4AQYT

Structure of ribosome-apramycin complexes
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
99
structure length
99
Chain Sequence
RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAVQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RIBOSOMAL RNA
publication title Dissociation of Antibacterial Activity and Aminoglycoside Ototoxicity in the 4-Monosubstituted 2-Deoxystreptamine Apramycin.
pubmed doi rcsb
molecule tags Ribosome
total genus 30
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF01649 Ribosomal_S20p Ribosomal protein S20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4aqyT00
4JI6T 2UUCT 4GKJT 3OTOT 5LMUT 4X66T 1J5ET 4DR6T 4X62T 4DV7T 4X65T 3T1HT 1XMQT 4JI3T 4NXMT 4DUZT 4LF7T 4LF8T 4OX9T 1IBMT 4JI5T 1N32T 1N33T 4K0KT 2UXDT 1HNXT 4DV3T 2VQFT 4LF9T 4LF4T 4LF5T 4LF6T 1FJGT 4DR7T 4DV4T 1IBKT 4DR3T 1HNWT 4B3ST 4DV0T 4B3TT 2UXCT 4DR4T 2UU9T 4JI2T 5LMNT 4LFBT 4B3MT 1N34T 4JV5T 4JI4T 4B3RT 4DR1T 4JI1T 4LFCT 2HHHT 4YY3T 4X64T 4JI0T 2UUAT 5IWAT 1XMOT 4DV6T 5BR8T 4AQYT 4GKKT 1XNRT 4LFAT 4DV5T 4YHHT 1HNZT 4JI7T 4DV2T 4JI8T 1IBLT 4DR2T 1XNQT 2ZM6T 4KHPT 4DR5T 4NXNT 1I94T 4DUYT 2UUBT 2UXBT 4JYAT 1HR0T 4DV1T 3T1YT 2VQET 1N36T 2E5LT 2F4VT
chains in the Genus database with same CATH superfamily
4JI6T 5FMNA 2JQHA 4PAGA 4X66T 4I0UA 4DR6T 3FHNA 3N9OA 2N9DA 2BBJA 2CXDA 2A3DA 1WRDA 2VL0A 5JRCB 1E2AA 3TLUA 4PK5A 1D1BA 3N9LA 2DWKA 4CZZB 3FBZA 4HWCA 4UELA 2FJDA 3UU5A 2OA5A 4WZXA 4OYJA 5KX5E 2H3RA 2QA7A 4ZI7E 3IA3A 4CI2B 2C5KT 3DTOA 4JI1T 4ILBA 4ZHQE 4BAYB 3K3QC 1MMDA 1XMOT 5AQSB 5HWYA 3GN5A 2LRKA 1BR0A 4LFAT 2ACZA 2DI4A 2EHOA 3PUXF 4YSYA 2CM0A 2V7LA 3F2EA 5GONE 3I9YA 4UF0A 3O1JA 1HCIA 1SE7A 4ZXLA 2LHNA 2CBJA 3E08A 4DV1T 3T1YT 5JTGA 1HTJF 3C50A 4AKIA 3P8CD 2XM2A 2WU5A 1HG5A 3N2GE 2UUCT 4JUYA 1Y64B 2JMKA 3IEEA 3NZQA 1MMAA 5FNVE 3EABA 4NXMT 3LK2B 3CIRA 5AQLB 2N2NA 3N9NA 3R84B 1ZV4X 2WDQA 1MMNA 3B5MA 3CKDA 3FZMB 4C91A 2PJQA 3ANWB 2JQ9A 4HWFA 4U2ZA 3FBLA 3ZJ1A 4IDOA 4DV4T 4GIWA 3V5UA 2JMHA 3OJAA 3S4UA 1WR0A 1ZP0A 2XQ7A 3MACA 4Z90A 5CGMA 5L3CB 4JI4T 4U33A 2MOZA 3ZPOA 5L47A 5J0ZA 1HS7A 4IE7A 5JDQA 3AE6A 5L3GB 4JI0T 3P4WA 2YOEA 1W09A 2YN6A 4UV8B 1OEDE 5AQHB 4EYYR 1IBLT 1XNQT 2QGSA 2IAKA 3NRXA 4IDZA 2UXBT 5DQWA 3QB5A 5DABA 3HKEE 3UQ4A 4YSXA 4QXCB 1HFAA 2XQYA 2E5LT 5LBMA 3FXEB 3AAAB 2WY2A 4TWFA 1MIYA 4AKLA 2BG9C 1I6ZA 2UXNB 3C98B 2J1DG 2AE9A 5F3JA 3UT5E 4LF8T 4UR9A 3K8PC 2NP9A 4P0BA 2WQYA 1IBMT 3KV4A 1D0XA 3Q5XA 3VU7H 2LOPA 2WWUA 3AVSA 3ANWA 3JAFA 3PURA 1W9RA 4J2CA 4A56A 2UXDT 1MMGA 4CI3B 4OK0A 2BDEA 2WCAA 2NOXA 4AISA 1OEDB 5AQFB 1HNWT 2CPTA 4B3ST 4YJ3E 4DO0A 1W0AA 1HX1B 1UCUA 4ZZCA 4CXXA 3AE3A 3ZMSB 2VKDA 3KVAA 4YSZA 2UUAT 3ZMUB 3C4XA 2IMLA 4EIWA 2V5CA 1IJ5A 2IW5B 3ZMZB 4QH1A 4N78D 2XZEA 5DJQC 2KMFA 3L3PA 2NR4A 5JDNA 4C90A 2YDQA 5JR9C 3SWHA 3OBVE 2W0GA 3LBXA 3PUVF 5L2LA 2WB5A 1XMQT 3G06A 2OV9A 4FI5A 3CQGB 4U2YA 3ZN1B 5L3BB 3QOFA 5LA6E 3KBUA 5L4HA 2DHRA 1T7SA 4U3CA 4JI5T 1N32T 1N33T 5FXWA 2VQFT 2K48A 3AE8A 5JDHA 2W4XA 1YKHB 1OEDA 3RC8A 3AECA 2HPJA 1KNRA 2XQ6A 2V7KA 