4AQYT

Structure of ribosome-apramycin complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4aqyT00
1XMQT 2UUBT 5LMUT 1IBLT 4JI0T 5BR8T 1IBKT 2E5LT 2UU9T 4LF6T 4JI6T 4LF8T 2HHHT 4B3TT 4NXNT 4JI2T 2F4VT 4DR2T 4DV6T 4X66T 2UXDT 4DV0T 4X62T 1N32T 1J5ET 4DR6T 4YY3T 4X65T 4DR3T 1IBMT 1FJGT 4GKKT 4B3ST 4LF7T 1N33T 2ZM6T 4LFAT 4YHHT 4JYAT 3T1YT 1N36T 1I94T 4DV5T 4DUYT 1XNQT 4KHPT 1HNXT 4LFBT 2UUAT 4LF4T 4NXMT 4LFCT 4JI7T 3T1HT 3OTOT 4DR4T 4JI4T 4JI5T 1XNRT 4LF5T 4DV3T 1HNWT 4DV2T 4JI3T 4LF9T 2VQFT 4B3MT 4DUZT 1XMOT 5IWAT 4DV1T 1HNZT 4AQYT 2VQET 4X64T 4JV5T 2UXCT 4DV4T 2UXBT 4DR5T 1N34T 4DV7T 4JI1T 1HR0T 2UUCT 4DR1T 5LMNT 4GKJT 4DR7T 4B3RT 4JI8T 4K0KT 4OX9T
chains in the Genus database with same CATH superfamily
2AE9A 2IIUA 2LT3A 2XAGB 2JMHA 1US7B 2X9YA 3B57A 3FZMB 3RYFE 4I55E 2ODUA 4PJJA 4U3CA 2NTXA 2UUBT 2L3LA 2VKJA 3CVRA 2XAHB 1UUSA 3JC6D 4HFVA 2E9XA 3RH3A 1IBLT 3BQKA 2CLYB 2W62A 3L39A 3P4PA 4LMLA 4QH5A 4N78D 2M67A 4BJMA 2K24A 3AE5A 4P1NA 2E9XC 5LB7B 1JNRA 3DJBA 4LF6T 2BS2A 4PFOA 4ILUA 1L0VA 2C5KT 2XAJB 3AA1B 1QSDA 4JUYA 5JDLA 2HHHT 2KNDA 5FYMA 2LSIA 2XASB 1KEYA 2WS3A 5FKYA 2F4VT 4UF0B 4EEDA 5ABEA 1NENA 3N9PA 1T72A 4U31A 2UXNB 2V8SV 5EK3A 1W0BA 3QC9A 4G2AA 3OYXA 3I9WA 1B7TA 5JDQA 2IUBA 2K48A 2K9AA 4ZI2C 3GMIA 5FVKA 4X66T 2XJ7A 2OA5A 2UXDT 1AJ3A 4XZCA 1UK5A 2SPCA 3I1AA 3AAIA 4X62T 4EEBA 3AE8A 2Q9QC 2CMRA 3CX7B 3V5UA 1J5ET 4TWFA 2A72A 2M6BA 4G63A 3P4WA 2K5BB 5L4EA 3HKCE 4WBNE 3H3MA 2LSGA 3P4QA 1XMOT 2JJ9A 4UXNB 2X0YA 3CK6A 2LKHA 4JEUB 3OVUA 4H9OC 2CXDA 2XTLA 3UU3A 3RQWA 2NW9A 1HCIA 3AEDA 3UFEA 4AKLA 4QHOA 3KBTA 4ERRA 2VVSA 4MFRA 2IAKA 2X9XA 1IJ6A 1XDPA 4LF5T 2BKPA 2LSJA 1JNZA 4UR9A 2ZM6T 1ZEEA 2XZEA 3O1HA 4H9SE 4OFZA 4E7SA 2W0GA 3TKLB 3ONJA 3UUNA 2PFVA 1BR4A 3F2EA 4EYUA 2FBWA 3OPCA 3T1YT 2W63A 2LOPA 3RRCA 5FY0A 5FXXA 3ZCIA 2N1GA 4XAXB 5AQLB 5FY7A 4ZI3D 2CEAA 4KHPT 3N9LA 4IE5A 3GA8A 1WCRA 1W09A 1MIVA 2A2FX 3UQ7A 4TNWA 4PW8A 2WSSV 4U74A 4BJNA 5AQIB 2BG9E 3NWIA 1D0ZA 5AQPB 3ZT7A 2LRLA 1IAPA 3IA3A 1OEDB 4ZS2A 2X51A 1E7PA 3Q5WA 4WW0A 3NKZA 2HH7A 2B1EA 4L5GA 4DBRA 2XHEB 5LYJE 2V26A 2Y6XA 1YD8G 5ETWA 5L3FB 2LKGA 1LRZA 2BKOA 3P50A 3RKGA 2E9XB 3EHZA 2B76A 2YU2A 1IZNB 3N2GE 3RHWA 1VOMA 2MYSA 4TV9E 3FZKB 1Z8UA 5KX5E 1O3XA 4DV1T 3NBXX 5DJQC 2CHNA 3R6NA 4TNVA 2E5VA 5J2TE 2WBLA 2XQ6A 3CQGB 4YTMA 5EK4A 3RRWA 3PDYA 5LGTB 5TAOA 4X64T 3HA4A 4DV4T 2WZIA 2UXCT 4C91A 1OEDE 2UXBT 4IL9A 1CHUA 3HKDE 5LA6E 4AQFC 4DR5T 2D0TA 4CZZB 2IDOB 1HTJF 3ANWA 3VKHA 4EV6A 4AKGA 3AE2A 5LJMA 2BBHA 4DBQA 2BDEA 4EAHA 4DR1T 4B3TT 3A5XA 2BZBA 2YN6A 1VCSA 1FIOA 1KNRA 2PTFA 2X9HA 1S94A 3FXEB 3MJXA 2GK9A 5HEOA 4UV9B 4X1YE 4PNIA 5AQQB 3BK9A 3ZKRA 3D0TA 3ZJ2A 4AKRB 2CPTA 4J2CA 3O1JA 1IBKT 3O9XA 5F5WA 4PJLA 3AAAB 4O4HE 5H6RB 5ABFB 3KBUA 4GYSA 4HKAA 4HWCA 3AEBA 4QXHB 3ZSSA 1XMQT 4YLHA 2PJQA 4QH1A 3LK42 4O2BE 4A98A 5L3GB 5LG3A 2KT9A 2XQ9A 2V7LA 3ZEFB 3C4XA 3PUXF 5HEHA 5H6QB 4F6RC 4HWFA 5FXZA 4P0AA 1ZP0A 1FMVA 3I9YA 3ZC0A 2VB6A 2JIWA 4HFHA 5J0ZA 2E5LT 5FMNA 