4YFSA

Structure of the synthetic duffy binding protein (dbp) antigen deknull relevant for malaria vaccine design
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
294
structure length
285
Chain Sequence
b'KNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTASTAATSRTSWWNESKAQIWTAMMYSVKKRLKGNFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Structural Analysis of the Synthetic Duffy Binding Protein (DBP) Antigen DEKnull Relevant for Plasmodium vivax Malaria Vaccine Design.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Erythrocyte binding protein
total genus 120
structure length 285
sequence length 294
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4yfsA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4yfsA01
3RRCA 2XU0A 2WAUA 2Y8DA 4NUVA 3C64A 2YK0A 3BQIA 3CMLA 4NUUA 3BQKA 3CPZA 5F3JA 4YFSA 3BQLA
chains in the Genus database with same CATH superfamily
3KFWX 4QXCB 4DV7T 4LFCT 3G06A 5LJNA 5IUXA 2BKPA 2XM2A 1W09A 3GMIA 1YW0A 5L4HA 3AAAB 3V5SA 5JDMA 5JDLA 2NW9A 1YKHB 3T1HT 3HKCE 3AVRA 1WFDA 2X9WA 5GONE 3SRZA 1M7KA 2UUAT 4OYKA 1NENA 5JQGE 2HH7A 2YKSA 3LJCA 3CVRA 3I9WA 4J2CA 2LLYA 3BQLA 3KV9A 3CQXC 2CLYC 3Q9DA 2LSYA 5LCYA 3O1JA 3ZCJA 4UV8B 3W15B 5LNKA 2YDSA 2V1DB 3VR8A 3UUMA 2ZM2A 4HWDA 2X0HA 4TX5A 3BQIA 2JQ9A 1D0ZA 3EHZA 1MNDA 3ZMVB 2XY8B 4DR5T 1NAFA 3L8RA 3JC6D 1Z8UA 2UU9T 3ZC0A 2XAHB 5HXSA 4DR1T 4UF0B 5JDGA 4JEHB 3OVUA 3WAKA 2E9XD 3OPCA 4GIWA 1IBKT 4QH4A 4K0UA 2YN6A 3AECA 4EV6A 5J2TE 3RRCA 1ZKEA 2W4XA 1MIYA 2DWGA 3UQ7A 3C4WA 3PUGA 4YXDA 2HPJA 2KNDA 3UU3A 3ZYKA 3E22E 5FVKA 1X79A 4BJMA 1X9BA 4KX6A 5FMNA 3JADA 4XBFB 3FBZA 3GA8A 3PUSA 1KFYA 4U31A 2K3WA 4U72A 1Y01A 4UVAB 4WNKA 5L2LA 3TLTA 2D5UA 5EZYE 2F4VT 4HFBA 2HPLA 2V5DA 3KINB 4NUVA 2LKGA 5ABFB 1ZOYA 4DBRA 4ERRA 4PW8A 4HWHA 3MZKB 3ZKRA 3A8YC 5AQUB 4BJNA 1MMAA 3F2EA 4EZHA 4AI6A 1LVFA 4H9OC 2WU2A 3IA3A 3TLUA 4LFBT 3LK3B 3N9LA 5DQVA 2CXLA 3OYXA 2JMKA 2VQFT 3MA9A 3VU7H 3QC9A 3O9XA 4U33A 3FBLA 4AKIA 3RPUA 2NTYA 4COFA 3RGLA 2XQ6A 2LT3A 2CE7A 4A5XA 1XMOT 4E7SA 4X62T 4ZI3D 4GK0E 2W63A 4DVDA 2D0UA 2N2NA 4PFOA 3VHLA 2WMOA 5EK3A 3AEFA 2QYWA 2H3RA 1S94A 2ODUA 4BAYB 1HFAA 1XWMA 1JNZA 2X9YA 5JH7E 4LF7T 2UXCT 1DU2A 4LF8T 3CX7B 4LF4T 1FEWA 5FY7A 2KMFA 4DIDB 2V7IA 5L3CB 3ZYLA 3ZYMA 2WQYA 4AQGA 3CK6A 2WMNA 1BR0A 1J1JA 4ZI3C 5AQMB 3NKZA 5JR9A 1E1HB 4ZS2A 4PNIA 5LG3A 1OWAA 4UVBB 3N9NA 3PU3A 3VRAA 4NXNT 3EDUA 3WAJA 4NXMT 2BG9B 4QX8B 2BKNA 2HN2A 5AQOB 3O4XE 4HWCA 2WAUA 4H9QC 1OEDC 2LJLA 2VURA 4G63A 4GKJT 2WY2A 3Q5DA 1D0YA 2XUEA 4B3ST 4JI7T 4AKHA 2BKOA 2Q9QA 4KUMB 2E2AA 1NEKA 2E8IA 4GYRA 3RKOA 4HFHA 4PK4A 3P4PA 1LDKB 2C5IT 5KX5E 2Z6EA 4H9PC 3ONJA 3L39A 1QSDA 2J62A 2J4GA 2W0GA 3A7MA 4O2AE 4AXPA 3PU8A 3UU8A 4O4JE 2EHOB 3H37A 1U4QA 4YFSA 1M62A 2H7OA 3ETUA 3H3MA 1I6ZA 4QH1A 2NR4A 2A72A 1T72A 2MOZA 2YOEA 2W2UA 4UVCB 4YJ3E 2B1EA 3HKEE 2QVAA 5FXXA 4MBQA 4UF0A 4HWIB 3PV0F 4EYUA 3OYZA 3P8CD 4YT0A 2DLRA 5HEHA 5L4EA 4YTNA 3F31A 5H6RB 4H63V 2W66A 5LBMA 3UQ4A 4HGAA 4V1Av 3HKDE 3T1YT 3DQVC 4PJMA 4ZZBA 5LXTE 4CXWA 5HWXA 2CLYB 4AQYT 3QUJA 4U2YA 3PUZF 3LK42 1SE7A 2XASB 3FZLB 4CN4A 2FJBA 2G0UA 4IL9A 5L3FB 1KEYA 1ZV4X 4B3RT 1MNEA 2XTLA 4C91A 4LF5T 4YSXA 2JMHA 3VKGA 2WZHA 3IEEA 2RA1A 3RHWA 3ANWB 3TLVA 4F6RC 2JIWA 1T8BA 4IE4A 2LSGA 3Q5XA 2NWBA 2LSIA 3KV5A 5ABFA 3LBXA 3C51A 2DWKA 2FJEA 4DV3T 1HNWT 4ZI7E 5HCMA 1VCSA 3K3OA 4EAHA 1UGOA 4CXXA 2DNXA 4DR2T 1QLBA 5AQLB 2K5BB 5LA6E 4JV5T 1WYBA 2H88A 2V6YB 3C98B 4JI3T 4MLKA 4ZHQE 3QK6A 3FZMB 3GN5B 5AQPB 3ZLIA 5JDFA 4JI8T 4PK6A 1SUMB 2OV9A 3QB5K 2CA5A 4JI2T 3AE3A 3L09A 3P4QA 5LJMA 2V5CA 3M65A 2ODVA 2DL1A 1US7B 4DV5T 2CWOA 1W0BA 2E9XB 3ZEFB 5JDNA 5L3GB 2JQQA 4JUYA 1HR0T 1HTJF 1FMWA 4DNDA 3K3NA 1YQ4A 4HEAA 4DR7T 5IHYA 2H89A 3KV6A 4PJNA 3ZT7A 4IE5A 4HFCA 4YTPA 4UV9B 1KNPA 3UUXB 2KXPB 4ZI2C 2CHNA 4CN6A 2D2SA 4X1IE 4X1KE 4KHZF 2IC6A 2JQKA 2FBWA 4LMLA 3HKBE 1KNRA 2ES0A 3CIRA 2M6IA 5LOVE 2KWHA 2E5VA 4GK5E 1MIVA 2X0YA 5TAOA 2V6XA 3A5XA 3MJXA 2BDEA 2I0MA 3ZT6A 4DV0T 2Y6XA 5ABGA 2VL8A 4QX7B 5FNVE 1J5ET 4YSZA 2QRXA 3OJAA 4PAGA 4LFAT 2V7LA 3RX6A 4O4IE 5HXHA 2DCFA 3CQGB 2LOSA 4A97A 2JJ9A 3AE4A 3P4RA 5BR8T 5DJQC 4DMVA 5JDHA 3QOFA 4ZXLA 2CBIA 5LMUT 2KINB 3CWZB 3NZQA 3PUQA 4GKKT 2V7MA 3SWHA 2UXBT 1CHUA 2CBJA 2D9DA 2M67A 1XNQT 2VKOA 2CWYA 3BQKA 3JAFA 1HG2A 1LVKA 2CXFA 5JR9C 3LFMA 5EK4A 1BR4A 4TZ4C 4TV8E 