4DR4T 1WR6A 4GYSA 4O8SA 4CN4A 5ADXL 3N2OA 3AEAA 4NIQA 3N5LA 5LCYA 3KDSE 1ZEEA 3MZKB 3HA4A 2Y8DA 3VHLA 2V8SV 1U5PA 2Y6XA 4E7ZA 4H9QC 4EYUA 3ZCIA 3RHWA 4KHPT 3W15B 5FP3A 3VRAA 3H3AA 2KNDA 1WYBA 3NBXX 4DUYT 4BA9A 1JNRA 2Q9QD 5ABGA 1NAFA 3I1AA 3LK3B 5AQIB 2V1DB 4I43B 4BJNA 1ZKEA 4AIUA 4DMWA 5IUXA 2XQ4A 4MHCA 5F8PA 1NWMX 3RYFE 4HFCA 4HKAA 5LHGB 4EOZB 3ZSSA 5ETWA 5JDGA 5AQVB 1LKXA 4ZI3D 1CHUA 3JAEA 3PE0A 2HN1A 5JQGE 4ANJA 4L5GA 1WCRA 3GA8A 3PUAA 2YKSA 1YQ4A 4UVBB 4TUYE 2XAHB 4TV9E 3RYCE 3UFEA 2UU9T 4XBFB 5LHIB 1Y01A 3DJBA 3ZYKA 2MPKA 3O9XA 3PU8A 3AE5A 3EDUA 4KX6A 4MLKA 4PJMA 2W61A 5HEHA 3AEDA 1R8IA 2WZHA 3AA7B 1YXRA 3LG7A 5AQTB 4EV6A 3UUNA 1VCSA 4IE0A 3PJAJ 5ABFA 4KI0F 3IHRA 5LYJE 4DV2T 5EK3A 4JI8T 2XY8B 4PJLA 2XM1A 3OKQA 3N9PA 3H3MA 2ODUA 2CMRA 3DP7A 4DR5T 2R6GF 2PG8A 1X9BA 3RYHE 5HCMA 3IBPA 3Q2MA 3GN5B 5HEGA 3TLVA 2E2AA 3RI5A 3NRYA 5LHHB 2XQ3A 3AE9A 5LJMA 3RIFA 5LG3A 3AA0B 4UF0B 2FUPA 2X66A 4IIJE 4IE6A 4XZCA 5J1GA 5AQJB 3BQLA 4NPPA 2P9BA 3ETUA 2A9UA 1G73A 2XQAA 2FJEA 2VKJA 1SUMB 4WBOA 4DR7T 2XSAA 4IGUA 4DR3T 1XDOA 2BS2A 5HEOA 1XDPA 3RC3A 2RA1A 3V5SA 3RGLA 5J2UE 3UQ7A 4AKGA 3PUSA 1KEYA 2YDSA 2BVLA 5FL0A 3EI0A 3AB3B 4LFCT 4DBQA 2CHNA 3L8RA 3ZMVB 2V6XA 2ZM8A 4K0UA 4L9IA 4QH5A 3ZN0B 3RYIE 2CLYB 2VURA 4Z8XA 3FB2A 4ZZBA 2CXLA 3UFGA 3AAEB 1MIWA 4WW0A 3MKDA 2KT9A 5L3DB 3JC6D 5FY7A 3A5XA 2H7VC 3ZT6A 4HTEA 1KFYA 5CA1E 3MXZA 3N9QA 5LMUT 4UEMA 3CQXC 2CRBA 2XJ7A 3T1HT 3F31A 4YLHA 1BR2A 3K1SA 4ISSA 4DMVA 4TWHA 2V7IA 5JVDE 5ABEA 2JQKA 3RQWA 4A98A 2DCFA 1GQEA 3MJXA 3U3IA 2IIUA 3AA6B 3CX8B 3CX7B 2YINA 2VK9A 4JLEA 5C3JA 4QKNA 4GYRA 2YDRA 3T8OA 4G63A 2JJ9A 3VR8A 2MAWA 4YT0A 3P50A 2EHOD 3ZC0A 3PUZF 1T8BA 4LMJA 1KK7A 1V9DA 2FJBA 5L4EA 4CN6A 1XWMA 2I6HA 5FY1A 2K9AA 3RH3A 2ES0A 3CPZA 5AQPB 1LRZA 2I0MA 5IHYA 1OXZA 3WAKA 2E9XA 2ACXA 3P4SA 2WU2A 1D0ZA 4NXNT 5CFBA 3HI2A 2FJAA 4KUMB 1YKEB 2Q9QC 4TNWA 2VQET 4ZI2C 3QK6A 3EHZA 4EZHA 2V6YB 5AQRB 5HXSA 4AQGA 5A1LA 3CK6A 4ASKA 2X68A 4G2AA 3ZJ2A 2D0TA 3LFMA 2X0YA 5TAOA 3P4PA 3JADA 3VKGA 3RRWA 4H9RC 3EUHA 3AEGA 2L8KA 5HCJA 3F57A 4ZI3C 2C5JA 4JEUB 4IREA 3H37A 2X67A 1O3XA 3LBXB 4IL9A 2VKOA 2CWYA 5HXEA 3BK9A 4B3TT 1FMWA 4TNVA 3KBTA 2HH7A 4O2BE 4KBMB 3HKCE 1L0VA 4B3MT 3TLWA 5KDMC 5JDFA 1HF8A 5H6QB 5L3EB 4NUUA 2WS3A 5IWAT 2BG9E 2CWOA 3RIUC 4ADZA 1Z0PA 4KHZF 3ZSTA 1WLXA 4X1KE 4DR2T 2X9YA 3MA9A 1H7CA 4AQFC 3CX6B 2YK0A 2X9WA 2UUBT 5CB4E 3Q5EA 3UTKA 4AKRB 2V6YA 2V7JA 4IE5A 3BQKA 4EAHA 4NUVA 2BS3A 5HXCA 4QHOA 3KVBA 4U7YA 2RPAA 3ZKRA 4X62T 5LGTB 4IDPA 5AQGB 4H9OC 2L3LA 4KP3C 5FKYA 2ODVA 2C5IT 3ZCJA 2VVSA 3VKHA 5LJNA 3ABVA 3EDVA 3KINB 2DWGA 3UU8A 4P09A 2KWIB 3P7IA 2KSRA 4LF6T 2VL8A 2J62A 4H9NC 1UX5A 2XAFB 2VB6A 4EXTA 4JI2T 3AXJB 3NZPA 3FXDB 4IDQA 4JV5T 2PTFA 1T98A 4B3RT 3AE4A 4DR1T 3PTRB 2C0SA 4TV8E 1DU2A 5LXTE 4OFZA 2I59A 2BBHA 2XAJB 1QSDA 4DV6T 4EGWA 4IE4A 4MALA 2ZM0A 4OHFA 5M4YA 4HFHA 4GKKT 3J9X1 4I55E 4YHHT 5FXZA 3WI3A 2B76A 4YJ2E 4AKHA 4TZ4C 3E0ZA 4PFPA 3A8YC 5FL1A 3ZEFB 4QX8B 3TKLB 3QC9A 2H88A 3UUXB 2F4VT 4WBNE 5ABFB 1SA0E 2BKNA 4EEBA 2X0LB 2LKGA 2BVMA 3AAIA 