2BZBA

Nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
b'MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CONSERVED DOMAIN PROTEIN
publication title Structural characterization of Spo0E-like protein-aspartic acid phosphatases that regulate sporulation in bacilli.
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Transferase
total genus 18
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09388 SpoOE-like Spo0E like sporulation regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2bzbA00
2BZBA 2C0SA
chains in the Genus database with same CATH superfamily
3SS1A 3P4WA 5JR9C 5FXVA 2MPKA 4A56A 2OV9A 2VQFT 4FI5A 3S4UA 1HG2A 3T8OA 4AQYT 5FY7A 5DABA 5FMNA 2DCFA 5L3EB 1X9BA 3IEEA 1XNQT 2L3LA 3RH3A 3P8CD 2BG9A 4IL4A 3MXZA 3KV5A 4CQIA 1CHUA 2C5JA 1MMDA 2X0LB 2KT9A 5LCYA 2DLRA 3BQIA 4AISA 3NRYA 2IW5B 5AQVB 5KX5E 2CBIA 4IE0A 5FY0A 4DMVA 3DJBA 2WMOA 2W63A 4EZ4A 2HPJA 3VU7H 4X66T 4MHCA 2ZM6T 3T1HT 4U33A 4CN6A 2YEVC 4IDQA 5JDMA 5L4HA 4AQFC 2LJLA 2OLTA 3P50A 4YSZA 4BAYB 1UX5A 4H9OC 1MNDA 5H6QB 3LBXA 1D1AA 3IF8B 3LG7A 3N9OA 5LJNA 2CBJA 3OPCA 4LMLA 3ZT6A 3RIAA 4A5XA 3VR9A 3H37A 3PUYF 3ZN1B 3L09A 5LGNB 3GN5A 1U4QA 4MALA 2N2NA 2VKHA 2UUCT 4WNKA 2WCAA 4HWFA 5LBQB 3OJAA 2WY2A 3B13A 1T98A 1Y01A 1ZOYA 1UGOA 1WYBA 2WS3A 4UF0A 4AKIA 4JI0T 4XZCA 1QSDA 4DR2T 5JH7E 4IDNA 5JRCB 5BR8T 3UU4A 5AQHB 3ANWA 2V5CA 5AQMB 4DV7T 4CXXA 2V7MA 1YW0A 4HTEA 5DJQC 4QH4A 3AE6A 1Y64B 5JR9A 4H9SE 4LF6T 5LOVE 5J2UE 5L4EA 4ILAA 4NUVA 4IDPA 1KFYA 1W0AA 4I43B 2I6HA 2XQ3A 4EYYR 4GK0E 5FVLA 2ZM2A 3ZYLA 3VRBA 1JNZA 3TLUA 3LK42 2F4VT 4U72A 5DQVA 3HI2A 4P0AA 5ADXL 5FXXA 1HCIA 4DUZT 4IREA 3RQUA 2YKSA 2W67A 3PUVF 3TLTA 5AQFB 2IUBA 1WCRA 1N32T 2LSGA 5HYAA 4AKLA 1VOMA 3FXEB 3I0OA 4OFZA 3P7IA 3M3ZB 4KUMB 2V6YB 2K24A 2FJAA 4H9PC 1HG5A 2NP9A 3ZMVB 2C5KT 2NW7A 3AA1B 5LA6E 1UX4A 4AQFA 2LE8A 2MTQA 4BJMA 5CFBA 3N9NA 2PTFA 2LEHA 4CZZB 3LK3B 4YTMA 1XDPA 1G8XA 2KWIB 4HKAA 3RLFF 2BKOA 4LF5T 3PV0F 1WR6A 4WBOA 2FJBA 3RF1A 3MK7C 3K3OA 4PAGA 4COFA 4K0UA 4J2CA 5HAXA 3EUHA 3RC8A 2BG9B 1LVKA 2J4GA 4KP3C 4MBQA 4ERRA 3C4ZA 2AE9A 2V6XA 2Q9QA 4CXWA 2IHR1 2ZLYA 1UUSA 3LFMA 5LMUT 5AQGB 4Z90A 2L9QA 4BJNA 4HE8A 2UXNB 4E7SA 2J1DG 5AQRB 2BBJA 2RPAA 4KI0F 3UU5A 2E9XC 4WW0A 1HS7A 4AKGA 4QH5A 4HFDA 4X64T 4CI3B 4DV6T 3RRWA 5JDGA 2VKDA 1YXRA 4ZOLE 4HGAA 4E7ZA 3ONXA 1SE7A 3LBXB 3DTOA 3ZT7A 5FXZA 1T72A 1WYCA 3AE3A 4IE7A 5IWAT 4TNWA 2ODUA 4YSXA 4Z91A 1FMVA 3I9WA 3R84B 3RQWA 4EYUA 3Q5XA 1Z0PA 3MKDA 3GN5B 1ZKEA 2E9XD 1HX8A 3N2GE 4UVBB 1IAPA 2WQYA 2XM2A 2XQ4A 2X0YA 1I94T 2BVLA 1OEDE 1CUNA 3ZYMA 3RKGA 3D0TA 3PU8A 4F6RC 4DV2T 5HEUA 3V5SA 2XQAA 3QK6A 3AAIA 2B1EA 2V5DA 4UF0B 4EZHA 4A97A 2UXBT 2KWHA 1JNRA 3KV4A 3IA3A 2WWVA 3PUSA 1LVFA 5KDMC 4CN1A 4NIQA 3ANWB 4ANJA 5CGMA 4AKHA 3P4RA 4UIGA 3CQGB 4ZEYA 1FIOA 3ZMSB 5JR9B 3LSVA 4ILUA 5FVKA 4TV9E 4AQGA 4PK4A 2CWOA 4I55E 4B3RT 2QGSA 4HWDA 4IL9A 3W15B 1UURA 4DR4T 5AQNB 3KV9A 2HN1A 5J2TE 3PUWF 3NKZA 4H9QC 3N2OA 4WYVA 3AECA 5JTGA 2XHEB 2V1DB 3L8RA 3J7Yq 4P1NA 4U3CA 5AQQB 5JVDE 2LKGA 3AEAA 4UV8B 2CXFA 4OX9T 4QX7B 2LT3A 1FMWA 4XAXB 4ISSA 3UULA 4AKRB 4DVDA 3TLSA 1MIYA 2E8IA 4I0UA 4YHHT 3CK6A 5ABFB 4DUYT 3EABA 1L0VA 2E9XA 4DV5T 3AEDA 5F3JA 4DV0T 5L3BB 2IIUA 2N9DA 3CX6B 3WAJA 3V5UA 4QXHB 4XBFB 2DWGA 3JAEA 3RIFA 2HHHT 2H7VC 2X66A 4PNIA 3UUXB 2XAFB 1NWMX 2VB6A 5HXRA 3CKDA 4EGWA 1KK7A 5JDQA 4GIWA 4AIUA 4ZXLA 2A3DA 4JI1T 1BR2A 3WAKA 1E7PA 4DV4T 4IE5A 4KX6A 4DBRA 3AE1A 3EDVA 5A1LA 3IHRA 4M1PA 5HEOA 2D0UA 3PUGA 5LXTE 1XNRT 4DV3T 2V7JA 3ZJ1A 1J5WA 3CX8B 3KDSE 2DWKA 2XQ8A 2WDVA 4JI8T 3UTKA 4ZS2A 3UFEA 1OEDC 4JI6T 4PJNA 2BS4A 4MLKA 3ZMTB 4O4IE 1J5ET 5LG3A 1D0YA 3HR0A 5JREA 1Z8UA 1E1HB 4GK5E 4TWDA 5JDNA 4B3ST 2X9WA 2WBLA 4LMJA 4X5TA 2LM2A 2ZM8A 3AEFA 1MMGA 3AA7B 2FJEA 4TV8E 4QXBB 2XASB 3NRXA 4X65T 4X62T 3EVYA 2W4XA 3CMLA 2PBIA 3ZN0B 3ETUA 5EK3A 1BR4A 4ADZA 4X1KE 2G0UA 4JLEA 2KINB 3RX6A 1YQ3A 2LSJA 2PG8A 2K9AA 2Q9QC 3E22E 3C64A 5ABGA 2CLYC 1ZEEA 2CA5A 5HEGA 5C8YE 4O8SA 2WWUA 4QXCB 3HKBE 1R8IA 4B3MT 2C5IT 4PFOA 2KXPB 5ABHA 1HTJF 5KXJA 5LGTB 4GKKT 2UUAT 3FZHB 4EV6A 4B3TT 2MOZA 3M65A 2CHOA 1XWMA 2WAUA 1QUUA 2CRBA 1SHZC 3SFDA 3I9YA 5TAOA 4QH1A 2FUPA 2ODVA 2WM9A 3AE7A 4NXMT 3PURA 2Q9QD 3KBUA 3UFGA 4DR6T 5AQPB 2FBWA 4YFSA 4LF9T 2P9BA 