4GK0E

Crystal structure of human rev3-rev7-rev1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
96
structure length
96
Chain Sequence
APNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Mitotic spindle assembly checkpoint protein MAD2B
publication title Structural insights into the assembly of human translesion polymerase complexes
pubmed doi rcsb
source organism Homo sapiens
total genus 33
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4gk0E00
2N1GA 4FJOA 2LSGA 2LSJA 4GK5E 4GK0E 3VU7H 4BA9A 2LSYA 4EXTA 2LSIA 2LSKA
chains in the Genus database with same CATH superfamily
2FUPA 3TLWA 3HI2A 5JDMA 4AISA 5F3JA 2EHOC 4KI0F 5ABFB 5HXCA 3NRYA 2X9XA 2X9WA 2LHNA 3WAKA 5FXXA 3F57A 1U4QA 2ACXA 3UUXB 3K3OA 1OEDC 4AQFA 1MMNA 3UU3A 4CN1A 1Z8UA 1XWMA 2BG9C 3UU5A 3TLUA 4X65T 3U3IA 3ONXA 4GKKT 2W66A 3AEBA 2XZEA 5ABHA 3LK3B 5L3EB 3RRCA 3ONLC 3VKHA 4PK4A 5EK2A 3ZC1A 1YW0A 4YTMA 2PTFA 5JDNA 2XQ7A 5JRCB 2KSRA 3PJAJ 3UUMA 1IJ5A 2E9XA 3BQIA 4C91A 2CBJA 3AE9A 2WQYA 3MK7C 5ABEA 5FP3A 3SFEA 3RX6A 4A56A 4ZEYA 3JADA 4WBOA 2NTYA 4NUUA 2K48A 3I9WA 4DR6T 3SFDA 2JQHA 4DBRA 1HX8A 2YKSA 3PUGA 3C64A 5HWXA 4L9IA 4CN4A 3ZSSA 1WRDA 3EVYA 4WYVA 2DHRA 4JEHB 1YXRA 5FY0A 3SWHA 4O4LE 1XDOA 2WP9A 3RH3A 5JQGE 2L8KA 3M65A 2UXNB 1US7B 3NVOA 3OKQA 2JQKA 2XASB 1G73A 2RA1A 5JH7E 3GMIA 3AE6A 3OPCA 3AA1B 3Q9DA 5CGMA 2AXDS 2IDOB 4DV5T 3OVUA 4YXDA 1J1JA 2CLYC 3O1JA 4AKRB 4DMVA 1HNZT 3PTRB 5L3FB 5JRCA 3N9OA 4TWFA 2KXPB 3A5XA 4ILCA 1ZV4X 1R8IA 4ILAA 5L3BB 4IDZA 3PV0F 3UT5E 3AE7A 2YK0A 2WU5A 5L3DB 4JI7T 3L09A 3FZHB 4O4HE 4EEBA 3NBXX 2SPCA 3UFGA 4DR2T 4CXYA 2IW5B 4AKGA 4XAXB 1CHUA 3KDSE 5L2LA 4YT0A 2VWAA 3BK9A 2YEVC 4MBQA 3FHNA 5TAOA 2E9XC 2L3LA 2CEAA 2WM9A 3ZN1B 4KX6A 3PUSA 2XQ3A 4O4IE 4J2CA 3ZN0B 3RIUA 2Q9QB 2ZM8A 2ACZA 5JDQA 1HG5A 3UU8A 5ABGA 1YKEB 4IDQA 2WS3A 4IGUA 2CE7A 3L3PA 4EZHA 2RPAA 1Y64B 1MNDA 2PBIA 5JDLA 4IT4A 2XY8B 4UEMA 3UQ7A 5AQUB 3FXDB 5BR8T 1OXZA 3P4WA 3PU8A 3JAEA 4X5TA 3AVSA 1IBMT 3T1HT 3JC6D 1J5WA 2P9BA 2A9UA 5F5WA 4MHCA 2VKHA 2J1DG 1HG2A 4YLHA 4LFBT 3EAMA 3P4QA 4AKLA 2VURA 5LB7B 2X67A 5CB4E 4B3MT 4B6XA 3VHLA 2V7MA 3CK6A 2EHOD 3QC9A 1DU2A 3N2OA 2R6GF 2G0UA 3RIFA 4CXXA 5LHIB 4X64T 1ZOYA 2YOEA 2UU9T 3AEGA 2V6XA 2V26A 3VRAA 2X9YA 5LMUT 3EABA 1YD8G 5AQGB 2LT3A 2MYSA 5FKYA 1XNRT 3O9XA 2CM0A 2LSKA 2Y8DA 2B1EA 2LEHA 1WYCA 4X1KE 3ZT5A 2JJ9A 3BQLA 1D0YA 4HFVA 4GK5E 4WW0A 3KBTA 2FJBA 1N36T 3AA6B 4YTNA 2X51A 2UXBT 2WU2A 2Q9QA 3AAIA 3PUAA 3QK6A 3A7MA 5LGTB 3N5LA 4JI0T 2YDRA 2XQ4A 4JI8T 3C50A 3FZFB 3IBPA 5JR9C 2V7IA 4IL9A 1HF8A 3PUYF 3KBUA 2V7LA 4TV9E 2ZLYA 1T8BA 1QUUA 4TX5A 1KEYA 2WWVA 2UXXB 2LRLA 4LF7T 2YN6A 2CXDA 5AQQB 2XAJB 4UVAB 4CI3B 3GN5B 1L0VA 1E1HB 2LSJA 2QGSA 3CX6B 4LF5T 2CPTA 3ZCJA 1ZKEA 3N9PA 4ZI7E 2LM9A 4YTPA 5IWAT 1FMVA 2V5DA 4P09A 5LGUB 3QOFA 4MALA 2J62A 2BDEA 3UU4A 2N1GA 1JNZA 4PK6A 1LVFA 4HN9A 4P0AA 4KUMB 4U3CA 2XUEA 2HPJA 3RF1A 3ETUA 3MKDA 4FJOA 2DLRA 3ZJ2A 3RLFF 5DJQC 1SA0E 2WDVA 2LKHA 1YQ3A 5HXHA 2C5IT 1HFAA 2ODUA 2D2SA 3TLVA 2IUBA 1V9DA 4CI1B 4JLEA 3SRZA 4DVDA 3JCFA 2CHOA 1D0ZA 3AE2A 3ZCIA 2XSBA 4PJJA 3R6NA 2HN2A 3AA0B 3Q2MA 3JC6C 4F6RC 4ZS2A 3MZKB 5FXWA 3PUXF 2A2FX 1UK5A 4X1IE 3FZLB 3ETVA 5J0ZA 3HA4A 3FZKB 3J9X1 4JI2T 1E2AA 4JUYA 4BJNA 1BR2A 4HFHA 5IUXA 4CQIA 3CX8B 3CMLA 4EEDA 3IEEA 2E9XD 3AAAB 4NIQA 3GN5A 5HEJA 4IDNA 4KBMB 5HXSA 4PAGA 2NW7A 4JI3T 4U74A 4IDPA 2X9HA 4K0KT 2MPKA 1WCRA 3CPZA 2DL1A 1HNXT 2V5CA 4QXBB 4LF4T 4LF8T 4AQYT 1N32T 2BS2A 4FI5A 4A5XA 5KXJA 3CX7B 4TWHA 1S94A 2JMKA 5ETWA 1MIYA 2XTLA 3K1SA 4QH1A 2WZHA 5A1LA 2WCAA 3EUHA 4A98A 1OEDE 2N9DA 4QXCB 3QUJA 4O2AE 2IMLA 2XAFB 2BG9E 3RKGA 3EDUA 4HEAA 4P1NA 2LLYA 3PE0A 3VKGA 3B57A 2ZM2A 3KV5A 3KVBA 2E5LT 4QXHB 2XQ8A 3PDYA 1IBLT 2KWHA 2M6BA 4DBQA 4TNWA 2X0HA 3LDQB 3S4UA 4HFEA 2VL0A 3EHZA 5HEUA 3RPUA 3E0ZA 3MA9A 1MMAA 2KNDA 3VU7H 4GOUA 2D0UA 5FNVE 1UCUA 5J1GA 4DUZT 1BR1A 2XQ9A 4ZZBA 2H7OA 5FVKA 3ESLA 5J2TE 3WI3A 4GYSA 4I43B 2NW9A 2X68A 5LXTE 4IE6A 5LBMA 2H7VC 3AE4A 4AQFC 2CCQA 4M1PA 5DABA 1IJ6A 3RI5A 3AAEB 4DR4T 4O8SA 2LM2A 3NWIA 2QVAA 2W67A 2BVMA 3MXZA 1T98A 2BS3A 2N2NA 3I0QA 3SOLA 2NW8A 5HEHA 5BMVE 3GWHA 4ZS3A 2MTQA 4QX8B 4HGAA 1HTJF 1E7PA 1NENA 3AE5A 4JEUB 2UUCT 5AQJB 4PJLA 3N9LA 2Y48B 4DO0A 3RHWA 5HXEA 5GONE 5LBQB 3X1DA 1LRZA 4ANJA 3RYIE 