4P09A

Crystal structure of hoip pub domain
Total Genus 68
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
68
sequence length
177
structure length
177
Chain Sequence
PGEEEERAFLVAREELASALRRDSGQAFSLEQLRPLLASSLPLAARYLQLDAARLVRCNAHGEPRNYLNTLSTALNILEKYGRNLLSPQRPRYWRGVKFNNPVFRSTVDAVQGGRDVLRLYGYTEEQPDGLSFPEGQEEPDEHQVATVTLEVLLLRTELSLLLQNTHPRQQALEQLL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Binding of OTULIN to the PUB domain of HOIP controls NF-kappa B signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase RNF31
total genus 68
structure length 177
sequence length 177
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2014-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09409 PUB PUB domain
A PF18486 PUB_1 PNGase/UBA- or UBX-containing domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2190 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4p09A00
4P0BA 2CCQA 4JUYA 2HPJA 4OYKA 4OYJA 2CM0A 4P09A 2HPLA 5LJMA 5LJNA 2D5UA 4P0AA
chains in the Genus database with same CATH superfamily
4IE4A 2CMRA 4H9RC 5JTGA 1UUSA 4DBQA 3AA0B 3TLSA 3QNUA 3QB5K 4XZCA 5JDQA 1XMOT 1QLBA 3KBTA 4ZI3C 1OEDB 3E22E 2I59A 3IA3A 3HKEE 2FJBA 3JC6C 2CPTA 3AE8A 3F31A 3HL6A 4IT4A 2WU5A 4IDNA 4A5XA 2CM0A 5EK2A 2Y8DA 4IGUA 3Q9DA 1KF6A 1UCUA 1BR2A 2XQ6A 2LKGA 4ZS2A 2RPAA 2C0SA 2A72A 4U33A 4MBQA 3OTOT 2C5JA 3OPCA 3NRXA 1CHUA 4BAYB 2CLYB 2X51A 3K3QC 4I43B 1I6ZA 3ZC0A 5HEGA 4IL4A 1G8XA 2YN6A 4PFOA 4AKRB 2VKDA 3HKBE 3HR0A 5ABHA 2UUBT 2YDQA 2XHEB 2C5KT 1WFDA 3LSVA 2A9UA 2H7VC 1MIYA 1H7CA 2C5IT 2HPLA 3K8PC 3LDQB 4QH5A 3T8OA 5E0OA 4CN6A 4IL9A 2PG8A 2XQ5A 3DTOA 3OYXA 4ZHQE 5JDLA 2E9XA 5L3CB 1BR0A 3AE9A 5GONE 3F2EA 3PDYA 3ONJA 3ZT6A 1XNRT 2F4VT 5L3EB 1ZP0A 1W0BA 3IF8B 2LSGA 3ZC1A 1IJ5A 1LKXA 4CI2B 4X1YE 4HKAA 5JDNA 4GKJT 2WQYA 3PUXF 5EK3A 3RYIE 4O8SA 2WB5A 2XAGB 2OLTA 4YHJA 3PUVF 1SHZC 2JQQA 1YXRA 2H88A 3C4ZA 5HAXA 3SFEA 3PJAA 2V7MA 2W2UA 4QWNB 5C3JA 3AVSA 4FJOA 1W9RA 4YFSA 4AKIA 3CWZB 4XAXB 4ZXLA 5LHIB 4JEUB 2WM9A 5AQSB 2E8IA 2LT3A 4HE8A 3CVRA 1QUUA 4WZXA 3FZLB 4YT0A 3CX8B 4NUVA 5HXRA 2DNXA 1UX5A 4MALA 3CMLA 4IDOA 3U3IA 3UU3A 5LJNA 4PK6A 5DQVA 4DR5T 2BDEA 4F8HA 2V7IA 2XQ4A 3AAIA 4ZS3A 3BQLA 2V8SV 2XM1A 2CXDA 3RC3A 2BG9C 2CRBA 2H7OA 1VOMA 4GIWA 3RRCA 4LFAT 1VCSA 4LMJA 4IE6A 1S94A 2ODVA 3CQXC 1L0VA 5LNKA 5AQTB 4YSZA 4O4IE 3VRAA 4E7SA 2N2NA 1YKEB 2QVAA 2WDQA 4KMCA 2JQHA 3DP7A 4Z90A 4LMKA 5EZYE 1D0YA 3KV4A 4HEAA 2QGSA 4HFHA 5FY1A 4KBMB 4A97A 2Z6EA 5AQRB 1MNDA 2CCQA 3A5XA 5F5WA 2HHHT 2PBIA 2D0UA 3OJAA 1CUNA 2RP4A 3AEDA 4YTMA 4EB6E 4ZZBA 4TN7B 1N36T 2WMOA 3AA6B 3H3MA 5HEUA 3AVRA 3ABVA 5HXSA 4U7YA 2LLYA 4EGWA 4LFCT 2CXLA 5CB4E 1WCRA 4DUYT 3AEEA 5LBQB 4DV4T 5DQWA 4HFEA 2CA5A 4ADZA 4DR2T 4UF0B 4UELA 4IE0A 4AQYT 3AE7A 2QYWA 3RHWA 3SOLA 2ES0A 2OV9A 5JDGA 3B57A 1DU2A 3ZMSB 2XAJB 4C90A 2D9DA 5JR9C 3VKHA 2EHOC 2B76A 2V5DA 1NAFA 3UFGA 4JBWF 3AE2A 4O2AE 1W0AA 2E5VA 5LA6E 3ANWA 3FB2A 3GA8A 1V9DA 3AE4A 3G06A 4KHZF 1HTJF 1YQ4A 4JI6T 5HCJA 2L9QA 3C50A 3KINB 5HCMA 2HN2A 4Q25A 3DJBA 2XUEA 2NP9A 3ZCIA 4DMVA 3N9LA 2VURA 1OWAA 3K3OA 4UVCB 4HFVA 2X67A 4JEHB 4HWFA 2CHOA 4OFZA 3KV5A 3O9XA 3AEAA 3MACA 2KWIB 4ILUA 3AE6A 1KK7A 3FZHB 3AECA 3NRYA 1N32T 2WCAA 2ZM0A 2WWVA 1E1HB 5A1LA 1WYBA 1T72A 4U74A 5DABA 2XQYA 1UX4A 4B3RT 3QUJA 4AXPA 1LRZA 2XASB 5IHYA 4P0BA 2ZM2A 3I1AA 3AXJB 2VKHA 3LJCA 3QK6A 3UULA 4P1NA 4YLHA 5LOVE 5KMGP 1MMGA 2DWKA 3RPUA 1MIVA 1SA0E 2J1DG 3C98B 3LK42 4EXTA 3OVUA 2HH7A 3FZFB 2V1DB 4NXMT 5AQQB 2VB6A 3U78A 2H3RA 2Y48B 4LFBT 2DCFA 3WAJA 3OBVE 2WWUA 2BKNA 2W61A 2W67A 2XQ8A 3UUXB 1SE7A 3A8YC 5AQMB 4QXBB 5FXZA 3UU5A 1MMAA 5JR9B 4DR6T 3NBXX 2NR4A 4KX6A 4YXDA 2HN1A 1XDOA 2PTFA 2V5CA 3QOFA 5JR9A 4AISA 5FNVE 2UXDT 4B3MT 2YKSA 4LF4T 2BS4A 2IAKA 1OEDC 2DHRA 2VASA 2VVSA 2XM2A 3E0ZA 3P4RA 4MFRA 4MLKA 4TUYE 4TX5A 3UTKA 1MMDA 2WZHA 2V6XA 3BQIA 2KSRA 5L4HA 5C8YE 2J47A 3CX7B 2CBJA 3GN5A 3MZKB 4UV8B 4V1Av 3V5UA 2XAQB 3L8RA 3ZN0B 4AQFA 4EIWA 2XY8B 4U7IA 3AXJA 3ESLA 4YTNA 5AQFB 3CQCB 4DMWA 1T98A 4U2YA 3RYCE 4CQIA 1D0XA 4DVDA 4ZOLE 4EV6A 5CFBA 3K1SA 5L3GB 4ASKA 4IDZA 5JRCB 4UXNB 2P9BA 2V7JA 4GKKT 4X62T 4E7ZA 5HYAA 4O4HE 2UUAT 1ZV4X 2BS3A 2I6HA 1GQEA 4N78D 4AI6A 4KP3C 2LRKA 5FVLA 3PUQA 1B7TA 5JREA 3Q5WA 3CIRA 2MPKA 4HFBA 3P4PA 2WDRA 4HWHA 4IE7A 4JI2T 4BJNA 1U5PA 1LVFA 4ILBA 3MA9A 3VHLA 4ZI7E 