4QXBB

Crystal structure of histone demethylase kdm2a-h3k36me3 with nog
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxbB00
4QXCB 4QXHB 4QWNB 4QX8B 4QX7B 4TN7B 4QXBB
chains in the Genus database with same CATH superfamily
3CVRA 5JR9A 4HFEA 3AEDA 3UULA 4B3TT 4L9IA 3ZMTB 2WS3A 3E08A 1T98A 4DO0A 4HN9A 5LBQB 5AQSB 5FKYA 3AXJA 3B57A 1SUMB 1E1HB 5DQWA 5LG3A 3PUVF 3E0ZA 4JYAT 4G2AA 1LVFA 2Q9QA 3O1JA 2XQYA 4IGUA 2LKGA 3ZJ2A 3TLVA 3L8RA 2XPKA 1OEDB 3SRZA 3TKLB 5C3JA 2VL0A 3OJAA 3LBXA 3CX7B 4XZCA 4E7SA 3AEEA 1Y64B 4TV8E 3ZMVB 2IAKA 2DL1A 5JVDE 2LHNA 3M65A 5LXTE 4DR7T 3JCFA 1U5PA 4KHPT 4YT0A 3EAMA 3NZPA 1WR6A 2VKJA 2DCFA 2E5VA 3FHNA 2E5LT 5HAXA 4BAYB 2VKDA 1KF6A 1OEDC 3ABVA 4LMLA 3ANWA 3L39A 2FJAA 2XM2A 4B3MT 1WRDA 5JDNA 2XJ7A 3T8OA 5LHHB 2CBIA 3RYFE 5AQPB 2UXDT 4EZHA 4LF4T 4X1YE 2I6HA 1XDOA 4WBOA 2W0GA 3TLUA 2XQ3A 2YINA 1BR1A 2WQYA 1VRBA 5CJ5A 3DP7A 1IBLT 3N9LA 2V7LA 4ZI2D 5FXWA 2UUAT 2NW9A 3QOFA 1HF8A 3N9MA 2DLRA 4LF9T 1QLBA 4IE7A 2WMNA 3SS1A 1D0ZA 3QB5K 3AE6A 4PAGA 4UV9B 2J1DG 4EGWA 3QUJA 3PUSA 2WWUA 3RQWA 2WDQA 4LFAT 2H7VC 3AE7A 4LF7T 5JDGA 4GOUA 4JI0T 4ERRA 1SA0E 3ZC0A 4ZHQE 4DV3T 2WU2A 2XQ7A 1UURA 2W61A 3ZT6A 2BVMA 2M6BA 5AQLB 3X1DA 5KDMC 3HKBE 4DNDA 4MALA 2NR4A 1J1JA 3AB3B 3RRCA 4AQFC 2M67A 1MNEA 5HEUA 3MXZA 5F3JA 4PK5A 4C90A 3J7Yq 1J5ET 4AI6A 2JQKA 3OPCA 3ONLC 4EEBA 1YD8G 2W67A 2V7KA 4Z91A 2DNXA 3QB5A 3UFEA 3OTOT 2D2SA 2J4GA 3Q2MA 4AQYT 4ZEYA 5BMVE 4IIJE 4DV1T 4KUMB 3BQLA 3UT5E 4GKJT 3D0TA 4OYKA 3PUXF 4TNWA 1MMNA 4JI1T 5EK2A 5KXJA 5BR8T 3N9OA 3RIUC 4DV0T 4QXBB 1HNZT 4N78D 3JC6C 4AISA 3P7IA 3NZQA 4JI7T 1IAPA 5L3FB 2FJDA 3QNUA 2V6YA 4HWHA 2CM0A 1T7SA 3ONJA 3CX8B 2RA1A 4ZZBA 3N9NA 3F2EA 2X0HA 4CZZB 4CXWA 1D1CA 3FXEB 5HCMA 2E9XD 5JDMA 2W63A 2LOPA 4Z90A 3VU7H 5JTGA 2KLQA 4OHFA 3CKDA 4U2ZA 5EK3A 2LOSA 3I0OA 2UXXB 3MZKB 1G8XA 2VQET 1V9DA 4GK5E 2PFVA 4I0UA 2A2FX 4A97A 1NENA 4DVDA 2Q9QD 3O1IA 3AVSA 4TWDA 5HEOA 3N2KE 5JREA 2BBHA 3SFDA 3KBUA 1FJGT 2MOZA 2B1EA 3AECA 3FZFB 2H7OA 3RX6A 3ZCJA 2OV9A 1X79A 3P4WA 2KWHA 4O4LE 4OFZA 4LMKA 3GN5B 5HYAA 4UR9A 5CA1E 2HPLA 1G73A 1Z8UA 2BG9B 2BZBA 2UXCT 3FZLB 4CN1A 3LFMA 1O3XA 2XHEB 3ZYMA 2LE8A 3P4QA 4HTEA 4U33A 2WY2A 4MHCA 1D1AA 2X9XA 4P0AA 2XM1A 5AQQB 4IL9A 2JIWA 5J2TE 4UVBB 3HL6A 5HEHA 2YDRA 5JRCB 2E2AA 2DHRA 3UUNA 3PU8A 4ASKA 3F31A 1VCSA 3H3MA 1MIVA 5ABHA 1OWAA 5CB4E 2BG9C 1QUUA 1IJ6A 3RC8A 4UF0B 3CK6A 3OYZA 3UFGA 4P0BA 2H88A 4UEMA 2HHHT 1T8BA 3ZJ1A 2IUBA 3AA6B 4CN6A 5AQHB 1ZHCA 3WI3A 3L3PA 5LOVE 1YW0A 2PG8A 2HN2A 2C5JA 2XQAA 4EIWA 5LYJE 2I0MA 3MACA 3H3AA 4MLKA 2MYSA 1W9RA 1M7KA 4LMJA 4JEHB 3AE4A 2UUBT 3RPUA 1QSDA 4F8HA 3RI5A 3GA8A 5LNKA 4U7IA 1T72A 4B6XA 2A72A 2IDOB 5CGMA 2E8IA 3U3IA 2CHOA 3UU6A 2H89A 5AQNB 5E0OA 5A1LA 4MBQA 3AA7B 1NWMX 4FJOA 2K5BB 1WLXA 2LSGA 4TX5A 4QH5A 3AAIA 4ZS2A 1W0AA 4AKLA 3Q5XA 3EI0A 4JUYA 3IEEA 4ZXLA 2FUPA 4TV9E 5LP6E 1KNZA 2JPFA 1N33T 3PUYF 4DBQA 1XZYA 3ETVA 2BG9E 2A9UA 2VB6A 4ZI3D 4U31A 1XNQT 3CWZB 4XBFB 4DUYT 2VASA 5ABFB 2MBGA 4EZ4A 2J47A 2ODVA 1HX8A 4QH1A 2WM9A 4KHZF 3HKCE 4ZI2C 2ODUA 4CXXA 2CRBA 2XZEA 2L9QA 1IBKT 4PFPA 4IE0A 2VKHA 3RLFF 3CPZA 3M3ZB 2NOXA 4EB6E 1OEDA 4I43B 1E2AA 2WDRA 4PJJA 3LG7A 3AVRA 2W00A 4L5GA 3PUWF 2ACZA 2NW8A 4IDNA 4I55E 3B5MA 3P4PA 3T1YT 2K24A 1I6ZA 1R8IA 3UQ7A 1WYCA 4NUUA 4O4HE 4AKIA 2WWVA 2AXDS 4DV5T 1VOMA 5L3EB 4QX8B 2W4XA 2ZM0A 4ILCA 1CUNA 3ZMUB 2KWIB 3C4ZA 1YKHB 5AQUB 2QA7A 3RYCE 4QKNA 2E9XB 3UU4A 1D0XA 2K9AA 3O1HA 4HE8A 4TZ4C 4WYVA 5LA6E 2H3RA 4IDZA 2NP9A 3FBZA 5F8PA 2BS3A 1HNXT 2WU5A 4PJLA 2V7MA 2FBWA 1XDPA 3KV5A 1U4QA 5JDQA 2JMHA 4IE6A 2XAGB 4HWIB 3P8CD 4AQFA 3IA3A 2NTYA 4YSZA 1LRZA 3ZN1B 3AEGA 2E9XC 2NW7A 2CWYA 2V5CA 2HH7A 2YEVC 3F57A 5C2TA 1D1BA 3PTRB 4QXCB 4UVAB 3PJAA 1B7TA 4GK0E 3O4XE 2YU1A 4BJMA 3C50A 4C91A 3A8YC 3KBTA 3QC9A 3N5LA 3RYIE 5J0ZA 3RIUA 4A98A 3LK2B 4TWHA 3SOLA 4TUYE 3T1HT 2AE9A 4PK4A 1LVKA 2X0YA 4M1PA 1HG5A 3TLTA 1UUSA 4AIUA 3N2GE 2CXFA 1ZP0A 4GKKT 3A7MA 3UU8A 4FI5A 5L4HA 2BVLA 3RHWA 2WB5A 3ZEFB 3I9YA 1N34T 4V1Av 2A3DA 5LBMA 2MPKA 5HXRA 1NAFA 1YQ3A 3VKHA 3I1AA 5IHYA 5HXCA 3AE2A 3L09A 2NTXA 3RRWA 1UX4A 1IJ5A 2IC6A 4G63A 3VRAA 3PJAJ 2CMRA 2XSAA 2VL8A 3NKZA 2BS4A 3UUXB 2V6XA 3O9XA 2CEAA 2Y6XA 3OBVE 3FB2A 3G06A 2V8SV 4X20E 