4QXBB

Crystal structure of histone demethylase kdm2a-h3k36me3 with nog
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
QVHLTHFELEGLRCLVDKLESLPLHKKCVPTGIEDEDALIADVKILLEELASSDPKLALTGVPIVQWP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase/structural protein
molecule keywords Lysine-specific demethylase 2A
publication title A molecular threading mechanism underlies Jumonji lysine demethylase KDM2A regulation of methylated H3K36.
pubmed doi rcsb
source organism Mus musculus
total genus 19
structure length 68
sequence length 68
chains with identical sequence D
ec nomenclature ec 1.14.11.27: [Histone H3]-dimetyl-L-lysine-36 demethylase.
pdb deposition date 2014-07-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.2210 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4qxbB00
4TN7B 4QXBB 4QXHB 4QX7B 4QX8B 4QWNB 4QXCB
chains in the Genus database with same CATH superfamily
4PK4A 3JAFA 3RQUA 4V1Av 2MPKA 3CX6B 4KX6A 1N34T 2CCQA 4CI3B 4DV7T 3P8CD 3PJAA 4JI7T 3PUGA 3QNUA 4U72A 2BS3A 5JVDE 2CLYB 1KK7A 4DUZT 5BMVE 2WU2A 5HEHA 3P7IA 2UUBT 3EVYA 2V26A 4B3MT 3UUNA 3ETUA 4A5XA 1KF6A 5JRCA 3AVSA 3TLVA 2YDSA 2QA7A 2BG9C 2WBLA 3ZYMA 3AE5A 2V6XA 2UXBT 4MHCA 3RIFA 3MACA 2A2FX 4E7ZA 2XPKA 2WP9A 4UV9B 1J5ET 5AQRB 2FJDA 1XMOT 1XNQT 3F57A 3L3PA 1SUMB 3RX6A 4HFCA 1LRZA 3RRWA 3AECA 3ZN0B 4EEBA 4C91A 2VKHA 3AEFA 3AB3B 4Z91A 5AQSB 3U78A 1HR0T 4QWNB 2E5LT 2HH7A 2NTXA 5FL0A 3N2KE 1MIVA 5L3EB 3PV0F 5HWYA 2FJBA 5H6RB 4TWHA 2YKSA 3M65A 2WCAA 1IJ6A 2CM0A 1D0XA 4EEDA 3P4SA 2ODVA 2KT9A 3GWHA 1OXZA 1Y64B 2V7KA 2V7LA 1LVFA 2UXXB 4LF8T 4PW8A 1HFAA 3C64A 4OK0A 4BA9A 2XSAA 3OYZA 3NRYA 4YTMA 4KHZF 5J0ZA 4ISSA 1MMDA 4ZEYA 4G2AA 3H37A 1FEWA 3MXZA 2NP9A 4DV5T 2HHHT 3BK9A 5AQTB 2D0TA 2X9HA 3KVAA 3ZT5A 3AA1B 2NTYA 5IHYA 4QHOA 3MZKB 3AEBA 2CWYA 2XQ7A 3A7MA 1YQ4A 4JI4T 2G0UA 3CQXC 2QRXA 5CB4E 4X5TA 5JDLA 1HX1B 3RGLA 2R6GF 2V8SV 1B7TA 3VKHA 5ABHA 3Q2MA 2VL0A 2LT3A 3VRBA 2LSKA 3O1HA 2LSJA 3H3MA 3AEGA 4EZHA 5AQMB 4U2YA 2K3WA 2XZEA 5L3FB 2V7JA 3LDQB 2L3LA 4H9NC 3N9NA 2D9DA 3SRZA 3AVRA 4E7SA 4PK5A 5AQGB 3N9OA 3ZJ1A 2UXCT 2XAHB 1DU2A 4UF0A 4ADZA 4ZS3A 5AQVB 4TV8E 1VRBA 4X66T 4P0BA 3FZLB 2V6YA 4ERRA 2YDRA 2JPFA 5FL1A 2E2AA 2VVNA 2M67A 2X0HA 2VKJA 3NZQA 5JRCB 5JDNA 3I1AA 4YSYA 1HCIA 2K9AA 1NEKA 3ZMVB 3N9QA 1CUNA 4O2AE 2CHOA 4GK5E 2GK9A 3EUHA 2ZLYA 3KBUA 3EDVA 3AE6A 3ZLIA 2LM9A 4FI5A 4JEHB 4MFRA 1FMVA 4LFBT 3OKQA 5A1LA 3Q5WA 4P09A 1CHUA 1T98A 2BKOA 5EZYE 1IBLT 1J5WA 3N9MA 3S4UA 5F5WA 3AE2A 2PTFA 5LJNA 4X1YE 2M6IA 4QXHB 4TWFA 3U3IA 4M1PA 2ACXA 4LFCT 2H88A 3CPZA 3BQKA 4H9RC 2WU5A 3SOLA 5LHGB 4I0UA 4H9QC 4ZOLE 4AI6A 5LBQB 2JJ9A 3DP7A 4QX7B 2VB6A 5E0OA 2DL1A 4YXDA 5H6QB 3NZPA 3PUAA 3J9X1 3J7Yq 4CI1B 1MIWA 2AXDS 2WMNA 3RRCA 4L5GA 2BS4A 3GA8A 5ABGA 4A56A 4EZ4A 2CXDA 2Q9QD 3F31A 2DWGA 1ZOYA 4X1IE 4A98A 2LSYA 4AQFA 3FXDB 2N1GA 1Y01A 3PUXF 3H3AA 1WCRA 5J2TE 4TNWA 5HCMA 3C98B 3HL6A 3V5SA 1SE7A 4UVBB 5DABA 3NVOA 4DR7T 2X9WA 2K5BB 3B13A 2C0SA 4H63H 3Q9DA 4Q25A 3JADA 3ZJ2A 4NPPA 2Y6XA 3C4ZA 2LE8A 2W2UA 1N33T 2W63A 4B3TT 4HN9A 2NW9A 4O4JE 2RPAA 2PJQA 4HWDA 1ZEEA 5IYZE 2LEHA 5ABEA 1J1JA 1W09A 2WWUA 1HG5A 2WM9A 5LNKA 2BG9E 5F8PA 2NWBA 2IIUA 4UF0B 3DTOA 4OX9T 2XTLA 4HE8A 2VL8A 2IDOB 3PJAJ 4JI2T 4DIDB 4ZHQE 2V6YB 2BG9A 3N9PA 3FHNA 3VR8A 5F3JA 1HNZT 5FYMA 3WAJA 2XQ6A 4LF4T 2KWIB 4DMVA 3AXJA 5L3CB 3B57A 4AIUA 1UUSA 1WR0A 2JQKA 5JDQA 4XAXB 4O8SA 4ZI2D 3VRAA 4C90A 2KNDA 2IAKA 5KX5E 4JV5T 3ZPOA 2ZMAA 2XQ4A 5HXCA 1MMNA 2HPLA 5DJQC 3GN5A 3UU6A 4AKRB 4HFVA 2FBWA 2XM2A 5AQIB 2Y8DA 2HPJA 4DNDA 4HFBA 4DV6T 4K0UA 1T8BA 5HAXA 3AEAA 2DNXA 1U4QA 4ZI7E 3I9YA 3KVBA 3ZYLA 3D0TA 4IE0A 4H9OC 4Z8XA 1WFDA 3Q5EA 2LLYA 1D0YA 3KINB 2YN6A 2VKOA 2Q9QC 5CA1E 4CQIA 5AQNB 4YJ2E 3RLFF 4HGAA 3B5MA 3ZKRA 3EDUA 5IWAT 3P4PA 5L3DB 1UX4A 5AFUL 1M62A 3V5UA 3UULA 2V5CA 3MA9A 5ADXL 3FB2A 2WDVA 4LF6T 1VCTA 3TLSA 2LOPA 2LHNA 3N2OA 3BQIA 3UT5E 3QB5A 5LP6E 4DR4T 5L47A 2CWOA 2F4VT 2V5DA 4CN4A 5LOVE 1BR1A 3ETVA 2EHOD 2XAGB 4K0KT 4ILUA 2DCFA 3Q5DA 1G8XA 1BR0A 2W0GA 4I50E 4QH1A 5FXXA 3PURA 5C2TA 2H3RA 3LK3B 4JUYA 4TV9E 2J1DG 4YY3T 2I6HA 3VKGA 3OYXA 5HEJA 3EI0A 3ZT7A 2YU1A 2WQYA 4JI3T 4TZ4C 3RIAA 3MKDA 3RKGA 5LHHB 5AQUB 3M3ZB 2OV9A 4HEAA 4WNKA 1OEDC 1NENA 2DHRA 3RQWA 4FJOA 3P50A 3P4WA 3ZMSB 4ZI2C 4JI1T 2BG9B 3G06A 2L8KA 