1E2AA 2FJAA 2KLQA 2XSBA 3ZMTB 4QKNA 5L3BB 2MTQA 3FXEB 1T8BA 2XTLA 4I0UA 4TV9E 3TLVA 3VRBA 5HXEA 2XAHB 3JAFA 3Q2MA 4IE5A 3RX6A 3TLTA 4HGAA 2X9WA 5ABFA 3PU3A 3SS1A 2ZLYA 5JDFA 3T1YT 5IUXA 3PURA 3TKLB 4JUYA 3AE3A 2V7LA 2FJEA 1NWMX 1R8IA 2LSYA 3LK3B 4UF0A 1JNZA 3AEGA 3RF1A 3AAAB 2NW8A 3AB3B 3VR8A 1T7SA 2X0LB 4PJMA 2OA5A 4DUZT 4H9QC 4AKHA 3EDVA 4B6XA 2L8KA 3N9NA 1Z0PA 3Q5EA 2YOEA 4X5TA 4AQFC 4QH1A 5L3DB 1IZNB 2DWGA 5AQIB 1BR4A 5AQVB 3PUYF 2LM2A 3EVYA 3ONXA 3RH3A 3M65A 4HFDA 2K9AA 4WBOA 3AAEB 2NW9A 2LEHA 2VWAA 3L39A 4U3CA 2WSSV 3ANWB 3PUWF 2X9XA 4A98A 5JH7E 1U4QA 3RC8A 4JI5T 2SPCA 4DV6T 1XWMA 3ZLIA 2V6YB 1HF8A 4EAHA 2E9XC 5JQGE 4I4TE 5L47A 4X66T 2G0UA 2UXCT 2VVNA 3UQ7A 2LRLA 3AEBA 5IWAT 1IBLT 2DLRA 3IEEA 5FP3A 4DV7T 2J4GA 4CXWA 2CWOA 3ZSTA 4NXNT 4LF8T 3JC6D 4YSYA 2UXXB 4GOUA 3RYFE 5AFUL 4H9SE 5LGNB 1BR1A 2LHNA 1HG5A 1IAPA 5FXWA 3PUGA 4X1KE 3JADA 5LGTB 2WP9A 2D0TA 5AQGB 5LP6E 4JI1T 4DBRA 4DV3T 3LG7A 2BBHA 2BBJA 3C4XA 5J2UE 1KNZA 2W63A 3RQUA 4ZI2D 4JV5T 3CX6B 3KVBA 2A3DA 3N9QA 4JI3T 2ACXA 4UVBB 4YJ3E 3T1HT 2BG9E 4ZI3D 3ZN1B 4B3TT 3O1JA 4IHJE 1VRBA 4OYJA 4YSXA 2XQ3A 3PE0A 4DR7T 4K0KT 3P4QA 4PJLA 3ZSSA 4IIJE 2X66A 4KI0F 4WBNE 2YINA 4OYKA 2I0MA 4EEDA 1N34T 3AE5A 4PFPA 4U72A 2JMKA 4EYYR 4ZEYA 4LF7T 1UURA 2VK9A 2LJLA 3B13A 5LXTE 3ZYLA 1E7PA 2NWBA 2PFVA 3CQGB 2XQ7A 4HWCA 2GK9A 1YD8G 2Q9QC 2XSAA 1Y01A 2WU2A 2WDVA 4PNIA 2IC6A 3ZT7A 2EHOA 5AQPB 3KBUA 3RKOA 2XPKA 3CPZA 3UUMA 4X64T 3FHNA 3M3ZB 3MK7C 4DR4T 4ZZCA 4KHPT 3C64A 4PK4A 3OKQA 4YY3T 1D1AA 4OK0A 3UQ4A 1Z8UA 1IJ6A 2QA7A 3H3AA 3JAEA 3ZYMA 4PJJA 3RLFF 2H89A 5FL1A 5HWYA 4OX9T 4NUUA 2LHRA 3MXZA 2BVMA 3GMIA 4DV0T 4QH4A 2UUCT 3C4WA 3O4XE 4JI8T 1KNPA 3N9MA 3L3PA 2WAUA 3E08A 3OYZA 2MYSA 2X9YA 4H63V 4HTEA 4L5GA 5ABGA 4LF5T 2ZM6T 1ZKEA 1KEYA 3KDSE 3MKDA 2JMHA 3ZJ2A 4ZI2C 4JYAT 3R6NA 2XZEA 5AQKB 2BZBA 2VKOA 5EK4A 2NTXA 5AQUB 2XQAA 3CKDA 3UU6A 4EYUA 5CA0E 4I55E 1FMWA 4DV2T 1X79A 5CGMA 5J0ZA 2CBIA 3J7Yq 2K24A 2D2SA 4CN4A 2IUBA 1NENA 2X0HA 4WNKA 4H9NC 3UT5E 5C2TA 1M62A 5LJMA 4TWHA 3UU4A 3AEFA 4OHFA 2IMLA 2J62A 2KT9A 3TLWA 3RGLA 3W15B 2UXBT 5IYZE 3I0OA 3HI2A 3HKDE 3VKGA 2E2AA 4ERRA 3LBXB 2KXPB 3F57A 1WR0A 2YDRA 1IBKT 3BQKA 1YKHB 1HX1B 3PUZF 4XBFB 4NPPA 1XDPA 3NKZA 5KX5E 3ZEFB 2VQFT 4C91A 4H9OC 5JDHA 1HX8A 2L3LA 2Q9QA 3HKCE 2JPFA 3S4UA 2LOPA 2D5UA 5FXVA 3D0TA 4AQGA 1HNWT 4TNVA 2FUPA 5TAOA 2CXFA 2W0GA 3UUBA 2PJQA 5LG3A 3RRWA 3H37A 4UVAB 4MHCA 3ZYKA 1J5ET 4JI7T 1KNRA 2R6GF 2CEAA 3K3NA 1NEKA 3I0QA 4TZ4C 1J1JA 3ONLC 3FBZA 4KUMB 4NIQA 3UFEA 3UU8A 3ZJ1A 5LMUT 3O1HA 3P7IA 2XAFB 3FZKB 3A7MA 4PW8A 5FL0A 3RIFA 4TV8E 3ZMZB 2ZM8A 4PK5A 4CZZB 2LSJA 5AQOB 4JI4T 4O4JE 2JIWA 4CN1A 2KINB 4X20E 1Y64B 2NW7A 1US7B 5LG4A 4WYVA 1YW0A 2KNDA 1OEDE 3ZT5A 3I9WA 3FZMB 1HNXT 2WZIA 1ZHCA 2KWHA 2UXNB 5H6QB 5KDMC 3O1IA 3RI5A 4DNDA 4DV1T 4G2AA 2V6YA 1UGOA 2KZ7B 4P09A 4PAGA 4PJNA 3CK6A 4B3ST 2V26A 1D1CA 3LK2B 1YQ3A 3RKGA 4F6RC 1HFAA 5ABEA 3LBXA 2LSIA 2W62A 3L09A 2AE9A 1D1BA 3EHZA 1OXZA 1G73A 3N9PA 3PTRB 3N2OA 1EZ3A 3PU8A 2YEVC 2DL1A 3QB5A 4H63H 4ILCA 4QX7B 2JQKA 2V7KA 2WMNA 2ODUA 2JRKA 2FBWA 3NWIA 4X1IE 3R84B 3KVAA 3UUNA 3ZKRA 3P50A 2VKJA 3AA1B 4X65T 4UIGA 2BVLA 4QX8B 2BS2A 2NTYA 3EAMA 4IDQA 3RIAA 3RQWA 3AE1A 2BG9B 1D0ZA 3NZQA 3ZMVB 4EZ4A 4EZHA 2YDSA 4GK0E 2JQ9A 4HFCA 1FEWA 1S35A 4UV9B 3V5SA 1XZYA 3C51A 2BKOA 2DI4A 2X68A 2ZMAA 4G63A 4I50E 4QXHB 2MBGA 5F3JA 3GN5B 1ZEEA 5FMNA 3N5LA 3RIUC 4ISTA 3N2KE 1I94T 2E9XD 5LBMA 2CHNA 1XMQT 4P0AA 4DIDB 2RA1A 3P4WA 4L9IA 4YHHT 2UU9T 3PUAA 1QSDA 2JJ9A 4GYSA 1XNQT 2LSKA 5L2LA 1IBMT 2N1GA 2VL8A 1M7KA 3VU7H 2W00A 2Y6XA 5AQHB 5H6RB 4QHOA 3WAKA 5LHHB 3JCFA 4Z8XA 1X9BA 1MMNA 5CJ5A 3J9X1 4AKGA 3ZPOA 4M1PA 4DV5T 3FBLA 2E9XB 4U31A 3AA7B 3FXDB 1J5WA 4L0RA 5JRCA 1WRDA 3RIUA 5L4EA 4CI1B 4LF9T 3B5MA 5L3FB 5AQNB 3EI0A 3EDUA 1JNRA 5HEHA 4FI5A 1AJ3A 4BA9A 4WW0A 1FMVA 3EABA 3PV0F 3SWHA 3KV9A 2LE8A 3IHRA 4LMLA 4DR3T 5JDMA 4UR9A 2BKPA 4Z91A 1HCIA 3GWHA 4HWIB 5FXXA 3WI3A 5LHGB 2MAWA 4HFIA 3SFDA 3ETVA 5BR8T 1FIOA 4HN9A 1MIWA 4U2ZA 3ETUA 5HXCA 5AQLB 2BG9A 2FJDA 2HPJA 4HWDA 4JI0T 5LGUB 2CWYA 3BK9A 3P4SA 1W09A 2YU2A 5FVKA 3TLUA 4YTPA 1O3XA 2KMFA 5J2TE 2EHOB 2WBLA 2ACZA 2WY2A 4CXXA 2M6IA 3N9OA 2VL0A 4BJMA 4EOZB 5BMVE 2IHR1 3PUSA 4ISSA 4LF6T 4EEBA 4AKLA 4JLEA 5FY7A 2LM9A 2NOXA 3VR9A 2Q9QD 4GYRA 4TWDA 4DO0A 2MOZA 5KXJA 1MNEA 3P8CD 1HS7A 