA 2D9DA 4AKLA 2NR4A 4HWDA 3QB5K 3RLFF 3K8PC 3AEAA 4PFOA 2YU1A 5IUXA 4O2AE 3RC3A 2IIUA 3ZCJA 2Q9QB 2A3DA 1XZYA 4EZHA 4ZI3C 2CWOA 2QA7A 3P8CD 3ESLA 5JDHA 4HFIA 5FMNA 4NXNT 1NENA 1E7PA 2E9XD 1YD8G 4MBQA 3H37A 2CEAA 3PURA 1XDPA 2ACXA 2V7JA 2YDSA 1ZV4X 4DVDA 2EHOD 3I0OA 3NZPA 2DWGA 4DV7T 4KHPT 1KFYA 1NEKA 2M6IA 1UGOA 3V5UA 3PUXF 4H63V 2C0SA 3D0TA 1QSDA 4HFDA 3AA0B 3EUHA 3RPUA 3KVBA 2A72A 2D0UA 2CLYB 5JVDE 4ERRA 1IAPA 4QXCB 3AE8A 2WBLA 3PDYA 4K0UA 2BDEA 4LF6T 1N32T 3L3PA 1YQ4A 3PUQA 2MTQA 2XQ8A 2UUCT 3ZJ1A 2V1DB 4ILUA 3K3OA 5HXCA 3ETUA 3BQLA 3LK42 4ZEYA 2I59A 3CVRA 3KVAA 4CXWA 2Z6EA 3UU5A 1N36T 2JPFA 1HNWT 2XQ3A 3ZEFB 5ABHA 1YW0A 5ABFA 4AQFC 2WU2A 5JQGE 3RX6A 3MACA 3PUYF 1MNEA 5C3JA 5LMUT 2VK9A 1G8XA 3B13A 3RRWA 1Z0PA 3P4WA 2VKJA 2NW8A 4JEHB 3QC9A 2LSIA 2UXCT 4P0AA 4GKKT 3KINB 4PJJA 5LGNB 3P4PA 2E5LT 2WY2A 3PJAJ 3HKCE 5IYZE 3MJXA 2K24A 1HS7A 3HKEE 2YN6A 1HNZT 2P9BA 5FL1A 3W15B 3SWHA 5LBMA 3HI2A 3HKBE 2W00A 3JADA 2LRKA 2XQ9A 3N5LA 2OLTA 2IC9A 3R84B 3PUVF 3PUWF 3ONXA 2WQYA 1KNZA 4PJMA 2CRBA 4IE7A 3ZSTA 3IEEA 5F3JA 2YU2A 1MMNA 3QK6A 5LHHB 5JRCB 2N1GA 3NRXA 5HAXA 5HXEA 2KMFA 2EHOC 4G63A 4LF8T 2PBIA 3C64A 5LOVE 2YINA 4WYVA 5FVKA 4CN4A 3LJCA 4B6XA 5AQNB 3ZMSB 2FBWA 2X9XA 1IBKT 1Y01A 2VKHA 4AIUA 5EK3A 3N9OA 3Q2MA 3ZKRA 4O2BE 1OEDC 3FZLB 2VB6A 4F6RC 4Z90A 3ZMVB 4V1Av 5DJQC 3WAKA 3N9MA 2XHEB 3MXZA 3VRAA 3KDSE 4CN1A 1X79A 2G0UA 2LSGA 4CN6A 4YHJA 3DJBA 3RC8A 3FZKB 1SUMB 4ILBA 2N2NA 5AFUL 2FJAA 5HXHA 5J1GA 2ES0A 4HFCA 2NTYA 2BG9A 1HX1B 4A56A 2H7VC 3N9LA 2X9WA 3VR9A 5ABEA 2LSKA 1L0VA 2WS3A 1ZHCA 5JDFA 4HWFA 2W4XA 1JNZA 4ISSA 3AE7A 3P4QA 2W61A 4DV1T 1SE7A 2PTFA 4WNKA 4DMVA 4IIJE 4U72A 5JR9C 4LF4T 4ZI2C 2E2AA 3KFWX 5FYMA 4LMKA 5AQUB 3IF8B 5CB4E 2YK0A 2UUBT 2DL1A 2VQFT 5AQQB 3RQWA 4ZZCA 5BR8T 2V7KA 5HCMA 4DR6T 4IDNA 4U7IA 3RI5A 2MAWA 2HHHT 4DUZT 4IE5A 2SPCA 3IHRA 1ZP0A 2JRKA 3CQCB 3PE0A 2VKOA 5LJNA 4DR5T 3GN5B 1W0BA 4TV8E 4UIGA 5LCYA 3Q9DA 1HCIA 5LHIB 3OPCA 2KT9A 3CKDA 4TNVA 4QX8B 4KBMB 3ZPOA 5ABGA 2Q9QC 4GIWA 1YXRA 4ZOLE 3AXJB 2BS4A 2BS3A 4X66T 3GA8A 3TLWA 5AQVB 3AAAB 3CK6A 3FXEB 4ZI3D 5LNKA 2PJQA 5HXSA 3ZYMA 2UU9T 4EAHA 3KBUA 1J5ET 4OFZA 4UXNB 4JI4T 2JQKA 1GQEA 1HFAA 5HYAA 4CI1B 4E7SA 2LOSA 3FZMB 1XDOA 2X0YA 2W62A 1MMAA 2N9DA 3IA3A 4HKAA 2CLYC 3T1HT 3ZC0A 4TN7B 2YDRA 3JAEA 3N2KE 2W63A 3F57A 3LK2B 4LMJA 4YSYA 1IBLT 3ETVA 1B7TA 5ADXL 3CQGB 2QGSA 3CWZB 4EEDA 3TLSA 3MA9A 3SFEA 4HWIB 3CX6B 4UV8B 4HEAA 5L3BB 3GN5A 4YTNA 5LMNT 4I4TE 2LE8A 4YTPA 4GYRA 5H6QB 3K3NA 4JEUB 3L8RA 3UQ4A 3F31A 3AAEB 4DMWA 4PNIA 1D0YA 2BG9E 3N2GE 4EZ4A 3ZT6A 4U7YA 5L4EA 3ZT5A 2E9XA 3ZMZB 3Q5WA 2NW7A 5HWYA 2CWYA 4ILAA 3AB3B 4QH4A 4TX5A 2XQ5A 4AXPA 4U2YA 1XWMA 2R6GF 3HL6A 1JNRA 4U31A 4AISA 4XAXB 5IWAT 5LG3A 1Z8UA 2VKDA 2PFVA 5EZYE 4ADZA 3AVSA 5HWXA 4HE8A 3KV4A 3X1DA 4K0KT 5ETWA 2BS2A 4O4HE 3SRZA 2B1EA 3RIUA 5JDQA 3JC6C 3P4SA 4EYYR 2RA1A 5C2TA 1R8IA 3EHZA 1AJ3A 3N9PA 3PUGA 3AEDA 2CHNA 2DCFA 3IBPA 4GYSA 4QWNB 2KWIB 2XQAA 1V9DA 4IL4A 4AKRB 4ANJA 5LHGB 1T98A 2BKOA 4E7ZA 3UUBA 3A5XA 2CCQA 1ZOYA 2XAQB 4I50E 3ZYKA 1KNPA 4YJ3E 3UU4A 2LOPA 1LVFA 3RYIE 5L2LA 3VKGA 1BR1A 2V6XA 1E1HB 4DR4T 3OKQA 3U3IA 5L3EB 2V7IA 1FMWA 1SHZC 2L9QA 3HA4A 1I94T 2OV9A 1J5WA 3B5MA 4PAGA 5HEHA 3OYZA 3CX8B 2LM2A 3BQIA 2WZIA 3HKDE 1UX4A 2NW9A 3C50A 2YOEA 3TLUA 2BVMA 1KF6A 1W09A 2FUPA 3NKZA 2V26A 1XNQT 1ZEEA 3PUAA 4IE4A 3ZT7A 4X62T 2ZM2A 4DR2T 3CQXC 1SA0E 3VU7H 5FY7A 4B3RT 3LG7A 2ZLYA 4HGAA 4IT4A 2LLYA 2AE9A 4TNWA 2AXDS 2XTLA 4ZHQE 5HXRA 1HX8A 2IUBA 2BG9B 4NUVA 4BAYB 2DHRA 4ZI2D 4L9IA 4DUYT 4QXHB 2LEHA 5HCJA 3WAJA 1WFDA 4DV0T 5FY0A 4JI0T 3DTOA 4KP3C 4O8SA 1O3XA 5CA1E 1XNRT 2VURA 4X20E 4AKHA 4B3TT 4DV6T 5LA6E 3C4XA 2XSAA 4X1IE 2VVSA 2WDQA 2L8KA 4DV2T 5JREA 2J47A 1T8BA 5LYJE 3C98B 2KLQA 1D1BA 3NBXX 2XQ6A 4A97A 4J2CA 4JLEA 2QYWA 3OJAA 2B76A 2XAFB 4CI3B 2Q9QD 2IW5B 4YTMA 4P1NA 1WR0A 2ODUA 3NVOA 3FBZA 4EIWA 5AQHB 4FJOA 1M7KA 3AE6A 1W9RA 3ZLIA 4P09A 3I0QA 1IBMT 1IZNB 2LKHA 2C5JA 3B57A 3P7IA 4Z91A 2W0GA 3RIUC 4IL9A 4HWCA 4GKJT 2CXFA 2LJLA 4WBOA 4I43B 4IDPA 2XUEA 4YSXA 4JBWF 4KI0F 5J0ZA 4JI7T 2CXLA 1IJ6A 2BBJA 4O4LE 