4GK0E

Crystal structure of human rev3-rev7-rev1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
96
structure length
96
Chain Sequence
APNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitotic spindle assembly checkpoint protein MAD2B
publication title Structural insights into the assembly of human translesion polymerase complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4gk0E00
2LSKA 2LSIA 4BA9A 4GK5E 2N1GA 2LSYA 4GK0E 4FJOA 3VU7H 4EXTA 2LSJA 2LSGA
chains in the Genus database with same CATH superfamily
2JQKA 5JR9C 2CE7A 3CK6A 4QH1A 1T8BA 4CN6A 1HCIA 2BDEA 2PG8A 3I9WA 1FIOA 5LA6E 3KV6A 2XPKA 2JIWA 4L5GA 3WAJA 1WYBA 3ETUA 3O1JA 3N2OA 2WCAA 3IHRA 2LKGA 4YTNA 5FYMA 2XQ7A 3AAEB 3A5XA 3NRYA 1SE7A 2UUCT 3KBUA 2WZHA 1HX8A 4ZOLE 2QVAA 1MNDA 4H63V 3UTKA 4I50E 3SS1A 2EHOD 5JRCB 2IDOB 1US7B 3TLSA 3RKGA 4QXHB 4JBWF 5HEOA 3ABVA 4BA9A 1N34T 3AEBA 4HWHA 3UFEA 5IYZE 4JI5T 3C98B 1D0YA 3ZSSA 4ISSA 2VKJA 3PJAA 2CPTA 3EAMA 5C8YE 5HAXA 3RRCA 3JCFA 1G73A 3R84B 3ZT6A 3N2KE 3J7Yq 3NBXX 1ZEEA 3FBZA 4HKAA 4DV0T 4A97A 3V5SA 1ZOYA 2QRXA 1KNZA 4DR7T 2MPKA 2A3DA 1O3XA 4ZI7E 5DQWA 3MKDA 4PAGA 3PTRB 3UU6A 4X66T 2JMKA 4AKRB 4EZ4A 5C2TA 1YD8G 1YW0A 3RYIE 5KXJA 4PK6A 4NXMT 2M6IA 2RP4A 3PUVF 5LNKA 4PK4A 2LSJA 3TLWA 3Q9DA 2XY8B 3QNUA 2AXDS 2C5KT 3NRXA 1E7PA 1JNRA 4X64T 3KV4A 4UVBB 1FMWA 5JR9B 2VK9A 2Q9QA 1QUUA 2WB5A 3BQKA 2ACXA 3LDQB 3RIFA 3ONXA 4ZZCA 2C5IT 3FHNA 4LF8T 4JV5T 1FMVA 2LSKA 3UUNA 1MMNA 3CMLA 3VR8A 1HFAA 1WYCA 3ZC0A 2DCFA 4AQYT 3CPZA 4UVCB 4AKGA 4DMVA 3ZN1B 5FVKA 2LRKA 3QUJA 3HL6A 3UFGA 3UULA 4TV9E 5KDMC 3BQIA 3TKLB 2PJQA 5LHGB 2V5CA 4AI6A 2W4XA 5HXCA 2ACZA 5LGTB 3ONLC 3O1HA 2CEAA 3VKHA 4ILUA 4JI1T 4TWDA 4JUYA 3ZJ2A 5LOVE 3B5MA 5FP3A 3JC6D 