2XJ7A 1HG5A 4HFVA 2EHOA 3GWHA 3Q5WA 4ZEYA 3F57A 4Z91A 4X5TA 2LSJA 4IREA 1QUUA 2X66A 4O4LE 3AEBA 2BS3A 4G2AA 3N9MA 3VKHA 4UXNB 3U78A 1XDOA 2MYSA 5BMVE 2LRKA 2WM9A 5ADXL 5FVLA 2XQYA 2HHHT 4EOZB 3C4ZA 4EZ4A 2LSKA 1OEDB 2X68A 1HX1B 2NOXA 2Q9QC 2WS3A 3ZC1A 4JI6T 5CGMA 2XPKA 5AQGB 2CXDA 4TWHA 3RKGA 1XNRT 1YD8G 2N9DA 3KVAA 5JTGA 5ETWA 2JQHA 3UT5E 3PURA 4HFEA 4P5OA 4PK5A 2XSAA 5F8PA 3QB5A 4QHOA 1EZ3A 2W61A 2DHRA 4LMKA 4LF6T 5CB4E 3LSVA 4CI3B 2K24A 4IHJE 2XSBA 1CUNA 2XQAA 3P50A 5LHGB 3Q2MA 2WU5A 4FI5A 2L9QA 2I59A 1IJ6A 2WSSV 2ACZA 3AXJA 2I6HA 1WLXA 3AA1B 4HFIA 3JAEA 3C4XA 3AVSA 5LB7B 5AQVB 3T8OA 4HE8A 3ZMUB 1JNRA 4HTEA 3EVYA 1N34T 2Y48B 4YLHA 4OFZA 4DV1T 3RF1A 2KZ7B 2LEHA 5KDMC 4NUUA 4DUYT 3RYFE 2DI4A 2ZM0A 3N9QA 3SS1A 1N32T 2BBJA 1T7SA 4CN1A 3C50A 3AAIA 2CEAA 2FJDA 1N36T 3DTOA 1G73A 4WBOA 1WR0A 4HKAA 4O4HE 4U2ZA 4ADZA 5AQFB 5L3BB 3R6NA 3GN5A 1KNZA 3OBVE 3PUWF 3B5MA 1BR1A 5HYAA 4CZZB 4CI1B 4EB6E 4JLEA 4O2BE 4KP3C 4DMWA 1LKXA 3ZN1B 3I9YA 2L8KA 1U5PA 2VB6A 2UXNB 4F52A 1VCTA 2E9XA 2XQ5A 3EDVA 4P1NA 1HS7A 4JI5T 3KV4A 1E7PA 2VWAA 3AE6A 4YHHT 1I94T 4WYVA 4XZCA 2YU1A 5HCJA 2PFVA 4I4TE 3CX8B 2BG9E 2YINA 1FMVA 3AE8A 3NVOA 5C8YE 2ZMAA 2YDQA 4AQFA 3TLWA 4ISTA 1N33T 1D1AA 5AQJB 4U3CA 2Y8DA 5AQIB 5FKYA 4TWFA 5ABEA 5FL1A 2XAFB 3ONLC 4WZXA 3FZKB 5FXWA 3P4WA 4OHFA 3N2OA 5M4YA 2PG8A 4PJJA 3PUAA 2R6GF 3PDYA 2WZKA 3RYHE 3FHNA 5J1GA 3UUNA 3NRXA 3RQWA 3EI0A 4F8HA 1FIOA 3K1SA 4WW0A 2IDOB 2W67A 4UELA 3ZMTB 4IE0A 2J1DG 4DBQA 2ACXA 3EABA 4DV2T 4YTMA 5L3EB 2BZBA 5AQNB 2CHOA 3JCFA 4N78D 3CX6B 2X51A 4HFDA 2QGSA 2GK9A 2KWIB 5KXJA 3Q5EA 2V7KA 4GOUA 2X9XA 4H9RC 3M3ZB 4C90A 2VVNA 4GYSA 5AQKB 4JBWF 5CA0E 2M6BA 2CM0A 3MKDA 2VKDA 3UU4A 2LOPA 2OA5A 4Q25A 1L0VA 4CXYA 2XU0A 2BVMA 4MALA 2UXDT 2IIUA 1ZEEA 3SFEA 4JYAT 4P0BA 3OTOT 2IC9A 4ILUA 4PJLA 4ILBA 3RIUA 1Z0PA 4JGHD 1UK5A 4NIQA 4H63H 4I43B 2CMRA 3ZN0B 2LKHA 5JRCB 4P0AA 3ZMZB 5CFBA 4I0UA 3RRWA 1B7TA 5JDQA 2X9HA 4O8SA 3FXEB 3LDQB 3ONXA 4APFB 3CPZA 5HXRA 4X64T 3AA6B 3TLSA 4ASKA 4YY3T 2VVSA 4ZI2D 3H3AA 3I1AA 2ZM6T 3K8PC 2PTFA 3R84B 1Y64B 1WCRA 2H7VC 3AA7B 3HA4A 5JR9B 5FL0A 2D0TA 3PUVF 5C3JA 2LM9A 4MFRA 4WQOD 2WDVA 3CMLA 1HX8A 2UUBT 4TNVA 4A64A 3PJAA 3ZJ1A 2C5KT 4YHJA 5A1LA 4LF9T 2FJAA 2KT9A 1V9DA 3RH3A 1KF6A 2SPCA 2WBLA 4I50E 3C64A 3VR9A 3CKDA 2Q9QB 3WI3A 1MIWA 4DR6T 4DO0A 3DJBA 4JEUB 4OK0A 1UCUA 2ZLYA 1WYCA 4I55E 4IE7A 4ZZCA 3PUYF 4NPPA 3E0ZA 4OX9T 5LYJE 1YXRA 2IUBA 2XAQB 3EAMA 4L0RA 5DABA 1XZYA 2WDQA 2XQ8A 2CPTA 1HF8A 3AEEA 2BG9A 5AFUL 2XQ3A 4X66T 4KI0F 2QA7A 3O1HA 3PJAJ 3NWIA 2VK9A 3ZCIA 1D0XA 4B3TT 4Z90A 1E2AA 2N1GA 4UR9A 2CRBA 4IDPA 2IHR1 5ABHA 4AP2B 2LHNA 3N5LA 3ABVA 2Q9QD 5LBQB 1AJ3A 5HAXA 3P7IA 3AE5A 2VL0A 4FJOA 3D0TA 1LDKA 3AEDA 3V5UA 4CQIA 3L3PA 1YQ3A 4WBNE 2RP4A 1VOMA 5FXVA 5LHHB 4ANJA 3RIFA 4EXTA 2VKJA 1LRZA 3ZPOA 4ISSA 4QXHB 2XAGB 1ZHCA 2LRLA 4K0KT 4CI2B 1R8IA 3JC6C 5FYMA 4DR3T 4AKLA 5IWAT 5C2TA 3CQCB 3N9OA 5LGUB 5J0ZA 2KSRA 5E0OA 1UX5A 3UUBA 3AB3B 2BBHA 2A3DA 2E9XC 1MMNA 3B57A 1LDJA 4U7IA 4H9NC 5L3DB 2RPAA 1BR2A 5HEUA 2XQ7A 3KBTA 2MPKA 4H9SE 3SOLA 3RC3A 4U74A 2HN1A 4EEDA 5FY1A 3LBXB 4XAXB 2C5JA 2XQ4A 5LMNT 3SFDA 3MACA 4IGUA 1IAPA 4ZS3A 4AQFC 1H7CA 2L3LA 3OKQA 1UX4A 4DV4T 3VRBA 1OEDE 4A56A 1XMQT 4IIJE 2KLQA 3PTRB 2WZIA 4HWFA 3J9X1 3AE9A 3LG7A 5FXZA 4TN7B 4TWDA 4P09A 2C0SA 2WWUA 3AEAA 2YK0A 1XDPA 5F5WA 3DP7A 3U3IA 4B3MT 4TNWA 4M1PA 5LGNB 2AXDS 4AISA 2VASA 3ANWA 3ZJ2A 5AQTB 3MXZA 1NWMX 2NW8A 4PFPA 3P4SA 4KBMB 3KBUA 3FZHB 2UXXB 4IDQA 1S35A 2OLTA 4AKGA 3AE1A 4EYYR 1U6GA 3NRYA 3AEGA 1W0AA 1WRDA 3FZFB 4JI4T 4JI1T 3ETVA 4DV6T 5IYZE 5JRCA 2PJQA 3UU6A 2IMLA 2P9BA 5LP6E 4IE6A 5KMGP 3B13A 3I0QA 4QH5A 2V6YA 5AQHB 3RC8A 5HXEA 4KHPT 5DQWA 4L5GA 4HXIB 2A2FX 2K48A 3K3QC 3ZT5A 3RYIE 5HEGA 1WR6A 2PBIA 4EEBA 1T98A 3DPLC 1SA0E 3TKLB 5FP3A 3RLFF 5AQQB 5HWYA 3RQUA 2MTQA 2W00A 3N9PA 2B76A 4HN9A 3RIUC 3O1IA 4QXBB 4EGWA 4TUYE 3KDSE 3AE2A 1OXZA 5F3JA 4A98A 1IBLT 4BA9A 3MK7C 2NTXA 3UU5A 2X0LB 2W62A 2XZEA 3RTRA 4YJ2E 1VRBA 4MHCA 2JPFA 1D1BA 4B6XA 5EK2A 4LMJA 4JI0T 1IBMT 4Z8XA 2XAJB 3AE7A 3ZSTA 3UFEA 4IDOA 4U7YA 5CJ5A 3FXDB 2XM1A 3X1DA 4IT4A 4EIWA 2LE8A 2J47A 1UURA 2IW5B 3UTKA 4AKRB 3S4UA 2VQET 4E7ZA 4IDNA 3UULA 5FY0A 1ZP0A 3AA0B 3J7Yq 2WB5A 1HNZT 2V26A 2XHEB 1FJGT 2WP9A 1D1CA 3HR0A 5HXCA 5JVDE 5LGTB 3QNUA 2X67A 3NZPA 3ZMSB 2MBGA 2YU2A 5H6QB 1YKEB 3PE0A 2BS4A 4ILAA 1GQEA 4TV9E 5LHIB 1MMDA 3RI5A 3IHRA 3NBXX 3RIAA 2UUCT 4YSYA 2XQ9A 4DR4T 3HI2A 4X65T 3PUXF 2NW7A 2IAKA 5HEOA 2V8SV 3N2KE 2V7JA 4N9F3 2EHOD 3BK9A 3LK2B 3E08A 3IF8B 4AIUA 2BG9C 4IDZA 1IZNB 5AQRB 1HCIA 1SHZC 2YEVC 2YDRA 4OYJA 3IBPA 2WCAA 3N2GE 5HEJA 2NP9A 4UEMA 2CCQA 3AXJB 4DUZT 3UFGA 2K9AA 1W9RA 2LHRA 2WWVA 1J5WA 4QKNA 2A9UA 1OEDA 3KVBA 1G8XA 2LM2A 1IJ5A 3I0OA 3FB2A 4UIGA 3AAEB 5L47A 4L9IA 2JRKA 2BS2A 2E5LT 5AQSB 5CA1E 3HL6A 1UUSA 4X20E 3ESLA 4IL4A 4X1YE 4KMCA 2ZM8A 1HNXT 3EUHA 2FUPA 2MAWA 5JREA 2EHOC 3ZSSA 2VKHA 4ZOLE 1KK7A 2AE9A 4ILCA 4QWNB 5LG4A 3RYCE 2BVLA 2WDRA 1MMGA 1O3XA 5J2UE
