4AQYT

Structure of ribosome-apramycin complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4aqyT00
2UUCT 1FJGT 5LMNT 4B3TT 4DR7T 4LF7T 5IWAT 4X66T 4JI6T 4LF5T 4LF4T 4B3MT 4B3RT 4DV3T 4DV4T 3T1YT 4YHHT 4YY3T 1N36T 4JYAT 4LFBT 2E5LT 2VQET 4X64T 4KHPT 2UXDT 2UXBT 4DUYT 2UUBT 4JI7T 4JI1T 4DUZT 4LF8T 4DR5T 4K0KT 1HR0T 4JI0T 2HHHT 4B3ST 3OTOT 1IBMT 1XMQT 1IBKT 2UU9T 4AQYT 4JI5T 4DV1T 4DV6T 2UXCT 4DV5T 1HNWT 4X65T 4GKJT 1HNZT 4X62T 4JV5T 4LF9T 5LMUT 4JI8T 1HNXT 4JI2T 3T1HT 4LFCT 4DV0T 5BR8T 4DR2T 4LF6T 2ZM6T 1XMOT 4DR6T 1J5ET 1XNRT 2VQFT 1I94T 4JI4T 4NXNT 4GKKT 1N33T 4LFAT 1XNQT 4DR3T 4JI3T 4DR1T 4DV7T 2UUAT 2F4VT 4DR4T 4DV2T 4NXMT 4OX9T 1N32T 1N34T 1IBLT
chains in the Genus database with same CATH superfamily
4OYJA 1SA0E 2WDQA 5KDMC 4OFZA 2JMHA 3CX7B 4F8HA 2X68A 1X79A 3DTOA 1I6ZA 3CK6A 5IUXA 4DR7T 4UELA 2NTYA 1WCRA 3BK9A 4JI6T 1W0AA 3AAEB 1EZ3A 3VR8A 3N2KE 5L3GB 3ZYMA 4ZI2C 4ZI3D 4HFDA 3C64A 3HKEE 4DV3T 5JDMA 5M4YA 3ONXA 2Q9QD 4TUYE 4A56A 4G63A 2XJ7A 2PTFA 3QB5K 2EHOA 1S35A 4H9NC 3MA9A 2M6BA 5LBQB 4DO0A 2H88A 5AQJB 4ZI7E 2WZIA 4CI3B 2YN6A 4B6XA 1N36T 3Q5DA 3IF8B 2WY2A 2C5KT 2FUPA 3DJBA 2VQET 2MPKA 4YXDA 4XAXB 2X51A 4EAHA 1XWMA 1KFYA 4ZS2A 1HF8A 2E9XC 5HEOA 3UT5E 2EHOD 4PJJA 2UUBT 4DUZT 4DR5T 5BMVE 1HG5A 3AA0B 1Z8UA 2KZ7B 5LGTB 5CA1E 2E8IA 4PK6A 2H89A 2LKHA 2VKHA 3GWHA 2HPJA 4FJOA 3PE0A 1HR0T 5EK4A 1YKHB 2ACXA 5AQGB 3L8RA 2D5UA 2X0YA 5AQNB 2V7IA 4HEAA 1D0YA 2PG8A 3I1AA 2LSGA 3JAFA 2XHEB 2XQ6A 2W2UA 1Y64B 4GK5E 4HWFA 2QGSA 2WAUA 4IE0A 3OVUA 3AEFA 3ANWB 3PU3A 1BR1A 1BR4A 2CXDA 2OV9A 3AXJA 2WMOA 3M65A 3PU8A 3Q5WA 4K0UA 3F57A 5AQKB 5EZYE 4JI5T 2HN1A 4C90A 5LP6E 2CEAA 2DNXA 3UULA 1UK5A 2IUBA 2WDRA 2HPLA 1OWAA 3C4ZA 1KK7A 2VL8A 2I59A 1D1CA 3G06A 5ABHA 2X66A 3E22E 4GKJT 1UX5A 3N9OA 2LHNA 5HXHA 4X62T 5DQWA 2Q9QB 5LG4A 4WYVA 1HNXT 1QUUA 3HKDE 5HXSA 5JRCB 5L4HA 3V5SA 5A1LA 4ZOLE 5AQUB 3SRZA 1FEWA 4EEDA 3T1HT 5HCMA 4E7SA 4X20E 2YKSA 2E9XA 3AE6A 1ZOYA 2R6GF 2YEVC 4QX7B 2XUEA 3SS1A 3UFGA 5LHGB 3ONLC 3QUJA 2OA5A 3O4XE 3CWZB 3ONJA 3TLTA 3KFWX 3RC3A 4GIWA 5L3FB 3TKLB 2A9UA 3CX8B 2V6YA 4YTPA 3D0TA 3J7Yq 4EZ4A 4DR2T 1HTJF 3RIFA 4M1PA 3AECA 2CLYB 4GOUA 1LVKA 2VURA 2ZM6T 1T72A 2BBHA 3ZCIA 4TNVA 4EB6E 1HS7A 4DBQA 3UU6A 1BR0A 2VASA 3OKQA 4TZ4C 4U31A 4NXNT 4IT4A 2X9XA 4JEHB 1VCSA 4MFRA 5CB4E 4UEMA 1ZP0A 4IL9A 5AQLB 5FY7A 4HFCA 3K3OA 3N5LA 3AVRA 3I9WA 1BR2A 3A7MA 3S4UA 4YJ3E 3RIUC 2CCQA 2IW5B 4AQGA 1IJ5A 4O4JE 4LFAT 3A8YC 2LOPA 3ETVA 5AQIB 3CQGB 4DIDB 3ZCJA 2ACZA 3AE9A 4PNIA 4UXNB 3RYFE 3ZC1A 1D0XA 2CM0A 5HEHA 3LK42 2UUAT 4NUUA 4QXHB 3RLFF 2WQYA 3P7IA 4TV8E 5HCJA 3PJAJ 4AKGA 2D2SA 4ADZA 4P0BA 5LJMA 3FZFB 2XZEA 2J47A 2Z6EA 1W9RA 2BG9A 1YQ3A 3PUAA 5LHHB 4IGUA 1WRDA 2YK0A 4WW0A 4OX9T 1UGOA 1FIOA 2LRKA 1R8IA 1N32T 2XAGB 3O9XA 2Q9QA 3C98B 5DABA 2VK9A 3P4WA 2KNDA 5AQRB 1ZV4X 2V1DB 4OHFA 3RQUA 4DMVA 3FZKB 1NEKA 2MAWA 3BQIA 3LBXA 3R84B 2WBLA 4UV8B 2CPTA 2JJ9A 5FL0A 4B3TT 1DU2A 4PJLA 5JR9C 4LF7T 5C3JA 5AQOB 5IWAT 2BKNA 5C8YE 4LF4T 5JTGA 