4QXBB

Crystal structure of histone demethylase kdm2a-h3k36me3 with nog
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxbB00
4QX7B 4TN7B 4QWNB 4QXBB 4QX8B 4QXCB 4QXHB
chains in the Genus database with same CATH superfamily
5DQWA 1XWMA 2KT9A 4ISTA 2VVNA 3ONLC 4X5TA 5L3CB 4IDQA 3RQWA 3FXEB 4AQYT 3AE1A 5L3EB 2XAQB 2X9XA 4GYSA 4DV0T 2N9DA 2PG8A 2YDQA 3KVAA 3ZC1A 4AKIA 5AQUB 1D0XA 3H37A 2LLYA 3JADA 3TLSA 4DUYT 5AQHB 4EB6E 1LKXA 2ZM0A 3T8OA 2LSKA 4MLKA 1J5WA 3TLUA 2MBGA 3WAJA 2FUPA 2UU9T 2ODUA 2A2FX 5KMGP 2WDVA 3MK7C 5HCJA 3ANWB 3F57A 5FXWA 3NWIA 5LBQB 4TV8E 2XSAA 2HPJA 4AKRB 1CHUA 2MYSA 4YT0A 4YXDA 4CXWA 3LK3B 4KBMB 3KBTA 4ZS3A 3ZT6A 3AA6B 3JCFA 2WP9A 4QHOA 4ZI2D 2VASA 3NBXX 4JI8T 3LG7A 4BA9A 4IDNA 3ZYMA 1MNEA 2V6YA 4PK5A 3ZJ2A 3RHWA 1WR0A 3AE5A 5JR9C 5L3FB 1LRZA 4HTEA 2EHOD 1E2AA 2KINB 2WM9A 5J2TE 3EABA 1WYCA 2CEAA 2LM2A 2XQAA 5EK4A 5FVKA 4NXNT 3KV4A 5ABHA 1VCTA 2X68A 3I9YA 3V5SA 3NVOA 2QRXA 4OYJA 5AQSB 2E5VA 2FJDA 3BQKA 3AXJB 1WFDA 2CCQA 2VL0A 4WW0A 5AQKB 4GKKT 1FIOA 2WMOA 3JC6C 4AXPA 2CXFA 4HWCA 5LA6E 4EYYR 5JTGA 5KXJA 4NXMT 4DR1T 4IT4A 2XQ4A 3PDYA 4JI0T 1D1CA 1S35A 5AQTB 5HEOA 3AE9A 2V8SV 5JVDE 2HHHT 4P0BA 5JQGE 2W62A 4ERRA 1XDPA 2DWKA 5LHHB 5JR9B 2JQHA 3EAMA 4OK0A 2LRKA 2WWVA 5FL1A 2IAKA 5HWYA 4B3ST 2Y48B 4CZZB 3KVBA 2XHEB 4H9RC 2BS3A 2I0MA 4TZ4C 4ZOLE 4PJJA 2UXXB 5DABA 1NEKA 3ABVA 3S4UA 3AE4A 4QH4A 4AKGA 5FXVA 3N9MA 2JMKA 5TAOA 2C0SA 4LF8T 1YKEB 3RRCA 4CI3B 4CI2B 4WBNE 2KWIB 2YU1A 1HR0T 2UXBT 1YD8G 2A72A 4U2YA 4DVDA 2BKNA 2K48A 3RIUA 3J7Yq 4K0KT 2CE7A 4H9QC 4KHPT 4TNWA 3PUXF 5FVLA 1Z0PA 2CRBA 4HE8A 4AQFA 3E22E 2X9WA 2L9QA 3AEAA 5HXSA 5L2LA 1HF8A 1NWMX 4MHCA 2ZLYA 3CMLA 4UEMA 4UV8B 3FZLB 3DP7A 5JDFA 4ASKA 2BG9B 3AE8A 3CX7B 5L4EA 2WDQA 2DWGA 2E2AA 5JDNA 2JJ9A 2HPLA 2JMHA 4O4JE 5DJQC 4LF9T 1D0YA 5AQMB 1W9RA 2OLTA 2UUBT 5JRCB 4EYUA 3RKOA 3AA7B 4C90A 3C4XA 3I1AA 2Q9QC 5A1LA 4PK4A 2DLRA 3RKGA 3D0TA 2C5KT 3B13A 3IA3A 4IE6A 4WZXA 2W66A 3ZKRA 3QNUA 2BVMA 4ILUA 4KHZF 4UVAB 3QOFA 5L4HA 3T1HT 2JQKA 5IHYA 2CBIA 3LBXA 2D9DA 1WCRA 3N9NA 3OKQA 2WY2A 3AECA 4UF0B 3ZSTA 3HA4A 2CHOA 4X1KE 1IZNB 1OEDC 4EOZB 4MFRA 4KP3C 5HWXA 4B3MT 2ACZA 1NAFA 1OXZA 3EDUA 2PBIA 4QX8B 2NW9A 3EI0A 5BR8T 1GQEA 3ZJ1A 2XQYA 2VK9A 3QUJA 4QX7B 5AQRB 3RPUA 3UU8A 4ZZCA 3P4QA 3LK2B 2K24A 4EEDA 4PAGA 2XAGB 2V6XA 2YDRA 5AQNB 2IC9A 1UGOA 4JI2T 5CFBA 2YK0A 4P09A 2Q9QB 4GK5E 3KBUA 4H63V 2CWOA 5JDLA 4LF7T 2IUBA 2Z6EA 4X64T 3I0QA 3FXDB 4F6RC 5AQFB 1WR6A 2HN2A 4PFOA 2X66A 3L3PA 2KMFA 4NIQA 1T72A 3K1SA 2KWHA 2H3RA 2YU2A 2VL8A 4TWFA 1DU2A 3H3MA 4UVCB 2IDOB 2CM0A 5JDQA 3AVSA 3KV6A 2QVAA 3RH3A 3TKLB 2RPAA 5J0ZA 3MA9A 5EK3A 3RX6A 4YY3T 5GONE 2ZM2A 3B57A 1VRBA 2DNXA 2HH7A 3AE7A 5AQOB 4DR6T 1I94T 5LJMA 1YQ4A 3AXJA 4H9PC 4H9SE 5HYAA 5CA1E 3HKDE 4IDZA 2JIWA 2SPCA 5AQVB 5FNVE 4I50E 3BK9A 2B1EA 2WQYA 2V5CA 4HFHA 4DV6T 3A5XA 3ETUA 3CKDA 2VQET 2K9AA 2BKPA 4UIGA 3HKCE 2XUEA 1YQ3A 4JI5T 2L3LA 3PUVF 3PV0F 3QK6A 4O4IE 4DV2T 5IUXA 3M65A 4B3TT 4JI4T 3NRXA 1HTJF 1MIVA 2J1DG 2J4GA 2LKHA 2PJQA 4IHJE 3CPZA 3FZMB 4U7IA 3AE6A 2MOZA 5FL0A 4FJOA 2G0UA 4DR5T 5LGUB 3Q2MA 3FBZA 1N33T 3N5LA 5E0OA 5L47A 3O1HA 1IBKT 3UUXB 1N36T 5AQIB 3AEEA 4EV6A 3U78A 4LFCT 4HWHA 2OA5A 1WYBA 4X62T 4TX5A 4U3CA 1W0BA 1KNPA 2WZHA 3C98B 4YJ3E 2CLYC 4AQGA 1J1JA 3F31A 4LF4T 4DR7T 1UK5A 1HFAA 3LDQB 2D0UA 2L8KA 2XQ5A 4YSXA 5BMVE 4MALA 1W0AA 2W67A 2V26A 3P4PA 4PJMA 3TLVA 4QXBB 3ESLA 3VR9A 3LSVA 3KFWX 2BS2A 5C3JA 1B7TA 4IE0A 4O4HE 3SWHA 2EHOA 4JBWF 2J47A 2C5JA 2E9XB 4DR4T 2W00A 5FMNA 3UU5A 4H9NC 3BQLA 4O8SA 4U7YA 4ANJA 4LMKA 2M67A 1SA0E 5L3DB 1D0ZA 2UUAT 3RYIE 2VB6A 4L9IA 2E9XC 2UXNB 2N1GA 2I6HA 2W61A 5LMNT 1M7KA 4JYAT 2LSIA 4EZ4A 5LB7B 1G73A 1OEDE 3ONXA 2LT3A 4PW8A 4AQFC 5LG3A 5L3GB 2YINA 3N2GE 1UCUA 1H7CA 3ZN1B 2CMRA 3CVRA 3C50A 3UULA 2PFVA 2WU2A 3H3AA 2V7LA 3UUBA 1HX1B 3AB3B 3VR8A 4DV3T 3EHZA 5EZYE 2ZM6T 2IC6A 3MZKB 3UU6A 3SS1A 4PK6A 1BR2A 3KINB 3FHNA 5LCYA 4ISSA 3RIAA 3DTOA 2Q9QD 3OPCA 5HCMA 2YN6A 4IL9A 3RF1A 1U4QA 2LSYA 3B5MA 4TNVA 2Q9QA 2X67A 3RQUA 3PTRB 3I0OA 2GK9A 4DIDB 4YSYA 2BKOA 4KUMB 3CIRA 4DUZT 1XZYA 1KNZA 3C4WA 3CWZB 5HEHA 4DO0A 2K5BB 1FEWA 4YJ2E 3UQ4A 5LHGB 5LJNA 3PU8A 2PTFA 3AE2A 4Z8XA 4O4LE 4YFSA 3SFDA 3FZKB 3LJCA 2A3DA 