1D0ZA 2VURA 3FZFB 1LKXA 5EK2A 2BBJA 4DR5T 2X0YA 3AXJB 3KV9A 3RHWA 1Z8UA 1S94A 3AE9A 3VU7H 5LYJE 3AE4A 4NXMT 1JNZA 3KV6A 2QYWA 2UXDT 5FP3A 3RKOA 3AEDA 3AE1A 3CMLA 3GN5B 2Z6EA 1W9RA 2MBGA 1WRDA 4O4LE 1HS7A 3LK42 3ZMTB 4GKJT 3LSVA 2MOZA 1UK5A 5C3JA 2YEVC 1FMWA 4N78D 2V7MA 1YKEB 3MJXA 2E5VA 5TAOA 3JAEA 3PUSA 3AEEA 4NIQA 3SS1A 1KEYA 4TUYE 4BAYB 3RYHE 4OYKA 3OBVE 2PFVA 2J47A 2E9XD 3SFDA 3IF8B 4B3ST 2LRKA 3PUWF 5HXHA 2P9BA 3T1HT 4AKLA 4LMKA 2ZM6T 5KXJA 3UUMA 2CXFA 4GIWA 1MMAA 4EGWA 3HKDE 3NWIA 5LHIB 3KV4A 1D1AA 1U5PA 4IE5A 1O3XA 2YINA 1OWAA 4CXXA 4EXTA 5BR8T 5AQJB 4CN6A 2WZHA 5LCYA 2EHOC 4ANJA 5L4EA 2CMRA 3ZMUB 5JDMA 4U31A 5FY0A 2MTQA 2LSGA 4IE4A 4NXNT 4PJLA 3E08A 3OTOT 1MMGA 4U33A 1NWMX 4EV6A 2KWHA 2WSSV 2BVLA 3CKDA 3QC9A 1W0BA 1E7PA 2E9XA 5HEUA 4EAHA 5LGNB 3UUXB 3P4RA 2XQAA 1SA0E 3K8PC 1XWMA 1ZV4X 3N9LA 4EYUA 4B3RT 4TN7B 5L3GB 2X66A 5AQFB 2UUCT 3T1YT 1R8IA 2LM2A 4PFOA 1XZYA 2CRBA 2XJ7A 3E0ZA 5J2UE 4AKIA 2BDEA 3ZC0A 3OPCA 4DVDA 4UEMA 1YXRA 4IDOA 3AAIA 2QVAA 4OYJA 3RH3A 2HN1A 2SPCA 2VK9A 3LG7A 5JDFA 4KI0F 1FIOA 2I0MA 1W0AA 2XUEA 2FUPA 4GYRA 3ZCJA 3F2EA 4HKAA 4DR1T 2DI4A 2K24A 4TNVA 4DV0T 4QXCB 2VASA 2AE9A 1XDOA 5LMNT 4YTPA 5L3BB 2BKNA 2X68A 4UXNB 3L09A 1WYCA 2CHNA 2C5IT 4QH5A 1ZKEA 4TWDA 2W62A 2WMOA 4ZXLA 4KUMB 2KINB 3C4WA 3UFEA 1H7CA 2WY2A 1M7KA 2YU2A 3NBXX 1X9BA 1KNZA 3T8OA 1IZNB 2C5JA 4U74A 3FZKB 4IE6A 2E9XC 3VHLA 4P1NA 5FNVE 2V1DB 5EK4A 5HXSA 3LFMA 3VR9A 2Q9QA 4CI2B 2PG8A 2K48A 4JI8T 1UX5A 3P4QA 2LJLA 4UVCB 2VWAA 5KDMC 1N32T 5FVLA 4O4IE 4UIGA 2PBIA 1Z0PA 5AQQB 4X64T 5LMUT 3ZC1A 5HEOA 1QUUA 2BBHA 2XQ9A 3ESLA 1L0VA 2W61A 1IBKT 1E1HB 5L2LA 5JR9C 5DQWA 2X51A 4LMLA 2CLYC 4ZZBA 2VVSA 4YHHT 1GQEA 4I4TE 3E22E 2A9UA 2XY8B 5DQVA 4CXYA 3SWHA 5AQHB 3IEEA 2XAQB 4Z90A 2B1EA 2H7OA 3PU8A 3RYIE 5HCJA 4AKHA 3ZSSA 4AQGA 1I94T 3EAMA 1IJ5A 3HKCE 2E9XB 3RI5A 2NR4A 3UTKA 2CEAA 3N2GE 2XASB 3C51A 4LMJA 2IC6A 1V9DA 3UU5A 4JLEA 1OEDE 1ZHCA 4QH4A 2ZM2A 4QXBB 2KZ7B 3K3NA 2WDRA 1WR6A 2LOSA 3LBXB 2LKHA 1SHZC 3NKZA 2DWKA 2W67A 3X1DA 2WS3A 1OEDA 4CZZB 3ONLC 2LSIA 3EABA 2XQYA 3ZYKA 1ZP0A 2J62A 3UU8A 4IDPA 3LK2B 2NW8A 5KMGP 1BR4A 2JMKA 2LRLA 3TLTA 5JR9B 4UR9A 2DLRA 3I9WA 2WB5A 4QKNA 1HF8A 3CVRA 4AQYT 3UQ7A 4U2ZA 2XQ3A 3DJBA 2B76A 4WW0A 2CE7A 3CX7B 4X65T 4H9PC 3OJAA 4GYSA 2XM1A 4PNIA 2LHRA 3C50A 4MALA 3Q5XA 4IIJE 2XQ8A 4JEUB 3ZMZB 1E2AA 1UGOA 4EOZB 3RYCE 2D0UA 5FMNA 4JI0T 4YT0A 5AQKB 2WZIA 3ANWA 3AA0B 3MK7C 3RIUC 1MIYA 4IREA 5JDGA 3EHZA 5FY7A 4ZI3D 3TLWA 5FXVA 4PFPA 3JCFA 2YOEA 5HYAA 2ACZA 4IT4A 3PDYA 4WYVA 3JC6D 5AQPB 5JREA 3KV5A 5JH7E 3BQLA 4F6RC 2Q9QB 4JYAT 4LFAT 4LF5T 1X79A 3TLUA 5HWXA 3NRXA 5L4HA 1UCUA 4GKKT 3ZT6A 3K3QC 4ILCA 3UFGA 5LJMA 5JQGE 2X67A 1XNRT 4EIWA 1EZ3A 3QB5K 4DBRA 1VCSA 5IUXA 2I59A 4BJMA 1HTJF 2OLTA 1KNPA 4HWCA 4WBOA 2RA1A 2C5KT 3FZMB 2EHOA 1NAFA 3AAEB 5GONE 4GOUA 1MNDA 2ES0A 4HWIB 4XBFB 4WZXA 1D1BA 2VQFT 3ABVA 2IC9A 4OHFA 4ZZCA 3SFEA 1YD8G 4NUUA 4LF7T 3RC3A 4JI6T 4G63A 4DUYT 2V7IA 4I55E 2W4XA 4YSZA 4IE7A 4O4HE 4KMCA 4DMWA 4QX8B 5HEGA 2QGSA 5JTGA 3PUVF 4YJ3E 3L8RA 2W66A 2JRKA 4YTNA 4DBQA 2VKDA 4X1KE 2WWVA 4U7IA 3UUBA 3PUZF 4HFDA 3HI2A 4AISA 2ZM0A 3ONXA 3GMIA 2RP4A 2IUBA 4DV3T 2M6BA 5ABFA 4HFIA 5LGUB 4ILAA 5CGMA 2VQET 1FJGT 4J2CA 2FJAA 4GK0E 2XAFB 4EYYR 1LVKA 4L0RA 1T72A 3QOFA 3O9XA 2ODUA 4MLKA 3ZCIA 2N9DA 3ZEFB 1OEDB 3KDSE 4DR6T 1JNRA 4B6XA 1KFYA 3O1JA 5LB7B 2LKGA 1UURA 3O1IA 4COFA 3HKBE 4ASKA 4PJNA 5ETWA 5JDHA 3UQ4A 3UU3A 4IHJE 4IL9A 3IA3A 4HWHA 4YSXA 2HN2A 5HXEA 3AE7A 5CFBA 1WYBA 3IHRA 4XZCA 2X9XA 3AE3A 4UELA 1KNRA 4L9IA 1IBMT 2UUAT 2D5UA 2WDQA 2A72A 1VOMA 4ZI3C 4U7YA 5CA0E 2XQ5A 4DR2T 2JQQA 2MYSA 2XAJB 1YQ3A 3PU3A 4WBNE 3CQCB 3WAKA 1MNEA 3JC6C 4ZS2A 3ANWB 3L39A 3I0QA 3PUQA 2W00A 3CIRA 1G73A 2CXLA 2OA5A 4IDNA 4O2BE 3A8YC 5LXTE 5J1GA 1D1CA 3R84B 3RF1A 2X0LB 4I43B 1XMQT 3LBXA 5FXZA 3AAAB 4MBQA 2BS2A 2CPTA 4DV4T 4NUVA 4AXPA 4IDZA 5LGTB 2JQ9A 4DV2T 3FBLA 1HNXT 4DV1T 1BR2A 4PK6A 2WAUA 4H9SE 4OFZA 4UV8B 5JR9A 2H7VC 1T7SA 3ZN1B 4KP3C 1YW0A 2EHOB 5CJ5A 2KSRA 4IGUA 4CXWA 1HNWT 2CBIA 5LBMA 5FVKA 3RYFE 4HFHA 3R6NA 2NOXA 3PE0A 2ZM8A 2IW5B 4ISTA 4PJJA 4TX5A 4LF9T 3HR0A 5LG3A 3W15B 4AKGA 3WI3A 4IDQA 5AQOB 3LJCA 3ZSTA 4DO0A 2XSBA 4U3CA 3CX8B 2D2SA 4DR3T 5FXWA 2XHEB 2JMHA 1HX8A 2Y48B 3QUJA 2KLQA 5LA6E 3AA7B 1US7B 3QK6A 3HA4A 2UXNB 5ABFB 1YKHB 2J4GA 4YFSA 4KBMB 1S35A 2NW7A 4JI5T 1N36T 4CN1A 2X9YA 2CBJA 2KMFA 2E8IA 1AJ3A 2BKPA 4YHJA 1HG2A 4KHPT 4PAGA 4YLHA 3I0OA 4PJMA 3K1SA 4IL4A 3RC8A 3FZHB 2YK0A 3UU4A 3RPUA 2CA5A 3AE8A 2BZBA 4HTEA 2JIWA 5AQLB 4HWFA 3PUYF 3PTRB 3OVUA 5M4YA 4ILBA 2IMLA 3CWZB 4JBWF 3TKLB 4X20E 3O4XE 3C4XA 2MAWA 2KXPB 2JQHA 5C8YE 4A97A 2L9QA 1I6ZA 4UVAB 3AA6B 3N5LA 3CK6A 3RIUA 4H63V 3K3OA 4P0AA 1XDPA 3KFWX 4AQFC 2BVMA 1QLBA 1QSDA 3ONJA 5FY1A 4HFEA 3KBTA 3A5XA 3FXEB 1WLXA 5HXRA 4X62T 4F8HA 5EK3A 2FJEA 5FKYA 3FBZA 4BJNA 3HKEE 2A3DA 2H89A 2YDQA 2N2NA 3IBPA 1IAPA 5LG4A 2UU9T 4EB6E 2IHR1 3CQGB
