4YFSA

Structure of the synthetic duffy binding protein (dbp) antigen deknull relevant for malaria vaccine design
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
294
structure length
285
Chain Sequence
KNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTASTAATSRTSWWNESKAQIWTAMMYSVKKRLKGNFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Erythrocyte binding protein
molecule keywords Duffy receptor
publication title Structural Analysis of the Synthetic Duffy Binding Protein (DBP) Antigen DEKnull Relevant for Plasmodium vivax Malaria Vaccine Design.
pubmed doi rcsb
source organism Plasmodium vivax
total genus 120
structure length 285
sequence length 294
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4yfsA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4yfsA01
3CMLA 2YK0A 4YFSA 5F3JA 3BQLA 3BQIA 2Y8DA 3CPZA 3C64A 4NUUA 3RRCA 2XU0A 4NUVA 3BQKA 2WAUA
chains in the Genus database with same CATH superfamily
3O1IA 4WZXA 2BKOA 4YSZA 2XQ8A 1US7B 4B6XA 4NIQA 4UXNB 3TLWA 3ZT6A 3AE5A 3EDVA 3UU4A 5F8PA 2LOPA 2HPLA 2JJ9A 2WU2A 2FJEA 5FL1A 1W0BA 4AI6A 1MNEA 1NWMX 5JDMA 5IUXA 3AA1B 4GK0E 2K5BB 4LFBT 1FMWA 4LF7T 4MFRA 5L4HA 2KWHA 4JYAT 3UUBA 1OWAA 3AEEA 4MLKA 4IDZA 4DNDA 2ODUA 3PUZF 4O4JE 4IE7A 3VR9A 4IDQA 4DR2T 3P4WA 2I59A 3UTKA 2CHNA 2LKGA 2OA5A 1MIYA 3OPCA 4ZOLE 2V8SV 5EZYE 1IZNB 2W4XA 3RLFF 3PJAA 5LJNA 3HR0A 2YDSA 1ZHCA 1U5PA 2YDRA 1SHZC 4NUVA 4CI2B 5IWAT 4DVDA 3AAIA 2PBIA 3DP7A 3RTRA 3N9NA 5FKYA 3OKQA 3RIFA 4PK5A 2V7KA 3UU8A 1KEYA 1T8BA 4IREA 2X9XA 1UK5A 2V7MA 4KI0F 3PDYA 2IW5B 2X9HA 2CBJA 5J0ZA 2NW8A 3PTRB 4DV4T 3SWHA 2CXDA 3FZHB 1D0XA 3ZYMA 4P5OA 4HFIA 4BJMA 1HTJF 2JQHA 1SUMB 5JVDE 4CI1B 4JV5T 4AKLA 3L09A 4IGUA 3RRCA 4U72A 1UCUA 3LK2B 3C4XA 2E5VA 3NVOA 4JI3T 3EUHA 2WWUA 5LGNB 3OTOT 4MALA 2BS2A 5ABFB 3O1JA 3C64A 4V1Av 3C98B 2YOEA 3ZCJA 3KV5A 3ANWA 2QGSA 4UEMA 2QYWA 5ABFA 1ZP0A 4ZI3D 4DR6T 2WZHA 1NAFA 1XMOT 3TLUA 5AQTB 2GK9A 4LF5T 3E22E 4IDOA 5JDFA 1VCTA 5AQKB 2XQ9A 4A56A 3I9YA 5LBMA 4ZI2C 4DR4T 4ILAA 3N9OA 2XY8B 3LK42 3NZQA 4H9RC 4PJLA 3RF1A 2H7OA 3PURA 4KHZF 2MAWA 3UUNA 4HFDA 1UGOA 4E7ZA 2UUCT 3ZN0B 1N34T 4ILBA 5CA1E 4DMVA 2KWIB 5AQFB 2Q9QC 2UU9T 4PJJA 3O1HA 4IDNA 2XAGB 3S4UA 1OXZA 3F2EA 4AKRB 3V5SA 2BS4A 3KFWX 3WI3A 3JC6D 5EK2A 4YSYA 4U2YA 2WBLA 3AEBA 2B1EA 1SA0E 4KHPT 3HA4A 4TWHA 2LEHA 3GMIA 3CIRA 4IL9A 1YKEB 4CXWA 5LGTB 4OYJA 2MBGA 2IIUA 4ZZBA 4L5GA 4KP3C 3X1DA 5EK4A 2MTQA 4F52A 3GA8A 2YKSA 3E08A 2WSSV 5HXHA 2C5IT 1T7SA 4EEBA 3MA9A 2W67A 3CVRA 3L8RA 5FY7A 5LJMA 3HKEE 4AQYT 1IBLT 2D2SA 2XQ3A 2Q9QB 2YU1A 3AB3B 4AKGA 2Q9QA 4JEHB 2LT3A 4EZHA 3N5LA 2X67A 2LOSA 2KSRA 2H7VC 2LM2A 3K8PC 3EI0A 5HCJA 4DIDB 4HWIB 3H3AA 2YU2A 2V7LA 4MHCA 5LXTE 2UXDT 3KVBA 1IBKT 5KMGP 1NENA 3UU5A 4CN6A 2H3RA 2V7JA 1LVKA 5L3GB 2EHOC 2HPJA 2V6YB 5FXXA 3UFGA 3P50A 3J9X1 2X9YA 5FXWA 4U74A 3R84B 2B76A 2V6YA 4QX7B 2CMRA 1BR0A 2W2UA 3I1AA 2X9WA 3RHWA 5HEHA 4U33A 4K0KT 1KFYA 1LDJA 2WP9A 2ACZA 3A8YC 4TUYE 2UXCT 1JNZA 4DR3T 4U2ZA 5AQSB 4YJ3E 5FL0A 4PFPA 4A97A 5JH7E 3UU3A 2E9XC 5JREA 4JI1T 3B57A 3ZN1B 3PUYF 1YQ3A 5CB4E 3CQGB 4LF6T 2EHOB 4EOZB 1J5ET 4BJNA 3LJCA 1W9RA 2N9DA 3A7MA 3H37A 5EK3A 3AVSA 2WDRA 5AQQB 2EHOA 3RYIE 3R6NA 4YTNA 4NXMT 2FJDA 4KMCA 1Y64B 4QXCB 4LMKA 1HG5A 3DQVC 5IYZE 5FNVE 3AE7A 4HWFA 4LF4T 2R6GF 5CJ5A 1I6ZA 3GWHA 5JR9C 3HI2A 4O4IE 3PUQA 3RYCE 1YD8G 4TX5A 3WAKA 2E9XB 4JI6T 2L8KA 2IC9A 5LHIB 4PJMA 2E2AA 5JDGA 2CRBA 3UQ4A 2DL1A 2E9XA 1WCRA 2JIWA 1WRDA 2OLTA 4DR1T 4YHJA 5HWXA 5HAXA 5F5WA 4EZ4A 2RPAA 5FXZA 2KT9A 3P4PA 2ZM0A 4YSXA 3AE8A 3CX6B 1EZ3A 4A64A 3UUXB 3RI5A 4K0UA 1J1JA 3MJXA 3P4RA 5AQOB 3VRBA 2JQ9A 1MMDA 1UX5A 1WYCA 2XAHB 3QNUA 2ACXA 1T98A 1U4QA 4Z90A 4HKAA 1IJ6A 4ZI2D 1KF6A 2BKNA 5ABHA 3P7IA 1KK7A 2NP9A 3KBTA 3FZFB 2WWVA 4IDPA 3PUWF 2NWBA 4GIWA 4H9OC 2C0SA 3ZSSA 1WR0A 2CE7A 2IAKA 3C4WA 1D0ZA 5ABGA 5L47A 4WYVA 1IJ5A 2Q9QD 2XAFB 3T8OA 3HKCE 4IIJE 3CWZB 2WDQA 3F57A 3QOFA 1YXRA 4LF9T 4ADZA 3DJBA 3KINB 2IMLA 3CQCB 3PU8A 3RC3A 3OYXA 2E8IA 1HX8A 5FY1A 1MMNA 4LFAT 3ONLC 2WM9A 3DTOA 4EIWA 2H88A 2BKPA 3DPLC 4GK5E 4YLHA 3VRAA 2DCFA 4AIUA 2A72A 3RC8A 2VK9A 3RYHE 2XQ4A 3A5XA 5FMNA 3AEGA 2LSYA 2ES0A 2FUPA 2VKHA 4X62T 1AJ3A 3CX7B 1E7PA 3O4XE 2CCQA 5F3JA 1D1BA 4KUMB 4QWNB 2F4VT 2X0YA 4U7YA 1D1AA 2VKOA 3RKOA 2XTLA 4DR7T 3ZC0A 2AE9A 2WMOA 3ONXA 3FXEB 1HNXT 5FP3A 2UXXB 2CWYA 4Z8XA 2VKDA 