4AQYT

Structure of ribosome-apramycin complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4aqyT00
1IBLT 2F4VT 4LFAT 4X62T 5BR8T 2UUCT 4DV4T 2E5LT 4DV5T 1N36T 1N32T 4LF4T 4LF5T 3T1HT 4DR2T 4GKJT 1HNWT 4B3ST 1FJGT 4DUYT 4JI2T 4DR3T 4GKKT 1XMQT 4OX9T 4DV1T 4LF9T 2UXDT 4JV5T 2UXBT 2UUBT 4K0KT 4NXMT 4DV6T 4B3TT 5LMUT 1N34T 4X64T 4JI7T 4DR4T 2HHHT 4JI4T 1J5ET 1XNRT 2VQET 1HNZT 4LFBT 4DR1T 4LF8T 4DV2T 4JI6T 4LF6T 4DR7T 4B3RT 1IBMT 4X66T 5LMNT 4JI5T 4KHPT 4JI8T 4NXNT 2UUAT 4LF7T 3OTOT 1XMOT 4DUZT 4LFCT 1HNXT 2UXCT 4JI0T 4JI3T 4DV0T 1IBKT 4JYAT 4DR5T 1XNQT 4AQYT 4YY3T 5IWAT 4DR6T 4DV7T 4YHHT 4B3MT 2UU9T 4DV3T 2ZM6T 4X65T 1I94T 3T1YT 1HR0T 2VQFT 1N33T 4JI1T
chains in the Genus database with same CATH superfamily
4GK5E 3O1HA 1W09A 1MMDA 5BR8T 2WS3A 2WAUA 3RLFF 1N36T 2WU2A 2WB5A 1IZNB 4LMJA 3VR8A 4ZZBA 2IC9A 5FXVA 3ZSSA 3TLSA 3MACA 2CHOA 4TNVA 2EHOC 2PFVA 4B3ST 3KVBA 3WI3A 3W15B 3ONXA 1HG5A 3RRCA 5HEUA 4JV5T 3I1AA 3U3IA 4DV6T 3CX8B 5HEOA 2OV9A 4UV8B 4UVBB 3PJAA 5ABFB 4YSXA 2E9XA 1YKEB 4LF6T 4NPPA 2GK9A 3AAIA 3PV0F 3UUBA 4IE6A 3QOFA 3F31A 4LF7T 3AE8A 5AQRB 2MYSA 2UXCT 4PW8A 3N9MA 4B6XA 2LHRA 4UVCB 4ANJA 3GA8A 5HAXA 4IHJE 5AQMB 2H88A 2H7OA 4Q25A 2PBIA 4DR6T 2CM0A 4PFOA 4CN6A 1FMWA 3T1YT 1VRBA 4KBMB 1N33T 2V6YA 1HX1B 4IL4A 2CXFA 3P7IA 2UXNB 5HEJA 4WZXA 4DV4T 3TLVA 2V7MA 3WAJA 3RIFA 4LF4T 2YDRA 3SFDA 3OKQA 5IYZE 4TWFA 1WR0A 3MKDA 2JQ9A 1WCRA 2JMKA 3ZYLA 3ESLA 4LF9T 1YW0A 1KF6A 2HH7A 4AI6A 1UURA 4YSZA 2WZHA 1FMVA 3HKEE 3N5LA 1DU2A 4COFA 4YT0A 2WU5A 4JI7T 2C5IT 2VKJA 4EIWA 3V5SA 4OYJA 4CZZB 2W61A 3ZJ1A 4X1IE 3ZJ2A 4MFRA 4AKLA 3KDSE 1Y01A 3B57A 4G2AA 2N1GA 1HG2A 3IF8B 5FL1A 2KWHA 2A3DA 3CIRA 5AQJB 5J2TE 2C0SA 5ADXL 2ODVA 4WYVA 1S35A 3P50A 2FJDA 1X79A 2P9BA 3C4ZA 1BR4A 4ZEYA 1D0XA 1ZOYA 1QUUA 2CCQA 3UU8A 4JBWF 5FY7A 1XNQT 4PNIA 5LOVE 4AQYT 3SFEA 4YJ2E 1KEYA 3PUGA 3ZEFB 4JEHB 5LBMA 4QH5A 5DABA 2BKPA 3N9OA 4HWCA 2CWYA 2BG9C 3PDYA 5LHGB 1T72A 3T1HT 2IC6A 5F5WA 3VRAA 5HXEA 4HFHA 4KMCA 3B5MA 4FI5A 5C3JA 5A1LA 4ISTA 2KXPB 2Q9QD 5LG4A 2UXDT 2X66A 2VB6A 3H3MA 3UULA 2UXBT 3QUJA 3EDUA 1W0BA 5L3GB 4O8SA 4UF0B 2FJBA 4UV9B 2WDVA 2DWGA 3JC6D 2CPTA 4UELA 1BR2A 2ZM2A 1SE7A 3A7MA 1KK7A 2VKDA 4JI6T 2HPLA 2BBJA 1S94A 5HCJA 3N2GE 4X66T 2KLQA 2E2AA 3KINB 2UUAT 4HFVA 4TV9E 5ETWA 4BA9A 3VHLA 2V8SV 3ZMSB 2J47A 5HEGA 3J9X1 1Y64B 1BR0A 2XQ9A 2R6GF 4IE4A 2XAGB 5FY1A 2VURA 4GYRA 1LKXA 2M6BA 4JEUB 4HKAA 3GWHA 3M3ZB 2WBLA 4TWDA 2YN6A 2WM9A 2CWOA 3T8OA 2QYWA 5ABHA 3PUSA 3EI0A 4A5XA 5L4HA 4H9QC 2KZ7B 2CA5A 2V26A 2E5VA 5ABFA 4OFZA 2Q9QC 4CI3B 4QXHB 2MPKA 5EK2A 4UXNB 3GN5A 4DMWA 4GKKT 3ETVA 2V5DA 2CRBA 1KNZA 1ZV4X 3I9YA 1M62A 4YTNA 3K3NA 2V5CA 4P0AA 4PAGA 3PTRB 2DI4A 5AQTB 5L3EB 4TV8E 3J7Yq 1NENA 1N34T 4U33A 3RX6A 3QB5A 3UU5A 3EVYA 1CHUA 3AE3A 2LSGA 3SWHA 2DL1A 3JAEA 2YOEA 4H9SE 2BS4A 5LGUB 2LOSA 1Z0PA 3RC3A 4WBNE 3OTOT 1XMOT 4CXYA 4LFCT 4XAXB 3RKGA 3NVOA 4JI0T 5KXJA 5JREA 2D0TA 4DR5T 2LKGA 5L2LA 3RYFE 2B76A 4H63V 2C5KT 4PJLA 2IAKA 2XQ4A 4UEMA 2ZM6T 