1YKEB 4X64T 2CBJA 2RP4A 5LB7B 4DMWA 5FNVE 2YDSA 4ZI7E 5ABEA 4KX6A 4P09A 3KV6A 1DU2A 4U3CA 1WFDA 4DBRA 3EDVA 4K0UA 2CCQA 2JQHA 2CXLA 5AQIB 1YQ4A 2XSBA 4LF8T 3BQIA 3RGLA 3NRXA 4YXDA 2VWAA 1Y01A 3WAKA 4NUVA 2N9DA 3ZSTA 3MKDA 3ZPOA 4IDQA 3DTOA 2YOEA 3WAJA 3EDUA 4YY3T 4ILUA 1LKXA 2WAUA 3P4RA 4HWDA 1SE7A 1EZ3A 2UXNB 3GN5A 2XQ8A 5FXZA 4O2AE 4U72A 2FJEA 4X65T 1NEKA 2ACXA 5JDHA 4YHJA 4A56A 5CFBA 2BKOA 2CWOA 4COFA 3CMLA 5L3CB 3PUZF 2V26A 2EHOA 4PJMA 4ZOLE 4NXMT 3JADA 3PUGA 4I50E 5JRCA 3UUMA 1MNDA 2CE7A 5IUXA 4QX7B 2LRLA 4A5XA 1YXRA 2XAHB 4IE4A 4DR4T 4DIDB 4AKHA 3EABA 4DV6T 3AEFA 3TLSA 4DUZT 1XMQT 4DR6T 2XAJB 2JJ9A 2B76A 3PV0F 4UF0A 1ZEEA 4ZI3C 3KVAA 2XQ5A 2WMOA 4BA9A 1HR0T 3VR8A 3FZHB 4EAHA 5L3GB 4ILBA 3KV9A 3OVUA 3EUHA 3J9X1 1ZKEA 1HFAA 4YHHT 3ZC1A 4PJNA 3HR0A 4Q25A 4ADZA 4O8SA 2VVSA 1HNWT 3JAFA 2ZM8A 3R6NA 1D0YA 5AQVB 4TWFA 2DI4A 2ZMAA 2D0TA 3I0QA 3IBPA 1HS7A 4NPPA 4KBMB 5FVKA 4UV8B 5ETWA 2BBJA 3AE5A 5EK4A 4OK0A 4B3ST 2WBLA 2YDQA 2NWBA 4IT4A 2OLTA 4GYSA 2X9WA 2LM2A 3IF8B 3ESLA 4AXPA 3N9PA 4O2BE 3P50A 3AE9A 1IBMT 3Q9DA 2WDVA 3LSVA 2BDEA 2QYWA 2I59A 4QH4A 3K8PC 1Z0PA 4XAXB 3VR9A 4H9SE 5FP3A 4X62T 3GWHA 2KT9A 4AQGA 4H63H 1E7PA 4JI6T 4B3RT 2XQ6A 3V5UA 5AQRB 3NVOA 4YJ3E 1KNPA 4P1NA 4E7ZA 5LJMA 5FY7A 3KVBA 3ZLIA 5LHGB 4GIWA 3IHRA 2DWGA 4CI1B 2FJBA 2SPCA 4QHOA 4L0RA 4EEDA 2VVNA 1JNZA 2QVAA 2KINB 4DMVA 3PURA 4JI5T 4HEAA 4DR2T 5M4YA 3MK7C 1KK7A 2HPJA 1MMDA 3DJBA 4X1IE 5FXVA 2LSYA 2KXPB 3RH3A 5HXHA 3FXDB 1XNRT 2C5IT 5FY1A 1FMVA 1CHUA 3K3OA 4JV5T 5HCJA 4DR5T 2XY8B 4CQIA 4X5TA 2WZHA 2D5UA 3ZYKA 5FMNA 3KINB 2W66A 4IDOA 5H6RB 4YTNA 1N36T 1MMAA 3LJCA 5TAOA 3RF1A 4I4TE 2D9DA 1XWMA 5FVLA 3UQ4A 3PUQA 1UCUA 5KMGP 3LDQB 4H9OC 5L2LA 4QXHB 2LSIA 5LHIB 3VKGA 3ONXA 4ISTA 3V5SA 5J2UE 4EYYR 2N2NA 3KFWX 2E9XA 4U7YA 5LMUT 1M62A 3MJXA 4H9NC 5HWYA 2MTQA 4ILAA 5LJNA 2EHOD 5DABA 5AFUL 5CA0E 4UXNB 4IL4A 3NRYA 1ZV4X 3PDYA 3ZSSA 5J1GA 3LK3B 2JQ9A 5JR9B 4DV2T 4PFOA 2YN6A 4NXNT 4Z8XA 2LT3A 4H63V 4U74A 2CA5A 3QK6A 4HFDA 3AXJB 3ZN0B 3RQUA 3B13A 2IC9A 5L3BB 5DJQC 2IMLA 2CPTA 2ES0A 4PK6A 2K48A 2X68A 2C5KT 4ZS3A 2V7IA 1J5WA 5JR9C 4KP3C 2Q9QB 3PUAA 3K1SA 3N2OA 1KNRA 2LHRA 4K0KT 2X66A 4QWNB 5JQGE 5L4EA 4AKGA 4HFHA 3MA9A 5FL1A 1FIOA 5HEJA 2YK0A 3OKQA 3LBXB 4HFCA 1UGOA 2YKSA 4EXTA 3VRBA 3E22E 3RIAA 5HWXA 3FBLA 4ZZCA 2QGSA 2QRXA 4WBNE 4DV7T 4YSYA 1US7B 4HFBA 3H37A 5ADXL 3W15B 2Q9QC 4IE5A 3CX6B 2PJQA 2X0LB 1L0VA 2LJLA 4JBWF 5AQTB 4YSXA 3GMIA 1HG2A 3ANWB 3U78A 4YTMA 1UK5A 2JMKA 5JH7E 4PW8A 3EHZA 4ISSA 4HWFA 4YTPA 4X1KE 2OA5A 2XAQB 4NIQA 2DWKA 4YFSA 4IHJE 4BJNA 5AQOB 3BK9A 2BKNA 5L47A 2GK9A 1KFYA 3HI2A 2UUCT 2VURA 2D0UA 3UTKA 3PU3A 3CIRA 3Q5EA 2K3WA 1BR2A 5GONE 4UIGA 2LM9A 2XASB 4JLEA 3I9WA 4DR3T 4OX9T 2WZIA 2MAWA 5AQJB 2KZ7B 4HWCA 3TLWA 3C98B 3AE3A 5FL0A 1OEDE 5F5WA 5LGUB 4J2CA 1VCTA 3ZT7A 4LFBT 2CHNA 2IIUA 4GYRA 4PNIA 2Y48B 2X9HA 5LGTB 1SHZC 3ZMZB 2G0UA 2ZM2A 3AEBA 3ZCIA 2Z6EA 3C4WA 2KMFA 3NWIA 5AQGB 5ABGA 2J62A 3LK42 2XQ9A 4MFRA 4LF5T 3HKEE 4TN7B 2W2UA 3PE0A 4CXYA 4IREA 3C4XA 4CI3B 3C64A 5IYZE 3RIFA 3AA1B 5LGNB 4UELA 2LRKA 3AEAA 4HFIA 3ETUA 3AA0B 4HGAA 4H9PC 1JNRA 3FZKB 2LLYA 2BKPA 3ZYLA 2UXBT 4CI2B 3K3NA 1S35A 2RPAA 2BG9A 2VQFT 5HXEA 3Q5WA 2L8KA 3RC3A 5KX5E 2KNDA 1N32T 3AAAB 5L3DB 3RKGA 4JI8T 5LCYA 1AJ3A 2V6YB 5FYMA 4KI0F 3RKOA 2X9YA 3UUBA 3AE8A 2XUEA 4WNKA 2X51A 1H7CA 5LMNT 5IWAT 3CQCB 4LFCT 1GQEA 1IZNB 3OYXA 4EV6A 3CQXC 5JDLA 3EVYA 1HCIA 1MIWA 3ZT5A 2P9BA 2V5DA 1WR0A 2BS2A 3BQKA 3UU3A 1FMWA 2LSJA 2XAFB 2CLYB 5JDFA 4JI2T 5DQVA 4H9RC 3Q5DA 4UVCB 2CXDA 4OYJA 5AQFB 2YU2A 4JI4T 3P4SA 4HKAA 3K3QC 2HN1A 4DR1T 2EHOB 2PTFA 3HA4A 4ANJA 1X9BA 1MIYA 1BR4A 2XQ4A 1MMGA 3CQGB 4EYUA 4O4JE 2CLYC 4LF6T 2WP9A 2VK9A 2R6GF 2W62A 4YLHA 2XTLA 3JC6D 1UX5A 1XMOT 4H9QC 1W0BA 2UU9T 1HTJF 1OXZA 3HKDE 3KDSE 2LKHA 2EHOC 2C0SA 4WZXA 1FEWA 5AQKB 2ZM6T 3A5XA 2V1DB 4TNVA 3ZMSB 3SWHA 5HXSA 1HX1B 3C51A 3ZKRA 1W09A 1KEYA 1ZOYA 4YJ2E 3VHLA 3R84B 5HEGA 5ABFA 2IHR1 4WW0A 2LSKA 4U2YA 2IW5B 2WCAA 2LEHA 2N1GA 2Y8DA 3FZMB 3JAEA 5FY0A 3KV4A 2JRKA 3AAEB 4EOZB 2F4VT 3SFEA 4HFVA 4X66T 1S94A 1WCRA 3AE1A 3NBXX 3RYHE 2JQQA 2V7JA 4AKRB 2PBIA 3S4UA 4JI3T 4O4IE 2VKOA 5EZYE 2ZLYA 5H6QB 1I94T 2WSSV 2M6IA 4F6RC 5FXXA 4CN4A 2L3LA 3UU5A 1WYBA 4KMCA 3N9QA 4IDPA 4DV4T 1BR0A 4JEUB 5C8YE 5LG4A 2X67A 2KSRA 5AQMB