3T1YT 5LMUT 4CQIA 3Q5XA 5L3DB 4GKJT 2BG9E 2V1DB 2EHOD 2XHEB 3QUJA 2W61A 5LB7B 4L0RA 2W62A 4WQOD 3IF8B 2LRKA 1QSDA 2IHR1 3PJAJ 3VU7H 3N2GE 1E1HB 1QLBA 2ZLYA 3TLTA 2VVNA 4AKIA 3M65A 1H7CA 4PW8A 3RQUA 3SOLA 4WBNE 2PTFA 1JNRA 4EGWA 1UUSA 2E9XD 2XSAA 2SPCA 1W0AA 5HEGA 2K48A 4AKHA 4M1PA 1HF8A 5AQPB 2UUAT 2WZKA 2BZBA 3HKBE 3FZMB 4HEAA 3EDUA 2M6BA 4JI5T 1N32T 5DQVA 3ZKRA 2MOZA 3AA7B 4IL4A 3FXDB 5JDNA 2CHOA 5HEUA 3NRXA 4COFA 2CA5A 2WDVA 3NZPA 5AQVB 2LSKA 1BR1A 2KMFA 4XBFB 4TN7B 4X1YE 3C51A 2LLYA 3BQIA 2FJAA 3AAEB 3B5MA 3ZMTB 3VHLA 4ILUA 3J7Yq 3OYZA 4HWDA 4ZS2A 2C5KT 3AEDA 3C4ZA 5BR8T 2XQ6A 4DV7T 4ISSA 2ZM8A 4PFOA 4X65T 4HE8A 4H63V 2WCAA 4O4HE 1LDKB 2HN1A 3CQXC 4ISTA 1KNRA 3SRZA 4TNWA 3QB5K 1WYBA 1LDKA 3ZYKA 1M7KA 5JRCB 4ILCA 4UVAB 1Y01A 3SFDA 2VQFT 4JI4T 3ZLIA 5JRCA 4I43B 4X64T 3AEAA 3IEEA 4O2BE 4J2CA 3IBPA 2XZEA 4GOUA 1MMGA 5GONE 3AE9A 3N9LA 4X66T 2I0MA 2BG9C 4HFBA 5LOVE 2UXNB 4G63A 3BQLA 1VOMA 3ZC1A 1FIOA 2MYSA 4DV1T 1HX1B 3ZMSB 3O9XA 4PJNA 5LA6E 3OBVE 4LMLA 2J1DG 4GYSA 2WY2A 4IE6A 4N78D 3MXZA 2X68A 2VKJA 4YTPA 5L3FB 1S94A 1N33T 5M4YA 1KNPA 2IDOB 3LSVA 1D1CA 2XQ7A 5C8YE 2K24A 1MIVA 2XASB 3CK6A 2JMKA 3UU6A 3AA0B 4MBQA 3RIAA 5C3JA 4JLEA 2BG9B 5LHHB 2XM2A 3FBLA 1VCSA 2IUBA 2BG9A 1GQEA 2H89A 4QH5A 2WAUA 2N1GA 2V5CA 3MZKB 3MACA 1ZKEA 2BBHA 5AQNB 3IA3A 4OX9T 2CWOA 3I0QA 3M3ZB 4GYRA 2W00A 3P4SA 4DV2T 4O2AE 4BA9A 2NTXA 4JGHD 4WBOA 5KDMC 5CFBA 4YFSA 3P8CD 2KINB 3HKDE 4F6RC 4ZI3C 4QH4A 5J2UE 4U31A 2J47A 3AE6A 3KDSE 5JDQA 4U3CA 4P09A 2RP4A 5JTGA 1HFAA 1HG2A 3V5UA 4ZI7E 5AQHB 5C2TA 4CI3B 4IE0A 4B3TT 3ZT7A 2LKHA 5LHGB 2VL0A 3NBXX 4NXNT 2Y8DA 2A9UA 2NW7A 3PU3A 4OHFA 4WNKA 1M62A 2QA7A 3PUSA 1FMVA 2K9AA 2A2FX 1Z0PA 4X20E 3P4QA 3U78A 1X9BA 3AE3A 3KV9A 3RYFE 2V7IA 3ZPOA 4UF0B 4UV8B 4X5TA 5DJQC 2A3DA 5JR9B 3ABVA 5LBQB 1UX4A 1XWMA 4UF0A 4P0BA 4LMJA 4JUYA 4P0AA 4EV6A 2UXBT 2L3LA 2ZMAA 5JR9A 3ZMUB 3OJAA 4YT0A 4YY3T 3LG7A 4JI0T 2XM1A 3EAMA 2BDEA 3WAJA 4IT4A 3SS1A 4CZZB 4IHJE 4ZZCA 4AQGA 5LCYA 4N9F3 5CGMA 3HL6A 3KV4A 5HXEA 5H6QB 3NRYA 2Y48B 4FJOA 1XDPA 3E0ZA 1FEWA 2YEVC 1X79A 3ZJ2A 1XNQT 1O3XA 3RIUC 1OEDE 4AXPA 2C5JA 4EAHA 4X1IE 2D0UA 1XMQT 2CBIA 2XQAA 4A5XA 3JCFA 3ZJ1A 4O4LE 1QUUA 2PFVA 2P9BA 3AA6B 4PK4A 3CX8B 4WW0A 2DWGA 3IHRA 4PNIA 1LVFA 1FJGT 5HEOA 2RA1A 1YW0A 3Q5DA 1G8XA 2CM0A 1XZYA 3PV0F 2G0UA 5HWYA 5TAOA 4YTMA 3BQKA 3CPZA 5LNKA 1IAPA 4DUZT 5FY0A 2W63A 3FBZA 2YDQA 3RIUA 5HXRA 2L9QA 5AQMB 3RKGA 4PK6A 3ZEFB 2BVMA 2CXFA 4FI5A 2E5LT 2VVSA 2V26A 4CN1A 4UIGA 1I94T 2Z6EA 5L3CB 2NOXA 5JDLA 3SFEA 2CPTA 4I50E 3AECA 3N2OA 3BK9A 3Q9DA 4TV8E 2LSGA 4E7SA 2I6HA 5L3BB 4Q25A 4F8HA 4HFEA 1L0VA 3ZMVB 4H9PC 2WU5A 3W15B 1D0YA 4H63H 2NTYA 1VRBA 2D5UA 4H9NC 1UURA 1T72A 4I0UA 4DBRA 5BMVE 2HH7A 5DQWA 3N9QA 4B3RT 2OV9A 3UQ7A 1G73A 2CLYC 3TLSA 2LSIA 2VASA 4UV9B 3RRWA 3Q5WA 3MK7C 2V5DA 2BS3A 5AQJB 4DBQA 2QRXA 4ANJA 3RPUA 2LRLA 2JMHA 1HCIA 3ANWB 5E0OA 5AQUB 4CXXA 3PUVF 4A98A 3AE4A 4I55E 3EHZA 5FYMA 2FJBA 3B13A 1E2AA 4EYYR 2DHRA 4UR9A 2ZM6T 1HNWT 1J5WA 4DV6T 3TKLB 1OEDC 1HR0T 4DV0T 2NW9A 3RGLA 1YKHB 4ASKA 4EXTA 3FHNA 1BR4A 4CXYA 3F31A 4APFB 3I9WA 3AVRA 2UUBT 3UFEA 5ETWA 3D0TA 4DV3T 4JI7T 4AQFC 2CLYB 2D0TA 2X66A 3K1SA 4UVBB 3AEFA 5LMNT 3ETUA 4KBMB 4IE5A 3QK6A 2KXPB 4YJ2E 4EYUA 4OFZA 5ADXL 1LKXA 3PUXF 4DR5T 3LK3B 5HEJA 2XUEA 4JI8T 3NKZA 1XNRT 1R8IA 2VB6A 3RX6A 3ZMZB 4PAGA 1ZOYA 3QB5A 4YHHT 4QKNA 2VURA 4CN4A 2DWKA 3LBXB 3CMLA 4LFCT 3VR8A 1OEDB 4ZHQE 5AQRB 5CA0E 3H3MA 3KV6A 2PG8A 2CXLA 1N36T 4EB6E 2WS3A 3LBXA 4HXIB 5A1LA 4OYKA 2W66A 1OEDA 1U6GA 1V9DA 2V6XA 3ZCIA 2WMNA 2WZIA 4GKKT 1HS7A 1MMAA 2PJQA 2KLQA 5DABA 2KZ7B 4HFCA 5LG3A 2LHRA 3N9PA 4OK0A 3FZKB 2CEAA 3ETVA 4AQFA 4NUUA 2FBWA 1MNDA 2W0GA 1HNZT 4ZEYA 1WR6A 5AFUL 3AXJB 2X51A 4QX8B 3AE1A 3LDQB 2D9DA 4UELA 3ZYLA 3AXJA 4XZCA 1B7TA 2LJLA 2YK0A 4ERRA 2DNXA 3RH3A 4HWHA 3CKDA 5LGUB 2JQKA 3PUGA 3T1HT 4IE4A 5JDHA 4O8SA 2XAQB 2XPKA 3N2KE 3U3IA 5LG4A 1CUNA 5HXCA 3EVYA 5IHYA 1MIWA 1W09A 4UVCB 4XAXB 2M67A 2YINA 2NR4A 4P1NA 5AQIB 2WB5A 4G2AA 4LF8T 2YN6A 3NWIA 1XDOA 4HN9A 5J1GA 1BR2A 2JPFA 4HTEA 3L3PA 3VKGA 4JEUB 4BAYB 5LYJE 2IC6A 4TNVA 1IBMT 4ZXLA 1SE7A 3OVUA 3LFMA 3AAAB 4QXHB 2K3WA 4TZ4C 3KBUA 3KVAA 2LHNA 2M6IA 4H9QC 3UULA 4C91A 1YQ4A 5HYAA 3TLVA 2XU0A 2DI4A 3EABA 4DMWA 3QC9A 3JAFA 5L2LA 4EEDA 1CHUA 4KX6A 2X0HA 3N9MA 4TV9E 2N2NA 3MKDA 1Z8UA 4AISA 5L4EA 2JQQA 2QVAA 2BVLA 3UT5E 4DV5T 2KNDA 3ONJA 2ZM2A 4QH1A 5AQLB 1ZEEA 1LRZA 1KNZA 2XSBA 2X0LB 3PUAA 3JADA 1NEKA 4L9IA 4B3MT 4JBWF 4DUYT 5J2TE 2Y6XA 5ABEA 3K3NA 4DO0A 4H9SE 4X1KE 2MPKA 2LE8A 1WLXA 2LSJA 2ODVA 4HFVA 3PE0A 3K3QC 5LP6E 3RQWA 2HHHT 4YXDA 2VL8A 4TWFA 4HFHA 4HWCA 3ESLA 3FZLB 4C90A 1WFDA 3C50A 4ZS3A 2XQ5A 5KXJA 4JI2T 3ZT5A 2XQYA 1ZV4X 3ZSTA 2BBJA 5HXSA 3GN5B 2LM9A 2J4GA 3Q5EA 4TWDA 5FXVA 3JC6C 3AE2A 3GN5A 4Z91A 3I0OA 2XAJB 3JAEA 5H6RB 5KX5E 5L3EB 2VWAA 5AQGB 3G06A 5HCMA 2JRKA 2DLRA 3FB2A 4AP2B 5FVLA 4U7IA 4NPPA 3K3OA 3VKHA 1S35A 2WQYA 2VQET 2J62A 3L39A 4HGAA 2XJ7A 4B3ST 4I4TE 2HN2A 3UUMA 5FVKA 5JQGE 2AXDS 4QHOA 4QXBB 1DU2A 3Q2MA