3UU4A 3CQXC 4L9IA 2V5CA 5LYJE 5LG3A 4B3MT 3PUYF 3OPCA 4QX8B 3ZC0A 4B3RT 1U5PA 3KINB 5ABEA 3N9MA 3PTRB 2L3LA 4EGWA 1IAPA 3SOLA 2H7VC 3VU7H 2PBIA 1KEYA 4OK0A 4CN1A 4JYAT 1X9BA 2XQ4A 4HWIB 4YY3T 2NTXA 3R6NA 3ZT6A 2MYSA 3VHLA 2BS2A 4TNWA 3AAAB 3BQKA 4HKAA 4IREA 3U3IA 4U7IA 2MTQA 3HKCE 3UU8A 3UUBA 4AXPA 4WBNE 2BKOA 3PUSA 3JC6C 3QK6A 4J2CA 3ZSTA 4O4HE 1WR0A 2IIUA 3OYXA 2BS3A 2KT9A 1UX4A 2XM1A 3ABVA 1S94A 4HFVA 4TWHA 4IDZA 1J5WA 4A97A 2UXDT 1D1AA 4IDNA 3ZLIA 4U2YA 4ASKA 4DUYT 2WS3A 3RI5A 5L4EA 1ZKEA 2V26A 3AAIA 2W0GA 1SUMB 1ZEEA 3AA6B 4GYSA 4LF8T 5ABFB 3WAJA 4LMJA 3CMLA 3CPZA 1WYCA 2P9BA 3BQLA 3CX6B 3FZHB 4IDOA 2CBJA 3EAMA 2VB6A 5FXZA 3ZKRA 3ZEFB 4UV9B 4DNDA 2HHHT 4K0KT 4WNKA 3EDVA 2E9XD 2BG9B 2HN2A 3K1SA 4IDQA 4P1NA 1E7PA 2V6YB 4ANJA 5CFBA 2WCAA 3PJAA 5FYMA 3QOFA 4I0UA 4AKHA 2FJAA 2VVSA 2LSJA 4JLEA 4JBWF 5FVLA 3SWHA 2X9WA 2FJEA 2K9AA 3KBTA 4HE8A 2DL1A 2LHRA 4UVBB 1UUSA 1VOMA 1JNZA 1CUNA 2A3DA 3AA1B 4X65T 4KHZF 4C91A 1G8XA 3EDUA 5LOVE 2W67A 3UUNA 3NZQA 1KF6A 1HNZT 2BVLA 2KWHA 2KMFA 3A5XA 4H9SE 4LF9T 1D1BA 2E5VA 4EYUA 5J2TE 3UU5A 1WLXA 2D0UA 2YU2A 4UIGA 3ZMUB 2JMKA 4A98A 2G0UA 5IHYA 2LLYA 2JRKA 4LFCT 4CXWA 5L47A 3MXZA 1M7KA 3ZYKA 4DVDA 2LRLA 5FL1A 1E1HB 3GN5B 4HWHA 4DV0T 1MMDA 1HCIA 1VCTA 2E2AA 2ES0A 3EI0A 5FP3A 5H6QB 3CIRA 3M3ZB 4AKLA 5KX5E 2ZM2A 4QWNB 1MIVA 2N1GA 2YDQA 3WAKA 5CA0E 1AJ3A 5FKYA 1MIWA 5HXEA 3ZJ1A 4AQFC 3B57A 3FXDB 3MK7C 2X0HA 3P4SA 5FXWA 5JDQA 1I94T 2LJLA 2DWGA 4G2AA 5ABFA 2IC6A 3ZJ2A 4BA9A 1KNZA 4IHJE 2CLYC 3LJCA 3IEEA 1OEDC 2JIWA 2MBGA 4HFBA 2CXFA 4L0RA 4X5TA 3GA8A 3RYHE 3LFMA 4U2ZA 3I9YA 2W61A 2ZLYA 2NW9A 4UF0A 3KV9A 4JI3T 1T98A 2HH7A 3AE4A 4P09A 3RKOA 4BAYB 2C0SA 4DV7T 4YHJA 3VKGA 4JUYA 4I50E 1V9DA 4XBFB 2VWAA 2W4XA 5DQVA 2V6XA 4QHOA 4DR4T 1ZHCA 2DWKA 3PUGA 1QLBA 4DV2T 5EK2A 3Q5EA 4ZI2D 1NAFA 1CHUA 3SFEA 2E9XB 2L8KA 4P0AA 2WSSV 2XAHB 4AQFA 2V7MA 5JREA 5IYZE 4YJ2E 5HXCA 4CI1B 2W62A 4QXCB 3P8CD 2XAQB 5FMNA 5FY1A 5LXTE 2JQQA 3KBUA 2KSRA 3MJXA 4HGAA 5LBMA 2A72A 3RIAA 5LMNT 3P4RA 4I4TE 3ZN1B 1NENA 2J62A 4GYRA 3UUXB 4EOZB 2KXPB 2W00A 2WP9A 3EUHA 2WZHA 4LF5T 1WFDA 4BJMA 4MHCA 4EIWA 1FMVA 2XQ5A 3Q5XA 3LK2B 2LSIA 2WWVA 4LF6T 1T7SA 2XQYA 4ZXLA 5L3CB 3KV5A 4U72A 4DV4T 3T1YT 4F6RC 1VRBA 2EHOC 5FY0A 4LMLA 1T8BA 1SE7A 3VRAA 3ZPOA 3AXJB 3E0ZA 4YTMA 5JDFA 4H9PC 4DMWA 2PJQA 2XSBA 3ZT5A 2MOZA 3PUXF 4EXTA 4YHHT 4AQYT 5FVKA 2CA5A 2DI4A 3P4QA 3H37A 4YT0A 2E5LT 2LSKA 4PJNA 1UURA 2IHR1 2JQ9A 3P4PA 4TN7B 4ZZBA 3H3MA 1YQ4A 4X64T 1US7B 4KHPT 2V8SV 4I43B 3E08A 3RIUA 1QSDA 1IJ6A 4OYKA 3TLVA 2V7JA 3O1IA 2AE9A 3L3PA 4HN9A 2H3RA 4JI1T 3KV6A 2N2NA 3LSVA 3RX6A 2ZM8A 3AE1A 3QB5A 3MKDA 5KMGP 4QH1A 3LG7A 1WYBA 4O2BE 1OXZA 2BS4A 3RH3A 3UTKA 2BG9E 2CMRA 2UXXB 3UQ7A 1J1JA 3AA7B 3F2EA 3LDQB 2GK9A 3GN5A 5DJQC 1U4QA 2W66A 2X0LB 3HA4A 3RHWA 4ZHQE 5CGMA 1W0BA 4V1Av 1M62A 3EHZA 4PFPA 1IBMT 1XMQT 2DCFA 2J4GA 2WU2A 4IE7A 5L3DB 5JDNA 4HFEA 5LHIB 3N2OA 2UU9T 4A5XA 1MNEA 4IE5A 3AEEA 2BZBA 3T8OA 4TX5A 1YKEB 2NP9A 5LJNA 4DV1T 5HAXA 5L3EB 2UXCT 