chains in the Genus database with same CATH topology
4ANJA 3KFWX 2LEHA 4QXCB 5KDMC 4EXTA 2VKJA 1LRZA 3ZPOA 4NUUA 4ISSA 4EYUA 3OYZA 3P8CD 5LJNA 4QXHB 3RYFE 2DI4A 2XAGB 1ZHCA 2ZM0A 1YW0A 3GMIA 3N9QA 3SS1A 4CI2B 2DLRA 3AAAB 3JC6C 3V5SA 5JDMA 3C50A 3AAIA 5JDLA 5FYMA 1YKHB 2NW9A 3F31A 3HKCE 4AKLA 3AVRA 2CEAA 5H6RB 4H63V 3CQCB 5LBMA 2X9WA 3N9OA 5LGUB 3DTOA 1G73A 4WBOA 4HGAA 4V1Av 5GONE 3SRZA 4HKAA 3HKDE 4O4HE 5E0OA 1UX5A 4ADZA 4PJMA 5LXTE 4CXWA 3AB3B 5HWXA 5L3BB 2A3DA 3R6NA 2E9XC 1MMNA 3GN5A 1KNZA 4OYKA 2CLYB 3B57A 5JQGE 2HH7A 3LJCA 4H9NC 3CVRA 3I9WA 3OBVE 4J2CA 5L3DB 1BR2A 3QUJA 1BR1A 5HYAA 4CZZB 4CI1B 3KBTA 4EB6E 4JLEA 3LK42 3BQLA 3KV9A 4H9SE 3SOLA 4O2BE 3CQXC 3RC3A 4U74A 2XASB 2CLYC 2G0UA 2LSYA 3Q9DA 4KP3C 5FY1A 5LCYA 1LKXA 4DMWA 5L3FB 1ZV4X 3ZN1B 3O1JA 3LBXB 3I9YA 4XAXB 1MNEA 2XTLA 4C91A 2C5JA 2L8KA 3ZCJA 4UV8B 3W15B 5LNKA 1U5PA 2VB6A 2UXNB 2E9XA 2JMHA 3EDVA 3MACA 3VKGA 2V1DB 3IEEA 2RA1A 3UUMA 1HS7A 4IGUA 2ZM2A 4TX5A 1IAPA 3BQIA 4ZS3A 4AQFC 3KV4A 2VWAA 1H7CA 2L3LA 3ANWB 1D0ZA 3ZMVB 1MNDA 3OKQA 4F6RC 1UX4A 4XZCA 2YU1A 4IE4A 4A56A 1NAFA 3JC6D 4IIJE 2PFVA 2KLQA 2LSGA 4I4TE 3CX8B 3PTRB 2YINA 3ZC0A 3J9X1 1FMVA 3Q5XA 2NWBA 3LG7A 2LSIA 2XAHB 3KV5A 5C8YE 4UF0B 5HXSA 3LBXA 5FXZA 5JDGA 4JEHB 3C51A 2ZMAA 4AQFA 4TN7B 4ISTA 4P09A 2C0SA 2WWUA 1D1AA 3WAKA 2DWKA 2Y8DA 2YK0A 4ZI7E 3DP7A 2E9XD 3U3IA 4GIWA 4K0UA 3K3OA 4M1PA 2XAFB 5LGNB 4EAHA 4CXXA 2VASA 3ANWA 2DNXA 2K5BB 5FXWA 5LA6E 3ZJ2A 5J2TE 3RRCA 1ZKEA 4OHFA 3N2OA 1MIYA 2DWGA 1WYBA 3MXZA 5M4YA 1NWMX 2NW8A 2PG8A 4PFPA 3C98B 4KBMB 4PJJA 3KBUA 3C4WA 3PUAA 4MLKA 4ZHQE 3QK6A 2UXXB 3PDYA 3PUGA 3GN5B 3ZLIA 2HPJA 2KNDA 1S35A 5JDFA 3RYHE 3ZYKA 3E22E 3FHNA 4AKGA 1X79A 4BJMA 5J1GA 4PK6A 3UUNA 3NRXA 4EYYR 3NRYA 1FIOA 5FMNA 1WRDA 2CA5A 4WW0A 4UELA 3ZMTB 3ETVA 3L09A 4XBFB 5IYZE 5JRCA 3FBZA 3GA8A 4IE0A 2J1DG 2PJQA 2ACXA 3PUSA 4DBQA 5LJMA 3M65A 2P9BA 2ODVA 5LP6E 1US7B 2CWOA 2E9XB 4IE6A 5KMGP 5L3EB 3B13A 3I0QA 4U72A 3ZEFB 3RC8A 2BZBA 5JDNA 5HXEA 5L3GB 2JQQA 4JUYA 4UVAB 4WNKA 1HTJF 4N78D 1FMWA 3CX6B 4DNDA 2X51A 2D5UA 5L2LA 5DQWA 5EZYE 4L5GA 3K3NA 2QGSA 2HPLA 2GK9A 2A2FX 2K48A 2KWIB 3K3QC 3KINB 4HEAA 5IHYA 4NUVA 3KV6A 4PJNA 2V7KA 3RYIE 4GOUA 4IE5A 1WR6A 2PBIA 4UV9B 1T98A 1SA0E 3TKLB 5FP3A 3UUXB 4DBRA 2X9XA 4H9RC 2KXPB 4ZI2C 5HWYA 4C90A 4ERRA 4PW8A 4GYSA 2MTQA 3MZKB 2D2SA 4X1IE 2W00A 3N9PA 5CA0E 2CM0A 4X1KE 2IC6A 3MKDA 4HN9A 4BJNA 3HKBE 2VKDA 1MMAA 3F2EA 3O1IA 4EZHA 4AI6A 2LOPA 1LVFA 4H9OC 2OA5A 4QXBB 2ES0A 5LOVE 2KWHA 4TUYE 3KDSE 3LK3B 4GK5E 1MIVA 1OXZA 5F3JA 5TAOA 3N9LA 5DQVA 4CXYA 3A5XA 3MJXA 4BA9A 3MK7C 2XU0A 2NTXA 2BDEA 2BVMA 2CXLA 3OYXA 2JMKA 4MALA 3MA9A 2X0LB 1ZEEA 2W62A 2Y6XA 3VU7H 3QC9A 4YJ2E 1VRBA 2VL8A 4MHCA 4P0BA 3O9XA 2IC9A 4ILUA 4PJLA 4QX7B 5FNVE 3FBLA 4AKIA 2JPFA 1Z0PA 2NTYA 3RPUA 1D1BA 3OJAA 2LT3A 4H63H 4I43B 4B6XA 4PAGA 5EK2A 2CE7A 2V7LA 2CMRA 4O4IE 3RX6A 4E7SA 2DCFA 5HXHA 3CQGB 4Z8XA 2XAJB 3ZN0B 3UFEA 5JRCB 4P0AA 2LOSA 3ZMZB 3FXDB 4ZI3D 2JJ9A 4GK0E 2W63A 3RRWA 1B7TA 4DVDA 2D0UA 4EIWA 5JDQA 2LE8A 2N2NA 2X9HA 4O8SA 3FXEB 2IW5B 4PFOA 3UTKA 3VHLA 4AKRB 3ONXA 3S4UA 2WMOA 5EK3A 3CPZA 5HXRA 3AA6B 5DJQC 4ASKA 4E7ZA 4DMVA 4ZI2D 2H3RA 3H3AA 3UULA 3I1AA 5JDHA 1S94A 5FY0A 3AA0B 3J7Yq 2ODUA 3K8PC 4BAYB 3R84B 2KINB 3CWZB 1Y64B 3NZQA 3PUQA 1HFAA 2V7MA 2H7VC 3AA7B 3SWHA 3HA4A 5JR9B 2M67A 2X9YA 2V26A 5JH7E 3BQKA 2VKOA 2CWYA 2XHEB 1D1CA 2D0TA 3HR0A 2LM9A 4MFRA 5HXCA 5JVDE 5LGTB 3CMLA 2X67A 3NZPA 1HX8A 3ZMSB 1HG2A 1LVKA 2CXFA 5JR9C 3LFMA 5EK4A 2MBGA 2YU2A 1BR4A 3CX7B 5H6QB 4TZ4C 1FEWA 4TV8E 1YKEB 3PE0A 5FY7A 1HG5A 2KMFA 2V7IA 4HFVA 5L3CB 2EHOA 3GWHA 3ZJ1A 3Q5WA 3ZYLA 3ZYMA 2C5KT 3F57A 4YHJA 4TV9E 4AQGA 5LHIB 2LSJA 1MMDA 1QUUA 2X66A 2WMNA 5A1LA 4O4LE 2KT9A 1BR0A 4G2AA 3N9MA 