1OXZA 2XY8B 4UVBB 4DR3T 5EK4A 2MBGA 4KUMB 4OHFA 4DV5T 5KX5E 3TLVA 3EAMA 4C91A 4BJMA 3I1AA 4TWFA 3H3MA 2CBIA 3Q5EA 4OK0A 5AQOB 3JCFA 1XMQT 3ZJ2A 3RH3A 4C90A 4CI2B 5FNVE 2H3RA 2Y48B 4NXMT 2IAKA 3BK9A 3RKOA 4YY3T 5FY1A 3OBVE 4EEBA 2JQQA 5AQLB 3UT5E 5E0OA 1IJ5A 1YKEB 2JQHA 3PU3A 2WMOA 2YKSA 3CX7B 4GK0E 2XQ4A 3C4WA 3UUXB 1M62A 2C5KT 5LB7B 3VHLA 4PK4A 2UUAT 3R6NA 3MKDA 4YSZA 4CQIA 2FJDA 3J9X1 4TWDA 4Z8XA 4FI5A 1DU2A 1X9BA 1KK7A 2H7OA 3RYCE 1NAFA 3UULA 4U3CA 1OWAA 3AEEA 4IE0A 4PK5A 4EXTA 3ANWB 5LJMA 3PU8A 1VOMA 4HTEA 4AQGA 3C4ZA 4UEMA 4LFBT 2LRLA 4DNDA 1BR4A 2IDOB 1I6ZA 3AA6B 2GK9A 1WCRA 5L4HA 2WB5A 5C8YE 1UURA 2D2SA 1UUSA 2E9XB 2D5UA 3PUZF 3AA1B 3SS1A 2H89A 3O1HA 4OX9T 3N9QA 3OTOT 3L39A 3UU6A 4U74A 2EHOB 4OYKA 3AEFA 3JC6D 4CZZB 3UFEA 4B3ST 2I0MA 4DR1T 2J4GA 2UXNB 3O1JA 5KMGP 2Y8DA 1WLXA 3K1SA 3ONJA 4UF0A 4OYJA 2A2FX 4AKIA 3ZC1A 3FXDB 2XZEA 2ZM8A 4EV6A 1WRDA 4WZXA 3WI3A 2UXXB 4EYUA 4JYAT 3TLTA 2ACZA 1YQ3A 4DV3T 2CXDA 4HFEA 3AVRA 5AQJB 1Y64B 4XBFB 5AQMB 2CMRA 4I55E 4WW0A 4AQFA 4IGUA 5AQTB 3RF1A 2ZM6T 4H9RC 4UV9B 4IDZA 4YJ2E 1QUUA 2X68A 3LDQB 2UXDT 4PJLA 4I0UA 1HG5A 5JDMA 5AQGB 3ZMTB 1VCSA 3A8YC 2WDRA 2BKPA 3FZFB 3OVUA 2HPJA 2E5VA 5FXVA 2MOZA 4NUUA 4TUYE 1KEYA 4CXXA 2K3WA 3ANWA 4YLHA 4YT0A 1E2AA 4H9QC 2W67A 1S35A 2WMNA 3O4XE 3O1IA 3QNUA 5LG4A 5CFBA 4MLKA 3KV9A 5LXTE 2UXBT 4HWHA 1T72A 4JI2T 2RP4A 2HN1A 1D1CA 3GMIA 3M3ZB 3AEBA 2HH7A 5A1LA 3Q5XA 2NP9A 4AI6A 1HTJF 2KZ7B 2V8SV 3F2EA 4QX7B 3SFDA 2BG9C 2M6BA 3V5SA 2EHOA 2XQYA 3P50A 1LVKA 2XM2A 3CMLA 3EDVA 1U4QA 4WBNE 2JIWA 3A7MA 4DO0A 2LSJA 5AQKB 1FMVA 4O4IE 3QB5A 2YDQA 1WYBA 3L09A 3RHWA 2I6HA 3ZYLA 4A98A 2WP9A 2X0LB 3H3AA 2E8IA 1H7CA 1OEDA 4QH5A 1BR0A 5F8PA 2ODVA 3NZQA 3VR8A 3K3QC 5DQVA 2DWKA 3PUSA 3CPZA 5L3CB 2VVNA 2HN2A 3RYHE 2VWAA 3PTRB 2PG8A 4H9OC 1LRZA 4LF5T 2WAUA 5FXWA 5FXZA 2CHOA 1WYCA 3UU8A 4IDOA 5FKYA 2CM0A 1FIOA 5LGUB 5KXJA 3QOFA 3HR0A 1S94A 4TZ4C 4G2AA 4NIQA 3ONLC 3TKLB 2KNDA 2V6YA 2ZM0A 4UVAB 4BA9A 3AE9A 3QUJA 5JR9A 3SOLA 2JJ9A 5JDNA 3RRCA 5M4YA 2LSYA 4LFAT 2VQET 2X0HA 3VKHA 4ILCA 1EZ3A 4ASKA 4TWHA 2WZHA 5IHYA 2XJ7A 3AE3A 2BZBA 2BVLA 2Y6XA 4IHJE 5AQPB 2C5IT 3P4RA 5AQSB 4YFSA 3AECA 4HFBA 3RGLA 2VL0A 3Q5DA 1XMOT 1NWMX 1WR6A 3RIFA 5FP3A 1CUNA 2X67A 3E08A 1MMGA 5AQRB 4A5XA 2V7LA 3ZN1B 2CBJA 4H9NC 3DP7A 3LK3B 2K48A 3LBXB 3UQ7A 3PJAA 4U33A 5JDGA 4MALA 5JTGA 2VASA 4X64T 4H9SE 4ISTA 2Q9QA 2J1DG 4ZI7E 1MMDA 4QHOA 3ZN0B 4BJNA 1UX5A 5L3FB 3AEGA 4YXDA 4EGWA 4X1YE 2KWHA 4GOUA 4DR7T 4UR9A 2IC6A 4H63H 4HFVA 5HEGA 2E9XC 2MPKA 5DQWA 2WCAA 4JUYA 2KSRA 4QH1A 1J1JA 2X51A 2WSSV 5FL0A 5HEOA 2F4VT 4PFPA 3PV0F 1D0ZA 2ZMAA 3S4UA 4AQYT 3UUNA 3G06A 3O9XA 2QRXA 3AAIA 2IMLA 1HF8A 2V5DA 3M65A 1OEDE 3KBTA 2RPAA 5CJ5A 3OYXA 4LFCT 2KINB 4JI3T 1VRBA 4HFHA 4AKGA 2X9YA 2W66A 3LSVA 2XAHB 3GWHA 4KMCA 1W0AA 4DV4T 3NWIA 3FHNA 1BR2A 4O4JE 4LF9T 5EK2A 2X66A 4DIDB 3MZKB 3FBLA 2H88A 2XPKA 2QVAA 1MIWA 5HEUA 2MYSA 3BQKA 2KXPB 3LBXA 4UF0B 5TAOA 4YHHT 3N9NA 1N34T 5CGMA 4LMLA 3VRBA 2LKGA 4PJNA 5JDLA 3EABA 1FEWA 3ZSSA 2LT3A 1HNXT 4H9PC 5H6RB 1LKXA 2CA5A 4M1PA 4X1KE 4UELA 5LP6E 4EB6E 1N33T 3UTKA 2V7MA 2XASB 3JAFA 1UCUA 3EVYA 3RIAA 4ZS2A 2WDVA 4IDQA 3AE5A 2XAGB 2V5CA 1CHUA 3RQUA 3NRYA 5JRCA 4MFRA 2XSBA 4IREA 4U2ZA 4PW8A 2BBHA 1VCTA 4DBRA 2J62A 2L3LA 2X9HA 3AE1A 4B3MT 5FVLA 3UFGA 4P0BA 2JMHA 4X5TA 2FJBA 4MHCA 4GK5E 1FJGT 3LFMA 3AE4A 2BKNA 4CXYA 4XZCA 3RYFE 2WU5A 3N2OA
chains in the Genus database with same CATH topology
3BQIA 3N9OA 5EK3A 3HKDE 3Q2MA 4O2BE 1D1AA 2NP9A 2WWUA 4AI6A 1HTJF 5FXXA 1UX4A 2VB6A 2NW9A 2KZ7B 2NOXA 3F2EA 4N78D 4QX7B 4V1Av 5DJQC 5LBQB 3ZMVB 3C50A 3WAKA 3N9MA 3V5SA 2BVMA 4QXBB 4DBQA 2EHOA 2XHEB 2XQYA 3MXZA 3KDSE 2V26A 1ZEEA 1G73A 1LVKA 3PUAA 3CMLA 4IE4A 1HG2A 1X79A 3EDVA 2G0UA 1U4QA 4WBNE 2LHRA 4DO0A 2ZM2A 2LSGA 2LSJA 4YHJA 1MIVA 3CQXC 1FMVA 1SA0E 4O4IE 3DJBA 3VU7H 3RC8A 1WYBA 5FY7A 3LG7A 2ZLYA 3L09A 4HGAA 2N2NA 3ZYLA 5DABA 5AFUL 5KDMC 3ZCIA 5CA0E 2WM9A 2NTXA 5HXHA 5J1GA 2XTLA 2X0LB 2ES0A 3H3AA 4ZHQE 2NTYA 2E8IA 1HX8A 1H7CA 5HXRA 5JH7E 1BR0A 5J2UE 5F8PA 3J7Yq 4NUVA 4BAYB 1US7B 2DHRA 2XAJB 4ZI2D 2OA5A 5L3GB 