4QXBB

Crystal structure of histone demethylase kdm2a-h3k36me3 with nog
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
b'QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxbB00
4QXHB 4QXBB 4TN7B 4QX7B 4QWNB 4QX8B 4QXCB
chains in the Genus database with same CATH superfamily
1T98A 2LJLA 5KX5E 1HCIA 2WQYA 2BKPA 2YEVC 4DIDB 1W0BA 4PNIA 3AA7B 2XAGB 2VQFT 1SHZC 5FYMA 2WWUA 3CWZB 4UELA 3BQLA 4XAXB 3PUQA 5CGMA 4G63A 5LGNB 2K3WA 2QRXA 4MHCA 1Z0PA 4X65T 3VRBA 4AIUA 4B3ST 2FJAA 1D0XA 2JMHA 2DI4A 3AA6B 3KFWX 1VCSA 4ZI3C 3SFEA 5GONE 4JI1T 5LJNA 2M6BA 3SWHA 4CN6A 1E1HB 4AXPA 1OEDB 4QHOA 2IW5B 4LF7T 2LKGA 4FI5A 3AXJB 4DR3T 3I0QA 2UUCT 3RYFE 4TNVA 3TLUA 4TN7B 2E5VA 4DVDA 3J9X1 2UUBT 4YFSA 2CWYA 3QOFA 2NR4A 2CBJA 2XM2A 2UXXB 2ZLYA 1KK7A 3PUXF 3ZYLA 2VL8A 4JV5T 3Q5EA 5EK3A 4KUMB 5BR8T 3VKHA 3T1YT 3AAAB 2W4XA 4U7YA 2YU1A 5FXVA 2NP9A 3K1SA 3TKLB 2ZM0A 2JMKA 4JBWF 4B6XA 1KEYA 4LF4T 3OTOT 4N78D 3EDUA 3J7Yq 3L39A 5AQQB 2WCAA 2ES0A 1SE7A 2H7OA 4HFBA 1FMVA 2LSYA 4EOZB 1KNRA 3PUSA 2X68A 1ZOYA 3AE8A 4ISSA 4YJ3E 4ZI3D 2W66A 4PK5A 5KDMC 3EI0A 3BK9A 3AEDA 5CA1E 2HPLA 4EZ4A 3UUXB 3WAJA 4AKHA 4OFZA 4OK0A 4TUYE 1H7CA 1KFYA 3C4ZA 4H9RC 2V6YB 3QK6A 4EV6A 4O4JE 4YTNA 2CLYC 2LSKA 5H6QB 2X0YA 4H9NC 1XDPA 2BVLA 2VVNA 5LA6E 3N9OA 4HN9A 3RHWA 1YQ4A 4U3CA 4NUUA 3LG7A 4BJMA 5J1GA 3AEEA 2X0HA 2XAHB 1UX4A 3RI5A 4HFDA 4EYUA 4HFCA 4JI2T 1M62A 5DQVA 3JC6C 3RYIE 5LG3A 2VL0A 2YKSA 2WBLA 4K0UA 3E0ZA 3ETUA 3FZLB 2J4GA 4G2AA 3E08A 5L3EB 4TV8E 3ZT7A 4AQYT 4UXNB 3LK2B 4OHFA 3QB5K 1U4QA 3FZKB 5LGUB 2DLRA 2ZM8A 3A7MA 2WSSV 5JDFA 4AKLA 2YU2A 1IBKT 3PDYA 3UUNA 5FL0A 4B3RT 3N5LA 4IE4A 5HEOA 4HFIA 2IIUA 3UU3A 3ZCIA 5JDMA 2D2SA 3B13A 3KV5A 4MLKA 4OYJA 4UR9A 5DABA 2CEAA 3N9PA 2E9XB 3RRWA 4CXWA 5CB4E 3HA4A 1Z8UA 4C90A 1UGOA 2VK9A 5A1LA 2JJ9A 1ZKEA 2V26A 1LVKA 1J5WA 2WDRA 3AE4A 4E7ZA 2GK9A 5TAOA 3IF8B 4HE8A 4PAGA 5HEGA 4YSXA 2HH7A 5FXXA 2QYWA 1IJ6A 2EHOB 4GYSA 4H9SE 2B76A 3LSVA 3RLFF 3V5UA 5LHIB 2YN6A 3KBTA 1XZYA 4U2YA 1MNDA 2XUEA 2RPAA 2PTFA 1O3XA 3TLSA 2MAWA 3ABVA 3SRZA 2BG9B 5CA0E 3AE3A 3MK7C 1LKXA 2M67A 2W62A 1ZP0A 4YT0A 1IAPA 1B7TA 2PG8A 3KV9A 4X1KE 4TWDA 5J2UE 2CXDA 4GOUA 2A9UA 1XNQT 5JRCB 3IEEA 2LM2A 4A56A 3P4WA 3CK6A 4YSYA 4DV7T 3PU3A 2WU5A 2XPKA 3ZMSB 3IA3A 1IZNB 4UF0A 3AEAA 1UX5A 4O4IE 3QNUA 4GIWA 4Q25A 1Y01A 3O4XE 1IBLT 2F4VT 4IREA 1T8BA 4B3MT 1VOMA 3IHRA 4IE0A 3O1IA 1CHUA 5L3DB 3RQWA 2UXCT 4X62T 3ONJA 3OVUA 2J62A 4DV4T 1VCTA 2IC9A 5EK4A 4Z8XA 5ADXL 3C4WA 3B57A 5LBMA 4HKAA 3ZC1A 4DBQA 2ZM6T 2VB6A 2YINA 2P9BA 2V8SV 3H3AA 3X1DA 2C0SA 2AE9A 3O1JA 3AVSA 2R6GF 5AQHB 2ODUA 1YQ3A 2LE8A 5IWAT 4Z91A 3GN5B 3RC8A 4DV3T 5JQGE 5L4EA 4TWHA 3PJAA 3PUAA 1MNEA 4DV6T 4PJLA 4ZI7E 4LFAT 4QXHB 3LFMA 3LBXA 3MJXA 1NENA 3AECA 5L2LA 5IHYA 2E9XD 5AQPB 3DTOA 5HWYA 2H88A 2UU9T 3UU5A 4KBMB 2W67A 5HWXA 5LHHB 5ABGA 3I9YA 4JI5T 2VKJA 3RIAA 4NXNT 4WBOA 1W09A 2LM9A 3AE1A 2A3DA 2HPJA 2EHOD 4DMWA 1HG2A 2BDEA 3PUVF 1J1JA 4UVCB 1G73A 5E0OA 3RYCE 4EEBA 4BAYB 5EZYE 3W15B 2HN2A 4HFEA 1AJ3A 1DU2A 5AQNB 4JI3T 1WYBA 3MXZA 1IBMT 3PU8A 3C50A 3NWIA 4YXDA 3H37A 1N36T 3UU6A 3AA1B 4NPPA 1ZHCA 4WNKA 5DQWA 2IDOB 5LMNT 2V7MA 2V7IA 5JR9B 1BR1A 5JVDE 2XTLA 1L0VA 4ILCA 2JQHA 1S35A 1NAFA 2KZ7B 4EAHA 5CJ5A 4AQFC 4DR7T 4O2BE 2KXPB 2XZEA 3ZT6A 1OWAA 4JLEA 3UQ7A 3Q5DA 1XMQT 1IJ5A 2MOZA 3ANWB 2WWVA 2VQET 3ONLC 1HNZT 2RA1A 3UT5E 4CN1A 2UXNB 2LT3A 4ILBA 5JDNA 3P4PA 2W61A 3N2OA 4KP3C 3N2KE 1WCRA 4DMVA 1KNPA 2BKOA 3N9LA 2XJ7A 5JR9C 3S4UA 3U78A 5L3FB 1XWMA 1W9RA 2ACXA 2PBIA 1HS7A 3AAIA 3OPCA 3RIUC 4CN4A 2A2FX 5C8YE 4ZI2C 2NTXA 4DV1T 1M7KA 4DR1T 4ZS3A 2V7LA 1U5PA 2D9DA 2DWKA 1D1AA 3Q5XA 4KX6A 3RX6A 4AI6A 3C4XA 4HWCA 5ABFB 2WMOA 2BZBA 4KI0F 4JYAT 2JIWA 1CUNA 5C2TA 4H9QC 2CHNA 1MMGA 2CWOA 2VKOA 2KNDA 3AE7A 2XQYA 3RF1A 3UUBA 2LLYA 4EXTA 2B1EA 2KWHA 2ZMAA 1OEDC 3CX8B 1MIVA 2X9WA 2W63A 3CMLA 1SA0E 2KMFA 2J47A 3A5XA 5JH7E 4H63V 1US7B 4PW8A 3SS1A 4U7IA 3MA9A 1NWMX 3PURA 1I94T 2DWGA 2NWBA 4QH4A 2OA5A 4I50E 3PUZF 3NZQA 5KMGP 1D1BA 5FMNA 3R84B 3ONXA 1ZV4X 3AEGA 3BQIA 3ZSTA 5CFBA 1QLBA 2AXDS 1WRDA 3LK3B 5HYAA 2LEHA 4MALA 2A72A 3LJCA 1BR2A 3RIFA 3EHZA 3F31A 2X9HA 4ZI2D 4DV5T 4P0BA 3QB5A 2H7VC 3RH3A 2VURA 4A5XA 2C5JA 3BQKA 2CMRA 4PJJA 2D0TA 3KBUA 2Q9QA 3RRCA 