1V9DA 3IHRA 3RH3A 4ZI3C 3VKHA 5JR9A 2SPCA 4UXNB 3U78A 3NBXX 1E1HB 2WBLA 4ZS2A 4PNIA 4I50E 2MYSA 1OWAA 5BMVE 4UVBB 3HI2A 3C64A 2NW7A 2WM9A 5ADXL 3CKDA 2Q9QB 2XQYA 2IAKA 3N9NA 3WI3A 4EOZB 3C4ZA 1MIWA 3PU3A 4DO0A 3N2KE 3EDUA 4EZ4A 2LSKA 3DJBA 4JEUB 2X68A 3WAJA 4OK0A 1UCUA 2ZLYA 2NOXA 2Q9QC 4QX8B 1WYCA 2V7JA 4I55E 3ZC1A 4IE7A 3O4XE 2WAUA 4H9QC 2EHOD 2LJLA 4G63A 3BK9A 3LK2B 2CXDA 3E08A 3IF8B 4IDZA 1IZNB 1YD8G 2N9DA 3KVAA 1HCIA 1D0YA 1SHZC 2YEVC 2XUEA 3E0ZA 4OYJA 5ETWA 3IBPA 3UT5E 3PURA 5LYJE 3N2GE 2NP9A 4PK5A 4AKHA 2Q9QA 4KUMB 4QHOA 2CCQA 2XAQB 4UEMA 5F8PA 2K9AA 2LHRA 4L0RA 5DABA 4QKNA 1EZ3A 3KVBA 2E8IA 2W61A 1G8XA 1HF8A 2DHRA 1IJ5A 4GYRA 3I0OA 3RKOA 3FB2A 4UIGA 3AAEB 4PK4A 5AFUL 5CB4E 4L9IA 2JRKA 2QA7A 4CI3B 3O1HA 2K24A 4IHJE 2C5IT 2VK9A 5KX5E 1CUNA 2Z6EA 4H9PC 3ZCIA 1QSDA 1D0XA 2W0GA 5LHGB 2N1GA 3HL6A 5CA1E 4X20E 3Q2MA 4O2AE 4AXPA 3PU8A 3ESLA 4FI5A 4O4JE 2EHOB 3H37A 1U4QA 2L9QA 4X1YE 4KMCA 2I59A 2ZM8A 1IJ6A 2LHNA 2WSSV 4YFSA 3N5LA 3EUHA 2H7OA 3ETUA 1WLXA 5LBQB 2Q9QD 3AA1B 1AJ3A 5HAXA 2A72A 5JREA 2EHOC 3C4XA 2MOZA 3P7IA 2VKHA 3AVSA 4FJOA 4ZOLE 3T8OA 4HE8A 1KK7A 4UVCB 4YJ3E 3D0TA 2B1EA 3HKEE 3ZMUB 4QWNB 4HTEA 3RYCE 5LG4A 3EVYA 2Y48B 4YLHA 3V5UA 4OFZA 2BVLA 4CQIA 3L3PA 5FXXA 1MMGA 4WBNE 1O3XA 2KZ7B 2RP4A 1VOMA 4MBQA 4UF0A 5FXVA 5J2UE 5LHHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RRC A;  2XU0 A;  2WAU A;  2Y8D A;  4NUV A;  3C64 A;  2YK0 A;  3BQI A;  3CML A;  4NUU A;  3BQK A;  3CPZ A;  5F3J A;  4YFS A;  3BQL A; 
#chains in the Genus database with same CATH topology
 3KFW X;  4QXC B;  4DV7 T;  4LFC T;  3G06 A;  5LJN A;  5IUX A;  2BKP A;  2XM2 A;  1W09 A;  3GMI A;  1YW0 A;  5L4H A;  3AAA B;  3V5S A;  5JDM A;  5JDL A;  2NW9 A;  1YKH B;  3T1H T;  3HKC E;  3AVR A;  1WFD A;  2X9W A;  5GON E;  3SRZ A;  1M7K A;  2UUA T;  4OYK A;  1NEN A;  5JQG E;  2HH7 A;  2YKS A;  3LJC A;  3CVR A;  3I9W A;  4J2C A;  2LLY A;  3BQL A;  3KV9 A;  3CQX C;  2CLY C;  3Q9D A;  2LSY A;  5LCY A;  3O1J A;  3ZCJ A;  4UV8 B;  3W15 B;  5LNK A;  2YDS A;  2V1D B;  3VR8 A;  3UUM A;  2ZM2 A;  4HWD A;  2X0H A;  4TX5 A;  3BQI A;  2JQ9 A;  1D0Z A;  3EHZ A;  1MND A;  3ZMV B;  2XY8 B;  4DR5 T;  1NAF A;  3L8R A;  3JC6 D;  1Z8U A;  2UU9 T;  3ZC0 A;  2XAH B;  5HXS A;  4DR1 T;  4UF0 B;  5JDG A;  4JEH B;  3OVU A;  3WAK A;  2E9X D;  3OPC A;  4GIW A;  1IBK T;  4QH4 A;  4K0U A;  2YN6 A;  3AEC A;  4EV6 A;  5J2T E;  3RRC A;  1ZKE A;  2W4X A;  1MIY A;  2DWG A;  3UQ7 A;  3C4W A;  3PUG A;  4YXD A;  2HPJ A;  2KND A;  3UU3 A;  3ZYK A;  3E22 E;  5FVK A;  1X79 A;  4BJM A;  1X9B A;  4KX6 A;  5FMN A;  3JAD A;  4XBF B;  3FBZ A;  3GA8 A;  3PUS A;  1KFY A;  4U31 A;  2K3W A;  4U72 A;  1Y01 A;  4UVA B;  4WNK A;  5L2L A;  3TLT A;  2D5U A;  5EZY E;  2F4V T;  4HFB A;  2HPL A;  2V5D A;  3KIN B;  4NUV A;  2LKG A;  5ABF B;  1ZOY A;  4DBR A;  4ERR A;  4PW8 A;  4HWH A;  3MZK B;  3ZKR A;  3A8Y C;  5AQU B;  4BJN A;  1MMA A;  3F2E A;  4EZH A;  4AI6 A;  1LVF A;  4H9O C;  2WU2 A;  3IA3 A;  3TLU A;  4LFB T;  3LK3 B;  3N9L A;  5DQV A;  2CXL A;  3OYX A;  2JMK A;  2VQF T;  3MA9 A;  3VU7 H;  3QC9 A;  3O9X A;  4U33 A;  3FBL A;  4AKI A;  3RPU A;  2NTY A;  4COF A;  3RGL A;  2XQ6 A;  2LT3 A;  2CE7 A;  4A5X A;  1XMO T;  4E7S A;  4X62 T;  4ZI3 D;  4GK0 E;  2W63 A;  4DVD A;  2D0U A;  2N2N A;  4PFO A;  3VHL A;  2WMO A;  5EK3 A;  3AEF A;  2QYW A;  2H3R A;  1S94 A;  2ODU A;  4BAY B;  1HFA A;  1XWM A;  1JNZ A;  2X9Y A;  5JH7 E;  4LF7 T;  2UXC T;  1DU2 A;  4LF8 T;  3CX7 B;  4LF4 T;  1FEW A;  5FY7 A;  2KMF A;  4DID B;  2V7I A;  5L3C B;  3ZYL A;  3ZYM A;  2WQY A;  4AQG A;  3CK6 A;  2WMN A;  1BR0 A;  1J1J A;  4ZI3 C;  5AQM B;  3NKZ A;  5JR9 A;  1E1H B;  4ZS2 A;  4PNI A;  5LG3 A;  1OWA A;  4UVB B;  3N9N A;  3PU3 A;  3VRA A;  4NXN T;  3EDU A;  3WAJ A;  4NXM T;  2BG9 B;  4QX8 B;  2BKN A;  2HN2 A;  5AQO B;  3O4X E;  4HWC A;  2WAU A;  4H9Q C;  1OED C;  2LJL A;  2VUR A;  4G63 A;  4GKJ T;  2WY2 A;  3Q5D A;  1D0Y A;  2XUE A;  4B3S T;  4JI7 T;  4AKH A;  2BKO A;  2Q9Q A;  4KUM B;  2E2A A;  1NEK A;  2E8I A;  4GYR A;  3RKO A;  4HFH A;  4PK4 A;  3P4P A;  1LDK B;  2C5I T;  5KX5 E;  2Z6E A;  4H9P C;  3ONJ A;  3L39 A;  1QSD A;  2J62 A;  2J4G A;  2W0G A;  3A7M A;  4O2A E;  4AXP A;  3PU8 A;  3UU8 A;  4O4J E;  2EHO B;  3H37 A;  1U4Q A;  4YFS A;  1M62 A;  2H7O A;  3ETU A;  