2W00A 2VASA 2KNDA 2J62A 2V7KA 3AA0B 3QB5A 2YU1A 4UXNB 2VKJA 3RKOA 4LFBT 2OA5A 3UT5E 4NPPA 5CB4E 3KVBA 4HFHA 5CA0E 2LRKA 3SFEA 5IUXA 3RI5A 3MZKB 3AE9A 2N1GA 4JV5T 4YJ2E 2YINA 2XJ7A 3ZLIA 3A8YC 4KBMB 1OEDA 5L3CB 3FBZA 4U74A 3LK2B 2E9XB 4IT4A 5AQIB 3CPZA 4UR9A 4H9NC 1IBKT 3RRCA 2XY8B 3E08A 4CXYA 4YJ3E 5LJMA 4DR5T 3BQKA 1QLBA 3ZCIA 3WI3A 2JQQA 2W61A 2XAHB 1MNEA 4KHZF 3O1JA 1KF6A 1N33T 3FZMB 3X1DA 2CCQA 5C3JA 5AQOB 4GOUA 2IC6A 1HR0T 3ESLA 1DU2A 2JQ9A 1WLXA 3N9QA 2ES0A 3LDQB 2XQ5A 3AEBA 2WSSV 4I50E 2LKHA 1HNXT 2KMFA 2XUEA 4C90A 3KVAA 2XPKA 1UK5A 3AEGA 2NTXA 4PJLA 3A7MA 4ZI2C 3RYFE 2MYSA 5M4YA 3UU3A 3VR8A 5ETWA 2X0HA 3C4XA 5C2TA 4IE6A 2XQYA 2M6IA 3PE0A 5LHIB 4PW8A 2VVNA 2IC9A 3HKCE 2KSRA 2LOPA 5AQKB 3OYXA 3AEEA 3QOFA 3GA8A 4TWFA 1XMQT 2I0MA 3OVUA 4QX8B 2BVMA 2M6BA 4ZHQE 2WDQA 3MACA 2I59A 2VURA 4H9RC 2JIWA 3RC3A 2LHRA 4ZI2D 2Y48B 5FL1A 2YDSA 4DR1T 3ABVA 3QC9A 4HFVA 3CVRA 2EHOC 2NTYA 4HFBA 3NZQA 4DV1T 5JDFA 3R6NA 4A98A 2NW8A 3F2EA 3KBTA 4GYRA 3RYIE 2R6GF 4JI4T 5HCJA 4LMKA 4WBNE 2QVAA 1N36T 4TZ4C 4AXPA 2V26A 2QA7A 3ZT5A 2YDRA 1NEKA 3ZMUB 4DR3T 3PTRB 2QRXA 2DL1A 3PDYA 3ONLC 2EHOD 1IBMT 4QWNB 2IMLA 5AQUB 3RGLA 5HXSA 2B76A 3CQXC 4HWHA 3RYHE 3AA6B 5AQSB 3ETVA 5LBMA 2WDRA 2XM1A 3SWHA 3L3PA 2M67A 2VWAA 2XQ7A 2Z6EA 1KNZA 3AE5A 4JEHB 1IJ6A 4ZI7E 1U5PA 5KMGP 3I1AA 3BK9A 2BS3A 3QUJA 2WU5A 3ONJA 4L5GA 4G63A 2WB5A 5LNKA 3AE2A 2W0GA 3BQLA 5BMVE 4IDOA 4UV9B 2MAWA 1D1BA 1YD8G 1X79A 4L0RA 2VKOA 2LLYA 5JDLA 3PUZF 4PK6A 1M7KA 1YKHB 5HXEA 1OEDB 2LSKA 2QYWA 1B7TA 5IYZE 4PJMA 3MA9A 2NR4A 2LHNA 5LG4A 3AE8A 3QNUA 4YY3T 4HWCA 3O1HA 2D9DA 2LSYA 1GQEA 4ZI3C 4LF4T 4LF7T 4EIWA 3N5LA 1KEYA 3ZC1A 4FJOA 4IGUA 3AXJA 1OXZA 3DP7A 2JMKA 4HFEA 3RIUC 1D0XA 4UVCB 4JI7T 4YTPA 1VCTA 4GYSA 2SPCA 2C0SA 4HFIA 5LYJE 5L3FB 1MIVA 1BR1A 4LFCT 2LOSA 2EHOA 4YLHA 2NWBA 1NENA 2ACXA 3PUAA 2KZ7B 2BS2A 5L3DB 3A5XA 3RPUA 4YTNA 2Q9QB 3HKEE 4ZI3D 2DHRA 2CLYB 1NAFA 2ZMAA 2XSBA 3UUNA 4NUUA 3H3MA 2JJ9A 4BA9A 2HN2A 2W66A 3C51A 2CMRA 2E2AA 2VL0A 2KLQA 1EZ3A 1T8BA 3N9MA 3TLWA 3HA4A 3RYCE 2X9HA 2XAQB 4Z8XA 4H63H 2K3WA 1IBLT 2BKPA 2CHNA 2X68A 5AQJB 1V9DA 4LFAT 4LF8T 3EHZA 4ILCA 5J0ZA 4IIJE 3CQCB 5L2LA 2JMHA 5FP3A 2BBHA 4L9IA 4H63V 5EZYE 5HXCA 4ISTA 4DNDA 2CWYA 1XMOT 2DI4A 3MJXA 1N34T 1WR0A 3L39A 1OWAA 2YOEA 4O4JE 1HNZT 2VK9A 5EK4A 4OYJA 4YSYA 2PFVA 4ILBA 2A2FX 3I0QA 2YK0A 2LM9A 2BDEA 2WP9A 1SA0E 3LJCA 5L3GB 4IE4A 5FYMA 2IAKA 4JYAT 5AFUL 2WMNA 4TWHA 5JQGE 2UUBT 2BKNA 3HKDE 1US7B 5F5WA 4DR7T 2XQ6A 5J1GA 1T7SA 3FZKB 3JCFA 3GMIA 2MBGA 1VRBA 3ZYKA 3SRZA 4DIDB 2W62A 2E5VA 4O2AE 4TNVA 4PFPA 4EB6E 3G06A 3AE4A 4JI3T 3ZKRA 5LHGB 3JADA 2WZHA 1W0BA 2YU2A 3ZCJA 5DQWA 3SOLA 1YQ4A 3U78A 3FZLB 5AQLB 2K48A 4YXDA 3Q5EA 4NXNT 3RIUA 1KNPA 2VL8A 4DBQA 3C50A 2UXDT 3T1YT 2CXDA 5H6RB 3FXDB 3F31A 4HEAA 3EAMA 5L47A 3UUMA 5CA1E 2UXCT 2K5BB 3B57A 3J9X1 3AAAB 3QB5K 3F57A 4WZXA 4JI2T 3KINB 2GK9A 3O1IA 3U3IA 2D5UA 3RHWA 4JEUB 3E0ZA 4ZS3A 3JC6C 5ABEA 4P0BA 1SUMB 5HWXA 1W9RA 3Q2MA 1WRDA 2BG9E 3Q9DA 3C4WA 2LRLA 3PU3A 3H3AA 3OKQA 1S35A 3Q5WA 4O4HE 1IJ5A 3TLVA 4V1Av 3O4XE 3UU6A 3PUQA 3FHNA 5LP6E 5FXWA 3VKHA 5AQTB 1ZV4X 4DO0A 3VRAA 3ZJ2A 4JUYA 4YT0A 4K0KT 1YKEB 3AXJB 2CPTA 2X9YA 4DMWA 3JC6D 3NWIA 3P4PA 4IHJE 5LB7B 3AAEB 5E0OA 2D2SA 1ZHCA 2CXLA 5ABFA 2A72A 1IZNB 1S94A 3AB3B 2EHOB 4X20E 4CI1B 4U7IA 1MIWA 3CX7B 4CI2B 2LSIA 2IDOB 2WU2A 3OYZA 2X51A 5HCMA 1LRZA 1J1JA 4EXTA 3ZSTA 3O9XA 3C98B 5FKYA 1HFAA 2V7LA 3OBVE 2CEAA 4OK0A 2RP4A 3K1SA 4O4LE 2PJQA 4EEDA 1O3XA 3N2KE 2FJDA 4U2ZA 4P09A 3ZEFB 5HEJA 1I6ZA 3NVOA 5FL0A 4I4TE 5LHHB 1E2AA 4HFCA 1H7CA 4HN9A 5EK2A 3AVRA 2E5LT 2XSAA 3KFWX 3FZFB 5FNVE 5LMNT 1VCSA 2H3RA 3CWZB 3UU8A 2YN6A 3ZC0A 3Q5DA 3NBXX 2ZM0A 2A9UA 4X1YE 5JDHA 4HWIB 2UU9T 2JRKA 4EAHA 2V7IA 2XTLA 1XZYA 4U31A 3ZMZB 4O2BE 1G73A 4ZZCA 2X67A 2H89A 4UEMA 4ASKA 1HF8A 3EDUA 3PJAA 2Y8DA 4PJJA 5HEHA 5HWYA 2DNXA 4TN7B 2X9XA 4QKNA 2J47A 3JAFA 5FY1A 1M62A 3PJAJ 4Q25A 4UELA 2L8KA 3EI0A 3NZPA 2WZIA 2BG9C 4TX5A 3K8PC 3B5MA 1MMAA 1XDOA 4CN4A 3HL6A 4OYKA 1W09A 2CM0A 4YHJA 2BZBA 4JI5T 1D1CA 2W2UA 2XAGB 2H88A 4GKJT 2XAJB 3CIRA 1BR0A 5JRCA 4EEBA 2HH7A 3KV6A 3P4QA 3VKGA 3PUXF 1WFDA 2UXXB 2NOXA 4ZZBA 2HPLA 2JPFA 3K3QC 4N78D 4MFRA 2D0TA 4OHFA 2CE7A 3UQ7A 3IBPA 4B6XA 3P4SA 5F8PA 5LGUB 2RA1A 3K3NA 3N9PA 4F8HA 1D0ZA 1MMNA 2JQKA 3ZSSA 4KMCA 1FEWA 3ZPOA 3N9LA 4JBWF 1UCUA 2NW9A 1LKXA 1HX1B 3AVSA 2VQET 4G2AA 2H7OA 2V8SV 5CJ5A 4U7YA 4TUYE 2YDQA 4EOZB 4UVAB 4KHPT 2VVSA 2XZEA 2AXDS 4IDZA 4U2YA 2Y6XA 4PK5A 2JQHA 3FB2A 4QHOA 3GWHA 3UQ4A 1ZP0A 4C91A 3OTOT 1HNWT 1KNRA 2XQ9A 1FJGT 2V6YA 3FBLA 4X1IE 4AI6A 5HXHA 5GONE 1AJ3A 2ACZA 3TKLB 3UUBA 3VHLA 5IHYA