5F5WA 5JR9B 5HWXA 2K5BB 2UXXB 2BG9A 3Q9DA 1IJ6A 5HAXA 4DV3T 3GMIA 5LNKA 4LMLA 4LF5T 4A5XA 4EB6E 2HN2A 4Z91A 1FJGT 3B57A 2WWVA 3FZHB 2UXCT 3AXJA 2M6BA 1JNZA 3CVRA 3HL6A 3FZFB 5LGNB 4AXPA 4HFBA 2EHOC 1IZNB 3RIUA 4HFVA 4AI6A 4UIGA 4TX5A 5AQKB 1KNPA 2WSSV 2LSGA 3X1DA 3KV9A 3PUGA 3K3OA 1W0BA 4H63H 2KWHA 4A97A 1J5WA 1AJ3A 2Y48B 2QYWA 2X9XA 3OYXA 4GK0E 4HGAA 4U72A 4F6RC 3PUYF 5E0OA 4HE8A 3ZT5A 4M1PA 4EZ4A 3RX6A 4CQIA 3FZKB 4V1Av 5FVLA 2WM9A 4ZS3A 2NTXA 3OVUA 3SFDA 5JR9A 4HN9A 3OYZA 5LBQB 2ZMAA 2VKHA 2BKOA 2MBGA 1MNDA 5C8YE 3ONXA 4X5TA 4P1NA 3D0TA 2YU2A 3FZLB 5HEJA 1MNEA 3KV6A 2BKPA 4U31A 2NWBA 1FIOA 2NW8A 2FBWA 4O4IE 5KXJA 2V7MA 3Q5WA 4XAXB 2H7OA 4B6XA 2CHOA 5KMGP 5L3FB 4IHJE 2JRKA 3O4XE 5JREA 3EVYA 4JYAT 1HR0T 3LJCA 3K3NA 5AQQB 2CXFA 2E5VA 1NENA 4YTMA 4YXDA 4HWIB 4ILCA 2E9XB 3N2KE 4PK6A 3PU3A 2LHRA 3N9MA 5FXXA 5EK4A 1S35A 4O2AE 4HFEA 2L9QA 2XPKA 2V26A 2PBIA 3SRZA 3UU3A 3ZYMA 5EZYE 4LF4T 3RPUA 1KF6A 2QRXA 3NKZA 2WAUA 4UXNB 4O4HE 2BZBA 3AE1A 4QWNB 4QXHB 2XASB 2ZM2A 4HFIA 2K3WA 3L39A 2ZLYA 3QB5K 4KMCA 4U7IA 4YY3T 2HHHT 2N1GA 3OPCA 2LOSA 3QUJA 2LSYA 4YTPA 3M65A 2WDRA 2XAQB 4AQYT 4CN1A 2IHR1 5JDMA 3JCFA 4ILAA 5LP6E 1T72A 4GK5E 1ZOYA 2IC6A 4TWDA 2ZM6T 3UU4A 2WP9A 4UVAB 5JRCA 4P0AA 3TLSA 2LKHA 3EAMA 4YHJA 3AE7A 1E7PA 3C4WA 1KNZA 3E22E 4X1YE 5AQOB 3RIAA 2LSJA 3HR0A 1VCTA 5FY0A 3J7Yq 4HWHA 4ZEYA 1MIVA 4LF7T 5HXRA 3PV0F 3C4ZA 1OEDC 2XQ5A 3AE2A 2CE7A 2CBIA 2D9DA 3A7MA 1QLBA 3P4QA 4OX9T 3KV5A 4HEAA 3M3ZB 3C51A 3HKBE 1OWAA 2NW9A 5J2TE 4X1IE 1ZHCA 3SOLA 1HNXT 3U78A 5LOVE 4ZS2A 1YD8G 2DL1A 4UVCB 3ZYLA 4YTNA 2JQQA 2CEAA 4DBRA 3SFEA 4MFRA 5H6RB 2WBLA 3KFWX 2WMOA 1D1CA 2XQ8A 1WFDA 4X64T 4ZOLE 2E9XD 1VRBA 4HWDA 1XNRT 2WDVA 4L0RA 4FJOA 2W00A 2WMNA 1WYCA 3ONJA 2GK9A 2OLTA 3UU6A 4YFSA 1VOMA 3PDYA 2XHEB 4X20E 2YEVC 2X9HA 3IF8B 4COFA 2CA5A 1D1AA 2A72A 2LLYA 2VVNA 2VWAA 4BJMA 4PNIA 5FVKA 2DLRA 4GKJT 2LSKA 3OTOT 2E8IA 1IAPA 1J5ET 5HXHA 4X65T 2KLQA 4QX7B 5ABHA 2V5DA 4JEHB 4DUZT 2Q9QB 3UULA 2G0UA 4CXYA 4E7SA 5HYAA 1YQ3A 2LJLA 4I4TE 3QNUA 3LSVA 1U4QA 5AQMB 2XSBA 3AA1B 4DV0T 5DQVA 3RQUA 4ISTA 1SHZC 1LVKA 2SPCA 3UUMA 3RKGA 1G8XA 3SS1A 1UGOA 4PJJA 4IT4A 1N34T 4HFDA 2LT3A 3RKOA 2BG9B 1LVFA 2LSIA 2KINB 1S94A 3ESLA 1YW0A 3UUBA 3ZMTB 3I0QA 2VASA 2B1EA 5LGUB 4DV5T 3PUQA 3PUWF 2X0HA 2LE8A 3RLFF 3AVRA 2DNXA 4H9PC 3LDQB 5BMVE 4O4LE 1M62A 2IC9A 4ERRA 1BR1A 1UK5A 2KZ7B 1FMVA 2D0UA 3AEFA 3P4RA 2M67A 1N36T 4H63V 3O1IA 4GOUA 4MBQA 5FYMA 4JI3T 1M7KA 2Q9QA 3C64A 3JC6C 2NW7A 5IYZE 4O4JE 2IDOB 4JBWF 3CWZB 1B7TA 2QVAA 3CMLA 1US7B 4IL4A 4K0KT 4H9SE 3ZC1A 2Z6EA 1HG2A 2LM2A 2LEHA 2KXPB 5JDLA 2W2UA 2D5UA 2W66A 4LFBT 5AFUL 2MYSA 1X79A 2D2SA 4DVDA 2H89A 3CQCB 2LRLA 2BS4A 3I9WA 4CI1B 4IDNA 5BR8T 4QH4A 1Z8UA 2XQ9A 4ZI2D 2YU1A 5FXVA 1QUUA 2AXDS 1HNZT 3AEEA 3ZT7A 4LMKA 4WYVA 2A2FX 2W67A 2W62A 4F8HA 4PK4A 3ONLC 2J47A 3LK42 4CXWA 2XUEA 3NWIA 4DNDA 1UURA 5EK2A 2JPFA 5LG4A 2LM9A 1UUSA 2XTLA 4AQFA 4WNKA 3GWHA 2X51A 1HX8A 3MK7C 4DV7T 3WAJA 3VRBA 1BR4A 3R6NA 1UX4A 4PJNA 2JIWA 1EZ3A 3RF1A 3TLTA 2PFVA 5LB7B 4PFOA 4LF9T 2CCQA 4EEDA 1IBKT 3BQIA 4PW8A 1XZYA 3B13A 1J1JA 5AQUB 2W63A 5LMNT 2CLYC 5C2TA 3O1HA 4DIDB 3PJAA 5CJ5A 1FEWA 1CUNA 3NVOA 1E1HB 2IUBA 3HKDE 4ILUA 5JH7E 4OYKA 2K24A 1NEKA 5HEUA 2E9XC 3I0OA 2WZIA 3ZLIA 3Q5DA 2J4GA 3ETVA 3RRCA 4JI7T 2EHOB 2XAGB 4TN7B 3L09A 3VR9A 4Q25A 4UV9B 2M6IA 1D0YA 2NTYA 4I50E 2MTQA 1I94T 4U74A 5CA0E 2RP4A 5AQNB 3AEBA 2HPLA 4QXBB