2E8IA 3UU4A 4IE6A 4A97A 4ASKA 4WZXA 4JEHB 1YKEB 4YY3T 5HEUA 2MYSA 4IDOA 4QXBB 2H3RA 3KV6A 2K9AA 2CBIA 2I0MA 4WBNE 2CA5A 4NIQA 3JCFA 3NRYA 2FUPA 2D0UA 4V1Av 5AFUL 5KXJA 3CQGB 3UUMA 1UK5A 3ZN1B 3KINB 2CM0A 2NW9A 5L4HA 4EIWA 5JDLA 2HHHT 3ZMZB 5LCYA 4X5TA 3FZMB 4PJNA 3CIRA 3KV4A 4LFBT 3WI3A 1LRZA 2OLTA 3PJAJ 1X79A 1FJGT 3OBVE 1HX8A 1FIOA 5EK2A 3JAEA 2Y6XA 1MMNA 4X20E 1XMOT 2V5DA 3N9QA 1OEDE 4IDQA 4HWHA 3OYXA 5JDHA 3T8OA 2WDQA 3FXEB 5HEHA 1LVFA 5C3JA 1HNXT 4UVBB 3PUYF 2L8KA 2W0GA 5FXZA 3CX7B 5JREA 2Z6EA 3ZSSA 3RPUA 4U74A 4ERRA 3AA0B 4LF8T 3AVRA 4I4TE 4WW0A 4PJMA 1MIWA 3O9XA 4FJOA 2PFVA 3HKCE 2K5BB 4HGAA 1X9BA 2I6HA 3GWHA 1V9DA 2X9XA 4IGUA 4DR5T 3TLTA 2E9XC 2QGSA 4I55E 1GQEA 3R6NA 2CXLA 1HFAA 3NKZA 2K24A 1N32T 3ZMTB 2MBGA 4AQFA 1EZ3A 5L3GB 2YK0A 5LMUT 4U31A 2XQ3A 3P50A 4ADZA 2EHOC 3ESLA 5LNKA 4JI8T 3ZC0A 2L9QA 2KT9A 1KF6A 3P4QA 3RKGA 4YJ2E 3M3ZB 3HI2A 2VWAA 3FXDB 4PFPA 2BG9C 2HN1A 4CXYA 3EABA 3NZPA 4JI7T 2G0UA 4OYKA 4J2CA 3AE9A 2XQ7A 3ZCJA 1I6ZA 1Y64B 5AQRB 4AKRB 2FBWA 2JPFA 2NW7A 3HKBE 4XBFB 4IT4A 3ZMVB 2JQQA 4QKNA 3K3NA 1YW0A 4DUZT 2XQ8A 5AQIB 3LK42 3JAFA 5LYJE 2CXFA 4ZEYA 2VVSA 4X1IE 3VU7H 2CE7A 3HR0A 3I0OA 1HR0T 4H9OC 5AQLB 2XAJB 4QH5A 5LB7B 2MPKA 4ZZBA 1NEKA 4LFCT 2FJDA 3PTRB 5HEJA 3SOLA 3PUGA 1XNRT 4UF0B 1OEDA 4DV2T 3PE0A 4L9IA 3AXJA 3GMIA 1S94A 4KHZF 1VRBA 2Q9QD 4C91A 5ABEA 4DV0T 4LMLA 3KVAA 1MMDA 4O2AE 5F8PA 5HXCA 3RGLA 2OV9A 3UQ4A 5FKYA 3TLVA 1YKHB 5FY0A 4O4HE 5JDGA 5L47A 5AQSB 2DL1A 4QWNB 1W0AA 3P8CD 4U33A 3CQCB 4H9PC 4L5GA 4QX8B 1T7SA 1D0ZA 4CQIA 3MACA 5IYZE 1BR4A 5LOVE 4DR6T 2D5UA 1JNZA 2CRBA 4HFVA 2LRLA 2N1GA 2WDVA 2LSGA 5AQGB 5FVKA 2BG9E 5HCMA 3FB2A 4UV9B 4CI3B 3U3IA 1FEWA 2FJEA 4L0RA 3UFGA 1D0YA 2JRKA 2SPCA 4I43B 3LBXB 2VKHA 2WM9A 4LF9T 2XHEB 2WZHA 3P4SA 3FBLA 2X67A 3GA8A 3NVOA 4O8SA 1D1CA 3EVYA 1XDOA 3KVBA 2Y48B 3A8YC 4EYYR 2BS2A 2V6YA 4HWDA 3VHLA 4CI2B 2V7JA 4TZ4C 4P1NA 4ANJA 3VRAA 3CQXC 4KMCA 2C5KT 4OX9T 4ZHQE 2KSRA 2IAKA 2JQKA 2WU2A 1WR6A 4QH1A 4NXMT 4X64T 2XY8B 1YXRA 4Z90A 4EEDA 5AQFB 3UU8A 4EGWA 2XSBA 2E2AA 3T1HT 3EAMA 4CXXA 4YHHT 1BR0A 5LHGB 2E5LT 2XAQB 4HTEA 2XQ9A 2CLYB 4F6RC 3N9MA 5FP3A 4QXCB 2ZM2A 4EB6E 4COFA 5AQOB 4HFHA 2UUAT 4UEMA 3RQUA 5HXHA 2QA7A 1ZEEA 2WP9A 2LHRA 2BS3A 3VR9A 4GKKT 4O4LE 3FBZA 5HXRA 4PFOA 2Y8DA 2J1DG 2NTYA 3CPZA 2VKDA 2PJQA 1R8IA 4YTMA 2E9XA 5FY1A 2DNXA 3AE6A 2WS3A 1T72A 4B3TT 3FZFB 3OKQA 4ZXLA 3FHNA 2XQAA 2X51A 3JADA 2C5IT 1N34T 2X0LB 3L8RA 3K3QC 3C51A 4JI6T 4H63H 4E7SA 4BJNA 4TV9E 2WMNA 3PUWF 2W00A 3ZPOA 1OXZA 2EHOA 2L3LA 3DJBA 3HL6A 5HCJA 4IIJE 3AE5A 1HX1B 5LG4A 3E22E 5L3BB 3HKDE 4DR2T 1HG5A 2BG9A 4X66T 1JNRA 2BBJA 3OYZA 5J2TE 3I9WA 5HAXA 3ZMUB 2YOEA 2IUBA 3AAEB 1WYCA 1WR0A 2WB5A 3Q5WA 2XQ4A 4UVAB 4CI1B 5JRCA 4LF5T 4X1YE 4DBRA 5LJMA 1HNWT 2M6IA 2XASB 3D0TA 3N9NA 5L3CB 2V5CA 4ZOLE 1G8XA 4GKJT 2ACZA 5FNVE 5ABHA 3CKDA 2ODVA 2V7KA 5LP6E 4AKIA 3H3MA 1HTJF 3MZKB 5HXSA 1E2AA 3F2EA 4JI4T 5AQKB 2K48A 2NOXA 2YDQA 3UTKA 1KNZA 3RYHE 4WYVA 2LOSA 4LMJA 3P7IA 2W2UA 4A98A 2V1DB 2KINB 3KDSE 4LMKA 1WFDA 2H89A 2YDRA 3QUJA 3AEBA 4U72A 1MIYA 2RP4A 3CX6B 4QX7B 3RKOA 2DCFA 5IUXA 5FXWA 4GK0E 3UULA 3GN5A 2Q9QB 4DUYT 1N33T 1QSDA 3LDQB 3P4RA 4GYRA 4JUYA 1FMWA 5DJQC 4LF6T 3JC6D 2BBHA 4IHJE 2WZIA 4PK6A 4AISA 2BKNA 3NRXA 5LBQB 4F8HA 5AQJB 2V6XA 1WLXA 2BS4A 5ETWA 4P09A 3L3PA 3ZKRA 3AEFA 4NUVA 2XM1A 3MKDA 3ZJ2A 2LSJA 1HF8A 3QC9A 4CZZB 2X66A 4HEAA 1MMAA 4MFRA 2XQ6A 5M4YA 3FZHB 3VKGA 3F57A 1QUUA 4K0KT 2WY2A 4UIGA 4GK5E 2KWIB 3ZN0B 3B5MA 4JI0T 4I0UA 3ZYMA 2Q9QC 5FVLA 3O1HA 4IL9A 2UXDT 4JEUB 4TWFA 5HXEA 4IDPA 2BVMA 4BA9A 2YDSA 3ZT5A 4IE5A 2X9YA 3C64A 4DO0A 2CHOA 4ZZCA 4M1PA 5JR9A 5LGTB 4IE7A 1J5ET 3K3OA 3RIUA 4HWIB 3G06A 2QVAA 5FL1A 3ZEFB 3EUHA 3C98B 5H6RB 1SUMB 5LXTE 2UXBT 4AQGA 5AQUB 3IBPA 2NW8A 4TX5A 2KLQA 3VR8A 4P0AA 4TNWA 4ILUA 3PV0F 3V5SA 2N2NA 3ANWA 4ISTA 4IDZA 3M65A 5JDQA 4HWFA 2JQ9A 4KHPT 2IMLA 1YD8G 4IDNA 2IC6A 3UFEA 4PK4A 2VASA 3AE2A 2WAUA 3Q2MA 4XZCA 4EZHA 3AB3B 3N2GE 2LSIA 2LOPA 3OJAA 3DP7A 3TLWA 4UV8B 5AQMB 3SFDA 2I59A 1E7PA 2CPTA 4DNDA 1UCUA 2XQ5A 3I1AA 5AQTB 2N9DA 4U2ZA 2FJBA 2IHR1 4ILAA 3NBXX 5BMVE 3K8PC 3ETVA 4YLHA 2LKHA 3ZYKA 3RC3A 4YTPA 2DHRA 4ZS2A 2CCQA 1UUSA 3CVRA 3EDVA 4DR4T 5JTGA 2LRKA 4IL4A 4YSZA 4YHJA 1UURA 4MBQA 3ZJ1A 2XAFB 5AQVB 3HKEE 5J0ZA 5F5WA 5FY7A 5ABFA 3ZLIA 3WAKA 3Q9DA 2MTQA 2LHNA 3L09A 4AKGA 2XSAA 5F3JA