4COFA 4YFSA 4DMVA 2WCAA 1D1CA 2XPKA 3VRAA 2FJDA 4AKHA 5LG4A 2KWIB 2VURA 4QX7B 1E2AA 2LHNA 2V5CA 2FUPA 2XQ4A 3ZYKA 3Q5EA 3PUAA 1SHZC 4DR2T 5E0OA 3HKEE 2HN1A 4EGWA 3KV5A 3L09A 3WAKA 3QOFA 4P0BA 3AA6B 1MMDA 2VKOA 3NVOA 3P4RA 1SE7A 2DWKA 3JAFA 1OEDC 1LKXA 1UGOA 1WR6A 3IHRA 4HFCA 5FVLA 3WI3A 3ZSTA 1W9RA 4GK5E 2CBIA 1WRDA 3AXJA 2M6IA 3RF1A 3X1DA 2IC6A 4EZ4A 3F31A 4AISA 2N9DA 4EB6E 1VCTA 5HXEA 5HCMA 3UUMA 3UT5E 4KHZF 3RC3A 3CQXC 3UTKA 2KSRA 3AE6A 5AQFB 4H9RC 3OYZA 5FL1A 1I6ZA 1HX1B 2G0UA 1T8BA 1YKHB 3Q2MA 5A1LA 1KNZA 4XBFB 2DL1A 4KX6A 2ES0A 4UV8B 4GOUA 3SOLA 4B3ST 2I0MA 5CA0E 4CN6A 1HG5A 3AE1A 5JREA 4QKNA 4LF7T 4I4TE 2BS4A 3QB5K 4ZXLA 2Q9QA 2X0LB 1NEKA 4IDQA 3J9X1 5C2TA 3JC6C 5C3JA 2RP4A 4GIWA 1OWAA 1M7KA 5FL0A 4Q25A 4YHHT 1T98A 4B3RT 2NOXA 3EUHA 5LOVE 1WYCA 2CLYC 1OXZA 3AE3A 4CI1B 3PUGA 3QNUA 3N9NA 3LK2B 4WYVA 3PU8A 2NR4A 4ZS3A 2IMLA 2V5DA 3W15B 1BR2A 4DV5T 4MALA 2DWGA 2WP9A 5HCJA 4EYYR 5FXVA 4EIWA 1D0XA 4ILCA 2XQYA 3SWHA 2KINB 3HR0A 3O1IA 1MMNA 1KFYA 1MNEA 4HFIA 4HEAA 5JVDE 5HEGA 4ILBA 3PUVF 1HG2A 4ZI7E 3RQUA 4LFCT 3RC8A 2JPFA 2XAFB 2YDSA 5C8YE 2NW8A 3PTRB 3ZYLA 5CJ5A 3OTOT 3T1HT 4JI4T 4JI7T 2R6GF 3AAEB 4IL4A 3RYHE 3UU4A 3SFDA 4CQIA 5J2UE 3Q5XA 4IHJE 2C5IT 3P7IA 4JEHB 2VL0A 4X20E 4DV3T 4HFBA 5LXTE 2BKNA 2ACZA 2CXFA 2W66A 3A8YC 3MXZA 3NZPA 5L4HA 1KNPA 5AQNB 2JRKA 1U4QA 2NTYA 2XQ5A 2BBJA 4HWIB 3LFMA 4FI5A 5AQMB 4CI2B 4E7ZA 5IWAT 3B5MA 5LCYA 2MOZA 1W0AA 3AB3B 3ONXA 3KDSE 2CE7A 4JV5T 1E1HB 3C4WA 3CMLA 4IE6A 3ZMVB 5CB4E 4GYRA 3P4SA 3MK7C 4YSXA 2V7MA 2V6YB 3AEGA 3DP7A 3N2KE 1NAFA 4M1PA 1N34T 2LSKA 3N2OA 2Q9QB 5FY1A 5IHYA 5JDNA 3JAEA 4HWDA 4MHCA 4JI1T 3E22E 3E0ZA 2X0HA 2X68A 5AQSB 5HXSA 2XQAA 4IE7A 3RPUA 3G06A 2YKSA 3K3QC 5JDMA 5JR9B 4F8HA 1H7CA 2KWHA 2N2NA 3AE4A 4A56A 4DR7T 2JQKA 2CRBA 2X67A 4TV8E 3CPZA 2VASA 3LBXA 4HWHA 2W61A 3LBXB 4X5TA 4O2AE 3RIAA 2QGSA 3AA7B 2CWYA 3CX8B 4OX9T 3ZMTB 3UU6A 4UELA 2WDVA 3K8PC 4I0UA 3MACA 3FB2A 2EHOB 4NPPA 1D1AA 1Y64B 3TLVA 2LM9A 3UULA 3HKBE 3PE0A 2H3RA 5JRCA 2A9UA 2WZHA 4ZZBA 1QLBA 3ZCJA 3V5SA 2V6YA 4IDNA 4YHJA 1LVKA 3RYCE 2CWOA 4CI3B 1SA0E 3WAJA 4DUZT 3PJAA 3AEAA 1ZOYA 2QA7A 3PUWF 2UU9T 4IE4A 2XM1A 1YKEB 2QRXA 2QVAA 4H9QC 4LF8T 4Z91A 1GQEA 1MMGA 3OJAA 3PUQA 4JLEA 4WBOA 4UVAB 4JI2T 2LLYA 5F3JA 3C51A 1DU2A 2BG9A 5LGNB 1WFDA 3KVBA 3ZMUB 3N9QA 4JBWF 2FJAA 2PG8A 2J47A 5HWYA 4FJOA 5AQGB 2WU5A 4TN7B 5AQKB 3ZN1B 2JQHA 2W00A 3RIUA 1ZHCA 2Q9QD 4B6XA 1X9BA 2CA5A 3I0QA 1HX8A 2JQQA 2DLRA 4HGAA 5JR9C 4TZ4C 2LEHA 4DV0T 4IIJE 2LOSA 2FJBA 3HI2A 5BMVE 4DR6T 3MZKB 3UFGA 4YY3T 5GONE 2Y8DA 3CQCB 3AEEA 3EABA 2CBJA 2BG9B 3ONLC 2HPJA 4U2ZA 3VR9A 4CN4A 4DR3T 2I59A 2MPKA 5F8PA 3ZMZB 2VWAA 4KUMB 2NP9A 2JMKA 2Y48B 2QYWA 4BAYB 1UURA 3K3OA 4Z8XA 2WWVA 4C90A 2XSBA 4NUUA 2X66A 3L3PA 1FJGT 1CUNA 2J4GA 1XWMA 3LDQB 5JTGA 2L8KA 3RLFF 3JADA 3UQ4A 1N33T 2P9BA 4U33A 2PBIA 3AVRA 3PV0F 4LFAT 3LK3B 4ILAA 2WMOA 1ZKEA 4EXTA 2H89A 4I50E 3RIUC 4JYAT 4O8SA 4NUVA 4ZHQE 2V7IA 2EHOA 2YDRA 4IREA 1N36T 3Q5DA 3C4ZA 3EI0A 5AQUB 3NRYA 