chains in the Genus database with same CATH topology
4JI6T 2UUCT 4GKJT 3OTOT 5LMUT 4X66T 1J5ET 4DR6T 4X62T 4DV7T 4X65T 3T1HT 1XMQT 4JI3T 4NXMT 4DUZT 4LF7T 4LF8T 4OX9T 1IBMT 4JI5T 1N32T 1N33T 4K0KT 2UXDT 1HNXT 4DV3T 2VQFT 4LF9T 4LF4T 4LF5T 4LF6T 1FJGT 4DR7T 4DV4T 1IBKT 4DR3T 1HNWT 4B3ST 4DV0T 4B3TT 2UXCT 4DR4T 2UU9T 4JI2T 5LMNT 4LFBT 4B3MT 1N34T 4JV5T 4JI4T 4B3RT 4DR1T 4JI1T 4LFCT 2HHHT 4YY3T 4X64T 4JI0T 2UUAT 5IWAT 1XMOT 4DV6T 5BR8T 4AQYT 4GKKT 1XNRT 4LFAT 4DV5T 4YHHT 1HNZT 4JI7T 4DV2T 4JI8T 1IBLT 4DR2T 1XNQT 2ZM6T 4KHPT 4DR5T 4NXNT 1I94T 4DUYT 2UUBT 2UXBT 4JYAT 1HR0T 4DV1T 3T1YT 2VQET 1N36T 2E5LT 2F4VT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 T;  2UUC T;  4GKJ T;  3OTO T;  5LMU T;  4X66 T;  1J5E T;  4DR6 T;  4X62 T;  4DV7 T;  4X65 T;  3T1H T;  1XMQ T;  4JI3 T;  4NXM T;  4DUZ T;  4LF7 T;  4LF8 T;  4OX9 T;  1IBM T;  4JI5 T;  1N32 T;  1N33 T;  4K0K T;  2UXD T;  1HNX T;  4DV3 T;  2VQF T;  4LF9 T;  4LF4 T;  4LF5 T;  4LF6 T;  1FJG T;  4DR7 T;  4DV4 T;  1IBK T;  4DR3 T;  1HNW T;  4B3S T;  4DV0 T;  4B3T T;  2UXC T;  4DR4 T;  2UU9 T;  4JI2 T;  5LMN T;  4LFB T;  4B3M T;  1N34 T;  4JV5 T;  4JI4 T;  4B3R T;  4DR1 T;  4JI1 T;  4LFC T;  2HHH T;  4YY3 T;  4X64 T;  4JI0 T;  2UUA T;  5IWA T;  1XMO T;  4DV6 T;  5BR8 T;  4AQY T;  4GKK T;  1XNR T;  4LFA T;  4DV5 T;  4YHH T;  1HNZ T;  4JI7 T;  4DV2 T;  4JI8 T;  1IBL T;  4DR2 T;  1XNQ T;  2ZM6 T;  4KHP T;  4DR5 T;  4NXN T;  1I94 T;  4DUY T;  2UUB T;  2UXB T;  4JYA T;  1HR0 T;  4DV1 T;  3T1Y T;  2VQE T;  1N36 T;  2E5L T;  2F4V T; 
#chains in the Genus database with same CATH topology
 4JI6 T;  5FMN A;  2JQH A;  4PAG A;  4X66 T;  4I0U A;  4DR6 T;  3FHN A;  3N9O A;  2N9D A;  2BBJ A;  2CXD A;  2A3D A;  1WRD A;  2VL0 A;  5JRC B;  1E2A A;  3TLU A;  4PK5 A;  1D1B A;  3N9L A;  2DWK A;  4CZZ B;  3FBZ A;  4HWC A;  4UEL A;  2FJD A;  3UU5 A;  2OA5 A;  4WZX A;  4OYJ A;  5KX5 E;  2H3R A;  2QA7 A;  4ZI7 E;  3IA3 A;  4CI2 B;  2C5K T;  3DTO A;  4JI1 T;  4ILB A;  4ZHQ E;  4BAY B;  3K3Q C;  1MMD A;  1XMO T;  5AQS B;  5HWY A;  3GN5 A;  2LRK A;  1BR0 A;  4LFA T;  2ACZ A;  2DI4 A;  2EHO A;  3PUX F;  4YSY A;  2CM0 A;  2V7L A;  3F2E A;  5GON E;  3I9Y A;  4UF0 A;  3O1J A;  1HCI A;  1SE7 A;  4ZXL A;  2LHN A;  2CBJ A;  3E08 A;  4DV1 T;  3T1Y T;  5JTG A;  1HTJ F;  3C50 A;  4AKI A;  3P8C D;  2XM2 A;  2WU5 A;  1HG5 A;  3N2G E;  2UUC T;  4JUY A;  1Y64 B;  2JMK A;  3IEE A;  3NZQ A;  1MMA A;  5FNV E;  3EAB A;  4NXM T;  3LK2 B;  3CIR A;  5AQL B;  2N2N A;  3N9N A;  3R84 B;  1ZV4 X;  2WDQ A;  1MMN A;  3B5M A;  3CKD A;  3FZM B;  4C91 A;  2PJQ A;  3ANW B;  2JQ9 A;  4HWF A;  4U2Z A;  3FBL A;  3ZJ1 A;  4IDO A;  4DV4 T;  4GIW A;  3V5U A;  2JMH A;  