4PK6A 5L3BB 4U7YA 2ACXA 1ZP0A 1FEWA 4P0BA 3CQXC 4YLHA 3MXZA 3R6NA 2V7LA 4U2YA 4GOUA 2WDRA 3P4SA 2OLTA 4O4IE 2ZM0A 3FZMB 5EK4A 3WAKA 2IHR1 1L0VA 5HXSA 4O2AE 2E9XD 3TKLB 5AQKB 3AE7A 3H37A 2LSIA 2IUBA 1WFDA 4HFEA 3UU4A 4DR7T 4QKNA 3AEBA 2Y8DA 5JQGE 5JR9C 2JQQA 4MALA 3K3QC 2W66A 3OYXA 2HPJA 1R8IA 1XWMA 3BQIA 5J1GA 3RYCE 3ZCJA 5LJMA 4AQGA 4EXTA 3PUQA 4H9NC 3LK3B 5F8PA 2QGSA 1VCSA 4IDZA 2CBJA 4YY3T 1MMGA 2CEAA 3ONJA 5KDMC 1HR0T 3JCFA 5FXZA 3CPZA 3FZLB 4LF5T 4EYUA 4EOZB 4QH4A 1UUSA 4QH1A 1HFAA 2BG9B 2NW7A 3CWZB 2I59A 1MIVA 2PJQA 4IE5A 5LYJE 4H63H 2J1DG 2L9QA 5JH7E 1XDPA 4JUYA 4KUMB 3TLTA 4AKHA 3HR0A 4OYKA 2CBIA 3VKHA 3ZPOA 2AXDS 2HHHT 4EGWA 3KFWX 4DV2T 3QNUA 4IDNA 2WWVA 4QHOA 5FP3A 3OBVE 5LCYA 4HN9A 3I0OA 2LRLA 3A8YC 4MHCA 1W0AA 5FVLA 4DUZT 3ANWB 4QX7B 4CXWA 5LB7B 3TLWA 2X9HA 1OEDA 5HEHA 4HWDA 5CA1E 4EYYR 3AXJA 2IMLA 3NKZA 4YHHT 4DV3T 2WMOA 3P4PA 2N2NA 4L9IA 3U78A 2EHOA 3OYZA 1YQ3A 2KWIB 4E7ZA 2XQ3A 5IUXA 2LSYA 4DV5T 2QA7A 4DVDA 2X51A 2LOPA 2YKSA 2ZLYA 5JVDE 4HFBA 3E0ZA 3AA7B 3VR9A 2DCFA 4EEDA 1JNZA 1MMNA 4ASKA 4J2CA 1ZHCA 4KX6A 4DO0A 2V7KA 4K0KT 3QC9A 2Q9QB 4N78D 3Q5DA 2YDQA 1AJ3A 2XJ7A 5LHHB 4YTMA 3LBXB 5DQVA 4OHFA 3ZKRA 2FJEA 3FHNA 4NUUA 3SOLA 1SHZC 2YEVC 4IDQA 4LFBT 5LHIB 3K3OA 2BDEA 5AQLB 3UUMA 3HA4A 2JQHA 4ZOLE 5L3DB 5M4YA 2PG8A 3UU3A 4NXNT 3UQ4A 3AA1B 4JYAT 3SS1A 2SPCA 2LKHA 3RRWA 5LGTB 3TLUA 3KVAA 3AVSA 2H89A 2DHRA 4IDPA 4JI1T 2H3RA 5HXRA 1KFYA 4X62T 2K24A 4M1PA 2JPFA 1GQEA 3MZKB 2V6XA 4EZ4A 3CKDA 4DNDA 1WYBA 2H7VC 1X9BA 4DR2T 1SA0E 3UT5E 4NUVA 1LVKA 1US7B 4HTEA 3FZKB 2KT9A 3ZN1B 3HKCE 2LSKA 4UIGA 3RH3A 2W62A 3PUVF 5AQFB 4EZHA 3A5XA 1YQ4A 4JI4T 3CMLA 3N2OA 3NZPA 2BKNA 3RI5A 3E08A 4YXDA 4B3RT 5LMNT 4Z90A 1V9DA 4P1NA 2VVSA 3AA6B 2Y6XA 1T98A 2XQ5A 5JR9B 4I50E 3AE1A 1LVFA 4ZI3D 5KX5E 5IHYA 1KNRA 3P4RA 5L3FB 2ES0A 2A72A 3ZC1A 3KV4A 4YHJA 1XDOA 5JRCB 3BQLA 2BG9A 3Q9DA 2XHEB 1OEDE 5AQNB 2K5BB 2YU2A 3AA0B 3P4QA 2VQFT 2YU1A 4YTPA 1MIWA 2YDSA 4H9RC 4LFAT 2XUEA 4PK4A 3KV6A 3Q2MA 4C90A 3ZMTB 2ODUA 3PJAJ 2NW8A 4PJMA 2NWBA 3ZN0B 1FJGT 3BQKA 4DUYT 2XAQB 1UX4A 1XMQT 3CQGB 4DV1T 2BKOA 2MOZA 1G73A 3RKOA 3EHZA 3MK7C 3CX7B 2WY2A 3AVRA 3RPUA 2PTFA 2DNXA 1HCIA 2VL0A 2XSBA 3NWIA 1MNEA 2VL8A 1VCTA 1J5ET 4LF8T 3RYHE 2E9XB 2B1EA 3PU8A 3Q5EA 1LRZA 2KSRA 2XQYA 3BK9A 3JC6C 3E22E 1HNXT 2ZM8A 5EK3A 4ZI3C 2NTYA 3AE6A 4HEAA 4UR9A 4C91A 3F2EA 2BS3A 4ILBA 4U3CA 2X0YA 4BAYB 2YK0A 5C2TA 4BJNA 4H9PC 2Y48B 3X1DA 1U5PA 2E8IA 2VWAA 2Q9QA 2FUPA 2BVLA 3AE2A 1T7SA 4ZZCA 3ABVA 5JDLA 1CUNA 2WWUA 3CQCB 3ZT5A 3KV9A 4WBOA 1NEKA 1J1JA 4PFPA 3KV5A 2QVAA 3HKDE 5JDHA 2W2UA 4AQFC 4IIJE 4QXBB 5FY0A 5HWXA 3FXEB 2K48A 2VVNA 4IE0A 2BBHA 4QWNB 4TX5A 1XNRT 4P09A 4ZI7E 3VU7H 2LRKA 2RP4A 3N9NA 1WLXA 1HTJF 2V7IA 3RIUC 5FYMA 3N2KE 3AEDA 4ZS3A 1EZ3A 5L47A 3O9XA 4IREA 5HXCA 3IHRA 2XASB 4IT4A 3C4XA 4EAHA 2LJLA 3O1JA 1IBKT 4FJOA 3FXDB 3UUNA 4AISA 5LA6E 3O4XE 3NRXA 3N9QA 3K1SA 3AB3B 1QSDA 3VRBA 3LK2B 3PURA 1YKHB 2BS2A 2D5UA 4F6RC 2W4XA 5JDGA 5LJNA 5CA0E 2AE9A 1I94T 1D1AA 