2YN6A 5AQTB 2QGSA 4G63A 3RYHE 1FJGT 2KT9A 4YLHA 3AA7B 4EGWA 5AQGB 5ABEA 2M67A 4CZZB 1HNZT 5IUXA 4Z90A 2X66A 5C3JA 4H9PC 3GWHA 4ERRA 2NW7A 1YXRA 5KMGP 2Y48B 3FZLB 2VWAA 5L3CB 4QHOA 3RPUA 2B76A 2HN2A 4LF6T 2V7KA 4JI4T 3M65A 1W0BA 2ODUA 5HCJA 4A5XA 1IJ6A 2P9BA 2BS2A 4DR6T 4U2YA 3H3AA 1ZHCA 2LM9A 2JQ9A 3P4QA 3AE3A 1ZV4X 5HEGA 3I0QA 3RX6A 3LK3B 2BS4A 4HGAA 4DBQA 4P1NA 3UUMA 2Q9QC 3W15B 2XUEA 4IGUA 4H9OC 4CXWA 4A98A 3AE9A 2XQ9A 4DR5T 3BQLA 1H7CA 2BVMA 4GYSA 4H9QC 5AQVB 2KZ7B 2XSBA 2D0TA 2W62A 1SA0E 2YDSA 3C51A 4X20E 3RH3A 5DABA 3FXDB 3RC8A 5AQRB 3P4PA 3EHZA 4TNWA 4GIWA 1R8IA 4OK0A 4AKIA 3NWIA 2IW5B 3UU5A 2UUAT 3Q5EA 1WR0A 2LRLA 2JRKA 4AKLA 5H6QB 2LHRA 2CMRA 4E7ZA 5CJ5A 5DQVA 3PUQA 3AE1A 2WSSV 2VB6A 2UUBT 4JI3T 4DUZT 2KWHA 4X5TA 4XAXB 1FEWA 1WFDA 3LBXA 5FXWA 3P8CD 3CQCB 2WP9A 4Z8XA 4OYJA 5L3FB 4PJJA 5FVLA 4EAHA 2M6BA 2E5LT 4WW0A 2JQHA 4UV8B 4YSYA 3HR0A 5LGUB 3EDUA 2HHHT 4YTMA 2LLYA 3HA4A 1D1CA 2X0YA 2KSRA 2C5JA 2YU2A 2YDRA 2V5DA 2XTLA 4IDPA 3X1DA 3F57A 4Z91A 4X1KE 3KFWX 3PUGA 2AE9A 2Q9QB 3FBLA 3B57A 3RF1A 2NR4A 4DV2T 5ABFA 2BKNA 2OA5A 3RLFF 3ZJ1A 1X79A 1MIYA 2X0HA 2FJEA 2WDVA 1Z0PA 3IF8B 5FY7A 5BMVE 5CB4E 4JI8T 2WMOA 2DWGA 4DVDA 2W2UA 2KLQA 2K3WA 4YHHT 3PU8A 2UXXB 3ZN0B 2V8SV 5JTGA 4LMKA 2VVSA 1LKXA 2UU9T 2WQYA 3O1IA 4HFIA 3RQWA 4DV5T 4IL4A 5LB7B 3LJCA 3RYCE 4GK5E 2LEHA 3K3OA 5LHHB 2KWIB 2H7OA 3TLUA 4LFBT 2ZLYA 4KUMB 3UU4A 5LMUT 1XMOT 2V7IA 2HN1A 2XAHB 1IBKT 4CI3B 3N9NA 3AAAB 4JLEA 1XWMA 3CWZB 3EVYA 5FXXA 2X9XA 2VQET 3IBPA 4TV8E 2E9XA 4HFDA 4BAYB 4F6RC 5FY1A 2K48A 1HR0T 4ZHQE 5FY0A 3DP7A 1IJ5A 1ZP0A 4G2AA 3CIRA 3MACA 4MFRA 1DU2A 3CX6B 1VRBA 2JMHA 2KNDA 4CN1A 2CBIA 3KVAA 4HWFA 3IEEA 1QLBA 2YKSA 3F2EA 1SHZC 3AEFA 5GONE 4PJLA 2E5VA 4P0BA 5L47A 3VHLA 