3F31A 4TZ4C 3GA8A 4EYYR 1VCSA 2J47A 2UUAT 1I94T 4OHFA 3DTOA 1D0XA 3L39A 4F8HA 3A8YC 3OJAA 5AQLB 4JI5T 4ZHQE 2PG8A 4IREA 2KWIB 2VVNA 1VRBA 4X1YE 3AEAA 1WR0A 5LG4A 3Q5EA 4ZXLA 2XJ7A 4JI6T 2V7KA 2IAKA 2UXDT 5LHHB 3FXEB 4HFCA 2MAWA 2BKNA 4HFDA 5H6QB 2WDQA 3OBVE 4QKNA 2MBGA 5HXRA 5FYMA 1HNWT 1FMWA 3P4SA 4U2YA 1HX1B 3K3NA 2W2UA 3UULA 4DV3T 1MMGA 4KMCA 2V6YB 1Y01A 2VQFT 5ADXL 3OYXA 3UFEA 5CA0E 2H3RA 2XSAA 5AQPB 2Q9QD 3N9MA 1U5PA 3HKDE 5EK3A 2KLQA 1MNEA 2D5UA 3AEDA 3NKZA 1N33T 5DQVA 3QNUA 3H3MA 4EIWA 2K24A 5LG3A 3O1HA 1QLBA 4DNDA 3D0TA 2CBIA 2X66A 2BBJA 4YY3T 3CVRA 3Q5XA 2IIUA 3J7Yq 5FXZA 1VOMA 3HL6A 3P4PA 2MOZA 5HCJA 3LK2B 1XMQT 3CQCB 4YJ3E 4HTEA 3LJCA 5LHGB 4LMLA 4EZ4A 4ILBA 1GQEA 2PJQA 4PNIA 4HWDA 4DV2T 1Z0PA 5LJNA 4CXWA 4EXTA 4X62T 4NPPA 2JRKA 4WNKA 2V7JA 2VASA 2LKGA 1FEWA 5AQTB 4HFBA 3ZMSB 4C90A 4COFA 1XMOT 5LGNB 2OA5A 5FL0A 2CXLA 1IBKT 1AJ3A 3RIUC 2PFVA 4HWIB 4PK5A 3N2KE 3NZQA 4HKAA 4TWDA 1D1BA 2W62A 4I4TE 5JTGA 5HWYA 4DV4T 2FJEA 2YINA 4AXPA 2V6YA 1LKXA 3AEFA 4H63H 3DJBA 3EI0A 1M62A 3IF8B 3P8CD 3CWZB 4O4JE 2YDQA 4O2BE 2M6IA 5JDGA 3DP7A 3EDVA 2VKDA 4IL4A 4LF9T 4B3RT 2YU2A 2BKOA 4QX7B 4YHHT 3FBZA 2ZM0A 3AEEA 2WY2A 5C2TA 4CN6A 3P50A 2X0LB 3ZYLA 2VKOA 2XAGB 3CIRA 4ZI3D 2FJAA 4AIUA 3LBXB 3LG7A 5F8PA 1D1AA 2W63A 3C4ZA 2UXCT 5HEOA 2BZBA 1WFDA 3ZYKA 2V1DB 3Q5WA 4DV1T 3HKEE 3AE3A 5M4YA 4NXMT 2RP4A 3MACA 3ZYMA 1SUMB 5CFBA 3ZLIA 4LFCT 4HWFA 2YDSA 3I1AA 1KF6A 4IHJE 4TV8E 1HCIA 4HFIA 2VK9A 5L3GB 2GK9A 2C5KT 2C0SA 4P0BA 4AKIA 2Q9QC 2XM1A 2HN1A 4UV8B 2HPLA 4JI1T 4KHZF 1I6ZA 2A3DA 3RYHE 2ZMAA 4H9NC 4N78D 1EZ3A 4H9RC 3W15B 2QYWA 2DWKA 3PU3A 4WBNE 1JNRA 1KNPA 2YU1A 2V8SV 2KINB 4I55E 4ISSA 1MIWA 2LJLA 2LSGA 3LSVA 4EOZB 5JDFA 4GKJT 5AQVB 1BR0A 3V5UA 4X66T 4XBFB 2VKJA 5LP6E 3VR8A 5L4EA 2XPKA 5KDMC 4BJMA 3E22E 2JQQA 3AXJB 2XQ5A 3KV9A 3QB5A 4DV0T 4DR3T 2LHRA 3P7IA 4UF0B 3HKBE 4YJ2E 4DMWA 2NTXA 4GK0E 3C4WA 3LBXA 3F2EA 5LA6E 5AQRB 4UV9B 1N34T 1G8XA 2VL8A 4ERRA 4DR7T 3C4XA 2WZIA 4OYJA 4I50E 3PUQA 4AI6A 3UTKA 3ZT7A 3C51A 2W00A 2NWBA 2ZM6T 1UX5A 3ZKRA 1KK7A 1MMDA 3PUZF 4ZI2D 1ZEEA 3V5SA 2LOSA 2E2AA 3MJXA 5LMNT 3CKDA 2JQ9A 4GIWA 3K8PC 5JDHA 2E5VA 3I9YA 3LFMA 2WB5A 4H63V 3RYCE 3ANWB 2DI4A 4OYKA 1H7CA 4DV7T 3HKCE 1T7SA 1B7TA 4IIJE 2A72A 4PW8A 2I59A 5DQWA 1FJGT 2AE9A 1SHZC 3LK42 2NOXA 3CQGB 3FZMB 4UVCB 2XHEB 2LSYA 3AE8A 2KZ7B 3IA3A 5IHYA 1UX4A 3RQWA 2LSIA 4HWHA 4HE8A 2C5JA 5JR9B 2HH7A 2LRKA 5HAXA 2DCFA 4DUYT 2WMOA 4OK0A 5HEGA 4TUYE 2E8IA 3I0OA 4PJMA 4ZI3C 1FIOA 3H3AA 5ABFA 2HHHT 1T72A 4PFOA 4JI4T 2B76A 2K9AA 3KFWX 2VVSA 4U7IA 4ILUA 1NWMX 2JPFA 1UUSA 5KMGP 4ZZCA 1YQ4A 4YSZA 5AQIB 4H9OC 2IHR1 3IHRA 5H6RB 3AXJA 3PUWF 4OFZA 2I6HA 4HWCA 3VRBA 2WSSV 3TLSA 2W61A 4UF0A 5JREA 4TN7B 2FJDA 3H37A 3KINB 4Q25A 5FY1A 4G63A 2WAUA 3OTOT 3N2GE 5L4HA 5AQOB 5AQSB 4EB6E 1IAPA 2K5BB 3B5MA 4UVBB 4XZCA 3RGLA 1SE7A 2J4GA 2W4XA 3Q5DA 1YKHB 2X0YA 3M3ZB 2OV9A 2VB6A 4JYAT 1KNZA 4K0UA 3CQXC 3PURA 5HYAA 1S35A 5C8YE 2OLTA 3B13A 3ANWA 3NZPA 4H9SE 4CI2B 5L47A 3ZJ1A 4LMKA 3RKOA 1M7KA 4ASKA 4MFRA 4EGWA 3AB3B 4B3TT 5LNKA 4ZOLE 2WMNA 4EYUA 2JMHA 4H9PC 4JV5T 4QWNB 5JR9A 1WLXA 2WBLA 2CA5A 1VCTA 1HS7A 2L9QA 5LCYA 2UUBT 1D1CA 1XZYA 2EHOB 3O1IA 2W0GA 4KHPT 3L8RA 5FL1A 4AKHA 2ODVA 4NUVA 2I0MA 4IE0A 2H89A 3ZT6A 3TKLB 2XQ6A 5AQMB 4L0RA 1NEKA 1W9RA 2Y6XA 1OEDB 5J2UE 4BAYB 1KFYA 1QSDA 3UU6A 3BQKA 4L5GA 4Z91A 3P4RA 4ZI2C 2BG9B 4NXNT 3UUBA 4X20E 2Z6EA 1HR0T 3HR0A 4UELA 2H88A 3KVAA 2DWGA 2F4VT 4AQGA 2WDRA 4U31A 4U33A 2CHNA 2KMFA 2WWUA 1UGOA 3E08A 2D9DA 3UUNA 4IE7A 3WAJA 3ZPOA 3QB5K 2K3WA 1CUNA 3ABVA 1MIVA 5E0OA 2FBWA 4E7ZA 4OX9T 2VQET 1UURA 1O3XA 2XAHB 4UR9A 3SS1A 4CZZB 2QA7A 5FXVA 3RQUA 3JAFA 1NAFA 3ZMTB 3KV6A 1IZNB 2QRXA 3N9NA 5AQHB 3VR9A 2XAQB 3AECA 5CA1E 1OWAA 3G06A 1W09A 4H9QC 4EAHA 4LF6T 4WZXA 2BVLA 2D0TA 4YSYA 4UXNB 4U2ZA 2LE8A 3ZC0A 5C3JA 2CRBA 3ZMZB 4IE4A 1LVKA 4IE5A 5FMNA 4YFSA 2NR4A 3RYFE 4DR1T 2BS4A 1W0BA 3FB2A 4Z90A 2BBHA 3AA7B 3RIAA 2IC9A 4YSXA 3ZMUB 3KV4A 1KNRA 2EHOA 4EV6A 1X9BA 4V1Av 3OYZA 5IYZE 4YHJA 3AVRA 4U72A 5HCMA 5AQKB 3K3QC 2M67A 2BKPA 4I0UA 1OEDA 3N9QA 3T8OA 4UIGA 2CWYA 5KX5E 2XQYA 5L3CB 1WR6A 2NP9A 2CMRA 3ZMVB 3R84B 2BG9A 5LYJE 4U7YA 2CWOA 4PJNA 1J5ET 5LOVE 5AQFB 2XQAA 4DIDB 4Z8XA 2LOPA 4QH5A 1BR4A 4KP3C 1XDPA 1WYBA 3RC3A 4E7SA 4QHOA 4DR5T 4MLKA 2CLYB 3FBLA 4GYRA 4PFPA 4G2AA 1XNQT 4ADZA 2ES0A 5FVLA 2KT9A 4B3ST 3ZEFB 3RRWA 3C98B 4QH4A 4LFAT 4DV6T 3NRXA 4IDOA 3U78A 4A97A 5JVDE 3RC8A 3TLTA 3T1YT 1W0AA 4BA9A 3PUVF 2E9XB 2IC6A 1ZHCA 4ISTA 5AFUL 4TNVA 2DNXA 4JBWF 3UQ4A 5EK4A 2CXFA 3PJAA 5FY7A 1X79A 2JIWA 4LMJA 3AE1A 1ZP0A 3ONJA 5LJMA 2XM2A 3O4XE 3ZSTA 5AQNB 5CJ5A 5EZYE