2EHOD 2LKHA 3I9YA 2K48A 2X0YA 5HEOA 2W66A 3N2GE 4AIUA 5HWXA 4CXYA 3Q5DA 4YJ2E 1KFYA 5JVDE 1HNZT 4TWFA 5LB7B 3SRZA 1HR0T 1N33T 5LCYA 5F8PA 5LYJE 2K3WA 5ETWA 5DJQC 1VCTA 1SUMB 3EUHA 2B1EA 3HA4A 4QXCB 5AQJB 3RYHE 1OEDA 1FJGT 2IDOB 3KFWX 2YU1A 2N9DA 3MJXA 2IW5B 4ILAA 2WS3A 4TNWA 3KV6A 4UEMA 4CI3B 4J2CA 2CLYC 3NZPA 3ZMUB 5CA1E 1WYCA 4IREA 2A2FX 2X9HA 2AXDS 3IBPA 5FY0A 5FYMA 2LOSA 4A56A 4IDPA 5ADXL 2XQ9A 5HXHA 2E5LT 5M4YA 1HG2A 2CE7A 2W4XA 2XJ7A 3NVOA 4K0UA 5FKYA 5ABFB 2VQET 5LMNT 3PJAJ 2Q9QB 4O2BE 5J1GA 2IC9A 2M67A 2QRXA 3Q5XA 4DR1T 4O4LE 3QC9A 4H9PC 1ZOYA 2M6BA 3LFMA 3ZCJA 4COFA 1WR6A 5HEJA 1WLXA 2IIUA 2YK0A 1UK5A 3X1DA 1LVKA 2K5BB 4ANJA 4GK5E
chains in the Genus database with same CATH topology
4IE4A 2CMRA 4H9RC 4DBQA 3AA0B 5JDQA 4XZCA 3KBTA 4ZI3C 3E22E 2I59A 3HKEE 3JC6C 3F31A 3HL6A 5EK2A 5KMGP 2CM0A 2Y8DA 4IGUA 3Q9DA 1UCUA 1BR2A 4ZS2A 2C0SA 2A72A 4MBQA 2C5JA 3NRXA 4BAYB 2CLYB 2X51A 3K3QC 4I43B 3ZC0A 1G8XA 4PFOA 4AKRB 2VKDA 3HKBE 3HR0A 2XHEB 2C5KT 2HPLA 2H7VC 1MIYA 1H7CA 2C5IT 3T8OA 3K8PC 5E0OA 4ZHQE 1BR0A 2PG8A 3DTOA 3OYXA 2E9XA 5GONE 3F2EA 3PDYA 5L3EB 3IF8B 3ZC1A 2LSGA 1IJ5A 1LKXA 4CI2B 4X1YE 4HKAA 5JDNA 5EK3A 3RYIE 4O8SA 2XAGB 4YHJA 1SHZC 2JQQA 5HAXA 3C4ZA 2V7MA 4QWNB 3AVSA 4FJOA 4YFSA 4AKIA 3CWZB 4XAXB 5LHIB 4JEUB 2WM9A 2E8IA 2LT3A 4HE8A 3CVRA 1QUUA 3CX8B 4NUVA 5HXRA 2DNXA 1UX5A 4MALA 3CMLA 3U3IA 5LJNA 4PK6A 5DQVA 2BDEA 2V7IA 3AAIA 4ZS3A 3BQLA 3RC3A 2CXDA 2H7OA 1VOMA 4GIWA 3RRCA 4IE6A 1S94A 2ODVA 3CQXC 5LNKA 4O4IE 4E7SA 2N2NA 1YKEB 4KMCA 3DP7A 5EZYE 1D0YA 3KV4A 4HEAA 2QGSA 5FY1A 4KBMB 2Z6EA 1MNDA 2CCQA 3A5XA 2PBIA 2D0UA 3OJAA 1CUNA 2RP4A 4EB6E 4TN7B 2WMOA 3AA6B 3AVRA 5HXSA 2CXLA 5CB4E 5LBQB 5DQWA 2CA5A 4ADZA 4UF0B 4UELA 4IE0A 5JDGA 3SOLA 2ES0A 3B57A 3ZMSB 2XAJB 4C90A 5JR9C 3VKHA 2EHOC 1NAFA 4O2AE 5LA6E 3ANWA 3FB2A 3GA8A 1V9DA 1HTJF 2L9QA 3C50A 3KINB 3DJBA 2XUEA 2NP9A 3ZCIA 4DMVA 3N9LA 4UVCB 1OWAA 3K3OA 4HFVA 2X67A 4JEHB 4OFZA 3KV5A 3O9XA 3MACA 2KWIB 4ILUA 3NRYA 1KK7A 2ZM0A 1E1HB 5A1LA 1WYBA 4U74A 5DABA 2XQYA 1UX4A 3QUJA 4AXPA 1LRZA 2XASB 5IHYA 4P0BA 2ZM2A 3I1AA 3LJCA 2VKHA 3QK6A 3UULA 4YLHA 5LOVE 1MMGA 2DWKA 3RPUA 1MIVA 1SA0E 2J1DG 3C98B 3LK42 4EXTA 2HH7A 2V1DB 2VB6A 3U78A 2H3RA 2Y48B 2DCFA 3WAJA 3OBVE 2WWUA 2W61A 3UUXB 5JR9B 5FXZA 4QXBB 1MMAA 3NBXX 5JR9A 5FNVE 2IAKA 5L3DB 2DHRA 4MFRA 2VASA 3E0ZA 4TUYE 4TX5A 4MLKA 3UTKA 1MMDA 3BQIA 5C8YE 3CX7B 3GN5A 3MZKB 4UV8B 4V1Av 3V5UA 2XAQB 3ZN0B 4AQFA 4EIWA 4EZ4A 3ESLA 3CQCB 4DMWA 1T98A 3RYCE 4DVDA 4CQIA 1D0XA 4ZOLE 4ASKA 4IDZA 5JRCB 4UXNB 2P9BA 2V7JA 4E7ZA 5HYAA 4O4HE 1ZV4X 4AI6A 4N78D 4KP3C 3PUQA 1B7TA 5JREA 3Q5WA 5L3CB 4IE7A 4BJNA 1U5PA 1LVFA 3MA9A 4ZI7E 2KLQA 3ZMTB 5L3BB 4QKNA 2MTQA 3FXEB 2XTLA 4TV9E 5HXEA 2XAHB 3Q2MA 4IE5A 3RX6A 4HGAA 2X9WA 3PU3A 3SS1A 2ZLYA 5JDFA 3PURA 3TKLB 4JUYA 3LK3B 2V7LA 2LSYA 1NWMX 4DO0A 4UF0A 3AAAB 2NW8A 3AB3B 4PJMA 2X0LB 4AKHA 2OA5A 4H9QC 3EDVA 4B6XA 2L8KA 3N9NA 1Z0PA 4AQFC 1IZNB 2DWGA 1BR4A 3EVYA 3ONXA 3RH3A 3M65A 2K9AA 4WBOA 3AAEB 2NW9A 2LEHA 2VWAA 2WSSV 3ANWB 5JH7E 2X9XA 3RC8A 1U4QA 2SPCA 3ZLIA 1HF8A 4EAHA 2E9XC 5JQGE 4I4TE 2G0UA 2DLRA 3IEEA 5FP3A 4CXWA 2CWOA 3JC6D 2UXXB 4GOUA 3RYFE 5AFUL 4H9SE 5LGNB 1BR1A 2LHNA 1HG5A 1IAPA 5FXWA 3PUGA 4X1KE 5LGTB 2D0TA 5LP6E 4DBRA 3LG7A 1KNZA 5J2UE 3C4XA 2W63A 4ZI2D 3CX6B 3KVBA 2A3DA 3N9QA 2ACXA 4UVBB 4YJ3E 4ZI3D 3ZN1B 3O1JA 4IHJE 1VRBA 4OYJA 3PE0A 4PJLA 4IIJE 2X66A 4WBNE 2YINA 4OYKA 4PFPA 4U72A 2JMKA 4EYYR 3B13A 2VK9A 2LJLA 5LXTE 3ZYLA 2NWBA 2PFVA 3CQGB 2GK9A 1YD8G 2Q9QC 4PNIA 2IC6A 2EHOA 3UUMA 3KBUA 3RKOA 3CPZA 3FHNA 3MK7C 3C64A 4PK4A 3OKQA 1D1AA 4OK0A 2QA7A 1IJ6A 3H3AA 4PJJA 5HWYA 4NUUA 2LHRA 3MXZA 2BVMA 3GMIA 3C4WA 3O4XE 3N9MA 3L3PA 2WAUA 3E08A 3OYZA 2MYSA 2X9YA 4H63V 4HTEA 4L5GA 1ZKEA 3KDSE 3MKDA 2JMHA 3ZJ2A 4ZI2C 3R6NA 2BZBA 2VKOA 5EK4A 2NTXA 4EYUA 3CKDA 5CA0E 4I55E 1FMWA 1X79A 3J7Yq 2K24A 2D2SA 4WNKA 4H9NC 3UT5E 5F3JA 4OHFA 3W15B 2KT9A 5IYZE 3I0OA 3HI2A 3HKDE 3VKGA 4ERRA 3LBXB 2KXPB 3F57A 3BQKA 1YKHB 4XBFB 5KX5E 3ZEFB 4C91A 4H9OC 5JDHA 1HX8A 2L3LA 2Q9QA 3HKCE 2JPFA 3S4UA 2LOPA 2D5UA 5FXVA 3D0TA 4AQGA 5TAOA 2CXFA 2W0GA 2PJQA 3RRWA 3H37A 4UVAB 4MHCA 3ZYKA 3VHLA 2CEAA 3K3NA 4TZ4C 3I0QA 3UFEA 5JDLA 3FBZA 4KUMB 3ZJ1A 3O1HA 3P7IA 2XAFB 4PW8A 3ZMZB 4TV8E 4CZZB 2ZM8A 4PK5A 2LSJA 4O4JE 2KINB 4X20E 1Y64B 2NW7A 1US7B 5LG4A 1YW0A 