4YFSA

Structure of the synthetic duffy binding protein (dbp) antigen deknull relevant for malaria vaccine design
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
294
structure length
285
Chain Sequence
KNCNYKRKRRERDWDCNTKKDVCIPDRRYQLCMKELTNLHRDITFRKLYLKRKLIYDAAVEGDLLLKLNNYRYNKDFCKDIRWSLGDFGDIIMGTDMEGIGYSKVVENNLRSIFGTASTAATSRTSWWNESKAQIWTAMMYSVKKRLKGNFIWICKLNVAVNIEPQIYRWIREWGRDYVSELPTEVQKLKEKCDGKINYTDKKVCKVPPCQNACKSYDQWITRKKNQWDVLSNKFISVKNAEKVQTAIVTPYDILKQELDEFNEVAFENEINKRDGAYIELCVCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Duffy receptor
publication title Structural Analysis of the Synthetic Duffy Binding Protein (DBP) Antigen DEKnull Relevant for Plasmodium vivax Malaria Vaccine Design.
pubmed doi rcsb
source organism Plasmodium vivax
molecule tags Erythrocyte binding protein
total genus 120
structure length 285
sequence length 294
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05424 Duffy_binding Duffy binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.830 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4yfsA02
1.20.1310.20 Mainly Alpha Up-down Bundle 5 helical Cullin repeat like 5 helical Cullin repeat like 4yfsA01
3BQLA 2Y8DA 2YK0A 2WAUA 3CPZA 4NUVA 3BQIA 3BQKA 3RRCA 4NUUA 5F3JA 2XU0A 3CMLA 3C64A 4YFSA
chains in the Genus database with same CATH superfamily
2QGSA 1HNZT 2UUAT 2IC9A 4UVCB 2BVLA 3PJAJ 4WQOD 3TLVA 5JDNA 4HTEA 1XNQT 5ABGA 1IAPA 4H9NC 5HCJA 2W00A 1D0YA 5AQMB 5J1GA 5LJNA 4OFZA 2XQ4A 4UV8B 2W62A 3TLWA 2J62A 3OYXA 3Q5WA 2E2AA 1V9DA 4ILBA 4X20E 4YTPA 4AP2B 2XTLA 3JAEA 2Z6EA 2YEVC 5FKYA 4UVBB 5LG4A 3KINB 4EAHA 2XQ6A 4J2CA 1M62A 4X62T 1D1AA 2BS2A 3C4WA 2XY8B 5AQTB 3AXJA 5FXVA 5LMNT 2W66A 3K3QC 4ZI3D 4IL4A 2QRXA 4HWCA 4O2AE 4CN1A 3LG7A 3ZKRA 3ETUA 3PUZF 3E08A 4QXHB 3UFGA 5ABFA 3U78A 2YDQA 2XAQB 3AA7B 5JRCB 4DUZT 2KZ7B 4UIGA 4NXMT 1XDPA 3PUSA 4AKHA 2LT3A 3A5XA 2CPTA 5AQPB 4L9IA 3SRZA 4YTMA 2ZM0A 3UU6A 4ISTA 4MBQA 4TN7B 3HR0A 3ESLA 2V8SV 3P4WA 2E9XD 3GWHA 4EXTA 4ISSA 2UXXB 2JMKA 4U31A 4N78D 1GQEA 1Y64B 3J7Yq 2NTYA 4P1NA 3B13A 2WDRA 2CXLA 3EDUA 4ZI7E 1FJGT 4IDQA 3ZMUB 3AXJB 4WBOA 4GYRA 3OVUA 4ZXLA 2H88A 4CI3B 2CHNA 3ZSSA 1IJ6A 3EHZA 4LFAT 5F3JA 4CXWA 1ZP0A 1E1HB 4NPPA 4UXNB 5ABFB 3EABA 4ILAA 2X66A 4N9F3 4BJNA 2WMNA 4YHJA 3E22E 1X9BA 2BG9E 2YDSA 2YKSA 3NKZA 3SS1A 1KFYA 5FXWA 5CA1E 3NZQA 4OK0A 2FJEA 4O4IE 5BR8T 4TNVA 4MHCA 3ONJA 3UFEA 5JDQA 4U74A 4HFIA 3RHWA 3T1YT 2BS3A 1OXZA 2OV9A 2QVAA 3FBLA 4NXNT 2FJBA 2IDOB 2LSKA 4I50E 4JEUB 5EK2A 1NEKA 3MK7C 4AXPA 5HEGA 2FJAA 2OLTA 3I0QA 3VKGA 4O4JE 1HNWT 1UK5A 5TAOA 2LOPA 3AE9A 3AEFA 3N9MA 4KP3C 3RH3A 4X1YE 1W0AA 4B3ST 5H6RB 4P0AA 3ZCIA 4H9SE 4AQFC 1FMWA 2V7IA 3DQVC 2WZHA 4DR3T 1D1BA 1HNXT 1MMAA 5J2TE 3FB2A 4QH5A 3ZJ1A 4LFCT 5FY7A 1MMGA 2MTQA 1T72A 4ZEYA 1JNRA 4QX8B 2XQAA 4DR7T 3O1JA 3HKCE 5EK3A 4CQIA 4KHZF 3EI0A 3AE6A 4AQGA 4YXDA 3AVSA 3VRBA 4B3RT 2E9XC 3N2KE 2CWYA 2DWKA 3KV9A 2LKGA 4YJ3E 2F4VT 2LEHA 2WU5A 2EHOD 5HEHA 3UUNA 2Q9QD 3ZCJA 3CX6B 5FNVE 2X9XA 3C4XA 1IBKT 2LHRA 4GOUA 2ZM8A 3OKQA 3MACA 2VL8A 4YFSA 2I0MA 2JPFA 5ADXL 4DMVA 1XDOA 3DPLC 2IHR1 3K3NA 3FZFB 2BDEA 4EYUA 3RIAA 1T7SA 4JI2T 2DWGA 3NWIA 5CA0E 3UUXB 2BBHA 2DI4A 2WZIA 1UURA 2XAGB 3N2GE 3PUGA 5L3CB 3OJAA 3UU4A 3AA0B 2CWOA 3P4RA 3SFDA 4UVAB 1BR4A 3FXDB 2V1DB 2X67A 2JQ9A 4WW0A 4CZZB 1UCUA 2WU2A 1U6GA 5LXTE 4F6RC 3KDSE 2V7JA 3CQGB 5L3DB 2JQKA 4G2AA 3L39A 3N9LA 2YU1A 5HWXA 5JDLA 4LF9T 3AE7A 2IIUA 3DP7A 5LYJE 1UGOA 3MA9A 1UUSA 2UUBT 1WR6A 5LMUT 2NP9A 4DV4T 3NVOA 2XSBA 2KSRA 4EV6A 2UXCT 3ZN1B 5F8PA 3L8RA 3LFMA 1VOMA 2XM1A 3ABVA 2FBWA 4JI3T 2XAFB 3RPUA 3P4QA 4L5GA 1VCSA 5AQUB 2HN2A 3WAKA 3AEGA 2J4GA 2LSIA 3AEEA 1WLXA 5LOVE 2XM2A 3HKDE 2FJDA 2ACZA 2LM9A 2LRKA 5LGUB 2PJQA 4G63A 5AQNB 4KMCA 4MLKA 1T98A 4A64A 2CLYB 4PK6A 4YSZA 4K0UA 2EHOC 2BG9C 2VKHA 3QB5A 2Q9QC 5CB4E 2XQ5A 3P4PA 1JNZA 2N2NA 2XHEB 4ASKA 2XU0A 4UEMA 3RC3A 3BQLA 4ZZBA 3FZLB 2CMRA 4IL9A 1YQ4A 1YKHB 5AQIB 3KVAA 4DV5T 4P0BA 4LF6T 1HCIA 3OTOT 3LK3B 2G0UA 2IC6A 2WZKA 2JQQA 1BR0A 1MIWA 2VVSA 1SHZC 1G8XA 5CJ5A 3RYFE 2LSJA 2ZM6T 4HKAA 3PU3A 2IAKA 2ODVA 4ZS2A 4DR6T 4KI0F 4DNDA 3PUXF 2X9WA 5AQLB 2YN6A 3I1AA 4IE0A 2WY2A 3RKOA 5KDMC 3RGLA 2WDVA 2NTXA 2AXDS 2WS3A 3LJCA 2XSAA 4NUUA 2UXDT 4IREA 1ZV4X 4DV0T 4P09A 5HXHA 3ETVA 4CXYA 4AI6A 1XMQT 3X1DA 3A8YC 2I59A 5AQOB 3RTRA 5LHHB 1HF8A 3UULA 1X79A 3R6NA 4PNIA 3RYHE 3PTRB 4KUMB 5JDFA 