chains in the Genus database with same CATH topology
3NRXA 3CVRA 5ADXL 2VWAA 3WAKA 5JR9A 2Q9QC 4IE5A 4NUVA 3W15B 3CX6B 2N9DA 2PJQA 3MKDA 3UULA 2X0LB 4UEMA 3ZPOA 3DTOA 2LJLA 3WAJA 3GMIA 3EDUA 3ZJ1A 1HG2A 4ILUA 4L9IA 3ZMTB 3ANWB 3U78A 1LKXA 2WAUA 3AA6B 3E08A 1T98A 4DO0A 1ZHCA 2JMKA 3WI3A 4HN9A 5LBQB 3L3PA 1EZ3A 5LOVE 2UXNB 1YW0A 2PG8A 5JH7E 4PW8A 3B57A 4ISSA 3GN5A 2C5JA 4X1KE 4EIWA 2OA5A 5FXZA 5LYJE 4O2AE 2XAQB 2DWKA 1E1HB 4YFSA 3MACA 3H3AA 4MLKA 2MYSA 4U72A 4IHJE 4BJNA 5DQWA 2ACXA 3BK9A 4JEHB 5JDHA 4YHJA 3E0ZA 4A56A 2GK9A 4G2AA 3RPUA 1LVFA 3HI2A 1QSDA 2CWOA 2Q9QA 3O1JA 2XQYA 2D0UA 4IGUA 3ZJ2A 3CMLA 3UTKA 3PU3A 5L3CB 2V26A 3GA8A 3SRZA 5GONE 1BR2A 2EHOA 3TKLB 5LNKA 4PJMA 4UIGA 4ZOLE 2LM9A 3OJAA 3LBXA 4B6XA 3CX7B 2A72A 2XASB 3PUGA 4I50E 4JLEA 5JRCA 3I9WA 3UUMA 1MNDA 2E8IA 4XZCA 2CE7A 3U3IA 4QX7B 4E7SA 2XAHB 1Y64B 2KZ7B 4IE4A 4TV8E 4MBQA 5E0OA 5A1LA 3AA7B 2IAKA 3ZMVB 4AKHA 1NWMX 3C98B 4FJOA 2K5BB 1WLXA 2LSGA 2JJ9A 2XAJB 5JVDE 2LHNA 3M65A 5LGUB 4TX5A 5LXTE 4J2CA 3AAIA 4UF0A 4ZS2A 1U5PA 1ZEEA 3KVAA 4ZI3C 4AKLA 2WMOA 3Q5XA 4JUYA 4BA9A 3IEEA 1WR6A 3NZPA 2VKJA 2DCFA 3FHNA 4EAHA 4TV9E 5L3GB 5LP6E 1KNZA 3KV9A 4GYRA 2JPFA 4PNIA 5HAXA 4BAYB 2Y48B 2VKDA 2X9HA 4DBQA 5LGTB 1SHZC 2G0UA 3EUHA 3J9X1 1ZKEA 3ANWA 3ETVA 3ZMZB 2ZM2A 1HFAA 2VB6A 3ZCIA 3ZC1A 4ZI3D 2Z6EA 3C4WA 2KMFA 4PJNA 3CWZB 3HR0A 1WRDA 4XBFB 2VASA 5JDNA 4ADZA 4O8SA 3T8OA 5LHHB 2MBGA 4EZ4A 3RYFE 3LK42 2ODVA 2ZM8A 3R6NA 1HX8A 2WM9A 4EZHA 4MFRA 1D0YA 3HKEE 4TN7B 4X1YE 3PE0A 3HKCE 4CXYA 4ZI2C 4WBOA 2ODUA 2W0GA 2DI4A 2ZMAA 2YINA 4CXXA 2D0TA 3I0QA 3IBPA 1HS7A 1BR1A 2L9QA 4PFPA 3C4XA 4IE0A 4CI3B 3C64A 5IYZE 4KBMB 2VKHA 3AA1B 1VRBA 3CPZA 5LGNB 4UV8B 4UELA 5ETWA 2NOXA 3DP7A 4EB6E 3N9LA 2V7LA 4I43B 3ETUA 3AA0B 4ZI2D 5FXWA 2NW9A 4HGAA 4H9PC 5EK4A 4PJJA 4OK0A 3LG7A 1HF8A 3AVRA 3N9MA 2W00A 2DLRA 3ZYLA 2WBLA 4IE7A 4L5GA 4CI2B 3K3NA 2WMNA 2NWBA 3SS1A 1D0ZA 4GYSA 2X9WA 1S35A 2NW8A 4PAGA 4UV9B 4I55E 3IF8B 3ESLA 4AXPA 5HXEA 2K24A 2J1DG 3Q5WA 3QUJA 3PUSA 2WWUA 3N9PA 2L8KA 3RC3A 5KX5E 4O2BE 2KNDA 3Q9DA 2H7VC 2BDEA 2I59A 3AAAB 5L3DB 3K8PC 1WYCA 4NUUA 1Z0PA 4O4HE 4XAXB 5LCYA 5JDGA 1AJ3A 4AKIA 4GOUA 4ERRA 4H9SE 1SA0E 5FYMA 5FP3A 3RKOA 2X9YA 3ZC0A 1VOMA 3GWHA 4ZHQE 2KT9A 4AQGA 5L3EB 2XUEA 4WNKA 4QX8B 2ZM0A 2X51A 1H7CA 4H63H 2W61A 2BVMA 1CUNA 3CQCB 3V5UA 3ZMUB 5KDMC 1IZNB 3HKBE 4DNDA 4MALA 3AB3B 3RRCA 3OYXA 4YJ3E 4AQFC 3CQXC 2M67A 1MNEA 5JDLA 3MXZA 2KWIB 3EVYA 4PK5A 3C4ZA 5F3JA 4C90A 3J7Yq 4E7ZA 5LJMA 1YKHB 4AI6A 5FY7A 2QA7A 3RYCE 1HCIA 4QKNA 2E9XB 3KVBA 3ZLIA 1MIWA 5LHGB 4GIWA 2P9BA 3IHRA 1YD8G 2DWGA 1D0XA 2K9AA 3BQKA 4CI1B 2V7KA 3O1HA 4HE8A 2DNXA 2SPCA 4TZ4C 1FMWA 5LA6E 4QHOA 2H3RA 4L0RA 3UFEA 2LSJA 2D2SA 2XAFB 3Q2MA 2CLYB 4IDZA 5JDFA 2NP9A 2KINB 3FBZA 5F8PA 4DMVA 3PURA 5DQVA 5BMVE 4HEAA 4H9RC 4IIJE 4UVCB 2CXDA 4PJLA 2V7MA 5M4YA 4KUMB 4OYJA 2YU2A 3BQLA 3KV5A 3MK7C 3D0TA 3UT5E 1KK7A 1U4QA 4HKAA 4OYKA 5JDQA 3K3QC 1MMNA 2JMHA 2HPJA 4IE6A 2XAGB 1MMDA 3DJBA 4X1IE 5EK2A 3P8CD 5FXVA 3N9OA 2EHOB 4AQFA 2LSYA 2NTYA 2KXPB 3HA4A 4ANJA 3RH3A 1LRZA 3ZN1B 4QXBB 4N78D 5HXHA 3FXDB 2C5IT 2E9XC 3JC6C 1MIYA 2NW7A 1FMVA 5FY1A 3K3OA 1BR4A 3P7IA 1MMGA 3CQGB 4EYUA 3NZQA 2CWYA 4CQIA 2HH7A 1IAPA 2YEVC 5L3FB 3F57A 4O4JE 2D5UA 1D1BA 2CLYC 2CM0A 3CX8B 3ZYKA 2RA1A 5FMNA 3KINB 3N9NA 3PTRB 3F2EA 5H6RB 2VK9A 4QXCB 4UVAB 1B7TA 2W62A 4CZZB 4CXWA 4YLHA 1D1CA 3FXEB 1MMAA 3LJCA 4GK0E 5TAOA 2XTLA 2E9XD 3JC6D 5JDMA 1UX5A 2W63A 3O4XE 2LOPA 2YU1A 4I4TE 4H9QC 3PUQA 1UCUA 5KMGP 4H9OC 3VU7H 5L2LA 1HTJF 3C50A 1OXZA 3HKDE 2KLQA 3KDSE 2LSIA 4QXHB 4BJMA 4C91A 5LHIB 4OHFA 3KBTA 3QC9A 2EHOC 2C0SA 3N5LA 3VKGA 3CKDA 3RYIE 5EK3A 1FEWA 2LOSA 3I0OA 2UXXB 3MZKB 1G8XA 3LK2B 1V9DA 3ONXA 4ISTA 3SOLA 4GK5E 2PFVA 4TUYE 3V5SA 4EYYR 2N2NA 5J2UE 3A5XA 2A2FX 2V1DB 3KFWX 4DVDA 4PK4A 2E9XA 1LVKA 2Q9QD 3O1IA 3AVSA 4M1PA 1HG5A 3MJXA 4H9NC 5HWYA 2MTQA 3ZMSB 3N2KE 3SWHA 5LJNA 2EHOD 5HXSA 3N2GE 5DABA 2CXFA 5JREA 5AFUL 3C51A 5CA0E 4UXNB 3NRYA 1ZV4X 3PDYA 4FI5A 3KBUA 5J1GA 4YJ2E 3LK3B 2BVLA 3VHLA 3R84B 3ZEFB 3I9YA 5JR9B 4V1Av 2A3DA 5LBMA 2MOZA 4WW0A 2LSKA 4PFOA 5HXRA 2B1EA 2H7OA 4Z8XA 2LT3A 2IW5B 1NAFA 4H63V 3RX6A 