2KNDA 3I9WA 1ZHCA 2KWHA 2UXNB 5H6QB 5KDMC 3O1IA 4DNDA 4G2AA 2KZ7B 4P09A 4PAGA 4PJNA 2V26A 1D1CA 3LK2B 4F6RC 1HFAA 3LBXA 2LSIA 2W62A 3L09A 1D1BA 1OXZA 1G73A 3N9PA 3PTRB 3N2OA 1EZ3A 3PU8A 2YEVC 3ZYMA 4H63H 4QX7B 2V7KA 2WMNA 2ODUA 2JRKA 4X1IE 3R84B 3KVAA 3UUNA 2VKJA 3AA1B 4UIGA 2BVLA 4QX8B 2NTYA 3NZQA 1D0ZA 3ZMVB 4EZHA 4GK0E 3V5SA 5LJMA 1FEWA 1S35A 4UV9B 3C51A 4G63A 2DI4A 2ZMAA 2X68A 4I50E 4QXHB 2MBGA 3GN5B 1ZEEA 5FMNA 3N5LA 4ISTA 3N2KE 2E9XD 5LBMA 4P0AA 2RA1A 4L9IA 3PUAA 1QSDA 2JJ9A 4GYSA 2LSKA 5L2LA 2N1GA 2VL8A 3VU7H 2W00A 2Y6XA 5H6RB 5LHHB 4QHOA 3WAKA 4AKGA 4Z8XA 1MMNA 3J9X1 3ZPOA 4M1PA 3FBLA 2E9XB 3AA7B 3FXDB 4L0RA 5JRCA 1WRDA 4CI1B 5L3FB 1AJ3A 3EDUA 4FI5A 4BA9A 4WW0A 1FMVA 3SWHA 3KV9A 2LE8A 3IHRA 5JDMA 1HCIA 3GWHA 5FXXA 3WI3A 5LHGB 3ETVA 1FIOA 4HN9A 1MIWA 5HXCA 3ETUA 2HPJA 5LGUB 2CWYA 3BK9A 2YU2A 1O3XA 2KMFA 5J2TE 2EHOB 2WBLA 4CXXA 3N9OA 4BJMA 4EOZB 5BMVE 3PUSA 4ISSA 4AKLA 4JLEA 5FY7A 2LM9A 2NOXA 1HS7A 2Q9QD 4GYRA 2MOZA 1MNEA 3P8CD 2EHOD 3I9YA 2K48A 5HWXA 4CXYA 3N2GE 4YJ2E 5JVDE 3SRZA 5LCYA 5F8PA 5ETWA 5DJQC 3EUHA 2B1EA 3HA4A 4QXCB 3RYHE 3KFWX 2YU1A 2N9DA 3MJXA 2IW5B 5L3GB 4UEMA 3KV6A 4CI3B 5LYJE 4J2CA 2CLYC 3NZPA 3ZMUB 5CA1E 1WYCA 2A2FX 2X9HA 3IBPA 5FY0A 5FYMA 2LOSA 4A56A 5ADXL 5HXHA 5M4YA 1HG2A 2CE7A 4K0UA 2Q9QB 4O2BE 5J1GA 2IC9A 2M67A 3Q5XA 4O4LE 3QC9A 4H9PC 3ZCJA 3LFMA 1WR6A 1WLXA 2YK0A 1LVKA 2K5BB 4ANJA 4GK5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P0B A;  2CCQ A;  4JUY A;  2HPJ A;  4OYK A;  4OYJ A;  2CM0 A;  4P09 A;  2HPL A;  5LJM A;  5LJN A;  2D5U A;  4P0A A; 
#chains in the Genus database with same CATH topology
 4IE4 A;  2CMR A;  4H9R C;  5JTG A;  1UUS A;  4DBQ A;  3AA0 B;  3TLS A;  3QNU A;  3QB5 K;  4XZC A;  5JDQ A;  1XMO T;  1QLB A;  3KBT A;  4ZI3 C;  1OED B;  3E22 E;  2I59 A;  3IA3 A;  3HKE E;  2FJB A;  3JC6 C;  2CPT A;  3AE8 A;  3F31 A;  3HL6 A;  4IT4 A;  2WU5 A;  4IDN A;  4A5X A;  2CM0 A;  5EK2 A;  2Y8D A;  4IGU A;  3Q9D A;  1KF6 A;  1UCU A;  1BR2 A;  2XQ6 A;  2LKG A;  4ZS2 A;  2RPA A;  2C0S A;  2A72 A;  4U33 A;  4MBQ A;  3OTO T;  2C5J A;  3OPC A;  3NRX A;  1CHU A;  4BAY B;  2CLY B;  2X51 A;  3K3Q C;  4I43 B;  1I6Z A;  3ZC0 A;  5HEG A;  4IL4 A;  1G8X A;  2YN6 A;  4PFO A;  4AKR B;  2VKD A;  3HKB E;  3HR0 A;  5ABH A;  2UUB T;  2YDQ A;  2XHE B;  2C5K T;  1WFD A;  3LSV A;  2A9U A;  2H7V C;  1MIY A;  1H7C A;  2C5I T;  2HPL A;  3K8P C;  3LDQ B;  4QH5 A;  3T8O A;  5E0O A;  4CN6 A;  4IL9 A;  2PG8 A;  2XQ5 A;  3DTO A;  3OYX A;  4ZHQ E;  5JDL A;  2E9X A;  5L3C B;  1BR0 A;  3AE9 A;  5GON E;  3F2E A;  3PDY A;  3ONJ A;  3ZT6 A;  1XNR T;  2F4V T;  5L3E B;  1ZP0 A;  1W0B A;  3IF8 B;  2LSG A;  3ZC1 A;  1IJ5 A;  1LKX A;  4CI2 B;  4X1Y E;  4HKA A;  5JDN A;  4GKJ T;  2WQY A;  3PUX F;  5EK3 A;  3RYI E;  4O8S A;  2WB5 A;  2XAG B;  2OLT A;  4YHJ A;  3PUV F;  1SHZ C;  2JQQ A;  1YXR A;  2H88 A;  3C4Z A;  5HAX A;  3SFE A;  3PJA A;  2V7M A;  2W2U A;  4QWN B;  5C3J A;  3AVS A;  4FJO A;  1W9R A;  4YFS A;  4AKI A;  3CWZ B;  4XAX B;  4ZXL A;  5LHI B;  4JEU B;  2WM9 A;  5AQS B;  2E8I A;  2LT3 A;  4HE8 A;  3CVR A;  1QUU A;  4WZX A;  3FZL B;  4YT0 A;  3CX8 B;  4NUV A;  5HXR A;  2DNX A;  1UX5 A;  4MAL A;  3CML A;  4IDO A;  3U3I A;  3UU3 A;  5LJN A;  4PK6 A;  5DQV A;  4DR5 T;  2BDE A;  4F8H A;  2V7I A;  2XQ4 A;  3AAI A;  4ZS3 A;  3BQL A;  2V8S V;  2XM1 A;  2CXD A;  3RC3 A;  2BG9 C;  2CRB A;  2H7O A;  1VOM A;  4GIW A;  3RRC A;  4LFA T;  1VCS A;  4LMJ A;  4IE6 A;  1S94 A;  2ODV A;  3CQX C;  1L0V A;  5LNK A;  5AQT B;  4YSZ A;  4O4I E;  3VRA A;  4E7S A;  2N2N A;  1YKE B;  2QVA A;  2WDQ A;  4KMC A;  2JQH A;  3DP7 A;  4Z90 A;  4LMK A;  5EZY E;  1D0Y A;  3KV4 A;  4HEA A;  2QGS A;  4HFH A;  5FY1 A;  4KBM B;  4A97 A;  2Z6E A;  5AQR B;  1MND A;  2CCQ A;  3A5X A;  5F5W A;  2HHH T;  2PBI A;  2D0U A;  3OJA A;  1CUN A;  2RP4 A;  3AED A;  4YTM A;  4EB6 E;  4ZZB A;  4TN7 B;  1N36 T;  2WMO A;  3AA6 B;  3H3M A;  5HEU A;  3AVR A;  3ABV A;  5HXS A;  4U7Y A;  2LLY A;  4EGW A;  4LFC T;  2CXL A;  5CB4 E;  1WCR A;  4DUY T;  3AEE A;  5LBQ B;  4DV4 T;  5DQW A;  4HFE A;  2CA5 A;  4ADZ A;  4DR2 T;  4UF0 B;  4UEL A;  4IE0 A;  4AQY T;  3AE7 A;  2QYW A;  3RHW A;  3SOL A;  2ES0 A;  2OV9 A;  5JDG A;  3B57 A;  1DU2 A;  3ZMS B;  2XAJ B;  4C90 A;  2D9D A;  5JR9 C;  3VKH A;  2EHO