chains in the Genus database with same CATH topology
3SS1A 5JR9C 4UF0B 1WLXA 5FXVA 3N9QA 4PFPA 4EB6E 2ES0A 4EZHA 4A56A 4FI5A 2WSSV 5LHGB 4I50E 2KWHA 2YU2A 3ZCJA 3S4UA 3KV4A 5DQWA 3PUSA 3SOLA 3U78A 1LVFA 5KDMC 1HG2A 3ANWB 4ANJA 2KMFA 2XUEA 3T8OA 5FY7A 2K48A 5DABA 4C90A 5FMNA 4AKHA 3KVAA 2DCFA 2VL8A 5L3EB 4UIGA 4DBQA 3CQGB 3C50A 3IEEA 2NTXA 1FIOA 4PJLA 3ZMSB 5JR9B 4ZI2C 3RYFE 2MYSA 2CXDA 2L3LA 5M4YA 5H6RB 3FXDB 3F31A 4HEAA 4ILUA 3RH3A 5ETWA 3P8CD 3C4XA 4TV9E 4AQGA 3MXZA 4IE6A 2XQYA 2CWOA 3KV5A 4PK4A 3UUMA 4CQIA 5CA1E 3PE0A 4I55E 5LHIB 4PW8A 2K5BB 2IC9A 3B57A 2QGSA 3J9X1 3HKCE 2C5JA 3AAAB 1MMDA 3F57A 2X0LB 2LOPA 2KT9A 5LCYA 2DLRA 3W15B 3OYXA 3BQIA 3KINB 2GK9A 3NRYA 3O1IA 2IW5B 3U3IA 2D5UA 3KV9A 5KX5E 4JEUB 3GA8A 3E0ZA 4IE0A 4ZS3A 5FY0A 3JC6C 4P0BA 4QX8B 2BVMA 5J2TE 4DMVA 4ZHQE 3MACA 3DJBA 4H9QC 5HWXA 2WMOA 2W63A 3N2OA 2I59A 4EZ4A 3Q2MA 1WRDA 2HPJA 3VU7H 4MHCA 2XHEB 4H9RC 3Q9DA 3C4WA 2V1DB 3PU3A 3H3AA 3J7Yq 3OKQA 1S35A 2YEVC 3RC3A 3Q5WA 5JDMA 2LHRA 4O4HE 1IJ5A 5JVDE 4ZI2D 4AQFC 4V1Av 2LJLA 4UV8B 2CXFA 4QX7B 2Y48B 2LT3A 3O4XE 1FMWA 4XAXB 4ISSA 3PUQA 3FHNA 5LP6E 4BAYB 5FXWA 3UULA 3VKHA 1UX5A 4AKRB 1ZV4X 4H9OC 4DVDA 1MNDA 3QC9A 5H6QB 1MIYA 2E8IA 3LBXA 4HFVA 3CVRA 2EHOC 2NTYA 4DO0A 1D1AA 3ZJ2A 4JUYA 3IF8B 1YKEB 3NZQA 3LG7A 2X9YA 3N9OA 4DMWA 5LJNA 2E9XA 3JC6D 5JDFA 3R6NA 2NW8A 3F2EA 4IHJE 5F3JA 3KBTA 3AAEB 5L3BB 5E0OA 4GYRA 2D2SA 3H37A 3RYIE 1ZHCA 2CXLA 3ZN1B 2A72A 2N9DA 3L09A 3CX6B 1IZNB 5LGNB 3WAJA 4WBNE 3V5UA 1S94A 3AB3B 4QXHB 3GN5A 2DWGA 4XBFB 2EHOB 2H7VC 2X66A 4X20E 1U4QA 4TZ4C 4MALA 4PNIA 4CI1B 4AXPA 2N2NA 2V26A 2QA7A 3UUXB 1MIWA 2VKHA 3CX7B 4CI2B 2LSIA 2XAFB 1NWMX 4WNKA 2VB6A 5HXRA 5LBQB 3CKDA 3OJAA 3B13A 1KK7A 3OYZA 3ZMUB 5JDQA 4GIWA 3PTRB 1T98A 3PDYA 2X51A 1WYBA 2A3DA 1BR2A 1LRZA 3WAKA 2EHOD 4IE5A 4EXTA 4QWNB 4UF0A 3C98B 3O9XA 4AKIA 4DBRA 1HFAA 4XZCA 1QSDA 3EDVA 2V7LA 5HXSA 3CQXC 3OBVE 5A1LA 5JH7E 5JRCB 3RYHE 2CEAA 4OK0A 2RP4A 3IHRA 4M1PA 3AA6B 2D0UA 4O4LE 2PJQA 3ETVA 3PUGA 5LBMA 5LXTE 1O3XA 3ANWA 2V7JA 3ZJ1A 3SWHA 3L3PA 2M67A 2VWAA 2Z6EA 3N2KE 4CXXA 3CX8B 4P09A 3ZEFB 1KNZA 2V7MA 4JEHB 3KDSE 2DWKA 1YW0A 1IJ6A 4HTEA 5DJQC 4ZI7E 1U5PA 4I4TE 1Y64B 5JR9A 5KMGP 3I1AA 5LHHB 3UTKA 3BK9A 4ZS2A 4H9SE 3UFEA 5LOVE 5J2UE 3QUJA 4L5GA 4G63A 4NUVA 4PJNA 5LNKA 4MLKA 1H7CA 3ZMTB 2W0GA 3BQLA 5BMVE 4UV9B 4O4IE 4HN9A 5EK2A 4I43B 1D0YA 3AVRA 3HR0A 4EYYR 1D1BA 3KFWX 4GK0E 1YD8G 5FNVE 1X79A 2ZM2A 4L0RA 3ZYLA 5JREA 2VKOA 5JDLA 1E1HB 2H3RA 4GK5E 5JDNA 4PK6A 2X9WA 3CWZB 2WBLA 1YKHB 3LK42 5HXEA 3ZC0A 2LSKA 3NBXX 1B7TA 2ZM0A 2ZM8A 5IYZE 4U72A 1MMGA 4PJMA 5DQVA 3HI2A 4P0AA 3MA9A 5ADXL 5FXXA 1HCIA 3AA7B 4X1YE 2LHNA 5LG4A 5JDHA 3O1HA 4TV8E 4QXBB 2LSGA 2JRKA 4AKLA 4EAHA 5HYAA 2V7IA 2XTLA 2XASB 1VOMA 3FXEB 3NRXA 3I0OA 4OFZA 3P7IA 3ZMZB 2LSYA 4O2BE 1G73A 3EVYA 4ZI3C 2X67A 3CMLA 4UEMA 4ASKA 2PBIA 3ZN0B 4EIWA 1HF8A 3ETUA 3N5LA 3EDUA 4KUMB 5EK3A 1BR4A 4ADZA 4X1KE 2G0UA 3ZC1A 4JLEA 2KINB 2K24A 2Y8DA 4FJOA 4IGUA 2LSJA 4H9PC 4PJJA 3RX6A 2PG8A 5HWYA 1OXZA 1HG5A 3DP7A 2DNXA 2K9AA 2NP9A 2JMKA 4TN7B 2X9XA 2C5KT 4QKNA 3ZMVB 2NW7A 2Q9QC 3AA1B 1D0XA 3C64A 3E22E 5FY1A 5LA6E 4UVCB 1UX4A 2CLYC 4AQFA 4UELA 1ZEEA 4GYSA 2CA5A 2L8KA 2SPCA 2LE8A 5C8YE 4O8SA 2C0SA 2WWUA 3NZPA 4QXCB 2MTQA 4BJMA 3HKBE 5L3FB 5LYJE 2C5IT 1MIVA 4PFOA 4TX5A 2KXPB 1BR1A 1HTJF 3K8PC 3N9NA 5LGTB 2LEHA 2LOSA 4CZZB 1MMAA 3LK3B 2EHOA 4YLHA 1G8XA 2NWBA 2ACXA 2KWIB 2MOZA 4HKAA 3PUAA 2KZ7B 3M65A 3HL6A 4OYKA 1WR6A 5L3DB 3A5XA 2CM0A 3RPUA 4WBOA 2Q9QB 2WAUA 1QUUA 3HKEE 4ZI3D 2DHRA 3MK7C 1SHZC 4YHJA 2BZBA 2CLYB 1NAFA 3K3OA 2ZMAA 3I9YA 4PAGA 1D1CA 4NUUA 3UUNA 4K0UA 4J2CA 2XAGB 2JJ9A 5TAOA 4BA9A 5HAXA 3EUHA 2XAJB 3RC8A 1LVKA 2ODVA 4KP3C 4MBQA 4ERRA 3C4ZA 3C51A 1BR0A 5JRCA 2CMRA 2WM9A 2Q9QA 2HH7A 3KV6A 3PURA 2Q9QD 4CXWA 3VKGA 2KLQA 1EZ3A 3KBUA 3N9MA 2ZLYA 2UXXB 2NOXA 3HA4A 3RYCE 2X9HA 2XAQB 4Z8XA 2HPLA 3LFMA 2JPFA 3K3QC 4H63H 