3AVRA 3E0ZA 3ANWA 4IE7A 4A97A 4GK0E 5C2TA 5LBMA 3K3QC 2IW5B 3AA1B 4ZI3D 3QB5A 5HXRA 2FBWA 2BS4A 2X0YA 4G63A 3VKGA 3Q5WA 1ZOYA 3OBVE 3ZMVB 5JR9A 4ZI2C 4I43B 3VU7H 1QLBA 2X0HA 3AEGA 3VRBA 4CQIA 2VQFT 2E8IA 5CB4E 5JDGA 5JREA 2WU5A 1KK7A 3VRAA 1X79A 2D5UA 2KZ7B 2LJLA 2QGSA 2KNDA 3U3IA 5JDHA 4U2ZA 4X65T 5ABFA 4L5GA 2AE9A 5LNKA 2LE8A 3CX8B 4XAXB 4CXXA 5FXXA 3O9XA 2DHRA 2IIUA 2WB5A 3GN5A 4HGAA 1KF6A 3O1IA 2UXCT 4XBFB 4FI5A 1VCSA 3CQXC 2XQ3A 1FMVA 5FXZA 5DQVA 4DMVA 4ILCA 2AXDS 2Y6XA 1X9BA 3GA8A 3ZLIA 4L0RA 2DI4A 3UT5E 4X1IE 2W4XA 2LHNA 2IMLA 5IYZE 2XASB 3CX6B 4IGUA 1J5ET 2X9YA 4XZCA 4HWIB 4KMCA 4U72A 3G06A 3GWHA 5LP6E 3LFMA 3PUZF 3UFEA 4A5XA 5C8YE 4H63H 4MBQA 2CXDA 2WAUA 1KFYA 3ZSSA 1YKHB 4DMWA 4EAHA 3PUSA 1UURA 2LRLA 3N2OA 5FP3A 2ZM8A 1ZEEA 4BJMA 4ZHQE 4QKNA 3J9X1 2XZEA 2DL1A 3MJXA 4NUUA 3C51A 1OEDA 4JI3T 1QSDA 4C91A 2EHOB 5ABGA 2ZMAA 2FJEA 3N9LA 3WI3A 1EZ3A 4TV9E 3AAEB 3ZMTB 4ZZBA 1FMWA 3PJAA 2P9BA 4LF6T 4KX6A 4PJLA 2E5LT 4JV5T 4YSZA 5ADXL 4IIJE 4A98A 5F8PA 3PUQA 1N34T 4CN1A 5J1GA 3NKZA 3IF8B 4HFCA 1XMOT 2I59A 2VURA 4U33A 1HG5A 5ABFB 5F5WA 3P4RA 1T98A 1LVKA 5HEGA 1HCIA 3Q5DA 3K8PC 4BJNA 1Y64B 2X9HA 1MMNA 2VKJA 3Q5EA 4PFPA 4ZI3C 1UUSA 3ZCIA 2XAFB 4GKJT 3AE3A 3CQGB 3ONJA 4V1Av 1ZKEA 3SOLA 2A9UA 1Z8UA 2V7KA 4AKLA 3UFGA 2RP4A 5LOVE 2BBJA 3OVUA 3ZT5A 2EHOC 3RGLA 5JDMA 2BDEA 2JRKA 4I4TE 2XJ7A 3PUGA 3SFEA 3HR0A 4YTNA 2M6BA 4UF0A 4DV7T 1IBMT 3UUNA 2ODVA 1HG2A 2C5IT 3VKHA 2BG9C 3A7MA 1S94A 4NPPA 4EEBA 4LFAT 3RI5A 3DJBA 3FBLA 4IDPA 2YEVC 3UUMA 4CI1B 1AJ3A 4H9OC 2NW8A 4PNIA 2JQQA 3RYCE 3HL6A 3ZYLA 5JH7E 3N9QA 4YTMA 4DV1T 4GIWA 3QC9A 4EIWA 2XTLA 2LOSA 4IE5A 4QWNB 4AKHA 1ZHCA 2WBLA 3NRYA 2J62A 4IL4A 3P7IA 4JUYA 5LYJE 4U31A 4WYVA 4EZHA 2YKSA 1SUMB 3QB5K 2LKGA 2VWAA 4GYRA 3C4ZA 3ZCJA 3VHLA 3A8YC 1MNDA 5LMUT 4I55E 2V7MA 2WCAA 4BAYB 4LF5T 1M62A 2ACXA 2E9XD 2XAHB 3EDVA 4K0UA 4OFZA 2V1DB 2LOPA 3K3OA 3UTKA 3ZT7A 4JEHB 2WZIA 4QXCB 4X20E 1V9DA 2WSSV 3AAIA 1MMGA 3AEDA 4Z91A 2WMNA 5KX5E 5HEJA 2N2NA 3ZPOA 3RIFA 1MIYA 2M6IA 2LM9A 2LEHA 4TN7B 2UUCT 1HNWT 1YW0A 3MXZA 1BR4A 3KV5A 2CBJA 1O3XA 1W09A 1XDOA 2B76A 3P50A 4YHJA 3UU3A 3O1JA 4Z90A 3X1DA 4ZS2A 4QXHB 3SRZA 4YTPA 3ZN0B 4WBOA 4CXYA 2VVSA 1WRDA 1HS7A 2YOEA 4UELA 5HEUA 4F8HA 2H88A 3FZHB 4JI1T 4HFEA 3F2EA 5AQJB 4AISA 5F3JA 4Q25A 2NWBA 5HXHA 5HXEA 5L3BB 4AI6A 3JC6D 2FJAA 3PUWF 5CGMA 2XQ6A 3L8RA 2DCFA 4TUYE 1LVFA 3RYHE 2K3WA 4ZI7E 2CXLA 4HWDA 2JQ9A 1N32T 3RYFE 3RC3A 4CN6A 4TWDA 1KNRA 3KV9A 1XNQT 2ES0A 4QH1A 2V7IA 4IE4A 3Q9DA 2H7VC 2VKOA 2CLYB 3OJAA 4HFVA 3CQCB 3L39A 1QUUA 2H7OA 2XAJB 3FB2A 4HFDA 3W15B 1WLXA 2MAWA 2VKDA 3OYZA 2XSBA 3PUYF 5LXTE 5M4YA 4HFIA 1JNZA 4DR2T 2NTYA 3AAAB 4HKAA 2CHNA 4WNKA 2BBHA 1IAPA 2WWUA 2E9XA 5HAXA 5FY7A 3V5UA 1JNRA 1NENA 3M3ZB 1MMDA 4J2CA 2UXDT 4E7SA 1VOMA 4X66T 3RC8A 4HFBA 4DBQA 3AEFA 2W63A 1KEYA 1E1HB 2XPKA 4UR9A 1MIWA 3ZEFB 5LGTB 3Q5XA 2XM2A 2X51A 3AA0B 5FY0A 4AIUA 5ETWA 3P8CD 4ZEYA 4ZXLA 1US7B 1YXRA 2CA5A 1I6ZA 2BG9E 4LMJA 2XQ7A 1OWAA 4GOUA 1D1AA 4M1PA 1SE7A 3PU3A 5FKYA 2NR4A 1IBLT 1FJGT 5AQLB 3ZC0A 5JRCA 3EUHA 3FZFB 3KDSE 4LFBT 4I0UA 5HXCA 4DV5T 3PJAJ 2KSRA 3GN5B 4UVBB 5EK2A 3NZQA 4DV4T 2MTQA 1R8IA 3LBXB 3BQIA 3R6NA 2NP9A 1UX4A 2NTXA 3IEEA 3MACA 3N2KE 4IREA 3TLTA 4DR3T 3OTOT 4HEAA 1BR0A 1D1BA 3E08A 5FY1A 3K3NA 3N9OA 2LHRA 4X1YE 4ILBA 3RLFF 4HWFA 1XNRT 5AQPB 3P4WA 2MPKA 4OX9T 5H6QB 4TWHA 3HKBE 3WAKA 2V6YB 1BR1A 3LK42 3UU4A 3ZMUB 2X0LB 1IJ5A 2CPTA 4KI0F 4EGWA 4P0AA 5AQGB 3EVYA 3JAFA 2Y8DA 2WS3A 2FJBA 1ZV4X 3N9PA 3HI2A 4YLHA 2D0TA 1T8BA 4OHFA 1MMAA 3RIUC 2HN1A 4O2BE 4B6XA 5IWAT 3GMIA 5LGNB 2IHR1 2WDRA 2W2UA 1OEDB 2YDSA 4PJNA 2NW7A 2R6GF 4UV9B 2QYWA 1XMQT 5LHIB 3AEBA 2V7JA 1U5PA 5CA0E 3RRWA 1HX8A 4ADZA 2VKHA 4DBRA 4B3RT 4QH5A 1Y01A 3JAEA 3UQ7A 4COFA 4IDOA 4NUVA 5KDMC 2KXPB 3ETVA 4JI6T 5J2UE 4LMLA 4N78D 4O2AE 2XM1A 5FYMA 1SHZC 1HNZT 2KLQA 5AFUL 3IBPA 1G8XA 5AQQB 3I9WA 5ABEA 1CUNA 1L0VA 4JI7T 3ZMSB 3R84B 3PE0A 1IJ6A 1E7PA 2LSGA 3NZPA 2H89A 4OYKA 4EXTA 4YHHT 2QA7A 2V5DA 4ILAA 2XY8B 3TLWA 5CJ5A 3PURA 4G2AA 4HN9A 3OYXA 4U74A 5H6RB 3ZYKA 2W0GA 2XQ8A 3C64A 3PUAA 2BVLA 4UXNB 5LG4A 3CK6A 3P4SA 2F4VT 2JPFA 1T7SA 4E7ZA 2D2SA 2LSJA 3O4XE 3L09A 4JEUB 3IHRA 4JLEA 2NOXA 2OV9A 4A56A 3HKEE 4CN4A 1UX5A 2BZBA 2BG9A 4DNDA 1HNXT 4P1NA 3ZMZB 3T1YT 2RA1A 2CWYA 2XQ9A 1ZP0A 3MKDA
chains in the Genus database with same CATH topology
5DQWA 4ISTA 2KT9A 5L3CB 3FXEB 5L3EB 2XAQB 2X9XA 4GYSA 2N9DA 2PG8A 3KVAA 3ZC1A 4AKIA 1D0XA 3H37A 4EB6E 1LKXA 2ZM0A 3T8OA 2LSKA 4MLKA 2MBGA 3WAJA 2ODUA 2A2FX 5KMGP 3MK7C 3ANWB 3F57A 5FXWA 5LBQB 4TV8E 2HPJA 4AKRB 2MYSA 4CXWA 3LK3B 4KBMB 3KBTA 4ZS3A 3AA6B 4QHOA 2VASA 3NBXX 3LG7A 4BA9A 3ZYMA 1MNEA 4PK5A 3ZJ2A 5JR9C 5L3FB 1LRZA 4HTEA 2EHOD 2KINB 2WM9A 5J2TE 5EK4A 1WYCA 2CEAA 3KV4A 3I9YA 2X68A 3V5SA 4OYJA 3BQKA 2CCQA 4WW0A 1FIOA 2WMOA 3JC6C 4AXPA 2CXFA 5LA6E 4EYYR 3PDYA 1D1CA 1S35A 5JVDE 4P0BA 5JQGE 2W62A 4ERRA 2DWKA 5LHHB 5JR9B 4OK0A 2IAKA 5HWYA 2Y48B 4CZZB 3KVBA 2XHEB 4H9RC 4TZ4C 4ZOLE 4PJJA 2UXXB 5DABA 3S4UA 4AKGA 5FXVA 3N9MA 2JMKA 5TAOA 2C0SA 3RRCA 1YKEB 4CI3B 4CI2B 4WBNE 4ZI2D 2KWIB 2YU1A 1YD8G 2A72A 4DVDA 2K48A 3J7Yq 2CE7A 4H9QC 1Z0PA 4AQFA 4HE8A 3E22E 2X9WA 2L9QA 5HXSA 5L2LA 1HF8A 1NWMX 4MHCA 2ZLYA 3CMLA 4UEMA 4UV8B 3DP7A 5JDFA 4ASKA 3CX7B 2DWGA 5JDNA 2JJ9A 2HPLA 2JMHA 4O4JE 5DJQC 1D0YA 5JRCB 4EYUA 3RKOA 3AA7B 4C90A 3C4XA 3I1AA 2Q9QC 5A1LA 4PK4A 2DLRA 3D0TA 2C5KT 3B13A 4IE6A 2BVMA 4ILUA 4UVAB 5IHYA 3LBXA 3OKQA 3N9NA 4UF0B 3HA4A 4X1KE 1IZNB 5HWXA 4EOZB 4MFRA 4KP3C 1NAFA 1OXZA 3EDUA 2PBIA 4QX8B 2NW9A 3ZJ1A 2XQYA 2VK9A 3QUJA 4QX7B 3RPUA 3LK2B 2K24A 4PAGA 2XAGB 2IC9A 2YK0A 4P09A 2Q9QB 4GK5E 3KBUA 4H63V 2CWOA 5JDLA 2Z6EA 3I0QA 3FXDB 4F6RC 1WR6A 4PFOA 2X66A 3L3PA 2KMFA 2KWHA 2H3RA 2YU2A 2VL8A 4UVCB 2CM0A 5JDQA 3AVSA 3KV6A 3RH3A 3TKLB 3MA9A 5EK3A 3RX6A 5GONE 2ZM2A 3B57A 1VRBA 2DNXA 2HH7A 5LJMA 4H9PC 4H9SE 5HYAA 5CA1E 3HKDE 4IDZA 2SPCA 5FNVE 4I50E 3BK9A 2B1EA 3A5XA 3ETUA 3CKDA 2K9AA 4UIGA 3HKCE 2XUEA 2L3LA 3QK6A 4O4IE 3M65A 3NRXA 1HTJF 1MIVA 2J1DG 2PJQA 4IHJE 3CPZA 2MOZA 4FJOA 2G0UA 5LGUB 3Q2MA 3FBZA 3N5LA 5E0OA 3O1HA 3UUXB 3U78A 2OA5A 1WYBA 4TX5A 4YJ3E 4AQGA 3C98B 2CLYC 3F31A 1HFAA 2D0UA 2L8KA 5BMVE 4MALA 2V26A 4PJMA 4QXBB 3ESLA 3KFWX 1B7TA 4IE0A 4O4HE 3SWHA 2EHOA 2C5JA 2E9XB 2W00A 5FMNA 4H9NC 3BQLA 4O8SA 4ANJA 2M67A 1SA0E 1D0ZA 3RYIE 2VB6A 4L9IA 2E9XC 2UXNB 2N1GA 2W61A 2LSIA 4EZ4A 1G73A 3ONXA 2LT3A 4PW8A 4AQFC 5L3GB 2YINA 3N2GE 1UCUA 1H7CA 3ZN1B 2CMRA 3CVRA 3C50A 3UULA 2PFVA 3H3AA 2V7LA 3AB3B 5EZYE 2IC6A 3MZKB 3SS1A 4PK6A 1BR2A 3KINB 3FHNA 5LCYA 4ISSA 3DTOA 2Q9QD 1U4QA 2LSYA 4CI1B 2Q9QA 2X67A 3PTRB 3I0OA 2GK9A 4KUMB 1KNZA 3C4WA 3CWZB 5LHGB 4DO0A 2K5BB 1FEWA 4YJ2E 5LJNA 3PU8A 4Z8XA 4O4LE 4YFSA 4IE7A 3LJCA 2A3DA 3AVRA 3E0ZA 3ANWA 5M4YA 4GK0E 5LBMA 3K3QC 2IW5B 3AA1B 4ZI3D 5HXRA 4G63A 3VKGA 3Q5WA 3OBVE 3ZMVB 5JR9A 4ZI2C 4I43B 3VU7H 4CQIA 2E8IA 5CB4E 5JDGA 5JREA 1KK7A 1X79A 2D5UA 2KZ7B 2LJLA 2QGSA 2KNDA 3U3IA 5JDHA 4L5GA 5LNKA 2LE8A 3CX8B 4XAXB 4CXXA 5FXXA 3O9XA 2DHRA 3GN5A 4HGAA 3O1IA 4XBFB 4FI5A 3CQXC 1FMVA 5FXZA 5DQVA 4DMVA 2Y6XA 3GA8A 3ZLIA 4L0RA 2DI4A 3UT5E 4X1IE 2LHNA 5IYZE 2XASB 3CX6B 4IGUA 2X9YA 4XZCA 4KMCA 4U72A 3GWHA 5LP6E 3LFMA 3UFEA 5C8YE 4H63H 2CXDA 2WAUA 4DMWA 1YKHB 4EAHA 3PUSA 4ZHQE 3N2OA 5FP3A 2ZM8A 1ZEEA 4BJMA 4QKNA 3J9X1 3MJXA 4NUUA 3C51A 1QSDA 4C91A 2EHOB 3WI3A 2ZMAA 3N9LA 1EZ3A 4TV9E 3AAEB 3ZMTB 1FMWA 2P9BA 4PJLA 5ADXL 4IIJE 5F8PA 3PUQA 5J1GA 3IF8B 2I59A 1HG5A 1T98A 1LVKA 1HCIA 3K8PC 4BJNA 1Y64B 2X9HA 1MMNA 2VKJA 4PFPA 4ZI3C 3ZCIA 2XAFB 3CQGB 4V1Av 1ZKEA 3SOLA 2V7KA 4AKLA 2RP4A 5LOVE 2EHOC 5JDMA 2BDEA 2JRKA 4I4TE 3PUGA 3HR0A 4UF0A 3UUNA 2ODVA 1HG2A 2C5IT 3VKHA 1S94A 3DJBA 3FBLA 2YEVC 3UUMA 1AJ3A 4H9OC 2NW8A 4PNIA 2JQQA 3RYCE 3HL6A 3ZYLA 5JH7E 3N9QA 4GIWA 3QC9A 4EIWA 2XTLA 2LOSA 4IE5A 4QWNB 4AKHA 1ZHCA 2WBLA 3NRYA 3P7IA 4JUYA 5LYJE 4EZHA 3ZCJA 2VWAA 4GYRA 3C4ZA 3VHLA 1MNDA 4I55E 2V7MA 4BAYB 2ACXA 2XAHB 3EDVA 2E9XD 4K0UA 4OFZA 2V1DB 2LOPA 3K3OA 3UTKA 4JEHB 4QXCB 4X20E 1V9DA 2WSSV 3AAIA 1MMGA 2WMNA 5KX5E 2N2NA 3ZPOA 1MIYA 2LM9A 2LEHA 4TN7B 1YW0A 3MXZA 1BR4A 3KV5A 1O3XA 4YHJA 5L3DB 3O1JA 4ZS2A 4QXHB 3SRZA 4CXYA 3ZN0B 4WBOA 1WRDA 1HS7A 4UELA 3F2EA 5F3JA 2NWBA 5HXHA 5HXEA 5L3BB 4AI6A 3JC6D 2DCFA 4TUYE 1LVFA 3RYHE 4ZI7E 2CXLA 3RYFE 3RC3A 3KV9A 2ES0A 2V7IA 4IE4A 3Q9DA 2H7VC 2VKOA 2CLYB 3OJAA 4HFVA 3CQCB 1QUUA 2H7OA 2XAJB 3FB2A 3W15B 1WLXA 2VKDA 3OYZA 5LXTE 2NTYA 3AAAB 4HKAA 4WNKA 1IAPA 2WWUA 2E9XA 5HAXA 5FY7A 3V5UA 