C;  2B76 A;  2V5D A;  1NAF A;  3UFG A;  4JBW F;  3AE2 A;  4O2A E;  1W0A A;  2E5V A;  5LA6 E;  3ANW A;  3FB2 A;  3GA8 A;  1V9D A;  3AE4 A;  3G06 A;  4KHZ F;  1HTJ F;  1YQ4 A;  4JI6 T;  5HCJ A;  2L9Q A;  3C50 A;  3KIN B;  5HCM A;  2HN2 A;  4Q25 A;  3DJB A;  2XUE A;  2NP9 A;  3ZCI A;  4DMV A;  3N9L A;  2VUR A;  1OWA A;  3K3O A;  4UVC B;  4HFV A;  2X67 A;  4JEH B;  4HWF A;  2CHO A;  4OFZ A;  3KV5 A;  3O9X A;  3AEA A;  3MAC A;  2KWI B;  4ILU A;  3AE6 A;  1KK7 A;  3FZH B;  3AEC A;  3NRY A;  1N32 T;  2WCA A;  2ZM0 A;  2WWV A;  1E1H B;  5A1L A;  1WYB A;  1T72 A;  4U74 A;  5DAB A;  2XQY A;  1UX4 A;  4B3R T;  3QUJ A;  4AXP A;  1LRZ A;  2XAS B;  5IHY A;  4P0B A;  2ZM2 A;  3I1A A;  3AXJ B;  2VKH A;  3LJC A;  3QK6 A;  3UUL A;  4P1N A;  4YLH A;  5LOV E;  5KMG P;  1MMG A;  2DWK A;  3RPU A;  1MIV A;  1SA0 E;  2J1D G;  3C98 B;  3LK4 2;  4EXT A;  3OVU A;  2HH7 A;  3FZF B;  2V1D B;  4NXM T;  5AQQ B;  2VB6 A;  3U78 A;  2H3R A;  2Y48 B;  4LFB T;  2DCF A;  3WAJ A;  3OBV E;  2WWU A;  2BKN A;  2W61 A;  2W67 A;  2XQ8 A;  3UUX B;  1SE7 A;  3A8Y C;  5AQM B;  4QXB B;  5FXZ A;  3UU5 A;  1MMA A;  5JR9 B;  4DR6 T;  3NBX X;  2NR4 A;  4KX6 A;  4YXD A;  2HN1 A;  1XDO A;  2PTF A;  2V5C A;  3QOF A;  5JR9 A;  4AIS A;  5FNV E;  2UXD T;  4B3M T;  2YKS A;  4LF4 T;  2BS4 A;  2IAK A;  1OED C;  2DHR A;  2VAS A;  2VVS A;  2XM2 A;  3E0Z A;  3P4R A;  4MFR A;  4MLK A;  4TUY E;  4TX5 A;  3UTK A;  1MMD A;  2WZH A;  2V6X A;  3BQI A;  2KSR A;  5L4H A;  5C8Y E;  2J47 A;  3CX7 B;  2CBJ A;  3GN5 A;  3MZK B;  4UV8 B;  4V1A v;  3V5U A;  2XAQ B;  3L8R A;  3ZN0 B;  4AQF A;  4EIW A;  2XY8 B;  4U7I A;  3AXJ A;  3ESL A;  4YTN A;  5AQF B;  3CQC B;  4DMW A;  1T98 A;  4U2Y A;  3RYC E;  4CQI A;  1D0X A;  4DVD A;  4ZOL E;  4EV6 A;  5CFB A;  3K1S A;  5L3G B;  4ASK A;  4IDZ A;  5JRC B;  4UXN B;  2P9B A;  2V7J A;  4GKK T;  4X62 T;  4E7Z A;  5HYA A;  4O4H E;  2UUA T;  1ZV4 X;  2BS3 A;  2I6H A;  1GQE A;  4N78 D;  4AI6 A;  4KP3 C;  2LRK A;  5FVL A;  3PUQ A;  1B7T A;  5JRE A;  3Q5W A;  3CIR A;  2MPK A;  4HFB A;  3P4P A;  2WDR A;  4HWH A;  4IE7 A;  4JI2 T;  4BJN A;  1U5P A;  1LVF A;  4ILB A;  3MA9 A;  3VHL A;  4ZI7 E;  1E2A A;  2FJA A;  2KLQ A;  2XSB A;  3ZMT B;  4QKN A;  5L3B B;  2MTQ A;  3FXE B;  1T8B A;  2XTL A;  4I0U A;  4TV9 E;  3TLV A;  3VRB A;  5HXE A;  2XAH B;  3JAF A;  3Q2M A;  4IE5 A;  3RX6 A;  3TLT A;  4HGA A;  2X9W A;  5ABF A;  3PU3 A;  3SS1 A;  2ZLY A;  5JDF A;  3T1Y T;  5IUX A;  3PUR A;  3TKL B;  4JUY A;  3AE3 A;  2V7L A;  2FJE A;  1NWM X;  1R8I A;  2LSY A;  3LK3 B;  4UF0 A;  1JNZ A;  3AEG A;  3RF1 A;  3AAA B;  2NW8 A;  3AB3 B;  3VR8 A;  1T7S A;  2X0L B;  4PJM A;  2OA5 A;  4DUZ T;  4H9Q C;  4AKH A;  3EDV A;  4B6X A;  2L8K A;  3N9N A;  1Z0P A;  3Q5E A;  2YOE A;  4X5T A;  4AQF C;  4QH1 A;  5L3D B;  1IZN B;  2DWG A;  5AQI B;  1BR4 A;  5AQV B;  3PUY F;  2LM2 A;  3EVY A;  3ONX A;  3RH3 A;  3M65 A;  4HFD A;  2K9A A;  4WBO A;  3AAE B;  2NW9 A;  2LEH A;  2VWA A;  3L39 A;  4U3C A;  2WSS V;  3ANW B;  3PUW F;  2X9X A;  4A98 A;  5JH7 E;  1U4Q A;  3RC8 A;  4JI5 T;  2SPC A;  4DV6 T;  1XWM A;  3ZLI A;  2V6Y B;  1HF8 A;  4EAH A;  2E9X C;  5JQG E;  4I4T E;  5L47 A;  4X66 T;  2G0U A;  2UXC T;  2VVN A;  3UQ7 A;  2LRL A;  3AEB A;  5IWA T;  1IBL T;  2DLR A;  3IEE A;  5FP3 A;  4DV7 T;  2J4G A;  4CXW A;  2CWO A;  3ZST A;  4NXN T;  4LF8 T;  3JC6 D;  4YSY A;  2UXX B;  4GOU A;  3RYF E;  5AFU L;  4H9S E;  5LGN B;  1BR1 A;  2LHN A;  1HG5 A;  1IAP A;  5FXW A;  3PUG A;  4X1K E;  3JAD A;  5LGT B;  2WP9 A;  2D0T A;  5AQG B;  5LP6 E;  4JI1 T;  4DBR A;  4DV3 T;  3LG7 A;  2BBH A;  2BBJ A;  3C4X A;  5J2U E;  1KNZ A;  2W63 A;  3RQU A;  4ZI2 D;  4JV5 T;  3CX6 B;  3KVB A;  2A3D A;  3N9Q A;  4JI3 T;  2ACX A;  4UVB B;  4YJ3 E;  3T1H T;  2BG9 E;  4ZI3 D;  3ZN1 B;  4B3T T;  3O1J A;  4IHJ E;  1VRB A;  4OYJ A;  4YSX A;  2XQ3 A;  3PE0 A;  4DR7 T;  4K0K T;  3P4Q A;  4PJL A;  3ZSS A;  4IIJ E;  2X66 A;  4KI0 F;  4WBN E;  2YIN A;  4OYK A;  2I0M A;  4EED A;  1N34 T;  3AE5 A;  4PFP A;  4U72 A;  2JMK A;  4EYY R;  4ZEY A;  4LF7 T;  1UUR A;  2VK9 A;  2LJL A;  3B13 A;  5LXT E;  3ZYL A;  1E7P A;  2NWB A;  2PFV A;  3CQG B;  2XQ7 A;  4HWC A;  2GK9 A;  1YD8 G;  2Q9Q C;  2XSA A;  1Y01 A;  2WU2 A;  2WDV A;  4PNI A;  2IC6 A;  3ZT7 A;  2EHO A;  5AQP B;  3KBU