1YQ3A 3RX6A 4IDNA 2X51A 2CA5A 1ZHCA 5EZYE 2CM0A 1NENA 2BBJA 1R8IA 4O4LE 2W61A 4BJMA 1MMNA 3FZKB 2XJ7A 3VR9A 1WFDA 1L0VA 2N1GA 5HXSA 2XQ3A 3ZPOA 3RYIE 3E0ZA 3P50A 4IE5A 3Q5DA 3Q5EA 4DV1T 5DABA 2V5CA 4F8HA 2VWAA 5H6QB 3KV4A 4PJMA 3LDQB 5BMVE 3OPCA 4K0KT 4LMKA 1T8BA 3UU8A 3UU3A 2K3WA 2K24A 3ZYKA 2W2UA 3N9PA 2E5VA 5HYAA 5KXJA 3BK9A 3PURA 3V5SA 3UQ7A 2C5IT 3NRXA 4LF8T 2BKNA 5LA6E 3IA3A 4HXIB 2FUPA 3BQKA 5JDMA 3FXEB 4M1PA 3TKLB 1H7CA 2L8KA 3GMIA 3SFEA 5L4HA 2X68A 4DUYT 1Z0PA 2VASA 4JLEA 5HEOA 4ZI2D 1WYCA 4X1KE 1KF6A 4PJNA 1Y01A 1WRDA 1KK7A 2WM9A 4QXCB 4PK5A 2NW9A 1WCRA 2W67A 3C98B 2XAHB 3QK6A 3O9XA 1FMVA 4PJLA 3MJXA 4E7SA 2R6GF 4ANJA 3RYCE 4E7ZA 2L3LA 4H9PC 4EB6E 4EYYR 5J0ZA 4FI5A 3IEEA 3VKHA 2NW7A 2K5BB 2C5JA 4JUYA 2WP9A 4ZS3A 3N9OA 4TWFA 3VRAA 1LKXA 5AQFB 2VURA 1FEWA 4O8SA 2DNXA 3AEDA 4H9QC 4HWIB 5FVLA 1N36T 2A3DA 5FY1A 3O1HA 2QYWA 2H89A 4PFPA 2XZEA 5JDHA 4JI7T 5LBMA 4EEDA 4IHJE 4UF0A 5CGMA 2H3RA 4DR1T 3I9WA 5AQGB 4GK0E 4QH4A 5IYZE 2LM2A 4CN4A 2D5UA 3SWHA 1KEYA 4Q25A 4WBNE 3P7IA 5LHGB 4YT0A 1J1JA 2LLYA 3L09A 3AB3B 3BQIA 3AE3A 3AECA 4TV8E 1LVKA 5LCYA 3MZKB 3VU7H 2V7LA 4QKNA 4YSXA 3ZT5A 4V1Av 3CPZA 1MNEA 4JYAT 3EDVA 4PJJA 5DQWA 3Q5XA 2CBJA 4O4HE 4AQYT 2WBLA 2KWHA 4OYJA 5JR9A 5LHIB 3RLFF 1VCTA 3C64A 1XWMA 3RIUA 3RI5A 4JI6T 2E5LT 4UF0B 4ILUA 3P8CD 4ZI2C 2LHNA 5AQJB 3PUWF 5FXXA 3C4ZA 3KVBA 4HFDA 3AE1A 3A7MA 4CI1B 2V7MA 4CN6A 2HPJA 2K48A 2M67A 3AAIA 2HN1A 3N9NA 4PW8A 3AAEB 3CIRA 1CHUA 4TZ4C 4IIJE 2VK9A 3PUAA 1MMDA 3I9YA 5AQSB 4TX5A 5JTGA 3MKDA 4U7IA 2M6BA 5C2TA 4X64T 2IMLA 2ZLYA 4MALA 1SE7A 3AE8A 1OEDA 3CQCB 2X0HA 3RQWA 2SPCA 3J9X1 5HWYA 2BVMA 1OWAA 4EOZB 5C3JA 5JR9B 2DLRA 2JMHA 2B1EA 4JI4T 1KNRA 2YDRA 1HX8A 2PBIA 2PTFA 3OBVE 1N33T 4UV9B 2J1DG 3QB5K 3JCFA 4KX6A 2L9QA 3H3AA 2Y6XA 3AE2A 3UUMA 2WWVA 4WZXA 5DJQC 3ZEFB 4HWDA 1KNPA 4UELA 2UUCT 2KINB 2LSGA 2J47A 2PG8A 4TUYE 1SA0E 1OEDC 4TV9E 3LK2B 1Z8UA 3NZPA 2A2FX 3UUBA 3ZYMA 2CLYC 5IUXA 2CRBA 4LMJA 4B3TT 1W9RA 3UU5A 5FL0A 4HGAA 2XPKA 2RA1A 2YOEA 2BKPA 4CXXA 1OEDB 4HFBA 5ABHA 2WMOA 4YHHT 4LMLA 1J5WA 4IE7A 3T8OA 1CUNA 5JDGA 4XZCA 3JC6D 2PFVA 1D1CA 2MAWA 3L3PA 1N32T 2MPKA 4OX9T 5LNKA 3M65A 4HWHA 4JBWF 4U33A 2RPAA 5AQVB 3B57A 4A98A 3QC9A 5FL1A 4KHPT 5HXRA 2X0YA 1BR1A 3KFWX 3KBTA 4H9RC 1XZYA 1LDJA 1MIVA 3VHLA 3N5LA 1AJ3A 1BR2A 2A9UA 3CK6A 3AEAA 4HFHA 2VKJA 3JAFA 3PE0A 3PUYF 5JVDE 1IBMT 1HS7A 3CQXC 2WQYA 2N9DA 4IT4A 3LBXA 4JI5T 2W63A 2YU2A 1FIOA 3UTKA 2ACXA 2DHRA 1HTJF 3EVYA 2KWIB 4COFA 2V26A 3FZHB 1NWMX 4O2BE 3H3MA 2W0GA 3MXZA 1G73A 2VQET 4HFVA 4XBFB 4HN9A 2CXDA 3HI2A 3ZJ2A 4DMWA 3CKDA 4U72A 4WNKA 4DR2T 5HEJA 2C0SA 2JIWA 3HA4A 2YK0A 5DQVA 1ZEEA 4QX7B 3PUVF 2V6XA 3IHRA 5AQQB 2XQ8A 3F2EA 2V5DA 5FVKA 2WDQA 5HEUA 5LGTB 4B3MT 2VL0A 5CFBA 3CX7B 1D0XA 4OHFA 3M3ZB 4X5TA 4ZHQE 3ZYLA 5A1LA 3DTOA 2XAJB 3LBXB 1D0ZA 4LF5T 4L0RA 2UU9T 3RQUA 2LSYA 2CXFA 2KNDA 3PU8A 4QH1A 4LF4T 2CHOA 3Q9DA 2H7OA 2BS4A 2X9YA 2GK9A 3JC6C 2VVNA 2KXPB 1WR0A 1XMOT 3QNUA 2DCFA 2ODUA 3KV6A 2CEAA 3C50A 4JV5T 1MNDA 3V5UA 5LP6E 4JEHB 2VB6A 2D0UA 2V6YA 2MYSA 1NAFA 1OEDE 2RP4A 3S4UA 3GA8A 2LRLA 4LF7T 2HH7A 4TNWA 1S94A 4DO0A 1YD8G 4C90A 4XAXB 3QOFA 5ETWA 3QUJA 2LJLA 3U3IA 4PAGA 2LOSA 4HE8A 3VR8A 3RIFA 3K1SA 3LSVA 2AE9A 3KV5A 5L3FB 2X0LB 5IHYA 4DR5T 5M4YA 3O1IA 4A5XA 3LK42 5J2UE 3ZMTB 3PJAA 2NW8A 3TLSA 2HHHT 1WYBA 5FMNA 5AQKB 3TLTA 3PDYA 5KMGP 4NUVA 1HR0T 3IBPA 4AKIA 2UXBT 5JREA 4B6XA 3K3OA 1N34T 5AQRB 2IW5B 4X66T 1J5ET 4KBMB 2QA7A 1IZNB 3EUHA 2V6YB 2D9DA 4YLHA 4U2ZA 4H63H 4LFBT 2VKOA 1M7KA 4H9OC 1I94T 1YW0A 4AQFA 4EZHA 3D0TA 5HXEA 3ANWA 3WAJA 5FP3A 1U5PA 4AKGA 2KMFA 4OYKA 3EAMA 4X65T 2BZBA 4BAYB 4DBQA 2WAUA 1B7TA 3T1HT 4IGUA 5LG3A 4ADZA 1YKEB 2DL1A 1DU2A 4YSYA 3HKBE 4U2YA 2E8IA 5FYMA 4IDOA 3HKEE 1EZ3A 2E9XA 5AQHB 4GYSA 3ZT7A 4ZI3C 3RKGA 3IF8B 4HWFA 2XUEA 2MOZA 4DVDA 1VRBA 2W4XA 2K9AA 4IDZA 4CI2B 4HFCA 4JGHD 4Z8XA 1QSDA 3AE5A 5E0OA 4U3CA 5F5WA 3CWZB 5KX5E 2ZMAA 2KT9A 4YTNA 5FY0A 3ANWB 3GN5A 4Z90A 2ZM2A 3ONXA 1YXRA 1E2AA 1HFAA 3B5MA 4Z91A 4WYVA 3TLUA 3CVRA 4QXBB 4BA9A 3FHNA 4IDPA 1SUMB 2VKDA 2JRKA 3ZMSB 5L3BB 4YY3T 4F52A 2WSSV 3DJBA 5L3GB 4DV6T 4APFB 5LB7B 3JADA 4MFRA 2E9XB 3AVRA 2HPLA 4AKLA 3CX8B 4AISA 4YJ2E 4I4TE 3R84B 3OYZA 3AA1B 3ZMVB 4IE6A 4TWDA 2CBIA 4DV7T 1HG5A 4HFEA 5ABEA 5JR9C 5GONE 1LDKA 4EGWA 4UR9A 3RIUC 4X1IE 2JQHA 5JH7E 3RRWA 4P5OA 4C91A 2M6IA 3GN5B 4TWHA 3AAAB 1XNRT 1KNZA 4AIUA 1I6ZA 4I43B 4NIQA 2WCAA 2ES0A 4A97A 