4A56A 2H7VC 2ODVA 2DLRA 3N9LA 3NZQA 4L9IA 5J2TE 3K3QC 2X9WA 5DQVA 2DWKA 3PUSA 2NWBA 2LSKA 4QXHB 1ZHCA 3CPZA 5JDFA 5L3CB 2LEHA 3AA7B 4ISSA 3RYHE 2VWAA 5L3DB 3PTRB 4UVCB 3I9YA 4QKNA 3WAJA 2PG8A 2W61A 4H9OC 1LRZA 3KV6A 3UUMA 4PK6A 5FY0A 5LGTB 3DTOA 4KP3C 4WNKA 2WAUA 4O8SA 4DMVA 4IIJE 4U72A 1O3XA 5JR9C 2LM9A 5FXWA 5CA1E 5FXZA 4ZI2C 3KFWX 1WYCA 5FYMA 3T8OA 4L5GA 4X20E 2DI4A 4AKHA 5LA6E 3C4XA 3IF8B 5CB4E 4X1IE 2YK0A 3C51A 2CM0A 1FIOA 2L8KA 4HN9A 5JREA 2K5BB 5LGUB 5LYJE 2V7KA 3C98B 3HR0A 3E0ZA 1U5PA 2VL8A 2KLQA 1D1BA 1S94A 3NBXX 4TZ4C 4G2AA 3U78A 4IE5A 4J2CA 2K9AA 2SPCA 3IHRA 4JLEA 4TV9E 2JRKA 3CQCB 2KNDA 3TKLB 3OJAA 3PE0A 2M67A 2ZM0A 4UVAB 2VKOA 4BA9A 2XAFB 5LJNA 4CI3B 3GN5B 2Q9QD 2IW5B 5GONE 3QUJA 5JR9B 1MNDA 5JR9A 3SOLA 4TV8E 3ZMUB 2JJ9A 4UIGA 5JDNA 5LCYA 3RRCA 3EDUA 5M4YA 2LSYA 2CE7A 2ODUA 3FBZA 3Q9DA 4L0RA 4EIWA 3VKHA 1HCIA 5LHIB 4FJOA 1EZ3A 4ASKA 4EOZB 2YEVC 2KT9A 5IHYA 3ZLIA 3CKDA 2BZBA 2BVLA 1YKHB 4IE6A 2Y6XA 4P09A 3I0QA 4QX8B 4IHJE 1IZNB 3MK7C 4ZS3A 2C5JA 2C5IT 3B57A 4F6RC 4KBMB 3P7IA 3ZPOA 2Q9QC 3N2OA 4GIWA 2W0GA 1D0XA 5BMVE 4YFSA 2CXFA 2LJLA 4WBOA 4ZOLE 4I43B 3FB2A 2LHNA 1ZKEA 1NWMX 2XUEA 2HPLA 3GA8A 1WR6A 2CXLA 3AAAB 1IJ6A 4O4LE 5FP3A 1CUNA 3FXEB 2X67A 4ZI3D 1OXZA 3E08A 5LNKA 4UVBB 1MMGA 5EK4A 2MBGA 2PJQA 4KUMB 3I9WA 4OHFA 5HXSA 1MIYA 2JMKA 2V7LA 2DNXA 3E22E 3ZN1B 3ZYMA 3KV5A 2D0TA 5KX5E 4H9NC 4EAHA 3DP7A 3LK3B 4AKLA 2K48A 4C91A 3KBUA 4BJMA 3I1AA 3LBXB 3K8PC 4PFOA 2YU1A 4OFZA 4UXNB 5JDGA 4MALA 4OK0A 4O2AE 2VASA 3ZJ2A 3RC3A 3ZCJA 2Q9QB 4H9SE 1HFAA 2A3DA 4ISTA 2Q9QA 3RH3A 5HYAA 2J1DG 4C90A 4EZHA 4CI1B 4E7SA 4CI2B 4ZI7E 2LOSA 1MMDA 2CWOA 4ZI3C 2W62A 5FNVE 4QHOA 2H3RA 2Y48B 2QA7A 3ZN0B 4BJNA 3P8CD 5JDHA 1MMAA 1UX5A 5FMNA 2N9DA 3BK9A 2IAKA 5L3FB 3RKOA 4HKAA 2E9XD 5FY1A 3OBVE 1YD8G 2CLYC 2JQQA 4MBQA 4X1YE 3H37A 2KWHA 2CEAA 4GOUA 3ZC0A 3UT5E 5E0OA 1IJ5A 1YKEB 2IC6A 4TN7B 3PU3A 3PURA 2WMOA 2ACXA 3N2KE 2W63A 3CX7B 3F57A 3LK2B 4GK0E 3C4WA 2V7JA 3UUXB 2C5KT 1ZV4X 3ETVA 2EHOD 4DVDA 3I0OA 3NZPA 4H63H 2DWGA 3VHLA 4PK4A 4HFVA 1B7TA 5ADXL 3R6NA 3MKDA 3V5UA 4CQIA 3CQGB 2E9XC 4H63V 3J9X1 5DQWA 4JUYA 2C0SA 4Z8XA 2QGSA 2X51A 3D0TA 3CWZB 1QSDA 2WSSV 3AA0B 4FI5A 3EUHA 3RPUA 1KK7A 3MA9A 2H7OA 2A72A 3KVBA 2D0UA 3RYCE 1NAFA 2CLYB 3CX6B 4UV8B 5JVDE 3UULA 4HEAA 5L3BB 4PFPA 1OWAA 3GN5A 4IE0A 4PK5A 4ERRA 1D0ZA 1IAPA 4I4TE 2ZMAA 2LE8A 4QXCB 4GYRA 2WBLA 3K3NA 3PDYA 3ANWB 5H6QB 3S4UA 3UUNA 4EXTA 4K0UA 5LJMA 2BDEA 3PU8A 4JEUB 3O9XA 1VOMA 4HTEA 4AQGA 3C4ZA 3AAIA 3L3PA 4UEMA 1HF8A 3F31A 3AAEB 4DNDA 1BR4A 3M65A 3PUQA 4DMWA 4PNIA 3AA6B 2GK9A 3KBTA 1D0YA 2MTQA 3N2GE 5C8YE 3ZJ1A 3OYXA 4EZ4A 2D2SA 2KINB 2V1DB 4ILUA 2E9XB 1VRBA 3K3OA 2E9XA 5HXCA 3ETUA 4AKGA 3ZMZB 2X9YA 3BQLA 2D5UA 3LK42 3Q5WA 2NW7A 2I59A 3CVRA 3KVAA 2XAHB 5HWYA 2CWYA 3AA1B 3AB3B 3GWHA 4KMCA 3SS1A 3FHNA 4TX5A 4CXWA 2Z6EA 4AXPA 3O1HA 3N9QA 2JPFA 1BR2A 4O4JE 4U74A 3ZEFB 2EHOB 4OYKA 1YW0A 5EK2A 3JC6D 2X66A 3HL6A 4CZZB 3UFEA 4AQFC 5JQGE 3MZKB 3RX6A 3MACA 3O1JA 2UXNB 1MNEA 3FBLA 4XAXB 5KMGP 2Y8DA 1WLXA 2VK9A 1MIWA 1G8XA 2VKDA 2PFVA 3B13A 5EZYE 2MYSA 3RRWA 1Z0PA 4ADZA 3AVSA 3BQKA 2KXPB 3LBXA 5HWXA 4UF0B 4UF0A 5TAOA 2VKJA 4HE8A 3KV4A 4OYJA 2NW8A 2A2FX 4JEHB 4AKIA 3QC9A 3ZC1A 5ETWA 3N9NA 2LSIA 3FXDB 4P0AA 2ZM8A 3KINB 4PJJA 5LGNB 4O4HE 3SRZA 1WRDA 4PJNA 2B1EA 3WI3A 5JDQA 5JDLA 2UXXB 4EYUA 3JC6C 4EYYR 2RA1A 3HKCE 2CXDA 1FEWA 5IYZE 3AVRA 3MJXA 2K24A 1Y64B 1HS7A 4XBFB 1AJ3A 2LT3A 3N9PA 3HKEE 3PUGA 4H9PC 2CMRA 4I55E 5H6RB 1LKXA 2CA5A 4M1PA 4WW0A 4X1KE 2P9BA 2DCFA 4AQFA 3W15B 3IBPA 4GYSA 3SWHA 5LBMA 4UELA 4QWNB 2KWIB 4IGUA 5LP6E 4EB6E 3HI2A 1V9DA 4H9RC 3HKBE 2W00A 4UV9B 3UTKA 2V7MA 3N5LA 2XASB 4AKRB 4IDZA 1UCUA 4YJ2E 1QUUA 2IC9A 3R84B 3EVYA 4ANJA 2X68A 3ONXA 5LHGB 1T98A 4ZS2A 1KNZA 4PJMA 4E7ZA 4PJLA 4IE7A 5F3JA 3IEEA 2XAGB 3A5XA 2CCQA 2YU2A 1HG5A 1MMNA 3QK6A 2XAQB 4I50E 3ZMTB 5JDMA 3NRYA 5LHHB 5JRCB 2N1GA 3ZYKA 5JRCA 4MFRA 4YJ3E 3NRXA 4PW8A 2LOPA 1LVFA 4DBRA 2HPJA 5HAXA 5HXEA 2KMFA 2L3LA 2X9HA 5FXVA 3RYIE 2EHOC 2MOZA 4NUUA 5L2LA 4TUYE 4CXXA 3ANWA 4G63A 3VKGA 4YLHA 2PBIA 1BR1A 1E1HB 3C64A 4H9QC 5LOVE 4P0BA 2YINA 2JMHA 1S35A 2WMNA 3O4XE 3LJCA 3O1IA 5LG4A 4MHCA 4B6XA 3OKQA 4GK5E 4MLKA 3U3IA 3KV9A 5LXTE 5L3EB 2V7IA 3LFMA 4CXYA 1FMWA 4XZCA 1SHZC 2L9QA 3HA4A 3ZMSB 2RP4A 2X9XA 4PAGA 3RYFE 1D1CA 2VKHA 3GMIA 3OYZA 2HH7A 3CX8B 3ESLA 5A1LA 3Q5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5U A;  4P0A A;  4JUY A;  4OYJ A;  5LJM A;  2HPL A;  4OYK A;  4P09 A;  4P0B A;  2HPJ A;  2CM0 A;  5LJN A;  2CCQ A; 
