4AQYT

Structure of ribosome-apramycin complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4aqyT00
2UXDT 4LF8T 1N36T 5LMUT 3T1YT 4JI5T 5IWAT 4JI3T 4GKJT 4LF7T 3OTOT 4LF6T 4DUYT 4X62T 1N34T 1HNZT 1HR0T 1N32T 2F4VT 2UUAT 4AQYT 2HHHT 4DV1T 4YHHT 4DV7T 4DR7T 1HNXT 2UUCT 1XNRT 4DV5T 1IBKT 2UU9T 4B3RT 4DR3T 4YY3T 4DV2T 4DV3T 4JI6T 5BR8T 4X64T 4LFCT 4DUZT 4KHPT 2E5LT 4NXNT 4DV6T 4GKKT 1XMQT 4LF5T 4B3ST 4JI1T 4K0KT 4B3TT 4X65T 1N33T 4JI4T 3T1HT 1HNWT 4DV4T 2UUBT 4LFAT 2ZM6T 4LF4T 1FJGT 1I94T 4DR2T 4NXMT 4LFBT 4JV5T 1XMOT 1IBMT 4DR4T 4DV0T 4JI2T 4DR5T 4DR6T 4X66T 4JYAT 2UXCT 4LF9T 2VQFT 1IBLT 1XNQT 5LMNT 2VQET 4B3MT 2UXBT 4DR1T 4JI0T 4JI8T 4OX9T 1J5ET 4JI7T
chains in the Genus database with same CATH superfamily
4CQIA 4DNDA 1M7KA 3A8YC 4HFVA 3P4RA 3Q5WA 4I0UA 4WYVA 3OBVE 3ZT6A 4NIQA 4EXTA 3RIFA 3JAEA 4AKRB 1OXZA 4I50E 3SS1A 2YK0A 1N32T 2IC9A 2J4GA 4GYRA 3UT5E 2LE8A 2UXXB 2H7OA 2MBGA 2PJQA 2X0LB 2UU9T 4AKGA 1JNZA 4MBQA 3ZSSA 4DV3T 1HG5A 4E7ZA 2VB6A 4HGAA 3RQUA 2DWGA 2NW8A 1KNZA 3AE8A 1W9RA 3Q2MA 3ZJ1A 2H89A 3C64A 5ETWA 1FJGT 5FXWA 2LSJA 4DVDA 3I9WA 2MOZA 3KV6A 4DR6T 2ODVA 2L8KA 3TLWA 1OEDA 2X9XA 3CWZB 3RIAA 3RI5A 2YKSA 5LHGB 5HXHA 1N36T 5LMUT 3E08A 3EUHA 3HKEE 2J1DG 5EK4A 4O8SA 1FEWA 2BG9B 2MAWA 3EVYA 3ZJ2A 4DUYT 3E0ZA 5FL1A 4HWFA 4LMKA 1BR0A 1FMWA 2HHHT 5C2TA 2WU5A 3X1DA 1MMDA 2W63A 3B5MA 2YN6A 4HN9A 2VKDA 4QH1A 4H9NC 3FXDB 2WSSV 1Y01A 4N78D 2YU1A 5L4EA 2VASA 5JQGE 2X67A 3UU8A 5IYZE 3FZMB 4ZI7E 3BQLA 4DV6T 4GKKT 3RC3A 2LKGA 3ZN1B 3B57A 1WFDA 2LHNA 4X65T 4CI2B 3T8OA 2KNDA 3M3ZB 4U7YA 2M67A 2LKHA 2WU2A 3O4XE 3PJAA 5DABA 4CXXA 4ZI2D 3ZT5A 3E22E 2V7LA 2UXCT 3ANWA 2FBWA 1L0VA 3LSVA 1KF6A 1J5WA 2VQET 4BJNA 2UXBT 2XQ5A 4KBMB 4JI7T 2RA1A 5JDLA 2IC6A 3ZMTB 3PU3A 3ZMUB 2H88A 4O4HE 2LT3A 2MTQA 1WR6A 2LSGA 3LBXA 1N34T 1KNPA 2JQ9A 2XAGB 3OJAA 2LLYA 4O2BE 4UIGA 1X9BA 1KK7A 5AQQB 3ZSTA 3RYCE 3HKDE 3WI3A 4DV5T 4YXDA 2CXFA 2BBHA 5AQTB 4QWNB 4JI6T 1HF8A 3V5UA 3IHRA 3JCFA 2X66A 2BS2A 3AB3B 4IDQA 3ZT7A 2WBLA 4UF0A 4U7IA 1CHUA 3N2KE 3L09A 4I4TE 4NXMT 3AEBA 3AE1A 2VKHA 5JDQA 4GYSA 2CRBA 4HE8A 4JI2T 5LP6E 4NUVA 1IBLT 1XNQT 4ZOLE 5F3JA 5CJ5A 4A56A 2YDQA 5JVDE 4JI8T 4CN6A 3CX6B 2WMOA 4H9RC 2YOEA 2LM9A 3RKGA 2CWYA 2OV9A 4U33A 2P9BA 2Y48B 3O1JA 2QGSA 4HFIA 4YSXA 2VKJA 1XZYA 3DTOA 2FJDA 4WZXA 5LG3A 5LGUB 3AE2A 1E2AA 2XQ9A 4HFDA 5HCMA 3PUVF 2JPFA 3BQIA 3RHWA 3LBXB 3ZPOA 4MALA 2NWBA 3CQXC 1D1AA 4C90A 5FMNA 4YTPA 2KZ7B 5BR8T 1NWMX 3RIUA 2EHOC 4ZEYA 3ZCIA 1IZNB 4DMWA 4YLHA 4TN7B 3RQWA 3ONXA 4C91A 4PK4A 4YJ2E 4LFBT 3MA9A 1GQEA 4A98A 2YDSA 4I55E 2FUPA 3CX7B 3H37A 2LM2A 2GK9A 4DO0A 3AA7B 4Z90A 2VVSA 3UU4A 3P4SA 3EHZA 1AJ3A 2PG8A 3NKZA 3TLTA 4OHFA 1WR0A 4JEUB 2HPJA 3ETUA 2SPCA 3NWIA 2KINB 2LRKA 3MKDA 2LRLA 4KP3C 3C4ZA 2J62A 3T1YT 1UX4A 2BBJA 4GKJT 3KINB 4K0UA 3OYZA 5LJMA 4EAHA 3Q5XA 4IT4A 3AA6B 2WP9A 5TAOA 3ZLIA 2NTYA 4V1Av 3C51A 5AQRB 3C4WA 4GK0E 3RRWA 2CE7A 2Z6EA 3UU3A 1XDOA 5KMGP 4IDOA 3I0QA 2M6IA 4O4LE 4P0BA 1UK5A 4YY3T 3VRAA 2HPLA 4YSZA 