4N78D 4MFRA 2D0TA 4YFSA 2P9BA 2W00A 4OHFA 2VASA 2KNDA 2X68A 2V7KA 2L9QA 2CE7A 4BJNA 1V9DA 4HE8A 2UXNB 3AA0B 4E7SA 2J1DG 3IBPA 4B6XA 5F8PA 2YU1A 5LGUB 4UXNB 2VKJA 4IIJE 3RKOA 3CQCB 2RA1A 5L2LA 3K3NA 2OA5A 3UT5E 2JMHA 5FP3A 3N9PA 5CB4E 4L9IA 4H63V 5EZYE 3KVBA 5HXCA 1D0ZA 1MMNA 2E9XC 4ISTA 4DNDA 4KMCA 2CWYA 2DI4A 5CA0E 4WW0A 3MJXA 1HS7A 4AKGA 1FEWA 4CI3B 3ZPOA 3MZKB 2N1GA 3RRWA 1OWAA 2VKDA 5JDGA 4ZOLE 3N9LA 4O4JE 4YJ2E 2VK9A 2YINA 4HGAA 4OYJA 5EK4A 3ZLIA 1UCUA 2PFVA 2NW9A 1LKXA 4E7ZA 3ONXA 4KBMB 3LBXB 3AVSA 3DTOA 2A2FX 4G2AA 3I0QA 5FXZA 2H7OA 5L3CB 2YK0A 1WYCA 3FBZA 2LM9A 4U74A 2BDEA 3LK2B 4TUYE 1SA0E 4EOZB 2E9XB 4UVAB 3LJCA 3CPZA 4IE7A 5L3GB 4H9NC 3RRCA 2ODUA 3E08A 4IE4A 4IDZA 5FYMA 1FMVA 2IAKA 4CXYA 3I9WA 4YJ3E 3R84B 2Y6XA 4EYUA 5AFUL 5LJMA 2WMNA 4PK5A 3Q5XA 3BQKA 3FB2A 4QHOA 3GWHA 3ZCIA 1Z0PA 5JQGE 3MKDA 4C91A 3GN5B 1ZKEA 2E9XD 2JQQA 1HX8A 2W61A 2XAHB 3N2GE 4UVBB 1IAPA 3WI3A 3HKDE 1MNEA 1US7B 3O1JA 3FBLA 4X1IE 2BVLA 5J1GA 1CUNA 3ZYMA 4AI6A 5HXHA 2CCQA 3D0TA 3PU8A 5GONE 3GMIA 2MBGA 1AJ3A 1VRBA 3ZYKA 4F6RC 3SRZA 3TKLB 4GOUA 3V5SA 2IC6A 2W62A 3ESLA 3VHLA 5IHYA 3QK6A 3AAIA 2B1EA 4O2AE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZB A;  2C0S A; 
#chains in the Genus database with same CATH topology
 3SS1 A;  3P4W A;  5JR9 C;  5FXV A;  2MPK A;  4A56 A;  2OV9 A;  2VQF T;  4FI5 A;  3S4U A;  1HG2 A;  3T8O A;  4AQY T;  5FY7 A;  5DAB A;  5FMN A;  2DCF A;  5L3E B;  1X9B A;  3IEE A;  1XNQ T;  2L3L A;  3RH3 A;  3P8C D;  2BG9 A;  4IL4 A;  3MXZ A;  3KV5 A;  4CQI A;  1CHU A;  2C5J A;  1MMD A;  2X0L B;  2KT9 A;  5LCY A;  2DLR A;  3BQI A;  4AIS A;  3NRY A;  2IW5 B;  5AQV B;  5KX5 E;  2CBI A;  4IE0 A;  5FY0 A;  4DMV A;  3DJB A;  2WMO A;  2W63 A;  4EZ4 A;  2HPJ A;  3VU7 H;  4X66 T;  4MHC A;  2ZM6 T;  3T1H T;  4U33 A;  4CN6 A;  2YEV C;  4IDQ A;  5JDM A;  5L4H A;  4AQF C;  2LJL A;  2OLT A;  3P50 A;  4YSZ A;  4BAY B;  1UX5 A;  4H9O C;  1MND A;  5H6Q B;  3LBX A;  1D1A A;  3IF8 B;  3LG7 A;  3N9O A;  5LJN A;  2CBJ A;  3OPC A;  4LML A;  3ZT6 A;  3RIA A;  4A5X A;  3VR9 A;  3H37 A;  3PUY F;  3ZN1 B;  3L09 A;  5LGN B;  3GN5 A;  1U4Q A;  4MAL A;  2N2N A;  2VKH A;  2UUC T;  4WNK A;  2WCA A;  4HWF A;  5LBQ B;  3OJA A;  2WY2 A;  3B13 A;  1T98 A;  1Y01 A;  1ZOY A;  1UGO A;  1WYB A;  2WS3 A;  4UF0 A;  4AKI A;  4JI0 T;  4XZC A;  1QSD A;  4DR2 T;  5JH7 E;  4IDN A;  5JRC B;  5BR8 T;  3UU4 A;  5AQH B;  3ANW A;  2V5C A;  5AQM B;  4DV7 T;  4CXX A;  2V7M A;  1YW0 A;  4HTE A;  5DJQ C;  4QH4 A;  3AE6 A;  1Y64 B;  5JR9 A;  4H9S E;  4LF6 T;  5LOV E;  5J2U E;  5L4E A;  4ILA A;  4NUV A;  4IDP A;  1KFY A;  1W0A A;  4I43 B;  2I6H A;  2XQ3 A;  4EYY R;  4GK0 E;  5FVL A;  2ZM2 A;  3ZYL A;  3VRB A;  1JNZ A;  3TLU A;  3LK4 2;  2F4V T;  4U72 A;  5DQV A;  3HI2 A;  4P0A A;  5ADX L;  5FXX A;  1HCI A;  4DUZ T;  4IRE A;  3RQU A;  2YKS A;  2W67 A;  3PUV F;  3TLT A;  5AQF B;  2IUB A;  1WCR A;  1N32 T;  2LSG A;  5HYA A;  4AKL A;  1VOM A;  3FXE B;  3I0O A;  4OFZ A;  3P7I A;  3M3Z B;  4KUM B;  2V6Y B;  2K24 A;  2FJA A;  4H9P C;  1HG5 A;  2NP9 A;  3ZMV B;  2C5K T;  2NW7 A;  3AA1 B;  5LA6 E;  1UX4 A;  4AQF A;  2LE8 A;  2MTQ A;  4BJM A;  5CFB A;  3N9N A;  2PTF A;  2LEH A;  4CZZ B;  3LK3 B;  4YTM A;  1XDP A;  1G8X A;  2KWI B;  4HKA A;  3RLF F;  2BKO A;  4LF5 T;  3PV0 F;  1WR6 A;  4WBO A;  2FJB A;  3RF1 A;  3MK7 C;  3K3O A;  4PAG A;  4COF A;  4K0U A;  4J2C A;  5HAX A;  3EUH A;  3RC8 A;  2BG9 B;  1LVK A;  2J4G A;  4KP3 C;  4MBQ A;  4ERR A;  3C4Z A;  2AE9 A;  2V6X A;  2Q9Q A;  4CXW A;  2IHR 1;  2ZLY A;  1UUS A;  3LFM A;  5LMU T;  5AQG B;  4Z90 A;  2L9Q A;  4BJN A;  4HE8 A;  2UXN B;  4E7S A;  2J1D G;  5AQR B;  2BBJ A;  2RPA A;  4KI0 F;  3UU5 A;  2E9X C;  4WW0 A;  1HS7 A;  4AKG A;  4QH5 A;  4HFD A;  4X64 T;  4CI3 B;  4DV6 T;  3RRW A;  5JDG A;  2VKD A;  1YXR A;  4ZOL E;  4HGA A;  4E7Z A;  3ONX A;  1SE7 A;  3LBX B;  3DTO A;  3ZT7 A;  5FXZ A;  1T72 A;  1WYC A;  3AE3 A;  4IE7 A;  5IWA T;  4TNW A;  2ODU A;  4YSX A;  4Z91 A;  1FMV A;  3I9W A;  3R84 B;  3RQW A;  4EYU A;  3Q5X A;  1Z0P A;  3MKD A;  3GN5 B;  1ZKE A;  2E9X D;  1HX8 A;  3N2G E;  4UVB B;  1IAP A;  2WQY A;  2XM2 A;  2XQ4 A;  2X0Y A;  1I94 T;  2BVL A;  1OED E;  1CUN A;  3ZYM A;  3RKG