3OJA A;  3S4U A;  1WR0 A;  1ZP0 A;  2XQ7 A;  3MAC A;  4Z90 A;  5CGM A;  5L3C B;  4JI4 T;  4U33 A;  2MOZ A;  3ZPO A;  5L47 A;  5J0Z A;  1HS7 A;  4IE7 A;  5JDQ A;  3AE6 A;  5L3G B;  4JI0 T;  3P4W A;  2YOE A;  1W09 A;  2YN6 A;  4UV8 B;  1OED E;  5AQH B;  4EYY R;  1IBL T;  1XNQ T;  2QGS A;  2IAK A;  3NRX A;  4IDZ A;  2UXB T;  5DQW A;  3QB5 A;  5DAB A;  3HKE E;  3UQ4 A;  4YSX A;  4QXC B;  1HFA A;  2XQY A;  2E5L T;  5LBM A;  3FXE B;  3AAA B;  2WY2 A;  4TWF A;  1MIY A;  4AKL A;  2BG9 C;  1I6Z A;  2UXN B;  3C98 B;  2J1D G;  2AE9 A;  5F3J A;  3UT5 E;  4LF8 T;  4UR9 A;  3K8P C;  2NP9 A;  4P0B A;  2WQY A;  1IBM T;  3KV4 A;  1D0X A;  3Q5X A;  3VU7 H;  2LOP A;  2WWU A;  3AVS A;  3ANW A;  3JAF A;  3PUR A;  1W9R A;  4J2C A;  4A56 A;  2UXD T;  1MMG A;  4CI3 B;  4OK0 A;  2BDE A;  2WCA A;  2NOX A;  4AIS A;  1OED B;  5AQF B;  1HNW T;  2CPT A;  4B3S T;  4YJ3 E;  4DO0 A;  1W0A A;  1HX1 B;  1UCU A;  4ZZC A;  4CXX A;  3AE3 A;  3ZMS B;  2VKD A;  3KVA A;  4YSZ A;  2UUA T;  3ZMU B;  3C4X A;  2IML A;  4EIW A;  2V5C A;  1IJ5 A;  2IW5 B;  3ZMZ B;  4QH1 A;  4N78 D;  2XZE A;  5DJQ C;  2KMF A;  3L3P A;  2NR4 A;  5JDN A;  4C90 A;  2YDQ A;  5JR9 C;  3SWH A;  3OBV E;  2W0G A;  3LBX A;  3PUV F;  5L2L A;  2WB5 A;  1XMQ T;  3G06 A;  2OV9 A;  4FI5 A;  3CQG B;  4U2Y A;  3ZN1 B;  5L3B B;  3QOF A;  5LA6 E;  3KBU A;  5L4H A;  2DHR A;  1T7S A;  4U3C A;  4JI5 T;  1N32 T;  1N33 T;  5FXW A;  2VQF T;  2K48 A;  3AE8 A;  5JDH A;  2W4X A;  1YKH B;  1OED A;  3RC8 A;  3AEC A;  2HPJ A;  1KNR A;  2XQ6 A;  2V7K A;  4DR4 T;  1WR6 A;  4GYS A;  4O8S A;  4CN4 A;  5ADX L;  3N2O A;  3AEA A;  4NIQ A;  3N5L A;  5LCY A;  3KDS E;  1ZEE A;  3MZK B;  3HA4 A;  2Y8D A;  3VHL A;  2V8S V;  1U5P A;  2Y6X A;  4E7Z A;  4H9Q C;  4EYU A;  3ZCI A;  3RHW A;  4KHP T;  3W15 B;  5FP3 A;  3VRA A;  3H3A A;  2KND A;  1WYB A;  3NBX X;  4DUY T;  4BA9 A;  1JNR A;  2Q9Q D;  5ABG A;  1NAF A;  3I1A A;  3LK3 B;  5AQI B;  2V1D B;  4I43 B;  4BJN A;  1ZKE A;  4AIU A;  4DMW A;  5IUX A;  2XQ4 A;  4MHC A;  5F8P A;  1NWM X;  3RYF E;  4HFC A;  4HKA A;  5LHG B;  4EOZ B;  3ZSS A;  5ETW A;  5JDG A;  5AQV B;  1LKX A;  4ZI3 D;  1CHU A;  3JAE A;  3PE0 A;  2HN1 A;  5JQG E;  4ANJ A;  4L5G A;  1WCR A;  3GA8 A;  3PUA A;  2YKS A;  1YQ4 A;  4UVB B;  4TUY E;  2XAH B;  4TV9 E;  3RYC E;  3UFE A;  2UU9 T;  4XBF B;  5LHI B;  1Y01 A;  3DJB A;  3ZYK A;  2MPK A;  3O9X A;  3PU8 A;  3AE5 A;  3EDU A;  4KX6 A;  4MLK A;  4PJM A;  2W61 A;  5HEH A;  3AED A;  1R8I A;  2WZH A;  3AA7 B;  1YXR A;  3LG7 A;  5AQT B;  4EV6 A;  3UUN A;  1VCS A;  4IE0 A;  3PJA J;  5ABF A;  4KI0 F;  3IHR A;  5LYJ E;  4DV2 T;  5EK3 A;  4JI8 T;  2XY8 B;  4PJL A;  2XM1 A;  3OKQ A;  3N9P A;  3H3M A;  2ODU A;  2CMR A;  3DP7 A;  4DR5 T;  2R6G F;  2PG8 A;  1X9B A;  3RYH E;  5HCM A;  3IBP A;  3Q2M A;  3GN5 B;  5HEG A;  3TLV A;  2E2A A;  3RI5 A;  3NRY A;  5LHH B;  2XQ3 A;  3AE9 A;  5LJM A;  3RIF A;  5LG3 A;  3AA0 B;  4UF0 B;  2FUP A;  2X66 A;  4IIJ E;  4IE6 A;  4XZC A;  5J1G A;  5AQJ B;  3BQL A;  4NPP A;  2P9B A;  3ETU A;  