chains in the Genus database with same CATH topology
1X79A 3B57A 1T98A 2LJLA 4UEMA 5LBMA 4HKAA 3ZC1A 4DBQA 5HXHA 5KX5E 3OBVE 1HCIA 2QA7A 2VB6A 1HX8A 1ZEEA 1FIOA 2YINA 2LHRA 2P9BA 2YEVC 3H3AA 5EK2A 2Y6XA 1MMNA 2C0SA 4O4LE 4PNIA 3FBZA 3AA7B 3O1JA 3AVSA 2XAGB 4X20E 2ODUA 4PFOA 5HXRA 2Y8DA 2J1DG 2NTYA 3CPZA 1SHZC 2LE8A 2VKDA 2PJQA 5FYMA 3N9QA 2WWUA 2E9XA 5FY1A 3OYXA 5JDHA 3GN5B 2DNXA 3CWZB 4UELA 3T8OA 3BQLA 4XAXB 3RC8A 3OKQA 3PUQA 4G63A 3FHNA 5JQGE 5LGNB 4MHCA 3FXEB 2X51A 1Z0PA 3PUAA 1LVFA 2C5IT 1MNEA 2X0LB 4PJLA 4ZI7E 3K3QC 3C51A 4UVBB 4H63H 4E7SA 4QXHB 3LFMA 2L8KA 3LBXA 1D0XA 2W0GA 2JMHA 3MJXA 5FXZA 5L2LA 5IHYA 4TV9E 2WMNA 4BJNA 2E9XD 2DI4A 2W00A 3AA6B 3CX7B 1OXZA 2Z6EA 5HWYA 2EHOA 3DTOA 3KFWX 3RPUA 3ZPOA 5JREA 4ZI3C 4KBMB 4U74A 4ERRA 5GONE 3AA0B 3AVRA 2L3LA 4I4TE 4WW0A 3DJBA 5HWXA 5LJNA 4PJMA 1MIWA 3O9XA 4FJOA 2PFVA 3HL6A 5LHHB 3HKCE 4IIJE 3SWHA 1E1HB 2K5BB 3I9YA 4HGAA 4AXPA 5LG4A 3E22E 4QHOA 2VKJA 2IW5B 5L3BB 3HKDE 1HG5A 4FI5A 3I0QA 3OYZA 4WBOA 3GWHA 1V9DA 5J2TE 2X9XA 2LM9A 4IGUA 3RYFE 3I9WA 5HAXA 3ZMUB 2A3DA 2HPJA 2EHOD 4DMWA 4TN7B 1HG2A 2E9XC 2QGSA 2BDEA 4DVDA 3AAEB 4I55E 3R6NA 4UVCB 1G73A 1HFAA 1WYCA 2CXLA 2K24A 3ZMTB 3J9X1 5E0OA 4YFSA 3Q5WA 2MBGA 3RYCE 2CWYA 4AQFA 4UVAB 4BAYB 4CI1B 2UXXB 5JRCA 5EZYE 2ZLYA 3W15B 4X1YE 4DBRA 5LJMA 1KK7A 1AJ3A 1EZ3A 3ZYLA 2VL8A 5L3GB 2YK0A 2XASB 5EK3A 1WYBA 3MXZA 3D0TA 3N9NA 5L3CB 4ADZA 4KUMB 4ZOLE 2EHOC 3PU8A 3C50A 1G8XA 3ESLA 3VKHA 5LNKA 3ZC0A 2L9QA 2KT9A 3AAAB 3H37A 5FNVE 3AA1B 3CKDA 2ODVA 1ZHCA 2V7KA 4YJ2E 5LP6E 4AKIA 3HI2A 2YU1A 4WNKA 2VWAA 5FXVA 5DQWA 1HTJF 3FXDB 3MZKB 4PFPA 2NP9A 3TKLB 2V7MA 5HXSA 2ZM0A 2JMKA 2V7IA 3F2EA 4B6XA 5JR9B 1BR1A 5JVDE 2XTLA 4N78D 3EDUA 4CXYA 3J7Yq 1S35A 1NAFA 2KZ7B 4EAHA 3NZPA 2ES0A 2G0UA 2H7OA 4AQFC 4OYKA 1FMVA 2LSYA 4J2CA 2K48A 4EOZB 3ZCJA 2NOXA 3UTKA 1KNZA 4O2BE 3PUSA 3RYHE 1Y64B 2KXPB 2X68A 1OWAA 2LOSA 4ISSA 4AKRB 4YJ3E 4JLEA 4ZI3D 3P7IA 2JPFA 2NW7A 2V1DB 3HKBE 4XBFB 4PK5A 5KDMC 3BK9A 5CA1E 1IJ5A 2MOZA 2HPLA 4EZ4A 3ANWB 2KINB 3KDSE 3UUXB 3ZMVB 2JQQA 4QKNA 3WAJA 3K3NA 4AKHA 3QUJA 4U72A 1YW0A 1MIYA 4OFZA 2RP4A 3CX6B 4OK0A 2RA1A 4QX7B 3RKOA 3UT5E 4TUYE 2DCFA 1H7CA 5FXWA 3LK42 2UXNB 4GK0E 3UULA 3GN5A 2Q9QB 5LYJE 2LT3A 3C4ZA 5JDNA 4H9RC 2CXFA 4X1IE 3VU7H 2CE7A 3HR0A 3I0OA 3QK6A 1QSDA 2W61A 4O4JE 3N2OA 4KP3C 4H9OC 2CLYC 2LSKA 3N2KE 4GYRA 4JUYA 4DMVA 1FMWA 5DJQC 2XAJB 5H6QB 3N9LA 3JC6D 5JR9C 4H9NC 4IHJE 3S4UA 3U78A 2BVLA 4PK6A 5LA6E 5L3FB 2ACXA 3N9OA 3NRXA 2PBIA 5LBQB 4HN9A 3AAIA 1HS7A 4NUUA 3PTRB 1WLXA 3LG7A 5ETWA 5J1GA 3SOLA 4BJMA 2A2FX 3PUGA 4P09A 4UF0B 2XAHB 3L3PA 1UX4A 4NUVA 3PE0A 5C8YE 4L9IA 4ZI2C 3MKDA 2NTXA 4EYUA 3ZJ2A 3GMIA 2LSJA 1S94A 4ZS3A 1VRBA 2V7LA 1U5PA 2Q9QD 4C91A 1HF8A 3QC9A 5DQVA 4CZZB 3JC6C 3RYIE 2X66A 4HEAA 2WBLA 4K0UA 3E0ZA 1MMDA 3KVAA 2DWKA 1D1AA 4O2AE 5F8PA 1MMAA 3ETUA 5HXCA 3Q5XA 4MFRA 5M4YA 3RX6A 3VKGA 3F57A 1QUUA 4G2AA 3E08A 5L3EB 1YKHB 4TV8E 4AI6A 3C4XA 5FY0A 4UIGA 4UXNB 4O4HE 4GK5E 5JDGA 3LK2B 2WMOA 2BZBA 2KWIB 4OHFA 3ZN0B 1U4QA 5LGUB 2DLRA 2ZM8A 4QWNB 1CUNA 2WSSV 5JDFA 3P8CD 3ZYMA 2Q9QC 4AKLA 4H9QC 3CQCB 1MMGA 2YU2A 2CWOA 4H9PC 3O1HA 2VKOA 4L5GA 2KNDA 4QX8B 1D0ZA 2XQYA 4JEUB 4CQIA 5HXEA 4EXTA 2B1EA 3MACA 3PDYA 3UUNA 5IYZE 2KWHA 1BR4A 2ZMAA 3N5LA 4IE4A 5LOVE 2BVMA 3CX8B 4BA9A 1MIVA 2D5UA 2X9WA 2W63A 3CMLA 1SA0E 2KMFA 4IE5A 2X9YA 3A5XA 3ZCIA 3C64A 4DO0A 4HFVA 5JH7E 2N1GA 4H63V 5JDMA 1US7B 2D2SA 3B13A 3KV5A 4M1PA 4MLKA 4OYJA 5DABA 5JR9A 4PW8A 5LGTB 3SS1A 2LSGA 3MA9A 2CEAA 4IE7A 3N9PA 2E9XB 3RRWA 1NWMX 3PURA 3K3OA 4CXWA 2DWGA 2NWBA 5CB4E 3HA4A 3FB2A 2OA5A 4I50E 4UV9B 4CI3B 3U3IA 4C90A 3NZQA 5KMGP 1FEWA 4L0RA 1D0YA 1D1BA 5FMNA 3R84B 2VK9A 3ONXA 5A1LA 1ZV4X 2JJ9A 3ZEFB 1ZKEA 2V26A 1LVKA 2JRKA 3BQIA 3EUHA 2GK9A 2SPCA 3C98B 4I43B 5H6RB 5TAOA 4E7ZA 3IF8B 5LXTE 3LBXB 4HE8A 4PAGA 4AQGA 2HH7A 5FXXA 3IBPA 2VKHA 2WM9A 1WRDA 2NW8A 4TX5A 1IJ6A 2KLQA 2EHOB 4GYSA 4P0AA 4H9SE 2XHEB 3LK3B 4ILUA 5HYAA 2LEHA 4MALA 3V5UA 2A72A 3LJCA 5ADXL 5LHIB 3KBTA 3V5SA 1BR2A 2N2NA 1MNDA 3ANWA 3FBLA 2XUEA 2X67A 3F31A 3GA8A 4ISTA 1O3XA 4IDZA 3M65A 2X9HA 5JDQA 4ZI2D 4P0BA 