#chains in the Genus database with same CATH topology
 1D1A A;  2WWU A;  5FXX A;  2NOX A;  4N78 D;  5LBQ B;  4QXB B;  4DBQ A;  4JI5 T;  2XM1 A;  2FJE A;  1G73 A;  4ZZB A;  1HG2 A;  1UK5 A;  2LHR A;  1MIV A;  4KX6 A;  2WWV A;  5AQI B;  4JV5 T;  5DAB A;  5KDM C;  3ZCI A;  5CA0 E;  2WM9 A;  2NTX A;  5HEJ A;  1OED B;  5JH7 E;  5J2U E;  3J7Y q;  1T7S A;  1US7 B;  2XAJ B;  2OA5 A;  5L3G B;  1KNR A;  2DLR A;  5J2T E;  2NWB A;  2CPT A;  3AA7 B;  2A9U A;  5L3D B;  4LF7 T;  4UVC B;  3I9Y A;  4QKN A;  2IHR 1;  4KHZ F;  3KV6 A;  3UUM A;  4PK6 A;  4NPP A;  5LGT B;  2LM9 A;  5AQF B;  3T8O A;  4L5G A;  4ZXL A;  4X65 T;  2DI4 A;  3C51 A;  5L47 A;  4HN9 A;  2JQ9 A;  2K5B B;  3E0Z A;  1U5P A;  2VL8 A;  3UU3 A;  3U78 A;  2K9A A;  3EI0 A;  4TV9 E;  2V6Y B;  2M67 A;  3AE2 A;  4Q25 A;  5GON E;  5JR9 B;  4JI8 T;  2W2U A;  1MND A;  3ZMU B;  3EDU A;  4JI1 T;  2CE7 A;  4L0R A;  4EOZ B;  1QLB A;  2YEV C;  5F5W A;  3T1Y T;  4F8H A;  1YKH B;  4IE6 A;  3MK7 C;  4ZS3 A;  1D0X A;  5BMV E;  4COF A;  4JI6 T;  3FB2 A;  2LHN A;  3CIR A;  3RKG A;  1ZKE A;  3AXJ A;  2HPL A;  3ABV A;  5ABF B;  2XQ7 A;  1HR0 T;  3FZH B;  3I9W A;  1MIY A;  2JMK A;  2DNX A;  3E22 E;  3KV5 A;  2D0T A;  2D9D A;  4AKL A;  2NR4 A;  4HWD A;  3QB5 K;  3RLF F;  3K8P C;  3AEA A;  4PFO A;  2YU1 A;  5IUX A;  4O2A E;  3RC3 A;  2IIU A;  3ZCJ A;  2Q9Q B;  2A3D A;  1XZY A;  4EZH A;  4ZI3 C;  2CWO A;  2QA7 A;  3P8C D;  3ESL A;  5JDH A;  4HFI A;  5FMN A;  4NXN T;  1NEN A;  1E7P A;  2E9X D;  1YD8 G;  4MBQ A;  3H37 A;  2CEA A;  3PUR A;  1XDP A;  2ACX A;  2V7J A;  2YDS A;  1ZV4 X;  4DVD A;  2EHO D;  3I0O A;  3NZP A;  2DWG A;  4DV7 T;  4KHP T;  1KFY A;  1NEK A;  2M6I A;  1UGO A;  3V5U A;  3PUX F;  4H63 V;  2C0S A;  3D0T A;  1QSD A;  4HFD A;  3AA0 B;  3EUH A;  3RPU A;  3KVB A;  2A72 A;  2D0U A;  2CLY B;  5JVD E;  4ERR A;  1IAP A;  4QXC B;  3AE8 A;  2WBL A;  3PDY A;  4K0U A;  2BDE A;  4LF6 T;  1N32 T;  3L3P A;  1YQ4 A;  3PUQ A;  2MTQ A;  2XQ8 A;  2UUC T;  3ZJ1 A;  2V1D B;  4ILU A;  3K3O A;  5HXC A;  3ETU A;  3BQL A;  3LK4 2;  4ZEY A;  2I59 A;  3CVR A;  3KVA A;  4CXW A;  2Z6E A;  3UU5 A;  1N36 T;  2JPF A;  1HNW T;  2XQ3 A;  3ZEF B;  5ABH A;  1YW0 A;  5ABF A;  4AQF C;  2WU2 A;  5JQG E;  3RX6 A;  3MAC A;  3PUY F;  1MNE A;  5C3J A;  5LMU T;  2VK9 A;  1G8X A;  3B13 A;  3RRW A;  1Z0P A;  3P4W A;  2VKJ A;  2NW8 A;  4JEH B;  3QC9 A;  2LSI A;  2UXC T;  4P0A A;  4GKK T;  3KIN B;  4PJJ A;  5LGN B;  3P4P A;  2E5L T;  2WY2 A;  3PJA J;  3HKC E;  5IYZ E;  3MJX A;  2K24 A;  1HS7 A;  3HKE E;  2YN6 A;  1HNZ T;  2P9B A;  5FL1 A;  3W15 B;  3SWH A;  5LBM A;  3HI2 A;  3HKB E;  2W00 A;  3JAD A;  2LRK A;  2XQ9 A;  3N5L A;  2OLT A;  2IC9 A;  3R84 B;  3PUV F;  3PUW F;  3ONX A;  2WQY A;  1KNZ A;  4PJM A;  2CRB A;  4IE7 A;  3ZST A;  3IEE A;  5F3J A;  2YU2 A;  1MMN A;  3QK6 A;  5LHH B;  5JRC B;  2N1G A;  3NRX A;  5HAX A;  5HXE A;  2KMF A;  2EHO C;  4G63 A;  4LF8 T;  2PBI A;  3C64 A;  5LOV E;  2YIN A;  4WYV A;  5FVK A;  4CN4 A;  3LJC A;  4B6X A;  5AQN B;  3ZMS B;  2FBW A;  2X9X A;  1IBK T;  1Y01 A;  2VKH A;  4AIU A;  5EK3 A;  3N9O A;  3Q2M A;  3ZKR A;  4O2B E;  1OED C;  3FZL B;  2VB6 A;  4F6R C;  4Z90 A;  3ZMV B;  4V1A v;  5DJQ C;  3WAK A;  3N9M A;  2XHE B;  3MXZ A;  3VRA A;  3KDS E;  4CN1 A;  1X79 A;  2G0U A;  2LSG A;  4CN6 A;  4YHJ A;  3DJB A;  3RC8 A;  3FZK B;  1SUM B;  4ILB A;  2N2N A;  5AFU L;  2FJA A;  5HXH A;  5J1G A;  2ES0 A;  4HFC A;  2NTY A;  2BG9 A;  1HX1 B;  4A56 A;  2H7V C;  3N9L A;  2X9W A;  3VR9 A;  5ABE A;  2LSK A;  1L0V A;  2WS3 A;  1ZHC A;  5JDF A;  4HWF A;  2W4X A;  1JNZ A;  4ISS A;  3AE7 A;  3P4Q A;  2W61 A;  4DV1 