chains in the Genus database with same CATH topology
4PK4A 4H63H 3ZMUB 3Q9DA 2I59A 4BJMA 5JDMA 1HTJF 3ZJ2A 4WBOA 5FY0A 2RA1A 2C5KT 2MTQA 4V1Av 2LSGA 4IE4A 2Y6XA 2EHOA 3CX6B 3C4ZA 1NAFA 3AAEB 4PJLA 5GONE 3E08A 2CCQA 4GOUA 1MNDA 2LE8A 2ES0A 1MMGA 4XBFB 4CI3B 3P8CD 1NWMX 1D1BA 2W63A 3PUGA 4HN9A 2KWHA 2WSSV 2NW9A 2IC9A 4OHFA 4U72A 2BVLA 3CKDA 3QC9A 1YD8G 4NUUA 5JVDE 3RC3A 4O4JE 4G63A 2PJQA 2V7IA 1ZEEA 2E9XA 2CLYB 4I55E 5IYZE 4EAHA 1KK7A 3UUXB 2LEHA 5LGNB 5BMVE 4IE7A 3P7IA 4O4HE 1SA0E 4KMCA 3K8PC 4DMWA 2WWUA 4QX8B 1ZV4X 3EVYA 3N9LA 4EYUA 1HG5A 2QGSA 2V26A 2WM9A 4TN7B 5L3GB 2X66A 3UUNA 4YJ3E 3ETUA 5LNKA 4PFOA 5JRCA 2JRKA 4DBQA 2VKDA 4X1KE 5F8PA 3AVSA 2NWBA 3E0ZA 5J2UE 2QA7A 4UF0B 3DTOA 4AKIA 2BDEA 2XTLA 2WBLA 4HE8A 3HI2A 2VL8A 3ZC0A 3ZYMA 2ZM0A 4ZHQE 3ONXA 3GMIA 4MHCA 2RP4A 3MACA 4DVDA 3N9PA 4UEMA 2A2FX 4E7ZA 4UV9B 3FHNA 3AAIA 3F57A 5F3JA 4OYJA 5LGUB 5FYMA 3RH3A 3WAJA 2SPCA 2VK9A 3L3PA 2KWIB 3LG7A 4DMVA 5JDFA 5L3CB 3B57A 3RX6A 4J2CA 4GK0E 1LRZA 2XAFB 4EYYR 1LVKA 3RRWA 4L0RA 3ZN0B 1FIOA 4C91A 2VKHA 5JDQA 4XAXB 3O9XA 4O8SA 2ODUA 3AB3B 4MLKA 2N9DA 3ZCIA 3ZEFB 2XUEA 3ZCJA 4GYRA 3KDSE 4ZI2D 3U78A 3F2EA 4B6XA 4C90A 4QWNB 4HKAA 2KNDA 3O1JA 2DI4A 2HH7A 2K24A 2NTXA 2IAKA 3O1IA 4QXCB 3HKBE 3N2KE 2VASA 4PJNA 4ASKA 1MIVA 5KX5E 5ETWA 5JDHA 5L3BB 3ZPOA 2ZMAA 5L3EB 5HWYA 5HXCA 1MMNA 2X68A 5H6RB 4UXNB 2HPLA 3L09A 5DJQC 3GN5A 1WYCA 3M65A 1IJ6A 4AKRB 2CM0A 1D0XA 4HFVA 4IHJE 2C5IT 1ZKEA 2ODVA 2W62A 2WMOA 2KT9A 2Y8DA 2HPJA 4DNDA 5HXEA 3GWHA 4K0UA 1WYBA 3IHRA 4XZCA 5HAXA 1OXZA 2X9XA 4KUMB 2KINB 4UELA 1Y64B 2V7KA 2V7LA 2DNXA 3C4WA 1U4QA 3UFEA 1H7CA 4L9IA 4ZI7E 2YU2A 3NBXX 1KNZA 2D5UA 3I9YA 3T8OA 2A72A 1VOMA 1IZNB 1LVFA 4ZI3C 2UXXB 2C5JA 5CA0E 3KVBA 4U74A 4IE6A 3ZYLA 2JQQA 2MYSA 3D0TA 2XAJB 2E9XC 4IE0A 4H9OC 4Z8XA 4PW8A 1HFAA 3C64A 4OK0A 3VHLA 4BA9A 3PU3A 4WBNE 1D0YA 3OYZA 5FNVE 3CQCB 3WAKA 2V1DB 3KINB 1MNEA 3JC6C 3NRYA 2VKOA 2Q9QC 5CA1E 4ZS2A 4CQIA 3ANWB 5EK4A 5HXSA 2C0SA 3I0QA 4YJ2E 3PUQA 3LFMA 1MMDA 4ISSA 4G2AA 2W00A 3H37A 4HGAA 1FEWA 3MXZA 1G73A 2CXLA 2NP9A 2OA5A 2Q9QA 3EDUA 4CI2B 5L3DB 4O2BE 2PG8A 3BK9A 2K48A 5LXTE 2D0TA 2CMRA 2X9HA 1UX4A 3KVAA 5J1GA 1UX5A 3AA1B 2LJLA 4UVCB 2VWAA 1D1CA 5KDMC 2NTYA 5AFUL 4O4IE 4UIGA 3R84B 5IHYA 2PBIA 1Z0PA 2X0LB 3V5UA 4QHOA 3MZKB 4I43B 3UULA 2CWYA 3LBXA 3MA9A 5FXZA 3ZC1A 3AAAB 4MBQA 5ADXL 3FB2A 2G0UA 4NUVA 2LOPA 2LHNA 3CQXC 1QUUA 5CB4E 3N2OA 3ESLA 4AXPA 5JDLA 3BQIA 4IDZA 3UT5E 2W61A 5LGTB 5LP6E 1B7TA 1E1HB 5L2LA 5JR9C 3VKHA 3FBLA 2CWOA 1BR2A 4PK6A 3Q2MA 5DQWA 2X51A 2CLYC 2WAUA 2LT3A 4H9SE 2LSKA 3O1HA 2LSJA 4OFZA 5LOVE 4UV8B 1BR1A 3ETVA 4I4TE 5JR9A 4EZHA 3E22E 2EHOD 2XAGB 2H7VC 4ILUA 2DCFA 3ZN1B 5DQVA 1G8XA 2V7JA 5L3FB 4CXYA 4KP3C 1BR0A 2L3LA 3SWHA 1YW0A 2W0GA 4I50E 5FXXA 3PURA 4H9NC 2EHOB 3IEEA 3N9NA 3SRZA 2H3RA 3AVRA 3LK3B 2XAQB 4E7SA 4IGUA 4PK5A 4JUYA 2B1EA 2H7OA 3PU8A 3N9OA 4CXWA 3ZJ1A 3RYIE 4TV9E 5LBMA 2J1DG 4AKHA 3RYFE 2XAHB 4UF0A 4AQGA 3R6NA 4ADZA 2NOXA 4ZS3A 3PE0A 1IJ5A 2ZM8A 3VKGA 3HKCE 2E9XB 3OYXA 4TV8E 3UTKA 1VRBA 2CEAA 2IW5B 4ISTA 4P0BA 3N2GE 4PJJA 4TX5A 2XASB 2YU1A 3C51A 3HR0A 2IC6A 4ERRA 1V9DA 2JPFA 4TZ4C 3W15B 4AKGA 3MKDA 3WI3A 2M67A 4JLEA 5LHHB 3LJCA 2VKJA 4DO0A 3CX8B 1ZHCA 2D2SA 3NZQA 2ZM2A 5JRCB 5FXWA 5JDNA 3I1AA 4QXBB 4HEAA 2KZ7B 1HCIA 3K3NA 2K9AA 4WNKA 1WR6A 3ZMVB 2LOSA 3N9QA 2DHRA 3LBXB 1CUNA 1SHZC 4FJOA 4O2AE 2XHEB 2DWKA 2JMHA 1HX8A 2Y48B 3QUJA 4GK5E 2GK9A 2KLQA 2ZLYA 3EUHA 5LA6E 3ZMSB 3KBUA 3EDVA 4ZI2C 3AA7B 4CZZB 1US7B 3QK6A 3ZLIA 3HA4A 2L8KA 1D0ZA 2UXNB 1YKHB 2LM9A 4FI5A 2LSIA 4YFSA 4JEHB 4KBMB 1LKXA 1S35A 4MFRA 5EK2A 2XQYA 1FMVA 3ZYKA 2NW7A 3OKQA 5A1LA 3LK2B 3Q5WA 2X9YA 2NW8A 5KMGP 1BR4A 2JMKA 2KMFA 3KV9A 2E8IA 1AJ3A 4YHJA 