A;  3RKO A;  2XPK A;  3CPZ A;  3UUM A;  4X64 T;  3FHN A;  3M3Z B;  3MK7 C;  4DR4 T;  4ZZC A;  4KHP T;  3C64 A;  4PK4 A;  3OKQ A;  4YY3 T;  1D1A A;  4OK0 A;  3UQ4 A;  1Z8U A;  1IJ6 A;  2QA7 A;  3H3A A;  3JAE A;  3ZYM A;  4PJJ A;  3RLF F;  2H89 A;  5FL1 A;  5HWY A;  4OX9 T;  4NUU A;  2LHR A;  3MXZ A;  2BVM A;  3GMI A;  4DV0 T;  4QH4 A;  2UUC T;  3C4W A;  3O4X E;  4JI8 T;  1KNP A;  3N9M A;  3L3P A;  2WAU A;  3E08 A;  3OYZ A;  2MYS A;  2X9Y A;  4H63 V;  4HTE A;  4L5G A;  5ABG A;  4LF5 T;  2ZM6 T;  1ZKE A;  1KEY A;  3KDS E;  3MKD A;  2JMH A;  3ZJ2 A;  4ZI2 C;  4JYA T;  3R6N A;  2XZE A;  5AQK B;  2BZB A;  2VKO A;  5EK4 A;  2NTX A;  5AQU B;  2XQA A;  3CKD A;  3UU6 A;  4EYU A;  5CA0 E;  4I55 E;  1FMW A;  4DV2 T;  1X79 A;  5CGM A;  5J0Z A;  2CBI A;  3J7Y q;  2K24 A;  2D2S A;  4CN4 A;  2IUB A;  1NEN A;  2X0H A;  4WNK A;  4H9N C;  3UT5 E;  5C2T A;  1M62 A;  5LJM A;  4TWH A;  3UU4 A;  3AEF A;  4OHF A;  2IML A;  2J62 A;  2KT9 A;  3TLW A;  3RGL A;  3W15 B;  2UXB T;  5IYZ E;  3I0O A;  3HI2 A;  3HKD E;  3VKG A;  2E2A A;  4ERR A;  3LBX B;  2KXP B;  3F57 A;  1WR0 A;  2YDR A;  1IBK T;  3BQK A;  1YKH B;  1HX1 B;  3PUZ F;  4XBF B;  4NPP A;  1XDP A;  3NKZ A;  5KX5 E;  3ZEF B;  2VQF T;  4C91 A;  4H9O C;  5JDH A;  1HX8 A;  2L3L A;  2Q9Q A;  3HKC E;  2JPF A;  3S4U A;  2LOP A;  2D5U A;  5FXV A;  3D0T A;  4AQG A;  1HNW T;  4TNV A;  2FUP A;  5TAO A;  2CXF A;  2W0G A;  3UUB A;  2PJQ A;  5LG3 A;  3RRW A;  3H37 A;  4UVA B;  4MHC A;  3ZYK A;  1J5E T;  4JI7 T;  1KNR A;  2R6G F;  2CEA A;  3K3N A;  1NEK A;  3I0Q A;  4TZ4 C;  1J1J A;  3ONL C;  3FBZ A;  4KUM B;  4NIQ A;  3UFE A;  3UU8 A;  3ZJ1 A;  5LMU T;  3O1H A;  3P7I A;  2XAF B;  3FZK B;  3A7M A;  4PW8 A;  5FL0 A;  3RIF A;  4TV8 E;  3ZMZ B;  2ZM8 A;  4PK5 A;  4CZZ B;  2LSJ A;  5AQO B;  4JI4 T;  4O4J E;  2JIW A;  4CN1 A;  2KIN B;  4X20 E;  1Y64 B;  2NW7 A;  1US7 B;  5LG4 A;  4WYV A;  1YW0 A;  2KND A;  1OED E;  3ZT5 A;  3I9W A;  3FZM B;  1HNX T;  2WZI A;  1ZHC A;  2KWH A;  2UXN B;  5H6Q B;  5KDM C;  3O1I A;  3RI5 A;  4DND A;  4DV1 T;  4G2A A;  2V6Y A;  1UGO A;  2KZ7 B;  4P09 A;  4PAG A;  4PJN A;  3CK6 A;  4B3S T;  2V26 A;  1D1C A;  3LK2 B;  1YQ3 A;  3RKG A;  4F6R C;  1HFA A;  5ABE A;  3LBX A;  2LSI A;  2W62 A;  3L09 A;  2AE9 A;  1D1B A;  3EHZ A;  1OXZ A;  1G73 A;  3N9P A;  3PTR B;  3N2O A;  1EZ3 A;  3PU8 A;  2YEV C;  2DL1 A;  3QB5 A;  4H63 H;  4ILC A;  4QX7 B;  2JQK A;  2V7K A;  2WMN A;  2ODU A;  2JRK A;  2FBW A;  3NWI A;  4X1I E;  3R84 B;  3KVA A;  3UUN A;  3ZKR A;  3P50 A;  2VKJ A;  3AA1 B;  4X65 T;  4UIG A;  2BVL A;  4QX8 B;  2BS2 A;  2NTY A;  3EAM A;  4IDQ A;  3RIA A;  3RQW A;  3AE1 A;  2BG9 B;  1D0Z A;  3NZQ A;  3ZMV B;  4EZ4 A;  4EZH A;  2YDS A;  4GK0 E;  2JQ9 A;  4HFC A;  1FEW A;  1S35 A;  4UV9 B;  3V5S A;  1XZY A;  3C51 A;  2BKO A;  2DI4 A;  2X68 A;  2ZMA A;  4G63 A;  4I50 E;  4QXH B;  2MBG A;  5F3J A;  3GN5 B;  1ZEE A;  5FMN A;  3N5L A;  3RIU C;  4IST A;  3N2K E;  1I94 T;  2E9X D;  5LBM A;  2CHN A;  1XMQ T;  4P0A A;  4DID B;  2RA1 A;  3P4W A;  4L9I A;  4YHH T;  2UU9 T;  3PUA A;  1QSD A;  2JJ9 A;  4GYS A;  1XNQ T;  2LSK A;  5L2L A;  1IBM T;  2N1G A;  2VL8 A;  1M7K A;  3VU7 H;  2W00 A;  2Y6X A;  5AQH B;  5H6R B;  4QHO A;  3WAK A;  5LHH B;  3JCF A;  4Z8X A;  1X9B A;  1MMN A;  5CJ5 A;  3J9X 1;  4AKG A;  3ZPO A;  4M1P A;  4DV5 T;  3FBL A;  2E9X B;  4U31 A;  3AA7 B;  3FXD B;  1J5W A;  4L0R A;  5JRC A;  1WRD A;  3RIU A;  5L4E A;  4CI1 B;  4LF9 T;  3B5M A;  5L3F B;  5AQN B;  3EI0 A;  3EDU A;  1JNR A;  5HEH A;  4FI5 A;  1AJ3 A;  4BA9 A;  4WW0 A;  1FMV A;  3EAB A;  3PV0 F;  3SWH A;  3KV9 A;  2LE8 A;  3IHR A;  4LML A;  4DR3 T;  5JDM A;  4UR9 A;  2BKP A;  4Z91 A;  1HCI A;  3GWH A;  4HWI B;  5FXX A;  3WI3 A;  5LHG B;  2MAW A;  4HFI A;  3SFD A;  3ETV A;  5BR8 T;  1FIO A;  4HN9 A;  1MIW A;  4U2Z A;  3ETU A;  5HXC A;  5AQL B;  2BG9 A;  2FJD A;  2HPJ A;  4HWD A;  4JI0 T;  5LGU B;  2CWY A;  3BK9 A;  3P4S A;  1W09 A;  2YU2 A;  5FVK A;  3TLU A;  4YTP A;  1O3X A;  2KMF A;  5J2T E;  2EHO B;  2WBL A;  2ACZ A;  2WY2 A;  4CXX A;  2M6I A;  3N9O A;  2VL0 A;  4BJM A;  4EOZ B;  5BMV E;  2IHR 1;  3PUS A;  4ISS A;  4LF6 T;  4EEB A;  4AKL A;  4JLE A;  5FY7 A;  2LM9 A;  2NOX A;  3VR9 A;  2Q9Q D;  4GYR A;  4TWD A;  4DO0 A;  2MOZ A;  5KXJ A;  