chains in the Genus database with same CATH topology
3O1IA 3CQXC 4ISTA 5CB4E 3W15B 3SRZA 1D0YA 1US7B 3CQGB 1WYBA 4H63H 4B6XA 2NTYA 4UXNB 1VRBA 2D5UA 3ZYKA 5JRCB 2EHOB 4EOZB 4UVAB 4BJNA 3EDVA 4H9NC 3LJCA 4DBRA 5F8PA 2N9DA 5BMVE 3H37A 2HH7A 5EK3A 2LOPA 5DQWA 3ZLIA 3AVSA 3N9QA 2HPLA 5JRCA 2EHOA 2JJ9A 4I43B 3R6NA 3RYIE 3IEEA 4O2BE 4J2CA 1G73A 3IBPA 2CLYC 4AI6A 2LSIA 4KMCA 1Y64B 1MNEA 4QXCB 1NWMX 2VASA 5JDMA 4GOUA 4UV9B 1MMGA 3AA1B 5GONE 1HG5A 3RRWA 3Q5WA 3MK7C 5IYZE 3N9LA 5FNVE 4GK0E 5LOVE 4DBQA 2UXNB 4ANJA 3GWHA 3RPUA 2JMHA 1HCIA 2K5BB 4G63A 5JR9C 3ANWB 3HI2A 4O4IE 1FMWA 5E0OA 3BQLA 3PUQA 1VOMA 4MFRA 3ZC1A 4CXXA 1FIOA 2KWHA 2MYSA 3RYCE 1YD8G 1OWAA 4I55E 3ZMSB 3O9XA 4PJNA 5FYMA 5LA6E 4TX5A 3OBVE 3WAKA 2E9XB 4MLKA 3B13A 4EYYR 2DHRA 4IDZA 4DNDA 2ODUA 4O4JE 2J1DG 4GYSA 4IE7A 2L8KA 3TKLB 4IE6A 2IC9A 4N78D 3MXZA 2X68A 2VKJA 4PJMA 5LHIB 5JDGA 5L3FB 1S94A 5M4YA 2NW9A 1YKHB 2E9XA 1WRDA 4YHJA 5HWXA 5HAXA 4ASKA 2I59A 4EZ4A 1D1CA 3UTKA 3FHNA 4EXTA 2OA5A 1BR4A 5FXZA 3F31A 5C8YE 4CXYA 3I9WA 2KT9A 2K24A 1MIVA 1MIYA 3AVRA 2XASB 2ZM0A 3UFEA 2JMKA 5ETWA 3D0TA 4ZOLE 3AA0B 4MBQA 4AQFC 2CLYB 3CX6B 1EZ3A 2D0TA 3UUXB 5EZYE 1IZNB 2X66A 4UVBB 4JLEA 4K0UA 3MJXA 3ETUA 4KBMB 1MMDA 4IE5A 5LJNA 3QK6A 5LHHB 1UX5A 3HR0A 1ZHCA 1U5PA 2KXPB 1SHZC 1WYCA 4NUVA 4YJ2E 4EYUA 3FBLA 4OFZA 1LKXA 5ADXL 2XAHB 4CI2B 3LK3B 2XUEA 4DVDA 3AAIA 2ACXA 1T98A 2VB6A 3RX6A 2PBIA 1U4QA 3DP7A 3ZMZB 4PAGA 3N9NA 4HKAA 1IJ6A 3OKQA 2WAUA 4QKNA 4PK5A 2V7KA 2N1GA 2DWKA 3MZKB 3MACA 3LBXB 4ZI2D 3CMLA 2X9XA 4ZHQE 2V7MA 3PDYA 2IW5B 5CA0E 2X9HA 1ZKEA 2NW8A 3KV6A 3P7IA 2PG8A 3PTRB 2CXLA 1KK7A 2NP9A 3KBTA 3SWHA 4EB6E 2CXDA 3LBXA 5A1LA 4OYKA 2CWOA 3I0QA 2NWBA 1V9DA 4GYRA 2W00A 3ZCIA 2WMNA 1D0XA 4O2AE 3ZYMA 4BA9A 2NTXA 4GIWA 1HS7A 1MMAA 2PJQA 2C0SA 4H9OC 2CE7A 2KLQA 4WBOA 2IAKA 5DABA 3C4WA 4BJMA 1D0ZA 5KDMC 1HTJF 2KZ7B 4YFSA 1IJ5A 2LHRA 3P8CD 2Q9QD 3N9PA 2KINB 2XAFB 4OK0A 5JVDE 3T8OA 3HKCE 4CI1B 2CEAA 3ETVA 4IIJE 3HKDE 4AQFA 3CWZB 4NUUA 4ZI3C 4AKLA 3F57A 4F6RC 5J2UE 1MNDA 2W0GA 3L09A 4IGUA 3RRCA 3KDSE 4U72A 1UCUA 1WR6A 5AFUL 3LK2B 3C4XA 4ADZA 5JDQA 3DJBA 4P09A 2RP4A 3KINB 1HFAA 3CQCB 3PU8A 2X51A 3EUHA 1HG2A 2WWUA 3V5UA 4QX8B 3RC3A 5LGNB 4ZI7E 3OYXA 4MALA 2E8IA 3O1JA 3C64A 4V1Av 3C98B 3ZCJA 1HX8A 4UELA 3ZYLA 4CI3B 4XZCA 4IE0A 5FY1A 1B7TA 1MMNA 2LJLA 3KV5A 2YK0A 3ANWA 5LHGB 4ERRA 2DNXA 3RH3A 2WM9A 3CKDA 3DTOA 5LGUB 4EIWA 2QGSA 3PUGA 4UEMA 3NBXX 2Y8DA 2NW7A 4IE4A 4ZI3D 3PU3A 4OHFA 5JDHA 4O8SA 2XAQB 4WNKA 3N2KE 3U3IA 1NAFA 5LG4A 3Q2MA 1CUNA 5HXCA 4GK5E 4YLHA 2DCFA 3EVYA 3PUSA 5IHYA 1FMVA 1MIWA 2A72A 2K9AA 2GK9A 2A2FX 3RC8A 4UVCB 1Z0PA 4X20E 2VK9A 2M67A 3E22E 4XAXB 5JDFA 3RYHE 3A5XA 2YINA 5FMNA 3U78A 2LSYA 2ES0A 4A56A 2VKHA 3I9YA 1AJ3A 3CX7B 3KV9A 4G2AA 5LBMA 3RYFE 4ZI2C 2V7IA 4HN9A 3O4XE 5J1GA 2CCQA 5F3JA 3ZPOA 3N9OA 1BR2A 1D1BA 4KUMB 2JPFA 4UF0B 3LK42 3NZQA 4UV8B 4H9RC 4PJLA 4QWNB 5DJQC 2A3DA 5JR9B 4HTEA 2H7OA 3PURA 1D1AA 3L3PA 2VKOA 3RKOA 2XTLA 5LBQB 3VKGA 1UX4A 4UF0A 3ZC0A 4P0BA 4JUYA 4P0AA 4JEUB 2WMOA 3UUNA 3ONXA 3FXEB 4BAYB 2L3LA 5LYJE 2ZMAA 5JR9A 4E7ZA 3ZMUB 5FP3A 2UXXB 3ZN0B 2CWYA 3OJAA 2IC6A 5CA1E 4DMVA 2KWIB 2Q9QC 3LG7A 4PJJA 3O1HA 2XAGB 4Z8XA 3S4UA 2VKDA 1OXZA 3LFMA 3AAAB 4QXHB 4CQIA 3F2EA 4AKRB 2BDEA 3V5SA 3WAJA 3Q5XA 5L3DB 3KFWX 2V1DB 2EHOD 3WI3A 3SS1A 4TZ4C 4CZZB 4IHJE 2XHEB 3JC6D 3KBUA 3QUJA 4AQGA 3KVAA 5EK2A 5LCYA 2LHNA 2W61A 2WBLA 4L0RA 2B1EA 2W62A 1SA0E 3HL6A 3KV4A 5HXEA 3IF8B 1QSDA 3HA4A 4H9QC 5H6QB 3NRYA 2LEHA 2Y48B 3GMIA 3UULA 1YKEB 4FJOA 4CXWA 4C91A 5LGTB 5HYAA 2XU0A 3VU7H 3E0ZA 2DI4A 1FEWA 3N2GE 1E1HB 4OYJA 2ZLYA 2MBGA 4DMWA 2YEVC 3QC9A 4L5GA 5L2LA 4KP3C 1X79A 3ZJ2A 5EK4A 2MTQA 1O3XA 3GA8A 3M65A 4AKIA 1H7CA 4AXPA 