5JR9B 1S94A 4P09A 1HG2A 2DLRA 1T98A 3I9WA 4PAGA 5EZYE 4YLHA 4QKNA 1HF8A 3N9MA 3CVRA 3S4UA 3VU7H 3I0OA 4PJMA 5LYJE 3RC8A 3DJBA 4WW0A 3KV6A 2CE7A 2YK0A 3CX7B 5LJNA 4X1YE 4H9PC 4QXHB 3RPUA 3OJAA 2CA5A 5FP3A 3RKOA 3U3IA 2BZBA 4GYSA 4M1PA 2ACXA 4HTEA 4PNIA 3CMLA 3CPZA 3BQKA 2LHRA 3GN5B 2Z6EA 4H9RC 3C50A 2MBGA 1WRDA 4MALA 4O4LE 3SOLA 3Q5XA 4IIJE 1HS7A 5LHGB 3PTRB 4DBRA 4H9QC 5M4YA 3LK42 4ZOLE 4JEUB 3ZMZB 4EOZB 4AI6A 3ZMTB 5LBQB 2JJ9A 2MOZA 3DP7A 3CWZB 4QX7B 2D0UA 3RYCE 2VB6A 5E0OA 5FMNA 3TKLB 4X20E 2YEVC 3ANWA 3O4XE 1FMWA 3C4XA 4N78D 2V7MA 1YKEB 3MJXA 5TAOA 3AA0B 5H6QB 2KXPB 3NZPA 3PUAA 3PUSA 3MK7C 3J9X1 1MIYA 3J7Yq 4CI1B 5JDGA 5C8YE 1MIWA 3SS1A 5FY7A 4ZI3D 2WMNA 4TUYE 2L9QA 3RRCA 4OYKA 3OBVE 4L5GA 3RYHE 2PFVA 4BAYB 2E9XD 3GA8A 5FXVA 4PFPA 4UVAB 3AA6B 3N5LA 5HYAA 3IF8B 4A56A 4H63V 3K3OA 3PDYA 4EZ4A 4P0AA 5HXHA 2P9BA 3KFWX 4AKLA 4AQFC 3JC6D 2CXDA 2Q9QD 2BVMA 3F31A 3UUMA 5JREA 2DWGA 1QSDA 2CXFA 4GIWA 5FY1A 3KV5A 4X1IE 5JH7E 3KBTA 3A5XA 1MMAA 3BQLA 3HKDE 2LSYA 3FXEB 4AQFA 3FXDB 2Q9QB 4F6RC 2N1GA 1WLXA 5LHIB 3KV4A 5HXRA 1X79A 5EK3A 5HWXA 1D1AA 3H3AA 1U5PA 3FBZA 4BJNA 3NRXA 3HKEE 5J2TE 1UCUA 4IE5A 2A3DA 3K3QC 1O3XA 3C98B 2YINA 3HL6A 3V5SA 4UVBB 5DABA 2N2NA 1OWAA 4CXXA 4EXTA 3IBPA 5LJMA 5JQGE 2X67A 1IAPA 5LCYA 2X9WA 5LG4A 4EIWA 1EZ3A 2EHOC 2K5BB 4ANJA 3B13A 4EB6E 3CQGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TN7 B;  4QXB B;  4QXH B;  4QX7 B;  4QX8 B;  4QWN B;  4QXC B; 
#chains in the Genus database with same CATH topology
 4PK4 A;  3JAF A;  3RQU A;  4V1A v;  2MPK A;  3CX6 B;  4KX6 A;  1N34 T;  2CCQ A;  4CI3 B;  4DV7 T;  3P8C D;  3PJA A;  4JI7 T;  3PUG A;  3QNU A;  4U72 A;  2BS3 A;  5JVD E;  2CLY B;  1KK7 A;  4DUZ T;  5BMV E;  2WU2 A;  5HEH A;  3P7I A;  2UUB T;  3EVY A;  2V26 A;  4B3M T;  3UUN A;  3ETU A;  4A5X A;  1KF6 A;  5JRC A;  3AVS A;  3TLV A;  2YDS A;  2QA7 A;  2BG9 C;  2WBL A;  3ZYM A;  3AE5 A;  2V6X A;  2UXB T;  4MHC A;  3RIF A;  3MAC A;  2A2F X;  4E7Z A;  2XPK A;  2WP9 A;  4UV9 B;  1J5E T;  5AQR B;  2FJD A;  1XMO T;  1XNQ T;  3F57 A;  3L3P A;  1SUM B;  3RX6 A;  4HFC A;  1LRZ A;  3RRW A;  3AEC A;  3ZN0 B;  4EEB A;  4C91 A;  2VKH A;  3AEF A;  3AB3 B;  4Z91 A;  5AQS B;  3U78 A;  1HR0 T;  4QWN B;  2E5L T;  2HH7 A;  2NTX A;  5FL0 A;  3N2K E;  1MIV A;  5L3E B;  3PV0 F;  5HWY A;  2FJB A;  5H6R B;  4TWH A;  2YKS A;  3M65 A;  2WCA A;  1IJ6 A;  2CM0 A;  1D0X A;  4EED A;  3P4S A;  2ODV A;  2KT9 A;  3GWH A;  1OXZ A;  1Y64 B;  2V7K A;  2V7L A;  1LVF A;  2UXX B;  4LF8 T;  4PW8 A;  1HFA A;  3C64 A;  4OK0 A;  4BA9 A;  2XSA A;  3OYZ A;  3NRY A;  4YTM A;  4KHZ F;  5J0Z A;  4ISS A;  1MMD A;  4ZEY A;  4G2A A;  3H37 A;  1FEW A;  3MXZ A;  2NP9 A;  4DV5 T;  2HHH T;  3BK9 A;  5AQT B;  2D0T A;  2X9H A;  3KVA A;  3ZT5 A;  3AA1 B;  2NTY A;  5IHY A;  4QHO A;  3MZK B;  3AEB A;  2CWY A;  2XQ7 A;  3A7M A;  1YQ4 A;  4JI4 T;  2G0U A;  3CQX C;  2QRX A;  5CB4 E;  4X5T A;  5JDL A;  1HX1 B;  3RGL A;  2R6G F;  2V8S V;  1B7T A;  3VKH A;  5ABH A;  3Q2M A;  2VL0 A;  2LT3 A;  3VRB A;  2LSK A;  3O1H A;  2LSJ A;  3H3M A;  3AEG A;  4EZH A;  5AQM B;  4U2Y A;  2K3W A;  2XZE A;  5L3F B;  2V7J A;  3LDQ B;  2L3L A;  4H9N C;  3N9N A;  2D9D A;  3SRZ A;  3AVR A;  4E7S A;  4PK5 A;  5AQG B;  3N9O A;  3ZJ1 A;  2UXC T;  2XAH B;  1DU2 A;  4UF0 A;  4ADZ A;  4ZS3 A;  5AQV B;  4TV8 E;  1VRB A;  4X66 T;  4P0B A;  3FZL B;  2V6Y A;  4ERR A;  2YDR A;  2JPF A;  5FL1 A;  2E2A A;  2VVN A;  2M67 A;  2X0H A;  2VKJ A;  3NZQ A;  5JRC B;  5JDN A;  3I1A A;  4YSY A;  1HCI A;  2K9A A;  1NEK A;  3ZMV B;  3N9Q A;  1CUN A;  4O2A E;  2CHO A;  4GK5 E;  2GK9 A;  3EUH A;  2ZLY A;  3KBU A;  3EDV A;  3AE6 A;  3ZLI A;  2LM9 A;  4FI5 A;  4JEH B;  4MFR A;  1FMV A;  4LFB T;  3OKQ A;  5A1L A;  3Q5W A;  4P09 A;  1CHU A;  1T98 A;  2BKO A;  5EZY E;  1IBL T;  1J5W A;  3N9M A;  3S4U A;  5F5W A;  3AE2 A;  2PTF A;  5LJN A;  4X1Y E;  2M6I A;  4QXH B;  4TWF A;  3U3I A;  4M1P A;  2ACX A;  4LFC T;  2H88 A;  3CPZ A;  3BQK A;  4H9R C;  2WU5 A;  3SOL A;  5LHG B;  4I0U A;  4H9Q C;  4ZOL E;  4AI6 A;  5LBQ B;  2JJ9 A;  3DP7 A;  4QX7 B;  2VB6 A;  5E0O A;  2DL1 A;  4YXD A;  5H6Q B;  3NZP A;  3PUA A;  3J9X 1;  3J7Y q;  4CI1 B;  1MIW A;  2AXD S;  2WMN A;  3RRC A;  4L5G A;  2BS4 A;  3GA8 A;  5ABG A;  4A56 A;  4EZ4 