4ZZCA 2CXLA 4EYYR 3ZN0B 2XTLA 2SPCA 4MBQA 1OEDA 2ODVA 3FBLA 4ILCA 4N78D 2Y8DA 1KNRA 3B13A 4O4LE 1D0ZA 4TWDA 4U7YA 5KXJA 5TAOA 4TWFA 4XZCA 3AE8A 5L3BB 1G73A 4EV6A 4HFHA 2BBJA 5LMUT 2IC9A 4JI8T 3PDYA 3FZMB 2WWUA 3AE5A 4EZHA 2B76A 4JI2T 5J1GA 3WI3A 1LKXA 4AKRB 2WU5A 2CWOA 1MMAA 2LT3A 3AEDA 4X1KE 1GQEA 4O8SA 3ZYLA 4MALA 5HEUA 2NWBA 1MNDA 3AEAA 3AEGA 5L2LA 1IBKT 4UF0B 2QVAA 3EVYA 4IE6A 5BR8T 2M67A 2LEHA 3RC8A 4AKIA 3K8PC 5JVDE 4KX6A 3NBXX 2XQ8A 3ETUA 2VKJA 1XMOT 5CJ5A 3RQWA 3Q2MA 4DR6T 2LSYA 2XM2A 5JR9B 4BJNA 4YSYA 1YD8G 2C5IT 2YOEA 3KVBA 5H6RB 2CBIA 3HL6A 4MLKA 1Y01A 3I0QA 4KP3C 1L0VA 4JI4T 5F5WA 3K3QC 1H7CA 1MIYA 5LA6E 1KNPA 1Z0PA 3P50A 3PUQA 3QC9A 2XQ3A 5J0ZA 4ILBA 5LCYA 3JCFA 3GMIA 5LGNB 3VR9A 3ZMTB 4EEBA 5JQGE 3RRWA 2K48A 2X9HA 4U3CA 5HXRA 4UR9A 5AQFB 4KUMB 4CI2B 4DR3T 4KMCA 3AB3B 3L39A 4DR1T 2JQKA 2JQHA 2ODUA 4WZXA 4Z91A 4H9OC 2N9DA 2LM2A 1HFAA 4PAGA 3UUMA 2XQ9A 4CZZB 5FXVA 5C2TA 4ISTA 5JH7E 4NXMT 2QA7A 3PURA 3AE3A 2DLRA 3RGLA 1XZYA 3ZSSA 4YTNA 3B5MA 3ESLA 1IBLT 2UUCT 4PK4A 3SFDA 3O1HA 3PUVF 3RKGA 3FXEB 3CKDA 1FJGT 2FJBA 4NPPA 4IE4A 3NZPA 5HEGA 4NUVA 2J1DG 2V7KA 3MACA 2AXDS 2KINB 4IIJE 5ADXL 4X66T 3O1JA 1IZNB 4O2AE 2VKOA 3ANWA 4U33A 3RF1A 4IL4A 1SHZC 2I6HA 1HX8A 3KV4A 3PUZF 5HYAA 3U78A 3FB2A 4ZEYA 1MMGA 5JDGA 2RP4A 5J2UE 4GK0E 4ILAA 4QKNA 4ERRA 3K3NA 4E7ZA 3TLUA 3V5UA 2VL0A 3Q9DA 4H63H 2VKDA 3AVSA 3H3AA 2NR4A 3NKZA 5E0OA 3J9X1 2LE8A 2LKGA 3RYCE 5LNKA 2BDEA 2WM9A 3C51A 3CQCB 4QH4A 5GONE 3TLSA 3ZMZB 2W63A 4KI0F 1O3XA 3FBZA 2YDSA 4CN6A 2C5JA 3IBPA 2OLTA 2K5BB 3F31A 3JAEA 3N2GE 4O4IE 3UU3A 5F3JA 2RPAA 4PW8A 3N9LA 2UXBT 2M6IA 2KWIB 4H63V 5AQHB 2YDRA 4JI7T 4KBMB 3LBXB 5ABGA 3LK3B 4UVCB 2PFVA 2K3WA 1YW0A 5EK3A 2H7OA 4TV9E 4H9RC 4PFOA 4YSXA 4B3ST 4JI0T 1XDOA 4CXYA 3JC6D 3I0OA 3N9PA 3OTOT 4CN4A 4IDPA 5HWXA 5AQMB 3N9QA 2JPFA 2VVNA 4NIQA 2BVMA 3OYZA 4HFIA 3DP7A 3C4WA 3N9NA 1NWMX 5AFUL 1FMWA 4ILUA 4WBOA 4LMKA 4ZI3C 2YU1A 3OJAA 1LVFA 1MMNA 2CWYA 4CXXA 3ZMSB 5JRCA 4DV6T 3L09A 2CHNA 2A2FX 1HG2A 2Q9QC 2XSAA 3KVAA 4PK5A 4DV5T 1HNWT 2Y48B 2XPKA 1LRZA 2V7LA 1B7TA 3C4XA 3HR0A 5FXXA 5LB7B 3RPUA 4JV5T 3NVOA 2NW8A 4Q25A 4PJMA 2ZMAA 5AQSB 4Z8XA 3VRBA 3CVRA 3X1DA 3IA3A 2XAFB 4QXBB 5JDLA 4YSZA 2QRXA 1OEDB 3PV0F 4AI6A 4HWCA 1JNRA 1W09A 5F8PA 2KLQA 3MZKB 4ISSA 3RRCA 3IHRA 3TLWA 3ZT7A 3AE7A 3QNUA 4H9QC 5AQQB 2XQAA 4HTEA 5LGUB 4YFSA 2XY8B 2IMLA 2UXNB 4Z90A 3W15B 2L9QA 5FNVE 2WB5A 2D0TA 4LFBT 2EHOB 2XAJB 3AE2A 2I0MA 1YXRA 2CHOA 2YINA 1J5ET 2B1EA 4HWDA 2D9DA 1XNRT 4CQIA 5AQTB 2VQFT 2XQ7A 2QYWA 3JADA 4UVAB 3VKHA 3HI2A 1HX1B 3NRXA 4AISA 5ETWA 4L5GA 4GKKT 2X67A 4X1YE 1E2AA 2DHRA 1N33T 2IDOB 1OEDE 3ZMVB 2WDVA 1XDPA 5HEJA 3RYIE 2ZM0A 3PUWF 4QH5A 2FJDA 4I55E 5JR9A 1XNQT 3OBVE 2Y6XA 2RA1A 3AEBA 3NRYA 4COFA 2CRBA 4FI5A 2V5DA 4U74A 4DBRA 2XASB 5HWYA 2NW7A 3C50A 2WMNA 4JEUB 2NOXA 3EABA 2F4VT 4X1IE 4YLHA 3FZLB 2K24A 1WR6A 2LOSA 5AQPB 3UQ4A 4AIUA 2BG9C 2IAKA 5JDHA 5AQVB 2BKPA 2LM9A 2X9YA 2CE7A 3KDSE 1N34T 2FBWA 3NWIA 4ZS3A 3FHNA 3UFEA 1UCUA 3HKBE