4DUYT 4AI6A 1MNDA 2D5UA 2XM2A 4PK6A 5HXCA 4KMCA 4DNDA 3N9MA 3ZLIA 2DI4A 2WY2A 4YSZA 2YINA 1YW0A 4O4IE 4LFBT 2UUAT 3KV9A 3ZMSB 2LSYA 2WQYA 3EDUA 2WB5A 3PU3A 4U72A 4LMJA 5EK2A 1MMAA 4NXMT 4P09A 4DR4T 1U5PA 2H7VC 1IJ5A 1R8IA 2KLQA 3BQLA 4PJMA 2EHOC 4QXBB 4ZOLE 2VKHA 3ZYMA 2V1DB 4IDOA 5HAXA 3PJAJ 5HXRA 3FXDB 3GN5A 3ABVA 3HL6A 3NZQA 4QH4A 4OYKA 4QX8B 3BQIA 1YXRA 3EAMA 2H7OA 4X1KE 5ABGA 3IF8B 4ADZA 1UX4A 2LE8A 4AQGA 5LHGB 1QUUA 1HNWT 4DV2T 1G73A 4V1Av 2XUEA 3CWZB 2V7KA 5IUXA 5HWXA 2W2UA 3I0OA 3P8CD 4X1IE 3ZN0B 2LHRA 4PAGA 3ZT6A 3OBVE 2VQET 1T7SA 3ZT5A 3RGLA 4ASKA 3TLSA 2MBGA 4YJ3E 4HN9A 4IGUA 1J1JA 3QK6A 4KBMB 5L3BB 4DV7T 4U7IA 3C50A 3AXJB 5CFBA 2UUCT 5ABHA 4TUYE 3M65A 4HFEA 3QUJA 3SFEA 1S35A 2HN2A 3ETVA 1Z0PA 1HS7A 2WDRA 2CCQA 4OYJA 2YK0A 1D0YA 3AE7A 5LBMA 3UU5A 3J7Yq 4K0KT 5LGUB 3DTOA 5EZYE 2C0SA 1KK7A 2XAQB 4CXXA 4IT4A 3SS1A 3U3IA 3VRBA 5LP6E 2ZM2A 3PUYF 2XQ3A 5FP3A 3FZHB 3TLTA 4ZEYA 1BR0A 2E2AA 3RYIE 4YTNA 4HE8A 5HEJA 5LJNA 3Q9DA 3M3ZB 3AVSA 4ISTA 4U2YA 5DABA 5LMUT 2V7JA 4IDZA 4UVBB 3SRZA 5M4YA 4TWHA 3VHLA 2DNXA 2VKDA 3NRXA 2KZ7B 1ZV4X 2LM2A 2MAWA 3E08A 3OKQA 4TWDA 4AXPA 4CXWA 1BR1A 1M62A 4EOZB 3IBPA 3TLWA 2XY8B 3AEFA 5BR8T 3UUBA 2ACXA 3C64A 1YQ3A 4AQFA 4CN1A 2AXDS 1XZYA 2RA1A 5JDHA 3TLUA 5JH7E 4H9NC 1X79A 3F57A 4JI6T 2WDQA 2IC9A 3AA0B 4KP3C 2OLTA 4OHFA 5LBQB 4DO0A 4YSYA 1WYBA 1NWMX 2CM0A 2Z6EA 3FZFB 2EHOD 5FNVE 2KMFA 5CGMA 3LJCA 4NXNT 4YTPA 1MIYA 1UCUA 2L9QA 2WMNA 3EVYA 3FBLA 3O4XE 5AFUL 4OK0A 4JI0T 4WZXA 5DQWA 5AQVB 3L8RA 2CXLA 2ZMAA 4DV6T 5J1GA 2CHOA 2D2SA 4CXYA 2NW7A 5AQHB 5LHHB 4GK0E 4Z90A 3H3AA 2ZLYA 2E8IA 3PUZF 2YOEA 4HFDA 2MTQA 2FJEA 3CX6B 4NIQA 1N32T 4UVCB 3S4UA 2ZM0A 3UU8A 4K0UA 3VR8A 3AECA 3FBZA 5HYAA 3VKGA 4AKIA 5LHIB 4X65T 4TX5A 3ETUA 4H63V 1HFAA 1IBMT 2X9WA 4UEMA 3EDVA 3GWHA 2LRKA 4YT0A 4L9IA 4GKKT 2YU1A 3RI5A 1SUMB 2E9XD 3MA9A 2WU2A 4HTEA 5JDFA 4O4JE 4PJNA 2VVNA 3CKDA 3RKOA 3ZC1A 3LG7A 2XSAA 5AQRB 5JR9A 3PURA 5L3EB 4KI0F 5FXWA 3ZJ1A 3K1SA 1FEWA 1WLXA 3JCFA 3N5LA 3RX6A 3U78A 4ANJA 1I94T 2UXXB 5KMGP 1XNQT 5ABFA 2IHR1 1XDOA 3MKDA 4ZI3C 1HNXT 5KDMC 4EZHA 3RIFA 4DMWA 1EZ3A 2KXPB 2W4XA 2JQ9A 3K3NA 4LF4T 2WM9A 1LVFA 4MLKA 5L2LA 3ESLA 3KFWX 2I6HA 2VK9A 2IW5B 5CA1E 2WWUA 4JI5T 3VU7H 1XNRT 5HXHA 2RPAA 3GN5B 3R84B 2BVMA 5JDGA 1Y01A 3B13A 2DHRA 2D9DA 3CIRA 4YXDA 3AE9A 3ANWB 4H63H 1D1BA 5LNKA 4QWNB 5JQGE 2V6XA 2XQ8A 1J5WA 1MIWA 1UX5A 4JI3T 1WR0A 3H37A 4LF9T 2H88A 5JRCB 2J62A 2VQFT 3ZPOA 4ISSA 2DCFA 4LMKA 5HEUA 2XQ7A 1KF6A 4IDPA 3T8OA 5AQJB 4YJ2E 4B3MT 4U7YA 1HNZT 2D0UA 4QXCB 5L3CB 2BVLA 2BS3A 2YEVC 2A3DA 2ZM8A 2OV9A 4UIGA 2NWBA 2BG9C 4A97A 4H9PC 4ZZCA 5IYZE 3FHNA 4AQYT 5KXJA 3A7MA 4PK4A 2YDQA 1VRBA 5L47A 3LSVA 5L3DB 4DVDA 1YQ4A 2W67A 3N9OA 2HPLA 3C98B 5AQTB 4DIDB 2C5JA 4ZI2D 1HR0T 4PK5A 3FZLB 5LMNT 1FMWA 3QB5A 4GKJT 3KV6A 1OEDA 2WAUA 3PUSA 4WNKA 5DQVA 4A5XA 5AQOB 4O4LE 4PFPA 1HF8A 2J1DG 2K3WA 4MBQA 4JI8T 1G8XA 2LJLA 3IEEA 4IE0A 2VL8A 3KINB 3UUXB 4L0RA 4UF0A 4I43B 3KV4A 4BA9A 5ADXL 1V9DA 2ODVA 3KVAA 4AIUA