4O8SA 2H7VC 3RH3A 3SRZA 2C5JA 3BQKA 1D1CA 2CMRA 4PJJA 2D0TA 5CA0E 3EVYA 3KBUA 1YD8G 3KVBA 2IC6A 3MK7C 3UFEA 2Q9QA 2Y48B 4PK4A 2VASA 1LKXA 2M67A 2W62A 4EYYR 3RRCA 2WAUA 3Q2MA 2E8IA 4XZCA 1IAPA 3VHLA 4CI2B 1B7TA 2PG8A 4EZHA 2V7JA 3KV9A 3AB3B 3N2GE 4TZ4C 2LSIA 4X1KE 4IE6A 4ANJA 5J2UE 2LOPA 2CXDA 4GOUA 3OJAA 3DP7A 4ASKA 4UV8B 5JRCB 3CQXC 4JEHB 3IEEA 4KMCA 2C5KT 1YKEB 2I59A 4ZHQE 4A56A 4DNDA 1UCUA 2MYSA 2IAKA 3I1AA 2N9DA 3PU3A 4QXBB 3ZMSB 1IZNB 1WR6A 2H3RA 3KV6A 3NBXX 5BMVE 2K9AA 3K8PC 3ETVA 4WBNE 4YLHA 4UF0A 2CA5A 3ZYKA 3RC3A 3NRYA 2DHRA 1UX5A 2D0UA 4V1Av 4O4IE 4ZS2A 5AFUL 2CCQA 3CVRA 3EDVA 3CQGB 4GIWA 3UUMA 3ZN1B 3KINB 3O4XE 4YHJA 4MBQA 3ZJ1A 2CM0A 2XAFB 4CXXA 2NW9A 4EIWA 1BR0A 1VOMA 3IHRA 5LHGB 4IE0A 3O1IA 2XAQB 3HKEE 5L3DB 5JDLA 3ZMZB 4HTEA 5LCYA 5FY7A 4PJNA 3ZLIA 2CLYB 4F6RC 3N9MA 5FP3A 3WAKA 3KV4A 3Q9DA 2MTQA 4QXCB 2LHNA 2ZM2A 2IC9A 5EK4A 3L09A 3WI3A 4EB6E 4AKGA 1LRZA 4Z8XA 3C4WA 5F3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QXH B;  4QXB B;  4TN7 B;  4QX7 B;  4QWN B;  4QX8 B;  4QXC B; 
#chains in the Genus database with same CATH topology
 1T98 A;  2LJL A;  5KX5 E;  1HCI A;  2WQY A;  2BKP A;  2YEV C;  4DID B;  1W0B A;  4PNI A;  3AA7 B;  2XAG B;  2VQF T;  1SHZ C;  5FYM A;  2WWU A;  3CWZ B;  4UEL A;  3BQL A;  4XAX B;  3PUQ A;  5CGM A;  4G63 A;  5LGN B;  2K3W A;  2QRX A;  4MHC A;  1Z0P A;  4X65 T;  3VRB A;  4AIU A;  4B3S T;  2FJA A;  1D0X A;  2JMH A;  2DI4 A;  3AA6 B;  3KFW X;  1VCS A;  4ZI3 C;  3SFE A;  5GON E;  4JI1 T;  5LJN A;  2M6B A;  3SWH A;  4CN6 A;  1E1H B;  4AXP A;  1OED B;  4QHO A;  2IW5 B;  4LF7 T;  2LKG A;  4FI5 A;  3AXJ B;  4DR3 T;  3I0Q A;  2UUC T;  3RYF E;  4TNV A;  3TLU A;  4TN7 B;  2E5V A;  4DVD A;  3J9X 1;  2UUB T;  4YFS A;  2CWY A;  3QOF A;  2NR4 A;  2CBJ A;  2XM2 A;  2UXX B;  2ZLY A;  1KK7 A;  3PUX F;  3ZYL A;  2VL8 A;  4JV5 T;  3Q5E A;  5EK3 A;  4KUM B;  5BR8 T;  3VKH A;  3T1Y T;  3AAA B;  2W4X A;  4U7Y A;  2YU1 A;  5FXV A;  2NP9 A;  3K1S A;  3TKL B;  2ZM0 A;  2JMK A;  4JBW F;  4B6X A;  1KEY A;  4LF4 T;  3OTO T;  4N78 D;  3EDU A;  3J7Y q;  3L39 A;  5AQQ B;  2WCA A;  2ES0 A;  1SE7 A;  2H7O A;  4HFB A;  1FMV A;  2LSY A;  4EOZ B;  1KNR A;  3PUS A;  2X68 A;  1ZOY A;  3AE8 A;  4ISS A;  4YJ3 E;  4ZI3 D;  2W66 A;  4PK5 A;  5KDM C;  3EI0 A;  3BK9 A;  3AED A;  5CA1 E;  2HPL A;  4EZ4 A;  3UUX B;  3WAJ A;  4AKH A;  4OFZ A;  4OK0 A;  4TUY E;  1H7C A;  1KFY A;  3C4Z A;  4H9R C;  2V6Y B;  3QK6 A;  4EV6 A;  4O4J E;  4YTN A;  2CLY C;  2LSK A;  5H6Q B;  2X0Y A;  4H9N C;  1XDP A;  2BVL A;  2VVN A;  5LA6 E;  3N9O A;  4HN9 A;  3RHW A;  1YQ4 A;  4U3C A;  4NUU A;  3LG7 A;  4BJM A;  5J1G A;  3AEE A;  2X0H A;  2XAH B;  1UX4 A;  3RI5 A;  4HFD A;  4EYU A;  4HFC A;  4JI2 T;  1M62 A;  5DQV A;  3JC6 C;  3RYI E;  5LG3 A;  2VL0 A;  2YKS A;  2WBL A;  4K0U A;  3E0Z A;  3ETU A;  3FZL B;  2J4G A;  4G2A A;  3E08 A;  5L3E B;  4TV8 E;  3ZT7 A;  4AQY T;  4UXN B;  3LK2 B;  4OHF A;  3QB5 K;  1U4Q A;  3FZK B;  5LGU B;  2DLR A;  2ZM8 A;  3A7M A;  2WSS V;  5JDF A;  4AKL A;  2YU2 A;  1IBK T;  3PDY A;  3UUN A;  5FL0 A;  4B3R T;  3N5L A;  4IE4 A;  5HEO A;  4HFI A;  2IIU A;  3UU3 A;  3ZCI A;  5JDM A;  2D2S A;  3B13 A;  3KV5 A;  4MLK A;  4OYJ A;  4UR9 A;  5DAB A;  2CEA A;  3N9P A;  2E9X B;  3RRW A;  4CXW A;  5CB4 E;  3HA4 A;  1Z8U A;  4C90 A;  1UGO A;  2VK9 A;  5A1L A;  2JJ9 A;  1ZKE A;  2V26 A;  1LVK A;  1J5W A;  2WDR A;  3AE4 A;  4E7Z A;  2GK9 A;  5TAO A;  3IF8 B;  4HE8 A;  4PAG A;  5HEG A;  4YSX A;  2HH7 A;  5FXX A;  2QYW A;  1IJ6 A;  2EHO B;  4GYS A;  4H9S E;  2B76 A;  3LSV A;  3RLF F;  3V5U A;  5LHI B;  2YN6 A;  3KBT A;  1XZY A;  4U2Y A;  1MND A;  2XUE A;  2RPA A;  2PTF A;  1O3X A;  3TLS A;  2MAW A;  3ABV A;  3SRZ A;  2BG9 B;  5CA0 E;  3AE3 A;  3MK7 C;  1LKX A;  2M67 A;  2W62 A;  1ZP0 A;  4YT0 A;  1IAP A;  1B7T A;  2PG8 A;  3KV9 A;  4X1K E;  4TWD A;  5J2U E;  2CXD A;  4GOU A;  2A9U A;  1XNQ T;  5JRC B;  3IEE A;  2LM2 A;  4A56 A;  3P4W A;  3CK6 A;  4YSY A;  4DV7 T;  3PU3 A;  2WU5 A;  2XPK A;  3ZMS B;  3IA3 A;  1IZN B;  4UF0 A;  3AEA A;  1UX5 A;  4O4I E;  3QNU A;  4GIW A;  4Q25 A;  1Y01 A;  3O4X E;  1IBL T;  2F4V T;  4IRE A;  1T8B A;  4B3M T;  1VOM A;  3IHR