4DUZT 2CBJA 4CN1A 5CB4E 5KDMC 4UEMA 1MMNA 3SFEA 5FY1A 3OPCA 4U2YA 5LBQB 2OLTA 1T7SA 4X20E 2N1GA 2WWVA 5L47A 4E7SA 3UFEA 1XMOT 5FY0A 2JMKA 4QX7B 2WCAA 2L3LA 4QXCB 3PUGA 3AEGA 3ZMVB 1ZOYA 5FL0A 4AXPA 1SUMB 2MPKA 4YSYA 2JQKA 5A1LA 2B1EA 1G73A 1HFAA 2D9DA 2C5KT 5AQVB 5DQVA 4DBQA 3L3PA 3LK3B 2ZM0A 4XZCA 3ZC1A 4HFCA 3KFWX 4LF6T 1OEDC 2ES0A 5LGTB 2HN1A 4ZS3A 5LB7B 2KMFA 5HEHA 4QKNA 2LSIA 3KBTA 3LFMA 4AKLA 3N9PA 2NTXA 4KMCA 3QK6A 4IGUA 4UV9B 1NAFA 3K3QC 3ZKRA 2IIUA 2NP9A 3WAKA 5IHYA 2BS3A 4DR3T 1B7TA 3PU8A 4YHJA 4WBNE 4IL9A 4X64T 3BK9A 3UUNA 2Q9QA 2IW5B 3VR9A 2K9AA 4JI1T 1DU2A 2E9XC 2I6HA 3T1HT 3PDYA 3RKOA 3NVOA 4UV8B 5ABGA 4AI6A 2EHOB 3BQKA 3ZEFB 4ASKA 5ABFA 4FJOA 4U2ZA 4TV8E 2V6XA 3HR0A 1D0ZA 2CA5A 1T72A 1D1CA 3O9XA 3PURA 2DNXA 1E7PA 4WW0A 5J1GA 1UUSA 3Q5EA 3UUBA 3GA8A 3GN5A 1YQ3A 3RPUA 2LOSA 3CK6A 4EB6E 1OEDE 4ILAA 4BJMA 1E1HB 5HCJA 2XHEB 4X62T 3CPZA 2XPKA 1YW0A 2W66A 3O1HA 4DV1T 5HWXA 5LCYA 2BS4A 1LKXA 3IEEA 1XNRT 4CXYA 2X51A 2NW7A 3NBXX 4X1KE 3PUWF 2CHNA 3AE9A 4ZI3D 1VCTA 4B6XA 5JRCA 1NEKA 5AQJB 4EEDA 5HEJA 2LEHA 4M1PA 3P8CD 1NENA 2W4XA 5ADXL 5KX5E 4H9SE 3H3MA 3N9LA 2E9XA 5EZYE 2Q9QB 1VOMA 4DR2T 4G2AA 2YU2A 4OK0A 5HEUA 1H7CA 4DR5T 2X9WA 4H9OC 1XWMA 2XAFB 4P0AA 3KDSE 2CCQA 1MNDA 4P09A 2IMLA 3NZQA 4UELA 5FNVE 2HH7A 4ADZA 2LOPA 5AQSB 3TLSA 1LVKA 4F6RC 4JI3T 2A3DA 3FZFB 1R8IA 5HXEA 5L3CB 2CBIA 3AEAA 2VWAA 4IIJE 4TWDA 3TLUA 4UVAB 1HR0T 3GN5B 4EEBA 2F4VT 3FXEB 1ZP0A 2WDQA 3J7Yq 2X9YA 1YKEB 2CXLA 5FY7A 1OEDB 2QRXA 3AECA 3RX6A 5GONE 4AIUA 1KNRA 3AXJA 4JUYA 4AKHA 5HXSA 2VKOA 2EHOD 3N9QA 3PUSA 5J2UE 5AQUB 4IE6A 3CX8B 4ERRA 4NXNT 5JH7E 2XM2A 1D1BA 4LF5T 3ZN0B 5H6RB 4B3TT 1OWAA 2XM1A 2W62A 4H63V 4TX5A 2UUBT 2CLYC 4LF4T 1UURA 3QB5A 4ZS2A 2LHRA 3RIUC 4BAYB 4CZZB 3N2GE 2E2AA 2H3RA 4DV0T 2WB5A 2E9XB 3C98B 3FZKB 2E5VA 2VQFT 3UQ7A 1HX1B 4OYKA 1YD8G 3KVAA 1BR1A 4LMLA 4MLKA 3P50A 4IDZA 2PBIA 4O4JE 2UXDT 1QSDA 1SA0E 2JQHA 3AE6A 4HWHA 3UULA 1U5PA 5JDNA 2YEVC 3ZYMA 2XJ7A 1VCSA 3HKBE 2BVLA 4GK5E 4F8HA 2LJLA 5EK3A 3AEEA 3ANWB 4EYUA 2K24A 1HNXT 4HFEA 4HTEA 3RGLA 4PW8A 5LOVE 3TKLB 3FZLB 1FMVA 4B3RT 2QA7A 4FI5A 5L3FB 3SWHA 4IHJE 5L3EB 5HXCA 3FBLA 4YJ3E 5L3GB 4AQFC 3RRCA 4QHOA 2E5LT 4OYJA 2N9DA 3R6NA 3VKGA 5BMVE 1WLXA 2RPAA 2W2UA 4IE4A 4LFAT 2W0GA 2QVAA 4BA9A 1S94A 4EGWA 3ETVA 1W09A 4YTMA 1ZHCA 5LYJE 4KUMB 1D0YA 5LMNT 5AQNB 2XZEA 4OX9T 2V7KA 4AQGA 2JQQA 3IBPA 4L5GA 5JDFA 5FP3A 2BKNA 2KWHA 2VURA 4PAGA 4UF0B 1HG2A 5LJNA 3I9YA 2V26A 2OA5A 1ZEEA 3AE7A 1QLBA 3JC6D 5LA6E 2CEAA 5IUXA 4U3CA 5AFUL 2CHOA 3AA1B 3K8PC 3H3AA 2E8IA 4DR7T 4HFBA 2WM9A 2XQ8A 4UXNB 5AQLB 3L8RA 3RYIE 3D0TA 3MXZA 3M65A 3KV5A 5AQPB 2A72A 2WY2A 4PJLA 4U72A 4O4IE 4JLEA 1HX8A 2ZLYA 5L3BB 3PTRB 1VRBA 4AQFA 2ACZA 3LG7A 1Y64B 1CUNA 4ISSA 5JTGA 3SOLA 3B13A 3K3NA 3EI0A 1QUUA 2I59A 2Y8DA 5JREA 3HI2A 1MNEA 3V5SA 3K3OA 3J9X1 2IAKA 4Z8XA 5AQKB 5HWYA 4XBFB 2Q9QC 3AVSA 3EDUA 4EZHA 4ISTA 5M4YA 4XAXB 2CLYB 5C3JA 2LSYA 1WCRA 3GMIA 1US7B 1UX5A 1J5ET 3PUXF 3CVRA 2ACXA 3FZHB 4KI0F 4L9IA 1JNRA 