2A9U A;  1G73 A;  2XQA A;  2FJE A;  2VKJ A;  1SUM B;  4WBO A;  4DR7 T;  2XSA A;  4IGU A;  4DR3 T;  1XDO A;  2BS2 A;  5HEO A;  1XDP A;  3RC3 A;  2RA1 A;  3V5S A;  3RGL A;  5J2U E;  3UQ7 A;  4AKG A;  3PUS A;  1KEY A;  2YDS A;  2BVL A;  5FL0 A;  3EI0 A;  3AB3 B;  4LFC T;  4DBQ A;  2CHN A;  3L8R A;  3ZMV B;  2V6X A;  2ZM8 A;  4K0U A;  4L9I A;  4QH5 A;  3ZN0 B;  3RYI E;  2CLY B;  2VUR A;  4Z8X A;  3FB2 A;  4ZZB A;  2CXL A;  3UFG A;  3AAE B;  1MIW A;  4WW0 A;  3MKD A;  2KT9 A;  5L3D B;  3JC6 D;  5FY7 A;  3A5X A;  2H7V C;  3ZT6 A;  4HTE A;  1KFY A;  5CA1 E;  3MXZ A;  3N9Q A;  5LMU T;  4UEM A;  3CQX C;  2CRB A;  2XJ7 A;  3T1H T;  3F31 A;  4YLH A;  1BR2 A;  3K1S A;  4ISS A;  4DMV A;  4TWH A;  2V7I A;  5JVD E;  5ABE A;  2JQK A;  3RQW A;  4A98 A;  2DCF A;  1GQE A;  3MJX A;  3U3I A;  2IIU A;  3AA6 B;  3CX8 B;  3CX7 B;  2YIN A;  2VK9 A;  4JLE A;  5C3J A;  4QKN A;  4GYR A;  2YDR A;  3T8O A;  4G63 A;  2JJ9 A;  3VR8 A;  2MAW A;  4YT0 A;  3P50 A;  2EHO D;  3ZC0 A;  3PUZ F;  1T8B A;  4LMJ A;  1KK7 A;  1V9D A;  2FJB A;  5L4E A;  4CN6 A;  1XWM A;  2I6H A;  5FY1 A;  2K9A A;  3RH3 A;  2ES0 A;  3CPZ A;  5AQP B;  1LRZ A;  2I0M A;  5IHY A;  1OXZ A;  3WAK A;  2E9X A;  2ACX A;  3P4S A;  2WU2 A;  1D0Z A;  4NXN T;  5CFB A;  3HI2 A;  2FJA A;  4KUM B;  1YKE B;  2Q9Q C;  4TNW A;  2VQE T;  4ZI2 C;  3QK6 A;  3EHZ A;  4EZH A;  2V6Y B;  5AQR B;  5HXS A;  4AQG A;  5A1L A;  3CK6 A;  4ASK A;  2X68 A;  4G2A A;  3ZJ2 A;  2D0T A;  3LFM A;  2X0Y A;  5TAO A;  3P4P A;  3JAD A;  3VKG A;  3RRW A;  4H9R C;  3EUH A;  3AEG A;  2L8K A;  5HCJ A;  3F57 A;  4ZI3 C;  2C5J A;  4JEU B;  4IRE A;  3H37 A;  2X67 A;  1O3X A;  3LBX B;  4IL9 A;  2VKO A;  2CWY A;  5HXE A;  3BK9 A;  4B3T T;  1FMW A;  4TNV A;  3KBT A;  2HH7 A;  4O2B E;  4KBM B;  3HKC E;  1L0V A;  4B3M T;  3TLW A;  5KDM C;  5JDF A;  1HF8 A;  5H6Q B;  5L3E B;  4NUU A;  2WS3 A;  5IWA T;  2BG9 E;  2CWO A;  3RIU C;  4ADZ A;  1Z0P A;  4KHZ F;  3ZST A;  1WLX A;  4X1K E;  4DR2 T;  2X9Y A;  3MA9 A;  1H7C A;  4AQF C;  3CX6 B;  2YK0 A;  2X9W A;  2UUB T;  5CB4 E;  3Q5E A;  3UTK A;  4AKR B;  2V6Y A;  2V7J A;  4IE5 A;  3BQK A;  4EAH A;  4NUV A;  2BS3 A;  5HXC A;  4QHO A;  3KVB A;  4U7Y A;  2RPA A;  3ZKR A;  4X62 T;  5LGT B;  4IDP A;  5AQG B;  4H9O C;  2L3L A;  4KP3 C;  5FKY A;  2ODV A;  2C5I T;  3ZCJ A;  2VVS A;  3VKH A;  5LJN A;  3ABV A;  3EDV A;  3KIN B;  2DWG A;  3UU8 A;  4P09 A;  2KWI B;  3P7I A;  2KSR A;  4LF6 T;  2VL8 A;  2J62 A;  4H9N C;  1UX5 A;  2XAF B;  2VB6 A;  4EXT A;  4JI2 T;  3AXJ B;  3NZP A;  3FXD B;  4IDQ A;  4JV5 T;  2PTF A;  1T98 A;  4B3R T;  3AE4 A;  4DR1 T;  3PTR B;  2C0S A;  4TV8 E;  1DU2 A;  5LXT E;  4OFZ A;  2I59 A;  2BBH A;  2XAJ B;  1QSD A;  4DV6 T;  4EGW A;  4IE4 A;  4MAL A;  2ZM0 A;  4OHF A;  5M4Y A;  4HFH A;  4GKK T;  3J9X 1;  4I55 E;  4YHH T;  5FXZ A;  3WI3 A;  2B76 A;  4YJ2 E;  4AKH A;  4TZ4 C;  3E0Z A;  4PFP A;  3A8Y C;  5FL1 A;  3ZEF B;  4QX8 B;  3TKL B;  3QC9 A;  2H88 A;  3UUX B;  2F4V T;  4WBN E;  5ABF B;  1SA0 E;  2BKN A;  4EEB A;  2X0L B;  2LKG