chains in the Genus database with same CATH topology
2WMOA 3FXEB 4OK0A 4TUYE 3KBUA 2E8IA 3I0OA 3HI2A 2V7LA 4PJMA 5H6QB 4ZI3C 4TV9E 1FIOA 5JDMA 3H3AA 2ZLYA 3OBVE 1QUUA 4QKNA 2MBGA 5HXRA 5FYMA 2EHOC 5F3JA 5HXCA 3NRYA 4PFOA 2X9XA 1FMWA 4TX5A 2X9WA 2LHNA 3WAKA 2K9AA 3KFWX 5FXXA 3F57A 2UXXB 1U4QA 3K3NA 1NWMX 2ACXA 2JPFA 4ILUA 3UULA 3UUXB 1MMGA 4KMCA 5KMGP 3K3OA 2CXDA 2XAJB 4UVAB 4AQFA 5ADXL 3OYXA 4H9OC 1MMNA 4CI3B 3UFEA 5H6RB 3IHRA 5CA0E 3GN5B 1E1HB 2LSJA 2H3RA 2QGSA 3CX6B 4OFZA 3ZCJA 1ZKEA 3N9PA 2Q9QD 4ZI7E 2LM9A 3N9MA 3U3IA 1U5PA 2WSSV 2W61A 3HKDE 3ONXA 5EK3A 2KLQA 1FMVA 4UF0A 1MNEA 4P09A 5JREA 4TN7B 3H37A 3KINB 5LGUB 2D5UA 5FY1A 4G63A 4MALA 2WAUA 3N2GE 2BDEA 5DQVA 4EIWA 2K24A 3LK3B 5L3EB 3RRCA 3O1HA 2N1GA 3VKHA 4PK4A 4DNDA 4EB6E 1IAPA 2K5BB 3D0TA 4UVBB 5EK2A 4XZCA 4PK6A 3ZC1A 1YW0A 2X66A 1LVFA 5JDNA 4HN9A 4P0AA 3CVRA 3Q5XA 4KUMB 3J7Yq 4I55E 2XUEA 5FXZA 2HPJA 1VOMA 3HL6A 5JRCB 2MOZA 1YKHB 3ETUA 3LK2B 3MKDA 4FJOA 2VB6A 2DLRA 3ZJ2A 3CQCB 4K0UA 4YJ3E 1KNZA 3CQXC 3PURA 4HTEA 5DJQC 5HYAA 3LJCA 5LHGB 1S35A 1SA0E 5C8YE 4EZ4A 3UUMA 3B13A 5HXHA 2C5IT 2PJQA 1IJ5A 3ANWA 1HFAA 3NZPA 4H9SE 4CI2B 4PNIA 2E9XA 2ODUA 3BQIA 4C91A 2D2SA 1Z0PA 3ZJ1A 1V9DA 3MK7C 5LJNA 5FP3A 4JLEA 3RKOA 4CI1B 3SRZA 3RX6A 4CXWA 4DVDA 4EXTA 4ASKA 1D0ZA 4A56A 2JRKA 4WBOA 4WNKA 2NTYA 2V7JA 2VASA 4MFRA 4NUUA 4PJJA 3R6NA 3ZCIA 2K48A 3AB3B 1FEWA 3AA0B 3I9WA 3Q2MA 3JC6C 3ZMSB 4ZOLE 4C90A 4F6RC 4DBRA 1HX8A 3PUGA 5LNKA 5LGNB 4ZS2A 3MZKB 3C64A 5FXWA 2WMNA 4EYUA 5HWXA 2A2FX 2OA5A 4X1IE 2JMHA 4L9IA 2CXLA 4H9PC 4QWNB 3ETVA 5JR9A 1WRDA 1WLXA 3EVYA 2WBLA 1AJ3A 2PFVA 3HA4A 2CA5A 4PK5A 1HS7A 3J9X1 2DHRA 2L9QA 3N2KE 5LCYA 4JEHB 1D1CA 4JUYA 4BJNA 1BR2A 3NZQA 2EHOB 3O1IA 4CQIA 3CX8B 2W0GA 4HKAA 5FY0A 3SWHA 4O4LE 3CMLA 4AKHA 2ODVA 3IEEA 3RH3A 1D1BA 5JQGE 2L8KA 2W62A 4I4TE 4NUVA 3M65A 2E9XD 2UXNB 4IE0A 5HWYA 3AAAB 2YINA 4AXPA 1LKXA 3TKLB 1US7B 4L0RA 3OKQA 2Y6XA 3GN5A 5J2UE 4H63H 3DJBA 4BAYB 2XASB 4KBMB 5HXSA 4PAGA 3IF8B 1G73A 2RA1A 1QSDA 5JH7E 2NW7A 3GMIA 3P8CD 4U74A 2X9HA 3BQKA 4L5GA 3CWZB 4O4JE 4ZI2C 3AA1B 4O2BE 3Q9DA 4X20E 5JDGA 2Z6EA 3DP7A 3EDVA 2VKDA 3CPZA 2YU2A 3HR0A 4UELA 4QX7B 3FBZA 3KVAA 2DWGA 4QXBB 4AQGA 2ZM0A 4FI5A 2KMFA 2WWUA 2X0LB 3ZYLA 2VKOA 2XAGB 4ZI3D 3CX7B 2CLYC 3E08A 3O1JA 4AKRB 4DMVA 3PTRB 3UUNA 4IE7A 5L3FB 3WAJA 5JRCA 3ZPOA 3LBXB 3N9OA 1CUNA 1S94A 2JMKA 3LG7A 1MIVA 1D1AA 5E0OA 5ETWA 5F8PA 2KXPB 2W63A 1MIYA 4E7ZA 3A5XA 3C4ZA 2XTLA 2BZBA 1ZV4X 5L3BB 3ZYKA 2V1DB 4IDZA 1O3XA 2XAHB 3Q5WA 3SS1A 4CZZB 2QA7A 5FXVA 3UT5E 1NAFA 3HKEE 3ZMTB 5A1LA 3KV6A 2YK0A 5L3DB 1IZNB 3EUHA 3N9NA 2N9DA 4QXCB 5M4YA 3L09A 2RP4A 3QUJA 4O2AE 4O4HE 3MACA 3ZYMA 2XAQB 2XAFB 3NBXX 2SPCA 3ZLIA 1OWAA 5CA1E 4H9QC 4EAHA 4CXYA 2IW5B 4AKGA 4XAXB 3I1AA 2BVLA 3KDSE 2D0TA 3EDUA 5L2LA 2VWAA 3BK9A 4IHJE 4UXNB 2YEVC 4MBQA 4HEAA 4TV8E 3FHNA 5TAOA 2LE8A 2E9XC 3PE0A 3ZC0A 3VKGA 2L3LA 1HCIA 3B57A 2CEAA 2ZM2A 2WM9A 3ZN1B 3ZMZB 3KV5A 4IE4A 2VK9A 3KVBA 1LVKA 4IE5A 5FMNA 4YFSA 3PUSA 5L3GB 3RYFE 4O4IE 2GK9A 2C5KT 4J2CA 4QXHB 3ZN0B 2C0SA 4P0BA 4AKIA 2Q9QC 3PDYA 4UV8B 2Q9QB 3FB2A 2HPLA 2ZM8A 5JDQA 3AA7B 1HG5A 2IC9A 2KWHA 2A3DA 4DBQA 3RYHE 3ZMUB 3KV4A 2EHOA 2ZMAA 1YKEB 4H9NC 4N78D 1EZ3A 4H9RC 3S4UA 4IGUA 4V1Av 4ISSA 3W15B 2CE7A 3L3PA 4EZHA 3RPUA 3OYZA 5IYZE 2DWKA 3E0ZA 3MA9A 1Y64B 4YHJA 1MMAA 1MNDA 3AVRA 2PBIA 4U72A 5JDLA 2KNDA 3VU7H 3K3QC 2M67A 3N9QA 4GOUA 3PU3A 3T8OA 4WBNE 2D0UA 4UIGA 2CWYA 5KX5E 5FNVE 4UEMA 1UCUA 5J1GA 1BR1A 2YU1A 2XQYA 5L3CB 2H7OA 2KINB 1WR6A 2NP9A 1MIWA 2CMRA 3FXDB 2LJLA 1OXZA 2LSGA 3ESLA 3R84B 3PU8A 3ZMVB 5LYJE 5J2TE 4EOZB 5JDFA 3WI3A 2CWOA 4GYSA 4PJNA 3AVSA 5LOVE 3JC6D 1BR0A 3V5UA 4I43B 2P9BA 2NW9A 4XBFB 2X68A 2VKJA 5LP6E 5LXTE 4IE6A 5LBMA 2H7VC 4AQFC 2CCQA 4MHCA 2VKHA 5KDMC 4Z8XA 4BJMA 2LOPA 3E22E 4M1PA 2J1DG 1BR4A 1HG2A 5DABA 1IJ6A 3AAEB 4YLHA 2JQQA 3KV9A 4KP3C 4O8SA 4AKLA 1WYBA 3RC3A 2X67A 5CB4E 4E7SA 4B6XA 3VHLA 4QHOA 2LHRA 4MLKA 3P7IA 