2BZBA

Nmr solution structure of a protein aspartic acid phosphate phosphatase from bacillus anthracis
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
62
structure length
62
Chain Sequence
MEMGQLKNKIENKKKELIQLVARHGLDHDKVLLFSRDLDKLINKFMNVKDKVHKLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords CONSERVED DOMAIN PROTEIN
publication title Structural characterization of Spo0E-like protein-aspartic acid phosphatases that regulate sporulation in bacilli.
pubmed doi rcsb
source organism Bacillus anthracis
total genus 18
structure length 62
sequence length 62
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09388 SpoOE-like Spo0E like sporulation regulatory protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.990 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2bzbA00
2BZBA 2C0SA
chains in the Genus database with same CATH superfamily
2CXDA 4QWNB 3A8YC 3SWHA 2E5VA 3L8RA 2HN1A 3IHRA 2H7VC 4NXNT 2V7KA 3TLVA 5AQQB 2IUBA 4MALA 4O4LE 2PTFA 4NPPA 4XZCA 4UVCB 2IC9A 3H3AA 4ANJA 4NIQA 5AQVB 3K8PC 3AECA 1ZP0A 1D1AA 2K3WA 3UU4A 2V5DA 4O2BE 3UT5E 2XSAA 4UXNB 2UXNB 4C91A 3OKQA 4EOZB 2XQ6A 3F57A 4X1YE 3WAKA 2BS3A 1S35A 2DCFA 2BKPA 2CHNA 4AQYT 5CJ5A 4E7SA 4PK4A 4K0UA 2V7JA 4QXCB 4UVBB 1IBKT 5CA0E 4HFDA 3UUBA 3V5UA 2XQ8A 4B3MT 5FXZA 1XDOA 3O9XA 1CHUA 1Y64B 3I1AA 1KFYA 4KX6A 4WYVA 4DV6T 2KWIB 4TUYE 5HXHA 3KFWX 4B6XA 1I94T 1LKXA 4MBQA 3ZYKA 2WZHA 3OTOT 2X67A 3RKGA 3BQIA 1G73A 4IE0A 2BKOA 4B3ST 1FIOA 1YXRA 2E9XA 5ABGA 2D0UA 5FY0A 3RKOA 5ADXL 3HA4A 2L8KA 4CN1A 3LBXA 4I43B 2XPKA 1N36T 3FZLB 2KINB 2VL8A 2H7OA 4ZZCA 1J5ET 5JDMA 5ABFB 3PV0F 1J5WA 3T8OA 3GN5B 3AAIA 2DWKA 2CHOA 3RIFA 3QB5K 1YKEB 2IIUA 1ZOYA 5AQFB 1OXZA 2DI4A 2H89A 2IMLA 1XMOT 3IEEA 2UUBT 3AE3A 4UV9B 4EZHA 5KDMC 2M6BA 4DMWA 2C0SA 2BS4A 4LFAT 2N1GA 2YKSA 3VRAA 2CMRA 3AE7A 3IA3A 2I59A 3UULA 1MIWA 1YKHB 4G2AA 2UUAT 3FZHB 2LSGA 5FNVE 2LM2A 3PU8A 4IDPA 5JVDE 4ISTA 2W66A 1AJ3A 3KV4A 3VU7H 1NAFA 4JYAT 4X1KE 4HWDA 4DV7T 5LHHB 1DU2A 2KMFA 3QNUA 2LHRA 3NVOA 5JRCB 5HXEA 5IYZE 1IJ6A 4O2AE 4DR5T 4AKHA 5FYMA 2V5CA 1XNQT 5KMGP 4IREA 5LHGB 2WCAA 4TV9E 5F3JA 4HFBA 4BA9A 3CWZB 5ETWA 4TV8E 4QH1A 2JQKA 3R6NA 5HYAA 4CN6A 3KVBA 2Y6XA 4OFZA 1UUSA 4PJJA 5TAOA 2ACXA 3HKCE 3B57A 5FXXA 2JMKA 2A2FX 2A9UA 1V9DA 4ZI3C 4DR4T 2LM9A 3ZC0A 3H3MA 2JMHA 3UU3A 3MJXA 1N32T 3PE0A 3HI2A 5GONE 3PUSA 4L5GA 3PJAA 1QSDA 1S94A 4U3CA 4O8SA 2E5LT 4O4IE 2E9XB 3UUXB 3ZSTA 4IDNA 2W2UA 2DL1A 3LG7A 4BJMA 3RIUA 3AE8A 4QX8B 3AVSA 3ZPOA 3ZT6A 1IJ5A 4JI5T 2FJEA 2IHR1 1WR0A 5CFBA 4HFIA 2YDSA 2Z6EA 1IBLT 2CA5A 3O1JA 2X0HA 4H9NC 3CKDA 3T1HT 3GMIA 1QUUA 2N9DA 2OLTA 4LF4T 2EHOA 1VOMA 2FUPA 2WDRA 4ZI7E 4IDQA 2QRXA 2QVAA 3SOLA 3EDUA 2NOXA 3FHNA 4DR3T 4ASKA 2YDRA 1FJGT 4OHFA 2W63A 3RC3A 5LYJE 2PFVA 4BAYB 1BR1A 1MMDA 5LJNA 4ZXLA 4OK0A 2WY2A 2XASB 4AISA 3OJAA 4ZI3D 5AQJB 4EIWA 3PUGA 2LOSA 1IAPA 5FVLA 3HKDE 1HF8A 2VL0A 2LHNA 1HFAA 5HXRA 3M3ZB 2CBIA 4YTMA 5DABA 1NWMX 3AAAB 3CMLA 4YHHT 1XZYA 2D5UA 2SPCA 2W4XA 5LG3A 4X65T 3U3IA 1SA0E 2YOEA 4UR9A 5HWXA 2Y8DA 4ISSA 2BG9A 5LNKA 5AQNB 5IWAT 4EV6A 2CLYB 4YXDA 5LHIB 3CQXC 3RH3A 3BK9A 1M7KA 2NTXA 3PDYA 4H9RC 3QB5A 3NZQA 2PJQA 4FI5A 2UXXB 3AE4A 5LGTB 4GKJT 4JI8T 1VRBA 1MIYA 5KX5E 2WWVA 3A7MA 2FJAA 4U33A 3ZN0B 2C5IT 3PUQA 2MBGA 3EUHA 4JI2T 2JIWA 4CQIA 1WR6A 5AQIB 3GN5A 4CN4A 2JQQA 2DHRA 3FBLA 4HTEA 3WI3A 2XZEA 3PUXF 3GA8A 3LFMA 3M65A 2V6XA 3JAEA 1T7SA 3RYIE 4OX9T 5BMVE 4DR2T 2EHOD 4DNDA 4EYYR 4TX5A 3WAJA 2D2SA 2ZMAA 3RQWA 1G8XA 5JR9C 2XAQB 3K1SA 4YHJA 2W00A 5JTGA 3TLWA 3UFGA 5LGUB 4ILCA 3O1IA 2WM9A 4IE5A 3ZT7A 5IHYA 2ZM0A 4ILAA 2MOZA 4DBRA 1BR4A 2BBHA 4M1PA 4IHJE 3P4QA 5F5WA 5L3FB 5JRCA 2WMOA 4QH5A 4LMJA 2BS2A 3AA7B 4OYJA 3L39A 4DMVA 3ETVA 5EZYE 3AA1B 4YLHA 3EDVA 4KHPT 2WZIA 3S4UA 4U74A 1E2AA 5JH7E 4DBQA 4PJNA 3CK6A 3H37A 2PBIA 2P9BA 4UEMA 2V8SV 4TWDA 3A5XA 2WU2A 3TLTA 2JQHA 2LOPA 1HX1B 3ZMZB 3ZCJA 1HG5A 3RC8A 3ZYLA 5FL0A 1XNRT 5J1GA 3NRXA 4N78D 2VQFT 2NTYA 5LBMA 4A98A 4HFCA 3J7Yq 2FBWA 2BG9B 2XAHB 2VURA 4O4HE 3UU8A 3E22E 2Y48B 1ZKEA 4UV8B 4TNWA 4QHOA 3JCFA 4PK5A 4LF8T 3SFEA 5HEUA 5C3JA 2XQAA 5FP3A 4Z90A 3UU5A 2XM2A 3C4ZA 1H7CA 1E7PA 3UQ7A 4QXBB 4U2ZA 4U7YA 4JUYA 4KP3C 2X66A 5JDNA 4DVDA 4X5TA 2K48A 3HL6A 1YW0A 3X1DA 4P0BA 1UX5A 2KLQA 1U5PA 3RLFF 1O3XA 4ZS3A 5J2UE 2WBLA 