chains in the Genus database with same CATH topology
1XMQT 2UUBT 5LMUT 1IBLT 4JI0T 5BR8T 1IBKT 2E5LT 2UU9T 4LF6T 4JI6T 4LF8T 2HHHT 4B3TT 4NXNT 4JI2T 2F4VT 4DR2T 4DV6T 4X66T 2UXDT 4DV0T 4X62T 1N32T 1J5ET 4DR6T 4YY3T 4X65T 4DR3T 1IBMT 1FJGT 4GKKT 4B3ST 4LF7T 1N33T 2ZM6T 4LFAT 4YHHT 4JYAT 3T1YT 1N36T 1I94T 4DV5T 4DUYT 1XNQT 4KHPT 1HNXT 4LFBT 2UUAT 4LF4T 4NXMT 4LFCT 4JI7T 3T1HT 3OTOT 4DR4T 4JI4T 4JI5T 1XNRT 4LF5T 4DV3T 1HNWT 4DV2T 4JI3T 4LF9T 2VQFT 4B3MT 4DUZT 1XMOT 5IWAT 4DV1T 1HNZT 4AQYT 2VQET 4X64T 4JV5T 2UXCT 4DV4T 2UXBT 4DR5T 1N34T 4DV7T 4JI1T 1HR0T 2UUCT 4DR1T 5LMNT 4GKJT 4DR7T 4B3RT 4JI8T 4K0KT 4OX9T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XMQ T;  2UUB T;  5LMU T;  1IBL T;  4JI0 T;  5BR8 T;  1IBK T;  2E5L T;  2UU9 T;  4LF6 T;  4JI6 T;  4LF8 T;  2HHH T;  4B3T T;  4NXN T;  4JI2 T;  2F4V T;  4DR2 T;  4DV6 T;  4X66 T;  2UXD T;  4DV0 T;  4X62 T;  1N32 T;  1J5E T;  4DR6 T;  4YY3 T;  4X65 T;  4DR3 T;  1IBM T;  1FJG T;  4GKK T;  4B3S T;  4LF7 T;  1N33 T;  2ZM6 T;  4LFA T;  4YHH T;  4JYA T;  3T1Y T;  1N36 T;  1I94 T;  4DV5 T;  4DUY T;  1XNQ T;  4KHP T;  1HNX T;  4LFB T;  2UUA T;  4LF4 T;  4NXM T;  4LFC T;  4JI7 T;  3T1H T;  3OTO T;  4DR4 T;  4JI4 T;  4JI5 T;  1XNR T;  4LF5 T;  4DV3 T;  1HNW T;  4DV2 T;  4JI3 T;  4LF9 T;  2VQF T;  4B3M T;  4DUZ T;  1XMO T;  5IWA T;  4DV1 T;  1HNZ T;  4AQY T;  2VQE T;  4X64 T;  4JV5 T;  2UXC T;  4DV4 T;  2UXB T;  4DR5 T;  1N34 T;  4DV7 T;  4JI1 T;  1HR0 T;  2UUC T;  4DR1 T;  5LMN T;  4GKJ T;  4DR7 T;  4B3R T;  4JI8 T;  4K0K T;  4OX9 T; 
#chains in the Genus database with same CATH topology
 2AE9 A;  2IIU A;  2LT3 A;  2XAG B;  2JMH A;  1US7 B;  2X9Y A;  3B57 A;  3FZM B;  3RYF E;  4I55 E;  2ODU A;  4PJJ A;  4U3C A;  2NTX A;  2UUB T;  2L3L A;  2VKJ A;  3CVR A;  2XAH B;  1UUS A;  3JC6 D;  4HFV A;  2E9X A;  3RH3 A;  1IBL T;  3BQK A;  2CLY B;  2W62 A;  3L39 A;  3P4P A;  4LML A;  4QH5 A;  4N78 D;  2M67 A;  4BJM A;  2K24 A;  3AE5 A;  4P1N A;  2E9X C;  5LB7 B;  1JNR A;  3DJB A;  4LF6 T;  2BS2 A;  4PFO A;  4ILU A;  1L0V A;  2C5K T;  2XAJ B;  3AA1 B;  1QSD A;  4JUY A;  5JDL A;  2HHH T;  2KND A;  5FYM A;  2LSI A;  2XAS B;  1KEY A;  2WS3 A;  5FKY A;  2F4V T;  4UF0 B;  4EED A;  5ABE A;  1NEN A;  3N9P A;  1T72 A;  4U31 A;  2UXN B;  2V8S V;  5EK3 A;  1W0B A;  3QC9 A;  4G2A A;  3OYX A;  3I9W A;  1B7T A;  5JDQ A;  2IUB A;  2K48 A;  2K9A A;  4ZI2 C;  3GMI A;  5FVK A;  4X66 T;  2XJ7 A;  2OA5 A;  2UXD T;  1AJ3 A;  4XZC A;  1UK5 A;  2SPC A;  3I1A A;  3AAI A;  4X62 T;  4EEB A;  3AE8 A;  2Q9Q C;  2CMR A;  3CX7 B;  3V5U A;  1J5E T;  4TWF A;  2A72 A;  2M6B A;  4G63 A;  3P4W A;  2K5B B;  5L4E A;  3HKC E;  4WBN E;  3H3M A;  2LSG A;  3P4Q A;  1XMO T;  2JJ9 A;  4UXN B;  2X0Y A;  3CK6 A;  2LKH A;  4JEU B;  3OVU A;  4H9O C;  2CXD A;  2XTL A;  3UU3 A;  3RQW A;  2NW9 A;  1HCI A;  3AED A;  3UFE A;  4AKL A;  4QHO A;  3KBT A;  4ERR A;  2VVS A;  4MFR A;  2IAK A;  2X9X A;  1IJ6 A;  1XDP A;  4LF5 T;  