4UF0B 2V7MA 2CLYB 3FBLA 3HKBE 4YJ2E 4DMWA 2EHOD 2NTXA 4GK0E 4GYRA 3QC9A 4PFPA 4G2AA 2BVMA 4ADZA 3C4WA 3LBXA 3F2EA 3N2OA 3MXZA 5LA6E 1T98A 2ES0A 2G0UA 2KT9A 2N2NA 4CXXA 3I0QA 4UV9B 3ZEFB 5LHIB 1G8XA 2VL8A 3RRWA 4ERRA 3SOLA 3C98B 3C4XA 4OYJA 2NW8A 4I50E 3PUQA 2V26A 4AI6A 2X9YA 3UTKA 3GWHA 3C51A 5BMVE 2W00A 4ZS3A 2MTQA 2NWBA 1UX5A 1YD8G 1KK7A 4QX8B 1MMDA 4HGAA 1HTJF 4ZI2D 1ZEEA 2LT3A 2MYSA 4JEUB 3V5SA 3NRXA 4PJLA 2LOSA 3N9LA 3O9XA 2Y48B 4DO0A 3U78A 2CM0A 3MJXA 5HXEA 3CKDA 4GIWA 2LSKA 3K8PC 2Y8DA 5JDHA 2B1EA 2LEHA 5JVDE 3RC8A 1WYCA 5GONE 5LBQB 3I9YA 3LFMA 4X1KE 2JJ9A 4H63V 1LRZA 4ANJA 3RYCE 3RYIE 3ANWB 3F31A 4BA9A 4TZ4C 3BQLA 2DI4A 1D0YA 2E9XB 2IC6A 1ZHCA 1H7CA 3GA8A 4ISTA 4OYKA 3HKCE 5AFUL 4HFVA 4EYYR 1B7TA 2DNXA 4GK5E 4IIJE 2A72A 4PW8A 2I59A 4WW0A 3KBTA 5EK4A 5DQWA 4OHFA 2CXFA 3AA6B 3DTOA 1D0XA 5FY7A 1X79A 2X51A 3OJAA 2Q9QA 1SHZC 3LK42 4ZHQE 2NOXA 2PG8A 3CQGB 4UVCB 2XHEB 2LSYA 3AAIA 3PUAA 3QK6A 2KWIB 4X1YE 1VRBA 2KZ7B 5LGTB 5LG4A 3N5LA 5IHYA 1UX4A 5LJMA 2LSIA 3O4XE 3C50A 3IBPA 5JR9C 4HE8A 2C5JA 2V7IA 2V7KA 5JR9B 2HH7A 2IAKA 1HF8A 5LHHB 5HAXA 2DCFA 5EZYE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1G A;  4FJO A;  2LSG A;  2LSJ A;  4GK5 E;  4GK0 E;  3VU7 H;  4BA9 A;  2LSY A;  4EXT A;  2LSI A;  2LSK A; 
#chains in the Genus database with same CATH topology
 2FUP A;  3TLW A;  3HI2 A;  5JDM A;  4AIS A;  5F3J A;  2EHO C;  4KI0 F;  5ABF B;  5HXC A;  3NRY A;  2X9X A;  2X9W A;  2LHN A;  3WAK A;  5FXX A;  3F57 A;  1U4Q A;  2ACX A;  3UUX B;  3K3O A;  1OED C;  4AQF A;  1MMN A;  3UU3 A;  4CN1 A;  1Z8U A;  1XWM A;  2BG9 C;  3UU5 A;  3TLU A;  4X65 T;  3U3I A;  3ONX A;  4GKK T;  2W66 A;  3AEB A;  2XZE A;  5ABH A;  3LK3 B;  5L3E B;  3RRC A;  3ONL C;  3VKH A;  4PK4 A;  5EK2 A;  3ZC1 A;  1YW0 A;  4YTM A;  2PTF A;  5JDN A;  2XQ7 A;  5JRC B;  2KSR A;  3PJA J;  3UUM A;  1IJ5 A;  2E9X A;  3BQI A;  4C91 A;  2CBJ A;  3AE9 A;  2WQY A;  3MK7 C;  5ABE A;  5FP3 A;  3SFE A;  3RX6 A;  4A56 A;  4ZEY A;  3JAD A;  4WBO A;  2NTY A;  4NUU A;  2K48 A;  3I9W A;  4DR6 T;  3SFD A;  2JQH A;  4DBR A;  1HX8 A;  2YKS A;  3PUG A;  3C64 A;  5HWX A;  4L9I A;  4CN4 A;  3ZSS A;  1WRD A;  3EVY A;  4WYV A;  2DHR A;  4JEH B;  1YXR A;  5FY0 A;  3SWH A;  4O4L E;  1XDO A;  2WP9 A;  3RH3 A;  5JQG E;  2L8K A;  3M65 A;  2UXN B;  1US7 B;  3NVO A;  3OKQ A;  2JQK A;  2XAS B;  1G73 A;  2RA1 A;  5JH7 E;  3GMI A;  3AE6 A;  3OPC A;  3AA1 B;  3Q9D A;  5CGM A;  2AXD S;  2IDO B;  4DV5 T;  3OVU A;  4YXD A;  1J1J A;  2CLY C;  3O1J A;  4AKR B;  4DMV A;  1HNZ T;  3PTR B;  5L3F B;  5JRC A;  3N9O A;  4TWF A;  2KXP B;  3A5X A;  4ILC A;  1ZV4 X;  1R8I A;  4ILA A;  5L3B B;  4IDZ A;  3PV0 F;  3UT5 E;  3AE7 A;  2YK0 A;  2WU5 A;  5L3D B;  4JI7 T;  3L09 A;  3FZH B;  4O4H E;  4EEB A;  3NBX X;  2SPC A;  3UFG A;  4DR2 T;  4CXY A;  2IW5 B;  4AKG A;  4XAX B;  1CHU A;  3KDS E;  5L2L A;  4YT0 A;  2VWA A;  3BK9 A;  2YEV C;  4MBQ A;  3FHN A;  5TAO A;  2E9X C;  2L3L A;  2CEA A;  2WM9 A;  3ZN1 B;  4KX6 A;  3PUS A;  2XQ3 A;  4O4I E;  4J2C A;  3ZN0 B;  3RIU A;  2Q9Q B;  2ZM8 A;  2ACZ A;  5JDQ A;  1HG5 A;  3UU8 A;  5ABG A;  1YKE B;  4IDQ A;  2WS3 A;  4IGU A;  2CE7 A;  3L3P A;  4EZH A;  2RPA A;  1Y64 B;  1MND A;  2PBI A;  5JDL A;  4IT4 A;  2XY8 B;  4UEM A;  3UQ7 A;  5AQU B;  3FXD B;  5BR8 T;  1OXZ A;  3P4W A;  3PU8 A;  3JAE A;  4X5T A;  3AVS A;  1IBM T;  3T1H T;  3JC6 D;  1J5W A;  2P9B A;  2A9U A;  5F5W A;  4MHC A;  2VKH A;  2J1D G;  1HG2 A;  4YLH A;  4LFB T;  3EAM A;  3P4Q A;  4AKL A;  2VUR A;  5LB7 B;  2X67 A;  5CB4 E;  4B3M T;  4B6X A;  3VHL A;  2V7M A;  3CK6 A;  2EHO D;  3QC9 A;  1DU2 A;  3N2O A;  2R6G F;  2G0U A;  3RIF A;  4CXX A;  5LHI B;  4X64 T;  1ZOY A;  2YOE A;  2UU9 T;  3AEG A;  2V6X A;  2V26 A;  3VRA A;  2X9Y A;  5LMU T;  3EAB A;  1YD8 G;  5AQG B;  2LT3 A;  2MYS A;  5FKY A;  1XNR T;  3O9X A;  2CM0 A;  2LSK A;  2Y8D A;  2B1E A;  2LEH A;  1WYC A;  4X1K E;  3ZT5 A;  2JJ9 A;  3BQL A;  1D0Y A;  4HFV A;  4GK5 E;  4WW0 A;  3KBT A;  2FJB A;  1N36 T;  3AA6 B;  4YTN A;  2X51 A;  2UXB T;  2WU2 A;  2Q9Q A;  3AAI A;  3PUA A;  3QK6 A;  3A7M A;  5LGT B;  3N5L A;  4JI0 T;  2YDR A;  2XQ4 A;  4JI8 T;  3C50 A;  3FZF B;  3IBP A;  5JR9 C;  2V7I A;  4IL9 A;  1HF8 A;  3PUY F;  