A;  2CXD A;  2Q9Q D;  3F31 A;  2DWG A;  1ZOY A;  4X1I E;  4A98 A;  2LSY A;  4AQF A;  3FXD B;  2N1G A;  1Y01 A;  3PUX F;  3H3A A;  1WCR A;  5J2T E;  4TNW A;  5HCM A;  3C98 B;  3HL6 A;  3V5S A;  1SE7 A;  4UVB B;  5DAB A;  3NVO A;  4DR7 T;  2X9W A;  2K5B B;  3B13 A;  2C0S A;  4H63 H;  3Q9D A;  4Q25 A;  3JAD A;  3ZJ2 A;  4NPP A;  2Y6X A;  3C4Z A;  2LE8 A;  2W2U A;  1N33 T;  2W63 A;  4B3T T;  4HN9 A;  2NW9 A;  4O4J E;  2RPA A;  2PJQ A;  4HWD A;  1ZEE A;  5IYZ E;  2LEH A;  5ABE A;  1J1J A;  1W09 A;  2WWU A;  1HG5 A;  2WM9 A;  5LNK A;  2BG9 E;  5F8P A;  2NWB A;  2IIU A;  4UF0 B;  3DTO A;  4OX9 T;  2XTL A;  4HE8 A;  2VL8 A;  2IDO B;  3PJA J;  4JI2 T;  4DID B;  4ZHQ E;  2V6Y B;  2BG9 A;  3N9P A;  3FHN A;  3VR8 A;  5F3J A;  1HNZ T;  5FYM A;  3WAJ A;  2XQ6 A;  4LF4 T;  2KWI B;  4DMV A;  3AXJ A;  5L3C B;  3B57 A;  4AIU A;  1UUS A;  1WR0 A;  2JQK A;  5JDQ A;  4XAX B;  4O8S A;  4ZI2 D;  3VRA A;  4C90 A;  2KND A;  2IAK A;  5KX5 E;  4JV5 T;  3ZPO A;  2ZMA A;  2XQ4 A;  5HXC A;  1MMN A;  2HPL A;  5DJQ C;  3GN5 A;  3UU6 A;  4AKR B;  4HFV A;  2FBW A;  2XM2 A;  5AQI B;  2Y8D A;  2HPJ A;  4DND A;  4HFB A;  4DV6 T;  4K0U A;  1T8B A;  5HAX A;  3AEA A;  2DNX A;  1U4Q A;  4ZI7 E;  3I9Y A;  3KVB A;  3ZYL A;  3D0T A;  4IE0 A;  4H9O C;  4Z8X A;  1WFD A;  3Q5E A;  2LLY A;  1D0Y A;  3KIN B;  2YN6 A;  2VKO A;  2Q9Q C;  5CA1 E;  4CQI A;  5AQN B;  4YJ2 E;  3RLF F;  4HGA A;  3B5M A;  3ZKR A;  3EDU A;  5IWA T;  3P4P A;  5L3D B;  1UX4 A;  5AFU L;  1M62 A;  3V5U A;  3UUL A;  2V5C A;  3MA9 A;  5ADX L;  3FB2 A;  2WDV A;  4LF6 T;  1VCT A;  3TLS A;  2LOP A;  2LHN A;  3N2O A;  3BQI A;  3UT5 E;  3QB5 A;  5LP6 E;  4DR4 T;  5L47 A;  2CWO A;  2F4V T;  2V5D A;  4CN4 A;  5LOV E;  1BR1 A;  3ETV A;  2EHO D;  2XAG B;  4K0K T;  4ILU A;  2DCF A;  3Q5D A;  1G8X A;  1BR0 A;  2W0G A;  4I50 E;  4QH1 A;  5FXX A;  3PUR A;  5C2T A;  2H3R A;  3LK3 B;  4JUY A;  4TV9 E;  2J1D G;  4YY3 T;  2I6H A;  3VKG A;  3OYX A;  5HEJ A;  3EI0 A;  3ZT7 A;  2YU1 A;  2WQY A;  4JI3 T;  4TZ4 C;  3RIA A;  3MKD A;  3RKG A;  5LHH B;  5AQU B;  3M3Z B;  2OV9 A;  4HEA A;  4WNK A;  1OED C;  1NEN A;  2DHR A;  3RQW A;  4FJO A;  3P50 A;  3P4W A;  3ZMS B;  4ZI2 C;  4JI1 T;  2BG9 B;  3G06 A;  2L8K A;  1D0Z A;  2VUR A;  3FZF B;  1LKX A;  5EK2 A;  2BBJ A;  4DR5 T;  2X0Y A;  3AXJ B;  3KV9 A;  3RHW A;  1Z8U A;  1S94 A;  3AE9 A;  3VU7 H;  5LYJ E;  3AE4 A;  4NXM T;  1JNZ A;  3KV6 A;  2QYW A;  2UXD T;  5FP3 A;  3RKO A;  3AED A;  3AE1 A;  3CML A;  3GN5 B;  2Z6E A;  1W9R A;  2MBG A;  1WRD A;  4O4L E;  1HS7 A;  3LK4 2;  3ZMT B;  4GKJ T;  3LSV A;  2MOZ A;  1UK5 A;  5C3J A;  2YEV C;  1FMW A;  4N78 D;  2V7M A;  1YKE B;  3MJX A;  2E5V A;  5TAO A;  3JAE A;  3PUS A;  3AEE A;  4NIQ A;  3SS1 A;  1KEY A;  4TUY E;  4BAY B;  3RYH E;  4OYK A;  3OBV E;  2PFV A;  2J47 A;  2E9X D;  3SFD A;  3IF8 B;  4B3S T;  2LRK A;  3PUW F;  5HXH A;  2P9B A;  3T1H T;  4AKL A;  4LMK A;  2ZM6 T;  5KXJ A;  3UUM A;  2CXF A;  4GIW A;  1MMA A;  4EGW A;  3HKD E;  3NWI A;  5LHI B;  3KV4 A;  1D1A A;  1U5P A;  4IE5 A;  1O3X A;  2YIN A;  1OWA A;  4CXX A;  4EXT A;  5BR8 T;  5AQJ B;  4CN6 A;  2WZH A;  5LCY A;  2EHO C;  4ANJ A;  5L4E A;  2CMR A;  3ZMU B;  5JDM A;  4U31 A;  5FY0 A;  2MTQ A;  2LSG A;  4IE4 A;  4NXN T;  4PJL A;  3E08 A;  3OTO T;  1MMG A;  4U33 A;  1NWM X;  4EV6 A;  2KWH A;  2WSS V;  2BVL A;  3CKD A;  3QC9 A;  1W0B A;  1E7P A;  2E9X A;  5HEU A;  4EAH A;  5LGN B;  3UUX B;  3P4R A;  2XQA A;  1SA0 E;  3K8P C;  1XWM A;  1ZV4 X;  3N9L A;  4EYU A;  4B3R T;  4TN7 B;  5L3G B;  2X66 A;  5AQF B;  2UUC T;  3T1Y T;  1R8I A;  2LM2 A;  4PFO A;  1XZY A;  2CRB A;  2XJ7 A;  3E0Z A;  5J2U E;  4AKI A;  2BDE A;  3ZC0 A;  3OPC A;  4DVD A;  4UEM A;  1YXR A;  4IDO A;  3AAI A;  2QVA A;  4OYJ A;  3RH3 A;  2HN1 A;  2SPC A;  2VK9 A;  3LG7 A;  5JDF A;  4KI0 F;  1FIO A;  2I0M A;  1W0A A;  2XUE A;  2FUP A;  4GYR A;  3ZCJ A;  3F2E A;  4HKA A;  4DR1 T;  2DI4 A;  2K24 A;  4TNV A;  4DV0 T;  4QXC B;  2VAS A;  2AE9 A;  1XDO A;  5LMN T;  4YTP A;  5L3B B;  2BKN A;  2X68 A;  4UXN B;  3L09 A;  1WYC A;  2CHN A;  2C5I T;  4QH5 A;  1ZKE A;  4TWD A;  2W62 A;  2WMO A;  4ZXL A;  4KUM B;  2KIN B;  3C4W A;  3UFE A;  1H7C A;  2WY2 A;  1M7K A;  2YU2 A;  3NBX X;  1X9B A;  1KNZ A;  3T8O A;  1IZN B;  