5FVLA 3L39A 4QXBB 2DWKA 2KXPB 3I1AA 5DQWA 2A9UA 4PJNA 4H63H 4AKIA 3LK2B 3CIRA 2UUAT 2D0UA 4AQYT 5FKYA 5J0ZA 4YHHT 4DV7T 2MYSA 2DLRA 3W15B 5L3DB 2Y6XA 2V5DA 5E0OA 5LBMA 3N9MA 5ABHA 1O3XA 2W67A 3HL6A 2XAQB 2C0SA 4EYYR 4HEAA 2CXDA 4PJJA 2YINA 1WYCA 4K0KT 1IAPA 4TZ4C 5FVKA 2JRKA 2XSBA 4NUUA 1WRDA 2BG9A 4IREA 2XQYA 2IDOB 3F31A 4JV5T 4U74A 4GIWA 3G06A 4A5XA 2K3WA 1HCIA 3VU7H 3LDQB 2BKPA 3AAEB 2V7JA 1HS7A 2WQYA 4QH5A 3PV0F 4YFSA 3RC8A 3AAIA 3SRZA 4I43B 2V7MA 2FJAA 3LJCA 1V9DA 4LF8T 3PUQA 5H6QB 3UFGA 1UCUA 3AE5A 5AQFB 1SHZC 2NR4A 3AE4A 5DJQC 2RP4A 4EZ4A 2XTLA 4MHCA 1HTJF 1HNZT 1KEYA 3IF8B 1LVFA 4TUYE 2XASB 1U4QA 4UVBB 2V1DB 4YT0A 5HXRA 3RF1A 3KVBA 1Z8UA 4ILCA 4A97A 5AQIB 2WWUA 2B76A 5HAXA 3I0OA 4HWCA 4LFCT 2ZM8A 3AAAB 2AE9A 5FXXA 4KHPT 3R84B 3UU5A 4TV9E 4IL4A 5C8YE 5LXTE 4B3ST 3MK7C 2X0YA 3FBZA 3DP7A 2G0UA 5AQMB 2IHR1 2XUEA 2ZM2A 3PUZF 5JR9C 1I94T 2JIWA 2DI4A 3KBUA 2WDVA 2KLQA 4DR4T 4YTNA 1T8BA 3CMLA 3O1IA 2NW9A 2C5IT 3U3IA 1S35A 1MMAA 4B3MT 3AA0B 2VVNA 4QH4A 4U31A 3WAJA 3NRXA 3ZC0A 2BKOA 1IJ5A 1WYBA 5IWAT 3ESLA 3ZYLA 1I6ZA 3UUXB 3QOFA 4ILUA 4LF7T 3PUAA 2CPTA 4H9QC 5CA1E 5ABFB 2J47A 1D0XA 5FYMA 4DMVA 2UUCT 2V8SV 4PK5A 3F2EA 4Q25A 5HEGA 3JAFA 2VL8A 1IBKT 3FB2A 4CI1B 3RLFF 4KX6A 2V7IA 4DV2T 2BDEA 3MJXA 2WDRA 2XY8B 1LRZA 3FHNA 3UQ4A 3Q5DA 5JDHA 4HKAA 3RYHE 3A7MA 4DIDB 1SE7A 1N33T 4PNIA 5LGNB 4JI4T 1BR2A 2H7VC 5JR9A 4CXWA 3RYFE 3OKQA 1KFYA 4IE5A 2DHRA 4LF9T 2R6GF 1M62A 2ODUA 5JRCB 3TLVA 4DR1T 2D0TA 2AXDS 1YXRA 3AE3A 4IE7A 5L4HA 3UTKA 3MACA 3QNUA 3U78A 4OFZA 3F57A 3DJBA 2A2FX 4CI3B 3AEDA 3GWHA 4PJMA 5F5WA 3VRBA 4O2AE 2JJ9A 4ZI3C 2XQ4A 4TWHA 3HKCE 2XQAA 3N5LA 4PFOA 3PE0A 1MIVA 2DCFA 2UXNB 4PK6A 3RH3A 5LHHB 3AVRA 2XSAA 4P1NA 3MZKB 3ZCJA 3P7IA 2JMHA 3ZMZB 2FJEA 2X68A 4WNKA 4ZHQE 5FXZA 4QXHB 3PJAJ 3C4XA 3KV9A 2K5BB 2V6YA 4MFRA 5LG4A 2ZM6T 3P4QA 5LHIB 5AQHB 2Q9QD 4IDNA 3A5XA 2XQ7A 4X5TA 4ZI2C 1MIYA 5J2TE 3EDVA 4X1YE 3AXJB 3UU6A 5ABEA 2W61A 5JR9B 3OVUA 5HEOA 2D5UA 5JDMA 5L2LA 3QB5K 1IJ6A 5LNKA 1EZ3A 1YQ4A 4ZXLA 5CFBA 2V5CA 3VR8A 5F8PA 2WS3A 5AQGB 4QX8B 3LK42 4CN4A 3OTOT 5CGMA 4LMJA 3NRYA 2HN2A 2CWOA 5HYAA 2D2SA 3N9NA 4HFHA 4EIWA 3P4PA 1BR4A 4WBOA 2PFVA 5JDGA 4ANJA 2W00A 4KHZF 4ILBA 4J2CA 3CQCB 3JADA 4GOUA 4UR9A 3VKHA 2M6BA 2VL0A 1XMQT 2DL1A 2VK9A 4HWIB 4JBWF 2XAHB 1HNWT 3HA4A 4EV6A 3AEFA 3VHLA 4DV4T 3ONLC 4ZZBA 1FIOA 2WMNA 1MIWA 2KT9A 2V6YB 2NOXA 2I0MA 4JEHB 2CMRA 2X9HA 2K48A 4EOZB 4X66T 4UVCB 5AQOB 1UGOA 3Q9DA 2E9XD 4PFPA 3EAMA 2QYWA 2WZHA 4JI0T 3CKDA 3CQGB 2BG9C 1T98A 4JI5T 5CA0E 1YKHB 3EABA 3C50A 4DBRA 2BZBA 2L9QA 1J1JA 2WAUA 2ZMAA 4H9PC 3ZMSB 2PTFA 4IE0A 3P4WA 2N2NA 3ONJA 3UUMA 3N2OA 1W0BA 2CM0A 2IUBA 2EHOA 4ZZCA 5EK2A 3ABVA 2C5JA 2WZIA 3N9OA 1MMGA 1X79A 5FXVA 4G63A 3NZPA 4HWDA 4AISA 1ZV4X 3QC9A 4NPPA 2BVMA 2LSKA 3IA3A 3ZYKA 2KWIB 5KXJA 3OYXA 3QUJA 2XQ3A 3KV4A 3K1SA 2FJBA 3SFDA 3PUYF 2XQ6A 2YDRA 4X1IE 4L0RA 2X0HA 4TWFA 4Z91A 2KSRA 1IBMT 4TNWA 2XAJB 4JYAT 1Z0PA 4TNVA 4COFA 1W0AA 1ZKEA 3JC6C 3S4UA 2BG9E 1XDPA 4IDPA 1G8XA