3N9MA 4TV9E 4PW8A 2N2NA 2WSSV 3E08A 3MKDA 5HXHA 2C5JA 4EAHA 4X1IE 2D0UA 2JQQA 2C5IT 3SOLA 2BVLA 3UT5E 4WBNE 2KNDA 2ZM2A 3MA9A 3CVRA 1ZEEA 5FY7A 5LJMA 1LRZA 3HKEE 2D2SA 1KNZA 2E9XD 3ZJ1A 2SPCA 2X0LB 3PUAA 2K48A 4O4LE 2Q9QB 4AKHA 2YU1A 1QUUA 3AB3B 4L9IA 4M1PA 1HF8A 2PFVA 4AKGA 2P9BA 2BZBA 5J2TE 2Y6XA 3K3NA 4DO0A 4H9SE 3AA6B 4X1KE 2LE8A 4PK4A 3HKBE 3CX8B 2Q9QA 4JEHB 4WW0A 1WLXA 2LT3A 3N5LA 4EZHA 2LSJA 2ODVA 2X67A 4HFVA 4HEAA 2LOSA 2DWGA 2H7VC 3IHRA 3K8PC 3PE0A 3K3QC 4PNIA 5LP6E 3EDUA 5DQVA 1LVFA 2VL8A 2RA1A 1YW0A 2MOZA 3H3AA 1G8XA 3ESLA 2YU2A 2V7LA 3C50A 4C90A 4MHCA 4ZS3A 3AA7B 2CM0A 3FXDB 5JDNA 2XQYA 5LXTE 1ZV4X 2G0UA 5HWYA 3NRXA 5TAOA 3KVBA 2CA5A 3BQKA 3CPZA 5LNKA 5KMGP 5HXSA 3GN5B 3NZPA 1IAPA 2LM9A 2LSKA 1BR1A 2H3RA 2V7JA 1LVKA 5FXVA 5L3GB 2KMFA 5FY0A 2EHOC 4XBFB 2W63A 3FBZA 2HPJA 3JC6C 4TN7B 3C51A 4X1YE 3GN5A 5FXXA 5HXRA 3BQIA 2L9QA 4PK6A 3ZEFB 3AAEB 2BVMA 2CXFA 4FI5A 3J9X1 3VHLA 3ZMTB 2X9YA 2V26A 3I0OA 5FXWA 4ILUA 4U74A 2XAJB 3R84B 3J7Yq 3OYZA 5H6RB 4ZS2A 4QX7B 2C5KT 2CMRA 5KX5E 1BR0A 4UIGA 2Z6EA 5L3EB 3C4ZA 2VWAA 3I1AA 5L3CB 2X9WA 2NOXA 5JDLA 2JRKA 2ZM8A 4ISSA 2DLRA 3FB2A 4I50E 3N2OA 4TUYE 3BK9A 4PFOA 3K3OA 3Q9DA 4TV8E 3VKHA 1S35A 4HE8A 4YJ3E 2LSGA 4E7SA 4H63V 5L3BB 4HGAA 4PFPA 5JH7E 4I4TE 3UUMA 2E9XC 5JQGE 5JREA 4QHOA 3B57A 3ZN1B 4O4HE 3ZMVB 4QXBB 2QA7A 4H9PC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CML A;  2YK0 A;  4YFS A;  5F3J A;  3BQL A;  3BQI A;  2Y8D A;  3CPZ A;  3C64 A;  4NUU A;  3RRC A;  2XU0 A;  4NUV A;  3BQK A;  2WAU A; 
#chains in the Genus database with same CATH topology
 3O1I A;  4WZX A;  2BKO A;  4YSZ A;  2XQ8 A;  1US7 B;  4B6X A;  4NIQ A;  4UXN B;  3TLW A;  3ZT6 A;  3AE5 A;  3EDV A;  3UU4 A;  5F8P A;  2LOP A;  2HPL A;  2JJ9 A;  2WU2 A;  2FJE A;  5FL1 A;  1W0B A;  4AI6 A;  1MNE A;  1NWM X;  5JDM A;  5IUX A;  3AA1 B;  4GK0 E;  2K5B B;  4LFB T;  1FMW A;  4LF7 T;  4MFR A;  5L4H A;  2KWH A;  4JYA T;  3UUB A;  1OWA A;  3AEE A;  4MLK A;  4IDZ A;  4DND A;  2ODU A;  3PUZ F;  4O4J E;  4IE7 A;  3VR9 A;  4IDQ A;  4DR2 T;  3P4W A;  2I59 A;  3UTK A;  2CHN A;  2LKG A;  2OA5 A;  1MIY A;  3OPC A;  4ZOL E;  2V8S V;  5EZY E;  1IZN B;  2W4X A;  3RLF F;  3PJA A;  5LJN A;  3HR0 A;  2YDS A;  1ZHC A;  1U5P A;  2YDR A;  1SHZ C;  4NUV A;  4CI2 B;  5IWA T;  4DVD A;  3AAI A;  2PBI A;  3DP7 A;  3RTR A;  3N9N A;  5FKY A;  3OKQ A;  3RIF A;  4PK5 A;  2V7K A;  3UU8 A;  1KEY A;  1T8B A;  4IRE A;  2X9X A;  1UK5 A;  2V7M A;  4KI0 F;  3PDY A;  2IW5 B;  2X9H A;  2CBJ A;  5J0Z A;  2NW8 A;  3PTR B;  4DV4 T;  3SWH A;  2CXD A;  3FZH B;  1D0X A;  3ZYM A;  4P5O A;  4HFI A;  4BJM A;  1HTJ F;  2JQH A;  1SUM B;  5JVD E;  4CI1 B;  4JV5 T;  4AKL A;  3L09 A;  4IGU A;  3RRC A;  4U72 A;  1UCU A;  3LK2 B;  3C4X A;  2E5V A;  3NVO A;  4JI3 T;  3EUH A;  2WWU A;  5LGN B;  3OTO T;  4MAL A;  2BS2 A;  5ABF B;  3O1J A;  3C64 A;  4V1A v;  3C98 B;  2YOE A;  3ZCJ A;  3KV5 A;  3ANW A;  2QGS A;  4UEM A;  2QYW A;  5ABF A;  1ZP0 A;  4ZI3 D;  4DR6 T;  2WZH A;  1NAF A;  1XMO T;  3TLU A;  5AQT B;  2GK9 A;  4LF5 T;  3E22 E;  4IDO A;  5JDF A;  1VCT A;  5AQK B;  2XQ9 A;  4A56 A;  3I9Y A;  5LBM A;  4ZI2 C;  4DR4 T;  4ILA A;  3N9O A;  2XY8 B;  3LK4 2;  3NZQ A;  4H9R C;  4PJL A;  3RF1 A;  2H7O A;  3PUR A;  4KHZ F;  2MAW A;  3UUN A;  4HFD A;  1UGO A;  4E7Z A;  2UUC T;  3ZN0 B;  1N34 T;  4ILB A;  5CA1 E;  4DMV A;  2KWI B;  5AQF B;  2Q9Q C;  2UU9 T;  4PJJ A;  3O1H A;  4IDN A;  2XAG B;  3S4U A;  1OXZ A;  3F2E A;  4AKR B;  3V5S A;  2BS4 A;  3KFW X;  3WI3 A;  3JC6 D;  5EK2 A;  4YSY A;  4U2Y A;  2WBL A;  3AEB A;  2B1E A;  1SA0 E;  4KHP T;  3HA4 A;  4TWH A;  2LEH A;  3GMI A;  3CIR A;  4IL9 A;  1YKE B;  4CXW A;  5LGT B;  4OYJ A;  2MBG A;  2IIU A;  4ZZB A;  4L5G A;  4KP3 C;  3X1D A;  5EK4 A;  2MTQ A;  4F52 A;  3GA8 A;  2YKS A;  3E08 A;  2WSS V;  5HXH A;  2C5I T;  1T7S A;  4EEB A;  3MA9 A;  2W67 A;  3CVR A;  3L8R A;  5FY7 A;  5LJM A;  3HKE E;  4AQY T;  1IBL T;  2D2S A;  2XQ3 A;  2Q9Q B;  2YU1 A;  3AB3 B;  4AKG A;  2Q9Q A;  4JEH B;  2LT3 A;  4EZH A;  3N5L A;  2X67 A;  2LOS A;  2KSR A;  2H7V C;  2LM2 A;  3K8P C;  3EI0 A;  5HCJ A;  4DID B;  4HWI B;  3H3A A;  2YU2 A;  2V7L A;  4MHC A;  5LXT E;  2UXD T;  3KVB A;  1IBK T;  5KMG P;  1NEN A;  3UU5 A;  4CN6 A;  2H3R A;  2V7J A;  1LVK A;  5L3G B;  2EHO C;  2HPJ A;  2V6Y B;  5FXX