2C5J A;  4U74 A;  3FZK B;  4IE6 A;  2E9X C;  3VHL A;  4P1N A;  5FNV E;  2V1D B;  5EK4 A;  5HXS A;  3LFM A;  3VR9 A;  2Q9Q A;  4CI2 B;  2PG8 A;  2K48 A;  4JI8 T;  1UX5 A;  3P4Q A;  2LJL A;  4UVC B;  2VWA A;  5KDM C;  1N32 T;  5FVL A;  4O4I E;  4UIG A;  2PBI A;  1Z0P A;  5AQQ B;  4X64 T;  5LMU T;  3ZC1 A;  5HEO A;  1QUU A;  2BBH A;  2XQ9 A;  3ESL A;  1L0V A;  2W61 A;  1IBK T;  1E1H B;  5L2L A;  5JR9 C;  5DQW A;  2X51 A;  4LML A;  2CLY C;  4ZZB A;  2VVS A;  4YHH T;  1GQE A;  4I4T E;  3E22 E;  2A9U A;  2XY8 B;  5DQV A;  4CXY A;  3SWH A;  5AQH B;  3IEE A;  2XAQ B;  4Z90 A;  2B1E A;  2H7O A;  3PU8 A;  3RYI E;  5HCJ A;  4AKH A;  3ZSS A;  4AQG A;  1I94 T;  3EAM A;  1IJ5 A;  3HKC E;  2E9X B;  3RI5 A;  2NR4 A;  3UTK A;  2CEA A;  3N2G E;  2XAS B;  3C51 A;  4LMJ A;  2IC6 A;  1V9D A;  3UU5 A;  4JLE A;  1OED E;  1ZHC A;  4QH4 A;  2ZM2 A;  4QXB B;  2KZ7 B;  3K3N A;  2WDR A;  1WR6 A;  2LOS A;  3LBX B;  2LKH A;  1SHZ C;  3NKZ A;  2DWK A;  2W67 A;  3X1D A;  2WS3 A;  1OED A;  4CZZ B;  3ONL C;  2LSI A;  3EAB A;  2XQY A;  3ZYK A;  1ZP0 A;  2J62 A;  3UU8 A;  4IDP A;  3LK2 B;  2NW8 A;  5KMG P;  1BR4 A;  2JMK A;  2LRL A;  3TLT A;  5JR9 B;  4UR9 A;  2DLR A;  3I9W A;  2WB5 A;  4QKN A;  1HF8 A;  3CVR A;  4AQY T;  3UQ7 A;  4U2Z A;  2XQ3 A;  3DJB A;  2B76 A;  4WW0 A;  2CE7 A;  3CX7 B;  4X65 T;  4H9P C;  3OJA A;  4GYS A;  2XM1 A;  4PNI A;  2LHR A;  3C50 A;  4MAL A;  3Q5X A;  4IIJ E;  2XQ8 A;  4JEU B;  3ZMZ B;  1E2A A;  1UGO A;  4EOZ B;  3RYC E;  2D0U A;  5FMN A;  4JI0 T;  4YT0 A;  5AQK B;  2WZI A;  3ANW A;  3AA0 B;  3MK7 C;  3RIU C;  1MIY A;  4IRE A;  5JDG A;  3EHZ A;  5FY7 A;  4ZI3 D;  3TLW A;  5FXV A;  4PFP A;  3JCF A;  2YOE A;  5HYA A;  2ACZ A;  4IT4 A;  3PDY A;  4WYV A;  3JC6 D;  5AQP B;  5JRE A;  3KV5 A;  5JH7 E;  3BQL A;  4F6R C;  2Q9Q B;  4JYA T;  4LFA T;  4LF5 T;  1X79 A;  3TLU A;  5HWX A;  3NRX A;  5L4H A;  1UCU A;  4GKK T;  3ZT6 A;  3K3Q C;  4ILC A;  3UFG A;  5LJM A;  5JQG E;  2X67 A;  1XNR T;  4EIW A;  1EZ3 A;  3QB5 K;  4DBR A;  1VCS A;  5IUX A;  2I59 A;  4BJM A;  1HTJ F;  2OLT A;  1KNP A;  4HWC A;  4WBO A;  2RA1 A;  2C5K T;  3FZM B;  2EHO A;  1NAF A;  3AAE B;  5GON E;  4GOU A;  1MND A;  2ES0 A;  4HWI B;  4XBF B;  4WZX A;  1D1B A;  2VQF T;  3ABV A;  2IC9 A;  4OHF A;  4ZZC A;  3SFE A;  1YD8 G;  4NUU A;  4LF7 T;  3RC3 A;  4JI6 T;  4G63 A;  4DUY T;  2V7I A;  4I55 E;  2W4X A;  4YSZ A;  4IE7 A;  4O4H E;  4KMC A;  4DMW A;  4QX8 B;  5HEG A;  2QGS A;  5JTG A;  3PUV F;  4YJ3 E;  3L8R A;  2W66 A;  2JRK A;  4YTN A;  4DBQ A;  2VKD A;  4X1K E;  2WWV A;  4U7I A;  3UUB A;  3PUZ F;  4HFD A;  3HI2 A;  4AIS A;  2ZM0 A;  3ONX A;  3GMI A;  2RP4 A;  2IUB A;  4DV3 T;  2M6B A;  5ABF A;  4HFI A;  5LGU B;  4ILA A;  5CGM A;  2VQE T;  1FJG T;  4J2C A;  2FJA A;  4GK0 E;  2XAF B;  4EYY R;  1LVK A;  4L0R A;  1T72 A;  3QOF A;  3O9X A;  2ODU A;  4MLK A;  3ZCI A;  2N9D A;  3ZEF B;  1OED B;  3KDS E;  4DR6 T;  1JNR A;  4B6X A;  1KFY A;  3O1J A;  5LB7 B;  2LKG A;  1UUR A;  3O1I A;  4COF A;  3HKB E;  4ASK A;  4PJN A;  5ETW A;  5JDH A;  3UQ4 A;  3UU3 A;  4IHJ E;  4IL9 A;  3IA3 A;  4HWH A;  4YSX A;  2HN2 A;  5HXE A;  3AE7 A;  5CFB A;  1WYB A;  3IHR A;  4XZC A;  2X9X A;  3AE3 A;  4UEL A;  1KNR A;  4L9I A;  1IBM T;  2UUA T;  2D5U A;  2WDQ A;  2A72 A;  1VOM A;  4ZI3 C;  4U7Y A;  5CA0 E;  2XQ5 A;  4DR2 T;  2JQQ A;  2MYS A;  2XAJ B;  1YQ3 A;  3PU3 A;  4WBN E;  3CQC B;  3WAK A;  1MNE A;  3JC6 C;  4ZS2 A;  3ANW B;  3L39 A;  3I0Q A;  3PUQ A;  2W00 A;  3CIR A;  1G73 A;  2CXL A;  2OA5 A;  4IDN A;  4O2B E;  3A8Y C;  5LXT E;  5J1G A;  1D1C A;  3R84 B;  3RF1 A;  2X0L B;  4I43 B;  1XMQ T;  3LBX A;  5FXZ A;  3AAA B;  4MBQ A;  2BS2 A;  2CPT A;  4DV4 T;  4NUV A;  4AXP A;  4IDZ A;  5LGT B;  2JQ9 A;  4DV2 T;  3FBL A;  1HNX T;  4DV1 T;  1BR2 A;  4PK6 A;  2WAU A;  4H9S E;  4OFZ A;  4UV8 B;  5JR9 A;  2H7V C;  1T7S A;  3ZN1 B;  4KP3 C;  1YW0 A;  2EHO B;  5CJ5 A;  2KSR A;  4IGU A;  4CXW A;  1HNW T;  2CBI A;  5LBM A;  5FVK A;  3RYF E;  4HFH A;  3R6N A;  2NOX A;  3PE0 A;  2ZM8 A;  2IW5 B;  4IST A;  4PJJ A;  4TX5 A;  4LF9 T;  3HR0 A;  5LG3 A;  3W15 B;  4AKG A;  3WI3 A;  4IDQ A;  5AQO B;  3LJC A;  3ZST A;  4DO0 A;  2XSB A;  4U3C A;  3CX8 B;  2D2S A;  4DR3 T;  5FXW A;  2XHE B;  2JMH A;  1HX8 A;  