chains in the Genus database with same CATH topology
2UXDT 4LF8T 1N36T 5LMUT 3T1YT 4JI5T 5IWAT 4JI3T 4GKJT 4LF7T 3OTOT 4LF6T 4DUYT 4X62T 1N34T 1HNZT 1HR0T 1N32T 2F4VT 2UUAT 4AQYT 2HHHT 4DV1T 4YHHT 4DV7T 4DR7T 1HNXT 2UUCT 1XNRT 4DV5T 1IBKT 2UU9T 4B3RT 4DR3T 4YY3T 4DV2T 4DV3T 4JI6T 5BR8T 4X64T 4LFCT 4DUZT 4KHPT 2E5LT 4NXNT 4DV6T 4GKKT 1XMQT 4LF5T 4B3ST 4JI1T 4K0KT 4B3TT 4X65T 1N33T 4JI4T 3T1HT 1HNWT 4DV4T 2UUBT 4LFAT 2ZM6T 4LF4T 1FJGT 1I94T 4DR2T 4NXMT 4LFBT 4JV5T 1XMOT 1IBMT 4DR4T 4DV0T 4JI2T 4DR5T 4DR6T 4X66T 4JYAT 2UXCT 4LF9T 2VQFT 1IBLT 1XNQT 5LMNT 2VQET 4B3MT 2UXBT 4DR1T 4JI0T 4JI8T 4OX9T 1J5ET 4JI7T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD T;  4LF8 T;  1N36 T;  5LMU T;  3T1Y T;  4JI5 T;  5IWA T;  4JI3 T;  4GKJ T;  4LF7 T;  3OTO T;  4LF6 T;  4DUY T;  4X62 T;  1N34 T;  1HNZ T;  1HR0 T;  1N32 T;  2F4V T;  2UUA T;  4AQY T;  2HHH T;  4DV1 T;  4YHH T;  4DV7 T;  4DR7 T;  1HNX T;  2UUC T;  1XNR T;  4DV5 T;  1IBK T;  2UU9 T;  4B3R T;  4DR3 T;  4YY3 T;  4DV2 T;  4DV3 T;  4JI6 T;  5BR8 T;  4X64 T;  4LFC T;  4DUZ T;  4KHP T;  2E5L T;  4NXN T;  4DV6 T;  4GKK T;  1XMQ T;  4LF5 T;  4B3S T;  4JI1 T;  4K0K T;  4B3T T;  4X65 T;  1N33 T;  4JI4 T;  3T1H T;  1HNW T;  4DV4 T;  2UUB T;  4LFA T;  2ZM6 T;  4LF4 T;  1FJG T;  1I94 T;  4DR2 T;  4NXM T;  4LFB T;  4JV5 T;  1XMO T;  1IBM T;  4DR4 T;  4DV0 T;  4JI2 T;  4DR5 T;  4DR6 T;  4X66 T;  4JYA T;  2UXC T;  4LF9 T;  2VQF T;  1IBL T;  1XNQ T;  5LMN T;  2VQE T;  4B3M T;  2UXB T;  4DR1 T;  4JI0 T;  4JI8 T;  4OX9 T;  1J5E T;  4JI7 T; 
#chains in the Genus database with same CATH topology
 4CQI A;  4DND A;  1M7K A;  3A8Y C;  4HFV A;  3P4R A;  3Q5W A;  4I0U A;  4WYV A;  3OBV E;  3ZT6 A;  4NIQ A;  4EXT A;  3RIF A;  3JAE A;  4AKR B;  1OXZ A;  4I50 E;  3SS1 A;  2YK0 A;  1N32 T;  2IC9 A;  2J4G A;  4GYR A;  3UT5 E;  2LE8 A;  2UXX B;  2H7O A;  2MBG A;  2PJQ A;  2X0L B;  2UU9 T;  4AKG A;  1JNZ A;  4MBQ A;  3ZSS A;  4DV3 T;  1HG5 A;  4E7Z A;  2VB6 A;  4HGA A;  3RQU A;  2DWG A;  2NW8 A;  1KNZ A;  3AE8 A;  1W9R A;  3Q2M A;  3ZJ1 A;  2H89 A;  3C64 A;  5ETW A;  1FJG T;  5FXW A;  2LSJ A;  4DVD A;  3I9W A;  2MOZ A;  3KV6 A;  4DR6 T;  2ODV A;  2L8K A;  3TLW A;  1OED A;  2X9X A;  3CWZ B;  3RIA A;  3RI5 A;  2YKS A;  5LHG B;  5HXH A;  1N36 T;  5LMU T;  3E08 A;  3EUH A;  3HKE E;  2J1D G;  5EK4 A;  4O8S A;  1FEW A;  2BG9 B;  2MAW A;  3EVY A;  3ZJ2 A;  4DUY T;  3E0Z A;  5FL1 A;  4HWF A;  4LMK A;  1BR0 A;  1FMW A;  2HHH T;  5C2T A;  2WU5 A;  3X1D A;  1MMD A;  2W63 A;  3B5M A;  2YN6 A;  4HN9 A;  2VKD A;  4QH1 A;  4H9N C;  3FXD B;  2WSS V;  1Y01 A;  4N78 D;  2YU1 A;  5L4E A;  2VAS A;  5JQG E;  2X67 A;  3UU8 A;  5IYZ E;  3FZM B;  4ZI7 E;  3BQL A;  4DV6 T;  4GKK T;  3RC3 A;  2LKG A;  3ZN1 B;  3B57 A;  1WFD A;  2LHN A;  4X65 T;  4CI2 B;  3T8O A;  2KND A;  3M3Z B;  4U7Y A;  2M67 A;  2LKH A;  2WU2 A;  3O4X E;  3PJA A;  5DAB A;  4CXX A;  4ZI2 D;  3ZT5 A;  3E22 E;  2V7L A;  2UXC T;  3ANW A;  