2BKP A;  2LSJ A;  1JNZ A;  4UR9 A;  2ZM6 T;  1ZEE A;  2XZE A;  3O1H A;  4H9S E;  4OFZ A;  4E7S A;  2W0G A;  3TKL B;  3ONJ A;  3UUN A;  2PFV A;  1BR4 A;  3F2E A;  4EYU A;  2FBW A;  3OPC A;  3T1Y T;  2W63 A;  2LOP A;  3RRC A;  5FY0 A;  5FXX A;  3ZCI A;  2N1G A;  4XAX B;  5AQL B;  5FY7 A;  4ZI3 D;  2CEA A;  4KHP T;  3N9L A;  4IE5 A;  3GA8 A;  1WCR A;  1W09 A;  1MIV A;  2A2F X;  3UQ7 A;  4TNW A;  4PW8 A;  2WSS V;  4U74 A;  4BJN A;  5AQI B;  2BG9 E;  3NWI A;  1D0Z A;  5AQP B;  3ZT7 A;  2LRL A;  1IAP A;  3IA3 A;  1OED B;  4ZS2 A;  2X51 A;  1E7P A;  3Q5W A;  4WW0 A;  3NKZ A;  2HH7 A;  2B1E A;  4L5G A;  4DBR A;  2XHE B;  5LYJ E;  2V26 A;  2Y6X A;  1YD8 G;  5ETW A;  5L3F B;  2LKG A;  1LRZ A;  2BKO A;  3P50 A;  3RKG A;  2E9X B;  3EHZ A;  2B76 A;  2YU2 A;  1IZN B;  3N2G E;  3RHW A;  1VOM A;  2MYS A;  4TV9 E;  3FZK B;  1Z8U A;  5KX5 E;  1O3X A;  4DV1 T;  3NBX X;  5DJQ C;  2CHN A;  3R6N A;  4TNV A;  2E5V A;  5J2T E;  2WBL A;  2XQ6 A;  3CQG B;  4YTM A;  5EK4 A;  3RRW A;  3PDY A;  5LGT B;  5TAO A;  4X64 T;  3HA4 A;  4DV4 T;  2WZI A;  2UXC T;  4C91 A;  1OED E;  2UXB T;  4IL9 A;  1CHU A;  3HKD E;  5LA6 E;  4AQF C;  4DR5 T;  2D0T A;  4CZZ B;  2IDO B;  1HTJ F;  3ANW A;  3VKH A;  4EV6 A;  4AKG A;  3AE2 A;  5LJM A;  2BBH A;  4DBQ A;  2BDE A;  4EAH A;  4DR1 T;  4B3T T;  3A5X A;  2BZB A;  2YN6 A;  1VCS A;  1FIO A;  1KNR A;  2PTF A;  2X9H A;  1S94 A;  3FXE B;  3MJX A;  2GK9 A;  5HEO A;  4UV9 B;  4X1Y E;  4PNI A;  5AQQ B;  3BK9 A;  3ZKR A;  3D0T A;  3ZJ2 A;  4AKR B;  2CPT A;  4J2C A;  3O1J A;  1IBK T;  3O9X A;  5F5W A;  4PJL A;  3AAA B;  4O4H E;  5H6R B;  5ABF B;  3KBU A;  4GYS A;  4HKA A;  4HWC A;  3AEB A;  4QXH B;  3ZSS A;  1XMQ T;  4YLH A;  2PJQ A;  4QH1 A;  3LK4 2;  4O2B E;  4A98 A;  5L3G B;  5LG3 A;  2KT9 A;  2XQ9 A;  2V7L A;  3ZEF B;  3C4X A;  3PUX F;  5HEH A;  5H6Q B;  4F6R C;  4HWF A;  5FXZ A;  4P0A A;  1ZP0 A;  1FMV A;  3I9Y A;  3ZC0 A;  2VB6 A;  2JIW A;  4HFH A;  5J0Z A;  2E5L T;  5FMN A;  4COF A;  4YFS A;  4DMV A;  2WCA A;  1D1C A;  2XPK A;  3VRA A;  2FJD A;  4AKH A;  5LG4 A;  2KWI B;  2VUR A;  4QX7 B;  1E2A A;  2LHN A;  2V5C A;  2FUP A;  2XQ4 A;  3ZYK A;  3Q5E A;  3PUA A;  1SHZ C;  4DR2 T;  5E0O A;  3HKE E;  2HN1 A;  4EGW A;  3KV5 A;  3L09 A;  3WAK A;  3QOF A;  4P0B A;  3AA6 B;  1MMD A;  2VKO A;  3NVO A;  3P4R A;  1SE7 A;  2DWK A;  3JAF A;  1OED C;  1LKX A;  1UGO A;  1WR6 A;  3IHR A;  4HFC A;  5FVL A;  3WI3 A;  3ZST A;  1W9R A;  4GK5 E;  2CBI A;  1WRD A;  3AXJ A;  2M6I A;  3RF1 A;  3X1D A;  2IC6 A;  4EZ4 A;  3F31 A;  4AIS A;  2N9D A;  4EB6 E;  1VCT A;  5HXE A;  5HCM A;  3UUM A;  3UT5 E;  4KHZ F;  3RC3 A;  3CQX C;  3UTK A;  2KSR A;  3AE6 A;  5AQF B;  4H9R C;  3OYZ A;  5FL1 A;  1I6Z A;  1HX1 B;  2G0U A;  1T8B A;  1YKH B;  3Q2M A;  5A1L A;  1KNZ A;  4XBF B;  2DL1 A;  4KX6 A;  2ES0 A;  4UV8 B;  4GOU A;  3SOL A;  4B3S T;  2I0M A;  5CA0 E;  4CN6 A;  1HG5 A;  3AE1 A;  5JRE A;  4QKN A;  4LF7 T;  4I4T E;  2BS4 A;  3QB5 K;  4ZXL