1MMDA 4J2CA 4E7SA 1VOMA 3RC8A 4DBQA 2W63A 1E1HB 3ZEFB 5LGTB 1MIWA 3Q5XA 2X51A 3AA0B 5FY0A 5ETWA 3P8CD 1US7B 2CA5A 1OWAA 4GOUA 1D1AA 4M1PA 3PU3A 5JRCA 3ZC0A 3EUHA 3KDSE 5HXCA 4UVBB 3GN5B 5EK2A 3NZQA 2MTQA 3LBXB 3BQIA 3R6NA 2NP9A 1UX4A 2NTXA 3IEEA 3MACA 3N2KE 1BR0A 4HEAA 1D1BA 3E08A 5FY1A 3K3NA 3N9OA 2LHRA 4X1YE 5H6QB 3HKBE 3WAKA 3LK42 1BR1A 3ZMUB 2X0LB 1IJ5A 4P0AA 3EVYA 2Y8DA 1ZV4X 3N9PA 3HI2A 4YLHA 2D0TA 4OHFA 1MMAA 4O2BE 4B6XA 3GMIA 5LGNB 4PJNA 2NW7A 4UV9B 5LHIB 2V7JA 1U5PA 5CA0E 3RRWA 1HX8A 4ADZA 2VKHA 4DBRA 4NUVA 5KDMC 2KXPB 3ETVA 5J2UE 4N78D 4O2AE 5FYMA 1SHZC 2KLQA 5AFUL 3IBPA 1G8XA 3I9WA 1CUNA 3ZMSB 3R84B 3PE0A 1IJ6A 2LSGA 3NZPA 4OYKA 4EXTA 2QA7A 3PURA 4G2AA 4HN9A 3OYXA 4U74A 5H6RB 3ZYKA 2W0GA 3C64A 3PUAA 4UXNB 2BVLA 5LG4A 2JPFA 4E7ZA 2D2SA 2LSJA 3O4XE 3L09A 4JEUB 3IHRA 4JLEA 2NOXA 4A56A 4DNDA 3HKEE 1UX5A 2BZBA 3ZMZB 2RA1A 2CWYA 4MBQA 3MKDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QX7 B;  4TN7 B;  4QWN B;  4QXB B;  4QX8 B;  4QXC B;  4QXH B; 
#chains in the Genus database with same CATH topology
 5DQW A;  1XWM A;  2KT9 A;  4IST A;  2VVN A;  3ONL C;  4X5T A;  5L3C B;  4IDQ A;  3RQW A;  3FXE B;  4AQY T;  3AE1 A;  5L3E B;  2XAQ B;  2X9X A;  4GYS A;  4DV0 T;  2N9D A;  2PG8 A;  2YDQ A;  3KVA A;  3ZC1 A;  4AKI A;  5AQU B;  1D0X A;  3H37 A;  2LLY A;  3JAD A;  3TLS A;  4DUY T;  5AQH B;  4EB6 E;  1LKX A;  2ZM0 A;  3T8O A;  2LSK A;  4MLK A;  1J5W A;  3TLU A;  2MBG A;  3WAJ A;  2FUP A;  2UU9 T;  2ODU A;  2A2F X;  5KMG P;  2WDV A;  3MK7 C;  5HCJ A;  3ANW B;  3F57 A;  5FXW A;  3NWI A;  5LBQ B;  4TV8 E;  2XSA A;  2HPJ A;  4AKR B;  1CHU A;  2MYS A;  4YT0 A;  4YXD A;  4CXW A;  3LK3 B;  4KBM B;  3KBT A;  4ZS3 A;  3ZT6 A;  3AA6 B;  3JCF A;  2WP9 A;  4QHO A;  4ZI2 D;  2VAS A;  3NBX X;  4JI8 T;  3LG7 A;  4BA9 A;  4IDN A;  3ZYM A;  1MNE A;  2V6Y A;  4PK5 A;  3ZJ2 A;  3RHW A;  1WR0 A;  3AE5 A;  5JR9 C;  5L3F B;  1LRZ A;  4HTE A;  2EHO D;  1E2A A;  2KIN B;  2WM9 A;  5J2T E;  3EAB A;  1WYC A;  2CEA A;  2LM2 A;  2XQA A;  5EK4 A;  5FVK A;  4NXN T;  3KV4 A;  5ABH A;  1VCT A;  2X68 A;  3I9Y A;  3V5S A;  3NVO A;  2QRX A;  4OYJ A;  5AQS B;  2E5V A;  2FJD A;  3BQK A;  3AXJ B;  1WFD A;  2CCQ A;  2VL0 A;  4WW0 A;  5AQK B;  4GKK T;  1FIO A;  2WMO A;  3JC6 C;  4AXP A;  2CXF A;  4HWC A;  5LA6 E;  4EYY R;  5JTG A;  5KXJ A;  4NXM T;  4DR1 T;  4IT4 A;  2XQ4 A;  3PDY A;  4JI0 T;  1D1C A;  1S35 A;  5AQT B;  5HEO A;  3AE9 A;  2V8S V;  5JVD E;  2HHH T;  4P0B A;  5JQG E;  2W62 A;  4ERR A;  1XDP A;  2DWK A;  5LHH B;  5JR9 B;  2JQH A;  3EAM A;  4OK0 A;  2LRK A;  2WWV A;  5FL1 A;  2IAK A;  5HWY A;  4B3S T;  2Y48 B;  4CZZ B;  3KVB A;  2XHE B;  4H9R C;  2BS3 A;  2I0M A;  4TZ4 C;  4ZOL E;  4PJJ A;  2UXX B;  5DAB A;  1NEK A;  3ABV A;  3S4U A;  3AE4 A;  4QH4 A;  4AKG A;  5FXV A;  3N9M A;  2JMK A;  5TAO A;  2C0S A;  4LF8 T;  1YKE B;  3RRC A;  4CI3 B;  4CI2 B;  4WBN E;  2KWI B;  2YU1 A;  1HR0 T;  2UXB T;  1YD8 G;  2A72 A;  4U2Y A;  4DVD A;  2BKN A;  2K48 A;  3RIU A;  3J7Y q;  4K0K T;  2CE7 A;  4H9Q C;  4KHP T;  4TNW A;  3PUX F;  5FVL A;  1Z0P A;  2CRB A;  4HE8 A;  4AQF A;  3E22 E;  2X9W A;  2L9Q A;  3AEA A;  5HXS A;  5L2L A;  1HF8 A;  1NWM X;  4MHC A;  2ZLY A;  3CML A;  4UEM A;  4UV8 B;  3FZL B;  3DP7 A;  5JDF A;  4ASK A;  2BG9 B;  3AE8 A;  3CX7 B;  5L4E A;  2WDQ A;  2DWG A;  2E2A A;  5JDN A;  2JJ9 A;  2HPL A;  2JMH A;  4O4J E;  5DJQ C;  4LF9 T;  1D0Y A;  5AQM B;  1W9R A;  2OLT A;  2UUB T;  5JRC B;  4EYU A;  3RKO A;  3AA7 B;  4C90 A;  3C4X A;  3I1A A;  2Q9Q C;  5A1L A;  4PK4 A;  2DLR A;  3RKG A;  3D0T A;  2C5K T;  3B13 A;  3IA3 A;  4IE6 A;  4WZX A;  2W66 A;  3ZKR A;  3QNU A;  2BVM A;  4ILU A;  4KHZ F;  4UVA B;  3QOF A;  5L4H A;  3T1H T;  2JQK A;  5IHY A;  2CBI A;  3LBX A;  2D9D A;  1WCR A;  3N9N A;  3OKQ A;  2WY2 A;  3AEC A;  4UF0 B;  3ZST A;  3HA4 A;  2CHO A;  4X1K E;  1IZN B;  1OED C;  4EOZ B;  4MFR A;  4KP3 C;  5HWX A;  4B3M T;  2ACZ A;  1NAF A;  1OXZ A;  3EDU A;  2PBI A;  4QX8 B;  2NW9 A;  3EI0 A;  5BR8 T;  1GQE A;  3ZJ1 A;  2XQY A;  2VK9 A;  3QUJ A;  4QX7 B;  5AQR B;  3RPU A;  3UU8 A;  4ZZC A;  3P4Q A;  3LK2 B;  2K24 A;  4EED A;  4PAG A;  2XAG B;  2V6X A;  2YDR