4HWCA 3N9PA 2YEVC 2E9XC 1UGOA 4IDOA 5DQVA 5AQPB 1OWAA 1NENA 3ETUA 5JREA 2XQYA 4L0RA 2V6YB 3JC6C 4ZOLE 3NZPA 4YSXA 4I0UA 5F8PA 2UUCT 1D0ZA 4LMLA 3U78A 3AB3B 4GK5E 2V1DB 3ONLC 2ZM8A 4HFHA 2KWHA 1M62A 2BDEA 4F8HA 3C51A 1W0AA 2LRLA 3RYHE 3I9YA 3CX7B 4JBWF 3MXZA 4YFSA 5FY1A 3AEBA 5HCMA 3OYXA 5LOVE 3KVAA 3ONXA 4PW8A 3UFEA 2KT9A 4JI3T 1LVFA 5DJQC 4MLKA 3LJCA 3VR8A 2CWYA 3K3NA 1MMNA 3PJAJ 3AEFA 3KV5A 3PURA 3R84B 4H63V 4HN9A 1KNZA 4EYUA 2M6IA 2W61A 5HWYA 1SE7A 2Q9QB 3HKBE 3P7IA 4X64T 4AKIA 3I9WA 1ZEEA 3AE9A 1EZ3A 4IIJE 1T98A 3TKLB 2DNXA 3PTRB 4EEDA 2E9XD 4YJ3E 4A97A 4X62T 1X79A 4MFRA 3IF8B 3NKZA 1WFDA 1MNEA 3ZCIA 3JC6D 2IW5B 4IE6A 3PUZF 2CM0A 2HHHT 2GK9A 1KNPA 3FZMB 4DV1T 2ZLYA 4QH4A 4UIGA 2IDOB 5CB4E 4TWHA 4EB6E 3HR0A 2CLYC 3RGLA 3ZJ2A 2BG9E 4PFPA 3O4XE 1XMQT 1J1JA 3N2OA 1HNZT 3RYCE 4KUMB 1QLBA 3N9LA 3NRYA 5C8YE 2J47A 2J1DG 2ZM2A 1GQEA 2XAJB 2VKJA 2XM1A 2WWUA 4Z91A 4XBFB 3N9OA 2LLYA 4L9IA 4BJNA 4LFBT 4B3TT 4ILBA 4A56A 3RIUC 4FJOA 2CWOA 3LSVA 4JV5T 4X1IE 2I6HA 4JI7T 4P1NA 2FJDA 5FL1A 2MTQA 1L0VA 2BKNA 3C50A 3ZMSB 5HXCA 3B13A 2OA5A 4ZEYA 3ZKRA 5AQOB 3PUAA 2LKGA 3C4WA 5HEHA 4IE4A 3RRCA 3P4WA 3OVUA 1D1BA 2E8IA 2KZ7B 2X9WA 2MAWA 3N9QA 2WB5A 4TWFA 4XAXB 3I0OA 4QKNA 2V7LA 1W0BA 2EHOC 4P09A 2VWAA 1D1CA 2YINA 3N5LA 3Q5EA 4I4TE 2X68A 3AEGA 3QUJA 3ZMVB 5HXSA 5EK2A 2V26A 3OYZA 4ILUA 4NXMT 3VR9A 4DR7T 1MNDA 3FXEB 5E0OA 5HEGA 3Q2MA 3L3PA 2XJ7A 2UXDT 1LRZA 3C4XA 2WDVA 2LJLA 2W67A 4H9OC 4QXHB 2LSIA 3CX6B 1W09A 3W15B 4ZS2A 5FXWA 4TN7B 2WP9A 2NWBA 3UQ4A 3P4SA 2K9AA 4ADZA 3DTOA 2C5KT 5JDFA 3UUMA 4G63A 2K5BB 1N34T 4JEUB 2HPJA 4DV0T 2CCQA 2YDQA 1UX4A 1HR0T 4H9PC 4NUVA 4EXTA 2W62A 3FXDB 3ZSSA 4JEHB 1T8BA 1OEDB 4EZ4A 4PJMA 1SUMB 2D9DA 3RRWA 4HWHA 2NP9A 4YSZA 1UURA 3KINB 5AQGB 2CE7A 3TLSA 3EABA 2VASA 5LGNB 2BG9C 1VCTA 4EAHA 4CXWA 4DUZT 3E0ZA 2KNDA 3LK42 4GIWA 5LMUT 1BR2A 3V5SA 2NW7A 4GOUA 3EI0A 4UF0B 5JQGE 3UUNA 1WYBA 4U7IA 3B5MA 4DO0A 2V6YA 2MPKA 5AQUB 1ZHCA 4DV2T 5L3EB 5DQWA 2JRKA 5BR8T 5LG4A 2YU2A 1MMAA 2XAFB 1B7TA 2X9HA 3P50A 4ZHQE 3F31A 3AE2A 5AQTB 5M4YA 4JLEA 3AA0B 2N2NA 3SFDA 4JI1T 5FMNA 3EAMA 4ERRA 4TNVA 4F6RC 1XWMA 5L3DB 2CRBA 3CQGB 3CPZA 2X0LB 4I55E 1HCIA 1YQ3A 2B1EA 1KEYA 5AQHB 2HPLA 2RA1A 2X51A 2KSRA 4YY3T 1KK7A 4AQGA 5L3BB 2B76A 3PU3A 2X9XA 1HX8A 4IL4A 4AI6A 3UTKA 1US7B 1WLXA 2XQ7A 4IDZA 3SS1A 2WMNA 3P4RA 3JADA 3RYFE 4HFVA 3RPUA 5AFUL 2WU5A 3MZKB 3AE5A 3RF1A 4H63H 1WYCA 1FEWA 3EVYA 3MK7C 2Q9QA 3CVRA 3ZLIA 2OV9A 1JNZA 3PUWF 2QYWA 1X9BA 2XUEA 1IBMT 2A72A 3RX6A 4KHZF 4LMKA 4EGWA 2XHEB 2YU1A 2L9QA 2CBJA 5L4EA 4LF6T 3CQCB 2IAKA 1KNRA 3QK6A 1YQ4A 2XQ9A 4LFCT 2NW8A 2VKOA 4CI1B 1IZNB 1W9RA 3L09A 3HKEE 2VB6A 5KXJA 4LF7T 2H3RA 4EEBA 5CGMA 4IL9A 2LE8A 2Q9QC 1HS7A 4PAGA 2M67A 2XAGB 5JR9B 2XTLA 3E08A 4ZZBA 2XQ5A 1HTJF 5HEOA 3EHZA 1KF6A 2LSJA 2YN6A 2AXDS 3MKDA 2LEHA 3QOFA 3KBUA 4JI0T 4OYKA 4DV4T 1JNRA 3UU6A 5L3CB 4WBOA 3Q5XA 3O1HA 5IUXA 2XSBA 3MA9A 5EK3A 4H9SE 2JPFA 2XY8B 4CXXA 3ZMTB 5J2TE 2ES0A 2K24A 3ZYMA 4NUUA 3AAEB 5HAXA 3ANWA 3JAFA 3RIAA 1OEDE 2ACZA 5ABHA 1FMWA 1U4QA 3G06A 4IT4A 3P4PA 3N9MA 2CXLA 4CZZB 1MMGA 3ZMUB 1ZV4X 3T1YT 4ZI2C 5FKYA 4PNIA 3DP7A 2V7IA 5FVKA 2X0YA 2VKDA 4HE8A 4HEAA 4UELA 3PUYF 4WZXA 2BVLA 1SHZC 1HNXT 4K0KT 4WW0A 4X20E 4Z8XA 4DR1T 3N9NA 3ZT5A 3AE1A 3DJBA 5HCJA 3ESLA 3D0TA 4I50E 2QGSA 2CXFA 5C2TA 4LF9T 4U31A 2XQ3A 2RPAA 1I6ZA 3VKHA 1LVKA 4KBMB 4U2YA 4PJLA 2Q9QD 4CI3B 4HWIB 5AQSB 2D0TA 1HG2A 2C5JA 4WNKA 4GK0E 4YTNA 4X66T 3CX8B 3ZC1A 3AVRA 1NEKA 4AKGA 4YTPA 2WS3A 2BBJA 4DR6T 5FXVA 3I0QA 1N33T 1WRDA 2ZM6T 3N2KE 5JDGA 3J9X1 3MACA 5J0ZA 4LF5T 3PUVF 3P8CD 5L47A 4H9QC 3AEEA 4AIUA 2UU9T 2A3DA 4DUYT 4P0AA 3K3OA 2IC6A 5LCYA 4E7ZA 2MYSA 2X9YA 2VVSA 5ABEA 3BQKA 3KV9A 4Q25A 3AEDA 5LB7B 2LSKA 5H6QB 2J62A 1T72A 1OEDA 5HEJA 2WSSV 1Z0PA 2VVNA 5JDLA 5EK4A 3ONJA 3VRBA 3C98B 4ZI2D 3FB2A 2VK9A 5LBQB 3AA6B 2XQ4A 2KXPB 1D0YA 4JI4T 3LBXB 4AQFA 5AQMB 2HN2A 2JQ9A 4HKAA 1VCSA 4UF0A 5LA6E 3RQUA 3NBXX 1XDPA 2BVMA 2NW9A 4AKLA 3AXJA 4GYSA 5L4HA 3GWHA 4TZ4C 4CXYA 4V1Av 3ZEFB 1Y01A 2WAUA 3ANWB 4YT0A 1OEDC 1E1HB 1YD8G 4IGUA 5LP6E 3KV6A 3N2GE 2FJBA 2ODUA 1MIVA 3Q9DA 4AKRB 3ABVA 2WQYA 2V7MA 2CPTA 4AQFC 1FMVA 4MHCA 2RP4A 4GKKT 4CI2B 3ZJ1A 3Q5WA 1HNWT 4HGAA 3FZFB 5L2LA 4PK6A 1UK5A 4HFEA 4DV5T 2PG8A 3RHWA 1D0XA 4GYRA 3AE6A 3FBZA 3KDSE 4KI0F 2LKHA 3KBTA 3OBVE 4QX7B 4B3RT 5A1LA 5L3GB 1BR0A 4PFOA 2DLRA 5AQRB 2BZBA 4WBNE 4J2CA 2AE9A 5LXTE 2W0GA 4A5XA 4C90A 2QA7A 4UVAB 5LMNT 2YK0A 2LSYA 4YSYA 3C64A 2LRKA 2WDQA 3BQLA 3SRZA 4DV3T 2LT3A 4COFA 2E2AA 3TLUA 2VQET 2L3LA 4DIDB 3LDQB 4AXPA 2DWGA 2VKHA 2ODVA 3F2EA 1R8IA 5CA1E 4YJ2E 2NR4A 3Q5DA 5AQLB 4JI6T 2UXCT 4IE7A 3AEAA 4U72A 1UCUA 3VKGA 1Z8UA 5JR9A 3OPCA 4O4JE 5FY7A 1CUNA 2F4VT 5LJMA 3CIRA 2H88A 5ABFA 2R6GF 3LK3B 2G0UA 3FZKB 3QC9A 3RI5A 3ZN1B 3VHLA 3NWIA 3AXJB 3IBPA 2JJ9A 2UXBT 5H6RB 3LK2B 5JDHA 2J4GA 4HWFA 5JDQA 1WCRA 2I0MA 2EHOB 2CEAA 2HH7A 3K3QC 5AQKB 4KMCA
chains in the Genus database with same CATH topology
2DNXA 3CMLA 2LSJA 3PTRB 2CXDA 4QWNB 3MKDA 2LEHA 2E9XD 3SWHA 3KBUA 4YJ3E 2D5UA 4OYKA 2SPCA 1X79A 3IHRA 4MFRA 4WBOA 5L3CB 2H7VC 3Q5XA 3O1HA 2V7KA 3IF8B 3U3IA 3MA9A 5EK3A 1MNEA 4MALA 4H9SE 2JPFA 3ZCIA 4CXXA 3ZMTB 5J2TE 3JC6D 4O4LE 2IW5B 2ES0A 2K24A 4IE6A 1SA0E 4UVCB 4XZCA 3ZYMA 2IC9A 3H3AA 4NUUA 3AAEB 5HAXA 4ANJA 3ANWA 5HWXA 2Y8DA 2CM0A 2GK9A 4ISSA 5LNKA 3K8PC 1FMWA 1U4QA 2ZLYA 4UIGA 2CLYB 1D1AA 5CB4E 3CQXC 4EB6E 5LHIB 3N9MA 4O2BE 2CXLA 3HR0A 3RH3A 1MMGA 2CLYC 3BK9A 3ZJ2A 4CZZB 2NTXA 3PDYA 4H9RC 3UT5E 3ZMUB 4UXNB 3NZQA 1ZV4X 4ZI2C 2UXNB 4PFPA 4C91A 2PJQA 4PNIA 3DP7A 2V7IA 3O4XE 3OKQA 2UXXB 4FI5A 2VKDA 4HE8A 3F57A 4EOZB 4HEAA 4X1YE 3WAKA 5LGTB 1S35A 4UELA 2DCFA 3N2OA 1VRBA 3RYCE 1MIYA 4KUMB 4E7SA 5KX5E 2BVLA 4PK4A 4K0UA 1SHZC 3N9LA 4WW0A 2V7JA 4QXCB 4UVBB 3NRYA 4X20E 4Z8XA 5CA0E 3V5UA 5FXZA 5C8YE 3O9XA 2C5IT 1Y64B 3PUQA 3I1AA 3N9NA 2J1DG 2ZM2A 3EUHA 2MBGA 3ZN0B 2XAJB 2VKJA 4CQIA 3DJBA 2WWUA 3ESLA 4XBFB 3N9OA 1WR6A 4L9IA 2KWIB 3D0TA 4I50E 2QGSA 3GN5A 4BJNA 4TUYE 2JQQA 2CXFA 5HXHA 2DHRA 3FBLA 3KFWX 4B6XA 4A56A 4FJOA 2CWOA 4HTEA 3WI3A 1LKXA 4X1IE 3GA8A 4MBQA 3ZYKA 3LFMA 2X67A 3BQIA 3VKHA 1LVKA 4KBMB 3M65A 1G73A 4IE0A 4PJLA 2Q9QD 2MTQA 4CI3B 2D0TA 1HG2A 2C5JA 3RYIE 3C50A 3ZMSB 5HXCA 4WNKA 3B13A 4GK0E 5BMVE 2OA5A 1FIOA 2E9XA 3CX8B 2D0UA 5FY0A 3RKOA 3ZC1A 2EHOD 4DNDA 3AVRA 5ADXL 4EYYR 3PUAA 3HA4A 4AKGA 3C4WA 4IE4A 2L8KA 3RRCA 3LBXA 4I43B 5FXVA 4TX5A 3WAJA 1D1BA 2E8IA 2KZ7B 2X9WA 2D2SA 3I0QA 2KINB 2VL8A 3N9QA 1WRDA 2ZMAA 1G8XA 4XAXB 3I0OA 2H7OA 5JR9C 2XAQB 4QKNA 2V7LA 2EHOC 3N2KE 4P09A 2VWAA 5JDGA 4YHJA 3J9X1 3MACA 1D1CA 2W00A 2YINA 3N5LA 4I4TE 5JDMA 3T8OA 3P8CD 4H9QC 2X68A 3GN5B 5LGUB 3AAIA 2A3DA 2DWKA 3QUJA 4P0AA 3ZMVB 3K3OA 3O1IA 5HXSA 2IC6A 2WM9A 5LCYA 1YKEB 2MYSA 4IE5A 2X9YA 4E7ZA 5EK2A 2V26A 3OYZA 4ILUA 2ZM0A 5IHYA 3BQKA 2MOZA 3KV9A 1BR4A 4DBRA 1OXZA 2DI4A 4M1PA 4IHJE 2LSKA 5H6QB 3IEEA 2WSSV 1MNDA 1Z0PA 3FXEB 5E0OA 5L3FB 5JRCA 2WMOA 3Q2MA 4UV9B 5JDLA 3L3PA 5EK4A 4EZHA 3C98B 4ZI2D 5KDMC 3AA7B 1LRZA 3FB2A 4OYJA 3C4XA 4DMWA 2C0SA 4DMVA 2LJLA 3ETVA 5EZYE 3AA1B 2N1GA 4YLHA 2VK9A 3EDVA 4H9OC 2CMRA 3AA6B 5LBQB 4QXHB 2LSIA 2KXPB 1D0YA 3CX6B 3LBXB 2I59A 3UULA 4AQFA 1MIWA 3W15B 3S4UA 4ZS2A 4U74A 1YKHB 4G2AA 5FXWA 5JH7E 2LSGA 4PJNA 4TN7B 4DBQA 5FNVE 3H37A 2NWBA 4HKAA 2K9AA 4UF0A 2PBIA 2P9BA 4UEMA 3DTOA 2C5KT 5LA6E 5JDFA 4ADZA 3NBXX 3PU8A 5JVDE 3UUMA 4G63A 2K5BB 3A5XA 4ISTA 2BVMA 4JEUB 2HPJA 2NW9A 2CCQA 4AKLA 4GYSA 2LOPA 1AJ3A 1UX4A 3KV4A 4H9PC 4NUVA 1NAFA 3VU7H 2W62A 4EXTA 3FXDB 3ZMZB 3ZCJA 3GWHA 4TZ4C 4CXYA 1HG5A 4X1KE 4V1Av 4JEHB 3RC8A 3ZYLA 5LHHB 3ZEFB 2KMFA 2WAUA 4EZ4A 4PJMA 2LHRA 5J1GA 3ANWB 3NRXA 4N78D 1E1HB 5JRCB 2NTYA 3RRWA 5LBMA 2NP9A 5HXEA 1YD8G 3KINB 4IGUA 3J7Yq 5IYZE 5LP6E 1IJ6A 2CE7A 3KV6A 4O2AE 2XAHB 2VASA 5LGNB 3N2GE 4O4HE 5FYMA 4EAHA 4AKHA 2ODUA 4CXWA 3E22E 3E0ZA 5KMGP 1MIVA 2Y48B 5LHGB 3Q9DA 2KNDA 1ZKEA 4TV9E 5F3JA 4UV8B 4AKRB 4QHOA 3LK42 2V7MA 4GIWA 4PK5A 4BA9A 3CWZB 5ETWA 4AQFC 4TV8E 1BR2A 1FMVA 4MHCA 3V5SA 2RP4A 2NW7A 4GOUA 3R6NA 4CI2B 3ZJ1A 4UF0B 5FP3A 5HYAA 5JQGE 3KVBA 3UUNA 1WYBA 2Y6XA 4OFZA 3Q5WA 4PJJA 4HGAA 5TAOA 3C4ZA 1H7CA 2ACXA 5L2LA 4QXBB 4DO0A 4PK6A 3HKCE 1ZHCA 5L3EB 3B57A 2PG8A 2JRKA 5DQWA 5FXXA 1D0XA 5LG4A 2JMKA 2YU2A 4GYRA 4JUYA 1MMAA 2A2FX 1B7TA 2XAFB 3FBZA 2X9HA 4KP3C 1V9DA 3KDSE 4ZHQE 3F31A 4ZI3C 2X66A 2LM9A 3KBTA 3ZC0A 5JDNA 3OBVE 4DVDA 2K48A 3HL6A 4QX7B 1YW0A 5M4YA 4JLEA 3AA0B 2JMHA 2N2NA 4P0BA 3MJXA 3PE0A 5A1LA 5L3GB 1BR0A 3HI2A 4PFOA 2DLRA 5GONE 5FMNA 1UX5A 3PUSA 4ERRA 2BZBA 4WBNE 2KLQA 4L5GA 4F6RC 1U5PA 1O3XA 4J2CA 1QSDA 1S94A 4ZS3A 4O8SA 5L3DB 3CQGB 5LXTE 2W0GA 3CPZA 4O4IE 4C90A 