T;  1SE7 A;  2PTF A;  4WNK A;  4DMV A;  4IIJ E;  4U72 A;  5JR9 C;  4LF4 T;  4ZI2 C;  2E2A A;  3KFW X;  5FYM A;  4LMK A;  5AQU B;  3IF8 B;  5CB4 E;  2YK0 A;  2UUB T;  2DL1 A;  2VQF T;  5AQQ B;  3RQW A;  4ZZC A;  5BR8 T;  2V7K A;  5HCM A;  4DR6 T;  4IDN A;  4U7I A;  3RI5 A;  2MAW A;  2HHH T;  4DUZ T;  4IE5 A;  2SPC A;  3IHR A;  1ZP0 A;  2JRK A;  3CQC B;  3PE0 A;  2VKO A;  5LJN A;  4DR5 T;  3GN5 B;  1W0B A;  4TV8 E;  4UIG A;  5LCY A;  3Q9D A;  1HCI A;  5LHI B;  3OPC A;  2KT9 A;  3CKD A;  4TNV A;  4QX8 B;  4KBM B;  3ZPO A;  5ABG A;  2Q9Q C;  4GIW A;  1YXR A;  4ZOL E;  3AXJ B;  2BS4 A;  2BS3 A;  4X66 T;  3GA8 A;  3TLW A;  5AQV B;  3AAA B;  3CK6 A;  3FXE B;  4ZI3 D;  5LNK A;  2PJQ A;  5HXS A;  3ZYM A;  2UU9 T;  4EAH A;  3KBU A;  1J5E T;  4OFZ A;  4UXN B;  4JI4 T;  2JQK A;  1GQE A;  1HFA A;  5HYA A;  4CI1 B;  4E7S A;  2LOS A;  3FZM B;  1XDO A;  2X0Y A;  2W62 A;  1MMA A;  2N9D A;  3IA3 A;  4HKA A;  2CLY C;  3T1H T;  3ZC0 A;  4TN7 B;  2YDR A;  3JAE A;  3N2K E;  2W63 A;  3F57 A;  3LK2 B;  4LMJ A;  4YSY A;  1IBL T;  3ETV A;  1B7T A;  5ADX L;  3CQG B;  2QGS A;  3CWZ B;  4EED A;  3TLS A;  3MA9 A;  3SFE A;  4HWI B;  3CX6 B;  4UV8 B;  4HEA A;  5L3B B;  3GN5 A;  4YTN A;  5LMN T;  4I4T E;  2LE8 A;  4YTP A;  4GYR A;  5H6Q B;  3K3N A;  4JEU B;  3L8R A;  3UQ4 A;  3F31 A;  3AAE B;  4DMW A;  4PNI A;  1D0Y A;  2BG9 E;  3N2G E;  4EZ4 A;  3ZT6 A;  4U7Y A;  5L4E A;  3ZT5 A;  2E9X A;  3ZMZ B;  3Q5W A;  2NW7 A;  5HWY A;  2CWY A;  4ILA A;  3AB3 B;  4QH4 A;  4TX5 A;  2XQ5 A;  4AXP A;  4U2Y A;  1XWM A;  2R6G F;  3HL6 A;  1JNR A;  4U31 A;  4AIS A;  4XAX B;  5IWA T;  5LG3 A;  1Z8U A;  2VKD A;  2PFV A;  5EZY E;  4ADZ A;  3AVS A;  5HWX A;  4HE8 A;  3KV4 A;  3X1D A;  4K0K T;  5ETW A;  2BS2 A;  4O4H E;  3SRZ A;  2B1E A;  3RIU A;  5JDQ A;  3JC6 C;  3P4S A;  4EYY R;  2RA1 A;  5C2T A;  1R8I A;  3EHZ A;  1AJ3 A;  3N9P A;  3PUG A;  3AED A;  2CHN A;  2DCF A;  3IBP A;  4GYS A;  4QWN B;  2KWI B;  2XQA A;  1V9D A;  4IL4 A;  4AKR B;  4ANJ A;  5LHG B;  1T98 A;  2BKO A;  4E7Z A;  3UUB A;  3A5X A;  2CCQ A;  1ZOY A;  2XAQ B;  4I50 E;  3ZYK A;  1KNP A;  4YJ3 E;  3UU4 A;  2LOP A;  1LVF A;  3RYI E;  5L2L A;  3VKG A;  1BR1 A;  2V6X A;  1E1H B;  4DR4 T;  3OKQ A;  3U3I A;  5L3E B;  2V7I A;  1FMW A;  1SHZ C;  2L9Q A;  3HA4 A;  1I94 T;  2OV9 A;  1J5W A;  3B5M A;  4PAG A;  5HEH A;  3OYZ A;  3CX8 B;  2LM2 A;  3BQI A;  2WZI A;  3HKD E;  1UX4 A;  2NW9 A;  3C50 A;  2YOE A;  3TLU A;  2BVM A;  1KF6 A;  1W09 A;  2FUP A;  3NKZ A;  2V26 A;  1XNQ T;  1ZEE A;  3PUA A;  4IE4 A;  3ZT7 A;  4X62 T;  2ZM2 A;  4DR2 T;  3CQX C;  1SA0 E;  3VU7 H;  5FY7 A;  4B3R T;  3LG7 A;  2ZLY A;  4HGA A;  4IT4 A;  2LLY A;  2AE9 A;  4TNW A;  2AXD S;  2XTL A;  4ZHQ E;  5HXR A;  1HX8 A;  2IUB A;  2BG9 B;  4NUV A;  4BAY B;  2DHR A;  4ZI2 D;  4L9I A;  4DUY T;  4QXH B;  2LEH A;  5HCJ A;  3WAJ A;  1WFD A;  4DV0 T;  5FY0 A;  4JI0 T;  3DTO A;  4KP3 C;  4O8S A;  1O3X A;  5CA1 E;  1XNR T;  2VUR A;  4X20 E;  4AKH A;  4B3T T;  4DV6 T;  5LA6 E;  3C4X A;  2XSA A;  4X1I E;  2VVS A;  2WDQ A;  2L8K A;  4DV2 T;  5JRE A;  2J47 A;  1T8B A;  5LYJ E;  3C98 B;  2KLQ A;  1D1B A;  3NBX X;  2XQ6 A;  4A97 A;  4J2C A;  4JLE A;  2QYW A;  3OJA A;  2B76 A;  2XAF B;  4CI3 B;  2Q9Q D;  2IW5 B;  4YTM A;  4P1N A;  1WR0 A;  2ODU A;  3NVO A;  3FBZ A;  4EIW A;  5AQH B;  4FJO A;  1M7K A;  3AE6 A;  1W9R A;  3ZLI A;  4P09 A;  3I0Q A;  1IBM T;  1IZN B;  2LKH A;  2C5J A;  3B57 A;  3P7I A;  4Z91 A;  2W0G A;  3RIU C;  4IL9 A;  4HWC A;  4GKJ T;  2CXF A;  2LJL A;  4WBO A;  4I43 B;  4IDP A;  2XUE A;  4YSX A;  4JBW F;  4KI0 F;  5J0Z A;  4JI7 T;  2CXL A;  1IJ6 A;  2BBJ A;  4O4L E;  1OXZ A;  2XY8 B;  4UVB B;  4DR3 T;  5EK4 A;  2MBG A;  4KUM B;  4OHF A;  4DV5 T;  5KX5 E;  3TLV A;  3EAM A;  4C91 A;  4BJM A;  3I1A A;  4TWF A;  3H3M A;  2CBI A;  3Q5E A;  4OK0 A;  5AQO B;  3JCF A;  1XMQ T;  3ZJ2 A;  3RH3 A;  4C90 A;  4CI2 B;  5FNV E;  2H3R A;  2Y48 B;  4NXM T;  2IAK A;  3BK9 A;  3RKO A;  4YY3 T;  5FY1 A;  3OBV E;  4EEB A;  2JQQ A;  5AQL B;  3UT5 E;  5E0O A;  1IJ5 