chains in the Genus database with same CATH topology
2UUCT 1FJGT 5LMNT 4B3TT 4DR7T 4LF7T 5IWAT 4X66T 4JI6T 4LF5T 4LF4T 4B3MT 4B3RT 4DV3T 4DV4T 3T1YT 4YHHT 4YY3T 1N36T 4JYAT 4LFBT 2E5LT 2VQET 4X64T 4KHPT 2UXDT 2UXBT 4DUYT 2UUBT 4JI7T 4JI1T 4DUZT 4LF8T 4DR5T 4K0KT 1HR0T 4JI0T 2HHHT 4B3ST 3OTOT 1IBMT 1XMQT 1IBKT 2UU9T 4AQYT 4JI5T 4DV1T 4DV6T 2UXCT 4DV5T 1HNWT 4X65T 4GKJT 1HNZT 4X62T 4JV5T 4LF9T 5LMUT 4JI8T 1HNXT 4JI2T 3T1HT 4LFCT 4DV0T 5BR8T 4DR2T 4LF6T 2ZM6T 1XMOT 4DR6T 1J5ET 1XNRT 2VQFT 1I94T 4JI4T 4NXNT 4GKKT 1N33T 4LFAT 1XNQT 4DR3T 4JI3T 4DR1T 4DV7T 2UUAT 2F4VT 4DR4T 4DV2T 4NXMT 4OX9T 1N32T 1N34T 1IBLT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUC T;  1FJG T;  5LMN T;  4B3T T;  4DR7 T;  4LF7 T;  5IWA T;  4X66 T;  4JI6 T;  4LF5 T;  4LF4 T;  4B3M T;  4B3R T;  4DV3 T;  4DV4 T;  3T1Y T;  4YHH T;  4YY3 T;  1N36 T;  4JYA T;  4LFB T;  2E5L T;  2VQE T;  4X64 T;  4KHP T;  2UXD T;  2UXB T;  4DUY T;  2UUB T;  4JI7 T;  4JI1 T;  4DUZ T;  4LF8 T;  4DR5 T;  4K0K T;  1HR0 T;  4JI0 T;  2HHH T;  4B3S T;  3OTO T;  1IBM T;  1XMQ T;  1IBK T;  2UU9 T;  4AQY T;  4JI5 T;  4DV1 T;  4DV6 T;  2UXC T;  4DV5 T;  1HNW T;  4X65 T;  4GKJ T;  1HNZ T;  4X62 T;  4JV5 T;  4LF9 T;  5LMU T;  4JI8 T;  1HNX T;  4JI2 T;  3T1H T;  4LFC T;  4DV0 T;  5BR8 T;  4DR2 T;  4LF6 T;  2ZM6 T;  1XMO T;  4DR6 T;  1J5E T;  1XNR T;  2VQF T;  1I94 T;  4JI4 T;  4NXN T;  4GKK T;  1N33 T;  4LFA T;  1XNQ T;  4DR3 T;  4JI3 T;  4DR1 T;  4DV7 T;  2UUA T;  2F4V T;  4DR4 T;  4DV2 T;  4NXM T;  4OX9 T;  1N32 T;  1N34 T;  1IBL T; 
#chains in the Genus database with same CATH topology
 4OYJ A;  1SA0 E;  2WDQ A;  5KDM C;  4OFZ A;  2JMH A;  3CX7 B;  4F8H A;  2X68 A;  1X79 A;  3DTO A;  1I6Z A;  3CK6 A;  5IUX A;  4DR7 T;  4UEL A;  2NTY A;  1WCR A;  3BK9 A;  4JI6 T;  1W0A A;  3AAE B;  1EZ3 A;  3VR8 A;  3N2K E;  5L3G B;  3ZYM A;  4ZI2 C;  4ZI3 D;  4HFD A;  3C64 A;  3HKE E;  4DV3 T;  5JDM A;  5M4Y A;  3ONX A;  2Q9Q D;  4TUY E;  4A56 A;  4G63 A;  2XJ7 A;  2PTF A;  3QB5 K;  2EHO A;  1S35 A;  4H9N C;  3MA9 A;  2M6B A;  5LBQ B;  4DO0 A;  2H88 A;  5AQJ B;  4ZI7 E;  2WZI A;  4CI3 B;  2YN6 A;  4B6X A;  1N36 T;  3Q5D A;  3IF8 B;  2WY2 A;  2C5K T;  2FUP A;  3DJB A;  2VQE T;  2MPK A;  4YXD A;  4XAX B;  2X51 A;  4EAH A;  1XWM A;  1KFY A;  4ZS2 A;  1HF8 A;  2E9X C;  5HEO A;  3UT5 E;  2EHO D;  4PJJ A;  2UUB T;  4DUZ T;  4DR5 T;  5BMV E;  1HG5 A;  3AA0 B;  1Z8U A;  2KZ7 B;  5LGT B;  5CA1 E;  2E8I A;  4PK6 A;  2H89 A;  2LKH A;  2VKH A;  3GWH A;  2HPJ A;  4FJO A;  3PE0 A;  1HR0 T;  5EK4 A;  1YKH B;  2ACX A;  5AQG B;  3L8R A;  2D5U A;  2X0Y A;  5AQN B;  2V7I A;  4HEA A;  1D0Y A;  2PG8 A;  3I1A A;  2LSG A;  3JAF A;  2XHE B;  2XQ6 A;  2W2U A;  1Y64 B;  4GK5 E;  4HWF A;  2QGS A;  2WAU A;  4IE0 A;  3OVU A;  3AEF A;  3ANW B;  3PU3 A;  1BR1 A;  1BR4 A;  2CXD A;  2OV9 A;  3AXJ A;  2WMO A;  3M65 A;  3PU8 A;  3Q5W A;  4K0U A;  3F57 A;  5AQK B;  5EZY E;  4JI5 T;  2HN1 A;  4C90 A;  5LP6 E;  