2WBLA 5J2UE 2X0LB 4I55E 1HCIA 2B1EA 2QA7A 3N9PA 2E9XB 2YEVC 3UUXB 2HPLA 2RA1A 4UVAB 2X51A 2YK0A 2LSYA 2E9XC 3LG7A 1KK7A 4AQGA 5DQVA 4BJMA 4QX8B 3C64A 3AVSA 1OWAA 5L3BB 3ETUA 3BQLA 2X9XA 3PU3A 3SRZA 5JREA 1HX8A 3ZPOA 2LT3A 4AI6A 3UTKA 2XQYA 4L0RA 1IJ5A 1US7B 1WLXA 3JC6C 4ZOLE 4IDZA 3SS1A 2WMNA 3RYFE 4HFVA 2L3LA 3RPUA 3NZPA 4AXPA 2DWGA 2VKHA 5F8PA 5AFUL 2ODVA 3F2EA 1D0ZA 3U78A 5CA1E 4YJ2E 2Z6EA 3AB3B 3MZKB 4GK5E 2V1DB 4H63H 1WYCA 1FEWA 3EVYA 3MK7C 2Q9QA 3CVRA 2CA5A 3ZLIA 2ZM8A 3O1JA 4IE7A 4H9NC 2KWHA 4U72A 1UCUA 3CKDA 3VKGA 2BDEA 3GMIA 3C51A 1QUUA 2N9DA 2XUEA 5JR9A 3RYHE 4O4JE 2EHOA 3I9YA 2A72A 3CX7B 5FY7A 1VOMA 3MXZA 3RX6A 4YFSA 1CUNA 5FY1A 3OYXA 5LJMA 5LOVE 3KVAA 3ONXA 4ZI7E 4PW8A 3UFEA 2XHEB 2YU1A 3LK3B 2L9QA 2KT9A 2G0UA 1LVFA 5DJQC 3SOLA 3EDUA 4MLKA 2NOXA 3CQCB 3FHNA 3LJCA 2CWYA 4ASKA 3QC9A 3K3NA 3ZN1B 4OHFA 2W63A 3RC3A 5LYJE 2IAKA 2PFVA 3QK6A 3VHLA 4BAYB 1BR1A 1MMDA 5LJNA 1MMNA 4OK0A 2NW8A 3KV5A 2VKOA 2XASB 4CI1B 3PURA 1IZNB 3R84B 3OJAA 4H63V 4ZI3D 4HN9A 1KNZA 4EYUA 3L09A 3HKEE 4EIWA 2VB6A 3PUGA 3IBPA 2JJ9A 2W61A 5H6RB 2LOSA 1IAPA 3LK2B 2H3RA 3HKDE 5HWYA 2Q9QB 3P7IA 3HKBE 5JDHA 1HF8A 2LE8A 2Q9QC 5JDQA 1HS7A 2LHNA 4PAGA 2M67A 4AKIA 3I9WA 2XAGB 1HFAA 5HXRA 1ZEEA 5JR9B 2XTLA 3E08A 2EHOB 2CEAA 5DABA 1EZ3A 2HH7A 3K3QC 1NWMX 4IIJE 1HTJF 1T98A 3AAAB 3TKLB 4KMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BZB A;  2C0S A; 
#chains in the Genus database with same CATH topology
 2CXD A;  4QWN B;  3A8Y C;  3SWH A;  2E5V A;  3L8R A;  2HN1 A;  3IHR A;  2H7V C;  4NXN T;  2V7K A;  3TLV A;  5AQQ B;  2IUB A;  4MAL A;  4O4L E;  2PTF A;  4NPP A;  4XZC A;  4UVC B;  2IC9 A;  3H3A A;  4ANJ A;  4NIQ A;  5AQV B;  3K8P C;  3AEC A;  1ZP0 A;  1D1A A;  2K3W A;  3UU4 A;  2V5D A;  4O2B E;  3UT5 E;  2XSA A;  4UXN B;  2UXN B;  4C91 A;  3OKQ A;  4EOZ B;  2XQ6 A;  3F57 A;  4X1Y E;  3WAK A;  2BS3 A;  1S35 A;  2DCF A;  2BKP A;  2CHN A;  4AQY T;  5CJ5 A;  4E7S A;  4PK4 A;  4K0U A;  2V7J A;  4QXC B;  4UVB B;  1IBK T;  5CA0 E;  4HFD A;  3UUB A;  3V5U A;  2XQ8 A;  4B3M T;  5FXZ A;  1XDO A;  3O9X A;  1CHU A;  1Y64 B;  3I1A A;  1KFY A;  4KX6 A;  4WYV A;  4DV6 T;  2KWI B;  4TUY E;  5HXH A;  3KFW X;  4B6X A;  1I94 T;  1LKX A;  4MBQ A;  3ZYK A;  2WZH A;  3OTO T;  2X67 A;  3RKG A;  3BQI A;  1G73 A;  4IE0 A;  2BKO A;  4B3S T;  1FIO A;  1YXR A;  2E9X A;  5ABG A;  2D0U A;  5FY0 A;  3RKO A;  5ADX L;  3HA4 A;  2L8K A;  4CN1 A;  3LBX A;  4I43 B;  2XPK A;  1N36 T;  3FZL B;  2KIN B;  2VL8 A;  2H7O A;  4ZZC A;  1J5E T;  5JDM A;  5ABF B;  3PV0 F;  1J5W A;  3T8O A;  3GN5 B;  3AAI A;  2DWK A;  2CHO A;  3RIF A;  3QB5 K;  1YKE B;  2IIU A;  1ZOY A;  5AQF B;  1OXZ A;  2DI4 A;  2H89 A;  2IML A;  1XMO T;  3IEE A;  2UUB T;  3AE3 A;  4UV9 B;  4EZH A;  5KDM C;  2M6B A;  4DMW A;  2C0S A;  2BS4 A;  4LFA T;  2N1G A;  2YKS A;  3VRA A;  2CMR A;  3AE7 A;  3IA3 A;  2I59 A;  3UUL A;  1MIW A;  1YKH B;  4G2A A;  2UUA T;  3FZH B;  2LSG A;  5FNV E;  2LM2 A;  3PU8 A;  4IDP A;  5JVD E;  4IST A;  2W66 A;  1AJ3 A;  3KV4 A;  3VU7 H;  1NAF A;  4JYA T;  4X1K E;  4HWD A;  4DV7 T;  5LHH B;  1DU2 A;  2KMF A;  3QNU A;  2LHR A;  3NVO A;  5JRC B;  5HXE A;  5IYZ E;  1IJ6 A;  4O2A E;  4DR5 T;  4AKH A;  5FYM A;  2V5C A;  1XNQ T;  5KMG P;  4IRE A;  5LHG B;  2WCA A;  4TV9 E;  5F3J A;  4HFB A;  4BA9 A;  3CWZ B;  5ETW A;  4TV8 E;  4QH1 A;  2JQK A;  3R6N A;  5HYA A;  4CN6 A;  3KVB A;  2Y6X A;  4OFZ A;  1UUS A;  4PJJ A;  5TAO A;  2ACX A;  3HKC E;  3B57 A;  5FXX A;  2JMK A;  2A2F X;  2A9U A;  1V9D A;  4ZI3 C;  4DR4 T;  2LM9 A;  3ZC0 A;  3H3M A;  2JMH A;  3UU3 A;  3MJX A;  1N32 T;  3PE0 A;  3HI2 A;  5GON E;  3PUS A;  4L5G A;  3PJA A;  1QSD A;  1S94 A;  4U3C A;  4O8S A;  2E5L T;  4O4I E;  2E9X B;  3UUX B;  3ZST A;  4IDN A;  2W2U A;  2DL1 A;  3LG7 A;  4BJM A;  3RIU A;  3AE8 A;  4QX8 B;  3AVS A;  3ZPO A;  3ZT6 A;  1IJ5 A;  4JI5 T;  2FJE A;  2IHR 1;  1WR0 A;  5CFB A;  4HFI A;  2YDS A;  2Z6E A;  1IBL T;  2CA5 A;  3O1J A;  2X0H A;  4H9N C;  3CKD A;  3T1H T;  3GMI A;  1QUU A;  2N9D A;  2OLT A;  4LF4 T;  2EHO A;  1VOM A;  2FUP A;  2WDR A;  4ZI7 E;  4IDQ A;  2QRX A;  2QVA A;  3SOL A;  3EDU A;  2NOX A;  3FHN A;  4DR3 T;  4ASK A;  2YDR A;  1FJG T;  4OHF A;  2W63 A;  3RC3 A;  5LYJ E;  2PFV A;  4BAY B;  1BR1 A;  