3KBU A;  2V7L A;  4TV9 E;  2ZLY A;  1T8B A;  1QUU A;  4TX5 A;  1KEY A;  2WWV A;  2UXX B;  2LRL A;  4LF7 T;  2YN6 A;  2CXD A;  5AQQ B;  2XAJ B;  4UVA B;  4CI3 B;  3GN5 B;  1L0V A;  1E1H B;  2LSJ A;  2QGS A;  3CX6 B;  4LF5 T;  2CPT A;  3ZCJ A;  1ZKE A;  3N9P A;  4ZI7 E;  2LM9 A;  4YTP A;  5IWA T;  1FMV A;  2V5D A;  4P09 A;  5LGU B;  3QOF A;  4MAL A;  2J62 A;  2BDE A;  3UU4 A;  2N1G A;  1JNZ A;  4PK6 A;  1LVF A;  4HN9 A;  4P0A A;  4KUM B;  4U3C A;  2XUE A;  2HPJ A;  3RF1 A;  3ETU A;  3MKD A;  4FJO A;  2DLR A;  3ZJ2 A;  3RLF F;  5DJQ C;  1SA0 E;  2WDV A;  2LKH A;  1YQ3 A;  5HXH A;  2C5I T;  1HFA A;  2ODU A;  2D2S A;  3TLV A;  2IUB A;  1V9D A;  4CI1 B;  4JLE A;  3SRZ A;  4DVD A;  3JCF A;  2CHO A;  1D0Z A;  3AE2 A;  3ZCI A;  2XSB A;  4PJJ A;  3R6N A;  2HN2 A;  3AA0 B;  3Q2M A;  3JC6 C;  4F6R C;  4ZS2 A;  3MZK B;  5FXW A;  3PUX F;  2A2F X;  1UK5 A;  4X1I E;  3FZL B;  3ETV A;  5J0Z A;  3HA4 A;  3FZK B;  3J9X 1;  4JI2 T;  1E2A A;  4JUY A;  4BJN A;  1BR2 A;  4HFH A;  5IUX A;  4CQI A;  3CX8 B;  3CML A;  4EED A;  3IEE A;  2E9X D;  3AAA B;  4NIQ A;  3GN5 A;  5HEJ A;  4IDN A;  4KBM B;  5HXS A;  4PAG A;  2NW7 A;  4JI3 T;  4U74 A;  4IDP A;  2X9H A;  4K0K T;  2MPK A;  1WCR A;  3CPZ A;  2DL1 A;  1HNX T;  2V5C A;  4QXB B;  4LF4 T;  4LF8 T;  4AQY T;  1N32 T;  2BS2 A;  4FI5 A;  4A5X A;  5KXJ A;  3CX7 B;  4TWH A;  1S94 A;  2JMK A;  5ETW A;  1MIY A;  2XTL A;  3K1S A;  4QH1 A;  2WZH A;  5A1L A;  2WCA A;  3EUH A;  4A98 A;  1OED E;  2N9D A;  4QXC B;  3QUJ A;  4O2A E;  2IML A;  2XAF B;  2BG9 E;  3RKG A;  3EDU A;  4HEA A;  4P1N A;  2LLY A;  3PE0 A;  3VKG A;  3B57 A;  2ZM2 A;  3KV5 A;  3KVB A;  2E5L T;  4QXH B;  2XQ8 A;  3PDY A;  1IBL T;  2KWH A;  2M6B A;  4DBQ A;  4TNW A;  2X0H A;  3LDQ B;  3S4U A;  4HFE A;  2VL0 A;  3EHZ A;  5HEU A;  3RPU A;  3E0Z A;  3MA9 A;  1MMA A;  2KND A;  3VU7 H;  4GOU A;  2D0U A;  5FNV E;  1UCU A;  5J1G A;  4DUZ T;  1BR1 A;  2XQ9 A;  4ZZB A;  2H7O A;  5FVK A;  3ESL A;  5J2T E;  3WI3 A;  4GYS A;  4I43 B;  2NW9 A;  2X68 A;  5LXT E;  4IE6 A;  5LBM A;  2H7V C;  3AE4 A;  4AQF C;  2CCQ A;  4M1P A;  5DAB A;  1IJ6 A;  3RI5 A;  3AAE B;  4DR4 T;  4O8S A;  2LM2 A;  3NWI A;  2QVA A;  2W67 A;  2BVM A;  3MXZ A;  1T98 A;  2BS3 A;  2N2N A;  3I0Q A;  3SOL A;  2NW8 A;  5HEH A;  5BMV E;  3GWH A;  4ZS3 A;  2MTQ A;  4QX8 B;  4HGA A;  1HTJ F;  1E7P A;  1NEN A;  3AE5 A;  4JEU B;  2UUC T;  5AQJ B;  4PJL A;  3N9L A;  2Y48 B;  4DO0 A;  3RHW A;  5HXE A;  5GON E;  5LBQ B;  3X1D A;  1LRZ A;  4ANJ A;  3RYI E;  3F31 A;  4TZ4 C;  3GA8 A;  4EYY R;  1VCS A;  2J47 A;  2UUA T;  1I94 T;  4OHF A;  3DTO A;  1D0X A;  3L39 A;  4F8H A;  3A8Y C;  3OJA A;  5AQL B;  4JI5 T;  4ZHQ E;  2PG8 A;  4IRE A;  2KWI B;  2VVN A;  1VRB A;  4X1Y E;  3AEA A;  1WR0 A;  5LG4 A;  3Q5E A;  4ZXL A;  2XJ7 A;  4JI6 T;  2V7K A;  2IAK A;  2UXD T;  5LHH B;  3FXE B;  4HFC A;  2MAW A;  2BKN A;  4HFD A;  5H6Q B;  2WDQ A;  3OBV E;  4QKN A;  2MBG A;  5HXR A;  5FYM A;  1HNW T;  1FMW A;  3P4S A;  4U2Y A;  1HX1 B;  3K3N A;  2W2U A;  3UUL A;  4DV3 T;  1MMG A;  4KMC A;  2V6Y B;  1Y01 A;  2VQF T;  5ADX L;  3OYX A;  3UFE A;  5CA0 E;  2H3R A;  2XSA A;  5AQP B;  2Q9Q D;  3N9M A;  1U5P A;  3HKD E;  5EK3 A;  2KLQ A;  1MNE A;  2D5U A;  3AED A;  3NKZ A;  1N33 T;  5DQV A;  3QNU A;  3H3M A;  4EIW A;  2K24 A;  5LG3 A;  3O1H A;  1QLB A;  4DND A;  3D0T A;  2CBI A;  2X66 A;  2BBJ A;  4YY3 T;  3CVR A;  3Q5X A;  2IIU A;  3J7Y q;  5FXZ A;  1VOM A;  3HL6 A;  3P4P A;  2MOZ A;  5HCJ A;  3LK2 B;  1XMQ T;  3CQC B;  4YJ3 E;  4HTE A;  3LJC A;  5LHG B;  4LML A;  4EZ4 A;  4ILB A;  1GQE A;  2PJQ A;  4PNI A;  4HWD A;  4DV2 T;  1Z0P A;  5LJN A;  4CXW A;  4EXT A;  4X62 T;  4NPP A;  2JRK A;  4WNK A;  2V7J A;  2VAS A;  2LKG A;  1FEW A;  5AQT B;  4HFB A;  3ZMS B;  4C90 A;  4COF A;  1XMO T;  5LGN B;  2OA5 A;  5FL0 A;  2CXL A;  1IBK T;  1AJ3 A;  3RIU C;  2PFV A;  4HWI B;  4PK5 A;  3N2K E;  3NZQ A;  4HKA A;  4TWD A;  1D1B A;  2W62 A;  4I4T E;  5JTG A;  5HWY A;  4DV4 T;  2FJE A;  2YIN A;  4AXP A;  2V6Y A;  1LKX A;  3AEF A;  4H63 H;  3DJB A;  3EI0 A;  1M62 A;  3IF8 B;  3P8C D;  3CWZ B;  4O4J E;  2YDQ A;  4O2B E;  2M6I A;  5JDG A;  3DP7 A;  3EDV A;  2VKD A;  4IL4 A;  4LF9 T;  4B3R T;  2YU2 A;  2BKO A;  