2EHOD 3PUZF 5L3CB 2LLYA 1YXRA 3EABA 2BVMA 2BG9E 3CVRA 3AECA 2KNDA 3AEGA 2XY8B 2LE8A 5FXXA 4ERRA 5CGMA 2XQ8A 5ABGA 1HNWT 5GONE 3RC8A 4TNWA 5LBQB 3UTKA 5JDFA 5H6QB 2IW5B 2XM2A 2X9XA 4UF0A 4B3TT 4QXCB 1HF8A 1HX8A 2L8KA 5JR9A 3V5UA 5J2UE 2XQ6A 4O4HE 5AFUL 2J4GA 2ZMAA 3LSVA 3MJXA 4AKRB 4AKGA 4XBFB 2YINA 5JRCA 2N9DA 2Z6EA 3C4WA 2LM9A 3H3AA 3R84B 4ILAA 3P4WA 4PK5A 1G8XA 2DWKA 2E9XC 2VKOA 3UU6A 4GK0E 5CB4E 4CI2B 2QRXA 1B7TA 3NRYA 3EAMA 4IE7A 3VKGA 1O3XA 3RGLA 5HCMA 2LSJA 4U31A 1MNDA 2VKHA 3P8CD 4ILCA 2XAHB 2E5LT 2RPAA 1XZYA 4G63A 2JMHA 3RHWA 3PU3A 3C50A 5C8YE 4Z8XA 1WYCA 3EUHA 5BMVE 3GN5B 2V7JA 4F8HA 3QK6A 1KNPA 2CMRA 2CLYC 4AKIA 5LNKA 3ONLC 4NXMT 4GYSA 2BZBA 1D1CA 1M7KA 4HWIB 3ZC0A 4HGAA 2XPKA 2VQET 4DR1T 4CXXA 3OPCA 3FBZA 1D0YA 3ZT6A 1OWAA 5AQOB 4JI5T 1UK5A 2G0UA 2W67A 3ZMZB 3AEEA 2MAWA 5FNVE 4ZXLA 3D0TA 3NZQA 3RQUA 4TUYE 3RIAA 2KINB 4GIWA 5AQVB 5AQGB 3L8RA 2XSAA 3FBLA 3I9WA 2NW9A 1MIYA 1NAFA 2OA5A 2UU9T 5FVKA 4KI0F 3UQ7A 2WP9A 2CHNA 1QLBA 4KP3C 2I6HA 4Z91A 2JJ9A 2FJAA 4GKJT 2L3LA 3IA3A 2A9UA 1D1BA 1ZKEA 4I4TE 5FL0A 3HI2A 4JI2T 4L5GA 1FIOA 4DR3T 4PJJA 5JTGA 3AE5A 3M65A 5KMGP 1WR6A 4U7IA 5HXHA 3GMIA 3UFGA 2LHNA 2XM1A 5LMUT 2NR4A 5FXWA 3ZT7A 1JNRA 4I43B 1H7CA 3C64A 4EB6E 4DR4T 4A98A 4DBRA 2JRKA 1HNZT 3QB5K 1Z8UA 3AE4A 1J5WA 1IAPA 2NP9A 3AEFA 2C5JA 4QX8B 3ZMVB 5AQUB 2X68A 3SRZA 3FZHB 1YD8G 4JI3T 3AAEB 2A2FX 1OXZA 2J62A 4TWHA 4HWFA 5JDMA 2M67A 4PJNA 5IWAT 5EZYE 5LP6E 5JDQA 4B3MT 2IDOB 3F57A 4I55E 2FBWA 2HN2A 2VK9A 2X0LB 3O1IA 2XAJB 2UUCT 4CN1A 4MLKA 3C98B 3ZSTA 4TN7B 3MA9A 1ZEEA 1SUMB 3IBPA 4MBQA 5JDNA 5LG3A 4YJ3E 4OK0A 1VOMA 2WMNA 4A97A 2RA1A 4EV6A 3I0QA 3AAAB 2UUBT 2K9AA 3B13A 3ETUA 5TAOA 4K0UA 5ABEA 4X1YE 3K8PC 2W63A 4H9OC 1NWMX 1E1HB 5E0OA 2JIWA 4U74A 4CN4A 1IBMT 4JI8T 4O2BE 1D0ZA 2XZEA 3ANWA 5HYAA 4HE8A 5LXTE 3PUXF 4ZHQE 2X0HA 1OEDB 4X20E 2JQKA 3JADA 2WZIA 4ISSA 5AQHB 3L39A 4JLEA 2CE7A 3AXJB 2LT3A 4CI1B 4DV7T 4AXPA 2XAFB 3N9LA 3RQWA 1IJ6A 2NTXA 4X65T 1HS7A 4TZ4C 2XTLA 3Q5WA 2X9YA 5DJQC 2EHOB 4EEBA 1N32T 4ZS2A 2IIUA 4XZCA 2V1DB 5L4EA 3AEAA 3G06A 4O4JE 4AIUA 4E7SA 3ZMUB 2VASA 2V6YB 1WRDA 3DP7A 3KBTA 3PE0A 3OVUA 1UX5A 4HFIA 2X9WA 2D9DA 2UXXB 5AQSB 3LBXA 4CQIA 4IDOA 2I0MA 2KMFA 2CLYB 5DQWA 3EDVA 3OJAA 3LJCA 4HFDA 4U2ZA 5H6RB 4DIDB 4O4LE 3L3PA 4KHZF 4ZI2D 1E2AA 2NOXA 4BJMA 1W9RA 4X1KE 4DMVA 3KBUA 3HKBE 4X5TA 3JAFA 5CJ5A 4U72A 3UUXB 4LMLA 3RF1A 2WQYA 3L09A 2X67A 3ZLIA 4NIQA 5LGNB 3FB2A 4ADZA 4A56A 2LEHA 3ZYMA 5FMNA 2WDQA 1IBLT 1UGOA 2F4VT 3PUAA 3NBXX 4ILUA 3PUYF 3AE9A 4WNKA 1UCUA 1U4QA 4AQFA 2W00A 3Q5XA 2M6IA 1T8BA 2CXLA 4HWHA 3LG7A 1E7PA 2CXDA 5AQPB 3HL6A 4I0UA 4WW0A 4OX9T 3LK42 4IL9A 3CK6A 3C51A 2MBGA 1I6ZA 2ACZA 4L0RA 3ZYKA 1IJ5A 5J0ZA 4X64T 3RIUA 2WCAA 4IGUA 2XQ7A 5HWYA 2W0GA 3DTOA 5AQIB 3RYIE 2WSSV 5FKYA 1BR1A 4ZI2C 3CX6B 3FZFB 5AQQB 1MMAA 2DLRA 4KHPT 2MTQA 3LFMA 2D0UA 2XQAA 3DJBA 3LDQB 5F3JA 3N9PA 4UVAB 4DV0T 5CFBA 3S4UA 2D2SA 4LMKA 2HN1A 4DBQA 4V1Av 2K3WA 4HFCA 3UFEA 3ZCIA 4YSYA 3IEEA 1OEDC 4YFSA 2LM2A 3PUWF