2LEHA 3ZCJA 2N1GA 3VKHA 4U74A 2CA5A 3I1AA 2Y8DA 1X79A 5IHYA 5HXCA 5FY0A 3QK6A 2KWHA 3KV4A 2JRKA 3AAEB 3L09A 4O4LE 4EOZB 2NTXA 3ZN0B 4OFZA 3B13A 3GN5B 5HYAA 3RRWA 1UX4A 1IJ5A 5CA1E 2IC9A 2HPLA 2IC6A 5L3BB 5DJQC 4G63A 2ES0A 4PK6A 1G73A 4HFVA 2BZBA 2CMRA 1S94A 2K48A 2X68A 2VL8A 3LFMA 1O3XA 2XHEB 3NBXX 3RYHE 2LE8A 3ZYMA 2C5KT 4HTEA 4ZS3A 3UUXB 2JQQA 3O9XA 2V7JA 2CEAA 4MHCA 2V7IA 4AKRB 2Y6XA 1D1AA 2X9XA 2PBIA 3OBVE 3S4UA 5JR9C 4P0AA 4O4IE 4KP3C 2Q9QB 3PUAA 3N2OA 2VKOA 2LHRA 5EZYE 3FB2A 2X66A 4QWNB 5JQGE 4AKGA 2ZLYA 5H6QB 3MA9A 4X20E 5J2TE 1YKEB 2WSSV 2RP4A 4UVBB 1FIOA 3HL6A 4DMWA 2YK0A 3OKQA 4F6RC 5FNVE 5FXXA 3LBXB 4ZI7E 2L3LA 5JRCB 4P09A 2DHRA 3KV6A 1WYBA 3UUNA 4KMCA 4DBRA 3PU8A 3EDVA 4ASKA 3N9QA 3F31A 4K0UA 1BR0A 2CCQA 4EXTA 1MIVA 4JEUB 2CXLA 5C8YE 5LG4A 2X67A 3E22E 5HWXA 1OWAA 5CB4E 3FBLA 1QUUA 1IJ6A 2QGSA 3RC8A 4WBNE 4UF0B 3BQIA 3OYZA 1US7B 4P0BA 3H37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXC B;  4QXH B;  4QWN B;  4QX8 B;  4QX7 B;  4TN7 B;  4QXB B; 
#chains in the Genus database with same CATH topology
 3CVR A;  5JR9 A;  4HFE A;  3AED A;  3UUL A;  4B3T T;  4L9I A;  3ZMT B;  2WS3 A;  3E08 A;  1T98 A;  4DO0 A;  4HN9 A;  5LBQ B;  5AQS B;  5FKY A;  3AXJ A;  3B57 A;  1SUM B;  1E1H B;  5DQW A;  5LG3 A;  3PUV F;  3E0Z A;  4JYA T;  4G2A A;  1LVF A;  2Q9Q A;  3O1J A;  2XQY A;  4IGU A;  2LKG A;  3ZJ2 A;  3TLV A;  3L8R A;  2XPK A;  1OED B;  3SRZ A;  3TKL B;  5C3J A;  2VL0 A;  3OJA A;  3LBX A;  3CX7 B;  4XZC A;  4E7S A;  3AEE A;  1Y64 B;  4TV8 E;  3ZMV B;  2IAK A;  2DL1 A;  5JVD E;  2LHN A;  3M65 A;  5LXT E;  4DR7 T;  3JCF A;  1U5P A;  4KHP T;  4YT0 A;  3EAM A;  3NZP A;  1WR6 A;  2VKJ A;  2DCF A;  2E5V A;  3FHN A;  2E5L T;  5HAX A;  4BAY B;  2VKD A;  1KF6 A;  1OED C;  3ABV A;  4LML A;  3ANW A;  3L39 A;  2FJA A;  2XM2 A;  4B3M T;  1WRD A;  5JDN A;  2XJ7 A;  3T8O A;  5LHH B;  2CBI A;  3RYF E;  5AQP B;  2UXD T;  4EZH A;  4LF4 T;  4X1Y E;  2I6H A;  1XDO A;  4WBO A;  2W0G A;  3TLU A;  2XQ3 A;  2YIN A;  1BR1 A;  2WQY A;  1VRB A;  5CJ5 A;  3DP7 A;  1IBL T;  3N9L A;  2V7L A;  4ZI2 D;  5FXW A;  2UUA T;  2NW9 A;  3QOF A;  1HF8 A;  3N9M A;  2DLR A;  4LF9 T;  1QLB A;  4IE7 A;  2WMN A;  3SS1 A;  1D0Z A;  3QB5 K;  3AE6 A;  4PAG A;  4UV9 B;  2J1D G;  4EGW A;  3QUJ A;  3PUS A;  2WWU A;  3RQW A;  2WDQ A;  4LFA T;  2H7V C;  3AE7 A;  4LF7 T;  5JDG A;  4GOU A;  4JI0 T;  4ERR A;  1SA0 E;  3ZC0 A;  4ZHQ E;  4DV3 T;  2WU2 A;  2XQ7 A;  1UUR A;  2W61 A;  3ZT6 A;  2BVM A;  2M6B A;  5AQL B;  3X1D A;  5KDM C;  3HKB E;  4DND A;  4MAL A;  2NR4 A;  1J1J A;  3AB3 B;  3RRC A;  4AQF C;  2M67 A;  1MNE A;  5HEU A;  3MXZ A;  5F3J A;  4PK5 A;  4C90 A;  3J7Y q;  1J5E T;  4AI6 A;  2JQK A;  3OPC A;  3ONL C;  4EEB A;  1YD8 G;  2W67 A;  2V7K A;  4Z91 A;  2DNX A;  3QB5 A;  3UFE A;  3OTO T;  2D2S A;  2J4G A;  3Q2M A;  4AQY T;  4ZEY A;  5BMV E;  4IIJ E;  4DV1 T;  4KUM B;  3BQL A;  3UT5 E;  4GKJ T;  3D0T A;  4OYK A;  3PUX F;  4TNW A;  1MMN A;  4JI1 T;  5EK2 A;  5KXJ A;  5BR8 T;  3N9O A;  3RIU C;  4DV0 T;  4QXB B;  1HNZ T;  4N78 D;  3JC6 C;  4AIS A;  3P7I A;  3NZQ A;  4JI7 T;  1IAP A;  5L3F B;  2FJD A;  3QNU A;  2V6Y A;  4HWH A;  2CM0 A;  1T7S A;  3ONJ A;  3CX8 B;  2RA1 A;  4ZZB A;  3N9N A;  3F2E A;  2X0H A;  4CZZ B;  4CXW A;  1D1C A;  3FXE B;  5HCM A;  2E9X D;  5JDM A;  2W63 A;  2LOP A;  4Z90 A;  3VU7 H;  5JTG A;  2KLQ A;  4OHF A;  3CKD A;  4U2Z A;  5EK3 A;  2LOS A;  3I0O A;  2UXX B;  3MZK B;  1G8X A;  2VQE T;  1V9D A;  4GK5 E;  2PFV A;  4I0U A;  2A2F X;  4A97 A;  1NEN A;  4DVD A;  2Q9Q D;  3O1I A;  3AVS A;  4TWD A;  5HEO A;  3N2K E;  5JRE A;  2BBH A;  3SFD A;  3KBU A;  1FJG T;  2MOZ A;  2B1E A;  3AEC A;  3FZF B;  2H7O A;  3RX6 A;  3ZCJ A;  2OV9 A;  1X79 A;  3P4W A;  2KWH A;  4O4L E;  4OFZ A;  4LMK A;  3GN5 B;  5HYA A;  4UR9 A;  5CA1 E;  2HPL A;  1G73 A;  1Z8U A;  2BG9 B;  2BZB A;  2UXC T;  3FZL B;  4CN1 A;  3LFM A;  1O3X A;  2XHE B;  3ZYM A;  2LE8 A;  3P4Q A;  4HTE A;  4U33 A;  2WY2 A;  4MHC A;  1D1A A;  2X9X A;  4P0A A;  2XM1 A;  5AQQ B;  4IL9 A;  2JIW A;  5J2T E;  4UVB B;  3HL6 A;  5HEH A;  2YDR A;  5JRC B;  2E2A A;  2DHR A;  3UUN A;  3PU8 A;  4ASK A;  3F31 A;  1VCS A;  3H3M