4QX7 B;  4YHH T;  3FBZ A;  2ZM0 A;  3AEE A;  2WY2 A;  5C2T A;  4CN6 A;  3P50 A;  2X0L B;  3ZYL A;  2VKO A;  2XAG B;  3CIR A;  4ZI3 D;  2FJA A;  4AIU A;  3LBX B;  3LG7 A;  5F8P A;  1D1A A;  2W63 A;  3C4Z A;  2UXC T;  5HEO A;  2BZB A;  1WFD A;  3ZYK A;  2V1D B;  3Q5W A;  4DV1 T;  3HKE E;  3AE3 A;  5M4Y A;  4NXM T;  2RP4 A;  3MAC A;  3ZYM A;  1SUM B;  5CFB A;  3ZLI A;  4LFC T;  4HWF A;  2YDS A;  3I1A A;  1KF6 A;  4IHJ E;  4TV8 E;  1HCI A;  4HFI A;  2VK9 A;  5L3G B;  2GK9 A;  2C5K T;  2C0S A;  4P0B A;  4AKI A;  2Q9Q C;  2XM1 A;  2HN1 A;  4UV8 B;  2HPL A;  4JI1 T;  4KHZ F;  1I6Z A;  2A3D A;  3RYH E;  2ZMA A;  4H9N C;  4N78 D;  1EZ3 A;  4H9R C;  3W15 B;  2QYW A;  2DWK A;  3PU3 A;  4WBN E;  1JNR A;  1KNP A;  2YU1 A;  2V8S V;  2KIN B;  4I55 E;  4ISS A;  1MIW A;  2LJL A;  2LSG A;  3LSV A;  4EOZ B;  5JDF A;  4GKJ T;  5AQV B;  1BR0 A;  3V5U A;  4X66 T;  4XBF B;  2VKJ A;  5LP6 E;  3VR8 A;  5L4E A;  2XPK A;  5KDM C;  4BJM A;  3E22 E;  2JQQ A;  3AXJ B;  2XQ5 A;  3KV9 A;  3QB5 A;  4DV0 T;  4DR3 T;  2LHR A;  3P7I A;  4UF0 B;  3HKB E;  4YJ2 E;  4DMW A;  2NTX A;  4GK0 E;  3C4W A;  3LBX A;  3F2E A;  5LA6 E;  5AQR B;  4UV9 B;  1N34 T;  1G8X A;  2VL8 A;  4ERR A;  4DR7 T;  3C4X A;  2WZI A;  4OYJ A;  4I50 E;  3PUQ A;  4AI6 A;  3UTK A;  3ZT7 A;  3C51 A;  2W00 A;  2NWB A;  2ZM6 T;  1UX5 A;  3ZKR A;  1KK7 A;  1MMD A;  3PUZ F;  4ZI2 D;  1ZEE A;  3V5S A;  2LOS A;  2E2A A;  3MJX A;  5LMN T;  3CKD A;  2JQ9 A;  4GIW A;  3K8P C;  5JDH A;  2E5V A;  3I9Y A;  3LFM A;  2WB5 A;  4H63 V;  3RYC E;  3ANW B;  2DI4 A;  4OYK A;  1H7C A;  4DV7 T;  3HKC E;  1T7S A;  1B7T A;  4IIJ E;  2A72 A;  4PW8 A;  2I59 A;  5DQW A;  1FJG T;  2AE9 A;  1SHZ C;  3LK4 2;  2NOX A;  3CQG B;  3FZM B;  4UVC B;  2XHE B;  2LSY A;  3AE8 A;  2KZ7 B;  3IA3 A;  5IHY A;  1UX4 A;  3RQW A;  2LSI A;  4HWH A;  4HE8 A;  2C5J A;  5JR9 B;  2HH7 A;  2LRK A;  5HAX A;  2DCF A;  4DUY T;  2WMO A;  4OK0 A;  5HEG A;  4TUY E;  2E8I A;  3I0O A;  4PJM A;  4ZI3 C;  1FIO A;  3H3A A;  5ABF A;  2HHH T;  1T72 A;  4PFO A;  4JI4 T;  2B76 A;  2K9A A;  3KFW X;  2VVS A;  4U7I A;  4ILU A;  1NWM X;  2JPF A;  1UUS A;  5KMG P;  4ZZC A;  1YQ4 A;  4YSZ A;  5AQI B;  4H9O C;  2IHR 1;  3IHR A;  5H6R B;  3AXJ A;  3PUW F;  4OFZ A;  2I6H A;  4HWC A;  3VRB A;  2WSS V;  3TLS A;  2W61 A;  4UF0 A;  5JRE A;  4TN7 B;  2FJD A;  3H37 A;  3KIN B;  4Q25 A;  5FY1 A;  4G63 A;  2WAU A;  3OTO T;  3N2G E;  5L4H A;  5AQO B;  5AQS B;  4EB6 E;  1IAP A;  2K5B B;  3B5M A;  4UVB B;  4XZC A;  3RGL A;  1SE7 A;  2J4G A;  2W4X A;  3Q5D A;  1YKH B;  2X0Y A;  3M3Z B;  2OV9 A;  2VB6 A;  4JYA T;  1KNZ A;  4K0U A;  3CQX C;  3PUR A;  5HYA A;  1S35 A;  5C8Y E;  2OLT A;  3B13 A;  3ANW A;  3NZP A;  4H9S E;  4CI2 B;  5L47 A;  3ZJ1 A;  4LMK A;  3RKO A;  1M7K A;  4ASK A;  4MFR A;  4EGW A;  3AB3 B;  4B3T T;  5LNK A;  4ZOL E;  2WMN A;  4EYU A;  2JMH A;  4H9P C;  4JV5 T;  4QWN B;  5JR9 A;  1WLX A;  2WBL A;  2CA5 A;  1VCT A;  1HS7 A;  2L9Q A;  5LCY A;  2UUB T;  1D1C A;  1XZY A;  2EHO B;  3O1I A;  2W0G A;  4KHP T;  3L8R A;  5FL1 A;  4AKH A;  2ODV A;  4NUV A;  2I0M A;  4IE0 A;  2H89 A;  3ZT6 A;  3TKL B;  2XQ6 A;  5AQM B;  4L0R A;  1NEK A;  1W9R A;  2Y6X A;  1OED B;  5J2U E;  4BAY B;  1KFY A;  1QSD A;  3UU6 A;  3BQK A;  4L5G A;  4Z91 A;  3P4R A;  4ZI2 C;  2BG9 B;  4NXN T;  3UUB A;  4X20 E;  2Z6E A;  1HR0 T;  3HR0 A;  4UEL A;  2H88 A;  3KVA A;  2DWG A;  2F4V T;  4AQG A;  2WDR A;  4U31 A;  4U33 A;  2CHN A;  2KMF A;  2WWU A;  1UGO A;  3E08 A;  2D9D A;  3UUN A;  4IE7 A;  3WAJ A;  3ZPO A;  3QB5 K;  2K3W A;  1CUN A;  3ABV A;  1MIV A;  5E0O A;  2FBW A;  4E7Z A;  4OX9 T;  2VQE T;  1UUR A;  1O3X A;  2XAH B;  4UR9 A;  3SS1 A;  4CZZ B;  2QA7 A;  5FXV A;  3RQU A;  3JAF A;  1NAF A;  3ZMT B;  3KV6 A;  1IZN B;  2QRX A;  3N9N A;  5AQH B;  3VR9 A;  2XAQ B;  3AEC A;  5CA1 E;  1OWA A;  3G06 A;  1W09 A;  4H9Q C;  4EAH A;  4LF6 T;  4WZX A;  2BVL A;  2D0T A;  4YSY A;  4UXN B;  4U2Z A;  2LE8 A;  3ZC0 A;  5C3J A;  2CRB A;  3ZMZ B;  4IE4 A;  1LVK A;  4IE5 A;  5FMN A;  4YFS A;  2NR4 A;  3RYF E;  4DR1 T;  2BS4 A;  1W0B A;  3FB2 A;  4Z90 A;  2BBH A;  3AA7 B;  3RIA A;  2IC9 A;  4YSX A;  3ZMU B;  3KV4 A;  1KNR A;  2EHO A;  4EV6 A;  1X9B A;  4V1A v;  3OYZ A;  5IYZ E;  4YHJ A;  3AVR A;  4U72 A;  5HCM A;  5AQK B;  3K3Q C;  2M67 A;  2BKP A;  4I0U A;  1OED A;  3N9Q A;  3T8O A;  4UIG A;  2CWY A;  5KX5 E;  2XQY A;  5L3C B;  1WR6 A;  2NP9 A;  2CMR A;  3ZMV B;  3R84 B;  2BG9 A;  5LYJ E;  4U7Y A;  2CWO A;  4PJN A;  1J5E T;  5LOV E;  5AQF B;  2XQA A;  4DID B;  4Z8X A;  2LOP A;  4QH5 A;  1BR4 A;  4KP3 C;  1XDP A;  1WYB A;  3RC3 A;  4E7S A;  4QHO A;  4DR5 T;  4MLK A;  2CLY B;  3FBL A;  4GYR A;  4PFP A;  4G2A A;  1XNQ T;  4ADZ A;  2ES0 A;  5FVL A;  2KT9 A;  4B3S T;  3ZEF B;  3RRW A;  3C98 B;  4QH4 A;  4LFA T;  4DV6 T;  3NRX A;  4IDO A;  3U78 A;  4A97 A;  5JVD E;  3RC8 A;  3TLT A;  3T1Y T;  1W0A A;  4BA9 A;  3PUV F;  2E9X B;  2IC6 A;  1ZHC A;  4IST A;  5AFU L;  4TNV A;  2DNX A;  4JBW F;  3UQ4 A;  5EK4 A;  2CXF A;  3PJA A;  5FY7 A;  1X79 A;  2JIW A;  4LMJ A;  3AE1 A;  1ZP0 A;  3ONJ A;  5LJM A;  2XM2 A;  3O4X E;  3ZST A;  5AQN B;  5CJ5 A;  5EZY E; 
#chains in the Genus database with same CATH homology
 2WMO A;  3FXE B;  4OK0 A;  4TUY E;  3KBU A;  2E8I A;  3I0O A;  3HI2 A;  2V7L A;  4PJM A;  5H6Q B;  4ZI3 C;  4TV9 E;  1FIO A;  5JDM A;  3H3A A;  2ZLY A;  3OBV E;  1QUU A;  4QKN A;  2MBG A;  5HXR A;  5FYM A;  2EHO C;  5F3J A;  5HXC A;  3NRY A;  4PFO A;  2X9X A;  1FMW A;  4TX5 A;  2X9W A;  2LHN A;  3WAK A;  2K9A A;  3KFW X;  5FXX A;  3F57 A;  2UXX B;  1U4Q A;  3K3N A;  1NWM X;  2ACX A;  2JPF A;  4ILU A;  3UUL A;  3UUX B;  1MMG A;  4KMC A;  5KMG P;  3K3O A;  2CXD A;  2XAJ B;  4UVA B;  4AQF A;  5ADX L;  3OYX A;  4H9O C;  1MMN A;  4CI3 B;  3UFE A;  5H6R B;  3IHR A;  5CA0 E;  3GN5 B;  1E1H B;  2LSJ A;  2H3R A;  2QGS A;  3CX6 B;  4OFZ A;  3ZCJ A;  1ZKE A;  3N9P A;  2Q9Q D;  4ZI7 E;  2LM9 A;  3N9M A;  3U3I A;  1U5P A;  2WSS V;  2W61 A;  3HKD E;  3ONX A;  5EK3 A;  2KLQ A;  1FMV A;  4UF0 A;  1MNE A;  4P09 A;  5JRE A;  4TN7 B;  3H37 A;  3KIN B;  5LGU B;  2D5U A;  5FY1 A;  4G63 A;  4MAL A;  2WAU A;  3N2G E;  2BDE A;  5DQV A;  4EIW A;  2K24 A;  3LK3 B;  5L3E B;  3RRC A;  3O1H A;  2N1G A;  3VKH A;  4PK4 A;  4DND A;  4EB6 E;  1IAP A;  2K5B B;  3D0T A;  4UVB B;  5EK2 A;  4XZC A;  4PK6 A;  3ZC1 A;  1YW0 A;  2X66 A;  1LVF A;  5JDN A;  4HN9 A;  4P0A A;  3CVR A;  3Q5X A;  4KUM B;  3J7Y q;  4I55 E;  2XUE A;  5FXZ A;  2HPJ A;  1VOM A;  3HL6 A;  5JRC B;  2MOZ A;  1YKH B;  3ETU A;  3LK2 B;  3MKD A;  4FJO A;  2VB6 A;  2DLR A;  3ZJ2 A;  3CQC B;  4K0U A;  4YJ3 E;  1KNZ A;  3CQX C;  3PUR A;  4HTE A;  5DJQ C;  5HYA A;  3LJC A;  5LHG B;  1S35 A;  1SA0 E;  5C8Y E;  4EZ4 A;  3UUM A;  3B13 A;  5HXH A;  2C5I T;  2PJQ A;  1IJ5 A;  3ANW A;  1HFA A;  3NZP A;  4H9S E;  4CI2 B;  4PNI A;  2E9X A;  2ODU A;  3BQI A;  4C91 A;  2D2S A;  1Z0P A;  3ZJ1 A;  1V9D A;  3MK7 C;  5LJN A;  5FP3 A;  4JLE A;  3RKO A;  4CI1 B;  3SRZ A;  3RX6 A;  4CXW A;  4DVD A;  4EXT A;  4ASK A;  1D0Z A;  4A56 A;  2JRK A;  4WBO A;  4WNK A;  2NTY A;  2V7J A;  2VAS A;  4MFR A;  4NUU A;  4PJJ A;  3R6N A;  3ZCI A;  2K48 A;  3AB3 B;  1FEW A;  3AA0 B;  3I9W A;  3Q2M A;  3JC6 C;  3ZMS B;  4ZOL E;  4C90 A;  4F6R C;  4DBR A;  1HX8 A;  3PUG A;  5LNK A;  5LGN B;  4ZS2 A;  3MZK B;  3C64 A;  5FXW A;  2WMN A;  4EYU A;  5HWX A;  2A2F X;  2OA5 A;  4X1I E;  2JMH A;  4L9I A;  2CXL A;  4H9P C;  4QWN B;  3ETV A;  5JR9 A;  1WRD A;  1WLX A;  3EVY A;  2WBL A;  1AJ3 A;  2PFV A;  3HA4 A;  2CA5 A;  4PK5 A;  1HS7 A;  3J9X 1;  2DHR A;  2L9Q A;  3N2K E;  5LCY A;  4JEH B;  1D1C A;  4JUY A;  4BJN A;  1BR2 A;  3NZQ A;  2EHO B;  3O1I A;  4CQI A;  3CX8 B;  2W0G A;  4HKA A;  5FY0 A;  3SWH A;  4O4L E;  3CML A;  4AKH A;  2ODV A;  3IEE A;  3RH3 A;  1D1B A;  5JQG E;  2L8K A;  2W62 A;  4I4T E;  4NUV A;  3M65 A;  2E9X D;  2UXN B;  4IE0 A;  5HWY A;  3AAA B;  2YIN A;  4AXP A;  1LKX A;  3TKL B;  1US7 B;  4L0R A;  3OKQ A;  2Y6X A;  3GN5 A;  5J2U E;  4H63 H;  3DJB A;  4BAY B;  2XAS B;  4KBM B;  5HXS A;  4PAG A;  3IF8 B;  1G73 A;  2RA1 A;  1QSD A;  5JH7 E;  2NW7 A;  3GMI A;  3P8C D;  4U74 A;  2X9H A;  3BQK A;  4L5G A;  3CWZ B;  4O4J E;  4ZI2 C;  3AA1 B;  4O2B E;  3Q9D A;  4X20 E;  5JDG A;  2Z6E A;  3DP7 A;  3EDV A;  2VKD A;  3CPZ A;  2YU2 A;  3HR0 A;  4UEL A;  4QX7 B;  3FBZ A;  3KVA A;  2DWG A;  4QXB B;  4AQG A;  2ZM0 A;  4FI5 A;  2KMF A;  2WWU A;  2X0L B;  3ZYL A;  2VKO A;  