3H3M A;  1I6Z A;  4QH1 A;  2NR4 A;  2A72 A;  1T72 A;  2MOZ A;  2YOE A;  2W2U A;  4UVC B;  4YJ3 E;  2B1E A;  3HKE E;  2QVA A;  5FXX A;  4MBQ A;  4UF0 A;  4HWI B;  3PV0 F;  4EYU A;  3OYZ A;  3P8C D;  4YT0 A;  2DLR A;  5HEH A;  5L4E A;  4YTN A;  3F31 A;  5H6R B;  4H63 V;  2W66 A;  5LBM A;  3UQ4 A;  4HGA A;  4V1A v;  3HKD E;  3T1Y T;  3DQV C;  4PJM A;  4ZZB A;  5LXT E;  4CXW A;  5HWX A;  2CLY B;  4AQY T;  3QUJ A;  4U2Y A;  3PUZ F;  3LK4 2;  1SE7 A;  2XAS B;  3FZL B;  4CN4 A;  2FJB A;  2G0U A;  4IL9 A;  5L3F B;  1KEY A;  1ZV4 X;  4B3R T;  1MNE A;  2XTL A;  4C91 A;  4LF5 T;  4YSX A;  2JMH A;  3VKG A;  2WZH A;  3IEE A;  2RA1 A;  3RHW A;  3ANW B;  3TLV A;  4F6R C;  2JIW A;  1T8B A;  4IE4 A;  2LSG A;  3Q5X A;  2NWB A;  2LSI A;  3KV5 A;  5ABF A;  3LBX A;  3C51 A;  2DWK A;  2FJE A;  4DV3 T;  1HNW T;  4ZI7 E;  5HCM A;  1VCS A;  3K3O A;  4EAH A;  1UGO A;  4CXX A;  2DNX A;  4DR2 T;  1QLB A;  5AQL B;  2K5B B;  5LA6 E;  4JV5 T;  1WYB A;  2H88 A;  2V6Y B;  3C98 B;  4JI3 T;  4MLK A;  4ZHQ E;  3QK6 A;  3FZM B;  3GN5 B;  5AQP B;  3ZLI A;  5JDF A;  4JI8 T;  4PK6 A;  1SUM B;  2OV9 A;  3QB5 K;  2CA5 A;  4JI2 T;  3AE3 A;  3L09 A;  3P4Q A;  5LJM A;  2V5C A;  3M65 A;  2ODV A;  2DL1 A;  1US7 B;  4DV5 T;  2CWO A;  1W0B A;  2E9X B;  3ZEF B;  5JDN A;  5L3G B;  2JQQ A;  4JUY A;  1HR0 T;  1HTJ F;  1FMW A;  4DND A;  3K3N A;  1YQ4 A;  4HEA A;  4DR7 T;  5IHY A;  2H89 A;  3KV6 A;  4PJN A;  3ZT7 A;  4IE5 A;  4HFC A;  4YTP A;  4UV9 B;  1KNP A;  3UUX B;  2KXP B;  4ZI2 C;  2CHN A;  4CN6 A;  2D2S A;  4X1I E;  4X1K E;  4KHZ F;  2IC6 A;  2JQK A;  2FBW A;  4LML A;  3HKB E;  1KNR A;  2ES0 A;  3CIR A;  2M6I A;  5LOV E;  2KWH A;  2E5V A;  4GK5 E;  1MIV A;  2X0Y A;  5TAO A;  2V6X A;  3A5X A;  3MJX A;  2BDE A;  2I0M A;  3ZT6 A;  4DV0 T;  2Y6X A;  5ABG A;  2VL8 A;  4QX7 B;  5FNV E;  1J5E T;  4YSZ A;  2QRX A;  3OJA A;  4PAG A;  4LFA T;  2V7L A;  3RX6 A;  4O4I E;  5HXH A;  2DCF A;  3CQG B;  2LOS A;  4A97 A;  2JJ9 A;  3AE4 A;  3P4R A;  5BR8 T;  5DJQ C;  4DMV A;  5JDH A;  3QOF A;  4ZXL A;  2CBI A;  5LMU T;  2KIN B;  3CWZ B;  3NZQ A;  3PUQ A;  4GKK T;  2V7M A;  3SWH A;  2UXB T;  1CHU A;  2CBJ A;  2D9D A;  2M67 A;  1XNQ T;  2VKO A;  2CWY A;  3BQK A;  3JAF A;  1HG2 A;  1LVK A;  2CXF A;  5JR9 C;  3LFM A;  5EK4 A;  1BR4 A;  4TZ4 C;  4TV8 E;  2XJ7 A;  1HG5 A;  4HFV A;  2EHO A;  3GWH A;  3Q5W A;  4ZEY A;  3F57 A;  4Z91 A;  4X5T A;  2LSJ A;  4IRE A;  1QUU A;  2X66 A;  4O4L E;  3AEB A;  2BS3 A;  4G2A A;  3N9M A;  3VKH A;  4UXN B;  3U78 A;  1XDO A;  2MYS A;  5BMV E;  2LRK A;  2WM9 A;  5ADX L;  5FVL A;  2XQY A;  2HHH T;  4EOZ B;  3C4Z A;  4EZ4 A;  2LSK A;  1OED B;  2X68 A;  1HX1 B;  2NOX A;  2Q9Q C;  2WS3 A;  3ZC1 A;  4JI6 T;  5CGM A;  2XPK A;  5AQG B;  2CXD A;  4TWH A;  3RKG A;  1XNR T;  1YD8 G;  2N9D A;  3KVA A;  5JTG A;  5ETW A;  2JQH A;  3UT5 E;  3PUR A;  4HFE A;  4P5O A;  4PK5 A;  2XSA A;  5F8P A;  3QB5 A;  4QHO A;  1EZ3 A;  2W61 A;  2DHR A;  4LMK A;  4LF6 T;  5CB4 E;  3LSV A;  4CI3 B;  2K24 A;  4IHJ E;  2XSB A;  1CUN A;  2XQA A;  3P50 A;  5LHG B;  3Q2M A;  2WU5 A;  4FI5 A;  2L9Q A;  2I59 A;  1IJ6 A;  2WSS V;  2ACZ A;  3AXJ A;  2I6H A;  1WLX A;  3AA1 B;  4HFI A;  3JAE A;  3C4X A;  3AVS A;  5LB7 B;  5AQV B;  3T8O A;  4HE8 A;  3ZMU B;  1JNR A;  4HTE A;  3EVY A;  1N34 T;  2Y48 B;  4YLH A;  4OFZ A;  4DV1 T;  3RF1 A;  2KZ7 B;  2LEH A;  5KDM C;  4NUU A;  4DUY T;  3RYF E;  2DI4 A;  2ZM0 A;  3N9Q A;  3SS1 A;  1N32 T;  2BBJ A;  1T7S A;  4CN1 A;  3C50 A;  3AAI A;  2CEA A;  2FJD A;  1N36 T;  3DTO A;  1G73 A;  4WBO A;  1WR0 A;  4HKA A;  4O4H E;  4U2Z A;  4ADZ A;  5AQF B;  5L3B B;  3R6N A;  3GN5 A;  1KNZ A;  3OBV E;  3PUW F;  3B5M A;  1BR1 A;  5HYA A;  4CZZ B;  4CI1 B;  4EB6 E;  4JLE A;  4O2B E;  4KP3 C;  4DMW A;  1LKX A;  3ZN1 B;  3I9Y A;  2L8K A;  1U5P A;  2VB6 A;  2UXN B;  4F52 A;  1VCT A;  2E9X A;  2XQ5 A;  3EDV A;  4P1N A;  1HS7 A;  4JI5 T;  3KV4 A;  1E7P A;  2VWA A;  3AE6 A;  4YHH T;  1I94 T;  4WYV A;  4XZC A;  2YU1 A;  5HCJ A;  2PFV A;  4I4T E;  3CX8 B;  2BG9 E;  2YIN A;  1FMV A;  3AE8 A;  3NVO A;  5C8Y E;  2ZMA A;  2YDQ A;  4AQF A;  3TLW A;  4IST A;  1N33 T;  1D1A A;  5AQJ B;  4U3C A;  2Y8D A;  5AQI B;  5FKY A;  4TWF A;  5ABE A;  5FL1 A;  2XAF B;  3ONL C;  4WZX A;  3FZK B;  5FXW A;  3P4W A;  4OHF A;  3N2O A;  5M4Y A;  