A;  4IE0 A;  3O1I A;  1CHU A;  5L3D B;  3RQW A;  2UXC T;  4X62 T;  3ONJ A;  3OVU A;  2J62 A;  4DV4 T;  1VCT A;  2IC9 A;  5EK4 A;  4Z8X A;  5ADX L;  3C4W A;  3B57 A;  5LBM A;  4HKA A;  3ZC1 A;  4DBQ A;  2ZM6 T;  2VB6 A;  2YIN A;  2P9B A;  2V8S V;  3H3A A;  3X1D A;  2C0S A;  2AE9 A;  3O1J A;  3AVS A;  2R6G F;  5AQH B;  2ODU A;  1YQ3 A;  2LE8 A;  5IWA T;  4Z91 A;  3GN5 B;  3RC8 A;  4DV3 T;  5JQG E;  5L4E A;  4TWH A;  3PJA A;  3PUA A;  1MNE A;  4DV6 T;  4PJL A;  4ZI7 E;  4LFA T;  4QXH B;  3LFM A;  3LBX A;  3MJX A;  1NEN A;  3AEC A;  5L2L A;  5IHY A;  2E9X D;  5AQP B;  3DTO A;  5HWY A;  2H88 A;  2UU9 T;  3UU5 A;  4KBM B;  2W67 A;  5HWX A;  5LHH B;  5ABG A;  3I9Y A;  4JI5 T;  2VKJ A;  3RIA A;  4NXN T;  4WBO A;  1W09 A;  2LM9 A;  3AE1 A;  2A3D A;  2HPJ A;  2EHO D;  4DMW A;  1HG2 A;  2BDE A;  3PUV F;  1J1J A;  4UVC B;  1G73 A;  5E0O A;  3RYC E;  4EEB A;  4BAY B;  5EZY E;  3W15 B;  2HN2 A;  4HFE A;  1AJ3 A;  1DU2 A;  5AQN B;  4JI3 T;  1WYB A;  3MXZ A;  1IBM T;  3PU8 A;  3C50 A;  3NWI A;  4YXD A;  3H37 A;  1N36 T;  3UU6 A;  3AA1 B;  4NPP A;  1ZHC A;  4WNK A;  5DQW A;  2IDO B;  5LMN T;  2V7M A;  2V7I A;  5JR9 B;  1BR1 A;  5JVD E;  2XTL A;  1L0V A;  4ILC A;  2JQH A;  1S35 A;  1NAF A;  2KZ7 B;  4EAH A;  5CJ5 A;  4AQF C;  4DR7 T;  4O2B E;  2KXP B;  2XZE A;  3ZT6 A;  1OWA A;  4JLE A;  3UQ7 A;  3Q5D A;  1XMQ T;  1IJ5 A;  2MOZ A;  3ANW B;  2WWV A;  2VQE T;  3ONL C;  1HNZ T;  2RA1 A;  3UT5 E;  4CN1 A;  2UXN B;  2LT3 A;  4ILB A;  5JDN A;  3P4P A;  2W61 A;  3N2O A;  4KP3 C;  3N2K E;  1WCR A;  4DMV A;  1KNP A;  2BKO A;  3N9L A;  2XJ7 A;  5JR9 C;  3S4U A;  3U78 A;  5L3F B;  1XWM A;  1W9R A;  2ACX A;  2PBI A;  1HS7 A;  3AAI A;  3OPC A;  3RIU C;  4CN4 A;  2A2F X;  5C8Y E;  4ZI2 C;  2NTX A;  4DV1 T;  1M7K A;  4DR1 T;  4ZS3 A;  2V7L A;  1U5P A;  2D9D A;  2DWK A;  1D1A A;  3Q5X A;  4KX6 A;  3RX6 A;  4AI6 A;  3C4X A;  4HWC A;  5ABF B;  2WMO A;  2BZB A;  4KI0 F;  4JYA T;  2JIW A;  1CUN A;  5C2T A;  4H9Q C;  2CHN A;  1MMG A;  2CWO A;  2VKO A;  2KND A;  3AE7 A;  2XQY A;  3RF1 A;  3UUB A;  2LLY A;  4EXT A;  2B1E A;  2KWH A;  2ZMA A;  1OED C;  3CX8 B;  1MIV A;  2X9W A;  2W63 A;  3CML A;  1SA0 E;  2KMF A;  2J47 A;  3A5X A;  5JH7 E;  4H63 V;  1US7 B;  4PW8 A;  3SS1 A;  4U7I A;  3MA9 A;  1NWM X;  3PUR A;  1I94 T;  2DWG A;  2NWB A;  4QH4 A;  2OA5 A;  4I50 E;  3PUZ F;  3NZQ A;  5KMG P;  1D1B A;  5FMN A;  3R84 B;  3ONX A;  1ZV4 X;  3AEG A;  3BQI A;  3ZST A;  5CFB A;  1QLB A;  2AXD S;  1WRD A;  3LK3 B;  5HYA A;  2LEH A;  4MAL A;  2A72 A;  3LJC A;  1BR2 A;  3RIF A;  3EHZ A;  3F31 A;  2X9H A;  4ZI2 D;  4DV5 T;  4P0B A;  3QB5 A;  2H7V C;  3RH3 A;  2VUR A;  4A5X A;  2C5J A;  3BQK A;  2CMR A;  4PJJ A;  2D0T A;  3KBU A;  2Q9Q A;  3RRC A;  2E8I A;  3UU4 A;  4IE6 A;  4A97 A;  4ASK A;  4WZX A;  4JEH B;  1YKE B;  4YY3 T;  5HEU A;  2MYS A;  4IDO A;  4QXB B;  2H3R A;  3KV6 A;  2K9A A;  2CBI A;  2I0M A;  4WBN E;  2CA5 A;  4NIQ A;  3JCF A;  3NRY A;  2FUP A;  2D0U A;  4V1A v;  5AFU L;  5KXJ A;  3CQG B;  3UUM A;  1UK5 A;  3ZN1 B;  3KIN B;  2CM0 A;  2NW9 A;  5L4H A;  4EIW A;  5JDL A;  2HHH T;  3ZMZ B;  5LCY A;  4X5T A;  3FZM B;  4PJN A;  3CIR A;  3KV4 A;  4LFB T;  3WI3 A;  1LRZ A;  2OLT A;  3PJA J;  1X79 A;  1FJG T;  3OBV E;  1HX8 A;  1FIO A;  5EK2 A;  3JAE A;  2Y6X A;  1MMN A;  4X20 E;  1XMO T;  2V5D A;  3N9Q A;  1OED E;  4IDQ A;  4HWH A;  3OYX A;  5JDH A;  3T8O A;  2WDQ A;  3FXE B;  5HEH A;  1LVF A;  5C3J A;  1HNX T;  4UVB B;  3PUY F;  2L8K A;  2W0G A;  5FXZ A;  3CX7 B;  5JRE A;  2Z6E A;  3ZSS A;  3RPU A;  4U74 A;  4ERR A;  3AA0 B;  4LF8 T;  3AVR A;  4I4T E;  4WW0 A;  4PJM A;  1MIW A;  3O9X A;  4FJO A;  2PFV A;  3HKC E;  2K5B B;  4HGA A;  1X9B A;  2I6H A;  3GWH A;  1V9D A;  2X9X A;  4IGU A;  4DR5 T;  3TLT A;  2E9X C;  2QGS A;  4I55 E;  1GQE A;  3R6N A;  2CXL A;  1HFA A;  3NKZ A;  2K24 A;  1N32 T;  3ZMT B;  2MBG A;  4AQF A;  1EZ3 A;  5L3G B;  2YK0 A;  5LMU T;  4U31 A;  2XQ3 A;  3P50 A;  4ADZ A;  2EHO C;  3ESL A;  5LNK A;  4JI8 T;  3ZC0 A;  2L9Q A;  2KT9 A;  1KF6 A;  3P4Q A;  3RKG A;  4YJ2 E;  3M3Z B;  3HI2 A;  2VWA A;  3FXD B;  4PFP A;  2BG9 C;  2HN1 A;  4CXY A;  3EAB A;  3NZP A;  4JI7 T;  2G0U