chains in the Genus database with same CATH topology
1IBLT 2F4VT 4LFAT 4X62T 5BR8T 2UUCT 4DV4T 2E5LT 4DV5T 1N36T 1N32T 4LF4T 4LF5T 3T1HT 4DR2T 4GKJT 1HNWT 4B3ST 1FJGT 4DUYT 4JI2T 4DR3T 4GKKT 1XMQT 4OX9T 4DV1T 4LF9T 2UXDT 4JV5T 2UXBT 2UUBT 4K0KT 4NXMT 4DV6T 4B3TT 5LMUT 1N34T 4X64T 4JI7T 4DR4T 2HHHT 4JI4T 1J5ET 1XNRT 2VQET 1HNZT 4LFBT 4DR1T 4LF8T 4DV2T 4JI6T 4LF6T 4DR7T 4B3RT 1IBMT 4X66T 5LMNT 4JI5T 4KHPT 4JI8T 4NXNT 2UUAT 4LF7T 3OTOT 1XMOT 4DUZT 4LFCT 1HNXT 2UXCT 4JI0T 4JI3T 4DV0T 1IBKT 4JYAT 4DR5T 1XNQT 4AQYT 4YY3T 5IWAT 4DR6T 4DV7T 4YHHT 4B3MT 2UU9T 4DV3T 2ZM6T 4X65T 1I94T 3T1YT 1HR0T 2VQFT 1N33T 4JI1T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBL T;  2F4V T;  4LFA T;  4X62 T;  5BR8 T;  2UUC T;  4DV4 T;  2E5L T;  4DV5 T;  1N36 T;  1N32 T;  4LF4 T;  4LF5 T;  3T1H T;  4DR2 T;  4GKJ T;  1HNW T;  4B3S T;  1FJG T;  4DUY T;  4JI2 T;  4DR3 T;  4GKK T;  1XMQ T;  4OX9 T;  4DV1 T;  4LF9 T;  2UXD T;  4JV5 T;  2UXB T;  2UUB T;  4K0K T;  4NXM T;  4DV6 T;  4B3T T;  5LMU T;  1N34 T;  4X64 T;  4JI7 T;  4DR4 T;  2HHH T;  4JI4 T;  1J5E T;  1XNR T;  2VQE T;  1HNZ T;  4LFB T;  4DR1 T;  4LF8 T;  4DV2 T;  4JI6 T;  4LF6 T;  4DR7 T;  4B3R T;  1IBM T;  4X66 T;  5LMN T;  4JI5 T;  4KHP T;  4JI8 T;  4NXN T;  2UUA T;  4LF7 T;  3OTO T;  1XMO T;  4DUZ T;  4LFC T;  1HNX T;  2UXC T;  4JI0 T;  4JI3 T;  4DV0 T;  1IBK T;  4JYA T;  4DR5 T;  1XNQ T;  4AQY T;  4YY3 T;  5IWA T;  4DR6 T;  4DV7 T;  4YHH T;  4B3M T;  2UU9 T;  4DV3 T;  2ZM6 T;  4X65 T;  1I94 T;  3T1Y T;  1HR0 T;  2VQF T;  1N33 T;  4JI1 T; 
#chains in the Genus database with same CATH topology
 4GK5 E;  3O1H A;  1W09 A;  1MMD A;  5BR8 T;  2WS3 A;  2WAU A;  3RLF F;  1N36 T;  2WU2 A;  2WB5 A;  1IZN B;  4LMJ A;  3VR8 A;  4ZZB A;  2IC9 A;  5FXV A;  3ZSS A;  3TLS A;  3MAC A;  2CHO A;  4TNV A;  2EHO C;  2PFV A;  4B3S T;  3KVB A;  3WI3 A;  3W15 B;  3ONX A;  1HG5 A;  3RRC A;  5HEU A;  4JV5 T;  3I1A A;  3U3I A;  4DV6 T;  3CX8 B;  5HEO A;  2OV9 A;  4UV8 B;  4UVB B;  3PJA A;  5ABF B;  4YSX A;  2E9X A;  1YKE B;  4LF6 T;  4NPP A;  2GK9 A;  3AAI A;  3PV0 F;  3UUB A;  4IE6 A;  3QOF A;  3F31 A;  4LF7 T;  3AE8 A;  5AQR B;  2MYS A;  2UXC T;  4PW8 A;  3N9M A;  4B6X A;  2LHR A;  4UVC B;  4ANJ A;  3GA8 A;  5HAX A;  4IHJ E;  5AQM B;  2H88 A;  2H7O A;  4Q25 A;  2PBI A;  4DR6 T;  2CM0 A;  4PFO A;  4CN6 A;  1FMW A;  3T1Y T;  1VRB A;  4KBM B;  1N33 T;  2V6Y A;  1HX1 B;  4IL4 A;  2CXF A;  3P7I A;  2UXN B;  5HEJ A;  4WZX A;  4DV4 T;  3TLV A;  2V7M A;  3WAJ A;  3RIF A;  4LF4 T;  2YDR A;  3SFD A;  3OKQ A;  5IYZ E;  4TWF A;  1WR0 A;  3MKD A;  2JQ9 A;  1WCR A;  2JMK A;  3ZYL A;  3ESL A;  4LF9 T;  1YW0 A;  1KF6 A;  2HH7 A;  4AI6 A;  1UUR A;  4YSZ A;  2WZH A;  1FMV A;  3HKE E;  3N5L A;  1DU2 A;  4COF A;  4YT0 A;  2WU5 A;  4JI7 T;  2C5I T;  2VKJ A;  4EIW A;  3V5S A;  4OYJ A;  4CZZ B;  2W61 A;  3ZJ1 A;  4X1I E;  3ZJ2 A;  4MFR A;  4AKL A;  3KDS E;  1Y01 A;  3B57 A;  4G2A A;  2N1G A;  1HG2 A;  3IF8 B;  