1MMD A;  5LJN A;  4ZXL A;  4OK0 A;  2WY2 A;  2XAS B;  4AIS A;  3OJA A;  4ZI3 D;  5AQJ B;  4EIW A;  3PUG A;  2LOS A;  1IAP A;  5FVL A;  3HKD E;  1HF8 A;  2VL0 A;  2LHN A;  1HFA A;  5HXR A;  3M3Z B;  2CBI A;  4YTM A;  5DAB A;  1NWM X;  3AAA B;  3CML A;  4YHH T;  1XZY A;  2D5U A;  2SPC A;  2W4X A;  5LG3 A;  4X65 T;  3U3I A;  1SA0 E;  2YOE A;  4UR9 A;  5HWX A;  2Y8D A;  4ISS A;  2BG9 A;  5LNK A;  5AQN B;  5IWA T;  4EV6 A;  2CLY B;  4YXD A;  5LHI B;  3CQX C;  3RH3 A;  3BK9 A;  1M7K A;  2NTX A;  3PDY A;  4H9R C;  3QB5 A;  3NZQ A;  2PJQ A;  4FI5 A;  2UXX B;  3AE4 A;  5LGT B;  4GKJ T;  4JI8 T;  1VRB A;  1MIY A;  5KX5 E;  2WWV A;  3A7M A;  2FJA A;  4U33 A;  3ZN0 B;  2C5I T;  3PUQ A;  2MBG A;  3EUH A;  4JI2 T;  2JIW A;  4CQI A;  1WR6 A;  5AQI B;  3GN5 A;  4CN4 A;  2JQQ A;  2DHR A;  3FBL A;  4HTE A;  3WI3 A;  2XZE A;  3PUX F;  3GA8 A;  3LFM A;  3M65 A;  2V6X A;  3JAE A;  1T7S A;  3RYI E;  4OX9 T;  5BMV E;  4DR2 T;  2EHO D;  4DND A;  4EYY R;  4TX5 A;  3WAJ A;  2D2S A;  2ZMA A;  3RQW A;  1G8X A;  5JR9 C;  2XAQ B;  3K1S A;  4YHJ A;  2W00 A;  5JTG A;  3TLW A;  3UFG A;  5LGU B;  4ILC A;  3O1I A;  2WM9 A;  4IE5 A;  3ZT7 A;  5IHY A;  2ZM0 A;  4ILA A;  2MOZ A;  4DBR A;  1BR4 A;  2BBH A;  4M1P A;  4IHJ E;  3P4Q A;  5F5W A;  5L3F B;  5JRC A;  2WMO A;  4QH5 A;  4LMJ A;  2BS2 A;  3AA7 B;  4OYJ A;  3L39 A;  4DMV A;  3ETV A;  5EZY E;  3AA1 B;  4YLH A;  3EDV A;  4KHP T;  2WZI A;  3S4U A;  4U74 A;  1E2A A;  5JH7 E;  4DBQ A;  4PJN A;  3CK6 A;  3H37 A;  2PBI A;  2P9B A;  4UEM A;  2V8S V;  4TWD A;  3A5X A;  2WU2 A;  3TLT A;  2JQH A;  2LOP A;  1HX1 B;  3ZMZ B;  3ZCJ A;  1HG5 A;  3RC8 A;  3ZYL A;  5FL0 A;  1XNR T;  5J1G A;  3NRX A;  4N78 D;  2VQF T;  2NTY A;  5LBM A;  4A98 A;  4HFC A;  3J7Y q;  2FBW A;  2BG9 B;  2XAH B;  2VUR A;  4O4H E;  3UU8 A;  3E22 E;  2Y48 B;  1ZKE A;  4UV8 B;  4TNW A;  4QHO A;  3JCF A;  4PK5 A;  4LF8 T;  3SFE A;  5HEU A;  5C3J A;  2XQA A;  5FP3 A;  4Z90 A;  3UU5 A;  2XM2 A;  3C4Z A;  1H7C A;  1E7P A;  3UQ7 A;  4QXB B;  4U2Z A;  4U7Y A;  4JUY A;  4KP3 C;  2X66 A;  5JDN A;  4DVD A;  4X5T A;  2K48 A;  3HL6 A;  1YW0 A;  3X1D A;  4P0B A;  1UX5 A;  2KLQ A;  1U5P A;  3RLF F;  1O3X A;  4ZS3 A;  5J2U E;  2WBL A;  4HWC A;  3N9P A;  2YEV C;  2E9X C;  1UGO A;  4IDO A;  5DQV A;  5AQP B;  1OWA A;  1NEN A;  3ETU A;  5JRE A;  2XQY A;  4L0R A;  2V6Y B;  3JC6 C;  4ZOL E;  3NZP A;  4YSX A;  4I0U A;  5F8P A;  2UUC T;  1D0Z A;  4LML A;  3U78 A;  3AB3 B;  4GK5 E;  2V1D B;  3ONL C;  2ZM8 A;  4HFH A;  2KWH A;  1M62 A;  2BDE A;  4F8H A;  3C51 A;  1W0A A;  2LRL A;  3RYH E;  3I9Y A;  3CX7 B;  4JBW F;  3MXZ A;  4YFS A;  5FY1 A;  3AEB A;  5HCM A;  3OYX A;  5LOV E;  3KVA A;  3ONX A;  4PW8 A;  3UFE A;  2KT9 A;  4JI3 T;  1LVF A;  5DJQ C;  4MLK A;  3LJC A;  3VR8 A;  2CWY A;  3K3N A;  1MMN A;  3PJA J;  3AEF A;  3KV5 A;  3PUR A;  3R84 B;  4H63 V;  4HN9 A;  1KNZ A;  4EYU A;  2M6I A;  2W61 A;  5HWY A;  1SE7 A;  2Q9Q B;  3HKB E;  3P7I A;  4X64 T;  4AKI A;  3I9W A;  1ZEE A;  3AE9 A;  1EZ3 A;  4IIJ E;  1T98 A;  3TKL B;  2DNX A;  3PTR B;  4EED A;  2E9X D;  4YJ3 E;  4A97 A;  4X62 T;  1X79 A;  4MFR A;  3IF8 B;  3NKZ A;  1WFD A;  1MNE A;  3ZCI A;  3JC6 D;  2IW5 B;  4IE6 A;  3PUZ F;  2CM0 A;  2HHH T;  2GK9 A;  1KNP A;  3FZM B;  4DV1 T;  2ZLY A;  4QH4 A;  4UIG A;  2IDO B;  5CB4 E;  4TWH A;  4EB6 E;  3HR0 A;  2CLY C;  3RGL A;  3ZJ2 A;  2BG9 E;  4PFP A;  3O4X E;  1XMQ T;  1J1J A;  3N2O A;  1HNZ T;  3RYC E;  4KUM B;  1QLB A;  3N9L A;  3NRY A;  5C8Y E;  2J47 A;  2J1D G;  2ZM2 A;  1GQE A;  2XAJ B;  2VKJ A;  2XM1 A;  2WWU A;  4Z91 A;  4XBF B;  3N9O A;  2LLY A;  4L9I A;  4BJN A;  4LFB T;  4B3T T;  4ILB A;  4A56 A;  3RIU C;  4FJO A;  2CWO A;  3LSV A;  4JV5 T;  4X1I E;  2I6H A;  4JI7 T;  4P1N A;  2FJD A;  5FL1 A;  2MTQ A;  1L0V A;  2BKN A;  3C50 A;  3ZMS B;  5HXC A;  3B13 A;  2OA5 A;  4ZEY A;  3ZKR A;  5AQO B;  3PUA A;  2LKG A;  3C4W A;  5HEH A;  4IE4 A;  3RRC A;  3P4W A;  3OVU A;  1D1B A;  2E8I A;  2KZ7 B;  2X9W A;  2MAW A;  3N9Q A;  2WB5 A;  4TWF A;  4XAX B;  3I0O A;  4QKN A;  2V7L A;  1W0B A;  2EHO C;  4P09 A;  2VWA A;  1D1C A;  2YIN A;  3N5L A;  3Q5E A;  4I4T E;  2X68 A;  3AEG A;  3QUJ A;  3ZMV B;  5HXS A;  5EK2 A;  2V26 A;  3OYZ A;  4ILU A;  4NXM T;  3VR9 A;  