1MNE A;  3P8C D;  1HS7 A;  2EHO D;  2LKH A;  3I9Y A;  2K48 A;  2X0Y A;  5HEO A;  2W66 A;  3N2G E;  4AIU A;  5HWX A;  4CXY A;  3Q5D A;  4YJ2 E;  1KFY A;  5JVD E;  1HNZ T;  4TWF A;  5LB7 B;  3SRZ A;  1HR0 T;  1N33 T;  5LCY A;  5F8P A;  5LYJ E;  2K3W A;  5ETW A;  5DJQ C;  1VCT A;  1SUM B;  3EUH A;  2B1E A;  3HA4 A;  4QXC B;  5AQJ B;  3RYH E;  1OED A;  1FJG T;  2IDO B;  3KFW X;  2YU1 A;  2N9D A;  3MJX A;  2IW5 B;  4ILA A;  2WS3 A;  4TNW A;  3KV6 A;  4UEM A;  4CI3 B;  4J2C A;  2CLY C;  3NZP A;  3ZMU B;  5CA1 E;  1WYC A;  4IRE A;  2A2F X;  2X9H A;  2AXD S;  3IBP A;  5FY0 A;  5FYM A;  2LOS A;  4A56 A;  4IDP A;  5ADX L;  2XQ9 A;  5HXH A;  2E5L T;  5M4Y A;  1HG2 A;  2CE7 A;  2W4X A;  2XJ7 A;  3NVO A;  4K0U A;  5FKY A;  5ABF B;  2VQE T;  5LMN T;  3PJA J;  2Q9Q B;  4O2B E;  5J1G A;  2IC9 A;  2M67 A;  2QRX A;  3Q5X A;  4DR1 T;  4O4L E;  3QC9 A;  4H9P C;  1ZOY A;  2M6B A;  3LFM A;  3ZCJ A;  4COF A;  1WR6 A;  5HEJ A;  1WLX A;  2IIU A;  2YK0 A;  1UK5 A;  3X1D A;  1LVK A;  2K5B B;  4ANJ A;  4GK5 E; 
#chains in the Genus database with same CATH homology
 4IE4 A;  2CMR A;  4H9R C;  4DBQ A;  3AA0 B;  5JDQ A;  4XZC A;  3KBT A;  4ZI3 C;  3E22 E;  2I59 A;  3HKE E;  3JC6 C;  3F31 A;  3HL6 A;  5EK2 A;  5KMG P;  2CM0 A;  2Y8D A;  4IGU A;  3Q9D A;  1UCU A;  1BR2 A;  4ZS2 A;  2C0S A;  2A72 A;  4MBQ A;  2C5J A;  3NRX A;  4BAY B;  2CLY B;  2X51 A;  3K3Q C;  4I43 B;  3ZC0 A;  1G8X A;  4PFO A;  4AKR B;  2VKD A;  3HKB E;  3HR0 A;  2XHE B;  2C5K T;  2HPL A;  2H7V C;  1MIY A;  1H7C A;  2C5I T;  3T8O A;  3K8P C;  5E0O A;  4ZHQ E;  1BR0 A;  2PG8 A;  3DTO A;  3OYX A;  2E9X A;  5GON E;  3F2E A;  3PDY A;  5L3E B;  3IF8 B;  3ZC1 A;  2LSG A;  1IJ5 A;  1LKX A;  4CI2 B;  4X1Y E;  4HKA A;  5JDN A;  5EK3 A;  3RYI E;  4O8S A;  2XAG B;  4YHJ A;  1SHZ C;  2JQQ A;  5HAX A;  3C4Z A;  2V7M A;  4QWN B;  3AVS A;  4FJO A;  4YFS A;  4AKI A;  3CWZ B;  4XAX B;  5LHI B;  4JEU B;  2WM9 A;  2E8I A;  2LT3 A;  4HE8 A;  3CVR A;  1QUU A;  3CX8 B;  4NUV A;  5HXR A;  2DNX A;  1UX5 A;  4MAL A;  3CML A;  3U3I A;  5LJN A;  4PK6 A;  5DQV A;  2BDE A;  2V7I A;  3AAI A;  4ZS3 A;  3BQL A;  3RC3 A;  2CXD A;  2H7O A;  1VOM A;  4GIW A;  3RRC A;  4IE6 A;  1S94 A;  2ODV A;  3CQX C;  5LNK A;  4O4I E;  4E7S A;  2N2N A;  1YKE B;  4KMC A;  3DP7 A;  5EZY E;  1D0Y A;  3KV4 A;  4HEA A;  2QGS A;  5FY1 A;  4KBM B;  2Z6E A;  1MND A;  2CCQ A;  3A5X A;  2PBI A;  2D0U A;  3OJA A;  1CUN A;  2RP4 A;  4EB6 E;  4TN7 B;  2WMO A;  3AA6 B;  3AVR A;  5HXS A;  2CXL A;  5CB4 E;  5LBQ B;  5DQW A;  2CA5 A;  4ADZ A;  4UF0 B;  4UEL A;  4IE0 A;  5JDG A;  3SOL A;  2ES0 A;  3B57 A;  3ZMS B;  2XAJ B;  4C90 A;  5JR9 C;  3VKH A;  2EHO C;  1NAF A;  4O2A E;  5LA6 E;  3ANW A;  3FB2 A;  3GA8 A;  1V9D A;  1HTJ F;  2L9Q A;  3C50 A;  3KIN B;  3DJB A;  2XUE A;  2NP9 A;  3ZCI A;  4DMV A;  3N9L A;  4UVC B;  1OWA A;  3K3O A;  4HFV A;  2X67 A;  4JEH B;  4OFZ A;  3KV5 A;  3O9X A;  3MAC A;  2KWI B;  4ILU A;  3NRY A;  1KK7 A;  2ZM0 A;  1E1H B;  5A1L A;  1WYB A;  4U74 A;  5DAB A;  2XQY A;  1UX4 A;  3QUJ A;  4AXP A;  1LRZ A;  2XAS B;  5IHY A;  4P0B A;  2ZM2 A;  3I1A A;  3LJC A;  2VKH A;  3QK6 A;  3UUL A;  4YLH A;  5LOV E;  1MMG A;  2DWK A;  3RPU A;  1MIV A;  1SA0 E;  2J1D G;  3C98 B;  3LK4 2;  4EXT A;  2HH7 A;  2V1D B;  2VB6 A;  3U78 A;  2H3R A;  2Y48 B;  2DCF A;  3WAJ A;  3OBV E;  2WWU A;  2W61 A;  3UUX B;  5JR9 B;  5FXZ A;  4QXB B;  1MMA A;  3NBX X;  5JR9 A;  5FNV E;  2IAK A;  5L3D B;  2DHR A;  4MFR A;  2VAS A;  3E0Z A;  4TUY E;  4TX5 A;  4MLK A;  3UTK A;  1MMD A;  3BQI A;  5C8Y E;  3CX7 B;  3GN5 A;  3MZK B;  4UV8 B;  4V1A v;  3V5U A;  2XAQ B;  3ZN0 B;  4AQF A;  4EIW A;  4EZ4 A;  3ESL A;  3CQC B;  4DMW A;  1T98 A;  3RYC E;  4DVD A;  4CQI A;  1D0X A;  4ZOL E;  4ASK A;  4IDZ A;  5JRC B;  4UXN B;  2P9B A;  2V7J A;  4E7Z A;  5HYA A;  4O4H E;  1ZV4 X;  4AI6 A;  4N78 D;  4KP3 C;  3PUQ A;  1B7T A;  5JRE A;  3Q5W A;  5L3C B;  4IE7 A;  4BJN A;  1U5P A;  1LVF A;  3MA9 A;  4ZI7 E;  2KLQ A;  3ZMT B;  5L3B B;  4QKN A;  2MTQ A;  3FXE B;  2XTL A;  4TV9 E;  5HXE A;  2XAH B;  3Q2M A;  4IE5 A;  3RX6 A;  4HGA A;  2X9W A;  3PU3 A;  3SS1 A;  2ZLY A;  5JDF A;  3PUR A;  3TKL B;  4JUY A;  3LK3 B;  2V7L A;  2LSY A;  1NWM X;  4DO0 A;  4UF0 A;  3AAA B;  2NW8 A;  3AB3 B;  4PJM A;  2X0L B;  