4I55E 3HL6A 1ZOYA 5L2LA 2CCQA 5LGNB 4QWNB 3AA6B 5AFUL 2KLQA 4PFOA 4ZZCA 1LVFA 2Y48B 3ZT6A 1QLBA 4EIWA 5HAXA 4EEBA 3F57A 2LE8A 3W15B 4ERRA 3NBXX 3UT5E 3ZSTA 3SOLA 2CE7A 3ZLIA 3NRYA 1W0BA 4I0UA 2BKOA 2H7VC 3ONLC 4PK4A 4H63V 2EHOA 5JQGE 3PUQA 4DV2T 2BG9A 1LDKB 3ZC1A 2D0TA 2OA5A 2Q9QA 3G06A 3ZMZB 2XQ7A 3Q2MA 3N9QA 1IJ5A 2MBGA 3AEBA 3RF1A 3ZN0B 3FBZA 1QUUA 5FXZA 1E7PA 5LBQB 2A72A 1O3XA 3O4XE 2C5KT 5HCMA 2WWUA 2NWBA 3P4SA 2P9BA 5L3EB 4JI1T 4DBRA 1HG2A 2D2SA 3KBUA 5LJMA 5L4EA 1LRZA 1UX5A 1W09A 2XASB 4HEAA 1UX4A 2NOXA 4GKJT 4GK5E 2VQFT 3WI3A 3UQ4A 2XQ9A 4GIWA 3RRCA 1IBLT 5L47A 5EK4A 2I6HA 1HX1B 1MIYA 4GKKT 1ZKEA 1US7B 4DIDB 2EHOB 3H37A 2BG9B 3CMLA 3RC8A 4JI8T 1U4QA 2Q9QB 4U7YA 2X9HA 4JI0T 4IE4A 4DV3T 2UXNB 3C51A 5IWAT 3AE4A 4DR4T 3N2OA 3FZMB 3PV0F 3K8PC 5HXCA 2IUBA 2XQYA 2B76A 1S35A 4QHOA 3I0OA 2JJ9A 5C8YE 4AKRB 4ZOLE 4EZ4A 4A56A 2LKHA 4ILCA 3ZC0A 5JRCA 4FJOA 2V7KA 2Y8DA 2NR4A 3F31A 2YINA 2WB5A
chains in the Genus database with same CATH topology
3Q5XA 2QGSA 2LSIA 4O4HE 5FMNA 2IC9A 1WLXA 2WBLA 3PDYA 5LOVE 4UVCB 2BVLA 5KMGP 3HKDE 4NUVA 3IBPA 2LM9A 4AKIA 2KWHA 4OYJA 5JDNA 5JR9A 4HTEA 5LGUB 5LHIB 5JREA 1IAPA 2PJQA 4B6XA 4H9NC 4G63A 2W00A 3K3OA 1D0YA 5J1GA 5LJNA 3C64A 4OFZA 4UV8B 2W62A 4KMCA 4MLKA 2IW5B 3OYXA 3Q5WA 4KBMB 1V9DA 4X20E 4UF0B 1T98A 2CLYB 4ILUA 2XTLA 2QA7A 3P8CD 1IZNB 3EUHA 2Z6EA 4ZI2C 4PK6A 2YEVC 4K0UA 2LHNA 4YLHA 4UVBB 5LG4A 2EHOC 3KINB 4H63H 4EAHA 5FXXA 2VKOA 3C4ZA 4J2CA 3KVBA 2VKHA 4CI1B 1D1AA 2V7MA 4H9OC 2Q9QC 3C4WA 1YW0A 5CB4E 2HPJA 2K48A 4AQFA 5FXVA 3D0TA 4EZHA 5HXEA 2M67A 3ANWA 3AAIA 3K3QC 3N9NA 4ZI3D 4PW8A 3WAJA 5FP3A 1U5PA 3AAEB 4O2AE 2N2NA 4AKGA 2XHEB 2KMFA 4OYKA 4ASKA 3LG7A 2XU0A 2BZBA 4BAYB 3ETUA 4UEMA 3RC3A 4DBQA 3E08A 3BQLA 2WAUA 2CMRA 4TZ4C 4QXHB 3U78A 1B7TA 2VK9A 4IIJE 3PUAA 2XAQB 1MMDA 1YKHB 3I9YA 3AA7B 4IGUA 5JRCB 2KZ7B 3KVAA 4UIGA 4ADZA 1YKEB 3PUSA 4P0BA 4TX5A 4AKHA 3MKDA 2LT3A 1HCIA 3A5XA 2ZLYA 3LK3B 3HKBE 2E8IA 2G0UA 2IC6A 4MALA 5FYMA 4L9IA 2JQQA 1BR0A 3SRZA 3CQCB 1MIWA 2SPCA 3J9X1 5HWYA 2BVMA 1SHZC 2ZM0A 3HKEE 1G8XA 3RYFE 4ISTA 1EZ3A 1OWAA 2E9XA 4MBQA 4GYSA 2LSJA 4TN7B 4EOZB 3HR0A 5JR9B 2DLRA 3ESLA 4HKAA 2JMHA 2B1EA 3PU3A 2IAKA 2ODVA 2E9XD 3GWHA 4ZI3C 4EXTA 4ZS2A 3IF8B 1HX8A 2PBIA 4DNDA 2XUEA 4ISSA 2MOZA 2UXXB 2X9WA 4DVDA 1VRBA 3OBVE 2JMKA 4UV9B 2J1DG 4N78D 3I1AA 4IE0A 2K9AA 4IDZA 1Y64B 4CI2B 3J7Yq 2NTYA 4Z8XA 2L9QA 3RKOA 3H3AA 1QSDA 2Y6XA 3UUMA 5E0OA 3B13A 5KDMC 2CXLA 3EDUA 3CWZB 5KX5E 2NTXA 4ZI7E 2ZMAA 5DJQC 2KT9A 3ZEFB 4UELA 3ZMUB 2KINB 5FY0A 3LJCA 2LSGA 4NUUA 4WBOA 2PG8A 4GYRA 4TUYE 1SA0E 1ZV4X 3ANWB 4P09A 5HXHA 3ETVA 4TV9E 4CI3B 4CXYA 4AI6A 3LK2B 3GN5A 2A2FX 2ZM2A 3NZPA 1IJ6A 2I59A 3ONXA 1HFAA 3ZYMA 2CLYC 5LHHB 5F3JA 1HF8A 4CXWA 1E1HB 3UULA 1X79A 4UXNB 3CVRA 4QXBB 3R6NA 4BA9A 3FHNA 4PNIA 2X66A 3RYHE 2VKDA 3PTRB 4KUMB 5JDFA 2WMNA 2JRKA 3ZMSB 4HGAA 4YHJA 4BJNA 3E22E 2RA1A 3RX6A 2X51A 5L3BB 2CA5A 2WSSV 3DJBA 4CXXA 1ZHCA 5EZYE 2CM0A 5L3GB 3SS1A 5FXWA 5CA1E 3NZQA 4MFRA 2E9XB 3AVRA 4OK0A 4O4IE 2HPLA 4AKLA 4MHCA 4O4LE 2WMOA 3CX8B 2W61A 3UFEA 5JDQA 4BJMA 1MMNA 4I4TE 4U74A 4YJ2E 4IE7A 3T8OA 3R84B 1CUNA 1OXZA 3OYZA 3AA1B 5JDGA 4XZCA 3JC6D 2PFVA 2N1GA 3ZMVB 5HXSA 3FBLA 4IE6A 1D1CA 1HG5A 3L3PA 3ZPOA 2LSKA 4I50E 4JEUB 5EK2A 5LNKA 3M65A 3RYIE 3MK7C 5JR9C 3E0ZA 4IE5A 5GONE 4AXPA 3I0QA 3VKGA 5DABA 4O4JE 4X1IE 5JH7E 5TAOA 3RRWA 4C91A 2VWAA 2LOPA 3GN5B 3B57A 3N9MA 5H6QB 3AAAB 3KV4A 4XBFB 4KP3C 4PJMA 3RH3A 3QC9A 1KNZA 4X1YE 5BMVE 5HXRA 4I43B 1BR1A 3KFWX 3KBTA 4H9RC 5H6RB 4P0AA 2ES0A 2K24A 3ZYKA 4I55E 3HL6A 3N9PA 3ZCIA 5L2LA 4H9SE 4AQFC 2CCQA 1FMWA 5LGNB 5HYAA 1MIVA 2V7IA 3VHLA 3BK9A 3PURA 3V5SA 3N5LA 2C5IT 4QWNB 3AA6B 5AFUL 1AJ3A 3NRXA 1BR2A 1D1BA 2KLQA 1MMAA 4PFOA 2VKJA 5J2TE 3PE0A 3FB2A 5LA6E 3ZJ1A 5FY7A 1LVFA 2Y48B 5JVDE 1MMGA 2MTQA 1HS7A 3CQXC 4EIWA 2N9DA 5HAXA 3BQKA 5JDMA 4QX8B 3F57A 3FXEB 4M1PA 3O1JA 3TKLB 3HKCE 1H7CA 2LE8A 3W15B 3LBXA 5EK3A 4CQIA 4ERRA 3NBXX 3UT5E 2W63A 2YU2A 2L8KA 3GMIA 1FIOA 3UTKA 3SOLA 2CE7A 2ACXA 2DHRA 3ZLIA 3NRYA 4AQGA 2X68A 3AVSA 1HTJF 2H7VC 3EVYA 2KWIB 1Z0PA 2E9XC 4PK4A 2V26A 4H63V 2VASA 3N2KE 2EHOA 2CWYA 3PUQA 5JQGE 2DWKA 4JLEA 3KV9A 4ZI2D 1WYCA 4X1KE 4YJ3E 3ZC1A 4PJNA 2D0TA 2OA5A 2LEHA 1WRDA 1KK7A 2EHOD 1NWMX 2Q9QA 2WM9A 4O2BE 4QXCB 4PK5A 2NW9A 2W0GA 3ZMZB 3MXZA 1G73A 3Q2MA 4HFVA 3UUNA 3N9QA 2Q9QD 3ZCJA 3CX6B 4HN9A 1IJ5A 2CXDA 3HI2A 2MBGA 3C98B 3ZJ2A 2XAHB 5FNVE 3QK6A 