5FL1 A;  2KWH A;  2A3D A;  3CIR A;  5AQJ B;  5J2T E;  2C0S A;  5ADX L;  2ODV A;  4WYV A;  1S35 A;  3P50 A;  2FJD A;  1X79 A;  2P9B A;  3C4Z A;  1BR4 A;  4ZEY A;  1D0X A;  1ZOY A;  1QUU A;  2CCQ A;  3UU8 A;  4JBW F;  5FY7 A;  1XNQ T;  4PNI A;  5LOV E;  4AQY T;  3SFE A;  4YJ2 E;  1KEY A;  3PUG A;  3ZEF B;  4JEH B;  5LBM A;  4QH5 A;  5DAB A;  2BKP A;  3N9O A;  4HWC A;  2CWY A;  2BG9 C;  3PDY A;  5LHG B;  1T72 A;  3T1H T;  2IC6 A;  5F5W A;  3VRA A;  5HXE A;  4HFH A;  4KMC A;  3B5M A;  4FI5 A;  5C3J A;  5A1L A;  4IST A;  2KXP B;  2Q9Q D;  5LG4 A;  2UXD T;  2X66 A;  2VB6 A;  3H3M A;  3UUL A;  2UXB T;  3QUJ A;  3EDU A;  1W0B A;  5L3G B;  4O8S A;  4UF0 B;  2FJB A;  4UV9 B;  2WDV A;  2DWG A;  3JC6 D;  2CPT A;  4UEL A;  1BR2 A;  2ZM2 A;  1SE7 A;  3A7M A;  1KK7 A;  2VKD A;  4JI6 T;  2HPL A;  2BBJ A;  1S94 A;  5HCJ A;  3N2G E;  4X66 T;  2KLQ A;  2E2A A;  3KIN B;  2UUA T;  4HFV A;  4TV9 E;  5ETW A;  4BA9 A;  3VHL A;  2V8S V;  3ZMS B;  2J47 A;  5HEG A;  3J9X 1;  1Y64 B;  1BR0 A;  2XQ9 A;  2R6G F;  4IE4 A;  2XAG B;  5FY1 A;  2VUR A;  4GYR A;  1LKX A;  2M6B A;  4JEU B;  4HKA A;  3GWH A;  3M3Z B;  2WBL A;  4TWD A;  2YN6 A;  2WM9 A;  2CWO A;  3T8O A;  2QYW A;  5ABH A;  3PUS A;  3EI0 A;  4A5X A;  5L4H A;  4H9Q C;  2KZ7 B;  2CA5 A;  2V26 A;  2E5V A;  5ABF A;  4OFZ A;  2Q9Q C;  4CI3 B;  4QXH B;  2MPK A;  5EK2 A;  4UXN B;  3GN5 A;  4DMW A;  4GKK T;  3ETV A;  2V5D A;  2CRB A;  1KNZ A;  1ZV4 X;  3I9Y A;  1M62 A;  4YTN A;  3K3N A;  2V5C A;  4P0A A;  4PAG A;  3PTR B;  2DI4 A;  5AQT B;  5L3E B;  4TV8 E;  3J7Y q;  1NEN A;  1N34 T;  4U33 A;  3RX6 A;  3QB5 A;  3UU5 A;  3EVY A;  1CHU A;  3AE3 A;  2LSG A;  3SWH A;  2DL1 A;  3JAE A;  2YOE A;  4H9S E;  2BS4 A;  5LGU B;  2LOS A;  1Z0P A;  3RC3 A;  4WBN E;  3OTO T;  1XMO T;  4CXY A;  4LFC T;  4XAX B;  3RKG A;  3NVO A;  4JI0 T;  5KXJ A;  5JRE A;  2D0T A;  4DR5 T;  2LKG A;  5L2L A;  3RYF E;  2B76 A;  4H63 V;  2C5K T;  4PJL A;  2IAK A;  2XQ4 A;  4UEM A;  2ZM6 T;  4PK6 A;  5L3B B;  4U7Y A;  2ACX A;  1ZP0 A;  1FEW A;  4P0B A;  3CQX C;  4YLH A;  3MXZ A;  3R6N A;  2V7L A;  4U2Y A;  4GOU A;  2WDR A;  3P4S A;  2OLT A;  4O4I E;  2ZM0 A;  3FZM B;  5EK4 A;  3WAK A;  2IHR 1;  1L0V A;  5HXS A;  4O2A E;  2E9X D;  3TKL B;  5AQK B;  3AE7 A;  3H37 A;  2LSI A;  2IUB A;  1WFD A;  4HFE A;  3UU4 A;  4DR7 T;  4QKN A;  3AEB A;  2Y8D A;  5JQG E;  5JR9 C;  2JQQ A;  4MAL A;  3K3Q C;  2W66 A;  3OYX A;  2HPJ A;  1R8I A;  1XWM A;  3BQI A;  5J1G A;  3RYC E;  3ZCJ A;  5LJM A;  4AQG A;  4EXT A;  3PUQ A;  4H9N C;  3LK3 B;  5F8P A;  2QGS A;  1VCS A;  4IDZ A;  2CBJ A;  4YY3 T;  1MMG A;  2CEA A;  3ONJ A;  5KDM C;  1HR0 T;  3JCF A;  5FXZ A;  3CPZ A;  3FZL B;  4LF5 T;  4EYU A;  4EOZ B;  4QH4 A;  1UUS A;  4QH1 A;  1HFA A;  2BG9 B;  2NW7 A;  3CWZ B;  2I59 A;  1MIV A;  2PJQ A;  4IE5 A;  5LYJ E;  4H63 H;  2J1D G;  2L9Q A;  5JH7 E;  1XDP A;  4JUY A;  4KUM B;  3TLT A;  4AKH A;  3HR0 A;  4OYK A;  2CBI A;  3VKH A;  3ZPO A;  2AXD S;  2HHH