4AKH A;  2OA5 A;  4H9Q C;  3EDV A;  4B6X A;  2L8K A;  3N9N A;  1Z0P A;  4AQF C;  1IZN B;  2DWG A;  1BR4 A;  3EVY A;  3ONX A;  3RH3 A;  3M65 A;  2K9A A;  4WBO A;  3AAE B;  2NW9 A;  2LEH A;  2VWA A;  2WSS V;  3ANW B;  5JH7 E;  2X9X A;  3RC8 A;  1U4Q A;  2SPC A;  3ZLI A;  1HF8 A;  4EAH A;  2E9X C;  5JQG E;  4I4T E;  2G0U A;  2DLR A;  3IEE A;  5FP3 A;  4CXW A;  2CWO A;  3JC6 D;  2UXX B;  4GOU A;  3RYF E;  5AFU L;  4H9S E;  5LGN B;  1BR1 A;  2LHN A;  1HG5 A;  1IAP A;  5FXW A;  3PUG A;  4X1K E;  5LGT B;  2D0T A;  5LP6 E;  4DBR A;  3LG7 A;  1KNZ A;  5J2U E;  3C4X A;  2W63 A;  4ZI2 D;  3CX6 B;  3KVB A;  2A3D A;  3N9Q A;  2ACX A;  4UVB B;  4YJ3 E;  4ZI3 D;  3ZN1 B;  3O1J A;  4IHJ E;  1VRB A;  4OYJ A;  3PE0 A;  4PJL A;  4IIJ E;  2X66 A;  4WBN E;  2YIN A;  4OYK A;  4PFP A;  4U72 A;  2JMK A;  4EYY R;  3B13 A;  2VK9 A;  2LJL A;  5LXT E;  3ZYL A;  2NWB A;  2PFV A;  3CQG B;  2GK9 A;  1YD8 G;  2Q9Q C;  4PNI A;  2IC6 A;  2EHO A;  3UUM A;  3KBU A;  3RKO A;  3CPZ A;  3FHN A;  3MK7 C;  3C64 A;  4PK4 A;  3OKQ A;  1D1A A;  4OK0 A;  2QA7 A;  1IJ6 A;  3H3A A;  4PJJ A;  5HWY A;  4NUU A;  2LHR A;  3MXZ A;  2BVM A;  3GMI A;  3C4W A;  3O4X E;  3N9M A;  3L3P A;  2WAU A;  3E08 A;  3OYZ A;  2MYS A;  2X9Y A;  4H63 V;  4HTE A;  4L5G A;  1ZKE A;  3KDS E;  3MKD A;  2JMH A;  3ZJ2 A;  4ZI2 C;  3R6N A;  2BZB A;  2VKO A;  5EK4 A;  2NTX A;  4EYU A;  3CKD A;  5CA0 E;  4I55 E;  1FMW A;  1X79 A;  3J7Y q;  2K24 A;  2D2S A;  4WNK A;  4H9N C;  3UT5 E;  5F3J A;  4OHF A;  3W15 B;  2KT9 A;  5IYZ E;  3I0O A;  3HI2 A;  3HKD E;  3VKG A;  4ERR A;  3LBX B;  2KXP B;  3F57 A;  3BQK A;  1YKH B;  4XBF B;  5KX5 E;  3ZEF B;  4C91 A;  4H9O C;  5JDH A;  1HX8 A;  2L3L A;  2Q9Q A;  3HKC E;  2JPF A;  3S4U A;  2LOP A;  2D5U A;  5FXV A;  3D0T A;  4AQG A;  5TAO A;  2CXF A;  2W0G A;  2PJQ A;  3RRW A;  3H37 A;  4UVA B;  4MHC A;  3ZYK A;  3VHL A;  2CEA A;  3K3N A;  4TZ4 C;  3I0Q A;  3UFE A;  5JDL A;  3FBZ A;  4KUM B;  3ZJ1 A;  3O1H A;  3P7I A;  2XAF B;  4PW8 A;  3ZMZ B;  4TV8 E;  4CZZ B;  2ZM8 A;  4PK5 A;  2LSJ A;  4O4J E;  2KIN B;  4X20 E;  1Y64 B;  2NW7 A;  1US7 B;  5LG4 A;  1YW0 A;  2KND A;  3I9W A;  1ZHC A;  2KWH A;  2UXN B;  5H6Q B;  5KDM C;  3O1I A;  4DND A;  4G2A A;  2KZ7 B;  4P09 A;  4PAG A;  4PJN A;  2V26 A;  1D1C A;  3LK2 B;  4F6R C;  1HFA A;  3LBX A;  2LSI A;  2W62 A;  3L09 A;  1D1B A;  1OXZ A;  1G73 A;  3N9P A;  3PTR B;  3N2O A;  1EZ3 A;  3PU8 A;  2YEV C;  3ZYM A;  4H63 H;  4QX7 B;  2V7K A;  2WMN A;  2ODU A;  2JRK A;  4X1I E;  3R84 B;  3KVA A;  3UUN A;  2VKJ A;  3AA1 B;  4UIG A;  2BVL A;  4QX8 B;  2NTY A;  3NZQ A;  1D0Z A;  3ZMV B;  4EZH A;  4GK0 E;  3V5S A;  5LJM A;  1FEW A;  1S35 A;  4UV9 B;  3C51 A;  4G63 A;  2DI4 A;  2ZMA A;  2X68 A;  4I50 E;  4QXH B;  2MBG A;  3GN5 B;  1ZEE A;  5FMN A;  3N5L A;  4IST A;  3N2K E;  2E9X D;  5LBM A;  4P0A A;  2RA1 A;  4L9I A;  3PUA A;  1QSD A;  2JJ9 A;  4GYS A;  2LSK A;  5L2L A;  2N1G A;  2VL8 A;  3VU7 H;  2W00 A;  2Y6X A;  5H6R B;  5LHH B;  4QHO A;  3WAK A;  4AKG A;  4Z8X A;  1MMN A;  3J9X 1;  3ZPO A;  4M1P A;  3FBL A;  2E9X B;  3AA7 B;  3FXD B;  4L0R A;  5JRC A;  1WRD A;  4CI1 B;  5L3F B;  1AJ3 A;  3EDU A;  4FI5 A;  4BA9 A;  4WW0 A;  1FMV A;  3SWH A;  3KV9 A;  2LE8 A;  3IHR A;  5JDM A;  1HCI A;  3GWH A;  5FXX A;  3WI3 A;  5LHG B;  3ETV A;  1FIO A;  4HN9 A;  1MIW A;  5HXC A;  3ETU A;  2HPJ A;  5LGU B;  2CWY A;  3BK9 A;  2YU2 A;  1O3X A;  2KMF A;  5J2T E;  2EHO B;  2WBL A;  4CXX A;  3N9O A;  4BJM A;  4EOZ B;  5BMV E;  3PUS A;  4ISS A;  4AKL A;  4JLE A;  5FY7 A;  2LM9 A;  2NOX A;  1HS7 A;  2Q9Q D;  4GYR A;  2MOZ A;  1MNE A;  3P8C D;  2EHO D;  3I9Y A;  2K48 A;  5HWX A;  4CXY A;  3N2G E;  4YJ2 E;  5JVD E;  3SRZ A;  5LCY A;  5F8P A;  5ETW A;  5DJQ C;  3EUH A;  2B1E A;  3HA4 A;  4QXC B;  3RYH E;  3KFW X;  2YU1 A;  2N9D A;  3MJX A;  2IW5 B;  5L3G B;  4UEM A;  3KV6 A;  4CI3 B;  5LYJ E;  4J2C A;  2CLY C;  3NZP A;  3ZMU B;  5CA1 E;  1WYC A;  2A2F X;  2X9H A;  3IBP A;  5FY0 A;  5FYM A;  2LOS A;  4A56 A;  5ADX L;  5HXH A;  5M4Y A;  1HG2 A;  2CE7 A;  4K0U A;  2Q9Q B;  4O2B E;  5J1G A;  2IC9 A;  2M67 A;  3Q5X A;  4O4L E;  3QC9 A;  4H9P C;  3ZCJ A;  3LFM A;  1WR6 A;  1WLX A;  2YK0 A;  1LVK A;  2K5B B;  4ANJ A;  4GK5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...