2Y48 B;  3QUJ A;  2KLQ A;  5LA6 E;  3AA7 B;  1US7 B;  3QK6 A;  3HA4 A;  2UXN B;  5ABF B;  1YKH B;  2J4G A;  4YFS A;  4KBM B;  1S35 A;  2NW7 A;  4JI5 T;  1N36 T;  4CN1 A;  2X9Y A;  2CBJ A;  2KMF A;  2E8I A;  1AJ3 A;  2BKP A;  4YHJ A;  1HG2 A;  4KHP T;  4PAG A;  4YLH A;  3I0O A;  4PJM A;  3K1S A;  4IL4 A;  3RC8 A;  3FZH B;  2YK0 A;  3UU4 A;  3RPU A;  2CA5 A;  3AE8 A;  2BZB A;  4HTE A;  2JIW A;  5AQL B;  4HWF A;  3PUY F;  3PTR B;  3OVU A;  5M4Y A;  4ILB A;  2IML A;  3CWZ B;  4JBW F;  3TKL B;  4X20 E;  3O4X E;  3C4X A;  2MAW A;  2KXP B;  2JQH A;  5C8Y E;  4A97 A;  2L9Q A;  1I6Z A;  4UVA B;  3AA6 B;  3N5L A;  3CK6 A;  3RIU A;  4H63 V;  3K3O A;  4P0A A;  1XDP A;  3KFW X;  4AQF C;  2BVM A;  1QLB A;  1QSD A;  3ONJ A;  5FY1 A;  4HFE A;  3KBT A;  3A5X A;  3FXE B;  1WLX A;  5HXR A;  4X62 T;  4F8H A;  5EK3 A;  2FJE A;  5FKY A;  3FBZ A;  4BJN A;  3HKE E;  2A3D A;  2H89 A;  2YDQ A;  2N2N A;  3IBP A;  1IAP A;  5LG4 A;  2UU9 T;  4EB6 E;  2IHR 1;  3CQG B; 
#chains in the Genus database with same CATH homology
 4PK4 A;  4H63 H;  3ZMU B;  3Q9D A;  2I59 A;  4BJM A;  5JDM A;  1HTJ F;  3ZJ2 A;  4WBO A;  5FY0 A;  2RA1 A;  2C5K T;  2MTQ A;  4V1A v;  2LSG A;  4IE4 A;  2Y6X A;  2EHO A;  3CX6 B;  3C4Z A;  1NAF A;  3AAE B;  4PJL A;  5GON E;  3E08 A;  2CCQ A;  4GOU A;  1MND A;  2LE8 A;  2ES0 A;  1MMG A;  4XBF B;  4CI3 B;  3P8C D;  1NWM X;  1D1B A;  2W63 A;  3PUG A;  4HN9 A;  2KWH A;  2WSS V;  2NW9 A;  2IC9 A;  4OHF A;  4U72 A;  2BVL A;  3CKD A;  3QC9 A;  1YD8 G;  4NUU A;  5JVD E;  3RC3 A;  4O4J E;  4G63 A;  2PJQ A;  2V7I A;  1ZEE A;  2E9X A;  2CLY B;  4I55 E;  5IYZ E;  4EAH A;  1KK7 A;  3UUX B;  2LEH A;  5LGN B;  5BMV E;  4IE7 A;  3P7I A;  4O4H E;  1SA0 E;  4KMC A;  3K8P C;  4DMW A;  2WWU A;  4QX8 B;  1ZV4 X;  3EVY A;  3N9L A;  4EYU A;  1HG5 A;  2QGS A;  2V26 A;  2WM9 A;  4TN7 B;  5L3G B;  2X66 A;  3UUN A;  4YJ3 E;  3ETU A;  5LNK A;  4PFO A;  5JRC A;  2JRK A;  4DBQ A;  2VKD A;  4X1K E;  5F8P A;  3AVS A;  2NWB A;  3E0Z A;  5J2U E;  2QA7 A;  4UF0 B;  3DTO A;  4AKI A;  2BDE A;  2XTL A;  2WBL A;  4HE8 A;  3HI2 A;  2VL8 A;  3ZC0 A;  3ZYM A;  2ZM0 A;  4ZHQ E;  3ONX A;  3GMI A;  4MHC A;  2RP4 A;  3MAC A;  4DVD A;  3N9P A;  4UEM A;  2A2F X;  4E7Z A;  4UV9 B;  3FHN A;  3AAI A;  3F57 A;  5F3J A;  4OYJ A;  5LGU B;  5FYM A;  3RH3 A;  3WAJ A;  2SPC A;  2VK9 A;  3L3P A;  2KWI B;  3LG7 A;  4DMV A;  5JDF A;  5L3C B;  3B57 A;  3RX6 A;  4J2C A;  4GK0 E;  1LRZ A;  2XAF B;  4EYY R;  1LVK A;  3RRW A;  4L0R A;  3ZN0 B;  1FIO A;  4C91 A;  2VKH A;  5JDQ A;  4XAX B;  3O9X A;  4O8S A;  2ODU A;  3AB3 B;  4MLK A;  2N9D A;  3ZCI A;  3ZEF B;  2XUE A;  3ZCJ A;  4GYR A;  3KDS E;  4ZI2 D;  3U78 A;  3F2E A;  4B6X A;  4C90 A;  4QWN B;  4HKA A;  2KND A;  3O1J A;  2DI4 A;  2HH7 A;  2K24 A;  2NTX A;  2IAK A;  3O1I A;  4QXC B;  3HKB E;  3N2K E;  2VAS A;  4PJN A;  4ASK A;  1MIV A;  5KX5 E;  5ETW A;  5JDH A;  5L3B B;  3ZPO A;  2ZMA A;  5L3E B;  5HWY A;  5HXC A;  1MMN A;  2X68 A;  5H6R B;  4UXN B;  2HPL A;  3L09 A;  5DJQ C;  3GN5 A;  1WYC A;  3M65 A;  1IJ6 A;  4AKR B;  2CM0 A;  1D0X A;  4HFV A;  4IHJ E;  2C5I T;  1ZKE A;  2ODV A;  2W62 A;  2WMO A;  2KT9 A;  2Y8D A;  2HPJ A;  4DND A;  5HXE A;  3GWH A;  4K0U A;  1WYB A;  3IHR A;  4XZC A;  5HAX A;  1OXZ A;  2X9X A;  4KUM B;  2KIN B;  4UEL A;  1Y64 B;  2V7K A;  2V7L A;  2DNX A;  3C4W A;  1U4Q A;  3UFE A;  1H7C A;  4L9I A;  4ZI7 E;  2YU2 A;  3NBX X;  1KNZ A;  2D5U A;  3I9Y A;  3T8O A;  2A72 A;  1VOM A;  1IZN B;  1LVF A;  4ZI3 C;  2UXX B;  2C5J A;  5CA0 E;  3KVB A;  4U74 A;  4IE6 A;  3ZYL A;  2JQQ A;  2MYS A;  3D0T A;  2XAJ B;  2E9X C;  4IE0 A;  4H9O C;  4Z8X A;  4PW8 A;  1HFA A;  3C64 A;  4OK0 A;  3VHL A;  4BA9 A;  3PU3 A;  4WBN E;  1D0Y A;  3OYZ A;  5FNV E;  3CQC B;  3WAK A;  2V1D B;  3KIN B;  1MNE A;  3JC6 C;  3NRY A;  2VKO A;  2Q9Q C;  5CA1 E;  4ZS2 A;  4CQI A;  3ANW B;  5EK4 A;  5HXS A;  2C0S A;  3I0Q A;  4YJ2 E;  3PUQ A;  3LFM A;  1MMD A;  4ISS A;  4G2A A;  2W00 A;  3H37 A;  4HGA A;  1FEW A;  3MXZ A;  1G73 A;  2CXL A;  2NP9 A;  2OA5 A;  2Q9Q A;  3EDU A;  4CI2 B;  5L3D B;  4O2B E;  2PG8 A;  3BK9 A;  2K48 A;  5LXT E;  2D0T A;  2CMR A;  2X9H A;  1UX4 A;  3KVA A;  5J1G A;  1UX5 A;  3AA1 B;  2LJL A;  4UVC B;  2VWA A;  1D1C A;  5KDM C;  2NTY