4DR7 T;  1MND A;  3FXE B;  5E0O A;  5HEG A;  3Q2M A;  3L3P A;  2XJ7 A;  2UXD T;  1LRZ A;  3C4X A;  2WDV A;  2LJL A;  2W67 A;  4H9O C;  4QXH B;  2LSI A;  3CX6 B;  1W09 A;  3W15 B;  4ZS2 A;  5FXW A;  4TN7 B;  2WP9 A;  2NWB A;  3UQ4 A;  3P4S A;  2K9A A;  4ADZ A;  3DTO A;  2C5K T;  5JDF A;  3UUM A;  4G63 A;  2K5B B;  1N34 T;  4JEU B;  2HPJ A;  4DV0 T;  2CCQ A;  2YDQ A;  1UX4 A;  1HR0 T;  4H9P C;  4NUV A;  4EXT A;  2W62 A;  3FXD B;  3ZSS A;  4JEH B;  1T8B A;  1OED B;  4EZ4 A;  4PJM A;  1SUM B;  2D9D A;  3RRW A;  4HWH A;  2NP9 A;  4YSZ A;  1UUR A;  3KIN B;  5AQG B;  2CE7 A;  3TLS A;  3EAB A;  2VAS A;  5LGN B;  2BG9 C;  1VCT A;  4EAH A;  4CXW A;  4DUZ T;  3E0Z A;  2KND A;  3LK4 2;  4GIW A;  5LMU T;  1BR2 A;  3V5S A;  2NW7 A;  4GOU A;  3EI0 A;  4UF0 B;  5JQG E;  3UUN A;  1WYB A;  4U7I A;  3B5M A;  4DO0 A;  2V6Y A;  2MPK A;  5AQU B;  1ZHC A;  4DV2 T;  5L3E B;  5DQW A;  2JRK A;  5BR8 T;  5LG4 A;  2YU2 A;  1MMA A;  2XAF B;  1B7T A;  2X9H A;  3P50 A;  4ZHQ E;  3F31 A;  3AE2 A;  5AQT B;  5M4Y A;  4JLE A;  3AA0 B;  2N2N A;  3SFD A;  4JI1 T;  5FMN A;  3EAM A;  4ERR A;  4TNV A;  4F6R C;  1XWM A;  5L3D B;  2CRB A;  3CQG B;  3CPZ A;  2X0L B;  4I55 E;  1HCI A;  1YQ3 A;  2B1E A;  1KEY A;  5AQH B;  2HPL A;  2RA1 A;  2X51 A;  2KSR A;  4YY3 T;  1KK7 A;  4AQG A;  5L3B B;  2B76 A;  3PU3 A;  2X9X A;  1HX8 A;  4IL4 A;  4AI6 A;  3UTK A;  1US7 B;  1WLX A;  2XQ7 A;  4IDZ A;  3SS1 A;  2WMN A;  3P4R A;  3JAD A;  3RYF E;  4HFV A;  3RPU A;  5AFU L;  2WU5 A;  3MZK B;  3AE5 A;  3RF1 A;  4H63 H;  1WYC A;  1FEW A;  3EVY A;  3MK7 C;  2Q9Q A;  3CVR A;  3ZLI A;  2OV9 A;  1JNZ A;  3PUW F;  2QYW A;  1X9B A;  2XUE A;  1IBM T;  2A72 A;  3RX6 A;  4KHZ F;  4LMK A;  4EGW A;  2XHE B;  2YU1 A;  2L9Q A;  2CBJ A;  5L4E A;  4LF6 T;  3CQC B;  2IAK A;  1KNR A;  3QK6 A;  1YQ4 A;  2XQ9 A;  4LFC T;  2NW8 A;  2VKO A;  4CI1 B;  1IZN B;  1W9R A;  3L09 A;  3HKE E;  2VB6 A;  5KXJ A;  4LF7 T;  2H3R A;  4EEB A;  5CGM A;  4IL9 A;  2LE8 A;  2Q9Q C;  1HS7 A;  4PAG A;  2M67 A;  2XAG B;  5JR9 B;  2XTL A;  3E08 A;  4ZZB A;  2XQ5 A;  1HTJ F;  5HEO A;  3EHZ A;  1KF6 A;  2LSJ A;  2YN6 A;  2AXD S;  3MKD A;  2LEH A;  3QOF A;  3KBU A;  4JI0 T;  4OYK A;  4DV4 T;  1JNR A;  3UU6 A;  5L3C B;  4WBO A;  3Q5X A;  3O1H A;  5IUX A;  2XSB A;  3MA9 A;  5EK3 A;  4H9S E;  2JPF A;  2XY8 B;  4CXX A;  3ZMT B;  5J2T E;  2ES0 A;  2K24 A;  3ZYM A;  4NUU A;  3AAE B;  5HAX A;  3ANW A;  3JAF A;  3RIA A;  1OED E;  2ACZ A;  5ABH A;  1FMW A;  1U4Q A;  3G06 A;  4IT4 A;  3P4P A;  3N9M A;  2CXL A;  4CZZ B;  1MMG A;  3ZMU B;  1ZV4 X;  3T1Y T;  4ZI2 C;  5FKY A;  4PNI A;  3DP7 A;  2V7I A;  5FVK A;  2X0Y A;  2VKD A;  4HE8 A;  4HEA A;  4UEL A;  3PUY F;  4WZX A;  2BVL A;  1SHZ C;  1HNX T;  4K0K T;  4WW0 A;  4X20 E;  4Z8X A;  4DR1 T;  3N9N A;  3ZT5 A;  3AE1 A;  3DJB A;  5HCJ A;  3ESL A;  3D0T A;  4I50 E;  2QGS A;  2CXF A;  5C2T A;  4LF9 T;  4U31 A;  2XQ3 A;  2RPA A;  1I6Z A;  3VKH A;  1LVK A;  4KBM B;  4U2Y A;  4PJL A;  2Q9Q D;  4CI3 B;  4HWI B;  5AQS B;  2D0T A;  1HG2 A;  2C5J A;  4WNK A;  4GK0 E;  4YTN A;  4X66 T;  3CX8 B;  3ZC1 A;  3AVR A;  1NEK A;  4AKG A;  4YTP A;  2WS3 A;  2BBJ A;  4DR6 T;  5FXV A;  3I0Q A;  1N33 T;  1WRD A;  2ZM6 T;  3N2K E;  5JDG A;  3J9X 1;  3MAC A;  5J0Z A;  4LF5 T;  3PUV F;  3P8C D;  5L47 A;  4H9Q C;  3AEE A;  4AIU A;  2UU9 T;  2A3D A;  4DUY T;  4P0A A;  3K3O A;  2IC6 A;  5LCY A;  4E7Z A;  2MYS A;  2X9Y A;  2VVS A;  5ABE A;  3BQK A;  3KV9 A;  4Q25 A;  3AED A;  5LB7 B;  2LSK A;  5H6Q B;  2J62 A;  1T72 A;  1OED A;  5HEJ A;  2WSS V;  1Z0P A;  2VVN A;  5JDL A;  5EK4 A;  3ONJ A;  3VRB A;  3C98 B;  4ZI2 D;  3FB2 A;  2VK9 A;  5LBQ B;  3AA6 B;  2XQ4 A;  2KXP B;  1D0Y A;  4JI4 T;  3LBX B;  4AQF A;  5AQM B;  2HN2 A;  2JQ9 A;  4HKA A;  1VCS A;  4UF0 A;  5LA6 E;  3RQU A;  3NBX X;  1XDP A;  2BVM A;  2NW9 A;  4AKL A;  3AXJ A;  4GYS A;  5L4H A;  3GWH A;  4TZ4 C;  4CXY A;  4V1A v;  3ZEF B;  1Y01 A;  2WAU A;  3ANW B;  4YT0 A;  1OED C;  1E1H B;  1YD8 G;  4IGU A;  5LP6 E;  3KV6 A;  3N2G E;  2FJB A;  2ODU A;  1MIV A;  3Q9D A;  4AKR B;  3ABV A;  2WQY A;  2V7M A;  2CPT A;  4AQF C;  1FMV A;  4MHC A;  2RP4 A;  4GKK T;  4CI2 B;  3ZJ1 A;  3Q5W A;  1HNW T;  4HGA A;  3FZF B;  5L2L A;  4PK6 A;  1UK5 A;  4HFE A;  