2PG8 A;  4PJJ A;  3PUA A;  2R6G F;  3PDY A;  2WZK A;  3RYH E;  3FHN A;  5J1G A;  3UUN A;  3NRX A;  3RQW A;  3EI0 A;  4F8H A;  1FIO A;  3K1S A;  4WW0 A;  2IDO B;  2W67 A;  4UEL A;  3ZMT B;  4IE0 A;  2J1D G;  4DBQ A;  2ACX A;  3EAB A;  4DV2 T;  4YTM A;  5L3E B;  2BZB A;  5AQN B;  2CHO A;  3JCF A;  4N78 D;  3CX6 B;  2X51 A;  4HFD A;  2QGS A;  2GK9 A;  2KWI B;  5KXJ A;  3Q5E A;  2V7K A;  4GOU A;  2X9X A;  4H9R C;  3M3Z B;  4C90 A;  2VVN A;  4GYS A;  5AQK B;  4JBW F;  5CA0 E;  2M6B A;  2CM0 A;  3MKD A;  2VKD A;  3UU4 A;  2LOP A;  2OA5 A;  4Q25 A;  1L0V A;  4CXY A;  2XU0 A;  2BVM A;  4MAL A;  2UXD T;  2IIU A;  1ZEE A;  3SFE A;  4JYA T;  4P0B A;  3OTO T;  2IC9 A;  4ILU A;  4PJL A;  4ILB A;  3RIU A;  1Z0P A;  4JGH D;  1UK5 A;  4NIQ A;  4H63 H;  4I43 B;  2CMR A;  3ZN0 B;  2LKH A;  5JRC B;  4P0A A;  3ZMZ B;  5CFB A;  4I0U A;  3RRW A;  1B7T A;  5JDQ A;  2X9H A;  4O8S A;  3FXE B;  3LDQ B;  3ONX A;  4APF B;  3CPZ A;  5HXR A;  4X64 T;  3AA6 B;  3TLS A;  4ASK A;  4YY3 T;  2VVS A;  4ZI2 D;  3H3A A;  3I1A A;  2ZM6 T;  3K8P C;  2PTF A;  3R84 B;  1Y64 B;  1WCR A;  2H7V C;  3AA7 B;  3HA4 A;  5JR9 B;  5FL0 A;  2D0T A;  3PUV F;  5C3J A;  2LM9 A;  4MFR A;  4WQO D;  2WDV A;  3CML A;  1HX8 A;  2UUB T;  4TNV A;  4A64 A;  3PJA A;  3ZJ1 A;  2C5K T;  4YHJ A;  5A1L A;  4LF9 T;  2FJA A;  2KT9 A;  1V9D A;  3RH3 A;  1KF6 A;  2SPC A;  2WBL A;  4I50 E;  3C64 A;  3VR9 A;  3CKD A;  2Q9Q B;  3WI3 A;  1MIW A;  4DR6 T;  4DO0 A;  3DJB A;  4JEU B;  4OK0 A;  1UCU A;  2ZLY A;  1WYC A;  4I55 E;  4IE7 A;  4ZZC A;  3PUY F;  4NPP A;  3E0Z A;  4OX9 T;  5LYJ E;  1YXR A;  2IUB A;  2XAQ B;  3EAM A;  4L0R A;  5DAB A;  1XZY A;  2WDQ A;  2XQ8 A;  2CPT A;  1HF8 A;  3AEE A;  2BG9 A;  5AFU L;  2XQ3 A;  4X66 T;  4KI0 F;  2QA7 A;  3O1H A;  3PJA J;  3NWI A;  2VK9 A;  3ZCI A;  1D0X A;  4B3T T;  4Z90 A;  1E2A A;  2N1G A;  4UR9 A;  2CRB A;  4IDP A;  2IHR 1;  5ABH A;  4AP2 B;  2LHN A;  3N5L A;  3ABV A;  2Q9Q D;  5LBQ B;  1AJ3 A;  5HAX A;  3P7I A;  3AE5 A;  2VL0 A;  4FJO A;  3D0T A;  1LDK A;  3AED A;  3V5U A;  4CQI A;  3L3P A;  1YQ3 A;  4WBN E;  2RP4 A;  1VOM A;  5FXV A;  5LHH B;  4ANJ A;  3RIF A;  4EXT A;  2VKJ A;  1LRZ A;  3ZPO A;  4ISS A;  4QXH B;  2XAG B;  1ZHC A;  2LRL A;  4K0K T;  4CI2 B;  1R8I A;  3JC6 C;  5FYM A;  4DR3 T;  4AKL A;  5IWA T;  5C2T A;  3CQC B;  3N9O A;  5LGU B;  5J0Z A;  2KSR A;  5E0O A;  1UX5 A;  3UUB A;  3AB3 B;  2BBH A;  2A3D A;  2E9X C;  1MMN A;  3B57 A;  1LDJ A;  4U7I A;  4H9N C;  5L3D B;  2RPA A;  1BR2 A;  5HEU A;  2XQ7 A;  3KBT A;  2MPK A;  4H9S E;  3SOL A;  3RC3 A;  4U74 A;  2HN1 A;  4EED A;  5FY1 A;  3LBX B;  4XAX B;  2C5J A;  2XQ4 A;  5LMN T;  3SFD A;  3MAC A;  4IGU A;  1IAP A;  4ZS3 A;  4AQF C;  1H7C A;  2L3L A;  3OKQ A;  1UX4 A;  4DV4 T;  3VRB A;  1OED E;  4A56 A;  1XMQ T;  4IIJ E;  2KLQ A;  3PTR B;  2WZI A;  4HWF A;  3J9X 1;  3AE9 A;  3LG7 A;  5FXZ A;  4TN7 B;  4TWD A;  4P09 A;  2C0S A;  2WWU A;  3AEA A;  2YK0 A;  1XDP A;  5F5W A;  3DP7 A;  3U3I A;  4B3M T;  4TNW A;  4M1P A;  5LGN B;  2AXD S;  4AIS A;  2VAS A;  3ANW A;  3ZJ2 A;  5AQT B;  3MXZ A;  1NWM X;  2NW8 A;  4PFP A;  3P4S A;  4KBM B;  3KBU A;  3FZH B;  2UXX B;  4IDQ A;  1S35 A;  2OLT A;  4AKG A;  3AE1 A;  4EYY R;  1U6G A;  3NRY A;  3AEG A;  1W0A A;  1WRD A;  3FZF B;  4JI4 T;  4JI1 T;  3ETV A;  4DV6 T;  5IYZ E;  5JRC A;  2PJQ A;  3UU6 A;  2IML A;  2P9B A;  5LP6 E;  4IE6 A;  5KMG P;  3B13 A;  3I0Q A;  4QH5 A;  2V6Y A;  5AQH B;  3RC8 A;  5HXE A;  4KHP T;  5DQW A;  4L5G A;  4HXI B;  2A2F X;  2K48 A;  3K3Q C;  3ZT5 A;  3RYI E;  5HEG A;  1WR6 A;  2PBI A;  4EEB A;  1T98 A;  3DPL C;  1SA0 E;  3TKL B;  5FP3 A;  3RLF F;  5AQQ B;  5HWY A;  3RQU A;  2MTQ A;  2W00 A;  3N9P A;  2B76 A;  4HN9 A;  3RIU C;  3O1I A;  4QXB B;  4EGW A;  4TUY E;  3KDS E;  3AE2 A;  1OXZ A;  5F3J A;  4A98 A;  1IBL T;  4BA9 A;  3MK7 C;  2NTX A;  3UU5 A;  2X0L B;  2W62 A;  2XZE A;  3RTR A;  4YJ2 E;  1VRB A;  4MHC A;  2JPF A;  1D1B A;  4B6X A;  5EK2 A;  4LMJ A;  4JI0 T;  1IBM T;  4Z8X A;  2XAJ B;  3AE7 A;  3ZST A;  3UFE A;  4IDO A;  4U7Y A;  5CJ5 A;  3FXD B;  2XM1 A;  3X1D A;  4IT4 A;  4EIW A;  2LE8 A;  2J47 A;  1UUR A;  2IW5 B;  3UTK A;  4AKR B;  3S4U A;  2VQE T;  4E7Z A;  4IDN A;  3UUL A;  5FY0 A;  1ZP0 A;  3AA0 B;  3J7Y q;  2WB5 A;  1HNZ T;  2V26 A;  2XHE B;  1FJG T;  2WP9 