A;  5AFU L;  4O4I E;  4UIG A;  3R84 B;  5IHY A;  2PBI A;  1Z0P A;  2X0L B;  3V5U A;  4QHO A;  3MZK B;  4I43 B;  3UUL A;  2CWY A;  3LBX A;  3MA9 A;  5FXZ A;  3ZC1 A;  3AAA B;  4MBQ A;  5ADX L;  3FB2 A;  2G0U A;  4NUV A;  2LOP A;  2LHN A;  3CQX C;  1QUU A;  5CB4 E;  3N2O A;  3ESL A;  4AXP A;  5JDL A;  3BQI A;  4IDZ A;  3UT5 E;  2W61 A;  5LGT B;  5LP6 E;  1B7T A;  1E1H B;  5L2L A;  5JR9 C;  3VKH A;  3FBL A;  2CWO A;  1BR2 A;  4PK6 A;  3Q2M A;  5DQW A;  2X51 A;  2CLY C;  2WAU A;  2LT3 A;  4H9S E;  2LSK A;  3O1H A;  2LSJ A;  4OFZ A;  5LOV E;  4UV8 B;  1BR1 A;  3ETV A;  4I4T E;  5JR9 A;  4EZH A;  3E22 E;  2EHO D;  2XAG B;  2H7V C;  4ILU A;  2DCF A;  3ZN1 B;  5DQV A;  1G8X A;  2V7J A;  5L3F B;  4CXY A;  4KP3 C;  1BR0 A;  2L3L A;  3SWH A;  1YW0 A;  2W0G A;  4I50 E;  5FXX A;  3PUR A;  4H9N C;  2EHO B;  3IEE A;  3N9N A;  3SRZ A;  2H3R A;  3AVR A;  3LK3 B;  2XAQ B;  4E7S A;  4IGU A;  4PK5 A;  4JUY A;  2B1E A;  2H7O A;  3PU8 A;  3N9O A;  4CXW A;  3ZJ1 A;  3RYI E;  4TV9 E;  5LBM A;  2J1D G;  4AKH A;  3RYF E;  2XAH B;  4UF0 A;  4AQG A;  3R6N A;  4ADZ A;  2NOX A;  4ZS3 A;  3PE0 A;  1IJ5 A;  2ZM8 A;  3VKG A;  3HKC E;  2E9X B;  3OYX A;  4TV8 E;  3UTK A;  1VRB A;  2CEA A;  2IW5 B;  4IST A;  4P0B A;  3N2G E;  4PJJ A;  4TX5 A;  2XAS B;  2YU1 A;  3C51 A;  3HR0 A;  2IC6 A;  4ERR A;  1V9D A;  2JPF A;  4TZ4 C;  3W15 B;  4AKG A;  3MKD A;  3WI3 A;  2M67 A;  4JLE A;  5LHH B;  3LJC A;  2VKJ A;  4DO0 A;  3CX8 B;  1ZHC A;  2D2S A;  3NZQ A;  2ZM2 A;  5JRC B;  5FXW A;  5JDN A;  3I1A A;  4QXB B;  4HEA A;  2KZ7 B;  1HCI A;  3K3N A;  2K9A A;  4WNK A;  1WR6 A;  3ZMV B;  2LOS A;  3N9Q A;  2DHR A;  3LBX B;  1CUN A;  1SHZ C;  4FJO A;  4O2A E;  2XHE B;  2DWK A;  2JMH A;  1HX8 A;  2Y48 B;  3QUJ A;  4GK5 E;  2GK9 A;  2KLQ A;  2ZLY A;  3EUH A;  5LA6 E;  3ZMS B;  3KBU A;  3EDV A;  4ZI2 C;  3AA7 B;  4CZZ B;  1US7 B;  3QK6 A;  3ZLI A;  3HA4 A;  2L8K A;  1D0Z A;  2UXN B;  1YKH B;  2LM9 A;  4FI5 A;  2LSI A;  4YFS A;  4JEH B;  4KBM B;  1LKX A;  1S35 A;  4MFR A;  5EK2 A;  2XQY A;  1FMV A;  3ZYK A;  2NW7 A;  3OKQ A;  5A1L A;  3LK2 B;  3Q5W A;  2X9Y A;  2NW8 A;  5KMG P;  1BR4 A;  2JMK A;  2KMF A;  3KV9 A;  2E8I A;  1AJ3 A;  4YHJ A;  5JR9 B;  1S94 A;  4P09 A;  1HG2 A;  2DLR A;  1T98 A;  3I9W A;  4PAG A;  5EZY E;  4YLH A;  4QKN A;  1HF8 A;  3N9M A;  3CVR A;  3S4U A;  3VU7 H;  3I0O A;  4PJM A;  5LYJ E;  3RC8 A;  3DJB A;  4WW0 A;  3KV6 A;  2CE7 A;  2YK0 A;  3CX7 B;  5LJN A;  4X1Y E;  4H9P C;  4QXH B;  3RPU A;  3OJA A;  2CA5 A;  5FP3 A;  3RKO A;  3U3I A;  2BZB A;  4GYS A;  4M1P A;  2ACX A;  4HTE A;  4PNI A;  3CML A;  3CPZ A;  3BQK A;  2LHR A;  3GN5 B;  2Z6E A;  4H9R C;  3C50 A;  2MBG A;  1WRD A;  4MAL A;  4O4L E;  3SOL A;  3Q5X A;  4IIJ E;  1HS7 A;  5LHG B;  3PTR B;  4DBR A;  4H9Q C;  5M4Y A;  3LK4 2;  4ZOL E;  4JEU B;  3ZMZ B;  4EOZ B;  4AI6 A;  3ZMT B;  5LBQ B;  2JJ9 A;  2MOZ A;  3DP7 A;  3CWZ B;  4QX7 B;  2D0U A;  3RYC E;  2VB6 A;  5E0O A;  5FMN A;  3TKL B;  4X20 E;  2YEV C;  3ANW A;  3O4X E;  1FMW A;  3C4X A;  4N78 D;  2V7M A;  1YKE B;  3MJX A;  5TAO A;  3AA0 B;  5H6Q B;  2KXP B;  3NZP A;  3PUA A;  3PUS A;  3MK7 C;  3J9X 1;  1MIY A;  3J7Y q;  4CI1 B;  5JDG A;  5C8Y E;  1MIW A;  3SS1 A;  5FY7 A;  4ZI3 D;  2WMN A;  4TUY E;  2L9Q A;  3RRC A;  4OYK A;  3OBV E;  4L5G A;  3RYH E;  2PFV A;  4BAY B;  2E9X D;  3GA8 A;  5FXV A;  4PFP A;  4UVA B;  3AA6 B;  3N5L A;  5HYA A;  3IF8 B;  4A56 A;  4H63 V;  3K3O A;  3PDY A;  4EZ4 A;  4P0A A;  5HXH A;  2P9B A;  3KFW X;  4AKL A;  4AQF C;  3JC6 D;  2CXD A;  2Q9Q D;  2BVM A;  3F31 A;  3UUM A;  5JRE A;  2DWG A;  1QSD A;  2CXF A;  4GIW A;  5FY1 A;  3KV5 A;  4X1I E;  5JH7 E;  3KBT A;  3A5X A;  1MMA A;  3BQL A;  3HKD E;  2LSY A;  3FXE B;  4AQF A;  3FXD B;  2Q9Q B;  4F6R C;  2N1G A;  1WLX A;  5LHI B;  3KV4 A;  5HXR A;  1X79 A;  5EK3 A;  5HWX A;  1D1A A;  3H3A A;  1U5P A;  3FBZ A;  4BJN A;  3NRX A;  3HKE E;  5J2T E;  1UCU A;  4IE5 A;  2A3D A;  3K3Q C;  1O3X A;  3C98 B;  2YIN A;  3HL6 A;  3V5S A;  4UVB B;  5DAB A;  2N2N A;  1OWA A;  4CXX A;  4EXT A;  3IBP A;  5LJM A;  5JQG E;  2X67 A;  1IAP A;  5LCY A;  2X9W A;  5LG4 A;  4EIW A;  1EZ3 A;  2EHO C;  2K5B B;  4ANJ A;  3B13 A;  4EB6 E;  3CQG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...