2FBW A;  1L0V A;  3LSV A;  1KF6 A;  1J5W A;  2VQE T;  4BJN A;  2UXB T;  2XQ5 A;  4KBM B;  4JI7 T;  2RA1 A;  5JDL A;  2IC6 A;  3ZMT B;  3PU3 A;  3ZMU B;  2H88 A;  4O4H E;  2LT3 A;  2MTQ A;  1WR6 A;  2LSG A;  3LBX A;  1N34 T;  1KNP A;  2JQ9 A;  2XAG B;  3OJA A;  2LLY A;  4O2B E;  4UIG A;  1X9B A;  1KK7 A;  5AQQ B;  3ZST A;  3RYC E;  3HKD E;  3WI3 A;  4DV5 T;  4YXD A;  2CXF A;  2BBH A;  5AQT B;  4QWN B;  4JI6 T;  1HF8 A;  3V5U A;  3IHR A;  3JCF A;  2X66 A;  2BS2 A;  3AB3 B;  4IDQ A;  3ZT7 A;  2WBL A;  4UF0 A;  4U7I A;  1CHU A;  3N2K E;  3L09 A;  4I4T E;  4NXM T;  3AEB A;  3AE1 A;  2VKH A;  5JDQ A;  4GYS A;  2CRB A;  4HE8 A;  4JI2 T;  5LP6 E;  4NUV A;  1IBL T;  1XNQ T;  4ZOL E;  5F3J A;  5CJ5 A;  4A56 A;  2YDQ A;  5JVD E;  4JI8 T;  4CN6 A;  3CX6 B;  2WMO A;  4H9R C;  2YOE A;  2LM9 A;  3RKG A;  2CWY A;  2OV9 A;  4U33 A;  2P9B A;  2Y48 B;  3O1J A;  2QGS A;  4HFI A;  4YSX A;  2VKJ A;  1XZY A;  3DTO A;  2FJD A;  4WZX A;  5LG3 A;  5LGU B;  3AE2 A;  1E2A A;  2XQ9 A;  4HFD A;  5HCM A;  3PUV F;  2JPF A;  3BQI A;  3RHW A;  3LBX B;  3ZPO A;  4MAL A;  2NWB A;  3CQX C;  1D1A A;  4C90 A;  5FMN A;  4YTP A;  2KZ7 B;  5BR8 T;  1NWM X;  3RIU A;  2EHO C;  4ZEY A;  3ZCI A;  1IZN B;  4DMW A;  4YLH A;  4TN7 B;  3RQW A;  3ONX A;  4C91 A;  4PK4 A;  4YJ2 E;  4LFB T;  3MA9 A;  1GQE A;  4A98 A;  2YDS A;  4I55 E;  2FUP A;  3CX7 B;  3H37 A;  2LM2 A;  2GK9 A;  4DO0 A;  3AA7 B;  4Z90 A;  2VVS A;  3UU4 A;  3P4S A;  3EHZ A;  1AJ3 A;  2PG8 A;  3NKZ A;  3TLT A;  4OHF A;  1WR0 A;  4JEU B;  2HPJ A;  3ETU A;  2SPC A;  3NWI A;  2KIN B;  2LRK A;  3MKD A;  2LRL A;  4KP3 C;  3C4Z A;  2J62 A;  3T1Y T;  1UX4 A;  2BBJ A;  4GKJ T;  3KIN B;  4K0U A;  3OYZ A;  5LJM A;  4EAH A;  3Q5X A;  4IT4 A;  3AA6 B;  2WP9 A;  5TAO A;  3ZLI A;  2NTY A;  4V1A v;  3C51 A;  5AQR B;  3C4W A;  4GK0 E;  3RRW A;  2CE7 A;  2Z6E A;  3UU3 A;  1XDO A;  5KMG P;  4IDO A;  3I0Q A;  2M6I A;  4O4L E;  4P0B A;  1UK5 A;  4YY3 T;  3VRA A;  2HPL A;  4YSZ A;  4DUZ T;  2CBJ A;  4CN1 A;  5CB4 E;  5KDM C;  4UEM A;  1MMN A;  3SFE A;  5FY1 A;  3OPC A;  4U2Y A;  5LBQ B;  2OLT A;  1T7S A;  4X20 E;  2N1G A;  2WWV A;  5L47 A;  4E7S A;  3UFE A;  1XMO T;  5FY0 A;  2JMK A;  4QX7 B;  2WCA A;  2L3L A;  4QXC B;  3PUG A;  3AEG A;  3ZMV B;  1ZOY A;  5FL0 A;  4AXP A;  1SUM B;  2MPK A;  4YSY A;  2JQK A;  5A1L A;  2B1E A;  1G73 A;  1HFA A;  2D9D A;  2C5K T;  5AQV B;  5DQV A;  4DBQ A;  3L3P A;  3LK3 B;  2ZM0 A;  4XZC A;  3ZC1 A;  4HFC A;  3KFW X;  4LF6 T;  1OED C;  2ES0 A;  5LGT B;  2HN1 A;  4ZS3 A;  5LB7 B;  2KMF A;  5HEH A;  4QKN A;  2LSI A;  3KBT A;  3LFM A;  4AKL A;  3N9P A;  2NTX A;  4KMC A;  3QK6 A;  4IGU A;  4UV9 B;  1NAF A;  3K3Q C;  3ZKR A;  2IIU A;  2NP9 A;  3WAK A;  5IHY A;  2BS3 A;  4DR3 T;  1B7T A;  3PU8 A;  4YHJ A;  4WBN E;  4IL9 A;  4X64 T;  3BK9 A;  3UUN A;  2Q9Q A;  2IW5 B;  3VR9 A;  2K9A A;  4JI1 T;  1DU2 A;  2E9X C;  2I6H A;  3T1H T;  3PDY A;  3RKO A;  3NVO A;  4UV8 B;  5ABG A;  4AI6 A;  2EHO B;  3BQK A;  3ZEF B;  4ASK A;  5ABF A;  4FJO A;  4U2Z A;  4TV8 E;  2V6X A;  3HR0 A;  1D0Z A;  2CA5 A;  1T72 A;  1D1C A;  3O9X A;  3PUR A;  2DNX A;  1E7P A;  4WW0 A;  5J1G A;  1UUS A;  3Q5E A;  3UUB A;  3GA8 A;  3GN5 A;  1YQ3 A;  3RPU A;  2LOS A;  3CK6 A;  4EB6 E;  1OED E;  4ILA A;  4BJM A;  1E1H B;  5HCJ A;  2XHE B;  4X62 T;  3CPZ A;  2XPK A;  1YW0 A;  2W66 A;  3O1H A;  4DV1 T;  5HWX A;  5LCY A;  2BS4 A;  1LKX A;  3IEE A;  1XNR T;  4CXY A;  2X51 A;  2NW7 A;  3NBX X;  4X1K E;  3PUW F;  2CHN A;  3AE9 A;  4ZI3 D;  1VCT A;  4B6X A;  5JRC A;  1NEK A;  5AQJ B;  4EED A;  5HEJ A;  2LEH A;  4M1P A;  3P8C D;  1NEN A;  2W4X A;  5ADX L;  5KX5 E;  4H9S E;  3H3M A;  3N9L A;  2E9X A;  5EZY E;  2Q9Q B;  1VOM A;  4DR2 T;  4G2A A;  2YU2 A;  4OK0 A;  5HEU A;  1H7C A;  4DR5 T;  2X9W A;  4H9O C;  1XWM A;  2XAF B;  4P0A A;  3KDS E;  2CCQ A;  1MND A;  4P09 A;  2IML A;  3NZQ A;  4UEL A;  5FNV E;  2HH7 A;  4ADZ A;  2LOP A;  5AQS B;  3TLS A;  1LVK A;  4F6R C;  4JI3 T;  2A3D A;  3FZF B;  1R8I A;  5HXE A;  5L3C B;  2CBI A;  3AEA A;  2VWA A;  4IIJ E;  4TWD A;  3TLU A;  4UVA B;  1HR0 T;  3GN5 B;  4EEB A;  2F4V T;  3FXE B;  1ZP0 A;  2WDQ A;  3J7Y q;  2X9Y A;  1YKE B;  2CXL A;  5FY7 A;  1OED B;  2QRX A;  3AEC A;  3RX6 A;  5GON E;  4AIU A;  1KNR A;  3AXJ A;  4JUY A;  4AKH A;  5HXS A;  2VKO A;  2EHO D;  3N9Q A;  3PUS A;  5J2U E;  5AQU B;  4IE6 A;  3CX8 B;  4ERR A;  4NXN T;  5JH7 E;  2XM2 A;  1D1B A;  4LF5 T;  3ZN0 B;  5H6R B;  4B3T T;  1OWA A;  2XM1 A;  2W62 A;  4H63 V;  4TX5 A;  2UUB T;  2CLY C;  4LF4 T;  1UUR A;  3QB5 A;  4ZS2 A;  2LHR A;  3RIU C;  4BAY B;  4CZZ B;  3N2G E;  2E2A A;  2H3R A;  4DV0 T;  2WB5 A;  2E9X B;  3C98 B;  3FZK B;  2E5V A;  2VQF T;  3UQ7 A;  1HX1 B;  4OYK A;  1YD8 G;  3KVA A;  1BR1 A;  4LML A;  4MLK A;  3P50 A;  4IDZ A;  2PBI A;  4O4J E;  2UXD T;  1QSD A;  1SA0 E;  2JQH A;  3AE6 A;  4HWH A;  3UUL A;  1U5P A;  5JDN A;  2YEV C;  3ZYM A;  2XJ7 A;  1VCS A;  3HKB E;  2BVL A;  4GK5 E;  4F8H A;  2LJL A;  5EK3 A;  3AEE A;  3ANW B;  4EYU A;  2K24 A;  1HNX T;  4HFE A;  4HTE A;  3RGL A;  4PW8 A;  5LOV E;  3TKL B;  3FZL B;  1FMV A;  4B3R T;  2QA7 A;  4FI5 A;  5L3F B;  3SWH A;  4IHJ E;  5L3E B;  5HXC A;  3FBL A;  4YJ3 E;  5L3G B;  4AQF C;  3RRC A;  4QHO A;  2E5L T;  4OYJ A;  2N9D A;  3R6N A;  3VKG A;  5BMV E;  1WLX A;  2RPA A;  2W2U A;  4IE4 A;  4LFA T;  2W0G A;  2QVA A;  4BA9 A;  1S94 A;  4EGW A;  3ETV A;  1W09 A;  4YTM A;  1ZHC A;  5LYJ E;  4KUM B;  1D0Y A;  5LMN T;  5AQN B;  2XZE A;  4OX9 T;  2V7K A;  4AQG A;  2JQQ A;  3IBP A;  4L5G A;  5JDF A;  5FP3 A;  2BKN A;  2KWH A;  2VUR A;  4PAG A;  4UF0 B;  1HG2 A;  5LJN A;  3I9Y A;  2V26 A;  2OA5 A;  1ZEE A;  3AE7 A;  1QLB A;  3JC6 D;  5LA6 E;  2CEA A;  5IUX A;  4U3C A;  5AFU L;  2CHO A;  3AA1 B;  3K8P C;  3H3A A;  2E8I A;  4DR7 T;  4HFB A;  2WM9 A;  2XQ8 A;  4UXN B;  5AQL B;  3L8R A;  3RYI E;  3D0T A;  3MXZ A;  3M65 A;  3KV5 A;  5AQP B;  2A72 A;  2WY2 A;  4PJL A;  4U72 A;  4O4I