A;  4OYK A;  4J2C A;  3AE9 A;  2XQ7 A;  3ZCJ A;  1I6Z A;  1Y64 B;  5AQR B;  4AKR B;  2FBW A;  2JPF A;  2NW7 A;  3HKB E;  4XBF B;  4IT4 A;  3ZMV B;  2JQQ A;  4QKN A;  3K3N A;  1YW0 A;  4DUZ T;  2XQ8 A;  5AQI B;  3LK4 2;  3JAF A;  5LYJ E;  2CXF A;  4ZEY A;  2VVS A;  4X1I E;  3VU7 H;  2CE7 A;  3HR0 A;  3I0O A;  1HR0 T;  4H9O C;  5AQL B;  2XAJ B;  4QH5 A;  5LB7 B;  2MPK A;  4ZZB A;  1NEK A;  4LFC T;  2FJD A;  3PTR B;  5HEJ A;  3SOL A;  3PUG A;  1XNR T;  4UF0 B;  1OED A;  4DV2 T;  3PE0 A;  4L9I A;  3AXJ A;  3GMI A;  1S94 A;  4KHZ F;  1VRB A;  2Q9Q D;  4C91 A;  5ABE A;  4DV0 T;  4LML A;  3KVA A;  1MMD A;  4O2A E;  5F8P A;  5HXC A;  3RGL A;  2OV9 A;  3UQ4 A;  5FKY A;  3TLV A;  1YKH B;  5FY0 A;  4O4H E;  5JDG A;  5L47 A;  5AQS B;  2DL1 A;  4QWN B;  1W0A A;  3P8C D;  4U33 A;  3CQC B;  4H9P C;  4L5G A;  4QX8 B;  1T7S A;  1D0Z A;  4CQI A;  3MAC A;  5IYZ E;  1BR4 A;  5LOV E;  4DR6 T;  2D5U A;  1JNZ A;  2CRB A;  4HFV A;  2LRL A;  2N1G A;  2WDV A;  2LSG A;  5AQG B;  5FVK A;  2BG9 E;  5HCM A;  3FB2 A;  4UV9 B;  4CI3 B;  3U3I A;  1FEW A;  2FJE A;  4L0R A;  3UFG A;  1D0Y A;  2JRK A;  2SPC A;  4I43 B;  3LBX B;  2VKH A;  2WM9 A;  4LF9 T;  2XHE B;  2WZH A;  3P4S A;  3FBL A;  2X67 A;  3GA8 A;  3NVO A;  4O8S A;  1D1C A;  3EVY A;  1XDO A;  3KVB A;  2Y48 B;  3A8Y C;  4EYY R;  2BS2 A;  2V6Y A;  4HWD A;  3VHL A;  4CI2 B;  2V7J A;  4TZ4 C;  4P1N A;  4ANJ A;  3VRA A;  3CQX C;  4KMC A;  2C5K T;  4OX9 T;  4ZHQ E;  2KSR A;  2IAK A;  2JQK A;  2WU2 A;  1WR6 A;  4QH1 A;  4NXM T;  4X64 T;  2XY8 B;  1YXR A;  4Z90 A;  4EED A;  5AQF B;  3UU8 A;  4EGW A;  2XSB A;  2E2A A;  3T1H T;  3EAM A;  4CXX A;  4YHH T;  1BR0 A;  5LHG B;  2E5L T;  2XAQ B;  4HTE A;  2XQ9 A;  2CLY B;  4F6R C;  3N9M A;  5FP3 A;  4QXC B;  2ZM2 A;  4EB6 E;  4COF A;  5AQO B;  4HFH A;  2UUA T;  4UEM A;  3RQU A;  5HXH A;  2QA7 A;  1ZEE A;  2WP9 A;  2LHR A;  2BS3 A;  3VR9 A;  4GKK T;  4O4L E;  3FBZ A;  5HXR A;  4PFO A;  2Y8D A;  2J1D G;  2NTY A;  3CPZ A;  2VKD A;  2PJQ A;  1R8I A;  4YTM A;  2E9X A;  5FY1 A;  2DNX A;  3AE6 A;  2WS3 A;  1T72 A;  4B3T T;  3FZF B;  3OKQ A;  4ZXL A;  3FHN A;  2XQA A;  2X51 A;  3JAD A;  2C5I T;  1N34 T;  2X0L B;  3L8R A;  3K3Q C;  3C51 A;  4JI6 T;  4H63 H;  4E7S A;  4BJN A;  4TV9 E;  2WMN A;  3PUW F;  2W00 A;  3ZPO A;  1OXZ A;  2EHO A;  2L3L A;  3DJB A;  3HL6 A;  5HCJ A;  4IIJ E;  3AE5 A;  1HX1 B;  5LG4 A;  3E22 E;  5L3B B;  3HKD E;  4DR2 T;  1HG5 A;  2BG9 A;  4X66 T;  1JNR A;  2BBJ A;  3OYZ A;  5J2T E;  3I9W A;  5HAX A;  3ZMU B;  2YOE A;  2IUB A;  3AAE B;  1WYC A;  1WR0 A;  2WB5 A;  3Q5W A;  2XQ4 A;  4UVA B;  4CI1 B;  5JRC A;  4LF5 T;  4X1Y E;  4DBR A;  5LJM A;  1HNW T;  2M6I A;  2XAS B;  3D0T A;  3N9N A;  5L3C B;  2V5C A;  4ZOL E;  1G8X A;  4GKJ T;  2ACZ A;  5FNV E;  5ABH A;  3CKD A;  2ODV A;  2V7K A;  5LP6 E;  4AKI A;  3H3M A;  1HTJ F;  3MZK B;  5HXS A;  1E2A A;  3F2E A;  4JI4 T;  5AQK B;  2K48 A;  2NOX A;  2YDQ A;  3UTK A;  1KNZ A;  3RYH E;  4WYV A;  2LOS A;  4LMJ A;  3P7I A;  2W2U A;  4A98 A;  2V1D B;  2KIN B;  3KDS E;  4LMK A;  1WFD A;  2H89 A;  2YDR A;  3QUJ A;  3AEB A;  4U72 A;  1MIY A;  2RP4 A;  3CX6 B;  4QX7 B;  3RKO A;  2DCF A;  5IUX A;  5FXW A;  4GK0 E;  3UUL A;  3GN5 A;  2Q9Q B;  4DUY T;  1N33 T;  1QSD A;  3LDQ B;  3P4R A;  4GYR A;  4JUY A;  1FMW A;  5DJQ C;  4LF6 T;  3JC6 D;  2BBH A;  4IHJ E;  2WZI A;  4PK6 A;  4AIS A;  2BKN A;  3NRX A;  5LBQ B;  4F8H A;  5AQJ B;  2V6X A;  1WLX A;  2BS4 A;  5ETW A;  4P09 A;  3L3P A;  3ZKR A;  3AEF A;  4NUV A;  2XM1 A;  3MKD A;  3ZJ2 A;  2LSJ A;  1HF8 A;  3QC9 A;  4CZZ B;  2X66 A;  4HEA A;  1MMA A;  4MFR A;  2XQ6 A;  5M4Y A;  3FZH B;  3VKG A;  3F57 A;  1QUU A;  4K0K T;  2WY2 A;  4UIG A;  4GK5 E;  2KWI B;  3ZN0 B;  3B5M A;  4JI0 T;  4I0U A;  3ZYM A;  2Q9Q C;  5FVL A;  3O1H A;  4IL9 A;  2UXD T;  4JEU B;  4TWF A;  5HXE A;  4IDP A;  2BVM A;  4BA9 A;  2YDS A;  3ZT5 A;  4IE5 A;  2X9Y A;  3C64 A;  4DO0 A;  2CHO A;  4ZZC A;  4M1P A;  5JR9 A;  5LGT B;  4IE7 A;  1J5E T;  3K3O A;  3RIU A;  4HWI B;  3G06 A;  2QVA A;  5FL1 A;  3ZEF B;  3EUH A;  3C98 B;  5H6R B;  1SUM B;  5LXT E;  2UXB T;  4AQG A;  5AQU B;  3IBP A;  2NW8 A;  4TX5 A;  2KLQ A;  3VR8 A;  