4DMWA 2X9XA 3O9XA 1FMVA 3C4XA 4PJLA 2LHRA 3CKDA 3MJXA 4GOUA 4E7SA 2ZM8A 4U72A 4ANJA 3OKQA 3MACA 3RYCE 3ZN0B 3FBZA 4WNKA 1QUUA 2VL8A 5FXZA 4E7ZA 2L3LA 4YFSA 5LBQB 2JPFA 2A72A 1O3XA 5ADXL 4DMVA 2C0SA 4H9PC 3K3NA 3HA4A 2YK0A 3O4XE 5DQVA 2BDEA 1ZEEA 4EYUA 4QX7B 4EB6E 2C5KT 2WWUA 2NWBA 3IHRA 2DWGA 2P9BA 3F2EA 5CA0E 3UUXB 2DI4A 5L3EB 5LGTB 4DBRA 2XAGB 1HG2A 3N2GE 3CX7B 3PUGA 2D2SA 1D0XA 3KBUA 4OHFA 4EYYR 5LJMA 4FI5A 3IEEA 4ZHQE 1LRZA 5L3CB 1UX5A 3ZYLA 3VKHA 5A1LA 2XASB 3DTOA 3OJAA 2NW7A 2K5BB 1UX4A 2C5JA 2NOXA 4HEAA 2XAJB 4GK5E 4JUYA 4ZS3A 3WI3A 3LBXB 3N9OA 3AA0B 4GIWA 2CWOA 1D0ZA 3RRCA 4UVAB 4L0RA 1LKXA 2LSYA 5EK4A 2CXFA 2KNDA 1MIYA 1BR4A 3PU8A 1FEWA 3Q9DA 2H7OA 1ZKEA 2V1DB 3FXDB 1US7B 2DNXA 4O8SA 2EHOB 4H9QC 3H37A 2X9YA 2X67A 3CMLA 4WW0A 3RC8A 4CZZB 2GK9A 1UCUA 2A3DA 1U4QA 5FY1A 5LXTE 2Q9QB 3O1HA 2X9HA 3JC6C 4PFPA 4F6RC 2KXPB 4IE4A 3KDSE 2V7JA 3CQGB 5L3DB 2UXNB 3C51A 5JDHA 4G2AA 2DCFA 5LBMA 2ODUA 3KV6A 4IHJE 4UF0A 2CEAA 3C50A 2H3RA 3N9LA 1MNDA 3I9WA 3N2OA 3V5UA 5LP6E 4JEHB 2VB6A 2YU1A 2D0UA 5HWXA 5JDLA 2MYSA 1NAFA 3K8PC 4GK0E 2RP4A 5HXCA 3DP7A 5IYZE 3S4UA 3GA8A 5LYJE 2XQYA 2D5UA 3MA9A 3SWHA 2HH7A 1S94A 1WR6A 2NP9A 4DO0A 1YD8G 4C90A 1S35A 4XAXB 5ETWA 4WBNE 3P7IA 3QUJA 2LJLA 3U3IA 5LHGB 4PAGA 2LOSA 4HE8A 4QHOA 3L09A 3AB3B 3BQIA 3ZN1B 4TV8E 3I0OA 2JJ9A 3KV5A 5L3FB 1LVKA 3LFMA 5F8PA 5C8YE 5LCYA 1VOMA 3MZKB 3VU7H 4AKRB 2V7LA 2X0LB 2XAFB 4ZOLE 3RPUA 4EZ4A 4A56A 4L5GA 4QKNA 5IHYA 4V1Av 3ZC0A 3CPZA 5M4YA 1MNEA 5JRCA 3O1IA 4FJOA 3LK42 2V7KA 2Y8DA 5J2UE 3ZMTB 3EDVA 3F31A 2YINA 2NW8A 4PJJA 3WAKA 1WYBA 5DQWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BQL A;  2Y8D A;  2YK0 A;  2WAU A;  3CPZ A;  4NUV A;  3BQI A;  3BQK A;  3RRC A;  4NUU A;  5F3J A;  2XU0 A;  3CML A;  3C64 A;  4YFS A; 
#chains in the Genus database with same CATH topology
 2QGS A;  1HNZ T;  2UUA T;  2IC9 A;  4UVC B;  2BVL A;  3PJA J;  4WQO D;  3TLV A;  5JDN A;  4HTE A;  1XNQ T;  5ABG A;  1IAP A;  4H9N C;  5HCJ A;  2W00 A;  1D0Y A;  5AQM B;  5J1G A;  5LJN A;  4OFZ A;  2XQ4 A;  4UV8 B;  2W62 A;  3TLW A;  2J62 A;  3OYX A;  3Q5W A;  2E2A A;  1V9D A;  4ILB A;  4X20 E;  4YTP A;  4AP2 B;  2XTL A;  3JAE A;  2Z6E A;  2YEV C;  5FKY A;  4UVB B;  5LG4 A;  3KIN B;  4EAH A;  2XQ6 A;  4J2C A;  1M62 A;  4X62 T;  1D1A A;  2BS2 A;  3C4W A;  2XY8 B;  5AQT B;  3AXJ A;  5FXV A;  5LMN T;  2W66 A;  3K3Q C;  4ZI3 D;  4IL4 A;  2QRX A;  4HWC A;  4O2A E;  4CN1 A;  3LG7 A;  3ZKR A;  3ETU A;  3PUZ F;  3E08 A;  4QXH B;  3UFG A;  5ABF A;  3U78 A;  2YDQ A;  2XAQ B;  3AA7 B;  5JRC B;  4DUZ T;  2KZ7 B;  4UIG A;  4NXM T;  1XDP A;  3PUS A;  4AKH A;  2LT3 A;  3A5X A;  2CPT A;  5AQP B;  4L9I A;  3SRZ A;  4YTM A;  2ZM0 A;  3UU6 A;  4IST A;  4MBQ A;  4TN7 B;  3HR0 A;  3ESL A;  2V8S V;  3P4W A;  2E9X D;  3GWH A;  4EXT A;  4ISS A;  2UXX B;  2JMK A;  4U31 A;  4N78 D;  1GQE A;  1Y64 B;  3J7Y q;  2NTY A;  4P1N A;  3B13 A;  2WDR A;  2CXL A;  3EDU A;  4ZI7 E;  1FJG T;  4IDQ A;  3ZMU B;  3AXJ B;  4WBO A;  4GYR A;  3OVU A;  4ZXL A;  2H88 A;  4CI3 B;  2CHN A;  3ZSS A;  1IJ6 A;  3EHZ A;  4LFA T;  5F3J A;  4CXW A;  1ZP0 A;  1E1H B;  4NPP A;  4UXN B;  5ABF B;  3EAB A;  4ILA A;  2X66 A;  4N9F 3;  4BJN A;  2WMN A;  4YHJ A;  3E22 E;  1X9B A;  2BG9 E;  2YDS A;  2YKS A;  3NKZ A;  3SS1 A;  1KFY A;  5FXW A;  5CA1 E;  3NZQ A;  4OK0 A;  2FJE A;  4O4I E;  5BR8 T;  4TNV A;  4MHC A;  3ONJ A;  3UFE A;  5JDQ A;  4U74 A;  4HFI A;  3RHW A;  3T1Y T;  2BS3 A;  1OXZ A;  2OV9 A;  2QVA A;  3FBL A;  4NXN T;  2FJB A;  2IDO B;  2LSK A;  4I50 E;  4JEU B;  5EK2 A;  1NEK A;  3MK7 C;  4AXP A;  5HEG A;  2FJA A;  2OLT A;  3I0Q A;  3VKG A;  4O4J E;  1HNW T;  1UK5 A;  5TAO A;  2LOP A;  3AE9 A;  3AEF A;  3N9M A;  4KP3 C;  3RH3 A;  4X1Y E;  1W0A A;  4B3S T;  5H6R B;  4P0A A;  3ZCI A;  4H9S E;  4AQF C;  1FMW A;  2V7I A;  3DQV C;  2WZH A;  4DR3 T;  1D1B A;  1HNX T;  1MMA A;  5J2T E;  3FB2 A;  4QH5 A;  3ZJ1 A;  4LFC T;  5FY7 A;  1MMG A;  2MTQ A;  1T72 A;  4ZEY A;  1JNR A;  4QX8 B;  2XQA A;  4DR7 T;  3O1J A;  3HKC E;  5EK3 A;  4CQI A;  4KHZ F;  3EI0 A;  3AE6 A;  4AQG A;  4YXD A;  3AVS A;  3VRB A;  4B3R T;  2E9X C;  3N2K E;  2CWY A;  2DWK A;  3KV9 A;  2LKG A;  4YJ3 E;  2F4V T;  2LEH A;  2WU5 A;  2EHO D;  5HEH A;  3UUN A;  2Q9Q D;  3ZCJ A;  3CX6 B;  5FNV E;  2X9X A;  3C4X A;  1IBK T;  2LHR A;  4GOU A;  2ZM8 A;  3OKQ A;  3MAC A;  2VL8 A;  4YFS