A;  3D0T A;  3PU8 A;  4F6R C;  4DV2 T;  5HEU A;  3V5S A;  2XQA A;  3QK6 A;  3AAI A;  2B1E A;  2V5D A;  4UF0 B;  4EZH A;  4A97 A;  2UXB T;  2KWH A;  1JNR A;  3KV4 A;  3IA3 A;  2WWV A;  3PUS A;  1LVF A;  5KDM C;  4CN1 A;  4NIQ A;  3ANW B;  4ANJ A;  5CGM A;  4AKH A;  3P4R A;  4UIG A;  3CQG B;  4ZEY A;  1FIO A;  3ZMS B;  5JR9 B;  3LSV A;  4ILU A;  5FVK A;  4TV9 E;  4AQG A;  4PK4 A;  2CWO A;  4I55 E;  4B3R T;  2QGS A;  4HWD A;  4IL9 A;  3W15 B;  1UUR A;  4DR4 T;  5AQN B;  3KV9 A;  2HN1 A;  5J2T E;  3PUW F;  3NKZ A;  4H9Q C;  3N2O A;  4WYV A;  3AEC A;  5JTG A;  2XHE B;  2V1D B;  3L8R A;  3J7Y q;  4P1N A;  4U3C A;  5AQQ B;  5JVD E;  2LKG A;  3AEA A;  4UV8 B;  2CXF A;  4OX9 T;  4QX7 B;  2LT3 A;  1FMW A;  4XAX B;  4ISS A;  3UUL A;  4AKR B;  4DVD A;  3TLS A;  1MIY A;  2E8I A;  4I0U A;  4YHH T;  3CK6 A;  5ABF B;  4DUY T;  3EAB A;  1L0V A;  2E9X A;  4DV5 T;  3AED A;  5F3J A;  4DV0 T;  5L3B B;  2IIU A;  2N9D A;  3CX6 B;  3WAJ A;  3V5U A;  4QXH B;  4XBF B;  2DWG A;  3JAE A;  3RIF A;  2HHH T;  2H7V C;  2X66 A;  4PNI A;  3UUX B;  2XAF B;  1NWM X;  2VB6 A;  5HXR A;  3CKD A;  4EGW A;  1KK7 A;  5JDQ A;  4GIW A;  4AIU A;  4ZXL A;  2A3D A;  4JI1 T;  1BR2 A;  3WAK A;  1E7P A;  4DV4 T;  4IE5 A;  4KX6 A;  4DBR A;  3AE1 A;  3EDV A;  5A1L A;  3IHR A;  4M1P A;  5HEO A;  2D0U A;  3PUG A;  5LXT E;  1XNR T;  4DV3 T;  2V7J A;  3ZJ1 A;  1J5W A;  3CX8 B;  3KDS E;  2DWK A;  2XQ8 A;  2WDV A;  4JI8 T;  3UTK A;  4ZS2 A;  3UFE A;  1OED C;  4JI6 T;  4PJN A;  2BS4 A;  4MLK A;  3ZMT B;  4O4I E;  1J5E T;  5LG3 A;  1D0Y A;  3HR0 A;  5JRE A;  1Z8U A;  1E1H B;  4GK5 E;  4TWD A;  5JDN A;  4B3S T;  2X9W A;  2WBL A;  4LMJ A;  4X5T A;  2LM2 A;  2ZM8 A;  3AEF A;  1MMG A;  3AA7 B;  2FJE A;  4TV8 E;  4QXB B;  2XAS B;  3NRX A;  4X65 T;  4X62 T;  3EVY A;  2W4X A;  3CML A;  2PBI A;  3ZN0 B;  3ETU A;  5EK3 A;  1BR4 A;  4ADZ A;  4X1K E;  2G0U A;  4JLE A;  2KIN B;  3RX6 A;  1YQ3 A;  2LSJ A;  2PG8 A;  2K9A A;  2Q9Q C;  3E22 E;  3C64 A;  5ABG A;  2CLY C;  1ZEE A;  2CA5 A;  5HEG A;  5C8Y E;  4O8S A;  2WWU A;  4QXC B;  3HKB E;  1R8I A;  4B3M T;  2C5I T;  4PFO A;  2KXP B;  5ABH A;  1HTJ F;  5KXJ A;  5LGT B;  4GKK T;  2UUA T;  3FZH B;  4EV6 A;  4B3T T;  2MOZ A;  3M65 A;  2CHO A;  1XWM A;  2WAU A;  1QUU A;  2CRB A;  1SHZ C;  3SFD A;  3I9Y A;  5TAO A;  4QH1 A;  2FUP A;  2ODV A;  2WM9 A;  3AE7 A;  4NXM T;  3PUR A;  2Q9Q D;  3KBU A;  3UFG A;  4DR6 T;  5AQP B;  2FBW A;  4YFS A;  4LF9 T;  2P9B A;  2W00 A;  2VAS A;  2KND A;  2J62 A;  2V7K A;  3AA0 B;  3QB5 A;  2YU1 A;  4UXN B;  2VKJ A;  3RKO A;  4LFB T;  2OA5 A;  3UT5 E;  4NPP A;  5CB4 E;  3KVB A;  4HFH A;  5CA0 E;  2LRK A;  3SFE A;  5IUX A;  3RI5 A;  3MZK B;  3AE9 A;  2N1G A;  4JV5 T;  4YJ2 E;  2YIN A;  2XJ7 A;  3ZLI A;  3A8Y C;  4KBM B;  1OED A;  5L3C B;  3FBZ A;  4U74 A;  3LK2 B;  2E9X B;  4IT4 A;  5AQI B;  3CPZ A;  4UR9 A;  4H9N C;  1IBK T;  3RRC A;  2XY8 B;  3E08 A;  4CXY A;  4YJ3 E;  5LJM A;  4DR5 T;  3BQK A;  1QLB A;  3ZCI A;  3WI3 A;  2JQQ A;  2W61 A;  2XAH B;  1MNE A;  4KHZ F;  3O1J A;  1KF6 A;  1N33 T;  3FZM B;  3X1D A;  2CCQ A;  5C3J A;  5AQO B;  4GOU A;  2IC6 A;  1HR0 T;  3ESL A;  1DU2 A;  2JQ9 A;  1WLX A;  3N9Q A;  2ES0 A;  3LDQ B;  2XQ5 A;  3AEB A;  2WSS V;  4I50 E;  2LKH A;  1HNX T;  2KMF A;  2XUE A;  4C90 A;  3KVA A;  2XPK A;  1UK5 A;  3AEG A;  2NTX A;  4PJL A;  3A7M A;  4ZI2 C;  3RYF E;  2MYS A;  5M4Y A;  3UU3 A;  3VR8 A;  5ETW A;  2X0H A;  3C4X A;  5C2T A;  4IE6 A;  2XQY A;  2M6I A;  3PE0 A;  5LHI B;  4PW8 A;  2VVN A;  2IC9 A;  3HKC E;  2KSR A;  2LOP A;  5AQK B;  3OYX A;  3AEE A;  3QOF A;  3GA8 A;  4TWF A;  1XMQ T;  2I0M A;  3OVU A;  4QX8 B;  2BVM A;  2M6B A;  4ZHQ E;  2WDQ A;  3MAC A;  2I59 A;  2VUR A;  4H9R C;  2JIW A;  3RC3 A;  2LHR A;  4ZI2 D;  2Y48 B;  5FL1 A;  2YDS A;  4DR1 T;  3ABV A;  3QC9 A;  4HFV A;  3CVR A;  2EHO C;  2NTY A;  4HFB A;  3NZQ A;  4DV1 T;  5JDF A;  3R6N A;  4A98 A;  2NW8 A;  3F2E A;  3KBT A;  4GYR A;  3RYI E;  2R6G F;  4JI4 T;  5HCJ A;  4LMK A;  4WBN E;  2QVA A;  1N36 T;  4TZ4 C;  4AXP A;  2V26 A;  2QA7 A;  3ZT5 A;  2YDR A;  1NEK A;  3ZMU B;  4DR3 T;  3PTR B;  2QRX A;  2DL1 A;  3PDY A;  3ONL C;  2EHO D;  1IBM T;  4QWN B;  2IML A;  5AQU B;  3RGL A;  