4P0A A;  4TNW A;  4ILU A;  3PV0 F;  3V5S A;  2N2N A;  3ANW A;  4IST A;  4IDZ A;  3M65 A;  5JDQ A;  4HWF A;  2JQ9 A;  4KHP T;  2IML A;  1YD8 G;  4IDN A;  2IC6 A;  3UFE A;  4PK4 A;  2VAS A;  3AE2 A;  2WAU A;  3Q2M A;  4XZC A;  4EZH A;  3AB3 B;  3N2G E;  2LSI A;  2LOP A;  3OJA A;  3DP7 A;  3TLW A;  4UV8 B;  5AQM B;  3SFD A;  2I59 A;  1E7P A;  2CPT A;  4DND A;  1UCU A;  2XQ5 A;  3I1A A;  5AQT B;  2N9D A;  4U2Z A;  2FJB A;  2IHR 1;  4ILA A;  3NBX X;  5BMV E;  3K8P C;  3ETV A;  4YLH A;  2LKH A;  3ZYK A;  3RC3 A;  4YTP A;  2DHR A;  4ZS2 A;  2CCQ A;  1UUS A;  3CVR A;  3EDV A;  4DR4 T;  5JTG A;  2LRK A;  4IL4 A;  4YSZ A;  4YHJ A;  1UUR A;  4MBQ A;  3ZJ1 A;  2XAF B;  5AQV B;  3HKE E;  5J0Z A;  5F5W A;  5FY7 A;  5ABF A;  3ZLI A;  3WAK A;  3Q9D A;  2MTQ A;  2LHN A;  3L09 A;  4AKG A;  2XSA A;  5F3J A; 
#chains in the Genus database with same CATH homology
 1X79 A;  3B57 A;  1T98 A;  2LJL A;  4UEM A;  5LBM A;  4HKA A;  3ZC1 A;  4DBQ A;  5HXH A;  5KX5 E;  3OBV E;  1HCI A;  2QA7 A;  2VB6 A;  1HX8 A;  1ZEE A;  1FIO A;  2YIN A;  2LHR A;  2P9B A;  2YEV C;  3H3A A;  5EK2 A;  2Y6X A;  1MMN A;  2C0S A;  4O4L E;  4PNI A;  3FBZ A;  3AA7 B;  3O1J A;  3AVS A;  2XAG B;  4X20 E;  2ODU A;  4PFO A;  5HXR A;  2Y8D A;  2J1D G;  2NTY A;  3CPZ A;  1SHZ C;  2LE8 A;  2VKD A;  2PJQ A;  5FYM A;  3N9Q A;  2WWU A;  2E9X A;  5FY1 A;  3OYX A;  5JDH A;  3GN5 B;  2DNX A;  3CWZ B;  4UEL A;  3T8O A;  3BQL A;  4XAX B;  3RC8 A;  3OKQ A;  3PUQ A;  4G63 A;  3FHN A;  5JQG E;  5LGN B;  4MHC A;  3FXE B;  2X51 A;  1Z0P A;  3PUA A;  1LVF A;  2C5I T;  1MNE A;  2X0L B;  4PJL A;  4ZI7 E;  3K3Q C;  3C51 A;  4UVB B;  4H63 H;  4E7S A;  4QXH B;  3LFM A;  2L8K A;  3LBX A;  1D0X A;  2W0G A;  2JMH A;  3MJX A;  5FXZ A;  5L2L A;  5IHY A;  4TV9 E;  2WMN A;  4BJN A;  2E9X D;  2DI4 A;  2W00 A;  3AA6 B;  3CX7 B;  1OXZ A;  2Z6E A;  5HWY A;  2EHO A;  3DTO A;  3KFW X;  3RPU A;  3ZPO A;  5JRE A;  4ZI3 C;  4KBM B;  4U74 A;  4ERR A;  5GON E;  3AA0 B;  3AVR A;  2L3L A;  4I4T E;  4WW0 A;  3DJB A;  5HWX A;  5LJN A;  4PJM A;  1MIW A;  3O9X A;  4FJO A;  2PFV A;  3HL6 A;  5LHH B;  3HKC E;  4IIJ E;  3SWH A;  1E1H B;  2K5B B;  3I9Y A;  4HGA A;  4AXP A;  5LG4 A;  3E22 E;  4QHO A;  2VKJ A;  2IW5 B;  5L3B B;  3HKD E;  1HG5 A;  4FI5 A;  3I0Q A;  3OYZ A;  4WBO A;  3GWH A;  1V9D A;  5J2T E;  2X9X A;  2LM9 A;  4IGU A;  3RYF E;  3I9W A;  5HAX A;  3ZMU B;  2A3D A;  2HPJ A;  2EHO D;  4DMW A;  4TN7 B;  1HG2 A;  2E9X C;  2QGS A;  2BDE A;  4DVD A;  3AAE B;  4I55 E;  3R6N A;  4UVC B;  1G73 A;  1HFA A;  1WYC A;  2CXL A;  2K24 A;  3ZMT B;  3J9X 1;  5E0O A;  4YFS A;  3Q5W A;  2MBG A;  3RYC E;  2CWY A;  4AQF A;  4UVA B;  4BAY B;  4CI1 B;  2UXX B;  5JRC A;  5EZY E;  2ZLY A;  3W15 B;  4X1Y E;  4DBR A;  5LJM A;  1KK7 A;  1AJ3 A;  1EZ3 A;  3ZYL A;  2VL8 A;  5L3G B;  2YK0 A;  2XAS B;  5EK3 A;  1WYB A;  3MXZ A;  3D0T A;  3N9N A;  5L3C B;  4ADZ A;  4KUM B;  4ZOL E;  2EHO C;  3PU8 A;  3C50 A;  1G8X A;  3ESL A;  3VKH A;  5LNK A;  3ZC0 A;  2L9Q A;  2KT9 A;  3AAA B;  3H37 A;  5FNV E;  3AA1 B;  3CKD A;  2ODV A;  1ZHC A;  2V7K A;  4YJ2 E;  5LP6 E;  4AKI A;  3HI2 A;  2YU1 A;  4WNK A;  2VWA A;  5FXV A;  5DQW A;  1HTJ F;  3FXD B;  3MZK B;  4PFP A;  2NP9 A;  3TKL B;  2V7M A;  5HXS A;  2ZM0 A;  2JMK A;  2V7I A;  3F2E A;  4B6X A;  5JR9 B;  1BR1 A;  5JVD E;  2XTL A;  4N78 D;  3EDU A;  4CXY A;  3J7Y q;  1S35 A;  1NAF A;  2KZ7 B;  4EAH A;  3NZP A;  2ES0 A;  2G0U A;  2H7O A;  4AQF C;  4OYK A;  1FMV A;  2LSY A;  4J2C A;  2K48 A;  4EOZ B;  3ZCJ A;  2NOX A;  3UTK A;  1KNZ A;  4O2B E;  3PUS A;  3RYH E;  1Y64 B;  2KXP B;  2X68 A;  1OWA A;  2LOS A;  4ISS A;  4AKR B;  4YJ3 E;  4JLE A;  4ZI3 D;  3P7I A;  2JPF A;  2NW7 A;  2V1D B;  3HKB E;  4XBF B;  4PK5 A;  5KDM C;  3BK9 A;  5CA1 E;  1IJ5 A;  2MOZ A;  2HPL A;  4EZ4 A;  3ANW B;  2KIN B;  3KDS E;  3UUX B;  3ZMV B;  2JQQ A;  4QKN A;  3WAJ A;  3K3N A;  4AKH A;  3QUJ A;  4U72 A;  1YW0 A;  1MIY A;  4OFZ A;  2RP4 A;  3CX6 B;  4OK0 A;  2RA1 A;  4QX7 B;  3RKO A;  3UT5 E;  4TUY E;  2DCF A;  1H7C A;  5FXW A;  3LK4 2;  2UXN B;  4GK0 E;  3UUL A;  3GN5 A;  2Q9Q B;  5LYJ E;  2LT3 A;  3C4Z A;  5JDN A;  4H9R C;  2CXF A;  4X1I E;  3VU7 