A;  3UFG A;  3P50 A;  3J9X 1;  2X9Y A;  5FXW A;  4U74 A;  3R84 B;  2B76 A;  2V6Y A;  4QX7 B;  2CMR A;  1BR0 A;  2W2U A;  3I1A A;  2X9W A;  3RHW A;  5HEH A;  4U33 A;  4K0K T;  1KFY A;  1LDJ A;  2WP9 A;  2ACZ A;  3A8Y C;  4TUY E;  2UXC T;  1JNZ A;  4DR3 T;  4U2Z A;  5AQS B;  4YJ3 E;  5FL0 A;  4PFP A;  4A97 A;  5JH7 E;  3UU3 A;  2E9X C;  5JRE A;  4JI1 T;  3B57 A;  3ZN1 B;  3PUY F;  1YQ3 A;  5CB4 E;  3CQG B;  4LF6 T;  2EHO B;  4EOZ B;  1J5E T;  4BJN A;  3LJC A;  1W9R A;  2N9D A;  3A7M A;  3H37 A;  5EK3 A;  3AVS A;  2WDR A;  5AQQ B;  2EHO A;  3RYI E;  3R6N A;  4YTN A;  4NXM T;  2FJD A;  4KMC A;  1Y64 B;  4QXC B;  4LMK A;  1HG5 A;  3DQV C;  5IYZ E;  5FNV E;  3AE7 A;  4HWF A;  4LF4 T;  2R6G F;  5CJ5 A;  1I6Z A;  3GWH A;  5JR9 C;  3HI2 A;  4O4I E;  3PUQ A;  3RYC E;  1YD8 G;  4TX5 A;  3WAK A;  2E9X B;  4JI6 T;  2L8K A;  2IC9 A;  5LHI B;  4PJM A;  2E2A A;  5JDG A;  2CRB A;  3UQ4 A;  2DL1 A;  2E9X A;  1WCR A;  2JIW A;  1WRD A;  2OLT A;  4DR1 T;  4YHJ A;  5HWX A;  5HAX A;  5F5W A;  4EZ4 A;  2RPA A;  5FXZ A;  2KT9 A;  3P4P A;  2ZM0 A;  4YSX A;  3AE8 A;  3CX6 B;  1EZ3 A;  4A64 A;  3UUX B;  3RI5 A;  4K0U A;  1J1J A;  3MJX A;  3P4R A;  5AQO B;  3VRB A;  2JQ9 A;  1MMD A;  1UX5 A;  1WYC A;  2XAH B;  3QNU A;  2ACX A;  1T98 A;  1U4Q A;  4Z90 A;  4HKA A;  1IJ6 A;  4ZI2 D;  1KF6 A;  2BKN A;  5ABH A;  3P7I A;  1KK7 A;  2NP9 A;  3KBT A;  3FZF B;  2WWV A;  4IDP A;  3PUW F;  2NWB A;  4GIW A;  4H9O C;  2C0S A;  3ZSS A;  1WR0 A;  2CE7 A;  2IAK A;  3C4W A;  1D0Z A;  5ABG A;  5L47 A;  4WYV A;  1IJ5 A;  2Q9Q D;  2XAF B;  3T8O A;  3HKC E;  4IIJ E;  3CWZ B;  2WDQ A;  3F57 A;  3QOF A;  1YXR A;  4LF9 T;  4ADZ A;  3DJB A;  3KIN B;  2IML A;  3CQC B;  3PU8 A;  3RC3 A;  3OYX A;  2E8I A;  1HX8 A;  5FY1 A;  1MMN A;  4LFA T;  3ONL C;  2WM9 A;  3DTO A;  4EIW A;  2H88 A;  2BKP A;  3DPL C;  4GK5 E;  4YLH A;  3VRA A;  2DCF A;  4AIU A;  2A72 A;  3RC8 A;  2VK9 A;  3RYH E;  2XQ4 A;  3A5X A;  5FMN A;  3AEG A;  2LSY A;  2ES0 A;  2FUP A;  2VKH A;  4X62 T;  1AJ3 A;  3CX7 B;  1E7P A;  3O4X E;  2CCQ A;  5F3J A;  1D1B A;  4KUM B;  4QWN B;  2F4V T;  2X0Y A;  4U7Y A;  1D1A A;  2VKO A;  3RKO A;  2XTL A;  4DR7 T;  3ZC0 A;  2AE9 A;  2WMO A;  3ONX A;  3FXE B;  1HNX T;  5FP3 A;  2UXX B;  2CWY A;  4Z8X A;  2VKD A;  3T1Y T;  5LMU T;  4CQI A;  3Q5X A;  5L3D B;  4GKJ T;  2BG9 E;  2V1D B;  2EHO D;  2XHE B;  3QUJ A;  2W61 A;  5LB7 B;  4L0R A;  2W62 A;  4WQO D;  3IF8 B;  2LRK A;  1QSD A;  2IHR 1;  3PJA J;  3VU7 H;  3N2G E;  1E1H B;  1QLB A;  2ZLY A;  3TLT A;  2VVN A;  4AKI A;  3M65 A;  1H7C A;  4PW8 A;  3RQU A;  3SOL A;  4WBN E;  2PTF A;  1JNR A;  4EGW A;  1UUS A;  2E9X D;  2XSA A;  2SPC A;  1W0A A;  5HEG A;  2K48 A;  4AKH A;  4M1P A;  1HF8 A;  5AQP B;  2UUA T;  2WZK A;  2BZB A;  3HKB E;  3FZM B;  4HEA A;  3EDU A;  2M6B A;  4JI5 T;  1N32 T;  5DQV A;  3ZKR A;  2MOZ A;  3AA7 B;  4IL4 A;  3FXD B;  5JDN A;  2CHO A;  5HEU A;  3NRX A;  4COF A;  2CA5 A;  2WDV A;  3NZP A;  5AQV B;  2LSK A;  1BR1 A;  2KMF A;  4XBF B;  4TN7 B;  4X1Y E;  3C51 A;  2LLY A;  3BQI A;  2FJA A;  3AAE B;  3B5M A;  3ZMT B;  3VHL A;  4ILU A;  3J7Y q;  3OYZ A;  4HWD A;  4ZS2 A;  2C5K T;  3AED A;  3C4Z A;  5BR8 T;  2XQ6 A;  4DV7 T;  4ISS A;  2ZM8 A;  4PFO A;  4X65 T;  4HE8 A;  4H63 V;  2WCA A;  4O4H E;  1LDK B;  2HN1 A;  3CQX C;  4IST A;  1KNR A;  3SRZ A;  4TNW A;  3QB5 K;  1WYB A;  1LDK A;  3ZYK A;  1M7K A;  5JRC B;  4ILC A;  4UVA B;  1Y01 A;  3SFD A;  2VQF T;  4JI4 T;  3ZLI A;  5JRC A;  4I43 B;  4X64 T;  3AEA A;  3IEE A;  4O2B E;  4J2C A;  3IBP A;  2XZE A;  4GOU A;  1MMG A;  5GON E;  3AE9 A;  3N9L A;  4X66 T;  2I0M A;  2BG9 C;  4HFB A;  5LOV E;  2UXN B;  4G63 A;  3BQL A;  1VOM A;  3ZC1 A;  1FIO A;  2MYS A;  4DV1 T;  1HX1 B;  3ZMS B;  3O9X A;  4PJN A;  5LA6 E;  3OBV E;  4LML A;  2J1D G;  4GYS A;  2WY2 A;  4IE6 A;  4N78 D;  3MXZ A;  2X68 A;  2VKJ A;  4YTP A;  5L3F B;  1S94 A;  1N33 T;  5M4Y A;  1KNP A;  2IDO B;  3LSV A;  1D1C A;  2XQ7 A;  5C8Y E;  2K24 A;  1MIV A;  2XAS B;  3CK6 A;  2JMK A;  3UU6 A;  3AA0 B;  4MBQ A;  3RIA A;  5C3J A;  4JLE A;  2BG9 B;  5LHH B;  2XM2 A;  3FBL A;  1VCS A;  2IUB A;  2BG9 A;  1GQE A;  2H89 A;  4QH5 A;  2WAU A;  2N1G A;  2V5C A;  3MZK B;  3MAC A;  1ZKE A;  2BBH A;  5AQN B;  3IA3 A;  4OX9 T;  2CWO A;  3I0Q A;  3M3Z B;  4GYR A;  2W00 A;  3P4S