A;  2BVM A;  3AAI A;  5F5W A;  5JR9 B;  5HWX A;  2K5B B;  2UXX B;  2BG9 A;  3Q9D A;  1IJ6 A;  5HAX A;  4DV3 T;  3GMI A;  5LNK A;  4LML A;  4LF5 T;  4A5X A;  4EB6 E;  2HN2 A;  4Z91 A;  1FJG T;  3B57 A;  2WWV A;  3FZH B;  2UXC T;  3AXJ A;  2M6B A;  1JNZ A;  3CVR A;  3HL6 A;  3FZF B;  5LGN B;  4AXP A;  4HFB A;  2EHO C;  1IZN B;  3RIU A;  4HFV A;  4AI6 A;  4UIG A;  4TX5 A;  5AQK B;  1KNP A;  2WSS V;  2LSG A;  3X1D A;  3KV9 A;  3PUG A;  3K3O A;  1W0B A;  4H63 H;  2KWH A;  4A97 A;  1J5W A;  1AJ3 A;  2Y48 B;  2QYW A;  2X9X A;  3OYX A;  4GK0 E;  4HGA A;  4U72 A;  4F6R C;  3PUY F;  5E0O A;  4HE8 A;  3ZT5 A;  4M1P A;  4EZ4 A;  3RX6 A;  4CQI A;  3FZK B;  4V1A v;  5FVL A;  2WM9 A;  4ZS3 A;  2NTX A;  3OVU A;  3SFD A;  5JR9 A;  4HN9 A;  3OYZ A;  5LBQ B;  2ZMA A;  2VKH A;  2BKO A;  2MBG A;  1MND A;  5C8Y E;  3ONX A;  4X5T A;  4P1N A;  3D0T A;  2YU2 A;  3FZL B;  5HEJ A;  1MNE A;  3KV6 A;  2BKP A;  4U31 A;  2NWB A;  1FIO A;  2NW8 A;  2FBW A;  4O4I E;  5KXJ A;  2V7M A;  3Q5W A;  4XAX B;  2H7O A;  4B6X A;  2CHO A;  5KMG P;  5L3F B;  4IHJ E;  2JRK A;  3O4X E;  5JRE A;  3EVY A;  4JYA T;  1HR0 T;  3LJC A;  3K3N A;  5AQQ B;  2CXF A;  2E5V A;  1NEN A;  4YTM A;  4YXD A;  4HWI B;  4ILC A;  2E9X B;  3N2K E;  4PK6 A;  3PU3 A;  2LHR A;  3N9M A;  5FXX A;  5EK4 A;  1S35 A;  4O2A E;  4HFE A;  2L9Q A;  2XPK A;  2V26 A;  2PBI A;  3SRZ A;  3UU3 A;  3ZYM A;  5EZY E;  4LF4 T;  3RPU A;  1KF6 A;  2QRX A;  3NKZ A;  2WAU A;  4UXN B;  4O4H E;  2BZB A;  3AE1 A;  4QWN B;  4QXH B;  2XAS B;  2ZM2 A;  4HFI A;  2K3W A;  3L39 A;  2ZLY A;  3QB5 K;  4KMC A;  4U7I A;  4YY3 T;  2HHH T;  2N1G A;  3OPC A;  2LOS A;  3QUJ A;  2LSY A;  4YTP A;  3M65 A;  2WDR A;  2XAQ B;  4AQY T;  4CN1 A;  2IHR 1;  5JDM A;  3JCF A;  4ILA A;  5LP6 E;  1T72 A;  4GK5 E;  1ZOY A;  2IC6 A;  4TWD A;  2ZM6 T;  3UU4 A;  2WP9 A;  4UVA B;  5JRC A;  4P0A A;  3TLS A;  2LKH A;  3EAM A;  4YHJ A;  3AE7 A;  1E7P A;  3C4W A;  1KNZ A;  3E22 E;  4X1Y E;  5AQO B;  3RIA A;  2LSJ A;  3HR0 A;  1VCT A;  5FY0 A;  3J7Y q;  4HWH A;  4ZEY A;  1MIV A;  4LF7 T;  5HXR A;  3PV0 F;  3C4Z A;  1OED C;  2XQ5 A;  3AE2 A;  2CE7 A;  2CBI A;  2D9D A;  3A7M A;  1QLB A;  3P4Q A;  4OX9 T;  3KV5 A;  4HEA A;  3M3Z B;  3C51 A;  3HKB E;  1OWA A;  2NW9 A;  5J2T E;  4X1I E;  1ZHC A;  3SOL A;  1HNX T;  3U78 A;  5LOV E;  4ZS2 A;  1YD8 G;  2DL1 A;  4UVC B;  3ZYL A;  4YTN A;  2JQQ A;  2CEA A;  4DBR A;  3SFE A;  4MFR A;  5H6R B;  2WBL A;  3KFW X;  2WMO A;  1D1C A;  2XQ8 A;  1WFD A;  4X64 T;  4ZOL E;  2E9X D;  1VRB A;  4HWD A;  1XNR T;  2WDV A;  4L0R A;  4FJO A;  2W00 A;  2WMN A;  1WYC A;  3ONJ A;  2GK9 A;  2OLT A;  3UU6 A;  4YFS A;  1VOM A;  3PDY A;  2XHE B;  4X20 E;  2YEV C;  2X9H A;  3IF8 B;  4COF A;  2CA5 A;  1D1A A;  2A72 A;  2LLY A;  2VVN A;  2VWA A;  4BJM A;  4PNI A;  5FVK A;  2DLR A;  4GKJ T;  2LSK A;  3OTO T;  2E8I A;  1IAP A;  1J5E T;  5HXH A;  4X65 T;  2KLQ A;  4QX7 B;  5ABH A;  2V5D A;  4JEH B;  4DUZ T;  2Q9Q B;  3UUL A;  2G0U A;  4CXY A;  4E7S A;  5HYA A;  1YQ3 A;  2LJL A;  4I4T