A;  2Q9Q A;  2X0L B;  1NEK A;  4IDQ A;  3J9X 1;  5C2T A;  3JC6 C;  5C3J A;  2RP4 A;  4GIW A;  1OWA A;  1M7K A;  5FL0 A;  4Q25 A;  4YHH T;  1T98 A;  4B3R T;  2NOX A;  3EUH A;  5LOV E;  1WYC A;  2CLY C;  1OXZ A;  3AE3 A;  4CI1 B;  3PUG A;  3QNU A;  3N9N A;  3LK2 B;  4WYV A;  3PU8 A;  2NR4 A;  4ZS3 A;  2IML A;  2V5D A;  3W15 B;  1BR2 A;  4DV5 T;  4MAL A;  2DWG A;  2WP9 A;  5HCJ A;  4EYY R;  5FXV A;  4EIW A;  1D0X A;  4ILC A;  2XQY A;  3SWH A;  2KIN B;  3HR0 A;  3O1I A;  1MMN A;  1KFY A;  1MNE A;  4HFI A;  4HEA A;  5JVD E;  5HEG A;  4ILB A;  3PUV F;  1HG2 A;  4ZI7 E;  3RQU A;  4LFC T;  3RC8 A;  2JPF A;  2XAF B;  2YDS A;  5C8Y E;  2NW8 A;  3PTR B;  3ZYL A;  5CJ5 A;  3OTO T;  3T1H T;  4JI4 T;  4JI7 T;  2R6G F;  3AAE B;  4IL4 A;  3RYH E;  3UU4 A;  3SFD A;  4CQI A;  5J2U E;  3Q5X A;  4IHJ E;  2C5I T;  3P7I A;  4JEH B;  2VL0 A;  4X20 E;  4DV3 T;  4HFB A;  5LXT E;  2BKN A;  2ACZ A;  2CXF A;  2W66 A;  3A8Y C;  3MXZ A;  3NZP A;  5L4H A;  1KNP A;  5AQN B;  2JRK A;  1U4Q A;  2NTY A;  2XQ5 A;  2BBJ A;  4HWI B;  3LFM A;  4FI5 A;  5AQM B;  4CI2 B;  4E7Z A;  5IWA T;  3B5M A;  5LCY A;  2MOZ A;  1W0A A;  3AB3 B;  3ONX A;  3KDS E;  2CE7 A;  4JV5 T;  1E1H B;  3C4W A;  3CML A;  4IE6 A;  3ZMV B;  5CB4 E;  4GYR A;  3P4S A;  3MK7 C;  4YSX A;  2V7M A;  2V6Y B;  3AEG A;  3DP7 A;  3N2K E;  1NAF A;  4M1P A;  1N34 T;  2LSK A;  3N2O A;  2Q9Q B;  5FY1 A;  5IHY A;  5JDN A;  3JAE A;  4HWD A;  4MHC A;  4JI1 T;  3E22 E;  3E0Z A;  2X0H A;  2X68 A;  5AQS B;  5HXS A;  2XQA A;  4IE7 A;  3RPU A;  3G06 A;  2YKS A;  3K3Q C;  5JDM A;  5JR9 B;  4F8H A;  1H7C A;  2KWH A;  2N2N A;  3AE4 A;  4A56 A;  4DR7 T;  2JQK A;  2CRB A;  2X67 A;  4TV8 E;  3CPZ A;  2VAS A;  3LBX A;  4HWH A;  2W61 A;  3LBX B;  4X5T A;  4O2A E;  3RIA A;  2QGS A;  3AA7 B;  2CWY A;  3CX8 B;  4OX9 T;  3ZMT B;  3UU6 A;  4UEL A;  2WDV A;  3K8P C;  4I0U A;  3MAC A;  3FB2 A;  2EHO B;  4NPP A;  1D1A A;  1Y64 B;  3TLV A;  2LM9 A;  3UUL A;  3HKB E;  3PE0 A;  2H3R A;  5JRC A;  2A9U A;  2WZH A;  4ZZB A;  1QLB A;  3ZCJ A;  3V5S A;  2V6Y A;  4IDN A;  4YHJ A;  1LVK A;  3RYC E;  2CWO A;  4CI3 B;  1SA0 E;  3WAJ A;  4DUZ T;  3PJA A;  3AEA A;  1ZOY A;  2QA7 A;  3PUW F;  2UU9 T;  4IE4 A;  2XM1 A;  1YKE B;  2QRX A;  2QVA A;  4H9Q C;  4LF8 T;  4Z91 A;  1GQE A;  1MMG A;  3OJA A;  3PUQ A;  4JLE A;  4WBO A;  4UVA B;  4JI2 T;  2LLY A;  5F3J A;  3C51 A;  1DU2 A;  2BG9 A;  5LGN B;  1WFD A;  3KVB A;  3ZMU B;  3N9Q A;  4JBW F;  2FJA A;  2PG8 A;  2J47 A;  5HWY A;  4FJO A;  5AQG B;  2WU5 A;  4TN7 B;  5AQK B;  3ZN1 B;  2JQH A;  2W00 A;  3RIU A;  1ZHC A;  2Q9Q D;  4B6X A;  1X9B A;  2CA5 A;  3I0Q A;  1HX8 A;  2JQQ A;  2DLR A;  4HGA A;  5JR9 C;  4TZ4 C;  2LEH A;  4DV0 T;  4IIJ E;  2LOS A;  2FJB A;  3HI2 A;  5BMV E;  4DR6 T;  3MZK B;  3UFG A;  4YY3 T;  5GON E;  2Y8D A;  3CQC B;  3AEE A;  3EAB A;  2CBJ A;  2BG9 B;  3ONL C;  2HPJ A;  4U2Z A;  3VR9 A;  4CN4 A;  4DR3 T;  2I59 A;  2MPK A;  5F8P A;  3ZMZ B;  2VWA A;  4KUM