2CEA A;  2DNX A;  3UUL A;  1UK5 A;  2IUB A;  2WDR A;  2HPL A;  1OWA A;  3C4Z A;  1KK7 A;  2VL8 A;  2I59 A;  1D1C A;  3G06 A;  5ABH A;  2X66 A;  3E22 E;  4GKJ T;  1UX5 A;  3N9O A;  2LHN A;  5HXH A;  4X62 T;  5DQW A;  2Q9Q B;  5LG4 A;  4WYV A;  1HNX T;  1QUU A;  3HKD E;  5HXS A;  5JRC B;  5L4H A;  3V5S A;  5A1L A;  4ZOL E;  5AQU B;  3SRZ A;  1FEW A;  4EED A;  3T1H T;  5HCM A;  4E7S A;  4X20 E;  2YKS A;  2E9X A;  3AE6 A;  1ZOY A;  2R6G F;  2YEV C;  4QX7 B;  2XUE A;  3SS1 A;  3UFG A;  5LHG B;  3ONL C;  3QUJ A;  2OA5 A;  3O4X E;  3CWZ B;  3ONJ A;  3TLT A;  3KFW X;  3RC3 A;  4GIW A;  5L3F B;  3TKL B;  2A9U A;  3CX8 B;  2V6Y A;  4YTP A;  3D0T A;  3J7Y q;  4EZ4 A;  4DR2 T;  1HTJ F;  3RIF A;  4M1P A;  3AEC A;  2CLY B;  4GOU A;  1LVK A;  2VUR A;  2ZM6 T;  1T72 A;  2BBH A;  3ZCI A;  4TNV A;  4EB6 E;  1HS7 A;  4DBQ A;  3UU6 A;  1BR0 A;  2VAS A;  3OKQ A;  4TZ4 C;  4U31 A;  4NXN T;  4IT4 A;  2X9X A;  4JEH B;  1VCS A;  4MFR A;  5CB4 E;  4UEM A;  1ZP0 A;  4IL9 A;  5AQL B;  5FY7 A;  4HFC A;  3K3O A;  3N5L A;  3AVR A;  3I9W A;  1BR2 A;  3A7M A;  3S4U A;  4YJ3 E;  3RIU C;  2CCQ A;  2IW5 B;  4AQG A;  1IJ5 A;  4O4J E;  4LFA T;  3A8Y C;  2LOP A;  3ETV A;  5AQI B;  3CQG B;  4DID B;  3ZCJ A;  2ACZ A;  3AE9 A;  4PNI A;  4UXN B;  3RYF E;  3ZC1 A;  1D0X A;  2CM0 A;  5HEH A;  3LK4 2;  2UUA T;  4NUU A;  4QXH B;  3RLF F;  2WQY A;  3P7I A;  4TV8 E;  5HCJ A;  3PJA J;  4AKG A;  2D2S A;  4ADZ A;  4P0B A;  5LJM A;  3FZF B;  2XZE A;  2J47 A;  2Z6E A;  1W9R A;  2BG9 A;  1YQ3 A;  3PUA A;  5LHH B;  4IGU A;  1WRD A;  2YK0 A;  4WW0 A;  4OX9 T;  1UGO A;  1FIO A;  2LRK A;  1R8I A;  1N32 T;  2XAG B;  3O9X A;  2Q9Q A;  3C98 B;  5DAB A;  2VK9 A;  3P4W A;  2KND A;  5AQR B;  1ZV4 X;  2V1D B;  4OHF A;  3RQU A;  4DMV A;  3FZK B;  1NEK A;  2MAW A;  3BQI A;  3LBX A;  3R84 B;  2WBL A;  4UV8 B;  2CPT A;  2JJ9 A;  5FL0 A;  4B3T T;  1DU2 A;  4PJL A;  5JR9 C;  4LF7 T;  5C3J A;  5AQO B;  5IWA T;  2BKN A;  5C8Y E;  4LF4 T;  5JTG A;  3UU4 A;  3CQX C;  4L9I A;  2V5C A;  5LYJ E;  5LG3 A;  4B3M T;  3PUY F;  3OPC A;  4QX8 B;  3ZC0 A;  4B3R T;  1U5P A;  3KIN B;  5ABE A;  3N9M A;  3PTR B;  2L3L A;  4EGW A;  1IAP A;  3SOL A;  2H7V C;  3VU7 H;  2PBI A;  1KEY A;  4OK0 A;  4CN1 A;  4JYA T;  1X9B A;  2XQ4 A;  4HWI B;  4YY3 T;  2NTX A;  3R6N A;  3ZT6 A;  2MYS A;  3VHL A;  2BS2 A;  4TNW A;  3AAA B;  3BQK A;  4HKA A;  4IRE A;  3U3I A;  4U7I A;  2MTQ A;  3HKC E;  3UU8 A;  3UUB A;  4AXP A;  4WBN E;  2BKO A;  3PUS A;  3JC6 C;  3QK6 A;  4J2C A;  3ZST A;  4O4H E;  1WR0 A;  2IIU A;  3OYX A;  2BS3 A;  2KT9 A;  1UX4 A;  2XM1 A;  3ABV A;  1S94 A;  4HFV A;  4TWH A;  4IDZ A;  1J5W A;  4A97 A;  2UXD T;  1D1A A;  4IDN A;  3ZLI A;  4U2Y A;  4ASK A;  4DUY T;  2WS3 A;  3RI5 A;  5L4E A;  1ZKE A;  2V26 A;  3AAI A;  2W0G A;  1SUM B;  1ZEE A;  3AA6 B;  4GYS A;  4LF8 T;  5ABF B;  3WAJ A;  4LMJ A;  3CML A;  3CPZ A;  1WYC A;  2P9B A;  3BQL A;  3CX6 B;  3FZH B;  4IDO A;  2CBJ A;  3EAM A;  2VB6 A;  5FXZ A;  3ZKR A;  3ZEF B;  4UV9 B;  4DND A;  2HHH T;  4K0K T;  4WNK A;  3EDV A;  2E9X D;  2BG9 B;  2HN2 A;  3K1S A;  4IDQ A;  4P1N A;  1E7P A;  2V6Y B;  4ANJ A;  5CFB A;  2WCA A;  3PJA A;  5FYM A;  3QOF A;  4I0U A;  4AKH A;  2FJA A;  2VVS A;  2LSJ A;  4JLE A;  4JBW F;  5FVL A;  3SWH A;  2X9W A;  2FJE A;  2K9A A;  3KBT A;  4HE8 A;  2DL1 A;  2LHR A;  4UVB B;  1UUS A;  1VOM A;  1JNZ A;  1CUN A;  2A3D A;  3AA1 B;  4X65 T;  4KHZ F;  4C91 A;  1G8X A;  3EDU A;  5LOV E;  2W67 A;  3UUN A;  3NZQ A;  1KF6 A;  1HNZ T;  2BVL A;  2KWH A;  2KMF A;  3A5X A;  4H9S E;  4LF9 T;  1D1B A;  2E5V A;  4EYU A;  5J2T E;  3UU5 A;  1WLX A;  2D0U A;  2YU2 A;  4UIG A;  3ZMU B;  2JMK A;  4A98 A;  2G0U A;  5IHY A;  2LLY A;  2JRK A;  4LFC T;  4CXW A;  5L47 A;  3MXZ A;  1M7K A;  3ZYK A;  4DVD A;  2LRL A;  5FL1 A;  1E1H B;  3GN5 B;  4HWH A;  4DV0 T;  1MMD A;  1HCI A;  1VCT A;  2E2A A;  2ES0 A;  3EI0 A;  5FP3 A;  5H6Q B;  3CIR A;  3M3Z B;  4AKL A;  5KX5 E;  2ZM2 A;  4QWN B;  1MIV A;  2N1G A;  2YDQ A;  3WAK A;  5CA0 E;  1AJ3 A;  5FKY A;  1MIW A;  5HXE A;  3ZJ1 A;  4AQF C;  3B57 A;  3FXD B;  3MK7 C;  2X0H A;  3P4S A;  5FXW A;  5JDQ A;  1I94 T;  2LJL A;  2DWG A;  4G2A A;  5ABF A;  2IC6 A;  3ZJ2 A;  4BA9 A;  1KNZ A;  4IHJ E;  2CLY C;  3LJC A;  3IEE A;  1OED C;  2JIW A;  2MBG A;  4HFB A;  2CXF A;  4L0R A;  4X5T A;  3GA8 A;  3RYH E;  3LFM A;  4U2Z A;  3I9Y A;  2W61 A;  2ZLY A;  2NW9 A;  4UF0 A;  3KV9 A;  4JI3 T;  1T98 A;  2HH7 A;  3AE4 A;  4P09 A;  3RKO A;  4BAY B;  2C0S A;  4DV7 T;  4YHJ A;  3VKG A;  4JUY A;  4I50 E;  1V9D A;  4XBF B;  2VWA A;  2W4X A;  5DQV A;  2V6X A;  4QHO A;  4DR4 T;  1ZHC A;  2DWK A;  3PUG A;  1QLB A;  4DV2 T;  5EK2 A;  3Q5E A;  4ZI2 D;  1NAF A;  1CHU A;  3SFE A;  2E9X B;  2L8K A;  4P0A A;  2WSS V;  2XAH B;  4AQF A;  2V7M A;  5JRE A;  5IYZ E;  4YJ2 E;  5HXC A;  4CI1 B;  2W62 A;  4QXC B;  3P8C D;  2XAQ B;  5FMN A;  5FY1 A;  5LXT E;  2JQQ A;  3KBU A;  2KSR A;  3MJX A;  4HGA A;  5LBM A;  2A72 A;  3RIA A;  5LMN T;  3P4R A;  4I4T E;  3ZN1 B;  1NEN A;  2J62 A;  4GYR A;  3UUX B;  4EOZ B;  2KXP B;  2W00 A;  2WP9 A;  3EUH A;  2WZH A;  4LF5 T;  1WFD A;  4BJM A;  4MHC A;  4EIW A;  1FMV A;  2XQ5 A;  3Q5X A;  3LK2 B;  2LSI A;  2WWV A;  4LF6 T;  1T7S A;  2XQY A;  4ZXL A;  5L3C B;  3KV5 A;  4U72 A;  4DV4 T;  3T1Y T;  4F6R C;  1VRB A;  2EHO C;  5FY0 A;  4LML A;  1T8B A;  1SE7 A;  3VRA A;  3ZPO A;  3AXJ B;  3E0Z A;  4YTM A;  5JDF A;  4H9P C;  4DMW A;  2PJQ A;  2XSB A;  3ZT5 A;  2MOZ A;  3PUX F;  4EXT A;  4YHH T;  4AQY T;  5FVK A;  2CA5 A;  2DI4 A;  3P4Q A;  3H37 A;  4YT0 A;  2E5L T;  2LSK A;  4PJN A;  1UUR A;  2IHR 1;  2JQ9 A;  3P4P A;  4TN7 B;  4ZZB A;  3H3M A;  1YQ4 A;  4X64 T;  1US7 B;  4KHP T;  2V8S V;  4I43 B;  3E08 A;  3RIU A;  1QSD A;  1IJ6 A;  4OYK A;  3TLV A;  2V7J A;  3O1I A;  2AE9 A;  3L3P A;  4HN9 A;  2H3R A;  4JI1 T;  3KV6 A;  2N2N A;  3LSV A;  3RX6 A;  2ZM8 A;  3AE1 A;  3QB5 A;  3MKD A;  5KMG P;  4QH1 A;  3LG7 A;  1WYB A;  4O2B