T;  4EGW A;  3KFW X;  4DV2 T;  3QNU A;  4IDN A;  2WWV A;  4QHO A;  5FP3 A;  3OBV E;  5LCY A;  4HN9 A;  3I0O A;  2LRL A;  3A8Y C;  4MHC A;  1W0A A;  5FVL A;  4DUZ T;  3ANW B;  4QX7 B;  4CXW A;  5LB7 B;  3TLW A;  2X9H A;  1OED A;  5HEH A;  4HWD A;  5CA1 E;  4EYY R;  3AXJ A;  2IML A;  3NKZ A;  4YHH T;  4DV3 T;  2WMO A;  3P4P A;  2N2N A;  4L9I A;  3U78 A;  2EHO A;  3OYZ A;  1YQ3 A;  2KWI B;  4E7Z A;  2XQ3 A;  5IUX A;  2LSY A;  4DV5 T;  2QA7 A;  4DVD A;  2X51 A;  2LOP A;  2YKS A;  2ZLY A;  5JVD E;  4HFB A;  3E0Z A;  3AA7 B;  3VR9 A;  2DCF A;  4EED A;  1JNZ A;  1MMN A;  4ASK A;  4J2C A;  1ZHC A;  4KX6 A;  4DO0 A;  2V7K A;  4K0K T;  3QC9 A;  2Q9Q B;  4N78 D;  3Q5D A;  2YDQ A;  1AJ3 A;  2XJ7 A;  5LHH B;  4YTM A;  3LBX B;  5DQV A;  4OHF A;  3ZKR A;  2FJE A;  3FHN A;  4NUU A;  3SOL A;  1SHZ C;  2YEV C;  4IDQ A;  4LFB T;  5LHI B;  3K3O A;  2BDE A;  5AQL B;  3UUM A;  3HA4 A;  2JQH A;  4ZOL E;  5L3D B;  5M4Y A;  2PG8 A;  3UU3 A;  4NXN T;  3UQ4 A;  3AA1 B;  4JYA T;  3SS1 A;  2SPC A;  2LKH A;  3RRW A;  5LGT B;  3TLU A;  3KVA A;  3AVS A;  2H89 A;  2DHR A;  4IDP A;  4JI1 T;  2H3R A;  5HXR A;  1KFY A;  4X62 T;  2K24 A;  4M1P A;  2JPF A;  1GQE A;  3MZK B;  2V6X A;  4EZ4 A;  3CKD A;  4DND A;  1WYB A;  2H7V C;  1X9B A;  4DR2 T;  1SA0 E;  3UT5 E;  4NUV A;  1LVK A;  1US7 B;  4HTE A;  3FZK B;  2KT9 A;  3ZN1 B;  3HKC E;  2LSK A;  4UIG A;  3RH3 A;  2W62 A;  3PUV F;  5AQF B;  4EZH A;  3A5X A;  1YQ4 A;  4JI4 T;  3CML A;  3N2O A;  3NZP A;  2BKN A;  3RI5 A;  3E08 A;  4YXD A;  4B3R T;  5LMN T;  4Z90 A;  1V9D A;  4P1N A;  2VVS A;  3AA6 B;  2Y6X A;  1T98 A;  2XQ5 A;  5JR9 B;  4I50 E;  3AE1 A;  1LVF A;  4ZI3 D;  5KX5 E;  5IHY A;  1KNR A;  3P4R A;  5L3F B;  2ES0 A;  2A72 A;  3ZC1 A;  3KV4 A;  4YHJ A;  1XDO A;  5JRC B;  3BQL A;  2BG9 A;  3Q9D A;  2XHE B;  1OED E;  5AQN B;  2K5B B;  2YU2 A;  3AA0 B;  3P4Q A;  2VQF T;  2YU1 A;  4YTP A;  1MIW A;  2YDS A;  4H9R C;  4LFA T;  2XUE A;  4PK4 A;  3KV6 A;  3Q2M A;  4C90 A;  3ZMT B;  2ODU A;  3PJA J;  2NW8 A;  4PJM A;  2NWB A;  3ZN0 B;  1FJG T;  3BQK A;  4DUY T;  2XAQ B;  1UX4 A;  1XMQ T;  3CQG B;  4DV1 T;  2BKO A;  2MOZ A;  1G73 A;  3RKO A;  3EHZ A;  3MK7 C;  3CX7 B;  2WY2 A;  3AVR A;  3RPU A;  2PTF A;  2DNX A;  1HCI A;  2VL0 A;  2XSB A;  3NWI A;  1MNE A;  2VL8 A;  1VCT A;  1J5E T;  4LF8 T;  3RYH E;  2E9X B;  2B1E A;  3PU8 A;  3Q5E A;  1LRZ A;  2KSR A;  2XQY A;  3BK9 A;  3JC6 C;  3E22 E;  1HNX T;  2ZM8 A;  5EK3 A;  4ZI3 C;  2NTY A;  3AE6 A;  4HEA A;  4UR9 A;  4C91 A;  3F2E A;  2BS3 A;  4ILB A;  4U3C A;  2X0Y A;  4BAY B;  2YK0 A;  5C2T A;  4BJN A;  4H9P C;  2Y48 B;  3X1D A;  1U5P A;  2E8I A;  2VWA A;  2Q9Q A;  2FUP A;  2BVL A;  3AE2 A;  1T7S A;  4ZZC A;  3ABV A;  5JDL A;  1CUN A;  2WWU A;  3CQC B;  3ZT5 A;  3KV9 A;  4WBO A;  1NEK A;  1J1J A;  4PFP A;  3KV5 A;  2QVA A;  3HKD E;  5JDH A;  2W2U A;  4AQF C;  4IIJ E;  4QXB B;  5FY0 A;  5HWX A;  3FXE B;  2K48 A;  2VVN A;  4IE0 A;  2BBH A;  4QWN B;  4TX5 