4DV5 T;  2PG8 A;  3RHW A;  1D0X A;  4GYR A;  3AE6 A;  3FBZ A;  3KDS E;  4KI0 F;  2LKH A;  3KBT A;  3OBV E;  4QX7 B;  4B3R T;  5A1L A;  5L3G B;  1BR0 A;  4PFO A;  2DLR A;  5AQR B;  2BZB A;  4WBN E;  4J2C A;  2AE9 A;  5LXT E;  2W0G A;  4A5X A;  4C90 A;  2QA7 A;  4UVA B;  5LMN T;  2YK0 A;  2LSY A;  4YSY A;  3C64 A;  2LRK A;  2WDQ A;  3BQL A;  3SRZ A;  4DV3 T;  2LT3 A;  4COF A;  2E2A A;  3TLU A;  2VQE T;  2L3L A;  4DID B;  3LDQ B;  4AXP A;  2DWG A;  2VKH A;  2ODV A;  3F2E A;  1R8I A;  5CA1 E;  4YJ2 E;  2NR4 A;  3Q5D A;  5AQL B;  4JI6 T;  2UXC T;  4IE7 A;  3AEA A;  4U72 A;  1UCU A;  3VKG A;  1Z8U A;  5JR9 A;  3OPC A;  4O4J E;  5FY7 A;  1CUN A;  2F4V T;  5LJM A;  3CIR A;  2H88 A;  5ABF A;  2R6G F;  3LK3 B;  2G0U A;  3FZK B;  3QC9 A;  3RI5 A;  3ZN1 B;  3VHL A;  3NWI A;  3AXJ B;  3IBP A;  2JJ9 A;  2UXB T;  5H6R B;  3LK2 B;  5JDH A;  2J4G A;  4HWF A;  5JDQ A;  1WCR A;  2I0M A;  2EHO B;  2CEA A;  2HH7 A;  3K3Q C;  5AQK B;  4KMC A; 
#chains in the Genus database with same CATH homology
 2DNX A;  3CML A;  2LSJ A;  3PTR B;  2CXD A;  4QWN B;  3MKD A;  2LEH A;  2E9X D;  3SWH A;  3KBU A;  4YJ3 E;  2D5U A;  4OYK A;  2SPC A;  1X79 A;  3IHR A;  4MFR A;  4WBO A;  5L3C B;  2H7V C;  3Q5X A;  3O1H A;  2V7K A;  3IF8 B;  3U3I A;  3MA9 A;  5EK3 A;  1MNE A;  4MAL A;  4H9S E;  2JPF A;  3ZCI A;  4CXX A;  3ZMT B;  5J2T E;  3JC6 D;  4O4L E;  2IW5 B;  2ES0 A;  2K24 A;  4IE6 A;  1SA0 E;  4UVC B;  4XZC A;  3ZYM A;  2IC9 A;  3H3A A;  4NUU A;  3AAE B;  5HAX A;  4ANJ A;  3ANW A;  5HWX A;  2Y8D A;  2CM0 A;  2GK9 A;  4ISS A;  5LNK A;  3K8P C;  1FMW A;  1U4Q A;  2ZLY A;  4UIG A;  2CLY B;  1D1A A;  5CB4 E;  3CQX C;  4EB6 E;  5LHI B;  3N9M A;  4O2B E;  2CXL A;  3HR0 A;  3RH3 A;  1MMG A;  2CLY C;  3BK9 A;  3ZJ2 A;  4CZZ B;  2NTX A;  3PDY A;  4H9R C;  3UT5 E;  3ZMU B;  4UXN B;  3NZQ A;  1ZV4 X;  4ZI2 C;  2UXN B;  4PFP A;  4C91 A;  2PJQ A;  4PNI A;  3DP7 A;  2V7I A;  3O4X E;  3OKQ A;  2UXX B;  4FI5 A;  2VKD A;  4HE8 A;  3F57 A;  4EOZ B;  4HEA A;  4X1Y E;  3WAK A;  5LGT B;  1S35 A;  4UEL A;  2DCF A;  3N2O A;  1VRB A;  3RYC E;  1MIY A;  4KUM B;  4E7S A;  5KX5 E;  2BVL A;  4PK4 A;  4K0U A;  1SHZ C;  3N9L A;  4WW0 A;  2V7J A;  4QXC B;  4UVB B;  3NRY A;  4X20 E;  4Z8X A;  5CA0 E;  3V5U A;  5FXZ A;  5C8Y E;  3O9X A;  2C5I T;  1Y64 B;  3PUQ A;  3I1A A;  3N9N A;  2J1D G;  2ZM2 A;  3EUH A;  2MBG A;  3ZN0 B;  2XAJ B;  2VKJ A;  4CQI A;  3DJB A;  2WWU A;  3ESL A;  4XBF B;  3N9O A;  1WR6 A;  4L9I A;  2KWI B;  3D0T A;  4I50 E;  2QGS A;  3GN5 A;  4BJN A;  4TUY E;  2JQQ A;  2CXF A;  5HXH A;  2DHR A;  3FBL A;  3KFW X;  4B6X A;  4A56 A;  4FJO A;  2CWO A;  4HTE A;  3WI3 A;  1LKX A;  4X1I E;  3GA8 A;  4MBQ A;  3ZYK A;  3LFM A;  2X67 A;  3BQI A;  3VKH A;  1LVK A;  4KBM B;  3M65 A;  1G73 A;  4IE0 A;  4PJL A;  2Q9Q D;  2MTQ A;  4CI3 B;  2D0T A;  1HG2 A;  2C5J A;  3RYI E;  3C50 A;  3ZMS B;  5HXC A;  4WNK A;  3B13 A;  4GK0 E;  5BMV E;  2OA5 A;  1FIO A;  2E9X A;  3CX8 B;  2D0U A;  5FY0 A;  3RKO A;  3ZC1 A;  2EHO D;  4DND A;  3AVR A;  5ADX L;  4EYY R;  3PUA A;  3HA4 A;  4AKG A;  3C4W A;  4IE4 A;  2L8K A;  3RRC A;  3LBX A;  4I43 B;  5FXV A;  4TX5 A;  3WAJ A;  1D1B A;  2E8I A;  2KZ7 B;  2X9W A;  2D2S A;  3I0Q A;  2KIN B;  2VL8 A;  3N9Q A;  1WRD A;  2ZMA A;  1G8X A;  4XAX B;  3I0O A;  2H7O A;  5JR9 C;  2XAQ B;  4QKN A;  2V7L A;  2EHO C;  3N2K E;  4P09 A;  2VWA A;  5JDG A;  4YHJ A;  3J9X 1;  3MAC A;  1D1C A;  2W00 A;  2YIN A;  3N5L A;  4I4T E;  5JDM A;  3T8O A;  3P8C D;  4H9Q C;  2X68 A;  3GN5 B;  5LGU B;  3AAI A;  2A3D A;  2DWK A;  3QUJ A;  4P0A A;  3ZMV B;  3K3O A;  3O1I A;  5HXS A;  2IC6 A;  2WM9 A;  5LCY A;  1YKE B;  2MYS A;  4IE5 A;  2X9Y A;  4E7Z A;  5EK2 A;  2V26 A;  3OYZ A;  4ILU A;  2ZM0 A;  5IHY A;  3BQK A;  2MOZ A;  3KV9 A;  1BR4 A;  4DBR A;  1OXZ A;  2DI4 A;  4M1P A;  4IHJ E;  2LSK A;  5H6Q B;  3IEE A;  2WSS V;  1MND A;  1Z0P A;  3FXE B;  5E0O A;  5L3F B;  5JRC A;  2WMO A;  3Q2M A;  4UV9 B;  5JDL A;  3L3P A;  5EK4 A;  4EZH A;  3C98 B;  4ZI2 D;  5KDM C;  3AA7 B;  1LRZ A;  3FB2 A;  4OYJ A;  3C4X A;  4DMW A;  2C0S A;  4DMV A;  2LJL A;  3ETV A;  5EZY E;  3AA1 B;  2N1G A;  4YLH A;  2VK9 A;  3EDV A;  4H9O C;  2CMR A;  3AA6 B;  5LBQ B;  4QXH B;  2LSI A;  2KXP B;  1D0Y A;  3CX6 