E;  1OXZ A;  2BS4 A;  3RH3 A;  3UTK A;  2BG9 E;  2CMR A;  2UXX B;  3UQ7 A;  1J1J A;  3AA7 B;  3F2E A;  3LDQ B;  2GK9 A;  3GN5 A;  5DJQ C;  1U4Q A;  2W66 A;  2X0L B;  3HA4 A;  3RHW A;  4ZHQ E;  5CGM A;  1W0B A;  4V1A v;  1M62 A;  3EHZ A;  4PFP A;  1IBM T;  1XMQ T;  2DCF A;  2J4G A;  2WU2 A;  4IE7 A;  5L3D B;  5JDN A;  4HFE A;  5LHI B;  3N2O A;  2UU9 T;  4A5X A;  1MNE A;  4IE5 A;  3AEE A;  2BZB A;  3T8O A;  4TX5 A;  1YKE B;  2NP9 A;  5LJN A;  4DV1 T;  5HAX A;  5L3E B;  2UXC T;  4ZZC A;  2CXL A;  4EYY R;  3ZN0 B;  2XTL A;  2SPC A;  4MBQ A;  1OED A;  2ODV A;  3FBL A;  4ILC A;  4N78 D;  2Y8D A;  1KNR A;  3B13 A;  4O4L E;  1D0Z A;  4TWD A;  4U7Y A;  5KXJ A;  5TAO A;  4TWF A;  4XZC A;  3AE8 A;  5L3B B;  1G73 A;  4EV6 A;  4HFH A;  2BBJ A;  5LMU T;  2IC9 A;  4JI8 T;  3PDY A;  3FZM B;  2WWU A;  3AE5 A;  4EZH A;  2B76 A;  4JI2 T;  5J1G A;  3WI3 A;  1LKX A;  4AKR B;  2WU5 A;  2CWO A;  1MMA A;  2LT3 A;  3AED A;  4X1K E;  1GQE A;  4O8S A;  3ZYL A;  4MAL A;  5HEU A;  2NWB A;  1MND A;  3AEA A;  3AEG A;  5L2L A;  1IBK T;  4UF0 B;  2QVA A;  3EVY A;  4IE6 A;  5BR8 T;  2M67 A;  2LEH A;  3RC8 A;  4AKI A;  3K8P C;  5JVD E;  4KX6 A;  3NBX X;  2XQ8 A;  3ETU A;  2VKJ A;  1XMO T;  5CJ5 A;  3RQW A;  3Q2M A;  4DR6 T;  2LSY A;  2XM2 A;  5JR9 B;  4BJN A;  4YSY A;  1YD8 G;  2C5I T;  2YOE A;  3KVB A;  5H6R B;  2CBI A;  3HL6 A;  4MLK A;  1Y01 A;  3I0Q A;  4KP3 C;  1L0V A;  4JI4 T;  5F5W A;  3K3Q C;  1H7C A;  1MIY A;  5LA6 E;  1KNP A;  1Z0P A;  3P50 A;  3PUQ A;  3QC9 A;  2XQ3 A;  5J0Z A;  4ILB A;  5LCY A;  3JCF A;  3GMI A;  5LGN B;  3VR9 A;  3ZMT B;  4EEB A;  5JQG E;  3RRW A;  2K48 A;  2X9H A;  4U3C A;  5HXR A;  4UR9 A;  5AQF B;  4KUM B;  4CI2 B;  4DR3 T;  4KMC A;  3AB3 B;  3L39 A;  4DR1 T;  2JQK A;  2JQH A;  2ODU A;  4WZX A;  4Z91 A;  4H9O C;  2N9D A;  2LM2 A;  1HFA A;  4PAG A;  3UUM A;  2XQ9 A;  4CZZ B;  5FXV A;  5C2T A;  4IST A;  5JH7 E;  4NXM T;  2QA7 A;  3PUR A;  3AE3 A;  2DLR A;  3RGL A;  1XZY A;  3ZSS A;  4YTN A;  3B5M A;  3ESL A;  1IBL T;  2UUC T;  4PK4 A;  3SFD A;  3O1H A;  3PUV F;  3RKG A;  3FXE B;  3CKD A;  1FJG T;  2FJB A;  4NPP A;  4IE4 A;  3NZP A;  5HEG A;  4NUV A;  2J1D G;  2V7K A;  3MAC A;  2AXD S;  2KIN B;  4IIJ E;  5ADX L;  4X66 T;  3O1J A;  1IZN B;  4O2A E;  2VKO A;  3ANW A;  4U33 A;  3RF1 A;  4IL4 A;  1SHZ C;  2I6H A;  1HX8 A;  3KV4 A;  3PUZ F;  5HYA A;  3U78 A;  3FB2 A;  4ZEY A;  1MMG A;  5JDG A;  2RP4 A;  5J2U E;  4GK0 E;  4ILA A;  4QKN A;  4ERR A;  3K3N A;  4E7Z A;  3TLU A;  3V5U A;  2VL0 A;  3Q9D A;  4H63 H;  2VKD A;  3AVS A;  3H3A A;  2NR4 A;  3NKZ A;  5E0O A;  3J9X 1;  2LE8 A;  2LKG A;  3RYC E;  5LNK A;  2BDE A;  2WM9 A;  3C51 A;  3CQC B;  4QH4 A;  5GON E;  3TLS A;  3ZMZ B;  2W63 A;  4KI0 F;  1O3X A;  3FBZ A;  2YDS A;  4CN6 A;  2C5J A;  3IBP A;  2OLT A;  2K5B B;  3F31 A;  3JAE A;  3N2G E;  4O4I E;  3UU3 A;  5F3J A;  2RPA A;  4PW8 A;  3N9L A;  2UXB T;  2M6I A;  2KWI B;  4H63 V;  5AQH B;  2YDR A;  4JI7 T;  4KBM B;  