A;  5AQN B;  2IC9 A;  1UGO A;  4JI2 T;  5CFB A;  2YK0 A;  4P09 A;  2Q9Q B;  4GK5 E;  3KBU A;  4H63 V;  2CWO A;  5JDL A;  4LF7 T;  2IUB A;  2Z6E A;  4X64 T;  3I0Q A;  3FXD B;  4F6R C;  5AQF B;  1WR6 A;  2HN2 A;  4PFO A;  2X66 A;  3L3P A;  2KMF A;  4NIQ A;  1T72 A;  3K1S A;  2KWH A;  2H3R A;  2YU2 A;  2VL8 A;  4TWF A;  1DU2 A;  3H3M A;  4UVC B;  2IDO B;  2CM0 A;  5JDQ A;  3AVS A;  3KV6 A;  2QVA A;  3RH3 A;  3TKL B;  2RPA A;  5J0Z A;  3MA9 A;  5EK3 A;  3RX6 A;  4YY3 T;  5GON E;  2ZM2 A;  3B57 A;  1VRB A;  2DNX A;  2HH7 A;  3AE7 A;  5AQO B;  4DR6 T;  1I94 T;  5LJM A;  1YQ4 A;  3AXJ A;  4H9P C;  4H9S E;  5HYA A;  5CA1 E;  3HKD E;  4IDZ A;  2JIW A;  2SPC A;  5AQV B;  5FNV E;  4I50 E;  3BK9 A;  2B1E A;  2WQY A;  2V5C A;  4HFH A;  4DV6 T;  3A5X A;  3ETU A;  3CKD A;  2VQE T;  2K9A A;  2BKP A;  4UIG A;  3HKC E;  2XUE A;  1YQ3 A;  4JI5 T;  2L3L A;  3PUV F;  3PV0 F;  3QK6 A;  4O4I E;  4DV2 T;  5IUX A;  3M65 A;  4B3T T;  4JI4 T;  3NRX A;  1HTJ F;  1MIV A;  2J1D G;  2J4G A;  2LKH A;  2PJQ A;  4IHJ E;  3CPZ A;  3FZM B;  4U7I A;  3AE6 A;  2MOZ A;  5FL0 A;  4FJO A;  2G0U A;  4DR5 T;  5LGU B;  3Q2M A;  3FBZ A;  1N33 T;  3N5L A;  5E0O A;  5L47 A;  3O1H A;  1IBK T;  3UUX B;  1N36 T;  5AQI B;  3AEE A;  4EV6 A;  3U78 A;  4LFC T;  4HWH A;  2OA5 A;  1WYB A;  4X62 T;  4TX5 A;  4U3C A;  1W0B A;  1KNP A;  2WZH A;  3C98 B;  4YJ3 E;  2CLY C;  4AQG A;  1J1J A;  3F31 A;  4LF4 T;  4DR7 T;  1UK5 A;  1HFA A;  3LDQ B;  2D0U A;  2L8K A;  2XQ5 A;  4YSX A;  5BMV E;  4MAL A;  1W0A A;  2W67 A;  2V26 A;  3P4P A;  4PJM A;  3TLV A;  4QXB B;  3ESL A;  3VR9 A;  3LSV A;  3KFW X;  2BS2 A;  5C3J A;  1B7T A;  4IE0 A;  4O4H E;  3SWH A;  2EHO A;  4JBW F;  2J47 A;  2C5J A;  2E9X B;  4DR4 T;  2W00 A;  5FMN A;  3UU5 A;  4H9N C;  3BQL A;  4O8S A;  4U7Y A;  4ANJ A;  4LMK A;  2M67 A;  1SA0 E;  5L3D B;  1D0Z A;  2UUA T;  3RYI E;  2VB6 A;  4L9I A;  2E9X C;  2UXN B;  2N1G A;  2I6H A;  2W61 A;  5LMN T;  1M7K A;  4JYA T;  2LSI A;  4EZ4 A;  5LB7 B;  1G73 A;  1OED E;  3ONX A;  2LT3 A;  4PW8 A;  4AQF C;  5LG3 A;  5L3G B;  2YIN A;  3N2G E;  1UCU A;  1H7C A;  3ZN1 B;  2CMR A;  3CVR A;  3C50 A;  3UUL A;  2PFV A;  2WU2 A;  3H3A A;  2V7L A;  3UUB A;  1HX1 B;  3AB3 B;  3VR8 A;  4DV3 T;  3EHZ A;  5EZY E;  2ZM6 T;  2IC6 A;  3MZK B;  3UU6 A;  3SS1 A;  4PK6 A;  1BR2 A;  3KIN B;  3FHN A;  5LCY A;  4ISS A;  3RIA A;  3DTO A;  2Q9Q D;  3OPC A;  5HCM A;  2YN6 A;  4IL9 A;  3RF1 A;  1U4Q A;  2LSY A;  3B5M A;  4TNV A;  2Q9Q A;  2X67 A;  3RQU A;  3PTR B;  3I0O A;  2GK9 A;  4DID B;  4YSY A;  2BKO A;  4KUM B;  3CIR A;  4DUZ T;  1XZY A;  1KNZ A;  3C4W A;  3CWZ B;  5HEH A;  4DO0 A;  2K5B B;  1FEW A;  4YJ2 E;  3UQ4 A;  5LHG B;  5LJN A;  3PU8 A;  2PTF A;  3AE2 A;  4Z8X A;  4O4L E;  4YFS A;  3SFD A;  3FZK B;  3LJC A;  2A3D A;  3AVR A;  3E0Z A;  3ANW A;  4IE7 A;  4A97 A;  4GK0 E;  5C2T A;  5LBM A;  3K3Q C;  2IW5 B;  3AA1 B;  4ZI3 D;  3QB5 A;  5HXR A;  2FBW A;  2BS4 A;  2X0Y A;  4G63 A;  3VKG A;  3Q5W A;  1ZOY A;  3OBV E;  3ZMV B;  5JR9 A;  4ZI2 C;  4I43 B;  3VU7 H;  1QLB A;  2X0H A;  3AEG A;  3VRB A;  4CQI A;  2VQF T;  2E8I A;  5CB4 E;  5JDG A;  5JRE A;  2WU5 A;  1KK7 A;  3VRA A;  1X79 A;  2D5U A;  2KZ7 B;  2LJL A;  2QGS A;  2KND A;  3U3I A;  5JDH A;  4U2Z A;  4X65 T;  5ABF A;  4L5G A;  2AE9 A;  5LNK A;  2LE8 A;  3CX8 B;  4XAX B;  4CXX A;  5FXX A;  3O9X A;  2DHR A;  2IIU A;  2WB5 A;  3GN5 A;  4HGA A;  1KF6 A;  3O1I A;  2UXC T;  4XBF B;  4FI5 A;  1VCS A;  3CQX C;  2XQ3 A;  1FMV A;  5FXZ A;  5DQV A;  4DMV A;  4ILC A;  2AXD S;  2Y6X A;  1X9B A;  3GA8 A;  3ZLI A;  4L0R A;  2DI4 A;  3UT5 E;  4X1I E;  2W4X A;  2LHN A;  2IML A;  5IYZ E;  2XAS B;  3CX6 B;  4IGU A;  1J5E T;  2X9Y A;  4XZC A;  4HWI B;  4KMC A;  4U72 A;  3G06 A;  3GWH A;  5LP6 E;  3LFM A;  3PUZ F;  3UFE A;  4A5X A;  5C8Y E;  4H63 H;  4MBQ A;  2CXD A;  2WAU A;  1KFY A;  3ZSS A;  1YKH B;  4DMW A;  4EAH A;  3PUS A;  1UUR A;  2LRL A;  3N2O A;  5FP3 A;  2ZM8 A;  1ZEE A;  4BJM A;  4ZHQ E;  4QKN A;  3J9X 1;  2XZE A;  2DL1 A;  3MJX A;  4NUU A;  3C51 A;  1OED A;  4JI3 T;  1QSD A;  4C91 A;  2EHO B;  5ABG A;  2ZMA A;  2FJE A;  3N9L A;  3WI3 A;  1EZ3 A;  4TV9 E;  3AAE B;  3ZMT