E;  4JLE A;  1HX8 A;  2ZLY A;  5L3B B;  3PTR B;  1VRB A;  4AQF A;  2ACZ A;  3LG7 A;  1Y64 B;  1CUN A;  4ISS A;  5JTG A;  3SOL A;  3B13 A;  3K3N A;  3EI0 A;  1QUU A;  2I59 A;  2Y8D A;  5JRE A;  3HI2 A;  1MNE A;  3V5S A;  3K3O A;  3J9X 1;  2IAK A;  4Z8X A;  5AQK B;  5HWY A;  4XBF B;  2Q9Q C;  3AVS A;  3EDU A;  4EZH A;  4IST A;  5M4Y A;  4XAX B;  2CLY B;  5C3J A;  2LSY A;  1WCR A;  3GMI A;  1US7 B;  1UX5 A;  1J5E T;  3PUX F;  3CVR A;  2ACX A;  3FZH B;  4KI0 F;  4L9I A;  1JNR A;  5FVL A;  3L39 A;  4QXB B;  2DWK A;  2KXP B;  3I1A A;  5DQW A;  2A9U A;  4PJN A;  4H63 H;  4AKI A;  3LK2 B;  3CIR A;  2UUA T;  2D0U A;  4AQY T;  5FKY A;  5J0Z A;  4YHH T;  4DV7 T;  2MYS A;  2DLR A;  3W15 B;  5L3D B;  2Y6X A;  2V5D A;  5E0O A;  5LBM A;  3N9M A;  5ABH A;  1O3X A;  2W67 A;  3HL6 A;  2XAQ B;  2C0S A;  4EYY R;  4HEA A;  2CXD A;  4PJJ A;  2YIN A;  1WYC A;  4K0K T;  1IAP A;  4TZ4 C;  5FVK A;  2JRK A;  2XSB A;  4NUU A;  1WRD A;  2BG9 A;  4IRE A;  2XQY A;  2IDO B;  3F31 A;  4JV5 T;  4U74 A;  4GIW A;  3G06 A;  4A5X A;  2K3W A;  1HCI A;  3VU7 H;  3LDQ B;  2BKP A;  3AAE B;  2V7J A;  1HS7 A;  2WQY A;  4QH5 A;  3PV0 F;  4YFS A;  3RC8 A;  3AAI A;  3SRZ A;  4I43 B;  2V7M A;  2FJA A;  3LJC A;  1V9D A;  4LF8 T;  3PUQ A;  5H6Q B;  3UFG A;  1UCU A;  3AE5 A;  5AQF B;  1SHZ C;  2NR4 A;  3AE4 A;  5DJQ C;  2RP4 A;  4EZ4 A;  2XTL A;  4MHC A;  1HTJ F;  1HNZ T;  1KEY A;  3IF8 B;  1LVF A;  4TUY E;  2XAS B;  1U4Q A;  4UVB B;  2V1D B;  4YT0 A;  5HXR A;  3RF1 A;  3KVB A;  1Z8U A;  4ILC A;  4A97 A;  5AQI B;  2WWU A;  2B76 A;  5HAX A;  3I0O A;  4HWC A;  4LFC T;  2ZM8 A;  3AAA B;  2AE9 A;  5FXX A;  4KHP T;  3R84 B;  3UU5 A;  4TV9 E;  4IL4 A;  5C8Y E;  5LXT E;  4B3S T;  3MK7 C;  2X0Y A;  3FBZ A;  3DP7 A;  2G0U A;  5AQM B;  2IHR 1;  2XUE A;  2ZM2 A;  3PUZ F;  5JR9 C;  1I94 T;  2JIW A;  2DI4 A;  3KBU A;  2WDV A;  2KLQ A;  4DR4 T;  4YTN A;  1T8B A;  3CML A;  3O1I A;  2NW9 A;  2C5I T;  3U3I A;  1S35 A;  1MMA A;  4B3M T;  3AA0 B;  2VVN A;  4QH4 A;  4U31 A;  3WAJ A;  3NRX A;  3ZC0 A;  2BKO A;  1IJ5 A;  1WYB A;  5IWA T;  3ESL A;  3ZYL A;  1I6Z A;  3UUX B;  3QOF A;  4ILU A;  4LF7 T;  3PUA A;  2CPT A;  4H9Q C;  5CA1 E;  5ABF B;  2J47 A;  1D0X A;  5FYM A;  4DMV A;  2UUC T;  2V8S V;  4PK5 A;  3F2E A;  4Q25 A;  5HEG A;  3JAF A;  2VL8 A;  1IBK T;  3FB2 A;  4CI1 B;  3RLF F;  4KX6 A;  2V7I A;  4DV2 T;  2BDE A;  3MJX A;  2WDR A;  2XY8 B;  1LRZ A;  3FHN A;  3UQ4 A;  3Q5D A;  5JDH A;  4HKA A;  3RYH E;  3A7M A;  4DID B;  1SE7 A;  1N33 T;  4PNI A;  5LGN B;  4JI4 T;  1BR2 A;  2H7V C;  5JR9 A;  4CXW A;  3RYF E;  3OKQ A;  1KFY A;  4IE5 A;  2DHR A;  4LF9 T;  2R6G F;  1M62 A;  2ODU A;  5JRC B;  3TLV A;  4DR1 T;  2D0T A;  2AXD S;  1YXR A;  3AE3 A;  4IE7 A;  5L4H A;  3UTK A;  3MAC A;  3QNU A;  3U78 A;  4OFZ A;  3F57 A;  3DJB A;  2A2F X;  4CI3 B;  3AED A;  3GWH A;  4PJM A;  5F5W A;  3VRB A;  4O2A E;  2JJ9 A;  4ZI3 C;  2XQ4 A;  4TWH A;  3HKC E;  2XQA A;  3N5L A;  4PFO A;  3PE0 