A;  1D1C A;  3HR0 A;  5HXC A;  5JVD E;  5LGT B;  3QNU A;  2X67 A;  3NZP A;  3ZMS B;  2MBG A;  2YU2 A;  5H6Q B;  1YKE B;  3PE0 A;  2BS4 A;  4ILA A;  1GQE A;  4TV9 E;  5LHI B;  1MMD A;  3RI5 A;  3IHR A;  3NBX X;  3RIA A;  2UUC T;  4YSY A;  2XQ9 A;  4DR4 T;  3HI2 A;  4X65 T;  3PUX F;  2NW7 A;  2IAK A;  5HEO A;  2V8S V;  3N2K E;  2V7J A;  4N9F 3;  2EHO D;  3BK9 A;  3LK2 B;  3E08 A;  3IF8 B;  4AIU A;  2BG9 C;  4IDZ A;  1IZN B;  5AQR B;  1HCI A;  1SHZ C;  2YEV C;  2YDR A;  4OYJ A;  3IBP A;  2WCA A;  3N2G E;  5HEJ A;  2NP9 A;  4UEM A;  2CCQ A;  3AXJ B;  4DUZ T;  3UFG A;  2K9A A;  1W9R A;  2LHR A;  2WWV A;  1J5W A;  4QKN A;  2A9U A;  1OED A;  3KVB A;  1G8X A;  2LM2 A;  1IJ5 A;  3I0O A;  3FB2 A;  4UIG A;  3AAE B;  5L47 A;  4L9I A;  2JRK A;  2BS2 A;  2E5L T;  5AQS B;  5CA1 E;  3HL6 A;  1UUS A;  4X20 E;  3ESL A;  4IL4 A;  4X1Y E;  4KMC A;  2ZM8 A;  1HNX T;  3EUH A;  2FUP A;  2MAW A;  5JRE A;  2EHO C;  3ZSS A;  2VKH A;  4ZOL E;  1KK7 A;  2AE9 A;  4ILC A;  4QWN B;  5LG4 A;  3RYC E;  2BVL A;  2WDR A;  1MMG A;  1O3X A;  5J2U E; 
#chains in the Genus database with same CATH homology
 4ANJ A;  3KFW X;  2LEH A;  4QXC B;  5KDM C;  4EXT A;  2VKJ A;  1LRZ A;  3ZPO A;  4NUU A;  4ISS A;  4EYU A;  3OYZ A;  3P8C D;  5LJN A;  4QXH B;  3RYF E;  2DI4 A;  2XAG B;  1ZHC A;  2ZM0 A;  1YW0 A;  3GMI A;  3N9Q A;  3SS1 A;  4CI2 B;  2DLR A;  3AAA B;  3JC6 C;  3V5S A;  5JDM A;  3C50 A;  3AAI A;  5JDL A;  5FYM A;  1YKH B;  2NW9 A;  3F31 A;  3HKC E;  4AKL A;  3AVR A;  2CEA A;  5H6R B;  4H63 V;  3CQC B;  5LBM A;  2X9W A;  3N9O A;  5LGU B;  3DTO A;  1G73 A;  4WBO A;  4HGA A;  4V1A v;  5GON E;  3SRZ A;  4HKA A;  3HKD E;  4O4H E;  5E0O A;  1UX5 A;  4ADZ A;  4PJM A;  5LXT E;  4CXW A;  3AB3 B;  5HWX A;  5L3B B;  2A3D A;  3R6N A;  2E9X C;  1MMN A;  3GN5 A;  1KNZ A;  4OYK A;  2CLY B;  3B57 A;  5JQG E;  2HH7 A;  3LJC A;  4H9N C;  3CVR A;  3I9W A;  3OBV E;  4J2C A;  5L3D B;  1BR2 A;  3QUJ A;  1BR1 A;  5HYA A;  4CZZ B;  4CI1 B;  3KBT A;  4EB6 E;  4JLE A;  3LK4 2;  3BQL A;  3KV9 A;  4H9S E;  3SOL A;  4O2B E;  3CQX C;  3RC3 A;  4U74 A;  2XAS B;  2CLY C;  2G0U A;  2LSY A;  3Q9D A;  4KP3 C;  5FY1 A;  5LCY A;  1LKX A;  4DMW A;  5L3F B;  1ZV4 X;  3ZN1 B;  3O1J A;  3LBX B;  3I9Y A;  4XAX B;  1MNE A;  2XTL A;  4C91 A;  2C5J A;  2L8K A;  3ZCJ A;  4UV8 B;  3W15 B;  5LNK A;  1U5P A;  2VB6 A;  2UXN B;  2E9X A;  2JMH A;  3EDV A;  3MAC A;  3VKG A;  2V1D B;  3IEE A;  2RA1 A;  3UUM A;  1HS7 A;  4IGU A;  2ZM2 A;  4TX5 A;  1IAP A;  3BQI A;  4ZS3 A;  4AQF C;  3KV4 A;  2VWA A;  1H7C A;  2L3L A;  3ANW B;  1D0Z A;  3ZMV B;  1MND A;  3OKQ A;  4F6R C;  1UX4 A;  4XZC A;  2YU1 A;  4IE4 A;  4A56 A;  1NAF A;  3JC6 D;  4IIJ E;  2PFV A;  2KLQ A;  2LSG A;  4I4T E;  3CX8 B;  3PTR B;  2YIN A;  3ZC0 A;  3J9X 1;  1FMV A;  3Q5X A;  2NWB A;  3LG7 A;  2LSI A;  2XAH B;  3KV5 A;  5C8Y E;  4UF0 B;  5HXS A;  3LBX A;  5FXZ A;  5JDG A;  4JEH B;  3C51 A;  2ZMA A;  4AQF A;  4TN7 B;  4IST A;  4P09 A;  2C0S A;  2WWU A;  1D1A A;  3WAK A;  2DWK A;  2Y8D A;  2YK0 A;  4ZI7 E;  3DP7 A;  2E9X D;  3U3I A;  4GIW A;  4K0U A;  3K3O A;  4M1P A;  2XAF B;  5LGN B;  4EAH A;  4CXX A;  2VAS A;  3ANW A;  2DNX A;  2K5B B;  5FXW A;  5LA6 E;  3ZJ2 A;  5J2T E;  3RRC A;  1ZKE A;  4OHF A;  3N2O A;  1MIY A;  2DWG A;  1WYB A;  3MXZ A;  5M4Y A;  1NWM X;  2NW8 A;  2PG8 A;  4PFP A;  3C98 B;  4KBM B;  4PJJ A;  3KBU A;  3C4W A;  3PUA A;  4MLK A;  4ZHQ E;  3QK6 A;  2UXX B;  3PDY A;  3PUG A;  3GN5 B;  3ZLI A;  2HPJ A;  2KND A;  1S35 A;  5JDF A;  3RYH E;  3ZYK A;  3E22 E;  3FHN A;  4AKG A;  1X79 A;  4BJM A;  5J1G A;  4PK6 A;  3UUN A;  3NRX A;  4EYY R;  3NRY A;  1FIO A;  5FMN A;  1WRD A;  2CA5 A;  4WW0 A;  4UEL A;  3ZMT B;  3ETV A;  3L09 A;  4XBF B;  5IYZ E;  5JRC A;  3FBZ A;  3GA8 A;  4IE0 A;  2J1D G;  2PJQ A;  2ACX A;  3PUS A;  4DBQ A;  5LJM A;  3M65 A;  2P9B A;  2ODV A;  5LP6 E;  1US7 B;  2CWO A;  2E9X B;  4IE6 A;  5KMG P;  5L3E B;  3B13 A;  3I0Q A;  4U72 A;  3ZEF B;  3RC8 A;  2BZB A;  5JDN A;  5HXE A;  5L3G B;  2JQQ A;  4JUY A;  4UVA B;  4WNK A;  1HTJ F;  4N78 D;  1FMW A;  3CX6 B;  4DND A;  2X51 A;  2D5U A;  5L2L A;  5DQW A;  5EZY E;  4L5G A;  3K3N A;  2QGS A;  2HPL A;  2GK9 A;  2A2F X;  2K48 A;  2KWI B;  3K3Q C;  3KIN B;  4HEA A;  5IHY A;  4NUV A;  3KV6 A;  4PJN A;  2V7K A;  3RYI