A;  1MIV A;  5ABH A;  1OWA A;  5CB4 E;  2BG9 C;  1QUU A;  1IJ6 A;  3RC8 A;  4UF0 B;  3CK6 A;  3OYZ A;  3UFG A;  4P0B A;  2H88 A;  4UEM A;  2HHH T;  1T8B A;  3ZJ1 A;  2IUB A;  3AA6 B;  4CN6 A;  5AQH B;  1ZHC A;  3WI3 A;  3L3P A;  5LOV E;  1YW0 A;  2PG8 A;  2HN2 A;  2C5J A;  2XQA A;  4EIW A;  5LYJ E;  2I0M A;  3MAC A;  3H3A A;  4MLK A;  2MYS A;  1W9R A;  1M7K A;  4LMJ A;  4JEH B;  3AE4 A;  2UUB T;  3RPU A;  1QSD A;  4F8H A;  3RI5 A;  3GA8 A;  5LNK A;  4U7I A;  1T72 A;  4B6X A;  2A72 A;  2IDO B;  5CGM A;  2E8I A;  3U3I A;  2CHO A;  3UU6 A;  2H89 A;  5AQN B;  5E0O A;  5A1L A;  4MBQ A;  3AA7 B;  1NWM X;  4FJO A;  2K5B B;  1WLX A;  2LSG A;  4TX5 A;  4QH5 A;  3AAI A;  4ZS2 A;  1W0A A;  4AKL A;  3Q5X A;  3EI0 A;  4JUY A;  3IEE A;  4ZXL A;  2FUP A;  4TV9 E;  5LP6 E;  1KNZ A;  2JPF A;  1N33 T;  3PUY F;  4DBQ A;  1XZY A;  3ETV A;  2BG9 E;  2A9U A;  2VB6 A;  4ZI3 D;  4U31 A;  1XNQ T;  3CWZ B;  4XBF B;  4DUY T;  2VAS A;  5ABF B;  2MBG A;  4EZ4 A;  2J47 A;  2ODV A;  1HX8 A;  4QH1 A;  2WM9 A;  4KHZ F;  3HKC E;  4ZI2 C;  2ODU A;  4CXX A;  2CRB A;  2XZE A;  2L9Q A;  1IBK T;  4PFP A;  4IE0 A;  2VKH A;  3RLF F;  3CPZ A;  3M3Z B;  2NOX A;  4EB6 E;  1OED A;  4I43 B;  1E2A A;  2WDR A;  4PJJ A;  3LG7 A;  3AVR A;  2W00 A;  4L5G A;  3PUW F;  2ACZ A;  2NW8 A;  4IDN A;  4I55 E;  3B5M A;  3P4P A;  3T1Y T;  2K24 A;  1I6Z A;  1R8I A;  3UQ7 A;  1WYC A;  4NUU A;  4O4H E;  4AKI A;  2WWV A;  2AXD S;  4DV5 T;  1VOM A;  5L3E B;  4QX8 B;  2W4X A;  2ZM0 A;  4ILC A;  1CUN A;  3ZMU B;  2KWI B;  3C4Z A;  1YKH B;  5AQU B;  2QA7 A;  3RYC E;  4QKN A;  2E9X B;  3UU4 A;  1D0X A;  2K9A A;  3O1H A;  4HE8 A;  4TZ4 C;  4WYV A;  5LA6 E;  2H3R A;  4IDZ A;  2NP9 A;  3FBZ A;  5F8P A;  2BS3 A;  1HNX T;  2WU5 A;  4PJL A;  2V7M A;  2FBW A;  1XDP A;  3KV5 A;  1U4Q A;  5JDQ A;  2JMH A;  4IE6 A;  2XAG B;  4HWI B;  3P8C D;  4AQF A;  3IA3 A;  2NTY A;  4YSZ A;  1LRZ A;  3ZN1 B;  3AEG A;  2E9X C;  2NW7 A;  2CWY A;  2V5C A;  2HH7 A;  2YEV C;  3F57 A;  5C2T A;  1D1B A;  3PTR B;  4QXC B;  4UVA B;  3PJA A;  1B7T A;  4GK0 E;  3O4X E;  2YU1 A;  4BJM A;  3C50 A;  4C91 A;  3A8Y C;  3KBT A;  3QC9 A;  3N5L A;  3RYI E;  5J0Z A;  3RIU A;  4A98 A;  3LK2 B;  4TWH A;  3SOL A;  4TUY E;  3T1H T;  2AE9 A;  4PK4 A;  1LVK A;  2X0Y A;  4M1P A;  1HG5 A;  3TLT A;  1UUS A;  4AIU A;  3N2G E;  2CXF A;  1ZP0 A;  4GKK T;  3A7M A;  3UU8 A;  4FI5 A;  5L4H A;  2BVL A;  3RHW A;  2WB5 A;  3ZEF B;  3I9Y A;  1N34 T;  4V1A v;  2A3D A;  5LBM A;  2MPK A;  5HXR A;  1NAF A;  1YQ3 A;  3VKH A;  3I1A A;  5IHY A;  5HXC A;  3AE2 A;  3L09 A;  2NTX A;  3RRW A;  1UX4 A;  1IJ5 A;  2IC6 A;  4G63 A;  3VRA A;  3PJA J;  2CMR A;  2XSA A;  2VL8 A;  3NKZ A;  2BS4 A;  3UUX B;  2V6X A;  3O9X A;  2CEA A;  2Y6X A;  3OBV E;  3FB2 A;  3G06 A;  2V8S V;  4X20 E;  1YKE B;  4X64 T;  2CBJ A;  2RP4 A;  5LB7 B;  4DMW A;  5FNV E;  2YDS A;  4ZI7 E;  5ABE A;  4KX6 A;  4P09 A;  3KV6 A;  1DU2 A;  4U3C A;  1WFD A;  4DBR A;  3EDV A;  4K0U A;  2CCQ A;  2JQH A;  2CXL A;  5AQI B;  1YQ4 A;  2XSB A;  4LF8 T;  3BQI A;  3RGL A;  3NRX A;  4YXD A;  2VWA A;  1Y01 A;  3WAK A;  4NUV A;  2N9D A;  3ZST A;  3MKD A;  3ZPO A;  4IDQ A;  3DTO A;  2YOE A;  3WAJ A;  3EDU A;  4YY3 T;  4ILU A;  1LKX A;  2WAU A;  3P4R A;  4HWD A;  1SE7 A;  1EZ3 A;  2UXN B;  3GN5 A;  2XQ8 A;  5FXZ A;  4O2A E;  4U72 A;  2FJE A;  4X65 T;  1NEK A;  2ACX A;  5JDH A;  4YHJ A;  4A56 A;  5CFB A;  2BKO A;  2CWO A;  4COF A;  3CML A;  5L3C B;  3PUZ F;  2V26 A;  2EHO A;  4PJM A;  4ZOL E;  4NXM T;  3JAD A;  3PUG A;  4I50 E;  5JRC A;  3UUM A;  1MND A;  2CE7 A;  5IUX A;  4QX7 B;  2LRL A;  4A5X A;  1YXR A;  2XAH B;  4IE4 A;  4DR4 T;  4DID B;  4AKH A;  3EAB A;  4DV6 T;  3AEF A;  3TLS A;  4DUZ T;  1XMQ T;  4DR6 T;  2XAJ B;  2JJ9 A;  2B76 A;  3PV0 F;  4UF0 A;  1ZEE A;  4ZI3 C;  3KVA A;  2XQ5 A;  2WMO A;  4BA9 A;  1HR0 T;  3VR8 A;  3FZH B;  4EAH A;  5L3G B;  4ILB A;  3KV9 A;  3OVU A;  3EUH A;  3J9X 1;  1ZKE A;  1HFA A;  4YHH T;  3ZC1 A;  4PJN A;  3HR0 A;  4Q25 A;  4ADZ A;  4O8S A;  2VVS A;  1HNW T;  3JAF A;  2ZM8 A;  3R6N A;  1D0Y A;  5AQV B;  4TWF A;  2DI4 A;  2ZMA A;  2D0T A;  3I0Q A;  3IBP A;  1HS7 A;  4NPP A;  4KBM B;  5FVK