A;  4DV2 T;  4O2A E;  4BA9 A;  2NTX A;  4JGH D;  4WBO A;  5KDM C;  5CFB A;  4YFS A;  3P8C D;  2KIN B;  3HKD E;  4F6R C;  4ZI3 C;  4QH4 A;  5J2U E;  4U31 A;  2J47 A;  3AE6 A;  3KDS E;  5JDQ A;  4U3C A;  4P09 A;  2RP4 A;  5JTG A;  1HFA A;  1HG2 A;  3V5U A;  4ZI7 E;  5AQH B;  5C2T A;  4CI3 B;  4IE0 A;  4B3T T;  3ZT7 A;  2LKH A;  5LHG B;  2VL0 A;  3NBX X;  4NXN T;  2Y8D A;  2A9U A;  2NW7 A;  3PU3 A;  4OHF A;  4WNK A;  1M62 A;  2QA7 A;  3PUS A;  1FMV A;  2K9A A;  2A2F X;  1Z0P A;  4X20 E;  3P4Q A;  3U78 A;  1X9B A;  3AE3 A;  3KV9 A;  3RYF E;  2V7I A;  3ZPO A;  4UF0 B;  4UV8 B;  4X5T A;  5DJQ C;  2A3D A;  5JR9 B;  3ABV A;  5LBQ B;  1UX4 A;  1XWM A;  4UF0 A;  4P0B A;  4LMJ A;  4JUY A;  4P0A A;  4EV6 A;  2UXB T;  2L3L A;  2ZMA A;  5JR9 A;  3ZMU B;  3OJA A;  4YT0 A;  4YY3 T;  3LG7 A;  4JI0 T;  2XM1 A;  3EAM A;  2BDE A;  3WAJ A;  4IT4 A;  3SS1 A;  4CZZ B;  4IHJ E;  4ZZC A;  4AQG A;  5LCY A;  4N9F 3;  5CGM A;  3HL6 A;  3KV4 A;  5HXE A;  5H6Q B;  3NRY A;  2Y48 B;  4FJO A;  1XDP A;  3E0Z A;  1FEW A;  2YEV C;  1X79 A;  3ZJ2 A;  1XNQ T;  1O3X A;  3RIU C;  1OED E;  4AXP A;  2C5J A;  4EAH A;  4X1I E;  2D0U A;  1XMQ T;  2CBI A;  2XQA A;  4A5X A;  3JCF A;  3ZJ1 A;  4O4L E;  1QUU A;  2PFV A;  2P9B A;  3AA6 B;  4PK4 A;  3CX8 B;  4WW0 A;  2DWG A;  3IHR A;  4PNI A;  1LVF A;  1FJG T;  5HEO A;  2RA1 A;  1YW0 A;  3Q5D A;  1G8X A;  2CM0 A;  1XZY A;  3PV0 F;  2G0U A;  5HWY A;  5TAO A;  4YTM A;  3BQK A;  3CPZ A;  5LNK A;  1IAP A;  4DUZ T;  5FY0 A;  2W63 A;  3FBZ A;  2YDQ A;  3RIU A;  5HXR A;  2L9Q A;  5AQM B;  3RKG A;  4PK6 A;  3ZEF B;  2BVM A;  2CXF A;  4FI5 A;  2E5L T;  2VVS A;  2V26 A;  4CN1 A;  4UIG A;  1I94 T;  2Z6E A;  5L3C B;  2NOX A;  5JDL A;  3SFE A;  2CPT A;  4I50 E;  3AEC A;  3N2O A;  3BK9 A;  3Q9D A;  4TV8 E;  2LSG A;  4E7S A;  2I6H A;  5L3B B;  4Q25 A;  4F8H A;  4HFE A;  1L0V A;  3ZMV B;  4H9P C;  2WU5 A;  3W15 B;  1D0Y A;  4H63 H;  2NTY A;  1VRB A;  2D5U A;  4H9N C;  1UUR A;  1T72 A;  4I0U A;  4DBR A;  5BMV E;  2HH7 A;  5DQW A;  3N9Q A;  4B3R T;  2OV9 A;  3UQ7 A;  1G73 A;  2CLY C;  3TLS A;  2LSI A;  2VAS A;  4UV9 B;  3RRW A;  3Q5W A;  3MK7 C;  2V5D A;  2BS3 A;  5AQJ B;  4DBQ A;  2QRX A;  4ANJ A;  3RPU A;  2LRL A;  2JMH A;  1HCI A;  3ANW B;  5E0O A;  5AQU B;  4CXX A;  3PUV F;  4A98 A;  3AE4 A;  4I55 E;  3EHZ A;  5FYM A;  2FJB A;  3B13 A;  1E2A A;  4EYY R;  2DHR A;  4UR9 A;  2ZM6 T;  1HNW T;  1J5W A;  4DV6 T;  3TKL B;  1OED C;  1HR0 T;  4DV0 T;  2NW9 A;  3RGL A;  1YKH B;  4ASK A;  4EXT A;  3FHN A;  1BR4 A;  4CXY A;  3F31 A;  4APF B;  3I9W A;  3AVR A;  2UUB T;  3UFE A;  5ETW A;  3D0T A;  4DV3 T;  4JI7 T;  4AQF C;  2CLY B;  2D0T A;  2X66 A;  3K1S A;  4UVB B;  3AEF A;  5LMN T;  3ETU A;  4KBM B;  4IE5 A;  3QK6 A;  2KXP B;  4YJ2 E;  4EYU A;  4OFZ A;  5ADX L;  1LKX A;  3PUX F;  4DR5 T;  3LK3 B;  5HEJ A;  2XUE A;  4JI8 T;  3NKZ A;  1XNR T;  1R8I A;  2VB6 A;  3RX6 A;  3ZMZ B;  4PAG A;  1ZOY A;  3QB5 A;  4YHH T;  4QKN A;  2VUR A;  4CN4 A;  2DWK A;  3LBX B;  3CML A;  4LFC T;  3VR8 A;  1OED B;  4ZHQ E;  5AQR B;  5CA0 E;  3H3M A;  3KV6 A;  2PG8 A;  2CXL A;  1N36 T;  4EB6 E;  2WS3 A;  3LBX A;  4HXI B;  5A1L A;  4OYK A;  2W66 A;  1OED A;  1U6G A;  1V9D A;  2V6X A;  3ZCI A;  2WMN A;  2WZI A;  4GKK T;  1HS7 A;  1MMA A;  2PJQ A;  2KLQ A;  5DAB A;  2KZ7 B;  4HFC A;  5LG3 A;  2LHR A;  3N9P A;  4OK0 A;  3FZK B;  2CEA A;  3ETV A;  4AQF A;  4NUU A;  2FBW A;  1MND A;  2W0G A;  1HNZ T;  4ZEY A;  1WR6 A;  5AFU L;  3AXJ B;  2X51 A;  4QX8 B;  3AE1 A;  3LDQ B;  2D9D A;  4UEL A;  3ZYL A;  3AXJ A;  4XZC A;  1B7T A;  2LJL A;  2YK0 A;  4ERR A;  2DNX A;  3RH3 A;  4HWH A;  3CKD A;  5LGU B;  2JQK A;  3PUG A;  3T1H T;  4IE4 A;  5JDH A;  4O8S A;  2XAQ B;  2XPK A;  3N2K E;  3U3I A;  5LG4 A;  1CUN A;  5HXC A;  3EVY A;  5IHY A;  1MIW A;  1W09 A;  4UVC B;  4XAX B;  2M67 A;  2YIN A;  2NR4 A;  4P1N A;  5AQI B;  2WB5 A;  4G2A A;  4LF8 T;  2YN6 A;  3NWI A;  1XDO A;  4HN9 A;  5J1G A;  1BR2 A;  2JPF A;  4HTE A;  3L3P A;  3VKG A;  4JEU B;  4BAY B;  5LYJ E;  2IC6 A;  4TNV A;  1IBM T;  4ZXL A;  1SE7 A;  3OVU A;  3LFM A;  3AAA B;  4QXH B;  2K3W A;  4TZ4 C;  3KBU A;  3KVA A;  2LHN A;  2M6I A;  4H9Q C;  3UUL A;  4C91 A;  1YQ4 A;  5HYA A;  3TLV A;  2XU0 A;  2DI4 A;  3EAB A;  4DMW A;  3QC9 A;  3JAF A;  5L2L A;  4EED A;  1CHU A;  4KX6 