A;  2I0M A;  2JPF A;  5ADX L;  4DMV A;  1XDO A;  3DPL C;  2IHR 1;  3K3N A;  3FZF B;  2BDE A;  4EYU A;  3RIA A;  1T7S A;  4JI2 T;  2DWG A;  3NWI A;  5CA0 E;  3UUX B;  2BBH A;  2DI4 A;  2WZI A;  1UUR A;  2XAG B;  3N2G E;  3PUG A;  5L3C B;  3OJA A;  3UU4 A;  3AA0 B;  2CWO A;  3P4R A;  3SFD A;  4UVA B;  1BR4 A;  3FXD B;  2V1D B;  2X67 A;  2JQ9 A;  4WW0 A;  4CZZ B;  1UCU A;  2WU2 A;  1U6G A;  5LXT E;  4F6R C;  3KDS E;  2V7J A;  3CQG B;  5L3D B;  2JQK A;  4G2A A;  3L39 A;  3N9L A;  2YU1 A;  5HWX A;  5JDL A;  4LF9 T;  3AE7 A;  2IIU A;  3DP7 A;  5LYJ E;  1UGO A;  3MA9 A;  1UUS A;  2UUB T;  1WR6 A;  5LMU T;  2NP9 A;  4DV4 T;  3NVO A;  2XSB A;  2KSR A;  4EV6 A;  2UXC T;  3ZN1 B;  5F8P A;  3L8R A;  3LFM A;  1VOM A;  2XM1 A;  3ABV A;  2FBW A;  4JI3 T;  2XAF B;  3RPU A;  3P4Q A;  4L5G A;  1VCS A;  5AQU B;  2HN2 A;  3WAK A;  3AEG A;  2J4G A;  2LSI A;  3AEE A;  1WLX A;  5LOV E;  2XM2 A;  3HKD E;  2FJD A;  2ACZ A;  2LM9 A;  2LRK A;  5LGU B;  2PJQ A;  4G63 A;  5AQN B;  4KMC A;  4MLK A;  1T98 A;  4A64 A;  2CLY B;  4PK6 A;  4YSZ A;  4K0U A;  2EHO C;  2BG9 C;  2VKH A;  3QB5 A;  2Q9Q C;  5CB4 E;  2XQ5 A;  3P4P A;  1JNZ A;  2N2N A;  2XHE B;  4ASK A;  2XU0 A;  4UEM A;  3RC3 A;  3BQL A;  4ZZB A;  3FZL B;  2CMR A;  4IL9 A;  1YQ4 A;  1YKH B;  5AQI B;  3KVA A;  4DV5 T;  4P0B A;  4LF6 T;  1HCI A;  3OTO T;  3LK3 B;  2G0U A;  2IC6 A;  2WZK A;  2JQQ A;  1BR0 A;  1MIW A;  2VVS A;  1SHZ C;  1G8X A;  5CJ5 A;  3RYF E;  2LSJ A;  2ZM6 T;  4HKA A;  3PU3 A;  2IAK A;  2ODV A;  4ZS2 A;  4DR6 T;  4KI0 F;  4DND A;  3PUX F;  2X9W A;  5AQL B;  2YN6 A;  3I1A A;  4IE0 A;  2WY2 A;  3RKO A;  5KDM C;  3RGL A;  2WDV A;  2NTX A;  2AXD S;  2WS3 A;  3LJC A;  2XSA A;  4NUU A;  2UXD T;  4IRE A;  1ZV4 X;  4DV0 T;  4P09 A;  5HXH A;  3ETV A;  4CXY A;  4AI6 A;  1XMQ T;  3X1D A;  3A8Y C;  2I59 A;  5AQO B;  3RTR A;  5LHH B;  1HF8 A;  3UUL A;  1X79 A;  3R6N A;  4PNI A;  3RYH E;  3PTR B;  4KUM B;  5JDF A;  1YQ3 A;  3RX6 A;  4IDN A;  2X51 A;  2CA5 A;  1ZHC A;  5EZY E;  2CM0 A;  1NEN A;  2BBJ A;  1R8I A;  4O4L E;  2W61 A;  4BJM A;  1MMN A;  3FZK B;  2XJ7 A;  3VR9 A;  1WFD A;  1L0V A;  2N1G A;  5HXS A;  2XQ3 A;  3ZPO A;  3RYI E;  3E0Z A;  3P50 A;  4IE5 A;  3Q5D A;  3Q5E A;  4DV1 T;  5DAB A;  2V5C A;  4F8H A;  2VWA A;  5H6Q B;  3KV4 A;  4PJM A;  3LDQ B;  5BMV E;  3OPC A;  4K0K T;  4LMK A;  1T8B A;  3UU8 A;  3UU3 A;  2K3W A;  2K24 A;  3ZYK A;  2W2U A;  3N9P A;  2E5V A;  5HYA A;  5KXJ A;  3BK9 A;  3PUR A;  3V5S A;  3UQ7 A;  2C5I T;  3NRX A;  4LF8 T;  2BKN A;  5LA6 E;  3IA3 A;  4HXI B;  2FUP A;  3BQK A;  5JDM A;  3FXE B;  4M1P A;  3TKL B;  1H7C A;  2L8K A;  3GMI A;  3SFE A;  5L4H A;  2X68 A;  4DUY T;  1Z0P A;  2VAS A;  4JLE A;  5HEO A;  4ZI2 D;  1WYC A;  4X1K E;  1KF6 A;  4PJN A;  1Y01 A;  1WRD A;  1KK7 A;  2WM9 A;  4QXC B;  4PK5 A;  2NW9 A;  1WCR A;  2W67 A;  3C98 B;  2XAH B;  3QK6 A;  3O9X A;  1FMV A;  4PJL A;  3MJX A;  4E7S A;  2R6G F;  4ANJ A;  3RYC E;  4E7Z A;  2L3L A;  4H9P C;  4EB6 E;  4EYY R;  5J0Z A;  4FI5 A;  3IEE A;  3VKH A;  2NW7 A;  2K5B B;  2C5J A;  4JUY A;  2WP9 A;  4ZS3 A;  3N9O A;  4TWF A;  3VRA A;  1LKX A;  5AQF B;  2VUR A;  1FEW A;  4O8S A;  2DNX A;  3AED A;  4H9Q C;  4HWI B;  5FVL A;  1N36 T;  2A3D A;  5FY1 A;  3O1H A;  2QYW A;  2H89 A;  4PFP A;  2XZE A;  5JDH A;  4JI7 T;  5LBM A;  4EED A;  4IHJ E;  4UF0 A;  5CGM A;  2H3R A;  4DR1 T;  3I9W A;  5AQG B;  4GK0 E;  4QH4 A;  5IYZ E;  2LM2 A;  4CN4 A;  2D5U A;  3SWH A;  1KEY A;  4Q25 A;  4WBN E;  3P7I A;  5LHG B;  4YT0 A;  1J1J A;  2LLY A;  3L09 A;  3AB3 B;  3BQI A;  3AE3 A;  3AEC A;  4TV8 E;  1LVK A;  5LCY A;  3MZK B;  3VU7 H;  2V7L A;  4QKN A;  4YSX A;  3ZT5 A;  4V1A v;  3CPZ A;  1MNE A;  4JYA T;  3EDV A;  4PJJ A;  5DQW A;  3Q5X A;  2CBJ A;  4O4H E;  4AQY T;  2WBL A;  2KWH A;  4OYJ A;  5JR9 A;  5LHI B;  3RLF F;  1VCT A;  3C64 A;  1XWM A;  3RIU A;  3RI5 A;  4JI6 T;  2E5L T;  4UF0 B;  4ILU A;  3P8C D;  4ZI2 C;  2LHN A;  5AQJ B;  3PUW F;  5FXX A;  3C4Z A;  3KVB A;  4HFD A;  3AE1 A;  3A7M A;  4CI1 B;  2V7M A;  4CN6 A;  2HPJ A;  2K48 A;  2M67 A;  3AAI A;  2HN1 A;  3N9N A;  4PW8 A;  3AAE B;  3CIR A;  1CHU A;  4TZ4 C;  4IIJ E;  2VK9 A;  3PUA A;  1MMD A;  3I9Y A;  5AQS B;  4TX5 A;  5JTG A;  3MKD A;  4U7I A;  2M6B A;  5C2T A;  4X64 T;  2IML A;  2ZLY A;  4MAL A;  1SE7 A;  3AE8 A;  1OED A;  3CQC B;  2X0H A;  3RQW A;  2SPC