B;  2NP9 A;  2JMK A;  2Y48 B;  2QYW A;  4BAY B;  1UUR A;  3K3O A;  4Z8X A;  2WWV A;  4C90 A;  2XSB A;  4NUU A;  2X66 A;  3L3P A;  1FJG T;  1CUN A;  2J4G A;  1XWM A;  3LDQ B;  5JTG A;  2L8K A;  3RLF F;  3JAD A;  3UQ4 A;  1N33 T;  2P9B A;  4U33 A;  2PBI A;  3AVR A;  3PV0 F;  4LFA T;  3LK3 B;  4ILA A;  2WMO A;  1ZKE A;  4EXT A;  2H89 A;  4I50 E;  3RIU C;  4JYA T;  4O8S A;  4NUV A;  4ZHQ E;  2V7I A;  2EHO A;  2YDR A;  4IRE A;  1N36 T;  3Q5D A;  3C4Z A;  3EI0 A;  5AQU B;  3NRY A;  4DUY T;  4AI6 A;  1MND A;  2D5U A;  2XM2 A;  4PK6 A;  5HXC A;  4KMC A;  4DND A;  3N9M A;  3ZLI A;  2DI4 A;  2WY2 A;  4YSZ A;  2YIN A;  1YW0 A;  4O4I E;  4LFB T;  2UUA T;  3KV9 A;  3ZMS B;  2LSY A;  2WQY A;  3EDU A;  2WB5 A;  3PU3 A;  4U72 A;  4LMJ A;  5EK2 A;  1MMA A;  4NXM T;  4P09 A;  4DR4 T;  1U5P A;  2H7V C;  1IJ5 A;  1R8I A;  2KLQ A;  3BQL A;  4PJM A;  2EHO C;  4QXB B;  4ZOL E;  2VKH A;  3ZYM A;  2V1D B;  4IDO A;  5HAX A;  3PJA J;  5HXR A;  3FXD B;  3GN5 A;  3ABV A;  3HL6 A;  3NZQ A;  4QH4 A;  4OYK A;  4QX8 B;  3BQI A;  1YXR A;  3EAM A;  2H7O A;  4X1K E;  5ABG A;  3IF8 B;  4ADZ A;  1UX4 A;  2LE8 A;  4AQG A;  5LHG B;  1QUU A;  1HNW T;  4DV2 T;  1G73 A;  4V1A v;  2XUE A;  3CWZ B;  2V7K A;  5IUX A;  5HWX A;  2W2U A;  3I0O A;  3P8C D;  4X1I E;  3ZN0 B;  2LHR A;  4PAG A;  3ZT6 A;  3OBV E;  2VQE T;  1T7S A;  3ZT5 A;  3RGL A;  4ASK A;  3TLS A;  2MBG A;  4YJ3 E;  4HN9 A;  4IGU A;  1J1J A;  3QK6 A;  4KBM B;  5L3B B;  4DV7 T;  4U7I A;  3C50 A;  3AXJ B;  5CFB A;  2UUC T;  5ABH A;  4TUY E;  3M65 A;  4HFE A;  3QUJ A;  3SFE A;  1S35 A;  2HN2 A;  3ETV A;  1Z0P A;  1HS7 A;  2WDR A;  2CCQ A;  4OYJ A;  2YK0 A;  1D0Y A;  3AE7 A;  5LBM A;  3UU5 A;  3J7Y q;  4K0K T;  5LGU B;  3DTO A;  5EZY E;  2C0S A;  1KK7 A;  2XAQ B;  4CXX A;  4IT4 A;  3SS1 A;  3U3I A;  3VRB A;  5LP6 E;  2ZM2 A;  3PUY F;  2XQ3 A;  5FP3 A;  3FZH B;  3TLT A;  4ZEY A;  1BR0 A;  2E2A A;  3RYI E;  4YTN A;  4HE8 A;  5HEJ A;  5LJN A;  3Q9D A;  3M3Z B;  3AVS A;  4IST A;  4U2Y A;  5DAB A;  5LMU T;  2V7J A;  4IDZ A;  4UVB B;  3SRZ A;  5M4Y A;  4TWH A;  3VHL A;  2DNX A;  2VKD A;  3NRX A;  2KZ7 B;  1ZV4 X;  2LM2 A;  2MAW A;  3E08 A;  3OKQ A;  4TWD A;  4AXP A;  4CXW A;  1BR1 A;  1M62 A;  4EOZ B;  3IBP A;  3TLW A;  2XY8 B;  3AEF A;  5BR8 T;  3UUB A;  2ACX A;  3C64 A;  1YQ3 A;  4AQF A;  4CN1 A;  2AXD S;  1XZY A;  2RA1 A;  5JDH A;  3TLU A;  5JH7 E;  4H9N C;  1X79 A;  3F57 A;  4JI6 T;  2WDQ A;  2IC9 A;  3AA0 B;  4KP3 C;  2OLT A;  4OHF A;  5LBQ B;  4DO0 A;  4YSY A;  1WYB A;  1NWM X;  2CM0 A;  2Z6E A;  3FZF B;  2EHO D;  5FNV E;  2KMF A;  5CGM A;  3LJC A;  4NXN T;  4YTP A;  1MIY A;  1UCU A;  2L9Q A;  2WMN A;  3EVY A;  3FBL A;  3O4X E;  5AFU L;  4OK0 A;  4JI0 T;  4WZX A;  5DQW A;  5AQV B;  3L8R A;  2CXL A;  2ZMA A;  4DV6 T;  5J1G A;  2CHO A;  2D2S A;  4CXY A;  2NW7 A;  5AQH B;  5LHH B;  4GK0 E;  4Z90 A;  3H3A A;  2ZLY A;  2E8I A;  3PUZ F;  2YOE A;  4HFD A;  2MTQ A;  2FJE A;  3CX6 B;  4NIQ A;  1N32 