A;  1XNR T;  4P09 A;  4ZI7 E;  3VU7 H;  2LRK A;  2RP4 A;  3N9N A;  1WLX A;  1HTJ F;  2V7I A;  3RIU C;  5FYM A;  3N2K E;  3AED A;  4ZS3 A;  1EZ3 A;  5L47 A;  3O9X A;  4IRE A;  5HXC A;  3IHR A;  2XAS B;  4IT4 A;  3C4X A;  4EAH A;  2LJL A;  3O1J A;  1IBK T;  4FJO A;  3FXD B;  3UUN A;  4AIS A;  5LA6 E;  3O4X E;  3NRX A;  3N9Q A;  3K1S A;  3AB3 B;  1QSD A;  3VRB A;  3LK2 B;  3PUR A;  1YKH B;  2BS2 A;  2D5U A;  4F6R C;  2W4X A;  5JDG A;  5LJN A;  5CA0 E;  2AE9 A;  1I94 T;  1D1A A;  2EHO D;  3PUZ F;  5L3C B;  2LLY A;  1YXR A;  3EAB A;  2BVM A;  2BG9 E;  3CVR A;  3AEC A;  2KND A;  3AEG A;  2XY8 B;  2LE8 A;  5FXX A;  4ERR A;  5CGM A;  2XQ8 A;  5ABG A;  1HNW T;  5GON E;  3RC8 A;  4TNW A;  5LBQ B;  3UTK A;  5JDF A;  5H6Q B;  2IW5 B;  2XM2 A;  2X9X A;  4UF0 A;  4B3T T;  4QXC B;  1HF8 A;  1HX8 A;  2L8K A;  5JR9 A;  3V5U A;  5J2U E;  2XQ6 A;  4O4H E;  5AFU L;  2J4G A;  2ZMA A;  3LSV A;  3MJX A;  4AKR B;  4AKG A;  4XBF B;  2YIN A;  5JRC A;  2N9D A;  2Z6E A;  3C4W A;  2LM9 A;  3H3A A;  3R84 B;  4ILA A;  3P4W A;  4PK5 A;  1G8X A;  2DWK A;  2E9X C;  2VKO A;  3UU6 A;  4GK0 E;  5CB4 E;  4CI2 B;  2QRX A;  1B7T A;  3NRY A;  3EAM A;  4IE7 A;  3VKG A;  1O3X A;  3RGL A;  5HCM A;  2LSJ A;  4U31 A;  1MND A;  2VKH A;  3P8C D;  4ILC A;  2XAH B;  2E5L T;  2RPA A;  1XZY A;  4G63 A;  2JMH A;  3RHW A;  3PU3 A;  3C50 A;  5C8Y E;  4Z8X A;  1WYC A;  3EUH A;  5BMV E;  3GN5 B;  2V7J A;  4F8H A;  3QK6 A;  1KNP A;  2CMR A;  2CLY C;  4AKI A;  5LNK A;  3ONL C;  4NXM T;  4GYS A;  2BZB A;  1D1C A;  1M7K A;  4HWI B;  3ZC0 A;  4HGA A;  2XPK A;  2VQE T;  4DR1 T;  4CXX A;  3OPC A;  3FBZ A;  1D0Y A;  3ZT6 A;  1OWA A;  5AQO B;  4JI5 T;  1UK5 A;  2G0U A;  2W67 A;  3ZMZ B;  3AEE A;  2MAW A;  5FNV E;  4ZXL A;  3D0T A;  3NZQ A;  3RQU A;  4TUY E;  3RIA A;  2KIN B;  4GIW A;  5AQV B;  5AQG B;  3L8R A;  2XSA A;  3FBL A;  3I9W A;  2NW9 A;  1MIY A;  1NAF A;  2OA5 A;  2UU9 T;  5FVK A;  4KI0 F;  3UQ7 A;  2WP9 A;  2CHN A;  1QLB A;  4KP3 C;  2I6H A;  4Z91 A;  2JJ9 A;  2FJA A;  4GKJ T;  2L3L A;  3IA3 A;  2A9U A;  1D1B A;  1ZKE A;  4I4T E;  5FL0 A;  3HI2 A;  4JI2 T;  4L5G A;  1FIO A;  4DR3 T;  4PJJ A;  5JTG A;  3AE5 A;  3M65 A;  5KMG P;  1WR6 A;  4U7I A;  5HXH A;  3GMI A;  3UFG A;  2LHN A;  2XM1 A;  5LMU T;  2NR4 A;  5FXW A;  3ZT7 A;  1JNR A;  4I43 B;  1H7C A;  3C64 A;  4EB6 E;  4DR4 T;  4A98 A;  4DBR A;  2JRK A;  1HNZ T;  3QB5 K;  1Z8U A;  3AE4 A;  1J5W A;  1IAP A;  2NP9 A;  3AEF A;  2C5J A;  4QX8 B;  3ZMV B;  5AQU B;  2X68 A;  3SRZ A;  3FZH B;  1YD8 G;  4JI3 T;  3AAE B;  2A2F X;  1OXZ A;  2J62 A;  4TWH A;  4HWF A;  5JDM A;  2M67 A;  4PJN A;  5IWA T;  5EZY E;  5LP6 E;  5JDQ A;  4B3M T;  2IDO B;  3F57 A;  4I55 E;  2FBW A;  2HN2 A;  2VK9 A;  2X0L B;  3O1I A;  2XAJ B;  2UUC T;  4CN1 A;  4MLK A;  3C98 B;  3ZST A;  4TN7 B;  3MA9 A;  1ZEE A;  1SUM B;  3IBP A;  4MBQ A;  5JDN A;  5LG3 A;  4YJ3 E;  4OK0 A;  1VOM A;  2WMN A;  4A97 A;  2RA1 A;  4EV6 A;  3I0Q A;  3AAA B;  2UUB