B;  4ZZB A;  1FMW A;  3PJA A;  2P9B A;  4LF6 T;  4KX6 A;  4PJL A;  2E5L T;  4JV5 T;  4YSZ A;  5ADX L;  4IIJ E;  4A98 A;  5F8P A;  3PUQ A;  1N34 T;  4CN1 A;  5J1G A;  3NKZ A;  3IF8 B;  4HFC A;  1XMO T;  2I59 A;  2VUR A;  4U33 A;  1HG5 A;  5ABF B;  5F5W A;  3P4R A;  1T98 A;  1LVK A;  5HEG A;  1HCI A;  3Q5D A;  3K8P C;  4BJN A;  1Y64 B;  2X9H A;  1MMN A;  2VKJ A;  3Q5E A;  4PFP A;  4ZI3 C;  1UUS A;  3ZCI A;  2XAF B;  4GKJ T;  3AE3 A;  3CQG B;  3ONJ A;  4V1A v;  1ZKE A;  3SOL A;  2A9U A;  1Z8U A;  2V7K A;  4AKL A;  3UFG A;  2RP4 A;  5LOV E;  2BBJ A;  3OVU A;  3ZT5 A;  2EHO C;  3RGL A;  5JDM A;  2BDE A;  2JRK A;  4I4T E;  2XJ7 A;  3PUG A;  3SFE A;  3HR0 A;  4YTN A;  2M6B A;  4UF0 A;  4DV7 T;  1IBM T;  3UUN A;  2ODV A;  1HG2 A;  2C5I T;  3VKH A;  2BG9 C;  3A7M A;  1S94 A;  4NPP A;  4EEB A;  4LFA T;  3RI5 A;  3DJB A;  3FBL A;  4IDP A;  2YEV C;  3UUM A;  4CI1 B;  1AJ3 A;  4H9O C;  2NW8 A;  4PNI A;  2JQQ A;  3RYC E;  3HL6 A;  3ZYL A;  5JH7 E;  3N9Q A;  4YTM A;  4DV1 T;  4GIW A;  3QC9 A;  4EIW A;  2XTL A;  2LOS A;  4IE5 A;  4QWN B;  4AKH A;  1ZHC A;  2WBL A;  3NRY A;  2J62 A;  4IL4 A;  3P7I A;  4JUY A;  5LYJ E;  4U31 A;  4WYV A;  4EZH A;  2YKS A;  1SUM B;  3QB5 K;  2LKG A;  2VWA A;  4GYR A;  3C4Z A;  3ZCJ A;  3VHL A;  3A8Y C;  1MND A;  5LMU T;  4I55 E;  2V7M A;  2WCA A;  4BAY B;  4LF5 T;  1M62 A;  2ACX A;  2E9X D;  2XAH B;  3EDV A;  4K0U A;  4OFZ A;  2V1D B;  2LOP A;  3K3O A;  3UTK A;  3ZT7 A;  4JEH B;  2WZI A;  4QXC B;  4X20 E;  1V9D A;  2WSS V;  3AAI A;  1MMG A;  3AED A;  4Z91 A;  2WMN A;  5KX5 E;  5HEJ A;  2N2N A;  3ZPO A;  3RIF A;  1MIY A;  2M6I A;  2LM9 A;  2LEH A;  4TN7 B;  2UUC T;  1HNW T;  1YW0 A;  3MXZ A;  1BR4 A;  3KV5 A;  2CBJ A;  1O3X A;  1W09 A;  1XDO A;  2B76 A;  3P50 A;  4YHJ A;  3UU3 A;  3O1J A;  4Z90 A;  3X1D A;  4ZS2 A;  4QXH B;  3SRZ A;  4YTP A;  3ZN0 B;  4WBO A;  4CXY A;  2VVS A;  1WRD A;  1HS7 A;  2YOE A;  4UEL A;  5HEU A;  4F8H A;  2H88 A;  3FZH B;  4JI1 T;  4HFE A;  3F2E A;  5AQJ B;  4AIS A;  5F3J A;  4Q25 A;  2NWB A;  5HXH A;  5HXE A;  5L3B B;  4AI6 A;  3JC6 D;  2FJA A;  3PUW F;  5CGM A;  2XQ6 A;  3L8R A;  2DCF A;  4TUY E;  1LVF A;  3RYH E;  2K3W A;  4ZI7 E;  2CXL A;  4HWD A;  2JQ9 A;  1N32 T;  3RYF E;  3RC3 A;  4CN6 A;  4TWD A;  1KNR A;  3KV9 A;  1XNQ T;  2ES0 A;  4QH1 A;  2V7I A;  4IE4 A;  3Q9D A;  2H7V C;  2VKO A;  2CLY B;  3OJA A;  4HFV A;  3CQC B;  3L39 A;  1QUU A;  2H7O A;  2XAJ B;  3FB2 A;  4HFD A;  3W15 B;  1WLX A;  2MAW A;  2VKD A;  3OYZ A;  2XSB A;  3PUY F;  5LXT E;  5M4Y A;  4HFI A;  1JNZ A;  4DR2 T;  2NTY A;  3AAA B;  4HKA A;  2CHN A;  4WNK A;  2BBH A;  1IAP A;  2WWU A;  2E9X A;  5HAX A;  5FY7 A;  3V5U A;  1JNR A;  1NEN A;  3M3Z B;  1MMD A;  4J2C A;  2UXD T;  4E7S A;  1VOM A;  4X66 T;  3RC8 A;  4HFB A;  4DBQ A;  3AEF A;  2W63 A;  1KEY A;  1E1H B;  2XPK A;  4UR9 A;  1MIW A;  3ZEF B;  5LGT B;  3Q5X A;  2XM2 A;  2X51 A;  3AA0 B;  5FY0 A;  4AIU A;  5ETW A;  3P8C D;  4ZEY A;  4ZXL A;  1US7 B;  1YXR A;  2CA5 A;  1I6Z A;  2BG9 E;  4LMJ A;  2XQ7 A;  1OWA A;  4GOU A;  1D1A A;  4M1P A;  1SE7 A;  3PU3 A;  5FKY A;  2NR4 A;  1IBL T;  1FJG T;  5AQL B;  3ZC0 A;  5JRC A;  3EUH A;  3FZF B;  3KDS E;  4LFB T;  4I0U A;  5HXC A;  4DV5 T;  3PJA J;  2KSR A;  3GN5 B;  4UVB B;  5EK2 A;  3NZQ A;  4DV4 T;  2MTQ A;  1R8I A;  3LBX B;  3BQI A;  3R6N A;  2NP9 A;  1UX4 A;  2NTX A;  3IEE A;  3MAC A;  3N2K E;  4IRE A;  3TLT A;  4DR3 T;  3OTO T;  4HEA A;  1BR0 A;  1D1B A;  3E08 A;  5FY1 A;  3K3N A;  3N9O A;  2LHR A;  4X1Y E;  4ILB A;  3RLF F;  4HWF A;  1XNR T;  5AQP B;  3P4W A;  2MPK A;  4OX9 T;  5H6Q B;  4TWH A;  3HKB E;  3WAK A;  2V6Y B;  1BR1 A;  3LK4 2;  3UU4 A;  3ZMU B;  2X0L B;  1IJ5 A;  2CPT A;  4KI0 F;  4EGW A;  4P0A A;  5AQG B;  3EVY A;  3JAF A;  2Y8D A;  2WS3 A;  2FJB A;  1ZV4 X;  3N9P A;  3HI2 A;  4YLH A;  2D0T A;  1T8B A;  4OHF A;  1MMA A;  3RIU C;  2HN1 A;  4O2B E;  4B6X A;  5IWA T;  3GMI A;  5LGN B;  2IHR 1;  2WDR A;  2W2U A;  1OED B;  2YDS A;  4PJN A;  2NW7 A;  2R6G F;  4UV9 B;  2QYW A;  1XMQ T;  5LHI B;  3AEB A;  2V7J A;  1U5P A;  5CA0 E;  3RRW A;  1HX8 A;  4ADZ A;  2VKH A;  4DBR A;  4B3R T;  4QH5 A;  1Y01 A;  3JAE A;  3UQ7 