T;  4UVC B;  3S4U A;  2ZM0 A;  3UU8 A;  4K0U A;  3VR8 A;  3AEC A;  3FBZ A;  5HYA A;  3VKG A;  4AKI A;  5LHI B;  4X65 T;  4TX5 A;  3ETU A;  4H63 V;  1HFA A;  1IBM T;  2X9W A;  4UEM A;  3EDV A;  3GWH A;  2LRK A;  4YT0 A;  4L9I A;  4GKK T;  2YU1 A;  3RI5 A;  1SUM B;  2E9X D;  3MA9 A;  2WU2 A;  4HTE A;  5JDF A;  4O4J E;  4PJN A;  2VVN A;  3CKD A;  3RKO A;  3ZC1 A;  3LG7 A;  2XSA A;  5AQR B;  5JR9 A;  3PUR A;  5L3E B;  4KI0 F;  5FXW A;  3ZJ1 A;  3K1S A;  1FEW A;  1WLX A;  3JCF A;  3N5L A;  3RX6 A;  3U78 A;  4ANJ A;  1I94 T;  2UXX B;  5KMG P;  1XNQ T;  5ABF A;  2IHR 1;  1XDO A;  3MKD A;  4ZI3 C;  1HNX T;  5KDM C;  4EZH A;  3RIF A;  4DMW A;  1EZ3 A;  2KXP B;  2W4X A;  2JQ9 A;  3K3N A;  4LF4 T;  2WM9 A;  1LVF A;  4MLK A;  5L2L A;  3ESL A;  3KFW X;  2I6H A;  2VK9 A;  2IW5 B;  5CA1 E;  2WWU A;  4JI5 T;  3VU7 H;  1XNR T;  5HXH A;  2RPA A;  3GN5 B;  3R84 B;  2BVM A;  5JDG A;  1Y01 A;  3B13 A;  2DHR A;  2D9D A;  3CIR A;  4YXD A;  3AE9 A;  3ANW B;  4H63 H;  1D1B A;  5LNK A;  4QWN B;  5JQG E;  2V6X A;  2XQ8 A;  1J5W A;  1MIW A;  1UX5 A;  4JI3 T;  1WR0 A;  3H37 A;  4LF9 T;  2H88 A;  5JRC B;  2J62 A;  2VQF T;  3ZPO A;  4ISS A;  2DCF A;  4LMK A;  5HEU A;  2XQ7 A;  1KF6 A;  4IDP A;  3T8O A;  5AQJ B;  4YJ2 E;  4B3M T;  4U7Y A;  1HNZ T;  2D0U A;  4QXC B;  5L3C B;  2BVL A;  2BS3 A;  2YEV C;  2A3D A;  2ZM8 A;  2OV9 A;  4UIG A;  2NWB A;  2BG9 C;  4A97 A;  4H9P C;  4ZZC A;  5IYZ E;  3FHN A;  4AQY T;  5KXJ A;  3A7M A;  4PK4 A;  2YDQ A;  1VRB A;  5L47 A;  3LSV A;  5L3D B;  4DVD A;  1YQ4 A;  2W67 A;  3N9O A;  2HPL A;  3C98 B;  5AQT B;  4DID B;  2C5J A;  4ZI2 D;  1HR0 T;  4PK5 A;  3FZL B;  5LMN T;  1FMW A;  3QB5 A;  4GKJ T;  3KV6 A;  1OED A;  2WAU A;  3PUS A;  4WNK A;  5DQV A;  4A5X A;  5AQO B;  4O4L E;  4PFP A;  1HF8 A;  2J1D G;  2K3W A;  4MBQ A;  4JI8 T;  1G8X A;  2LJL A;  3IEE A;  4IE0 A;  2VL8 A;  3KIN B;  3UUX B;  4L0R A;  4UF0 A;  4I43 B;  3KV4 A;  4BA9 A;  5ADX L;  1V9D A;  2ODV A;  3KVA A;  4AIU A; 
#chains in the Genus database with same CATH homology
 1XMQ T;  2UUB T;  5LMU T;  1IBL T;  4JI0 T;  5BR8 T;  1IBK T;  2E5L T;  2UU9 T;  4LF6 T;  4JI6 T;  4LF8 T;  2HHH T;  4B3T T;  4NXN T;  4JI2 T;  2F4V T;  4DR2 T;  4DV6 T;  4X66 T;  2UXD T;  4DV0 T;  4X62 T;  1N32 T;  1J5E T;  4DR6 T;  4YY3 T;  4X65 T;  4DR3 T;  1IBM T;  1FJG T;  4GKK T;  4B3S T;  4LF7 T;  1N33 T;  2ZM6 T;  4LFA T;  4YHH T;  4JYA T;  3T1Y T;  1N36 T;  1I94 T;  4DV5 T;  4DUY T;  1XNQ T;  4KHP T;  1HNX T;  4LFB T;  2UUA T;  4LF4 T;  4NXM T;  4LFC T;  4JI7 T;  3T1H T;  3OTO T;  4DR4 T;  4JI4 T;  4JI5 T;  1XNR T;  4LF5 T;  4DV3 T;  1HNW T;  4DV2 T;  4JI3 T;  4LF9 T;  2VQF T;  4B3M T;  4DUZ T;  1XMO T;  5IWA T;  4DV1 T;  1HNZ T;  4AQY T;  2VQE T;  4X64 T;  4JV5 T;  2UXC T;  4DV4 T;  2UXB T;  4DR5 T;  1N34 T;  4DV7 T;  4JI1 T;  1HR0 T;  2UUC T;  4DR1 T;  5LMN T;  4GKJ T;  4DR7 T;  4B3R T;  4JI8 T;  4K0K T;  4OX9 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...