A;  3J9X 1;  5HWY A;  2BVM A;  1OWA A;  4EOZ B;  5C3J A;  5JR9 B;  2DLR A;  2JMH A;  2B1E A;  4JI4 T;  1KNR A;  2YDR A;  1HX8 A;  2PBI A;  2PTF A;  3OBV E;  1N33 T;  4UV9 B;  2J1D G;  3QB5 K;  3JCF A;  4KX6 A;  2L9Q A;  3H3A A;  2Y6X A;  3AE2 A;  3UUM A;  2WWV A;  4WZX A;  5DJQ C;  3ZEF B;  4HWD A;  1KNP A;  4UEL A;  2UUC T;  2KIN B;  2LSG A;  2J47 A;  2PG8 A;  4TUY E;  1SA0 E;  1OED C;  4TV9 E;  3LK2 B;  1Z8U A;  3NZP A;  2A2F X;  3UUB A;  3ZYM A;  2CLY C;  5IUX A;  2CRB A;  4LMJ A;  4B3T T;  1W9R A;  3UU5 A;  5FL0 A;  4HGA A;  2XPK A;  2RA1 A;  2YOE A;  2BKP A;  4CXX A;  1OED B;  4HFB A;  5ABH A;  2WMO A;  4YHH T;  4LML A;  1J5W A;  4IE7 A;  3T8O A;  1CUN A;  5JDG A;  4XZC A;  3JC6 D;  2PFV A;  1D1C A;  2MAW A;  3L3P A;  1N32 T;  2MPK A;  4OX9 T;  5LNK A;  3M65 A;  4HWH A;  4JBW F;  4U33 A;  2RPA A;  5AQV B;  3B57 A;  4A98 A;  3QC9 A;  5FL1 A;  4KHP T;  5HXR A;  2X0Y A;  1BR1 A;  3KFW X;  3KBT A;  4H9R C;  1XZY A;  1LDJ A;  1MIV A;  3VHL A;  3N5L A;  1AJ3 A;  1BR2 A;  2A9U A;  3CK6 A;  3AEA A;  4HFH A;  2VKJ A;  3JAF A;  3PE0 A;  3PUY F;  5JVD E;  1IBM T;  1HS7 A;  3CQX C;  2WQY A;  2N9D A;  4IT4 A;  3LBX A;  4JI5 T;  2W63 A;  2YU2 A;  1FIO A;  3UTK A;  2ACX A;  2DHR A;  1HTJ F;  3EVY A;  2KWI B;  4COF A;  2V26 A;  3FZH B;  1NWM X;  4O2B E;  3H3M A;  2W0G A;  3MXZ A;  1G73 A;  2VQE T;  4HFV A;  4XBF B;  4HN9 A;  2CXD A;  3HI2 A;  3ZJ2 A;  4DMW A;  3CKD A;  4U72 A;  4WNK A;  4DR2 T;  5HEJ A;  2C0S A;  2JIW A;  3HA4 A;  2YK0 A;  5DQV A;  1ZEE A;  4QX7 B;  3PUV F;  2V6X A;  3IHR A;  5AQQ B;  2XQ8 A;  3F2E A;  2V5D A;  5FVK A;  2WDQ A;  5HEU A;  5LGT B;  4B3M T;  2VL0 A;  5CFB A;  3CX7 B;  1D0X A;  4OHF A;  3M3Z B;  4X5T A;  4ZHQ E;  3ZYL A;  5A1L A;  3DTO A;  2XAJ B;  3LBX B;  1D0Z A;  4LF5 T;  4L0R A;  2UU9 T;  3RQU A;  2LSY A;  2CXF A;  2KND A;  3PU8 A;  4QH1 A;  4LF4 T;  2CHO A;  3Q9D A;  2H7O A;  2BS4 A;  2X9Y A;  2GK9 A;  3JC6 C;  2VVN A;  2KXP B;  1WR0 A;  1XMO T;  3QNU A;  2DCF A;  2ODU A;  3KV6 A;  2CEA A;  3C50 A;  4JV5 T;  1MND A;  3V5U A;  5LP6 E;  4JEH B;  2VB6 A;  2D0U A;  2V6Y A;  2MYS A;  1NAF A;  1OED E;  2RP4 A;  3S4U A;  3GA8 A;  2LRL A;  4LF7 T;  2HH7 A;  4TNW A;  1S94 A;  4DO0 A;  1YD8 G;  4C90 A;  4XAX B;  3QOF A;  5ETW A;  3QUJ A;  2LJL A;  3U3I A;  4PAG A;  2LOS A;  4HE8 A;  3VR8 A;  3RIF A;  3K1S A;  3LSV A;  2AE9 A;  3KV5 A;  5L3F B;  2X0L B;  5IHY A;  4DR5 T;  5M4Y A;  3O1I A;  4A5X A;  3LK4 2;  5J2U E;  3ZMT B;  3PJA A;  2NW8 A;  3TLS A;  2HHH T;  1WYB A;  5FMN A;  5AQK B;  3TLT A;  3PDY A;  5KMG P;  4NUV A;  1HR0 T;  3IBP A;  4AKI A;  2UXB T;  5JRE A;  4B6X A;  3K3O A;  1N34 T;  5AQR B;  2IW5 B;  4X66 T;  1J5E T;  4KBM B;  2QA7 A;  1IZN B;  3EUH A;  2V6Y B;  2D9D A;  4YLH A;  4U2Z A;  4H63 H;  4LFB T;  2VKO A;  1M7K A;  4H9O C;  1I94 T;  1YW0 A;  4AQF A;  4EZH A;  3D0T A;  5HXE A;  3ANW A;  3WAJ A;  5FP3 A;  1U5P A;  4AKG A;  2KMF A;  4OYK A;  3EAM A;  4X65 T;  2BZB A;  4BAY B;  4DBQ A;  2WAU A;  1B7T A;  3T1H T;  4IGU A;  5LG3 A;  4ADZ A;  1YKE B;  2DL1 A;  1DU2 A;  4YSY A;  3HKB E;  4U2Y A;  2E8I A;  5FYM A;  4IDO A;  3HKE E;  1EZ3 A;  2E9X A;  5AQH B;  4GYS A;  3ZT7 A;  4ZI3 C;  3RKG A;  3IF8 B;  4HWF A;  2XUE A;  2MOZ A;  4DVD A;  1VRB A;  2W4X A;  2K9A A;  4IDZ A;  4CI2 B;  4HFC A;  4JGH D;  4Z8X A;  1QSD A;  3AE5 A;  5E0O A;  4U3C A;  5F5W A;  3CWZ B;  5KX5 E;  2ZMA A;  2KT9 A;  4YTN A;  5FY0 A;  3ANW B;  3GN5 A;  4Z90 A;  2ZM2 A;  3ONX A;  1YXR A;  1E2A A;  1HFA A;  3B5M A;  4Z91 A;  4WYV A;  3TLU A;  3CVR A;  4QXB B;  4BA9 A;  3FHN A;  4IDP A;  1SUM B;  2VKD A;  2JRK A;  3ZMS B;  5L3B B;  4YY3 T;  4F52 A;  2WSS V;  3DJB A;  5L3G B;  4DV6 T;  4APF B;  5LB7 B;  3JAD A;  4MFR A;  2E9X B;  3AVR A;  2HPL A;  4AKL A;  3CX8 B;  4AIS A;  4YJ2 E;  4I4T E;  3R84 B;  3OYZ A;  3AA1 B;  3ZMV B;  4IE6 A;  4TWD A;  2CBI A;  4DV7 T;  1HG5 A;  4HFE A;  5ABE A;  5JR9 C;  5GON E;  1LDK A;  4EGW A;  4UR9 A;  3RIU C;  4X1I E;  2JQH A;  5JH7 E;  3RRW A;  4P5O A;  4C91 A;  2M6I A;  3GN5 B;  4TWH A;  3AAA B;  1XNR T;  1KNZ A;  4AIU A;  1I6Z A;  4I43 B;  4NIQ A;  2WCA A;  2ES0 A;  4A97 A;  4I55 E;  3HL6 A;  1ZOY A;  5L2L A;  2CCQ A;  5LGN B;  4QWN B;  3AA6 B;  5AFU L;  2KLQ A;  4PFO A;  4ZZC A;  1LVF A;  2Y48 B;  3ZT6 A;  1QLB A;  4EIW A;  5HAX A;  4EEB A;  3F57 A;  2LE8 A;  3W15 B;  4ERR A;  3NBX