5HXS A;  2B76 A;  3CQX C;  4HWH A;  3RYH E;  3AA6 B;  5AQS B;  3ETV A;  5LBM A;  2WDR A;  2XM1 A;  3SWH A;  3L3P A;  2M67 A;  2VWA A;  2XQ7 A;  2Z6E A;  1KNZ A;  3AE5 A;  4JEH B;  1IJ6 A;  4ZI7 E;  1U5P A;  5KMG P;  3I1A A;  3BK9 A;  2BS3 A;  3QUJ A;  2WU5 A;  3ONJ A;  4L5G A;  4G63 A;  2WB5 A;  5LNK A;  3AE2 A;  2W0G A;  3BQL A;  5BMV E;  4IDO A;  4UV9 B;  2MAW A;  1D1B A;  1YD8 G;  1X79 A;  4L0R A;  2VKO A;  2LLY A;  5JDL A;  3PUZ F;  4PK6 A;  1M7K A;  1YKH B;  5HXE A;  1OED B;  2LSK A;  2QYW A;  1B7T A;  5IYZ E;  4PJM A;  3MA9 A;  2NR4 A;  2LHN A;  5LG4 A;  3AE8 A;  3QNU A;  4YY3 T;  4HWC A;  3O1H A;  2D9D A;  2LSY A;  1GQE A;  4ZI3 C;  4LF4 T;  4LF7 T;  4EIW A;  3N5L A;  1KEY A;  3ZC1 A;  4FJO A;  4IGU A;  3AXJ A;  1OXZ A;  3DP7 A;  2JMK A;  4HFE A;  3RIU C;  1D0X A;  4UVC B;  4JI7 T;  4YTP A;  1VCT A;  4GYS A;  2SPC A;  2C0S A;  4HFI A;  5LYJ E;  5L3F B;  1MIV A;  1BR1 A;  4LFC T;  2LOS A;  2EHO A;  4YLH A;  2NWB A;  1NEN A;  2ACX A;  3PUA A;  2KZ7 B;  2BS2 A;  5L3D B;  3A5X A;  3RPU A;  4YTN A;  2Q9Q B;  3HKE E;  4ZI3 D;  2DHR A;  2CLY B;  1NAF A;  2ZMA A;  2XSB A;  3UUN A;  4NUU A;  3H3M A;  2JJ9 A;  4BA9 A;  2HN2 A;  2W66 A;  3C51 A;  2CMR A;  2E2A A;  2VL0 A;  2KLQ A;  1EZ3 A;  1T8B A;  3N9M A;  3TLW A;  3HA4 A;  3RYC E;  2X9H A;  2XAQ B;  4Z8X A;  4H63 H;  2K3W A;  1IBL T;  2BKP A;  2CHN A;  2X68 A;  5AQJ B;  1V9D A;  4LFA T;  4LF8 T;  3EHZ A;  4ILC A;  5J0Z A;  4IIJ E;  3CQC B;  5L2L A;  2JMH A;  5FP3 A;  2BBH A;  4L9I A;  4H63 V;  5EZY E;  5HXC A;  4IST A;  4DND A;  2CWY A;  1XMO T;  2DI4 A;  3MJX A;  1N34 T;  1WR0 A;  3L39 A;  1OWA A;  2YOE A;  4O4J E;  1HNZ T;  2VK9 A;  5EK4 A;  4OYJ A;  4YSY A;  2PFV A;  4ILB A;  2A2F X;  3I0Q A;  2YK0 A;  2LM9 A;  2BDE A;  2WP9 A;  1SA0 E;  3LJC A;  5L3G B;  4IE4 A;  5FYM A;  2IAK A;  4JYA T;  5AFU L;  2WMN A;  4TWH A;  5JQG E;  2UUB T;  2BKN A;  3HKD E;  1US7 B;  5F5W A;  4DR7 T;  2XQ6 A;  5J1G A;  1T7S A;  3FZK B;  3JCF A;  3GMI A;  2MBG A;  1VRB A;  3ZYK A;  3SRZ A;  4DID B;  2W62 A;  2E5V A;  4O2A E;  4TNV A;  4PFP A;  4EB6 E;  3G06 A;  3AE4 A;  4JI3 T;  3ZKR A;  5LHG B;  3JAD A;  2WZH A;  1W0B A;  2YU2 A;  3ZCJ A;  5DQW A;  3SOL A;  1YQ4 A;  3U78 A;  3FZL B;  5AQL B;  2K48 A;  4YXD A;  3Q5E A;  4NXN T;  3RIU A;  1KNP A;  2VL8 A;  4DBQ A;  3C50 A;  2UXD T;  3T1Y T;  2CXD A;  5H6R B;  3FXD B;  3F31 A;  4HEA A;  3EAM A;  5L47 A;  3UUM A;  5CA1 E;  2UXC T;  2K5B B;  3B57 A;  3J9X 1;  3AAA B;  3QB5 K;  3F57 A;  4WZX A;  4JI2 T;  3KIN B;  2GK9 A;  3O1I A;  3U3I A;  2D5U A;  3RHW A;  4JEU B;  3E0Z A;  4ZS3 A;  3JC6 C;  5ABE A;  4P0B A;  1SUM B;  5HWX A;  1W9R A;  3Q2M A;  1WRD A;  2BG9 E;  3Q9D A;  3C4W A;  2LRL A;  3PU3 A;  3H3A A;  3OKQ A;  1S35 A;  3Q5W A;  4O4H E;  1IJ5 A;  3TLV A;  4V1A v;  3O4X E;  3UU6 A;  3PUQ A;  3FHN A;  5LP6 E;  5FXW A;  3VKH A;  5AQT B;  1ZV4 X;  4DO0 A;  3VRA A;  3ZJ2 A;  4JUY A;  4YT0 A;  4K0K T;  1YKE B;  3AXJ B;  2CPT A;  2X9Y A;  4DMW A;  3JC6 D;  3NWI A;  3P4P A;  4IHJ E;  5LB7 B;  3AAE B;  5E0O A;  2D2S A;  1ZHC A;  2CXL A;  5ABF A;  2A72 A;  1IZN B;  1S94 A;  3AB3 B;  2EHO B;  4X20 E;  4CI1 B;  4U7I A;  1MIW A;  3CX7 B;  4CI2 B;  2LSI A;  2IDO B;  2WU2 A;  3OYZ A;  2X51 A;  5HCM A;  1LRZ A;  1J1J A;  4EXT A;  3ZST A;  3O9X A;  3C98 B;  5FKY A;  1HFA A;  2V7L A;  3OBV E;  2CEA A;  4OK0 A;  2RP4 A;  3K1S A;  4O4L E;  2PJQ A;  4EED A;  1O3X A;  3N2K E;  2FJD A;  4U2Z A;  4P09 A;  3ZEF B;  5HEJ A;  1I6Z A;  3NVO A;  5FL0 A;  4I4T E;  5LHH B;  1E2A A;  4HFC A;  1H7C A;  4HN9 A;  5EK2 A;  3AVR A;  2E5L T;  2XSA A;  3KFW X;  3FZF B;  5FNV E;  5LMN T;  1VCS A;  2H3R A;  3CWZ B;  3UU8 A;  2YN6 A;  3ZC0 A;  3Q5D A;  3NBX X;  2ZM0 A;  2A9U A;  4X1Y E;  5JDH A;  4HWI B;  2UU9 T;  2JRK A;  4EAH A;  2V7I A;  2XTL A;  1XZY A;  4U31 A;  3ZMZ B;  4O2B E;  1G73 A;  4ZZC A;  2X67 A;  2H89 A;  4UEM A;  4ASK A;  1HF8 A;  3EDU A;  3PJA A;  2Y8D A;  4PJJ A;  5HEH A;  5HWY A;  2DNX A;  4TN7 B;  2X9X A;  4QKN A;  2J47 A;  3JAF A;  5FY1 A;  1M62 A;  3PJA J;  4Q25 A;  4UEL A;  2L8K A;  3EI0 A;  3NZP A;  2WZI A;  2BG9 C;  4TX5 A;  3K8P C;  3B5M A;  1MMA A;  1XDO A;  4CN4 A;  3HL6 A;  4OYK A;  1W09 A;  2CM0 A;  4YHJ A;  2BZB A;  4JI5 T;  1D1C A;  2W2U A;  2XAG B;  2H88 A;  4GKJ T;  2XAJ B;  3CIR A;  1BR0 A;  5JRC A;  4EEB A;  2HH7 A;  3KV6 A;  3P4Q A;  3VKG A;  3PUX F;  1WFD A;  2UXX B;  2NOX A;  4ZZB A;  2HPL A;  2JPF A;  3K3Q C;  4N78 D;  4MFR A;  2D0T A;  4OHF A;  2CE7 A;  3UQ7 A;  3IBP A;  4B6X A;  3P4S A;  5F8P A;  5LGU B;  2RA1 A;  3K3N A;  3N9P A;  4F8H A;  1D0Z A;  1MMN A;  2JQK A;  3ZSS A;  4KMC A;  1FEW A;  3ZPO A;  3N9L A;  4JBW F;  1UCU A;  2NW9 A;  1LKX A;  1HX1 B;  3AVS A;  2VQE T;  4G2A A;  2H7O A;  2V8S V;  5CJ5 A;  4U7Y A;  4TUY E;  2YDQ A;  4EOZ B;  4UVA B;  4KHP T;  2VVS A;  2XZE A;  2AXD S;  4IDZ A;  4U2Y A;  2Y6X A;  4PK5 A;  2JQH A;  3FB2 A;  4QHO A;  3GWH A;  3UQ4 A;  1ZP0 A;  4C91 A;  3OTO T;  1HNW T;  1KNR A;  2XQ9 A;  1FJG T;  2V6Y A;  3FBL A;  4X1I E;  4AI6 A;  5HXH A;  5GON E;  1AJ3 A;  2ACZ A;  3TKL B;  3UUB A;  3VHL A;  5IHY A; 
#chains in the Genus database with same CATH homology
 3SS1 A;  5JR9 C;  4UF0 B;  1WLX A;  5FXV A;  3N9Q A;  4PFP A;  4EB6 E;  2ES0 A;  4EZH A;  4A56 A;  4FI5 A;  2WSS V;  5LHG B;  4I50 E;  2KWH A;  2YU2 A;  3ZCJ A;  3S4U A;  3KV4 A;  5DQW A;  3PUS A;  3SOL A;  3U78 A;  1LVF A;  5KDM C;  1HG2 A;  3ANW B;  4ANJ A;  2KMF A;  2XUE A;  3T8O A;  5FY7 A;  2K48 A;  5DAB A;  4C90 A;  5FMN A;  4AKH A;  3KVA A;  2DCF A;  2VL8 A;  5L3E B;  4UIG A;  4DBQ A;  3CQG B;  3C50 A;  3IEE A;  2NTX A;  1FIO A;  4PJL A;  3ZMS B;  5JR9 B;  4ZI2 C;  3RYF E;  2MYS A;  2CXD A;  2L3L A;  5M4Y A;  5H6R B;  3FXD B;  3F31 A;  4HEA A;  4ILU A;  3RH3 A;  5ETW A;  3P8C D;  3C4X A;  4TV9 E;  4AQG A;  3MXZ A;  4IE6 A;  2XQY A;  2CWO A;  3KV5 A;  4PK4 A;  3UUM A;  4CQI A;  5CA1 E;  3PE0 A;  4I55 E;  5LHI B;  4PW8 A;  2K5B B;  2IC9 A;  3B57 A;  2QGS A;  3J9X 1;  3HKC E;  2C5J A;  3AAA B;  1MMD A;  3F57 A;  2X0L B;  2LOP A;  2KT9 A;  5LCY A;  2DLR A;  3W15 B;  3OYX A;  3BQI A;  3KIN B;  2GK9 A;  3NRY A;  3O1I A;  2IW5 B;  3U3I A;  2D5U A;  3KV9 A;  5KX5 E;  4JEU B;  3GA8 A;  3E0Z A;  4IE0 A;  4ZS3 A;  5FY0 A;  3JC6 C;  4P0B A;  4QX8 B;  2BVM A;  5J2T E;  4DMV A;  4ZHQ E;  3MAC A;  3DJB A;  4H9Q C;  5HWX A;  2WMO A;  2W63 A;  3N2O A;  2I59 A;  4EZ4 A;  3Q2M A;  1WRD A;  2HPJ A;  3VU7 H;  4MHC A;  2XHE B;  4H9R C;  3Q9D A;  3C4W A;  2V1D B;  3PU3 A;  3H3A A;  3J7Y q;  3OKQ A;  1S35 A;  2YEV C;  3RC3 A;  3Q5W A;  5JDM A;  2LHR A;  4O4H E;  1IJ5 A;  5JVD E;  4ZI2 D;  4AQF C;  4V1A v;  2LJL A;  4UV8 B;  2CXF A;  4QX7 B;  2Y48 B;  2LT3 A;  3O4X E;  1FMW A;  4XAX B;  4ISS A;  3PUQ A;  3FHN A;  5LP6 E;  4BAY B;  5FXW A;  3UUL A;  3VKH A;  1UX5 A;  4AKR B;  1ZV4 X;  4H9O C;  4DVD A;  1MND A;  3QC9 A;  5H6Q B;  1MIY A;  2E8I A;  3LBX A;  4HFV A;  3CVR A;  2EHO C;  2NTY A;  4DO0 A;  1D1A A;  3ZJ2 A;  4JUY A;  3IF8 B;  1YKE B;  3NZQ A;  3LG7 A;  2X9Y A;  3N9O A;  4DMW A;  5LJN A;  2E9X A;  3JC6 D;  5JDF A;  3R6N A;  2NW8 A;  3F2E A;  4IHJ E;  5F3J A;  3KBT A;  3AAE B;  5L3B B;  5E0O A;  4GYR A;  2D2S A;  3H37 A;  3RYI E;  1ZHC A;  2CXL A;  3ZN1 B;  2A72 A;  2N9D A;  3L09 A;  3CX6 B;  1IZN B;  5LGN B;  3WAJ A;  4WBN E;  3V5U A;  1S94 A;  3AB3 B;  4QXH B;  3GN5 A;  2DWG A;  4XBF B;  2EHO B;  2H7V C;  2X66 A;  4X20 E;  1U4Q A;  4TZ4 C;  4MAL A;  4PNI A;  4CI1 B;  4AXP A;  2N2N A;  2V26 A;  2QA7 A;  3UUX B;  1MIW A;  2VKH A;  3CX7 B;  4CI2 B;  2LSI A;  2XAF B;  1NWM X;  4WNK A;  2VB6 A;  5HXR A;  5LBQ B;  3CKD A;  3OJA A;  3B13 A;  1KK7 A;  3OYZ A;  3ZMU B;  5JDQ A;  4GIW A;  3PTR B;  1T98 A;  3PDY A;  2X51 A;  1WYB A;  2A3D A;  1BR2 A;  1LRZ A;  3WAK A;  2EHO D;  4IE5 A;  4EXT A;  4QWN B;  4UF0 A;  3C98 B;  3O9X A;  4AKI A;  4DBR A;  1HFA A;  4XZC A;  1QSD A;  3EDV A;  2V7L A;  5HXS A;  3CQX C;  3OBV E;  5A1L A;  5JH7 E;  5JRC B;  3RYH E;  2CEA A;  4OK0 A;  2RP4 A;  3IHR A;  4M1P A;  3AA6 B;  2D0U A;  4O4L E;  2PJQ A;  3ETV A;  3PUG A;  5LBM A;  5LXT E;  1O3X A;  3ANW A;  2V7J A;  3ZJ1 A;  3SWH A;  3L3P A;  2M67 A;  2VWA A;  2Z6E A;  3N2K E;  4CXX A;  3CX8 B;  4P09 A;  3ZEF B;  1KNZ A;  2V7M A;  4JEH B;  3KDS E;  2DWK A;  1YW0 A;  1IJ6 A;  4HTE A;  5DJQ C;  4ZI7 E;  1U5P A;  4I4T E;  1Y64 B;  5JR9 A;  5KMG P;  3I1A A;  5LHH B;  3UTK A;  3BK9 A;  4ZS2 A;  4H9S E;  3UFE A;  5LOV