3LBX B;  5ABG A;  3LK3 B;  4UVC B;  2PFV A;  2K3W A;  1YW0 A;  5EK3 A;  2H7O A;  4TV9 E;  4H9R C;  4PFO A;  4YSX A;  4B3S T;  4JI0 T;  1XDO A;  4CXY A;  3JC6 D;  3I0O A;  3N9P A;  3OTO T;  4CN4 A;  4IDP A;  5HWX A;  5AQM B;  3N9Q A;  2JPF A;  2VVN A;  4NIQ A;  2BVM A;  3OYZ A;  4HFI A;  3DP7 A;  3C4W A;  3N9N A;  1NWM X;  5AFU L;  1FMW A;  4ILU A;  4WBO A;  4LMK A;  4ZI3 C;  2YU1 A;  3OJA A;  1LVF A;  1MMN A;  2CWY A;  4CXX A;  3ZMS B;  5JRC A;  4DV6 T;  3L09 A;  2CHN A;  2A2F X;  1HG2 A;  2Q9Q C;  2XSA A;  3KVA A;  4PK5 A;  4DV5 T;  1HNW T;  2Y48 B;  2XPK A;  1LRZ A;  2V7L A;  1B7T A;  3C4X A;  3HR0 A;  5FXX A;  5LB7 B;  3RPU A;  4JV5 T;  3NVO A;  2NW8 A;  4Q25 A;  4PJM A;  2ZMA A;  5AQS B;  4Z8X A;  3VRB A;  3CVR A;  3X1D A;  3IA3 A;  2XAF B;  4QXB B;  5JDL A;  4YSZ A;  2QRX A;  1OED B;  3PV0 F;  4AI6 A;  4HWC A;  1JNR A;  1W09 A;  5F8P A;  2KLQ A;  3MZK B;  4ISS A;  3RRC A;  3IHR A;  3TLW A;  3ZT7 A;  3AE7 A;  3QNU A;  4H9Q C;  5AQQ B;  2XQA A;  4HTE A;  5LGU B;  4YFS A;  2XY8 B;  2IML A;  2UXN B;  4Z90 A;  3W15 B;  2L9Q A;  5FNV E;  2WB5 A;  2D0T A;  4LFB T;  2EHO B;  2XAJ B;  3AE2 A;  2I0M A;  1YXR A;  2CHO A;  2YIN A;  1J5E T;  2B1E A;  4HWD A;  2D9D A;  1XNR T;  4CQI A;  5AQT B;  2VQF T;  2XQ7 A;  2QYW A;  3JAD A;  4UVA B;  3VKH A;  3HI2 A;  1HX1 B;  3NRX A;  4AIS A;  5ETW A;  4L5G A;  4GKK T;  2X67 A;  4X1Y E;  1E2A A;  2DHR A;  1N33 T;  2IDO B;  1OED E;  3ZMV B;  2WDV A;  1XDP A;  5HEJ A;  3RYI E;  2ZM0 A;  3PUW F;  4QH5 A;  2FJD A;  4I55 E;  5JR9 A;  1XNQ T;  3OBV E;  2Y6X A;  2RA1 A;  3AEB A;  3NRY A;  4COF A;  2CRB A;  4FI5 A;  2V5D A;  4U74 A;  4DBR A;  2XAS B;  5HWY A;  2NW7 A;  3C50 A;  2WMN A;  4JEU B;  2NOX A;  3EAB A;  2F4V T;  4X1I E;  4YLH A;  3FZL B;  2K24 A;  1WR6 A;  2LOS A;  5AQP B;  3UQ4 A;  4AIU A;  2BG9 C;  2IAK A;  5JDH A;  5AQV B;  2BKP A;  2LM9 A;  2X9Y A;  2CE7 A;  3KDS E;  1N34 T;  2FBW A;  3NWI A;  4ZS3 A;  3FHN A;  3UFE A;  1UCU A;  3HKB E; 
#chains in the Genus database with same CATH homology
 2UUC T;  1FJG T;  5LMN T;  4B3T T;  4DR7 T;  4LF7 T;  5IWA T;  4X66 T;  4JI6 T;  4LF5 T;  4LF4 T;  4B3M T;  4B3R T;  4DV3 T;  4DV4 T;  3T1Y T;  4YHH T;  4YY3 T;  1N36 T;  4JYA T;  4LFB T;  2E5L T;  2VQE T;  4X64 T;  4KHP T;  2UXD T;  2UXB T;  4DUY T;  2UUB T;  4JI7 T;  4JI1 T;  4DUZ T;  4LF8 T;  4DR5 T;  4K0K T;  1HR0 T;  4JI0 T;  2HHH T;  4B3S T;  3OTO T;  1IBM T;  1XMQ T;  1IBK T;  2UU9 T;  4AQY T;  4JI5 T;  4DV1 T;  4DV6 T;  2UXC T;  4DV5 T;  1HNW T;  4X65 T;  4GKJ T;  1HNZ T;  4X62 T;  4JV5 T;  4LF9 T;  5LMU T;  4JI8 T;  1HNX T;  4JI2 T;  3T1H T;  4LFC T;  4DV0 T;  5BR8 T;  4DR2 T;  4LF6 T;  2ZM6 T;  1XMO T;  4DR6 T;  1J5E T;  1XNR T;  2VQF T;  1I94 T;  4JI4 T;  4NXN T;  4GKK T;  1N33 T;  4LFA T;  1XNQ T;  4DR3 T;  4JI3 T;  4DR1 T;  4DV7 T;  2UUA T;  2F4V T;  4DR4 T;  4DV2 T;  4NXM T;  4OX9 T;  1N32 T;  1N34 T;  1IBL T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...