B;  3LBX B;  2I59 A;  3UUL A;  4AQF A;  1MIW A;  3W15 B;  3S4U A;  4ZS2 A;  4U74 A;  1YKH B;  4G2A A;  5FXW A;  5JH7 E;  2LSG A;  4PJN A;  4TN7 B;  4DBQ A;  5FNV E;  3H37 A;  2NWB A;  4HKA A;  2K9A A;  4UF0 A;  2PBI A;  2P9B A;  4UEM A;  3DTO A;  2C5K T;  5LA6 E;  5JDF A;  4ADZ A;  3NBX X;  3PU8 A;  5JVD E;  3UUM A;  4G63 A;  2K5B B;  3A5X A;  4IST A;  2BVM A;  4JEU B;  2HPJ A;  2NW9 A;  2CCQ A;  4AKL A;  4GYS A;  2LOP A;  1AJ3 A;  1UX4 A;  3KV4 A;  4H9P C;  4NUV A;  1NAF A;  3VU7 H;  2W62 A;  4EXT A;  3FXD B;  3ZMZ B;  3ZCJ A;  3GWH A;  4TZ4 C;  4CXY A;  1HG5 A;  4X1K E;  4V1A v;  4JEH B;  3RC8 A;  3ZYL A;  5LHH B;  3ZEF B;  2KMF A;  2WAU A;  4EZ4 A;  4PJM A;  2LHR A;  5J1G A;  3ANW B;  3NRX A;  4N78 D;  1E1H B;  5JRC B;  2NTY A;  3RRW A;  5LBM A;  2NP9 A;  5HXE A;  1YD8 G;  3KIN B;  4IGU A;  3J7Y q;  5IYZ E;  5LP6 E;  1IJ6 A;  2CE7 A;  3KV6 A;  4O2A E;  2XAH B;  2VAS A;  5LGN B;  3N2G E;  4O4H E;  5FYM A;  4EAH A;  4AKH A;  2ODU A;  4CXW A;  3E22 E;  3E0Z A;  5KMG P;  1MIV A;  2Y48 B;  5LHG B;  3Q9D A;  2KND A;  1ZKE A;  4TV9 E;  5F3J A;  4UV8 B;  4AKR B;  4QHO A;  3LK4 2;  2V7M A;  4GIW A;  4PK5 A;  4BA9 A;  3CWZ B;  5ETW A;  4AQF C;  4TV8 E;  1BR2 A;  1FMV A;  4MHC A;  3V5S A;  2RP4 A;  2NW7 A;  4GOU A;  3R6N A;  4CI2 B;  3ZJ1 A;  4UF0 B;  5FP3 A;  5HYA A;  5JQG E;  3KVB A;  3UUN A;  1WYB A;  2Y6X A;  4OFZ A;  3Q5W A;  4PJJ A;  4HGA A;  5TAO A;  3C4Z A;  1H7C A;  2ACX A;  5L2L A;  4QXB B;  4DO0 A;  4PK6 A;  3HKC E;  1ZHC A;  5L3E B;  3B57 A;  2PG8 A;  2JRK A;  5DQW A;  5FXX A;  1D0X A;  5LG4 A;  2JMK A;  2YU2 A;  4GYR A;  4JUY A;  1MMA A;  2A2F X;  1B7T A;  2XAF B;  3FBZ A;  2X9H A;  4KP3 C;  1V9D A;  3KDS E;  4ZHQ E;  3F31 A;  4ZI3 C;  2X66 A;  2LM9 A;  3KBT A;  3ZC0 A;  5JDN A;  3OBV E;  4DVD A;  2K48 A;  3HL6 A;  4QX7 B;  1YW0 A;  5M4Y A;  4JLE A;  3AA0 B;  2JMH A;  2N2N A;  4P0B A;  3MJX A;  3PE0 A;  5A1L A;  5L3G B;  1BR0 A;  3HI2 A;  4PFO A;  2DLR A;  5GON E;  5FMN A;  1UX5 A;  3PUS A;  4ERR A;  2BZB A;  4WBN E;  2KLQ A;  4L5G A;  4F6R C;  1U5P A;  1O3X A;  4J2C A;  1QSD A;  1S94 A;  4ZS3 A;  4O8S A;  5L3D B;  3CQG B;  5LXT E;  2W0G A;  3CPZ A;  4O4I E;  4C90 A;  2WBL A;  5J2U E;  2X0L B;  4I55 E;  1HCI A;  2B1E A;  2QA7 A;  3N9P A;  2E9X B;  2YEV C;  3UUX B;  2HPL A;  2RA1 A;  4UVA B;  2X51 A;  2YK0 A;  2LSY A;  2E9X C;  3LG7 A;  1KK7 A;  4AQG A;  5DQV A;  4BJM A;  4QX8 B;  3C64 A;  3AVS A;  1OWA A;  5L3B B;  3ETU A;  3BQL A;  2X9X A;  3PU3 A;  3SRZ A;  5JRE A;  1HX8 A;  3ZPO A;  2LT3 A;  4AI6 A;  3UTK A;  2XQY A;  4L0R A;  1IJ5 A;  1US7 B;  1WLX A;  3JC6 C;  4ZOL E;  4IDZ A;  3SS1 A;  2WMN A;  3RYF E;  4HFV A;  2L3L A;  3RPU A;  3NZP A;  4AXP A;  2DWG A;  2VKH A;  5F8P A;  5AFU L;  2ODV A;  3F2E A;  1D0Z A;  3U78 A;  5CA1 E;  4YJ2 E;  2Z6E A;  3AB3 B;  3MZK B;  4GK5 E;  2V1D B;  4H63 H;  1WYC A;  1FEW A;  3EVY A;  3MK7 C;  2Q9Q A;  3CVR A;  2CA5 A;  3ZLI A;  2ZM8 A;  3O1J A;  4IE7 A;  4H9N C;  2KWH A;  4U72 A;  1UCU A;  3CKD A;  3VKG A;  2BDE A;  3GMI A;  3C51 A;  1QUU A;  2N9D A;  2XUE A;  5JR9 A;  3RYH E;  4O4J E;  2EHO A;  3I9Y A;  2A72 A;  3CX7 B;  5FY7 A;  1VOM A;  3MXZ A;  3RX6 A;  4YFS A;  1CUN A;  5FY1 A;  3OYX A;  5LJM A;  5LOV E;  3KVA A;  3ONX A;  4ZI7 E;  4PW8 A;  3UFE A;  2XHE B;  2YU1 A;  3LK3 B;  2L9Q A;  2KT9 A;  2G0U A;  1LVF A;  5DJQ C;  3SOL A;  3EDU A;  4MLK A;  2NOX A;  3CQC B;  3FHN A;  3LJC A;  2CWY A;  4ASK A;  3QC9 A;  3K3N A;  3ZN1 B;  4OHF A;  2W63 A;  3RC3 A;  5LYJ E;  2IAK A;  2PFV A;  3QK6 A;  3VHL A;  4BAY B;  1BR1 A;  1MMD A;  5LJN A;  1MMN A;  4OK0 A;  2NW8 A;  3KV5 A;  2VKO A;  2XAS B;  4CI1 B;  3PUR A;  1IZN B;  3R84 B;  3OJA A;  4H63 V;  4ZI3 D;  4HN9 A;  1KNZ A;  4EYU A;  3L09 A;  3HKE E;  4EIW A;  2VB6 A;  3PUG A;  3IBP A;  2JJ9 A;  2W61 A;  5H6R B;  2LOS A;  1IAP A;  3LK2 B;  2H3R A;  3HKD E;  5HWY A;  2Q9Q B;  3P7I A;  3HKB E;  5JDH A;  1HF8 A;  2LE8 A;  2Q9Q C;  5JDQ A;  1HS7 A;  2LHN A;  4PAG A;  2M67 A;  4AKI A;  3I9W A;  2XAG B;  1HFA A;  5HXR A;  1ZEE A;  5JR9 B;  2XTL A;  3E08 A;  2EHO B;  2CEA A;  5DAB A;  1EZ3 A;  2HH7 A;  3K3Q C;  1NWM X;  4IIJ E;  1HTJ F;  1T98 A;  3AAA B;  3TKL B;  4KMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...