2XAG B;  4ZI3 D;  3CX7 B;  2CLY C;  3E08 A;  3O1J A;  4AKR B;  4DMV A;  3PTR B;  3UUN A;  4IE7 A;  5L3F B;  3WAJ A;  5JRC A;  3ZPO A;  3LBX B;  3N9O A;  1CUN A;  1S94 A;  2JMK A;  3LG7 A;  1MIV A;  1D1A A;  5E0O A;  5ETW A;  5F8P A;  2KXP B;  2W63 A;  1MIY A;  4E7Z A;  3A5X A;  3C4Z A;  2XTL A;  2BZB A;  1ZV4 X;  5L3B B;  3ZYK A;  2V1D B;  4IDZ A;  1O3X A;  2XAH B;  3Q5W A;  3SS1 A;  4CZZ B;  2QA7 A;  5FXV A;  3UT5 E;  1NAF A;  3HKE E;  3ZMT B;  5A1L A;  3KV6 A;  2YK0 A;  5L3D B;  1IZN B;  3EUH A;  3N9N A;  2N9D A;  4QXC B;  5M4Y A;  3L09 A;  2RP4 A;  3QUJ A;  4O2A E;  4O4H E;  3MAC A;  3ZYM A;  2XAQ B;  2XAF B;  3NBX X;  2SPC A;  3ZLI A;  1OWA A;  5CA1 E;  4H9Q C;  4EAH A;  4CXY A;  2IW5 B;  4AKG A;  4XAX B;  3I1A A;  2BVL A;  3KDS E;  2D0T A;  3EDU A;  5L2L A;  2VWA A;  3BK9 A;  4IHJ E;  4UXN B;  2YEV C;  4MBQ A;  4HEA A;  4TV8 E;  3FHN A;  5TAO A;  2LE8 A;  2E9X C;  3PE0 A;  3ZC0 A;  3VKG A;  2L3L A;  1HCI A;  3B57 A;  2CEA A;  2ZM2 A;  2WM9 A;  3ZN1 B;  3ZMZ B;  3KV5 A;  4IE4 A;  2VK9 A;  3KVB A;  1LVK A;  4IE5 A;  5FMN A;  4YFS A;  3PUS A;  5L3G B;  3RYF E;  4O4I E;  2GK9 A;  2C5K T;  4J2C A;  4QXH B;  3ZN0 B;  2C0S A;  4P0B A;  4AKI A;  2Q9Q C;  3PDY A;  4UV8 B;  2Q9Q B;  3FB2 A;  2HPL A;  2ZM8 A;  5JDQ A;  3AA7 B;  1HG5 A;  2IC9 A;  2KWH A;  2A3D A;  4DBQ A;  3RYH E;  3ZMU B;  3KV4 A;  2EHO A;  2ZMA A;  1YKE B;  4H9N C;  4N78 D;  1EZ3 A;  4H9R C;  3S4U A;  4IGU A;  4V1A v;  4ISS A;  3W15 B;  2CE7 A;  3L3P A;  4EZH A;  3RPU A;  3OYZ A;  5IYZ E;  2DWK A;  3E0Z A;  3MA9 A;  1Y64 B;  4YHJ A;  1MMA A;  1MND A;  3AVR A;  2PBI A;  4U72 A;  5JDL A;  2KND A;  3VU7 H;  3K3Q C;  2M67 A;  3N9Q A;  4GOU A;  3PU3 A;  3T8O A;  4WBN E;  2D0U A;  4UIG A;  2CWY A;  5KX5 E;  5FNV E;  4UEM A;  1UCU A;  5J1G A;  1BR1 A;  2YU1 A;  2XQY A;  5L3C B;  2H7O A;  2KIN B;  1WR6 A;  2NP9 A;  1MIW A;  2CMR A;  3FXD B;  2LJL A;  1OXZ A;  2LSG A;  3ESL A;  3R84 B;  3PU8 A;  3ZMV B;  5LYJ E;  5J2T E;  4EOZ B;  5JDF A;  3WI3 A;  2CWO A;  4GYS A;  4PJN A;  3AVS A;  5LOV E;  3JC6 D;  1BR0 A;  3V5U A;  4I43 B;  2P9B A;  2NW9 A;  4XBF B;  2X68 A;  2VKJ A;  5LP6 E;  5LXT E;  4IE6 A;  5LBM A;  2H7V C;  4AQF C;  2CCQ A;  4MHC A;  2VKH A;  5KDM C;  4Z8X A;  4BJM A;  2LOP A;  3E22 E;  4M1P A;  2J1D G;  1BR4 A;  1HG2 A;  5DAB A;  1IJ6 A;  3AAE B;  4YLH A;  2JQQ A;  3KV9 A;  4KP3 C;  4O8S A;  4AKL A;  1WYB A;  3RC3 A;  2X67 A;  5CB4 E;  4E7S A;  4B6X A;  3VHL A;  4QHO A;  2LHR A;  4MLK A;  3P7I A;  4UF0 B;  2V7M A;  2CLY B;  3FBL A;  3HKB E;  4YJ2 E;  4DMW A;  2EHO D;  2NTX A;  4GK0 E;  4GYR A;  3QC9 A;  4PFP A;  4G2A A;  2BVM A;  4ADZ A;  3C4W A;  3LBX A;  3F2E A;  3N2O A;  3MXZ A;  5LA6 E;  1T98 A;  2ES0 A;  2G0U A;  2KT9 A;  2N2N A;  4CXX A;  3I0Q A;  4UV9 B;  3ZEF B;  5LHI B;  1G8X A;  2VL8 A;  3RRW A;  4ERR A;  3SOL A;  3C98 B;  3C4X A;  4OYJ A;  2NW8 A;  4I50 E;  3PUQ A;  2V26 A;  4AI6 A;  2X9Y A;  3UTK A;  3GWH A;  3C51 A;  5BMV E;  2W00 A;  4ZS3 A;  2MTQ A;  2NWB A;  1UX5 A;  1YD8 G;  1KK7 A;  4QX8 B;  1MMD A;  4HGA A;  1HTJ F;  4ZI2 D;  1ZEE A;  2LT3 A;  2MYS A;  4JEU B;  3V5S A;  3NRX A;  4PJL A;  2LOS A;  3N9L A;  3O9X A;  2Y48 B;  4DO0 A;  3U78 A;  2CM0 A;  3MJX A;  5HXE A;  3CKD A;  4GIW A;  2LSK A;  3K8P C;  2Y8D A;  5JDH A;  2B1E A;  2LEH A;  5JVD E;  3RC8 A;  1WYC A;  5GON E;  5LBQ B;  3I9Y A;  3LFM A;  4X1K E;  2JJ9 A;  4H63 V;  1LRZ A;  4ANJ A;  3RYC E;  3RYI E;  3ANW B;  3F31 A;  4BA9 A;  4TZ4 C;  3BQL A;  2DI4 A;  1D0Y A;  2E9X B;  2IC6 A;  1ZHC A;  1H7C A;  3GA8 A;  4IST A;  4OYK A;  3HKC E;  5AFU L;  4HFV A;  4EYY R;  1B7T A;  2DNX A;  4GK5 E;  4IIJ E;  2A72 A;  4PW8 A;  2I59 A;  4WW0 A;  3KBT A;  5EK4 A;  5DQW A;  4OHF A;  2CXF A;  3AA6 B;  3DTO A;  1D0X A;  5FY7 A;  1X79 A;  2X51 A;  3OJA A;  2Q9Q A;  1SHZ C;  3LK4 2;  4ZHQ E;  2NOX A;  2PG8 A;  3CQG B;  4UVC B;  2XHE B;  2LSY A;  3AAI A;  3PUA A;  3QK6 A;  2KWI B;  4X1Y E;  1VRB A;  2KZ7 B;  5LGT B;  5LG4 A;  3N5L A;  5IHY A;  1UX4 A;  5LJM A;  2LSI A;  3O4X E;  3C50 A;  3IBP A;  5JR9 C;  4HE8 A;  2C5J A;  2V7I A;  2V7K A;  5JR9 B;  2HH7 A;  2IAK A;  1HF8 A;  5LHH B;  5HAX A;  2DCF A;  5EZY E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...