A;  1YKE B;  2JQH A;  3PU3 A;  2WMO A;  2YKS A;  3CX7 B;  4GK0 E;  2XQ4 A;  3C4W A;  3UUX B;  1M62 A;  2C5K T;  5LB7 B;  3VHL A;  4PK4 A;  2UUA T;  3R6N A;  3MKD A;  4YSZ A;  4CQI A;  2FJD A;  3J9X 1;  4TWD A;  4Z8X A;  4FI5 A;  1DU2 A;  1X9B A;  1KK7 A;  2H7O A;  3RYC E;  1NAF A;  3UUL A;  4U3C A;  1OWA A;  3AEE A;  4IE0 A;  4PK5 A;  4EXT A;  3ANW B;  5LJM A;  3PU8 A;  1VOM A;  4HTE A;  4AQG A;  3C4Z A;  4UEM A;  4LFB T;  2LRL A;  4DND A;  1BR4 A;  2IDO B;  1I6Z A;  3AA6 B;  2GK9 A;  1WCR A;  5L4H A;  2WB5 A;  5C8Y E;  1UUR A;  2D2S A;  1UUS A;  2E9X B;  2D5U A;  3PUZ F;  3AA1 B;  3SS1 A;  2H89 A;  3O1H A;  4OX9 T;  3N9Q A;  3OTO T;  3L39 A;  3UU6 A;  4U74 A;  2EHO B;  4OYK A;  3AEF A;  3JC6 D;  4CZZ B;  3UFE A;  4B3S T;  2I0M A;  4DR1 T;  2J4G A;  2UXN B;  3O1J A;  5KMG P;  2Y8D A;  1WLX A;  3K1S A;  3ONJ A;  4UF0 A;  4OYJ A;  2A2F X;  4AKI A;  3ZC1 A;  3FXD B;  2XZE A;  2ZM8 A;  4EV6 A;  1WRD A;  4WZX A;  3WI3 A;  2UXX B;  4EYU A;  4JYA T;  3TLT A;  2ACZ A;  1YQ3 A;  4DV3 T;  2CXD A;  4HFE A;  3AVR A;  5AQJ B;  1Y64 B;  4XBF B;  5AQM B;  2CMR A;  4I55 E;  4WW0 A;  4AQF A;  4IGU A;  5AQT B;  3RF1 A;  2ZM6 T;  4H9R C;  4UV9 B;  4IDZ A;  4YJ2 E;  1QUU A;  2X68 A;  3LDQ B;  2UXD T;  4PJL A;  4I0U A;  1HG5 A;  5JDM A;  5AQG B;  3ZMT B;  1VCS A;  3A8Y C;  2WDR A;  2BKP A;  3FZF B;  3OVU A;  2HPJ A;  2E5V A;  5FXV A;  2MOZ A;  4NUU A;  4TUY E;  1KEY A;  4CXX A;  2K3W A;  3ANW A;  4YLH A;  4YT0 A;  1E2A A;  4H9Q C;  2W67 A;  1S35 A;  2WMN A;  3O4X E;  3O1I A;  3QNU A;  5LG4 A;  5CFB A;  4MLK A;  3KV9 A;  5LXT E;  2UXB T;  4HWH A;  1T72 A;  4JI2 T;  2RP4 A;  2HN1 A;  1D1C A;  3GMI A;  3M3Z B;  3AEB A;  2HH7 A;  5A1L A;  3Q5X A;  2NP9 A;  4AI6 A;  1HTJ F;  2KZ7 B;  2V8S V;  3F2E A;  4QX7 B;  3SFD A;  2BG9 C;  2M6B A;  3V5S A;  2EHO A;  2XQY A;  3P50 A;  1LVK A;  2XM2 A;  3CML A;  3EDV A;  1U4Q A;  4WBN E;  2JIW A;  3A7M A;  4DO0 A;  2LSJ A;  5AQK B;  1FMV A;  4O4I E;  3QB5 A;  2YDQ A;  1WYB A;  3L09 A;  3RHW A;  2I6H A;  3ZYL A;  4A98 A;  2WP9 A;  2X0L B;  3H3A A;  2E8I A;  1H7C A;  1OED A;  4QH5 A;  1BR0 A;  5F8P A;  2ODV A;  3NZQ A;  3VR8 A;  3K3Q C;  5DQV A;  2DWK A;  3PUS A;  3CPZ A;  5L3C B;  2VVN A;  2HN2 A;  3RYH E;  2VWA A;  3PTR B;  2PG8 A;  4H9O C;  1LRZ A;  4LF5 T;  2WAU A;  5FXW A;  5FXZ A;  2CHO A;  1WYC A;  3UU8 A;  4IDO A;  5FKY A;  2CM0 A;  1FIO A;  5LGU B;  5KXJ A;  3QOF A;  3HR0 A;  1S94 A;  4TZ4 C;  4G2A A;  4NIQ A;  3ONL C;  3TKL B;  2KND A;  2V6Y A;  2ZM0 A;  4UVA B;  4BA9 A;  3AE9 A;  3QUJ A;  5JR9 A;  3SOL A;  2JJ9 A;  5JDN A;  3RRC A;  5M4Y A;  2LSY A;  4LFA T;  2VQE T;  2X0H A;  3VKH A;  4ILC A;  1EZ3 A;  4ASK A;  4TWH A;  2WZH A;  5IHY A;  2XJ7 A;  3AE3 A;  2BZB A;  2BVL A;  2Y6X A;  4IHJ E;  5AQP B;  2C5I T;  3P4R A;  5AQS B;  4YFS A;  3AEC A;  4HFB A;  3RGL A;  2VL0 A;  3Q5D A;  1XMO T;  1NWM X;  1WR6 A;  3RIF A;  5FP3 A;  1CUN A;  2X67 A;  3E08 A;  1MMG A;  5AQR B;  4A5X A;  2V7L A;  3ZN1 B;  2CBJ A;  4H9N C;  3DP7 A;  3LK3 B;  2K48 A;  3LBX B;  3UQ7 A;  3PJA A;  4U33 A;  5JDG A;  4MAL A;  5JTG A;  2VAS A;  4X64 T;  4H9S E;  4IST A;  2Q9Q A;  2J1D G;  4ZI7 E;  1MMD A;  4QHO A;  3ZN0 B;  4BJN A;  1UX5 A;  5L3F B;  3AEG A;  4YXD A;  4EGW A;  4X1Y E;  2KWH A;  4GOU A;  4DR7 T;  4UR9 A;  2IC6 A;  4H63 H;  4HFV A;  5HEG A;  2E9X C;  2MPK A;  5DQW A;  2WCA A;  4JUY A;  2KSR A;  4QH1 A;  1J1J A;  2X51 A;  2WSS V;  5FL0 A;  5HEO A;  2F4V T;  4PFP A;  3PV0 F;  1D0Z A;  2ZMA A;  3S4U A;  4AQY T;  3UUN A;  3G06 A;  3O9X A;  2QRX A;  3AAI A;  2IML A;  1HF8 A;  2V5D A;  3M65 A;  1OED E;  3KBT A;  2RPA A;  5CJ5 A;  3OYX A;  4LFC T;  2KIN B;  4JI3 T;  1VRB A;  4HFH A;  4AKG A;  2X9Y A;  2W66 A;  3LSV A;  2XAH B;  3GWH A;  4KMC A;  1W0A A;  4DV4 T;  3NWI A;  3FHN A;  1BR2 A;  4O4J E;  4LF9 T;  5EK2 A;  2X66 A;  4DID B;  3MZK B;  3FBL A;  2H88 A;  2XPK A;  2QVA A;  1MIW A;  5HEU A;  2MYS A;  3BQK A;  2KXP B;  3LBX A;  4UF0 B;  5TAO A;  4YHH T;  3N9N A;  1N34 T;  5CGM A;  4LML A;  3VRB A;  2LKG A;  4PJN A;  5JDL A;  3EAB A;  1FEW A;  3ZSS A;  2LT3 A;  1HNX T;  4H9P C;  5H6R B;  1LKX A;  2CA5 A;  4M1P A;  4X1K E;  4UEL A;  5LP6 E;  4EB6 E;  1N33 T;  3UTK A;  2V7M A;  2XAS B;  3JAF A;  1UCU A;  3EVY A;  3RIA A;  4ZS2 A;  2WDV A;  4IDQ A;  3AE5 A;  2XAG B;  2V5C A;  1CHU A;  3RQU A;  3NRY A;  5JRC A;  4MFR A;  2XSB A;  4IRE A;  4U2Z A;  4PW8 A;  2BBH A;  1VCT A;  4DBR A;  2J62 A;  2L3L A;  2X9H A;  3AE1 A;  4B3M T;  5FVL A;  3UFG A;  4P0B A;  2JMH A;  4X5T A;  2FJB A;  4MHC A;  4GK5 E;  1FJG T;  3LFM A;  3AE4 A;  2BKN A;  4CXY A;  4XZC A;  3RYF E;  2WU5 A;  3N2O A; 