A;  1MIV A;  2DCF A;  2UXN B;  4PK6 A;  3RH3 A;  5LHH B;  3AVR A;  2XSA A;  4P1N A;  3MZK B;  3ZCJ A;  3P7I A;  2JMH A;  3ZMZ B;  2FJE A;  2X68 A;  4WNK A;  4ZHQ E;  5FXZ A;  4QXH B;  3PJA J;  3C4X A;  3KV9 A;  2K5B B;  2V6Y A;  4MFR A;  5LG4 A;  2ZM6 T;  3P4Q A;  5LHI B;  5AQH B;  2Q9Q D;  4IDN A;  3A5X A;  2XQ7 A;  4X5T A;  4ZI2 C;  1MIY A;  5J2T E;  3EDV A;  4X1Y E;  3AXJ B;  3UU6 A;  5ABE A;  2W61 A;  5JR9 B;  3OVU A;  5HEO A;  2D5U A;  5JDM A;  5L2L A;  3QB5 K;  1IJ6 A;  5LNK A;  1EZ3 A;  1YQ4 A;  4ZXL A;  5CFB A;  2V5C A;  3VR8 A;  5F8P A;  2WS3 A;  5AQG B;  4QX8 B;  3LK4 2;  4CN4 A;  3OTO T;  5CGM A;  4LMJ A;  3NRY A;  2HN2 A;  2CWO A;  5HYA A;  2D2S A;  3N9N A;  4HFH A;  4EIW A;  3P4P A;  1BR4 A;  4WBO A;  2PFV A;  5JDG A;  4ANJ A;  2W00 A;  4KHZ F;  4ILB A;  4J2C A;  3CQC B;  3JAD A;  4GOU A;  4UR9 A;  3VKH A;  2M6B A;  2VL0 A;  1XMQ T;  2DL1 A;  2VK9 A;  4HWI B;  4JBW F;  2XAH B;  1HNW T;  3HA4 A;  4EV6 A;  3AEF A;  3VHL A;  4DV4 T;  3ONL C;  4ZZB A;  1FIO A;  2WMN A;  1MIW A;  2KT9 A;  2V6Y B;  2NOX A;  2I0M A;  4JEH B;  2CMR A;  2X9H A;  2K48 A;  4EOZ B;  4X66 T;  4UVC B;  5AQO B;  1UGO A;  3Q9D A;  2E9X D;  4PFP A;  3EAM A;  2QYW A;  2WZH A;  4JI0 T;  3CKD A;  3CQG B;  2BG9 C;  1T98 A;  4JI5 T;  5CA0 E;  1YKH B;  3EAB A;  3C50 A;  4DBR A;  2BZB A;  2L9Q A;  1J1J A;  2WAU A;  2ZMA A;  4H9P C;  3ZMS B;  2PTF A;  4IE0 A;  3P4W A;  2N2N A;  3ONJ A;  3UUM A;  3N2O A;  1W0B A;  2CM0 A;  2IUB A;  2EHO A;  4ZZC A;  5EK2 A;  3ABV A;  2C5J A;  2WZI A;  3N9O A;  1MMG A;  1X79 A;  5FXV A;  4G63 A;  3NZP A;  4HWD A;  4AIS A;  1ZV4 X;  3QC9 A;  4NPP A;  2BVM A;  2LSK A;  3IA3 A;  3ZYK A;  2KWI B;  5KXJ A;  3OYX A;  3QUJ A;  2XQ3 A;  3KV4 A;  3K1S A;  2FJB A;  3SFD A;  3PUY F;  2XQ6 A;  2YDR A;  4X1I E;  4L0R A;  2X0H A;  4TWF A;  4Z91 A;  2KSR A;  1IBM T;  4TNW A;  2XAJ B;  4JYA T;  1Z0P A;  4TNV A;  4COF A;  1W0A A;  1ZKE A;  3JC6 C;  3S4U A;  2BG9 E;  1XDP A;  4IDP A;  1G8X A; 
#chains in the Genus database with same CATH homology
 2UXD T;  4LF8 T;  1N36 T;  5LMU T;  3T1Y T;  4JI5 T;  5IWA T;  4JI3 T;  4GKJ T;  4LF7 T;  3OTO T;  4LF6 T;  4DUY T;  4X62 T;  1N34 T;  1HNZ T;  1HR0 T;  1N32 T;  2F4V T;  2UUA T;  4AQY T;  2HHH T;  4DV1 T;  4YHH T;  4DV7 T;  4DR7 T;  1HNX T;  2UUC T;  1XNR T;  4DV5 T;  1IBK T;  2UU9 T;  4B3R T;  4DR3 T;  4YY3 T;  4DV2 T;  4DV3 T;  4JI6 T;  5BR8 T;  4X64 T;  4LFC T;  4DUZ T;  4KHP T;  2E5L T;  4NXN T;  4DV6 T;  4GKK T;  1XMQ T;  4LF5 T;  4B3S T;  4JI1 T;  4K0K T;  4B3T T;  4X65 T;  1N33 T;  4JI4 T;  3T1H T;  1HNW T;  4DV4 T;  2UUB T;  4LFA T;  2ZM6 T;  4LF4 T;  1FJG T;  1I94 T;  4DR2 T;  4NXM T;  4LFB T;  4JV5 T;  1XMO T;  1IBM T;  4DR4 T;  4DV0 T;  4JI2 T;  4DR5 T;  4DR6 T;  4X66 T;  4JYA T;  2UXC T;  4LF9 T;  2VQF T;  1IBL T;  1XNQ T;  5LMN T;  2VQE T;  4B3M T;  2UXB T;  4DR1 T;  4JI0 T;  4JI8 T;  4OX9 T;  1J5E T;  4JI7 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...