X;  3UT5 E;  3ZST A;  3SOL A;  2CE7 A;  3ZLI A;  3NRY A;  1W0B A;  4I0U A;  2BKO A;  2H7V C;  3ONL C;  4PK4 A;  4H63 V;  2EHO A;  5JQG E;  3PUQ A;  4DV2 T;  2BG9 A;  1LDK B;  3ZC1 A;  2D0T A;  2OA5 A;  2Q9Q A;  3G06 A;  3ZMZ B;  2XQ7 A;  3Q2M A;  3N9Q A;  1IJ5 A;  2MBG A;  3AEB A;  3RF1 A;  3ZN0 B;  3FBZ A;  1QUU A;  5FXZ A;  1E7P A;  5LBQ B;  2A72 A;  1O3X A;  3O4X E;  2C5K T;  5HCM A;  2WWU A;  2NWB A;  3P4S A;  2P9B A;  5L3E B;  4JI1 T;  4DBR A;  1HG2 A;  2D2S A;  3KBU A;  5LJM A;  5L4E A;  1LRZ A;  1UX5 A;  1W09 A;  2XAS B;  4HEA A;  1UX4 A;  2NOX A;  4GKJ T;  4GK5 E;  2VQF T;  3WI3 A;  3UQ4 A;  2XQ9 A;  4GIW A;  3RRC A;  1IBL T;  5L47 A;  5EK4 A;  2I6H A;  1HX1 B;  1MIY A;  4GKK T;  1ZKE A;  1US7 B;  4DID B;  2EHO B;  3H37 A;  2BG9 B;  3CML A;  3RC8 A;  4JI8 T;  1U4Q A;  2Q9Q B;  4U7Y A;  2X9H A;  4JI0 T;  4IE4 A;  4DV3 T;  2UXN B;  3C51 A;  5IWA T;  3AE4 A;  4DR4 T;  3N2O A;  3FZM B;  3PV0 F;  3K8P C;  5HXC A;  2IUB A;  2XQY A;  2B76 A;  1S35 A;  4QHO A;  3I0O A;  2JJ9 A;  5C8Y E;  4AKR B;  4ZOL E;  4EZ4 A;  4A56 A;  2LKH A;  4ILC A;  3ZC0 A;  5JRC A;  4FJO A;  2V7K A;  2Y8D A;  2NR4 A;  3F31 A;  2YIN A;  2WB5 A; 
#chains in the Genus database with same CATH homology
 3Q5X A;  2QGS A;  2LSI A;  4O4H E;  5FMN A;  2IC9 A;  1WLX A;  2WBL A;  3PDY A;  5LOV E;  4UVC B;  2BVL A;  5KMG P;  3HKD E;  4NUV A;  3IBP A;  2LM9 A;  4AKI A;  2KWH A;  4OYJ A;  5JDN A;  5JR9 A;  4HTE A;  5LGU B;  5LHI B;  5JRE A;  1IAP A;  2PJQ A;  4B6X A;  4H9N C;  4G63 A;  2W00 A;  3K3O A;  1D0Y A;  5J1G A;  5LJN A;  3C64 A;  4OFZ A;  4UV8 B;  2W62 A;  4KMC A;  4MLK A;  2IW5 B;  3OYX A;  3Q5W A;  4KBM B;  1V9D A;  4X20 E;  4UF0 B;  1T98 A;  2CLY B;  4ILU A;  2XTL A;  2QA7 A;  3P8C D;  1IZN B;  3EUH A;  2Z6E A;  4ZI2 C;  4PK6 A;  2YEV C;  4K0U A;  2LHN A;  4YLH A;  4UVB B;  5LG4 A;  2EHO C;  3KIN B;  4H63 H;  4EAH A;  5FXX A;  2VKO A;  3C4Z A;  4J2C A;  3KVB A;  2VKH A;  4CI1 B;  1D1A A;  2V7M A;  4H9O C;  2Q9Q C;  3C4W A;  1YW0 A;  5CB4 E;  2HPJ A;  2K48 A;  4AQF A;  5FXV A;  3D0T A;  4EZH A;  5HXE A;  2M67 A;  3ANW A;  3AAI A;  3K3Q C;  3N9N A;  4ZI3 D;  4PW8 A;  3WAJ A;  5FP3 A;  1U5P A;  3AAE B;  4O2A E;  2N2N A;  4AKG A;  2XHE B;  2KMF A;  4OYK A;  4ASK A;  3LG7 A;  2XU0 A;  2BZB A;  4BAY B;  3ETU A;  4UEM A;  3RC3 A;  4DBQ A;  3E08 A;  3BQL A;  2WAU A;  2CMR A;  4TZ4 C;  4QXH B;  3U78 A;  1B7T A;  2VK9 A;  4IIJ E;  3PUA A;  2XAQ B;  1MMD A;  1YKH B;  3I9Y A;  3AA7 B;  4IGU A;  5JRC B;  2KZ7 B;  3KVA A;  4UIG A;  4ADZ A;  1YKE B;  3PUS A;  4P0B A;  4TX5 A;  4AKH A;  3MKD A;  2LT3 A;  1HCI A;  3A5X A;  2ZLY A;  3LK3 B;  3HKB E;  2E8I A;  2G0U A;  2IC6 A;  4MAL A;  5FYM A;  4L9I A;  2JQQ A;  1BR0 A;  3SRZ A;  3CQC B;  1MIW A;  2SPC A;  3J9X 1;  5HWY A;  2BVM A;  1SHZ C;  2ZM0 A;  3HKE E;  1G8X A;  3RYF E;  4IST A;  1EZ3 A;  1OWA A;  2E9X A;  4MBQ A;  4GYS A;  2LSJ A;  4TN7 B;  4EOZ B;  3HR0 A;  5JR9 B;  2DLR A;  3ESL A;  4HKA A;  2JMH A;  2B1E A;  3PU3 A;  2IAK A;  2ODV A;  2E9X D;  3GWH A;  4ZI3 C;  4EXT A;  4ZS2 A;  3IF8 B;  1HX8 A;  2PBI A;  4DND A;  2XUE A;  4ISS A;  2MOZ A;  2UXX B;  2X9W A;  4DVD A;  1VRB A;  3OBV E;  2JMK A;  4UV9 B;  2J1D G;  4N78 D;  3I1A A;  4IE0 A;  2K9A A;  4IDZ A;  1Y64 B;  4CI2 B;  3J7Y q;  2NTY A;  4Z8X A;  2L9Q A;  3RKO A;  3H3A A;  1QSD A;  2Y6X A;  3UUM A;  5E0O A;  3B13 A;  5KDM C;  2CXL A;  3EDU A;  3CWZ B;  5KX5 E;  2NTX A;  4ZI7 E;  2ZMA A;  5DJQ C;  2KT9 A;  3ZEF B;  4UEL A;  3ZMU B;  2KIN B;  5FY0 A;  3LJC A;  2LSG A;  4NUU A;  4WBO A;  2PG8 A;  4GYR A;  4TUY E;  1SA0 E;  1ZV4 X;  3ANW B;  4P09 A;  5HXH A;  3ETV A;  4TV9 E;  4CI3 B;  4CXY A;  4AI6 A;  3LK2 B;  3GN5 A;  2A2F X;  2ZM2 A;  3NZP A;  1IJ6 A;  2I59 A;  3ONX A;  1HFA A;  3ZYM A;  2CLY C;  5LHH B;  5F3J A;  1HF8 A;  4CXW A;  1E1H B;  3UUL A;  1X79 A;  4UXN B;  3CVR A;  4QXB B;  3R6N A;  4BA9 A;  3FHN A;  4PNI A;  2X66 A;  3RYH E;  2VKD A;  3PTR B;  4KUM B;  5JDF A;  2WMN A;  2JRK A;  3ZMS B;  4HGA A;  4YHJ A;  4BJN A;  3E22 E;  2RA1 A;  3RX6 A;  2X51 A;  5L3B B;  2CA5 A;  2WSS V;  3DJB A;  4CXX A;  1ZHC A;  5EZY E;  2CM0 A;  5L3G B;  3SS1 A;  5FXW A;  5CA1 E;  3NZQ A;  4MFR A;  2E9X B;  3AVR A;  4OK0 A;  4O4I E;  2HPL A;  4AKL A;  4MHC A;  4O4L E;  2WMO A;  3CX8 B;  2W61 A;  3UFE A;  5JDQ A;  4BJM A;  1MMN A;  4I4T E;  4U74 A;  4YJ2 