A;  4UV8 B;  5ETW A;  2BBJ A;  3AE5 A;  5EK4 A;  4OK0 A;  4B3S T;  2WBL A;  2YDQ A;  2NWB A;  4IT4 A;  2OLT A;  4GYS A;  2X9W A;  2LM2 A;  3IF8 B;  3ESL A;  4AXP A;  3N9P A;  4O2B E;  3P50 A;  3AE9 A;  1IBM T;  3Q9D A;  2WDV A;  3LSV A;  2BDE A;  2QYW A;  2I59 A;  4QH4 A;  3K8P C;  1Z0P A;  4XAX B;  3VR9 A;  4H9S E;  5FP3 A;  4X62 T;  3GWH A;  2KT9 A;  4AQG A;  4H63 H;  1E7P A;  4JI6 T;  4B3R T;  2XQ6 A;  3V5U A;  5AQR B;  3NVO A;  4YJ3 E;  1KNP A;  4P1N A;  4E7Z A;  5LJM A;  5FY7 A;  3KVB A;  3ZLI A;  5LHG B;  4GIW A;  3IHR A;  2DWG A;  4CI1 B;  2FJB A;  2SPC A;  4QHO A;  4L0R A;  4EED A;  2VVN A;  1JNZ A;  2QVA A;  2KIN B;  4DMV A;  3PUR A;  4JI5 T;  4HEA A;  4DR2 T;  5M4Y A;  3MK7 C;  1KK7 A;  2HPJ A;  1MMD A;  3DJB A;  4X1I E;  5FXV A;  2LSY A;  2KXP B;  3RH3 A;  5HXH A;  3FXD B;  1XNR T;  2C5I T;  5FY1 A;  1FMV A;  1CHU A;  3K3O A;  4JV5 T;  5HCJ A;  4DR5 T;  2XY8 B;  4CQI A;  4X5T A;  2WZH A;  2D5U A;  3ZYK A;  5FMN A;  3KIN B;  2W66 A;  4IDO A;  5H6R B;  4YTN A;  1N36 T;  1MMA A;  3LJC A;  5TAO A;  3RF1 A;  4I4T E;  2D9D A;  1XWM A;  5FVL A;  3UQ4 A;  3PUQ A;  1UCU A;  5KMG P;  3LDQ B;  4H9O C;  5L2L A;  4QXH B;  2LSI A;  5LHI B;  3VKG A;  3ONX A;  4IST A;  3V5S A;  5J2U E;  4EYY R;  2N2N A;  3KFW X;  2E9X A;  4U7Y A;  5LMU T;  1M62 A;  3MJX A;  4H9N C;  5HWY A;  2MTQ A;  4ILA A;  5LJN A;  2EHO D;  5DAB A;  5AFU L;  5CA0 E;  4UXN B;  4IL4 A;  3NRY A;  1ZV4 X;  3PDY A;  3ZSS A;  5J1G A;  3LK3 B;  2JQ9 A;  5JR9 B;  4DV2 T;  4PFO A;  2YN6 A;  4NXN T;  4Z8X A;  2LT3 A;  4H63 V;  4U74 A;  2CA5 A;  3QK6 A;  4HFD A;  3AXJ B;  3ZN0 B;  3RQU A;  3B13 A;  2IC9 A;  5L3B B;  5DJQ C;  2IML A;  2CPT A;  2ES0 A;  4PK6 A;  2K48 A;  2X68 A;  2C5K T;  4ZS3 A;  2V7I A;  1J5W A;  5JR9 C;  4KP3 C;  2Q9Q B;  3PUA A;  3K1S A;  3N2O A;  1KNR A;  2LHR A;  4K0K T;  2X66 A;  4QWN B;  5JQG E;  5L4E A;  4AKG A;  4HFH A;  3MA9 A;  5FL1 A;  1FIO A;  5HEJ A;  2YK0 A;  3OKQ A;  3LBX B;  4HFC A;  1UGO A;  2YKS A;  4EXT A;  3VRB A;  3E22 E;  3RIA A;  5HWX A;  3FBL A;  4ZZC A;  2QGS A;  2QRX A;  4WBN E;  4DV7 T;  4YSY A;  1US7 B;  4HFB A;  3H37 A;  5ADX L;  3W15 B;  2Q9Q C;  4IE5 A;  3CX6 B;  2PJQ A;  2X0L B;  1L0V A;  2LJL A;  4JBW F;  5AQT B;  4YSX A;  3GMI A;  1HG2 A;  3ANW B;  3U78 A;  4YTM A;  1UK5 A;  2JMK A;  5JH7 E;  4PW8 A;  3EHZ A;  4ISS A;  4HWF A;  4YTP A;  4X1K E;  2OA5 A;  2XAQ B;  4NIQ A;  2DWK A;  4YFS A;  4IHJ E;  4BJN A;  5AQO B;  3BK9 A;  2BKN A;  5L47 A;  2GK9 A;  1KFY A;  3HI2 A;  2UUC T;  2VUR A;  2D0U A;  3UTK A;  3PU3 A;  3CIR A;  3Q5E A;  2K3W A;  1BR2 A;  5GON E;  4UIG A;  2LM9 A;  2XAS B;  4JLE A;  3I9W A;  4DR3 T;  4OX9 T;  2WZI A;  2MAW A;  5AQJ B;  2KZ7 B;  4HWC A;  3TLW A;  3C98 B;  3AE3 A;  5FL0 A;  1OED E;  5F5W A;  5LGU B;  4J2C A;  1VCT A;  3ZT7 A;  4LFB T;  2CHN A;  2IIU A;  4GYR A;  4PNI A;  2Y48 B;  2X9H A;  5LGT B;  1SHZ C;  3ZMZ B;  2G0U A;  2ZM2 A;  3AEB A;  3ZCI A;  2Z6E A;  3C4W A;  2KMF A;  3NWI A;  5AQG B;  5ABG A;  2J62 A;  3LK4 2;  2XQ9 A;  4MFR A;  4LF5 T;  3HKE E;  4TN7 B;  2W2U A;  3PE0 A;  4CXY A;  4IRE A;  3C4X A;  4CI3 B;  3C64 A;  5IYZ E;  3RIF A;  3AA1 B;  5LGN B;  4UEL A;  2LRK A;  3AEA A;  4HFI A;  3ETU A;  3AA0 B;  4HGA A;  4H9P C;  1JNR A;  3FZK B;  2LLY A;  2BKP A;  3ZYL A;  2UXB T;  4CI2 B;  3K3N A;  1S35 A;  2RPA A;  2BG9 A;  2VQF T;  5HXE A;  3Q5W A;  2L8K A;  3RC3 A;  5KX5 E;  2KND A;  1N32 T;  3AAA B;  5L3D B;  3RKG A;  4JI8 T;  5LCY A;  1AJ3 A;  2V6Y B;  5FYM A;  4KI0 F;  3RKO A;  2X9Y A;  3UUB A;  3AE8 A;  2XUE A;  4WNK A;  2X51 A;  1H7C A;  5LMN T;  5IWA T;  3CQC B;  4LFC T;  1GQE A;  1IZN B;  3OYX A;  4EV6 A;  3CQX C;  5JDL A;  3EVY A;  1HCI A;  1MIW A;  3ZT5 A;  2P9B A;  2V5D A;  1WR0 A;  2BS2 A;  3BQK A;  3UU3 A;  1FMW A;  2LSJ A;  2XAF B;  2CLY B;  5JDF A;  4JI2 T;  5DQV A;  4H9R C;  3Q5D A;  4UVC B;  2CXD A;  4OYJ A;  5AQF B;  2YU2 A;  4JI4 T;  3P4S A;  4HKA A;  3K3Q C;  2HN1 A;  4DR1 T;  2EHO B;  2PTF A;  3HA4 A;  4ANJ A;  1X9B A;  1MIY A;  1BR4 A;  2XQ4 A;  1MMG A;  3CQG B;  4EYU A;  4O4J E;  2CLY C;  4LF6 T;  2WP9 A;  2VK9 A;  2R6G F;  2W62 A;  4YLH A;  2XTL A;  3JC6 D;  1UX5 A;  1XMO