A;  4COF A;  4IDO A;  4NUV A;  5KDM C;  2KXP B;  3ETV A;  4JI6 T;  5J2U E;  4LML A;  4N78 D;  4O2A E;  2XM1 A;  5FYM A;  1SHZ C;  1HNZ T;  2KLQ A;  5AFU L;  3IBP A;  1G8X A;  5AQQ B;  3I9W A;  5ABE A;  1CUN A;  1L0V A;  4JI7 T;  3ZMS B;  3R84 B;  3PE0 A;  1IJ6 A;  1E7P A;  2LSG A;  3NZP A;  2H89 A;  4OYK A;  4EXT A;  4YHH T;  2QA7 A;  2V5D A;  4ILA A;  2XY8 B;  3TLW A;  5CJ5 A;  3PUR A;  4G2A A;  4HN9 A;  3OYX A;  4U74 A;  5H6R B;  3ZYK A;  2W0G A;  2XQ8 A;  3C64 A;  3PUA A;  2BVL A;  4UXN B;  5LG4 A;  3CK6 A;  3P4S A;  2F4V T;  2JPF A;  1T7S A;  4E7Z A;  2D2S A;  2LSJ A;  3O4X E;  3L09 A;  4JEU B;  3IHR A;  4JLE A;  2NOX A;  2OV9 A;  4A56 A;  3HKE E;  4CN4 A;  1UX5 A;  2BZB A;  2BG9 A;  4DND A;  1HNX T;  4P1N A;  3ZMZ B;  3T1Y T;  2RA1 A;  2CWY A;  2XQ9 A;  1ZP0 A;  3MKD A; 
#chains in the Genus database with same CATH homology
 5DQW A;  4IST A;  2KT9 A;  5L3C B;  3FXE B;  5L3E B;  2XAQ B;  2X9X A;  4GYS A;  2N9D A;  2PG8 A;  3KVA A;  3ZC1 A;  4AKI A;  1D0X A;  3H37 A;  4EB6 E;  1LKX A;  2ZM0 A;  3T8O A;  2LSK A;  4MLK A;  2MBG A;  3WAJ A;  2ODU A;  2A2F X;  5KMG P;  3MK7 C;  3ANW B;  3F57 A;  5FXW A;  5LBQ B;  4TV8 E;  2HPJ A;  4AKR B;  2MYS A;  4CXW A;  3LK3 B;  4KBM B;  3KBT A;  4ZS3 A;  3AA6 B;  4QHO A;  2VAS A;  3NBX X;  3LG7 A;  4BA9 A;  3ZYM A;  1MNE A;  4PK5 A;  3ZJ2 A;  5JR9 C;  5L3F B;  1LRZ A;  4HTE A;  2EHO D;  2KIN B;  2WM9 A;  5J2T E;  5EK4 A;  1WYC A;  2CEA A;  3KV4 A;  3I9Y A;  2X68 A;  3V5S A;  4OYJ A;  3BQK A;  2CCQ A;  4WW0 A;  1FIO A;  2WMO A;  3JC6 C;  4AXP A;  2CXF A;  5LA6 E;  4EYY R;  3PDY A;  1D1C A;  1S35 A;  5JVD E;  4P0B A;  5JQG E;  2W62 A;  4ERR A;  2DWK A;  5LHH B;  5JR9 B;  4OK0 A;  2IAK A;  5HWY A;  2Y48 B;  4CZZ B;  3KVB A;  2XHE B;  4H9R C;  4TZ4 C;  4ZOL E;  4PJJ A;  2UXX B;  5DAB A;  3S4U A;  4AKG A;  5FXV A;  3N9M A;  2JMK A;  5TAO A;  2C0S A;  3RRC A;  1YKE B;  4CI3 B;  4CI2 B;  4WBN E;  4ZI2 D;  2KWI B;  2YU1 A;  1YD8 G;  2A72 A;  4DVD A;  2K48 A;  3J7Y q;  2CE7 A;  4H9Q C;  1Z0P A;  4AQF A;  4HE8 A;  3E22 E;  2X9W A;  2L9Q A;  5HXS A;  5L2L A;  1HF8 A;  1NWM X;  4MHC A;  2ZLY A;  3CML A;  4UEM A;  4UV8 B;  3DP7 A;  5JDF A;  4ASK A;  3CX7 B;  2DWG A;  5JDN A;  2JJ9 A;  2HPL A;  2JMH A;  4O4J E;  5DJQ C;  1D0Y A;  5JRC B;  4EYU A;  3RKO A;  3AA7 B;  4C90 A;  3C4X A;  3I1A A;  2Q9Q C;  5A1L A;  4PK4 A;  2DLR A;  3D0T A;  2C5K T;  3B13 A;  4IE6 A;  2BVM A;  4ILU A;  4UVA B;  5IHY A;  3LBX A;  3OKQ A;  3N9N A;  4UF0 B;  3HA4 A;  4X1K E;  1IZN B;  5HWX A;  4EOZ B;  4MFR A;  4KP3 C;  1NAF A;  1OXZ A;  3EDU A;  2PBI A;  4QX8 B;  2NW9 A;  3ZJ1 A;  2XQY A;  2VK9 A;  3QUJ A;  4QX7 B;  3RPU A;  3LK2 B;  2K24 A;  4PAG A;  2XAG B;  2IC9 A;  2YK0 A;  4P09 A;  2Q9Q B;  4GK5 E;  3KBU A;  4H63 V;  2CWO A;  5JDL A;  2Z6E A;  3I0Q A;  3FXD B;  4F6R C;  1WR6 A;  4PFO A;  2X66 A;  3L3P A;  2KMF A;  2KWH A;  2H3R A;  2YU2 A;  2VL8 A;  4UVC B;  2CM0 A;  5JDQ A;  3AVS A;  3KV6 A;  3RH3 A;  3TKL B;  3MA9 A;  5EK3 A;  3RX6 A;  5GON E;  2ZM2 A;  3B57 A;  1VRB A;  2DNX A;  2HH7 A;  5LJM A;  4H9P C;  4H9S E;  5HYA A;  5CA1 E;  3HKD E;  4IDZ A;  2SPC A;  5FNV E;  4I50 E;  3BK9 A;  2B1E A;  3A5X A;  3ETU A;  3CKD A;  2K9A A;  4UIG A;  3HKC E;  2XUE A;  2L3L A;  3QK6 A;  4O4I E;  3M65 A;  3NRX A;  1HTJ F;  1MIV A;  2J1D G;  2PJQ A;  4IHJ E;  3CPZ A;  2MOZ A;  4FJO A;  2G0U A;  5LGU B;  3Q2M A;  3FBZ A;  3N5L A;  5E0O A;  3O1H A;  3UUX B;  3U78 A;  2OA5 A;  1WYB A;  4TX5 A;  4YJ3 E;  4AQG A;  3C98 B;  2CLY C;  3F31 A;  1HFA A;  2D0U A;  2L8K A;  5BMV E;  4MAL A;  2V26 A;  4PJM A;  4QXB B;  3ESL A;  3KFW X;  1B7T A;  4IE0 A;  4O4H E;  3SWH A;  2EHO A;  2C5J A;  2E9X B;  2W00 A;  5FMN A;  4H9N C;  3BQL A;  4O8S A;  4ANJ A;  2M67 A;  1SA0 E;  1D0Z A;  3RYI E;  2VB6 A;  4L9I A;  2E9X C;  2UXN B;  2N1G A;  2W61 A;  2LSI A;  4EZ4 A;  1G73 A;  3ONX A;  2LT3 A;  4PW8 A;  4AQF C;  5L3G B;  2YIN A;  3N2G E;  1UCU A;  1H7C A;  3ZN1 B;  2CMR A;  3CVR A;  3C50 A;  3UUL A;  2PFV A;  3H3A A;  2V7L A;  3AB3 B;  5EZY E;  2IC6 A;  3MZK B;  3SS1 A;  4PK6 A;  1BR2 A;  3KIN B;  3FHN A;  5LCY A;  4ISS A;  3DTO A;  2Q9Q D;  1U4Q A;  2LSY A;  4CI1 