E;  4IE7 A;  3T8O A;  3R84 B;  1CUN A;  1OXZ A;  3OYZ A;  3AA1 B;  5JDG A;  4XZC A;  3JC6 D;  2PFV A;  2N1G A;  3ZMV B;  5HXS A;  3FBL A;  4IE6 A;  1D1C A;  1HG5 A;  3L3P A;  3ZPO A;  2LSK A;  4I50 E;  4JEU B;  5EK2 A;  5LNK A;  3M65 A;  3RYI E;  3MK7 C;  5JR9 C;  3E0Z A;  4IE5 A;  5GON E;  4AXP A;  3I0Q A;  3VKG A;  5DAB A;  4O4J E;  4X1I E;  5JH7 E;  5TAO A;  3RRW A;  4C91 A;  2VWA A;  2LOP A;  3GN5 B;  3B57 A;  3N9M A;  5H6Q B;  3AAA B;  3KV4 A;  4XBF B;  4KP3 C;  4PJM A;  3RH3 A;  3QC9 A;  1KNZ A;  4X1Y E;  5BMV E;  5HXR A;  4I43 B;  1BR1 A;  3KFW X;  3KBT A;  4H9R C;  5H6R B;  4P0A A;  2ES0 A;  2K24 A;  3ZYK A;  4I55 E;  3HL6 A;  3N9P A;  3ZCI A;  5L2L A;  4H9S E;  4AQF C;  2CCQ A;  1FMW A;  5LGN B;  5HYA A;  1MIV A;  2V7I A;  3VHL A;  3BK9 A;  3PUR A;  3V5S A;  3N5L A;  2C5I T;  4QWN B;  3AA6 B;  5AFU L;  1AJ3 A;  3NRX A;  1BR2 A;  1D1B A;  2KLQ A;  1MMA A;  4PFO A;  2VKJ A;  5J2T E;  3PE0 A;  3FB2 A;  5LA6 E;  3ZJ1 A;  5FY7 A;  1LVF A;  2Y48 B;  5JVD E;  1MMG A;  2MTQ A;  1HS7 A;  3CQX C;  4EIW A;  2N9D A;  5HAX A;  3BQK A;  5JDM A;  4QX8 B;  3F57 A;  3FXE B;  4M1P A;  3O1J A;  3TKL B;  3HKC E;  1H7C A;  2LE8 A;  3W15 B;  3LBX A;  5EK3 A;  4CQI A;  4ERR A;  3NBX X;  3UT5 E;  2W63 A;  2YU2 A;  2L8K A;  3GMI A;  1FIO A;  3UTK A;  3SOL A;  2CE7 A;  2ACX A;  2DHR A;  3ZLI A;  3NRY A;  4AQG A;  2X68 A;  3AVS A;  1HTJ F;  2H7V C;  3EVY A;  2KWI B;  1Z0P A;  2E9X C;  4PK4 A;  2V26 A;  4H63 V;  2VAS A;  3N2K E;  2EHO A;  2CWY A;  3PUQ A;  5JQG E;  2DWK A;  4JLE A;  3KV9 A;  4ZI2 D;  1WYC A;  4X1K E;  4YJ3 E;  3ZC1 A;  4PJN A;  2D0T A;  2OA5 A;  2LEH A;  1WRD A;  1KK7 A;  2EHO D;  1NWM X;  2Q9Q A;  2WM9 A;  4O2B E;  4QXC B;  4PK5 A;  2NW9 A;  2W0G A;  3ZMZ B;  3MXZ A;  1G73 A;  3Q2M A;  4HFV A;  3UUN A;  3N9Q A;  2Q9Q D;  3ZCJ A;  3CX6 B;  4HN9 A;  1IJ5 A;  2CXD A;  3HI2 A;  2MBG A;  3C98 B;  3ZJ2 A;  2XAH B;  5FNV E;  3QK6 A;  4DMW A;  2X9X A;  3O9X A;  1FMV A;  3C4X A;  4PJL A;  2LHR A;  3CKD A;  3MJX A;  4GOU A;  4E7S A;  2ZM8 A;  4U72 A;  4ANJ A;  3OKQ A;  3MAC A;  3RYC E;  3ZN0 B;  3FBZ A;  4WNK A;  1QUU A;  2VL8 A;  5FXZ A;  4E7Z A;  2L3L A;  4YFS A;  5LBQ B;  2JPF A;  2A72 A;  1O3X A;  5ADX L;  4DMV A;  2C0S A;  4H9P C;  3K3N A;  3HA4 A;  2YK0 A;  3O4X E;  5DQV A;  2BDE A;  1ZEE A;  4EYU A;  4QX7 B;  4EB6 E;  2C5K T;  2WWU A;  2NWB A;  3IHR A;  2DWG A;  2P9B A;  3F2E A;  5CA0 E;  3UUX B;  2DI4 A;  5L3E B;  5LGT B;  4DBR A;  2XAG B;  1HG2 A;  3N2G E;  3CX7 B;  3PUG A;  2D2S A;  1D0X A;  3KBU A;  4OHF A;  4EYY R;  5LJM A;  4FI5 A;  3IEE A;  4ZHQ E;  1LRZ A;  5L3C B;  1UX5 A;  3ZYL A;  3VKH A;  5A1L A;  2XAS B;  3DTO A;  3OJA A;  2NW7 A;  2K5B B;  1UX4 A;  2C5J A;  2NOX A;  4HEA A;  2XAJ B;  4GK5 E;  4JUY A;  4ZS3 A;  3WI3 A;  3LBX B;  3N9O A;  3AA0 B;  4GIW A;  2CWO A;  1D0Z A;  3RRC A;  4UVA B;  4L0R A;  1LKX A;  2LSY A;  5EK4 A;  2CXF A;  2KND A;  1MIY A;  1BR4 A;  3PU8 A;  1FEW A;  3Q9D A;  2H7O A;  1ZKE A;  2V1D B;  3FXD B;  1US7 B;  2DNX A;  4O8S A;  2EHO B;  4H9Q C;  3H37 A;  2X9Y A;  2X67 A;  3CML A;  4WW0 A;  3RC8 A;  4CZZ B;  2GK9 A;  1UCU A;  2A3D A;  1U4Q A;  5FY1 A;  5LXT E;  2Q9Q B;  3O1H A;  2X9H A;  3JC6 C;  4PFP A;  4F6R C;  2KXP B;  4IE4 A;  3KDS E;  2V7J A;  3CQG B;  5L3D B;  2UXN B;  3C51 A;  5JDH A;  4G2A A;  2DCF A;  5LBM A;  2ODU A;  3KV6 A;  4IHJ E;  4UF0 A;  2CEA A;  3C50 A;  2H3R A;  3N9L A;  1MND A;  3I9W A;  3N2O A;  3V5U A;  5LP6 E;  4JEH B;  2VB6 A;  2YU1 A;  2D0U A;  5HWX A;  5JDL A;  2MYS A;  1NAF A;  3K8P C;  4GK0 E;  2RP4 A;  5HXC A;  3DP7 A;  5IYZ E;  3S4U A;  3GA8 A;  5LYJ E;  2XQY A;  2D5U A;  3MA9 A;  3SWH A;  2HH7 A;  1S94 A;  1WR6 A;  2NP9 A;  4DO0 A;  1YD8 G;  4C90 A;  1S35 A;  4XAX B;  5ETW A;  4WBN E;  3P7I A;  3QUJ A;  2LJL A;  3U3I A;  5LHG B;  4PAG A;  2LOS A;  4HE8 A;  4QHO A;  3L09 A;  3AB3 B;  3BQI A;  3ZN1 B;  4TV8 E;  3I0O A;  2JJ9 A;  3KV5 A;  5L3F B;  1LVK A;  3LFM A;  5F8P A;  5C8Y E;  5LCY A;  1VOM A;  3MZK B;  3VU7 H;  4AKR B;  2V7L A;  2X0L B;  2XAF B;  4ZOL E;  3RPU A;  4EZ4 A;  4A56 A;  4L5G A;  4QKN A;  5IHY A;  4V1A v;  3ZC0 A;  3CPZ A;  5M4Y A;  1MNE A;  5JRC A;  3O1I A;  4FJO A;  3LK4 2;  2V7K A;  2Y8D A;  5J2U E;  3ZMT B;  3EDV A;  3F31 A;  2YIN A;  2NW8 A;  4PJJ A;  3WAK A;  1WYB A;  5DQW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...