E;  4GOU A;  4IE5 A;  1WR6 A;  2PBI A;  4UV9 B;  1T98 A;  1SA0 E;  3TKL B;  5FP3 A;  3UUX B;  4DBR A;  2X9X A;  4H9R C;  2KXP B;  4ZI2 C;  5HWY A;  4C90 A;  4ERR A;  4PW8 A;  4GYS A;  2MTQ A;  3MZK B;  2D2S A;  4X1I E;  2W00 A;  3N9P A;  5CA0 E;  2CM0 A;  4X1K E;  2IC6 A;  3MKD A;  4HN9 A;  4BJN A;  3HKB E;  2VKD A;  1MMA A;  3F2E A;  3O1I A;  4EZH A;  4AI6 A;  2LOP A;  1LVF A;  4H9O C;  2OA5 A;  4QXB B;  2ES0 A;  5LOV E;  2KWH A;  4TUY E;  3KDS E;  3LK3 B;  4GK5 E;  1MIV A;  1OXZ A;  5F3J A;  5TAO A;  3N9L A;  5DQV A;  4CXY A;  3A5X A;  3MJX A;  4BA9 A;  3MK7 C;  2XU0 A;  2NTX A;  2BDE A;  2BVM A;  2CXL A;  3OYX A;  2JMK A;  4MAL A;  3MA9 A;  2X0L B;  1ZEE A;  2W62 A;  2Y6X A;  3VU7 H;  3QC9 A;  4YJ2 E;  1VRB A;  2VL8 A;  4MHC A;  4P0B A;  3O9X A;  2IC9 A;  4ILU A;  4PJL A;  4QX7 B;  5FNV E;  3FBL A;  4AKI A;  2JPF A;  1Z0P A;  2NTY A;  3RPU A;  1D1B A;  3OJA A;  2LT3 A;  4H63 H;  4I43 B;  4B6X A;  4PAG A;  5EK2 A;  2CE7 A;  2V7L A;  2CMR A;  4O4I E;  3RX6 A;  4E7S A;  2DCF A;  5HXH A;  3CQG B;  4Z8X A;  2XAJ B;  3ZN0 B;  3UFE A;  5JRC B;  4P0A A;  2LOS A;  3ZMZ B;  3FXD B;  4ZI3 D;  2JJ9 A;  4GK0 E;  2W63 A;  3RRW A;  1B7T A;  4DVD A;  2D0U A;  4EIW A;  5JDQ A;  2LE8 A;  2N2N A;  2X9H A;  4O8S A;  3FXE B;  2IW5 B;  4PFO A;  3UTK A;  3VHL A;  4AKR B;  3ONX A;  3S4U A;  2WMO A;  5EK3 A;  3CPZ A;  5HXR A;  3AA6 B;  5DJQ C;  4ASK A;  4E7Z A;  4DMV A;  4ZI2 D;  2H3R A;  3H3A A;  3UUL A;  3I1A A;  5JDH A;  1S94 A;  5FY0 A;  3AA0 B;  3J7Y q;  2ODU A;  3K8P C;  4BAY B;  3R84 B;  2KIN B;  3CWZ B;  1Y64 B;  3NZQ A;  3PUQ A;  1HFA A;  2V7M A;  2H7V C;  3AA7 B;  3SWH A;  3HA4 A;  5JR9 B;  2M67 A;  2X9Y A;  2V26 A;  5JH7 E;  3BQK A;  2VKO A;  2CWY A;  2XHE B;  1D1C A;  2D0T A;  3HR0 A;  2LM9 A;  4MFR A;  5HXC A;  5JVD E;  5LGT B;  3CML A;  2X67 A;  3NZP A;  1HX8 A;  3ZMS B;  1HG2 A;  1LVK A;  2CXF A;  5JR9 C;  3LFM A;  5EK4 A;  2MBG A;  2YU2 A;  1BR4 A;  3CX7 B;  5H6Q B;  4TZ4 C;  1FEW A;  4TV8 E;  1YKE B;  3PE0 A;  5FY7 A;  1HG5 A;  2KMF A;  2V7I A;  4HFV A;  5L3C B;  2EHO A;  3GWH A;  3ZJ1 A;  3Q5W A;  3ZYL A;  3ZYM A;  2C5K T;  3F57 A;  4YHJ A;  4TV9 E;  4AQG A;  5LHI B;  2LSJ A;  1MMD A;  1QUU A;  2X66 A;  2WMN A;  5A1L A;  4O4L E;  2KT9 A;  1BR0 A;  4G2A A;  3N9M A;  1V9D A;  3IHR A;  3RH3 A;  4ZI3 C;  3VKH A;  5JR9 A;  2SPC A;  4UXN B;  3U78 A;  3NBX X;  1E1H B;  2WBL A;  4ZS2 A;  4PNI A;  4I50 E;  2MYS A;  1OWA A;  5BMV E;  4UVB B;  3HI2 A;  3C64 A;  2NW7 A;  2WM9 A;  5ADX L;  3CKD A;  2Q9Q B;  2XQY A;  2IAK A;  3N9N A;  3WI3 A;  4EOZ B;  3C4Z A;  1MIW A;  3PU3 A;  4DO0 A;  3N2K E;  3EDU A;  4EZ4 A;  2LSK A;  3DJB A;  4JEU B;  2X68 A;  3WAJ A;  4OK0 A;  1UCU A;  2ZLY A;  2NOX A;  2Q9Q C;  4QX8 B;  1WYC A;  2V7J A;  4I55 E;  3ZC1 A;  4IE7 A;  3O4X E;  2WAU A;  4H9Q C;  2EHO D;  2LJL A;  4G63 A;  3BK9 A;  3LK2 B;  2CXD A;  3E08 A;  3IF8 B;  4IDZ A;  1IZN B;  1YD8 G;  2N9D A;  3KVA A;  1HCI A;  1D0Y A;  1SHZ C;  2YEV C;  2XUE A;  3E0Z A;  4OYJ A;  5ETW A;  3IBP A;  3UT5 E;  3PUR A;  5LYJ E;  3N2G E;  2NP9 A;  4PK5 A;  4AKH A;  2Q9Q A;  4KUM B;  4QHO A;  2CCQ A;  2XAQ B;  4UEM A;  5F8P A;  2K9A A;  2LHR A;  4L0R A;  5DAB A;  4QKN A;  1EZ3 A;  3KVB A;  2E8I A;  2W61 A;  1G8X A;  1HF8 A;  2DHR A;  1IJ5 A;  4GYR A;  3I0O A;  3RKO A;  3FB2 A;  4UIG A;  3AAE B;  4PK4 A;  5AFU L;  5CB4 E;  4L9I A;  2JRK A;  2QA7 A;  4CI3 B;  3O1H A;  2K24 A;  4IHJ E;  2C5I T;  2VK9 A;  5KX5 E;  1CUN A;  2Z6E A;  4H9P C;  3ZCI A;  1QSD A;  1D0X A;  2W0G A;  5LHG B;  2N1G A;  3HL6 A;  5CA1 E;  4X20 E;  3Q2M A;  4O2A E;  4AXP A;  3PU8 A;  3ESL A;  4FI5 A;  4O4J E;  2EHO B;  3H37 A;  1U4Q A;  2L9Q A;  4X1Y E;  4KMC A;  2I59 A;  2ZM8 A;  1IJ6 A;  2LHN A;  2WSS V;  4YFS A;  3N5L A;  3EUH A;  2H7O A;  3ETU A;  1WLX A;  5LBQ B;  2Q9Q D;  3AA1 B;  1AJ3 A;  5HAX A;  2A72 A;  5JRE A;  2EHO C;  3C4X A;  2MOZ A;  3P7I A;  2VKH A;  3AVS A;  4FJO A;  4ZOL E;  3T8O A;  4HE8 A;  1KK7 A;  4UVC B;  4YJ3 E;  3D0T A;  2B1E A;  3HKE E;  3ZMU B;  4QWN B;  4HTE A;  3RYC E;  5LG4 A;  3EVY A;  2Y48 B;  4YLH A;  3V5U A;  4OFZ A;  2BVL A;  4CQI A;  3L3P A;  5FXX A;  1MMG A;  4WBN E;  1O3X A;  2KZ7 B;  2RP4 A;  1VOM A;  4MBQ A;  4UF0 A;  5FXV A;  5J2U E;  5LHH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...