H;  2CE7 A;  3HR0 A;  3I0O A;  3QK6 A;  1QSD A;  2W61 A;  4O4J E;  3N2O A;  4KP3 C;  4H9O C;  2CLY C;  2LSK A;  3N2K E;  4GYR A;  4JUY A;  4DMV A;  1FMW A;  5DJQ C;  2XAJ B;  5H6Q B;  3N9L A;  3JC6 D;  5JR9 C;  4H9N C;  4IHJ E;  3S4U A;  3U78 A;  2BVL A;  4PK6 A;  5LA6 E;  5L3F B;  2ACX A;  3N9O A;  3NRX A;  2PBI A;  5LBQ B;  4HN9 A;  3AAI A;  1HS7 A;  4NUU A;  3PTR B;  1WLX A;  3LG7 A;  5ETW A;  5J1G A;  3SOL A;  4BJM A;  2A2F X;  3PUG A;  4P09 A;  4UF0 B;  2XAH B;  3L3P A;  1UX4 A;  4NUV A;  3PE0 A;  5C8Y E;  4L9I A;  4ZI2 C;  3MKD A;  2NTX A;  4EYU A;  3ZJ2 A;  3GMI A;  2LSJ A;  1S94 A;  4ZS3 A;  1VRB A;  2V7L A;  1U5P A;  2Q9Q D;  4C91 A;  1HF8 A;  3QC9 A;  5DQV A;  4CZZ B;  3JC6 C;  3RYI E;  2X66 A;  4HEA A;  2WBL A;  4K0U A;  3E0Z A;  1MMD A;  3KVA A;  2DWK A;  1D1A A;  4O2A E;  5F8P A;  1MMA A;  3ETU A;  5HXC A;  3Q5X A;  4MFR A;  5M4Y A;  3RX6 A;  3VKG A;  3F57 A;  1QUU A;  4G2A A;  3E08 A;  5L3E B;  1YKH B;  4TV8 E;  4AI6 A;  3C4X A;  5FY0 A;  4UIG A;  4UXN B;  4O4H E;  4GK5 E;  5JDG A;  3LK2 B;  2WMO A;  2BZB A;  2KWI B;  4OHF A;  3ZN0 B;  1U4Q A;  5LGU B;  2DLR A;  2ZM8 A;  4QWN B;  1CUN A;  2WSS V;  5JDF A;  3P8C D;  3ZYM A;  2Q9Q C;  4AKL A;  4H9Q C;  3CQC B;  1MMG A;  2YU2 A;  2CWO A;  4H9P C;  3O1H A;  2VKO A;  4L5G A;  2KND A;  4QX8 B;  1D0Z A;  2XQY A;  4JEU B;  4CQI A;  5HXE A;  4EXT A;  2B1E A;  3MAC A;  3PDY A;  3UUN A;  5IYZ E;  2KWH A;  1BR4 A;  2ZMA A;  3N5L A;  4IE4 A;  5LOV E;  2BVM A;  3CX8 B;  4BA9 A;  1MIV A;  2D5U A;  2X9W A;  2W63 A;  3CML A;  1SA0 E;  2KMF A;  4IE5 A;  2X9Y A;  3A5X A;  3ZCI A;  3C64 A;  4DO0 A;  4HFV A;  5JH7 E;  2N1G A;  4H63 V;  5JDM A;  1US7 B;  2D2S A;  3B13 A;  3KV5 A;  4M1P A;  4MLK A;  4OYJ A;  5DAB A;  5JR9 A;  4PW8 A;  5LGT B;  3SS1 A;  2LSG A;  3MA9 A;  2CEA A;  4IE7 A;  3N9P A;  2E9X B;  3RRW A;  1NWM X;  3PUR A;  3K3O A;  4CXW A;  2DWG A;  2NWB A;  5CB4 E;  3HA4 A;  3FB2 A;  2OA5 A;  4I50 E;  4UV9 B;  4CI3 B;  3U3I A;  4C90 A;  3NZQ A;  5KMG P;  1FEW A;  4L0R A;  1D0Y A;  1D1B A;  5FMN A;  3R84 B;  2VK9 A;  3ONX A;  5A1L A;  1ZV4 X;  2JJ9 A;  3ZEF B;  1ZKE A;  2V26 A;  1LVK A;  2JRK A;  3BQI A;  3EUH A;  2GK9 A;  2SPC A;  3C98 B;  4I43 B;  5H6R B;  5TAO A;  4E7Z A;  3IF8 B;  5LXT E;  3LBX B;  4HE8 A;  4PAG A;  4AQG A;  2HH7 A;  5FXX A;  3IBP A;  2VKH A;  2WM9 A;  1WRD A;  2NW8 A;  4TX5 A;  1IJ6 A;  2KLQ A;  2EHO B;  4GYS A;  4P0A A;  4H9S E;  2XHE B;  3LK3 B;  4ILU A;  5HYA A;  2LEH A;  4MAL A;  3V5U A;  2A72 A;  3LJC A;  5ADX L;  5LHI B;  3KBT A;  3V5S A;  1BR2 A;  2N2N A;  1MND A;  3ANW A;  3FBL A;  2XUE A;  2X67 A;  3F31 A;  3GA8 A;  4IST A;  1O3X A;  4IDZ A;  3M65 A;  2X9H A;  5JDQ A;  4ZI2 D;  4P0B A;  4O8S A;  2H7V C;  3RH3 A;  3SRZ A;  2C5J A;  3BQK A;  1D1C A;  2CMR A;  4PJJ A;  2D0T A;  5CA0 E;  3EVY A;  3KBU A;  1YD8 G;  3KVB A;  2IC6 A;  3MK7 C;  3UFE A;  2Q9Q A;  2Y48 B;  4PK4 A;  2VAS A;  1LKX A;  2M67 A;  2W62 A;  4EYY R;  3RRC A;  2WAU A;  3Q2M A;  2E8I A;  4XZC A;  1IAP A;  3VHL A;  4CI2 B;  1B7T A;  2PG8 A;  4EZH A;  2V7J A;  3KV9 A;  3AB3 B;  3N2G E;  4TZ4 C;  2LSI A;  4X1K E;  4IE6 A;  4ANJ A;  5J2U E;  2LOP A;  2CXD A;  4GOU A;  3OJA A;  3DP7 A;  4ASK A;  4UV8 B;  5JRC B;  3CQX C;  4JEH B;  3IEE A;  4KMC A;  2C5K T;  1YKE B;  2I59 A;  4ZHQ E;  4A56 A;  4DND A;  1UCU A;  2MYS A;  2IAK A;  3I1A A;  2N9D A;  3PU3 A;  4QXB B;  3ZMS B;  1IZN B;  1WR6 A;  2H3R A;  3KV6 A;  3NBX X;  5BMV E;  2K9A A;  3K8P C;  3ETV A;  4WBN E;  4YLH A;  4UF0 A;  2CA5 A;  3ZYK A;  3RC3 A;  3NRY A;  2DHR A;  1UX5 A;  2D0U A;  4V1A v;  4O4I E;  4ZS2 A;  5AFU L;  2CCQ A;  3CVR A;  3EDV A;  3CQG B;  4GIW A;  3UUM A;  3ZN1 B;  3KIN B;  3O4X E;  4YHJ A;  4MBQ A;  3ZJ1 A;  2CM0 A;  2XAF B;  4CXX A;  2NW9 A;  4EIW A;  1BR0 A;  1VOM A;  3IHR A;  5LHG B;  4IE0 A;  3O1I A;  2XAQ B;  3HKE E;  5L3D B;  5JDL A;  3ZMZ B;  4HTE A;  5LCY A;  5FY7 A;  4PJN A;  3ZLI A;  2CLY B;  4F6R C;  3N9M A;  5FP3 A;  3WAK A;  3KV4 A;  3Q9D A;  2MTQ A;  4QXC B;  2LHN A;  2ZM2 A;  2IC9 A;  5EK4 A;  3L09 A;  3WI3 A;  4EB6 E;  4AKG A;  1LRZ A;  4Z8X A;  3C4W A;  5F3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...