E;  3QNU A;  3LSV A;  1U4Q A;  5AQM B;  2XSB A;  3AA1 B;  4DV0 T;  5DQV A;  3RQU A;  4IST A;  1SHZ C;  1LVK A;  2SPC A;  3UUM A;  3RKG A;  1G8X A;  3SS1 A;  1UGO A;  4PJJ A;  4IT4 A;  1N34 T;  4HFD A;  2LT3 A;  3RKO A;  2BG9 B;  1LVF A;  2LSI A;  2KIN B;  1S94 A;  3ESL A;  1YW0 A;  3UUB A;  3ZMT B;  3I0Q A;  2VAS A;  2B1E A;  5LGU B;  4DV5 T;  3PUQ A;  3PUW F;  2X0H A;  2LE8 A;  3RLF F;  3AVR A;  2DNX A;  4H9P C;  3LDQ B;  5BMV E;  4O4L E;  1M62 A;  2IC9 A;  4ERR A;  1BR1 A;  1UK5 A;  2KZ7 B;  1FMV A;  2D0U A;  3AEF A;  3P4R A;  2M67 A;  1N36 T;  4H63 V;  3O1I A;  4GOU A;  4MBQ A;  5FYM A;  4JI3 T;  1M7K A;  2Q9Q A;  3C64 A;  3JC6 C;  2NW7 A;  5IYZ E;  4O4J E;  2IDO B;  4JBW F;  3CWZ B;  1B7T A;  2QVA A;  3CML A;  1US7 B;  4IL4 A;  4K0K T;  4H9S E;  3ZC1 A;  2Z6E A;  1HG2 A;  2LM2 A;  2LEH A;  2KXP B;  5JDL A;  2W2U A;  2D5U A;  2W66 A;  4LFB T;  5AFU L;  2MYS A;  1X79 A;  2D2S A;  4DVD A;  2H89 A;  3CQC B;  2LRL A;  2BS4 A;  3I9W A;  4CI1 B;  4IDN A;  5BR8 T;  4QH4 A;  1Z8U A;  2XQ9 A;  4ZI2 D;  2YU1 A;  5FXV A;  1QUU A;  2AXD S;  1HNZ T;  3AEE A;  3ZT7 A;  4LMK A;  4WYV A;  2A2F X;  2W67 A;  2W62 A;  4F8H A;  4PK4 A;  3ONL C;  2J47 A;  3LK4 2;  4CXW A;  2XUE A;  3NWI A;  4DND A;  1UUR A;  5EK2 A;  2JPF A;  5LG4 A;  2LM9 A;  1UUS A;  2XTL A;  4AQF A;  4WNK A;  3GWH A;  2X51 A;  1HX8 A;  3MK7 C;  4DV7 T;  3WAJ A;  3VRB A;  1BR4 A;  3R6N A;  1UX4 A;  4PJN A;  2JIW A;  1EZ3 A;  3RF1 A;  3TLT A;  2PFV A;  5LB7 B;  4PFO A;  4LF9 T;  2CCQ A;  4EED A;  1IBK T;  3BQI A;  4PW8 A;  1XZY A;  3B13 A;  1J1J A;  5AQU B;  2W63 A;  5LMN T;  2CLY C;  5C2T A;  3O1H A;  4DID B;  3PJA A;  5CJ5 A;  1FEW A;  1CUN A;  3NVO A;  1E1H B;  2IUB A;  3HKD E;  4ILU A;  5JH7 E;  4OYK A;  2K24 A;  1NEK A;  5HEU A;  2E9X C;  3I0O A;  2WZI A;  3ZLI A;  3Q5D A;  2J4G A;  3ETV A;  3RRC A;  4JI7 T;  2EHO B;  2XAG B;  4TN7 B;  3L09 A;  3VR9 A;  4Q25 A;  4UV9 B;  2M6I A;  1D0Y A;  2NTY A;  4I50 E;  2MTQ A;  1I94 T;  4U74 A;  5CA0 E;  2RP4 A;  5AQN B;  3AEB A;  2HPL A;  4QXB B; 
#chains in the Genus database with same CATH homology
 4JI6 T;  2UUC T;  4GKJ T;  3OTO T;  5LMU T;  4X66 T;  1J5E T;  4DR6 T;  4X62 T;  4DV7 T;  4X65 T;  3T1H T;  1XMQ T;  4JI3 T;  4NXM T;  4DUZ T;  4LF7 T;  4LF8 T;  4OX9 T;  1IBM T;  4JI5 T;  1N32 T;  1N33 T;  4K0K T;  2UXD T;  1HNX T;  4DV3 T;  2VQF T;  4LF9 T;  4LF4 T;  4LF5 T;  4LF6 T;  1FJG T;  4DR7 T;  4DV4 T;  1IBK T;  4DR3 T;  1HNW T;  4B3S T;  4DV0 T;  4B3T T;  2UXC T;  4DR4 T;  2UU9 T;  4JI2 T;  5LMN T;  4LFB T;  4B3M T;  1N34 T;  4JV5 T;  4JI4 T;  4B3R T;  4DR1 T;  4JI1 T;  4LFC T;  2HHH T;  4YY3 T;  4X64 T;  4JI0 T;  2UUA T;  5IWA T;  1XMO T;  4DV6 T;  5BR8 T;  4AQY T;  4GKK T;  1XNR T;  4LFA T;  4DV5 T;  4YHH T;  1HNZ T;  4JI7 T;  4DV2 T;  4JI8 T;  1IBL T;  4DR2 T;  1XNQ T;  2ZM6 T;  4KHP T;  4DR5 T;  4NXN T;  1I94 T;  4DUY T;  2UUB T;  2UXB T;  4JYA T;  1HR0 T;  4DV1 T;  3T1Y T;  2VQE T;  1N36 T;  2E5L T;  2F4V T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...