E;  5J2U E;  3QUJ A;  4L5G A;  4G63 A;  4NUV A;  4PJN A;  5LNK A;  4MLK A;  1H7C A;  3ZMT B;  2W0G A;  3BQL A;  5BMV E;  4UV9 B;  4O4I E;  4HN9 A;  5EK2 A;  4I43 B;  1D0Y A;  3AVR A;  3HR0 A;  4EYY R;  1D1B A;  3KFW X;  4GK0 E;  1YD8 G;  5FNV E;  1X79 A;  2ZM2 A;  4L0R A;  3ZYL A;  5JRE A;  2VKO A;  5JDL A;  1E1H B;  2H3R A;  4GK5 E;  5JDN A;  4PK6 A;  2X9W A;  3CWZ B;  2WBL A;  1YKH B;  3LK4 2;  5HXE A;  3ZC0 A;  2LSK A;  3NBX X;  1B7T A;  2ZM0 A;  2ZM8 A;  5IYZ E;  4U72 A;  1MMG A;  4PJM A;  5DQV A;  3HI2 A;  4P0A A;  3MA9 A;  5ADX L;  5FXX A;  1HCI A;  3AA7 B;  4X1Y E;  2LHN A;  5LG4 A;  5JDH A;  3O1H A;  4TV8 E;  4QXB B;  2LSG A;  2JRK A;  4AKL A;  4EAH A;  5HYA A;  2V7I A;  2XTL A;  2XAS B;  1VOM A;  3FXE B;  3NRX A;  3I0O A;  4OFZ A;  3P7I A;  3ZMZ B;  2LSY A;  4O2B E;  1G73 A;  3EVY A;  4ZI3 C;  2X67 A;  3CML A;  4UEM A;  4ASK A;  2PBI A;  3ZN0 B;  4EIW A;  1HF8 A;  3ETU A;  3N5L A;  3EDU A;  4KUM B;  5EK3 A;  1BR4 A;  4ADZ A;  4X1K E;  2G0U A;  3ZC1 A;  4JLE A;  2KIN B;  2K24 A;  2Y8D A;  4FJO A;  4IGU A;  2LSJ A;  4H9P C;  4PJJ A;  3RX6 A;  2PG8 A;  5HWY A;  1OXZ A;  1HG5 A;  3DP7 A;  2DNX A;  2K9A A;  2NP9 A;  2JMK A;  4TN7 B;  2X9X A;  2C5K T;  4QKN A;  3ZMV B;  2NW7 A;  2Q9Q C;  3AA1 B;  1D0X A;  3C64 A;  3E22 E;  5FY1 A;  5LA6 E;  4UVC B;  1UX4 A;  2CLY C;  4AQF A;  4UEL A;  1ZEE A;  4GYS A;  2CA5 A;  2L8K A;  2SPC A;  2LE8 A;  5C8Y E;  4O8S A;  2C0S A;  2WWU A;  3NZP A;  4QXC B;  2MTQ A;  4BJM A;  3HKB E;  5L3F B;  5LYJ E;  2C5I T;  1MIV A;  4PFO A;  4TX5 A;  2KXP B;  1BR1 A;  1HTJ F;  3K8P C;  3N9N A;  5LGT B;  2LEH A;  2LOS A;  4CZZ B;  1MMA A;  3LK3 B;  2EHO A;  4YLH A;  1G8X A;  2NWB A;  2ACX A;  2KWI B;  2MOZ A;  4HKA A;  3PUA A;  2KZ7 B;  3M65 A;  3HL6 A;  4OYK A;  1WR6 A;  5L3D B;  3A5X A;  2CM0 A;  3RPU A;  4WBO A;  2Q9Q B;  2WAU A;  1QUU A;  3HKE E;  4ZI3 D;  2DHR A;  3MK7 C;  1SHZ C;  4YHJ A;  2BZB A;  2CLY B;  1NAF A;  3K3O A;  2ZMA A;  3I9Y A;  4PAG A;  1D1C A;  4NUU A;  3UUN A;  4K0U A;  4J2C A;  2XAG B;  2JJ9 A;  5TAO A;  4BA9 A;  5HAX A;  3EUH A;  2XAJ B;  3RC8 A;  1LVK A;  2ODV A;  4KP3 C;  4MBQ A;  4ERR A;  3C4Z A;  3C51 A;  1BR0 A;  5JRC A;  2CMR A;  2WM9 A;  2Q9Q A;  2HH7 A;  3KV6 A;  3PUR A;  2Q9Q D;  4CXW A;  3VKG A;  2KLQ A;  1EZ3 A;  3KBU A;  3N9M A;  2ZLY A;  2UXX B;  2NOX A;  3HA4 A;  3RYC E;  2X9H A;  2XAQ B;  4Z8X A;  2HPL A;  3LFM A;  2JPF A;  3K3Q C;  4H63 H;  4N78 D;  4MFR A;  2D0T A;  4YFS A;  2P9B A;  2W00 A;  4OHF A;  2VAS A;  2KND A;  2X68 A;  2V7K A;  2L9Q A;  2CE7 A;  4BJN A;  1V9D A;  4HE8 A;  2UXN B;  3AA0 B;  4E7S A;  2J1D G;  3IBP A;  4B6X A;  5F8P A;  2YU1 A;  5LGU B;  4UXN B;  2VKJ A;  4IIJ E;  3RKO A;  3CQC B;  2RA1 A;  5L2L A;  3K3N A;  2OA5 A;  3UT5 E;  2JMH A;  5FP3 A;  3N9P A;  5CB4 E;  4L9I A;  4H63 V;  5EZY E;  3KVB A;  5HXC A;  1D0Z A;  1MMN A;  2E9X C;  4IST A;  4DND A;  4KMC A;  2CWY A;  2DI4 A;  5CA0 E;  4WW0 A;  3MJX A;  1HS7 A;  4AKG A;  1FEW A;  4CI3 B;  3ZPO A;  3MZK B;  2N1G A;  3RRW A;  1OWA A;  2VKD A;  5JDG A;  4ZOL E;  3N9L A;  4O4J E;  4YJ2 E;  2VK9 A;  2YIN A;  4HGA A;  4OYJ A;  5EK4 A;  3ZLI A;  1UCU A;  2PFV A;  2NW9 A;  1LKX A;  4E7Z A;  3ONX A;  4KBM B;  3LBX B;  3AVS A;  3DTO A;  2A2F X;  4G2A A;  3I0Q A;  5FXZ A;  2H7O A;  5L3C B;  2YK0 A;  1WYC A;  3FBZ A;  2LM9 A;  4U74 A;  2BDE A;  3LK2 B;  4TUY E;  1SA0 E;  4EOZ B;  2E9X B;  4UVA B;  3LJC A;  3CPZ A;  4IE7 A;  5L3G B;  4H9N C;  3RRC A;  2ODU A;  3E08 A;  4IE4 A;  4IDZ A;  5FYM A;  1FMV A;  2IAK A;  4CXY A;  3I9W A;  4YJ3 E;  3R84 B;  2Y6X A;  4EYU A;  5AFU L;  5LJM A;  2WMN A;  4PK5 A;  3Q5X A;  3BQK A;  3FB2 A;  4QHO A;  3GWH A;  3ZCI A;  1Z0P A;  5JQG E;  3MKD A;  4C91 A;  3GN5 B;  1ZKE A;  2E9X D;  2JQQ A;  1HX8 A;  2W61 A;  2XAH B;  3N2G E;  4UVB B;  1IAP A;  3WI3 A;  3HKD E;  1MNE A;  1US7 B;  3O1J A;  3FBL A;  4X1I E;  2BVL A;  5J1G A;  1CUN A;  3ZYM A;  4AI6 A;  5HXH A;  2CCQ A;  3D0T A;  3PU8 A;  5GON E;  3GMI A;  2MBG A;  1AJ3 A;  1VRB A;  3ZYK A;  4F6R C;  3SRZ A;  3TKL B;  4GOU A;  3V5S A;  2IC6 A;  2W62 A;  3ESL A;  3VHL A;  5IHY A;  3QK6 A;  3AAI A;  2B1E A;  4O2A E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...