T;  2K9A A;  3B13 A;  3ETU A;  5TAO A;  4K0U A;  5ABE A;  4X1Y E;  3K8P C;  2W63 A;  4H9O C;  1NWM X;  1E1H B;  5E0O A;  2JIW A;  4U74 A;  4CN4 A;  1IBM T;  4JI8 T;  4O2B E;  1D0Z A;  2XZE A;  3ANW A;  5HYA A;  4HE8 A;  5LXT E;  3PUX F;  4ZHQ E;  2X0H A;  1OED B;  4X20 E;  2JQK A;  3JAD A;  2WZI A;  4ISS A;  5AQH B;  3L39 A;  4JLE A;  2CE7 A;  3AXJ B;  2LT3 A;  4CI1 B;  4DV7 T;  4AXP A;  2XAF B;  3N9L A;  3RQW A;  1IJ6 A;  2NTX A;  4X65 T;  1HS7 A;  4TZ4 C;  2XTL A;  3Q5W A;  2X9Y A;  5DJQ C;  2EHO B;  4EEB A;  1N32 T;  4ZS2 A;  2IIU A;  4XZC A;  2V1D B;  5L4E A;  3AEA A;  3G06 A;  4O4J E;  4AIU A;  4E7S A;  3ZMU B;  2VAS A;  2V6Y B;  1WRD A;  3DP7 A;  3KBT A;  3PE0 A;  3OVU A;  1UX5 A;  4HFI A;  2X9W A;  2D9D A;  2UXX B;  5AQS B;  3LBX A;  4CQI A;  4IDO A;  2I0M A;  2KMF A;  2CLY B;  5DQW A;  3EDV A;  3OJA A;  3LJC A;  4HFD A;  4U2Z A;  5H6R B;  4DID B;  4O4L E;  3L3P A;  4KHZ F;  4ZI2 D;  1E2A A;  2NOX A;  4BJM A;  1W9R A;  4X1K E;  4DMV A;  3KBU A;  3HKB E;  4X5T A;  3JAF A;  5CJ5 A;  4U72 A;  3UUX B;  4LML A;  3RF1 A;  2WQY A;  3L09 A;  2X67 A;  3ZLI A;  4NIQ A;  5LGN B;  3FB2 A;  4ADZ A;  4A56 A;  2LEH A;  3ZYM A;  5FMN A;  2WDQ A;  1IBL T;  1UGO A;  2F4V T;  3PUA A;  3NBX X;  4ILU A;  3PUY F;  3AE9 A;  4WNK A;  1UCU A;  1U4Q A;  4AQF A;  2W00 A;  3Q5X A;  2M6I A;  1T8B A;  2CXL A;  4HWH A;  3LG7 A;  1E7P A;  2CXD A;  5AQP B;  3HL6 A;  4I0U A;  4WW0 A;  4OX9 T;  3LK4 2;  4IL9 A;  3CK6 A;  3C51 A;  2MBG A;  1I6Z A;  2ACZ A;  4L0R A;  3ZYK A;  1IJ5 A;  5J0Z A;  4X64 T;  3RIU A;  2WCA A;  4IGU A;  2XQ7 A;  5HWY A;  2W0G A;  3DTO A;  5AQI B;  3RYI E;  2WSS V;  5FKY A;  1BR1 A;  4ZI2 C;  3CX6 B;  3FZF B;  5AQQ B;  1MMA A;  2DLR A;  4KHP T;  2MTQ A;  3LFM A;  2D0U A;  2XQA A;  3DJB A;  3LDQ B;  5F3J A;  3N9P A;  4UVA B;  4DV0 T;  5CFB A;  3S4U A;  2D2S A;  4LMK A;  2HN1 A;  4DBQ A;  4V1A v;  2K3W A;  4HFC A;  3UFE A;  3ZCI A;  4YSY A;  3IEE A;  1OED C;  4YFS A;  2LM2 A;  3PUW F; 
#chains in the Genus database with same CATH homology
 1IBL T;  2F4V T;  4LFA T;  4X62 T;  5BR8 T;  2UUC T;  4DV4 T;  2E5L T;  4DV5 T;  1N36 T;  1N32 T;  4LF4 T;  4LF5 T;  3T1H T;  4DR2 T;  4GKJ T;  1HNW T;  4B3S T;  1FJG T;  4DUY T;  4JI2 T;  4DR3 T;  4GKK T;  1XMQ T;  4OX9 T;  4DV1 T;  4LF9 T;  2UXD T;  4JV5 T;  2UXB T;  2UUB T;  4K0K T;  4NXM T;  4DV6 T;  4B3T T;  5LMU T;  1N34 T;  4X64 T;  4JI7 T;  4DR4 T;  2HHH T;  4JI4 T;  1J5E T;  1XNR T;  2VQE T;  1HNZ T;  4LFB T;  4DR1 T;  4LF8 T;  4DV2 T;  4JI6 T;  4LF6 T;  4DR7 T;  4B3R T;  1IBM T;  4X66 T;  5LMN T;  4JI5 T;  4KHP T;  4JI8 T;  4NXN T;  2UUA T;  4LF7 T;  3OTO T;  1XMO T;  4DUZ T;  4LFC T;  1HNX T;  2UXC T;  4JI0 T;  4JI3 T;  4DV0 T;  1IBK T;  4JYA T;  4DR5 T;  1XNQ T;  4AQY T;  4YY3 T;  5IWA T;  4DR6 T;  4DV7 T;  4YHH T;  4B3M T;  2UU9 T;  4DV3 T;  2ZM6 T;  4X65 T;  1I94 T;  3T1Y T;  1HR0 T;  2VQF T;  1N33 T;  4JI1 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...