#chains in the Genus database with same CATH homology
 3BQI A;  3N9O A;  5EK3 A;  3HKD E;  3Q2M A;  4O2B E;  1D1A A;  2NP9 A;  2WWU A;  4AI6 A;  1HTJ F;  5FXX A;  1UX4 A;  2VB6 A;  2NW9 A;  2KZ7 B;  2NOX A;  3F2E A;  4N78 D;  4QX7 B;  4V1A v;  5DJQ C;  5LBQ B;  3ZMV B;  3C50 A;  3WAK A;  3N9M A;  3V5S A;  2BVM A;  4QXB B;  4DBQ A;  2EHO A;  2XHE B;  2XQY A;  3MXZ A;  3KDS E;  2V26 A;  1ZEE A;  1G73 A;  1LVK A;  3PUA A;  3CML A;  4IE4 A;  1HG2 A;  1X79 A;  3EDV A;  2G0U A;  1U4Q A;  4WBN E;  2LHR A;  4DO0 A;  2ZM2 A;  2LSG A;  2LSJ A;  4YHJ A;  1MIV A;  3CQX C;  1FMV A;  1SA0 E;  4O4I E;  3DJB A;  3VU7 H;  3RC8 A;  1WYB A;  5FY7 A;  3LG7 A;  2ZLY A;  3L09 A;  4HGA A;  2N2N A;  3ZYL A;  5DAB A;  5AFU L;  5KDM C;  3ZCI A;  5CA0 E;  2WM9 A;  2NTX A;  5HXH A;  5J1G A;  2XTL A;  2X0L B;  2ES0 A;  3H3A A;  4ZHQ E;  2NTY A;  2E8I A;  1HX8 A;  1H7C A;  5HXR A;  5JH7 E;  1BR0 A;  5J2U E;  5F8P A;  3J7Y q;  4NUV A;  4BAY B;  1US7 B;  2DHR A;  2XAJ B;  4ZI2 D;  2OA5 A;  5L3G B;  4A56 A;  2H7V C;  2ODV A;  2DLR A;  3N9L A;  3NZQ A;  4L9I A;  5J2T E;  3K3Q C;  2X9W A;  5DQV A;  2DWK A;  3PUS A;  2NWB A;  2LSK A;  4QXH B;  1ZHC A;  3CPZ A;  5JDF A;  5L3C B;  2LEH A;  3AA7 B;  4ISS A;  3RYH E;  2VWA A;  5L3D B;  3PTR B;  4UVC B;  3I9Y A;  4QKN A;  3WAJ A;  2PG8 A;  2W61 A;  4H9O C;  1LRZ A;  3KV6 A;  3UUM A;  4PK6 A;  5FY0 A;  5LGT B;  3DTO A;  4KP3 C;  4WNK A;  2WAU A;  4O8S A;  4DMV A;  4IIJ E;  4U72 A;  1O3X A;  5JR9 C;  2LM9 A;  5FXW A;  5CA1 E;  5FXZ A;  4ZI2 C;  3KFW X;  1WYC A;  5FYM A;  3T8O A;  4L5G A;  4X20 E;  2DI4 A;  4AKH A;  5LA6 E;  3C4X A;  3IF8 B;  5CB4 E;  4X1I E;  2YK0 A;  3C51 A;  2CM0 A;  1FIO A;  2L8K A;  4HN9 A;  5JRE A;  2K5B B;  5LGU B;  5LYJ E;  2V7K A;  3C98 B;  3HR0 A;  3E0Z A;  1U5P A;  2VL8 A;  2KLQ A;  1D1B A;  1S94 A;  3NBX X;  4TZ4 C;  4G2A A;  3U78 A;  4IE5 A;  4J2C A;  2K9A A;  2SPC A;  3IHR A;  4JLE A;  4TV9 E;  2JRK A;  3CQC B;  2KND A;  3TKL B;  3OJA A;  3PE0 A;  2M67 A;  2ZM0 A;  4UVA B;  2VKO A;  4BA9 A;  2XAF B;  5LJN A;  4CI3 B;  3GN5 B;  2Q9Q D;  2IW5 B;  5GON E;  3QUJ A;  5JR9 B;  1MND A;  5JR9 A;  3SOL A;  4TV8 E;  3ZMU B;  2JJ9 A;  4UIG A;  5JDN A;  5LCY A;  3RRC A;  3EDU A;  5M4Y A;  2LSY A;  2CE7 A;  2ODU A;  3FBZ A;  3Q9D A;  4L0R A;  4EIW A;  3VKH A;  1HCI A;  5LHI B;  4FJO A;  1EZ3 A;  4ASK A;  4EOZ B;  2YEV C;  2KT9 A;  5IHY A;  3ZLI A;  3CKD A;  2BZB A;  2BVL A;  1YKH B;  4IE6 A;  2Y6X A;  4P09 A;  3I0Q A;  4QX8 B;  4IHJ E;  1IZN B;  3MK7 C;  4ZS3 A;  2C5J A;  2C5I T;  3B57 A;  4F6R C;  4KBM B;  3P7I A;  3ZPO A;  2Q9Q C;  3N2O A;  4GIW A;  2W0G A;  1D0X A;  5BMV E;  4YFS A;  2CXF A;  2LJL A;  4WBO A;  4ZOL E;  4I43 B;  3FB2 A;  2LHN A;  1ZKE A;  1NWM X;  2XUE A;  2HPL A;  3GA8 A;  1WR6 A;  2CXL A;  3AAA B;  1IJ6 A;  4O4L E;  5FP3 A;  1CUN A;  3FXE B;  2X67 A;  4ZI3 D;  1OXZ A;  3E08 A;  5LNK A;  4UVB B;  1MMG A;  5EK4 A;  2MBG A;  2PJQ A;  4KUM B;  3I9W A;  4OHF A;  5HXS A;  1MIY A;  2JMK A;  2V7L A;  2DNX A;  3E22 E;  3ZN1 B;  3ZYM A;  3KV5 A;  2D0T A;  5KX5 E;  4H9N C;  4EAH A;  3DP7 A;  3LK3 B;  4AKL A;  2K48 A;  4C91 A;  3KBU A;  4BJM A;  3I1A A;  3LBX B;  3K8P C;  4PFO A;  2YU1 A;  4OFZ A;  4UXN B;  5JDG A;  4MAL A;  4OK0 A;  4O2A E;  2VAS A;  3ZJ2 A;  3RC3 A;  3ZCJ A;  2Q9Q B;  4H9S E;  1HFA A;  2A3D A;  4IST A;  2Q9Q A;  3RH3 A;  5HYA A;  2J1D G;  4C90 A;  4EZH A;  4CI1 B;  4E7S A;  4CI2 B;  4ZI7 E;  2LOS A;  1MMD A;  2CWO A;  