B;  2Q9Q A;  2X67 A;  3PTR B;  3I0O A;  2GK9 A;  4KUM B;  1KNZ A;  3C4W A;  3CWZ B;  5LHG B;  4DO0 A;  2K5B B;  1FEW A;  4YJ2 E;  5LJN A;  3PU8 A;  4Z8X A;  4O4L E;  4YFS A;  4IE7 A;  3LJC A;  2A3D A;  3AVR A;  3E0Z A;  3ANW A;  5M4Y A;  4GK0 E;  5LBM A;  3K3Q C;  2IW5 B;  3AA1 B;  4ZI3 D;  5HXR A;  4G63 A;  3VKG A;  3Q5W A;  3OBV E;  3ZMV B;  5JR9 A;  4ZI2 C;  4I43 B;  3VU7 H;  4CQI A;  2E8I A;  5CB4 E;  5JDG A;  5JRE A;  1KK7 A;  1X79 A;  2D5U A;  2KZ7 B;  2LJL A;  2QGS A;  2KND A;  3U3I A;  5JDH A;  4L5G A;  5LNK A;  2LE8 A;  3CX8 B;  4XAX B;  4CXX A;  5FXX A;  3O9X A;  2DHR A;  3GN5 A;  4HGA A;  3O1I A;  4XBF B;  4FI5 A;  3CQX C;  1FMV A;  5FXZ A;  5DQV A;  4DMV A;  2Y6X A;  3GA8 A;  3ZLI A;  4L0R A;  2DI4 A;  3UT5 E;  4X1I E;  2LHN A;  5IYZ E;  2XAS B;  3CX6 B;  4IGU A;  2X9Y A;  4XZC A;  4KMC A;  4U72 A;  3GWH A;  5LP6 E;  3LFM A;  3UFE A;  5C8Y E;  4H63 H;  2CXD A;  2WAU A;  4DMW A;  1YKH B;  4EAH A;  3PUS A;  4ZHQ E;  3N2O A;  5FP3 A;  2ZM8 A;  1ZEE A;  4BJM A;  4QKN A;  3J9X 1;  3MJX A;  4NUU A;  3C51 A;  1QSD A;  4C91 A;  2EHO B;  3WI3 A;  2ZMA A;  3N9L A;  1EZ3 A;  4TV9 E;  3AAE B;  3ZMT B;  1FMW A;  2P9B A;  4PJL A;  5ADX L;  4IIJ E;  5F8P A;  3PUQ A;  5J1G A;  3IF8 B;  2I59 A;  1HG5 A;  1T98 A;  1LVK A;  1HCI A;  3K8P C;  4BJN A;  1Y64 B;  2X9H A;  1MMN A;  2VKJ A;  4PFP A;  4ZI3 C;  3ZCI A;  2XAF B;  3CQG B;  4V1A v;  1ZKE A;  3SOL A;  2V7K A;  4AKL A;  2RP4 A;  5LOV E;  2EHO C;  5JDM A;  2BDE A;  2JRK A;  4I4T E;  3PUG A;  3HR0 A;  4UF0 A;  3UUN A;  2ODV A;  1HG2 A;  2C5I T;  3VKH A;  1S94 A;  3DJB A;  3FBL A;  2YEV C;  3UUM A;  1AJ3 A;  4H9O C;  2NW8 A;  4PNI A;  2JQQ A;  3RYC E;  3HL6 A;  3ZYL A;  5JH7 E;  3N9Q A;  4GIW A;  3QC9 A;  4EIW A;  2XTL A;  2LOS A;  4IE5 A;  4QWN B;  4AKH A;  1ZHC A;  2WBL A;  3NRY A;  3P7I A;  4JUY A;  5LYJ E;  4EZH A;  3ZCJ A;  2VWA A;  4GYR A;  3C4Z A;  3VHL A;  1MND A;  4I55 E;  2V7M A;  4BAY B;  2ACX A;  2XAH B;  3EDV A;  2E9X D;  4K0U A;  4OFZ A;  2V1D B;  2LOP A;  3K3O A;  3UTK A;  4JEH B;  4QXC B;  4X20 E;  1V9D A;  2WSS V;  3AAI A;  1MMG A;  2WMN A;  5KX5 E;  2N2N A;  3ZPO A;  1MIY A;  2LM9 A;  2LEH A;  4TN7 B;  1YW0 A;  3MXZ A;  1BR4 A;  3KV5 A;  1O3X A;  4YHJ A;  5L3D B;  3O1J A;  4ZS2 A;  4QXH B;  3SRZ A;  4CXY A;  3ZN0 B;  4WBO A;  1WRD A;  1HS7 A;  4UEL A;  3F2E A;  5F3J A;  2NWB A;  5HXH A;  5HXE A;  5L3B B;  4AI6 A;  3JC6 D;  2DCF A;  4TUY E;  1LVF A;  3RYH E;  4ZI7 E;  2CXL A;  3RYF E;  3RC3 A;  3KV9 A;  2ES0 A;  2V7I A;  4IE4 A;  3Q9D A;  2H7V C;  2VKO A;  2CLY B;  3OJA A;  4HFV A;  3CQC B;  1QUU A;  2H7O A;  2XAJ B;  3FB2 A;  3W15 B;  1WLX A;  2VKD A;  3OYZ A;  5LXT E;  2NTY A;  3AAA B;  4HKA A;  4WNK A;  1IAP A;  2WWU A;  2E9X A;  5HAX A;  5FY7 A;  3V5U A;  1MMD A;  4J2C A;  4E7S A;  1VOM A;  3RC8 A;  4DBQ A;  2W63 A;  1E1H B;  3ZEF B;  5LGT B;  1MIW A;  3Q5X A;  2X51 A;  3AA0 B;  5FY0 A;  5ETW A;  3P8C D;  1US7 B;  2CA5 A;  1OWA A;  4GOU A;  1D1A A;  4M1P A;  3PU3 A;  5JRC A;  3ZC0 A;  3EUH A;  3KDS E;  5HXC A;  4UVB B;  3GN5 B;  5EK2 A;  3NZQ A;  2MTQ A;  3LBX B;  3BQI A;  3R6N A;  2NP9 A;  1UX4 A;  2NTX A;  3IEE A;  3MAC A;  3N2K E;  1BR0 A;  4HEA A;  1D1B A;  3E08 A;  5FY1 A;  3K3N A;  3N9O A;  2LHR A;  4X1Y E;  5H6Q B;  3HKB E;  3WAK A;  3LK4 2;  1BR1 A;  3ZMU B;  2X0L B;  1IJ5 A;  4P0A A;  3EVY A;  2Y8D A;  1ZV4 X;  3N9P A;  3HI2 A;  4YLH A;  2D0T A;  4OHF A;  1MMA A;  4O2B E;  4B6X A;  3GMI A;  5LGN B;  4PJN A;  2NW7 A;  4UV9 B;  5LHI B;  2V7J A;  1U5P A;  5CA0 E;  3RRW A;  1HX8 A;  4ADZ A;  2VKH A;  4DBR A;  4NUV A;  5KDM C;  2KXP B;  3ETV A;  5J2U E;  4N78 D;  4O2A E;  5FYM A;  1SHZ C;  2KLQ A;  5AFU L;  3IBP A;  1G8X A;  3I9W A;  1CUN A;  3ZMS B;  3R84 B;  3PE0 A;  1IJ6 A;  2LSG A;  3NZP A;  4OYK A;  4EXT A;  2QA7 A;  3PUR A;  4G2A A;  4HN9 A;  3OYX A;  4U74 A;  5H6R B;  3ZYK A;  2W0G A;  3C64 A;  3PUA A;  4UXN B;  2BVL A;  5LG4 A;  2JPF A;  4E7Z A;  2D2S A;  2LSJ A;  3O4X E;  3L09 A;  4JEU B;  3IHR A;  4JLE A;  2NOX A;  4A56 A;  4DND A;  3HKE E;  1UX5 A;  2BZB A;  3ZMZ B;  2RA1 A;  2CWY A;  4MBQ A;  3MKD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...