T;  4H9Q C;  1W0B A;  2UU9 T;  1HTJ F;  1OXZ A;  3HKD E;  3KDS E;  2LKH A;  2EHO C;  2C0S A;  4WZX A;  1FEW A;  5AQK B;  2ZM6 T;  3A5X A;  2V1D B;  4TNV A;  3ZMS B;  3SWH A;  5HXS A;  1HX1 B;  3C51 A;  3ZKR A;  1W09 A;  1KEY A;  1ZOY A;  4YJ2 E;  3VHL A;  3R84 B;  5HEG A;  5ABF A;  2IHR 1;  4WW0 A;  2LSK A;  4U2Y A;  2IW5 B;  2WCA A;  2LEH A;  2N1G A;  2Y8D A;  3FZM B;  3JAE A;  5FY0 A;  3KV4 A;  2JRK A;  3AAE B;  4EOZ B;  2F4V T;  3SFE A;  4HFV A;  4X66 T;  1S94 A;  1WCR A;  3AE1 A;  3NBX X;  3RYH E;  2JQQ A;  2V7J A;  4AKR B;  2PBI A;  3S4U A;  4JI3 T;  4O4I E;  2VKO A;  5EZY E;  2ZLY A;  5H6Q B;  1I94 T;  2WSS V;  2M6I A;  4F6R C;  5FXX A;  4CN4 A;  2L3L A;  3UU5 A;  1WYB A;  4KMC A;  3N9Q A;  4IDP A;  4DV4 T;  1BR0 A;  4JEU B;  5C8Y E;  5LG4 A;  2X67 A;  2KSR A;  5AQM B; 
#chains in the Genus database with same CATH homology
 3NRX A;  3CVR A;  5ADX L;  2VWA A;  3WAK A;  5JR9 A;  2Q9Q C;  4IE5 A;  4NUV A;  3W15 B;  3CX6 B;  2N9D A;  2PJQ A;  3MKD A;  3UUL A;  2X0L B;  4UEM A;  3ZPO A;  3DTO A;  2LJL A;  3WAJ A;  3GMI A;  3EDU A;  3ZJ1 A;  1HG2 A;  4ILU A;  4L9I A;  3ZMT B;  3ANW B;  3U78 A;  1LKX A;  2WAU A;  3AA6 B;  3E08 A;  1T98 A;  4DO0 A;  1ZHC A;  2JMK A;  3WI3 A;  4HN9 A;  5LBQ B;  3L3P A;  1EZ3 A;  5LOV E;  2UXN B;  1YW0 A;  2PG8 A;  5JH7 E;  4PW8 A;  3B57 A;  4ISS A;  3GN5 A;  2C5J A;  4X1K E;  4EIW A;  2OA5 A;  5FXZ A;  5LYJ E;  4O2A E;  2XAQ B;  2DWK A;  1E1H B;  4YFS A;  3MAC A;  3H3A A;  4MLK A;  2MYS A;  4U72 A;  4IHJ E;  4BJN A;  5DQW A;  2ACX A;  3BK9 A;  4JEH B;  5JDH A;  4YHJ A;  3E0Z A;  4A56 A;  2GK9 A;  4G2A A;  3RPU A;  1LVF A;  3HI2 A;  1QSD A;  2CWO A;  2Q9Q A;  3O1J A;  2XQY A;  2D0U A;  4IGU A;  3ZJ2 A;  3CML A;  3UTK A;  3PU3 A;  5L3C B;  2V26 A;  3GA8 A;  3SRZ A;  5GON E;  1BR2 A;  2EHO A;  3TKL B;  5LNK A;  4PJM A;  4UIG A;  4ZOL E;  2LM9 A;  3OJA A;  3LBX A;  4B6X A;  3CX7 B;  2A72 A;  2XAS B;  3PUG A;  4I50 E;  4JLE A;  5JRC A;  3I9W A;  3UUM A;  1MND A;  2E8I A;  4XZC A;  2CE7 A;  3U3I A;  4QX7 B;  4E7S A;  2XAH B;  1Y64 B;  2KZ7 B;  4IE4 A;  4TV8 E;  4MBQ A;  5E0O A;  5A1L A;  3AA7 B;  2IAK A;  3ZMV B;  4AKH A;  1NWM X;  3C98 B;  4FJO A;  2K5B B;  1WLX A;  2LSG A;  2JJ9 A;  2XAJ B;  5JVD E;  2LHN A;  3M65 A;  5LGU B;  4TX5 A;  5LXT E;  4J2C A;  3AAI A;  4UF0 A;  4ZS2 A;  1U5P A;  1ZEE A;  3KVA A;  4ZI3 C;  4AKL A;  2WMO A;  3Q5X A;  4JUY A;  4BA9 A;  3IEE A;  1WR6 A;  3NZP A;  2VKJ A;  2DCF A;  3FHN A;  4EAH A;  4TV9 E;  5L3G B;  5LP6 E;  1KNZ A;  3KV9 A;  4GYR A;  2JPF A;  4PNI A;  5HAX A;  4BAY B;  2Y48 B;  2VKD A;  2X9H A;  4DBQ A;  5LGT B;  1SHZ C;  2G0U A;  3EUH A;  3J9X 1;  1ZKE A;  3ANW A;  3ETV A;  3ZMZ B;  2ZM2 A;  1HFA A;  2VB6 A;  3ZCI A;  3ZC1 A;  4ZI3 D;  2Z6E A;  3C4W A;  2KMF A;  4PJN A;  3CWZ B;  3HR0 A;  1WRD A;  4XBF B;  2VAS A;  5JDN A;  4ADZ A;  4O8S A;  3T8O A;  5LHH B;  2MBG A;  4EZ4 A;  3RYF E;  3LK4 2;  2ODV A;  2ZM8 A;  3R6N A;  1HX8 A;  2WM9 A;  4EZH A;  4MFR A;  1D0Y A;  3HKE E;  4TN7 B;  4X1Y E;  3PE0 A;  3HKC E;  4CXY A;  4ZI2 C;  4WBO A;  2ODU A;  2W0G A;  2DI4 A;  2ZMA A;  2YIN A;  4CXX A;  2D0T A;  3I0Q A;  3IBP A;  1HS7 A;  1BR1 A;  2L9Q A;  4PFP A;  3C4X A;  4IE0 A;  4CI3 B;  3C64 A;  5IYZ E;  4KBM B;  2VKH A;  3AA1 B;  1VRB A;  3CPZ A;  5LGN B;  4UV8 B;  4UEL A;  5ETW A;  2NOX A;  3DP7 A;  4EB6 E;  3N9L A;  2V7L A;  4I43 B;  3ETU A;  3AA0 B;  4ZI2 D;  5FXW A;  2NW9 A;  4HGA A;  4H9P C;  5EK4 A;  4PJJ A;  4OK0 A;  3LG7 A;  1HF8 A;  3AVR A;  3N9M A;  2W00 A;  2DLR A;  3ZYL A;  2WBL A;  4IE7 A;  4L5G A;  4CI2 B;  3K3N A;  2WMN A;  2NWB A;  3SS1 A;  1D0Z A;  4GYS A;  2X9W A;  1S35 A;  2NW8 A;  4PAG A;  4UV9 B;  4I55 E;  3IF8 B;  3ESL A;  4AXP A;  5HXE A;  2K24 A;  2J1D G;  3Q5W A;  3QUJ A;  3PUS A;  2WWU A;  3N9P A;  2L8K A;  3RC3 A;  5KX5 E;  4O2B E;  2KND A;  3Q9D A;  2H7V C;  2BDE A;  2I59 A;  3AAA B;  5L3D B;  3K8P C;  1WYC A;  4NUU A;  1Z0P A;  4O4H E;  4XAX B;  5LCY A;  5JDG A;  1AJ3 A;  4AKI A;  4GOU A;  4ERR A;  4H9S E;  1SA0 E;  5FYM A;  5FP3 A;  3RKO A;  2X9Y A;  3ZC0 A;  1VOM A;  3GWH A;  4ZHQ E;  2KT9 A;  4AQG A;  5L3E B;  2XUE A;  4WNK A;  4QX8 B;  2ZM0 