A;  2X0H A;  3N9M A;  4TV9 E;  2N2N A;  3MKD A;  1Z8U A;  4AIS A;  5L4E A;  2JQQ A;  2QVA A;  2BVL A;  3UT5 E;  4DV5 T;  2KND A;  3ONJ A;  2ZM2 A;  4QH1 A;  5AQL B;  1ZEE A;  1LRZ A;  1KNZ A;  2XSB A;  2X0L B;  3PUA A;  3JAD A;  1NEK A;  4L9I A;  4B3M T;  4JBW F;  4DUY T;  5J2T E;  2Y6X A;  5ABE A;  3K3N A;  4DO0 A;  4H9S E;  4X1K E;  2MPK A;  2LE8 A;  1WLX A;  2LSJ A;  2ODV A;  4HFV A;  3PE0 A;  3K3Q C;  5LP6 E;  3RQW A;  2HHH T;  4YXD A;  2VL8 A;  4TWF A;  4HFH A;  4HWC A;  3ESL A;  3FZL B;  4C90 A;  1WFD A;  3C50 A;  4ZS3 A;  2XQ5 A;  5KXJ A;  4JI2 T;  3ZT5 A;  2XQY A;  1ZV4 X;  3ZST A;  2BBJ A;  5HXS A;  3GN5 B;  2LM9 A;  2J4G A;  3Q5E A;  4TWD A;  5FXV A;  3JC6 C;  3AE2 A;  3GN5 A;  4Z91 A;  3I0O A;  2XAJ B;  3JAE A;  5H6R B;  5KX5 E;  5L3E B;  2VWA A;  5AQG B;  3G06 A;  5HCM A;  2JRK A;  2DLR A;  3FB2 A;  4AP2 B;  5FVL A;  4U7I A;  4NPP A;  3K3O A;  3VKH A;  1S35 A;  2WQY A;  2VQE T;  2J62 A;  3L39 A;  4HGA A;  2XJ7 A;  4B3S T;  4I4T E;  2HN2 A;  3UUM A;  5FVK A;  5JQG E;  2AXD S;  4QHO A;  4QXB B;  1DU2 A;  3Q2M A; 
#chains in the Genus database with same CATH homology
 3O1I A;  3CQX C;  4IST A;  5CB4 E;  3W15 B;  3SRZ A;  1D0Y A;  1US7 B;  3CQG B;  1WYB A;  4H63 H;  4B6X A;  2NTY A;  4UXN B;  1VRB A;  2D5U A;  3ZYK A;  5JRC B;  2EHO B;  4EOZ B;  4UVA B;  4BJN A;  3EDV A;  4H9N C;  3LJC A;  4DBR A;  5F8P A;  2N9D A;  5BMV E;  3H37 A;  2HH7 A;  5EK3 A;  2LOP A;  5DQW A;  3ZLI A;  3AVS A;  3N9Q A;  2HPL A;  5JRC A;  2EHO A;  2JJ9 A;  4I43 B;  3R6N A;  3RYI E;  3IEE A;  4O2B E;  4J2C A;  1G73 A;  3IBP A;  2CLY C;  4AI6 A;  2LSI A;  4KMC A;  1Y64 B;  1MNE A;  4QXC B;  1NWM X;  2VAS A;  5JDM A;  4GOU A;  4UV9 B;  1MMG A;  3AA1 B;  5GON E;  1HG5 A;  3RRW A;  3Q5W A;  3MK7 C;  5IYZ E;  3N9L A;  5FNV E;  4GK0 E;  5LOV E;  4DBQ A;  2UXN B;  4ANJ A;  3GWH A;  3RPU A;  2JMH A;  1HCI A;  2K5B B;  4G63 A;  5JR9 C;  3ANW B;  3HI2 A;  4O4I E;  1FMW A;  5E0O A;  3BQL A;  3PUQ A;  1VOM A;  4MFR A;  3ZC1 A;  4CXX A;  1FIO A;  2KWH A;  2MYS A;  3RYC E;  1YD8 G;  1OWA A;  4I55 E;  3ZMS B;  3O9X A;  4PJN A;  5FYM A;  5LA6 E;  4TX5 A;  3OBV E;  3WAK A;  2E9X B;  4MLK A;  3B13 A;  4EYY R;  2DHR A;  4IDZ A;  4DND A;  2ODU A;  4O4J E;  2J1D G;  4GYS A;  4IE7 A;  2L8K A;  3TKL B;  4IE6 A;  2IC9 A;  4N78 D;  3MXZ A;  2X68 A;  2VKJ A;  4PJM A;  5LHI B;  5JDG A;  5L3F B;  1S94 A;  5M4Y A;  2NW9 A;  1YKH B;  2E9X A;  1WRD A;  4YHJ A;  5HWX A;  5HAX A;  4ASK A;  2I59 A;  4EZ4 A;  1D1C A;  3UTK A;  3FHN A;  4EXT A;  2OA5 A;  1BR4 A;  5FXZ A;  3F31 A;  5C8Y E;  4CXY A;  3I9W A;  2KT9 A;  2K24 A;  1MIV A;  1MIY A;  3AVR A;  2XAS B;  2ZM0 A;  3UFE A;  2JMK A;  5ETW A;  3D0T A;  4ZOL E;  3AA0 B;  4MBQ A;  4AQF C;  2CLY B;  3CX6 B;  1EZ3 A;  2D0T A;  3UUX B;  5EZY E;  1IZN B;  2X66 A;  4UVB B;  4JLE A;  4K0U A;  3MJX A;  3ETU A;  4KBM B;  1MMD A;  4IE5 A;  5LJN A;  3QK6 A;  5LHH B;  1UX5 A;  3HR0 A;  1ZHC A;  1U5P A;  2KXP B;  1SHZ C;  1WYC A;  4NUV A;  4YJ2 E;  4EYU A;  3FBL A;  4OFZ A;  1LKX A;  5ADX L;  2XAH B;  4CI2 B;  3LK3 B;  2XUE A;  4DVD A;  3AAI A;  2ACX A;  1T98 A;  2VB6 A;  3RX6 A;  2PBI A;  1U4Q A;  3DP7 A;  3ZMZ B;  4PAG A;  3N9N A;  4HKA A;  1IJ6 A;  3OKQ A;  2WAU A;  4QKN A;  4PK5 A;  2V7K A;  2N1G A;  2DWK A;  3MZK B;  3MAC A;  3LBX B;  4ZI2 D;  3CML A;  2X9X A;  4ZHQ E;  2V7M A;  3PDY A;  2IW5 B;  5CA0 E;  2X9H A;  1ZKE A;  2NW8 A;  3KV6 A;  3P7I A;  2PG8 A;  3PTR B;  2CXL A;  1KK7 A;  2NP9 A;  3KBT A;  3SWH A;  4EB6 E;  2CXD A;  3LBX A;  5A1L A;  4OYK A;  2CWO A;  3I0Q A;  2NWB A;  1V9D A;  4GYR A;  2W00 A;  3ZCI A;  2WMN A;  1D0X A;  4O2A E;  3ZYM A;  4BA9 A;  2NTX A;  4GIW A;  1HS7 A;  1MMA A;  2PJQ A;  2C0S A;  4H9O C;  2CE7 A;  2KLQ A;  4WBO A;  2IAK A;  5DAB A;  3C4W A;  4BJM A;  1D0Z A;  5KDM C;  1HTJ F;  2KZ7 B;  4YFS A;  1IJ5 A;  2LHR A;  3P8C D;  2Q9Q D;  3N9P A;  2KIN B;  2XAF B;  4OK0 A;  5JVD E;  3T8O A;  3HKC E;  4CI1 B;  2CEA A;  3ETV A;  4IIJ E;  3HKD E;  4AQF A;  3CWZ B;  4NUU A;  4ZI3 C;  4AKL A;  3F57 A;  4F6R C;  5J2U E;  1MND A;  2W0G A;  3L09 A;  4IGU A;  3RRC A;  3KDS E;  4U72 A;  1UCU A;  1WR6 A;  5AFU L;  3LK2 B;  3C4X A;  4ADZ A;  5JDQ A;  3DJB A;  4P09 A;  2RP4 A;  3KIN B;  1HFA A;  3CQC B;  3PU8 A;  2X51 A;  3EUH A;  1HG2 A;  2WWU A;  3V5U A;  