4ZI3 C;  2W62 A;  5FNV E;  4QHO A;  2H3R A;  2Y48 B;  2QA7 A;  3ZN0 B;  4BJN A;  3P8C D;  5JDH A;  1MMA A;  1UX5 A;  5FMN A;  2N9D A;  3BK9 A;  2IAK A;  5L3F B;  3RKO A;  4HKA A;  2E9X D;  5FY1 A;  3OBV E;  1YD8 G;  2CLY C;  2JQQ A;  4MBQ A;  4X1Y E;  3H37 A;  2KWH A;  2CEA A;  4GOU A;  3ZC0 A;  3UT5 E;  5E0O A;  1IJ5 A;  1YKE B;  2IC6 A;  4TN7 B;  3PU3 A;  3PUR A;  2WMO A;  2ACX A;  3N2K E;  2W63 A;  3CX7 B;  3F57 A;  3LK2 B;  4GK0 E;  3C4W A;  2V7J A;  3UUX B;  2C5K T;  1ZV4 X;  3ETV A;  2EHO D;  4DVD A;  3I0O A;  3NZP A;  4H63 H;  2DWG A;  3VHL A;  4PK4 A;  4HFV A;  1B7T A;  5ADX L;  3R6N A;  3MKD A;  3V5U A;  4CQI A;  3CQG B;  2E9X C;  4H63 V;  3J9X 1;  5DQW A;  4JUY A;  2C0S A;  4Z8X A;  2QGS A;  2X51 A;  3D0T A;  3CWZ B;  1QSD A;  2WSS V;  3AA0 B;  4FI5 A;  3EUH A;  3RPU A;  1KK7 A;  3MA9 A;  2H7O A;  2A72 A;  3KVB A;  2D0U A;  3RYC E;  1NAF A;  2CLY B;  3CX6 B;  4UV8 B;  5JVD E;  3UUL A;  4HEA A;  5L3B B;  4PFP A;  1OWA A;  3GN5 A;  4IE0 A;  4PK5 A;  4ERR A;  1D0Z A;  1IAP A;  4I4T E;  2ZMA A;  2LE8 A;  4QXC B;  4GYR A;  2WBL A;  3K3N A;  3PDY A;  3ANW B;  5H6Q B;  3S4U A;  3UUN A;  4EXT A;  4K0U A;  5LJM A;  2BDE A;  3PU8 A;  4JEU B;  3O9X A;  1VOM A;  4HTE A;  4AQG A;  3C4Z A;  3AAI A;  3L3P A;  4UEM A;  1HF8 A;  3F31 A;  3AAE B;  4DND A;  1BR4 A;  3M65 A;  3PUQ A;  4DMW A;  4PNI A;  3AA6 B;  2GK9 A;  3KBT A;  1D0Y A;  2MTQ A;  3N2G E;  5C8Y E;  3ZJ1 A;  3OYX A;  4EZ4 A;  2D2S A;  2KIN B;  2V1D B;  4ILU A;  2E9X B;  1VRB A;  3K3O A;  2E9X A;  5HXC A;  3ETU A;  4AKG A;  3ZMZ B;  2X9Y A;  3BQL A;  2D5U A;  3LK4 2;  3Q5W A;  2NW7 A;  2I59 A;  3CVR A;  3KVA A;  2XAH B;  5HWY A;  2CWY A;  3AA1 B;  3AB3 B;  3GWH A;  4KMC A;  3SS1 A;  3FHN A;  4TX5 A;  4CXW A;  2Z6E A;  4AXP A;  3O1H A;  3N9Q A;  2JPF A;  1BR2 A;  4O4J E;  4U74 A;  3ZEF B;  2EHO B;  4OYK A;  1YW0 A;  5EK2 A;  3JC6 D;  2X66 A;  3HL6 A;  4CZZ B;  3UFE A;  4AQF C;  5JQG E;  3MZK B;  3RX6 A;  3MAC A;  3O1J A;  2UXN B;  1MNE A;  3FBL A;  4XAX B;  5KMG P;  2Y8D A;  1WLX A;  2VK9 A;  1MIW A;  1G8X A;  2VKD A;  2PFV A;  3B13 A;  5EZY E;  2MYS A;  3RRW A;  1Z0P A;  4ADZ A;  3AVS A;  3BQK A;  2KXP B;  3LBX A;  5HWX A;  4UF0 B;  4UF0 A;  5TAO A;  2VKJ A;  4HE8 A;  3KV4 A;  4OYJ A;  2NW8 A;  2A2F X;  4JEH B;  4AKI A;  3QC9 A;  3ZC1 A;  5ETW A;  3N9N A;  2LSI A;  3FXD B;  4P0A A;  2ZM8 A;  3KIN B;  4PJJ A;  5LGN B;  4O4H E;  3SRZ A;  1WRD A;  4PJN A;  2B1E A;  3WI3 A;  5JDQ A;  5JDL A;  2UXX B;  4EYU A;  3JC6 C;  4EYY R;  2RA1 A;  3HKC E;  2CXD A;  1FEW A;  5IYZ E;  3AVR A;  3MJX A;  2K24 A;  1Y64 B;  1HS7 A;  4XBF B;  1AJ3 A;  2LT3 A;  3N9P A;  3HKE E;  3PUG A;  4H9P C;  2CMR A;  4I55 E;  5H6R B;  1LKX A;  2CA5 A;  4M1P A;  4WW0 A;  4X1K E;  2P9B A;  2DCF A;  4AQF A;  3W15 B;  3IBP A;  4GYS A;  3SWH A;  5LBM A;  4UEL A;  4QWN B;  2KWI B;  4IGU A;  5LP6 E;  4EB6 E;  3HI2 A;  1V9D A;  4H9R C;  3HKB E;  2W00 A;  4UV9 B;  3UTK A;  2V7M A;  3N5L A;  2XAS B;  4AKR B;  4IDZ A;  1UCU A;  4YJ2 E;  1QUU A;  2IC9 A;  3R84 B;  3EVY A;  4ANJ A;  2X68 A;  3ONX A;  5LHG B;  1T98 A;  4ZS2 A;  1KNZ A;  4PJM A;  4E7Z A;  4PJL A;  4IE7 A;  5F3J A;  3IEE A;  2XAG B;  3A5X A;  2CCQ A;  2YU2 A;  1HG5 A;  1MMN A;  3QK6 A;  2XAQ B;  4I50 E;  3ZMT B;  5JDM A;  3NRY A;  5LHH B;  5JRC B;  2N1G A;  3ZYK A;  5JRC A;  4MFR A;  4YJ3 E;  3NRX A;  4PW8 A;  2LOP A;  1LVF A;  4DBR A;  2HPJ A;  5HAX A;  5HXE A;  2KMF A;  2L3L A;  2X9H A;  5FXV A;  3RYI E;  2EHO C;  2MOZ A;  4NUU A;  5L2L A;  4TUY E;  4CXX A;  3ANW A;  4G63 A;  3VKG A;  4YLH A;  2PBI A;  1BR1 A;  1E1H B;  3C64 A;  4H9Q C;  5LOV E;  4P0B A;  2YIN A;  2JMH A;  1S35 A;  2WMN A;  3O4X E;  3LJC A;  3O1I A;  5LG4 A;  4MHC A;  4B6X A;  3OKQ A;  4GK5 E;  4MLK A;  3U3I A;  3KV9 A;  5LXT E;  5L3E B;  2V7I A;  3LFM A;  4CXY A;  1FMW A;  4XZC A;  1SHZ C;  2L9Q A;  3HA4 A;  3ZMS B;  2RP4 A;  2X9X A;  4PAG A;  3RYF E;  1D1C A;  2VKH A;  3GMI A;  3OYZ A;  2HH7 A;  3CX8 B;  3ESL A;  5A1L A;  3Q5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...