A;  2X51 A;  1H7C A;  4H63 H;  2W61 A;  2BVM A;  1CUN A;  3CQC B;  3V5U A;  3ZMU B;  5KDM C;  1IZN B;  3HKB E;  4DND A;  4MAL A;  3AB3 B;  3RRC A;  3OYX A;  4YJ3 E;  4AQF C;  3CQX C;  2M67 A;  1MNE A;  5JDL A;  3MXZ A;  2KWI B;  3EVY A;  4PK5 A;  3C4Z A;  5F3J A;  4C90 A;  3J7Y q;  4E7Z A;  5LJM A;  1YKH B;  4AI6 A;  5FY7 A;  2QA7 A;  3RYC E;  1HCI A;  4QKN A;  2E9X B;  3KVB A;  3ZLI A;  1MIW A;  5LHG B;  4GIW A;  2P9B A;  3IHR A;  1YD8 G;  2DWG A;  1D0X A;  2K9A A;  3BQK A;  4CI1 B;  2V7K A;  3O1H A;  4HE8 A;  2DNX A;  2SPC A;  4TZ4 C;  1FMW A;  5LA6 E;  4QHO A;  2H3R A;  4L0R A;  3UFE A;  2LSJ A;  2D2S A;  2XAF B;  3Q2M A;  2CLY B;  4IDZ A;  5JDF A;  2NP9 A;  2KIN B;  3FBZ A;  5F8P A;  4DMV A;  3PUR A;  5DQV A;  5BMV E;  4HEA A;  4H9R C;  4IIJ E;  4UVC B;  2CXD A;  4PJL A;  2V7M A;  5M4Y A;  4KUM B;  4OYJ A;  2YU2 A;  3BQL A;  3KV5 A;  3MK7 C;  3D0T A;  3UT5 E;  1KK7 A;  1U4Q A;  4HKA A;  4OYK A;  5JDQ A;  3K3Q C;  1MMN A;  2JMH A;  2HPJ A;  4IE6 A;  2XAG B;  1MMD A;  3DJB A;  4X1I E;  5EK2 A;  3P8C D;  5FXV A;  3N9O A;  2EHO B;  4AQF A;  2LSY A;  2NTY A;  2KXP B;  3HA4 A;  4ANJ A;  3RH3 A;  1LRZ A;  3ZN1 B;  4QXB B;  4N78 D;  5HXH A;  3FXD B;  2C5I T;  2E9X C;  3JC6 C;  1MIY A;  2NW7 A;  1FMV A;  5FY1 A;  3K3O A;  1BR4 A;  3P7I A;  1MMG A;  3CQG B;  4EYU A;  3NZQ A;  2CWY A;  4CQI A;  2HH7 A;  1IAP A;  2YEV C;  5L3F B;  3F57 A;  4O4J E;  2D5U A;  1D1B A;  2CLY C;  2CM0 A;  3CX8 B;  3ZYK A;  2RA1 A;  5FMN A;  3KIN B;  3N9N A;  3PTR B;  3F2E A;  5H6R B;  2VK9 A;  4QXC B;  4UVA B;  1B7T A;  2W62 A;  4CZZ B;  4CXW A;  4YLH A;  1D1C A;  3FXE B;  1MMA A;  3LJC A;  4GK0 E;  5TAO A;  2XTL A;  2E9X D;  3JC6 D;  5JDM A;  1UX5 A;  2W63 A;  3O4X E;  2LOP A;  2YU1 A;  4I4T E;  4H9Q C;  3PUQ A;  1UCU A;  5KMG P;  4H9O C;  3VU7 H;  5L2L A;  1HTJ F;  3C50 A;  1OXZ A;  3HKD E;  2KLQ A;  3KDS E;  2LSI A;  4QXH B;  4BJM A;  4C91 A;  5LHI B;  4OHF A;  3KBT A;  3QC9 A;  2EHO C;  2C0S A;  3N5L A;  3VKG A;  3CKD A;  3RYI E;  5EK3 A;  1FEW A;  2LOS A;  3I0O A;  2UXX B;  3MZK B;  1G8X A;  3LK2 B;  1V9D A;  3ONX A;  4IST A;  3SOL A;  4GK5 E;  2PFV A;  4TUY E;  3V5S A;  4EYY R;  2N2N A;  5J2U E;  3A5X A;  2A2F X;  2V1D B;  3KFW X;  4DVD A;  4PK4 A;  2E9X A;  1LVK A;  2Q9Q D;  3O1I A;  3AVS A;  4M1P A;  1HG5 A;  3MJX A;  4H9N C;  5HWY A;  2MTQ A;  3ZMS B;  3N2K E;  3SWH A;  5LJN A;  2EHO D;  5HXS A;  3N2G E;  5DAB A;  2CXF A;  5JRE A;  5AFU L;  3C51 A;  5CA0 E;  4UXN B;  3NRY A;  1ZV4 X;  3PDY A;  4FI5 A;  3KBU A;  5J1G A;  4YJ2 E;  3LK3 B;  2BVL A;  3VHL A;  3R84 B;  3ZEF B;  3I9Y A;  5JR9 B;  4V1A v;  2A3D A;  5LBM A;  2MOZ A;  4WW0 A;  2LSK A;  4PFO A;  5HXR A;  2B1E A;  2H7O A;  4Z8X A;  2LT3 A;  2IW5 B;  1NAF A;  4H63 V;  3RX6 A;  2LEH A;  3ZCJ A;  2N1G A;  3VKH A;  4U74 A;  2CA5 A;  3I1A A;  2Y8D A;  1X79 A;  5IHY A;  5HXC A;  5FY0 A;  3QK6 A;  2KWH A;  3KV4 A;  2JRK A;  3AAE B;  3L09 A;  4O4L E;  4EOZ B;  2NTX A;  3ZN0 B;  4OFZ A;  3B13 A;  3GN5 B;  5HYA A;  3RRW A;  1UX4 A;  1IJ5 A;  5CA1 E;  2IC9 A;  2HPL A;  2IC6 A;  5L3B B;  5DJQ C;  4G63 A;  2ES0 A;  4PK6 A;  1G73 A;  4HFV A;  2BZB A;  2CMR A;  1S94 A;  2K48 A;  2X68 A;  2VL8 A;  3LFM A;  1O3X A;  2XHE B;  3NBX X;  3RYH E;  2LE8 A;  3ZYM A;  2C5K T;  4HTE A;  4ZS3 A;  3UUX B;  2JQQ A;  3O9X A;  2V7J A;  2CEA A;  4MHC A;  2V7I A;  4AKR B;  2Y6X A;  1D1A A;  2X9X A;  2PBI A;  3OBV E;  3S4U A;  5JR9 C;  4P0A A;  4O4I E;  4KP3 C;  2Q9Q B;  3PUA A;  3N2O A;  2VKO A;  2LHR A;  5EZY E;  3FB2 A;  2X66 A;  4QWN B;  5JQG E;  4AKG A;  2ZLY A;  5H6Q B;  3MA9 A;  4X20 E;  5J2T E;  1YKE B;  2WSS V;  2RP4 A;  4UVB B;  1FIO A;  3HL6 A;  4DMW A;  2YK0 A;  3OKQ A;  4F6R C;  5FNV E;  5FXX A;  3LBX B;  4ZI7 E;  2L3L A;  5JRC B;  4P09 A;  2DHR A;  3KV6 A;  1WYB A;  3UUN A;  4KMC A;  4DBR A;  3PU8 A;  3EDV A;  4ASK A;  3N9Q A;  3F31 A;  4K0U A;  1BR0 A;  2CCQ A;  4EXT A;  1MIV A;  4JEU B;  2CXL A;  5C8Y E;  5LG4 A;  2X67 A;  3E22 E;  5HWX A;  1OWA A;  5CB4 E;  3FBL A;  1QUU A;  1IJ6 A;  2QGS A;  3RC8 A;  4WBN E;  4UF0 B;  3BQI A;  3OYZ A;  1US7 B;  4P0B A;  3H37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...