4QX8 B;  3RC3 A;  5LGN B;  4ZI7 E;  3OYX A;  4MAL A;  2E8I A;  3O1J A;  3C64 A;  4V1A v;  3C98 B;  3ZCJ A;  1HX8 A;  4UEL A;  3ZYL A;  4CI3 B;  4XZC A;  4IE0 A;  5FY1 A;  1B7T A;  1MMN A;  2LJL A;  3KV5 A;  2YK0 A;  3ANW A;  5LHG B;  4ERR A;  2DNX A;  3RH3 A;  2WM9 A;  3CKD A;  3DTO A;  5LGU B;  4EIW A;  2QGS A;  3PUG A;  4UEM A;  3NBX X;  2Y8D A;  2NW7 A;  4IE4 A;  4ZI3 D;  3PU3 A;  4OHF A;  5JDH A;  4O8S A;  2XAQ B;  4WNK A;  3N2K E;  3U3I A;  1NAF A;  5LG4 A;  3Q2M A;  1CUN A;  5HXC A;  4GK5 E;  4YLH A;  2DCF A;  3EVY A;  3PUS A;  5IHY A;  1FMV A;  1MIW A;  2A72 A;  2K9A A;  2GK9 A;  2A2F X;  3RC8 A;  4UVC B;  1Z0P A;  4X20 E;  2VK9 A;  2M67 A;  3E22 E;  4XAX B;  5JDF A;  3RYH E;  3A5X A;  2YIN A;  5FMN A;  3U78 A;  2LSY A;  2ES0 A;  4A56 A;  2VKH A;  3I9Y A;  1AJ3 A;  3CX7 B;  3KV9 A;  4G2A A;  5LBM A;  3RYF E;  4ZI2 C;  2V7I A;  4HN9 A;  3O4X E;  5J1G A;  2CCQ A;  5F3J A;  3ZPO A;  3N9O A;  1BR2 A;  1D1B A;  4KUM B;  2JPF A;  4UF0 B;  3LK4 2;  3NZQ A;  4UV8 B;  4H9R C;  4PJL A;  4QWN B;  5DJQ C;  2A3D A;  5JR9 B;  4HTE A;  2H7O A;  3PUR A;  1D1A A;  3L3P A;  2VKO A;  3RKO A;  2XTL A;  5LBQ B;  3VKG A;  1UX4 A;  4UF0 A;  3ZC0 A;  4P0B A;  4JUY A;  4P0A A;  4JEU B;  2WMO A;  3UUN A;  3ONX A;  3FXE B;  4BAY B;  2L3L A;  5LYJ E;  2ZMA A;  5JR9 A;  4E7Z A;  3ZMU B;  5FP3 A;  2UXX B;  3ZN0 B;  2CWY A;  3OJA A;  2IC6 A;  5CA1 E;  4DMV A;  2KWI B;  2Q9Q C;  3LG7 A;  4PJJ A;  3O1H A;  2XAG B;  4Z8X A;  3S4U A;  2VKD A;  1OXZ A;  3LFM A;  3AAA B;  4QXH B;  4CQI A;  3F2E A;  4AKR B;  2BDE A;  3V5S A;  3WAJ A;  3Q5X A;  5L3D B;  3KFW X;  2V1D B;  2EHO D;  3WI3 A;  3SS1 A;  4TZ4 C;  4CZZ B;  4IHJ E;  2XHE B;  3JC6 D;  3KBU A;  3QUJ A;  4AQG A;  3KVA A;  5EK2 A;  5LCY A;  2LHN A;  2W61 A;  2WBL A;  4L0R A;  2B1E A;  2W62 A;  1SA0 E;  3HL6 A;  3KV4 A;  5HXE A;  3IF8 B;  1QSD A;  3HA4 A;  4H9Q C;  5H6Q B;  3NRY A;  2LEH A;  2Y48 B;  3GMI A;  3UUL A;  1YKE B;  4FJO A;  4CXW A;  4C91 A;  5LGT B;  5HYA A;  2XU0 A;  3VU7 H;  3E0Z A;  2DI4 A;  1FEW A;  3N2G E;  1E1H B;  4OYJ A;  2ZLY A;  2MBG A;  4DMW A;  2YEV C;  3QC9 A;  4L5G A;  5L2L A;  4KP3 C;  1X79 A;  3ZJ2 A;  5EK4 A;  2MTQ A;  1O3X A;  3GA8 A;  3M65 A;  4AKI A;  1H7C A;  4AXP A;  3N9M A;  4TV9 E;  4PW8 A;  2N2N A;  2WSS V;  3E08 A;  3MKD A;  5HXH A;  2C5J A;  4EAH A;  4X1I E;  2D0U A;  2JQQ A;  2C5I T;  3SOL A;  2BVL A;  3UT5 E;  4WBN E;  2KND A;  2ZM2 A;  3MA9 A;  3CVR A;  1ZEE A;  5FY7 A;  5LJM A;  1LRZ A;  3HKE E;  2D2S A;  1KNZ A;  2E9X D;  3ZJ1 A;  2SPC A;  2X0L B;  3PUA A;  2K48 A;  4O4L E;  2Q9Q B;  4AKH A;  2YU1 A;  1QUU A;  3AB3 B;  4L9I A;  4M1P A;  1HF8 A;  2PFV A;  4AKG A;  2P9B A;  2BZB A;  5J2T E;  2Y6X A;  3K3N A;  4DO0 A;  4H9S E;  3AA6 B;  4X1K E;  2LE8 A;  4PK4 A;  3HKB E;  3CX8 B;  2Q9Q A;  4JEH B;  4WW0 A;  1WLX A;  2LT3 A;  3N5L A;  4EZH A;  2LSJ A;  2ODV A;  2X67 A;  4HFV A;  4HEA A;  2LOS A;  2DWG A;  2H7V C;  3IHR A;  3K8P C;  3PE0 A;  3K3Q C;  4PNI A;  5LP6 E;  3EDU A;  5DQV A;  1LVF A;  2VL8 A;  2RA1 A;  1YW0 A;  2MOZ A;  3H3A A;  1G8X A;  3ESL A;  2YU2 A;  2V7L A;  3C50 A;  4C90 A;  4MHC A;  4ZS3 A;  3AA7 B;  2CM0 A;  3FXD B;  5JDN A;  2XQY A;  5LXT E;  1ZV4 X;  2G0U A;  5HWY A;  3NRX A;  5TAO A;  3KVB A;  2CA5 A;  3BQK A;  3CPZ A;  5LNK A;  5KMG P;  5HXS A;  3GN5 B;  3NZP A;  1IAP A;  2LM9 A;  2LSK A;  1BR1 A;  2H3R A;  2V7J A;  1LVK A;  5FXV A;  5L3G B;  2KMF A;  5FY0 A;  2EHO C;  4XBF B;  2W63 A;  3FBZ A;  2HPJ A;  3JC6 C;  4TN7 B;  3C51 A;  4X1Y E;  3GN5 A;  5FXX A;  5HXR A;  3BQI A;  2L9Q A;  4PK6 A;  3ZEF B;  3AAE B;  2BVM A;  2CXF A;  4FI5 A;  3J9X 1;  3VHL A;  3ZMT B;  2X9Y A;  2V26 A;  3I0O A;  5FXW A;  4ILU A;  4U74 A;  2XAJ B;  3R84 B;  3J7Y q;  3OYZ A;  5H6R B;  4ZS2 A;  4QX7 B;  2C5K T;  2CMR A;  5KX5 E;  1BR0 A;  4UIG A;  2Z6E A;  5L3E B;  3C4Z A;  2VWA A;  3I1A A;  5L3C B;  2X9W A;  2NOX A;  5JDL A;  2JRK A;  2ZM8 A;  4ISS A;  2DLR A;  3FB2 A;  4I50 E;  3N2O A;  4TUY E;  3BK9 A;  4PFO A;  3K3O A;  3Q9D A;  4TV8 E;  3VKH A;  1S35 A;  4HE8 A;  4YJ3 E;  2LSG A;  4E7S A;  4H63 V;  5L3B B;  4HGA A;  4PFP A;  5JH7 E;  4I4T E;  3UUM A;  2E9X C;  5JQG E;  5JRE A;  4QHO A;  3B57 A;  3ZN1 B;  4O4H E;  3ZMV B;  4QXB B;  2QA7 A;  4H9P C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...