3N9LA 2QA7A 5L3BB 5FKYA 2IC6A 4ISTA 2V6YB 5LG3A 2ODVA 2ZM0A 5CA0E 2CXLA 4U74A 4EEDA 3AE5A 4H9NC 4A56A 5AQNB 4O4IE 2UXDT 2E9XD 4EB6E 4H9RC 4PFPA 3AAIA 1MNEA 4YJ2E 2LOSA 3K1SA 1KNPA 3MA9A 1OEDB 1UX5A 2WU5A 3L09A 5M4YA 5LGNB 2E2AA 2CBJA 5AQOB 1I6ZA 5JH7E 4O4HE 2J1DG 3FZKB 3MK7C 3ZCJA 3VU7H 3KBTA 3QB5K 5ABHA 4IDOA 4COFA 5HXSA 3WI3A 2ZM6T 4KX6A 5FXZA 3RGLA 3E22E 5LJNA 2D2SA 2VURA 1S35A 2WMNA 3EDVA 4IDZA 2IMLA 2ZMAA 5JVDE 4I55E 1UUSA 4PJNA 3G06A 1HNWT 3AXJA 1NAFA 4ZS2A 3Q5DA 4DIDB 5TAOA 2KMFA 3N9PA 1MIWA 3ZSTA 2D0UA 1M7KA 2WDRA 1E1HB 2CLYC 2DL1A 4YSXA 3UQ7A 5HYAA 2L8KA 2ZM2A 2WBLA 3T8OA 2X9WA 5J0ZA 4B3TT 2XAJB 4KHPT 5EK2A 2K24A 3UT5E 4YSZA 4MBQA 1WLXA 4AKHA 1KF6A 2EHOC 3JAFA 2H3RA 4UR9A 3J9X1 3PUZF 2LSYA 4I4TE 4DR4T 4CI1B 2XAFB 3AEEA 1OWAA 3L3PA 2XAQB 2V7JA 4DR1T 4DNDA 2G0UA 2WZIA 1IZNB 1D0XA 3B13A 4ILAA 4ZXLA 4DV4T 1N33T 2YOEA 2BG9A 4B3RT 4TN7B 2FBWA 1N32T 5HEHA 5DJQC 2A9UA 4HN9A 4QX8B 4IREA 5JDMA 3AB3B 1J1JA 3C64A 4K0KT 3GN5A 4JI2T 1V9DA 2X0LB 2KXPB 4U7IA 3ANWA 3ZT5A 2X9YA 1XNRT 4B3ST 1UURA 4WYVA 3ONJA 4HWDA 2QYWA 2L9QA 2XJ7A 3EABA 2VL0A 3OPCA 2V1DB 3PU3A 4OYKA 5ADXL 3AEDA 5CA1E 5AQJB 3CQXC 5L3DB 2D5UA 4UF0B 4GYRA 4JI6T 4WNKA 2N2NA 4WBOA 4IE7A 2DNXA 3LFMA 2MOZA 1MMDA 2CLYB 5AQHB 2XQ5A 3AA1B 3FZHB 3N9QA 1ZKEA 3JADA 4BJNA 4YFSA 2UXBT 1Y64B 4QKNA 3PJAJ 2EHOB 2VASA 3RIUA 2K5BB 5HEJA 1QSDA 1UK5A 5AQLB 3GA8A 3HKCE 4U7YA 1IBMT 3V5UA 4LFAT 1UCUA 4X1IE 3P50A 4HTEA 2NOXA 1T72A 1U4QA 2CWYA 2JPFA 3ZYKA 4Q25A 3JC6C 4QWNB 4QH4A 2YU1A 4V1Av 4UV9B 4EIWA 2DHRA 3WAKA 1MMGA 5JRCA 4HFHA 2YDQA 4AQFA 2R6GF 1YQ3A 5FL1A 4GOUA 4P0AA 3F31A 2I6HA 2J62A 2N9DA 3P4RA 4ZI3D 2BKPA 2UXNB 1W9RA 4L9IA 2OV9A 1HNXT 2HPJA 5KX5E 2I59A 3VRBA 3SRZA 5E0OA 2BVLA 2BG9C 1AJ3A 1N36T 2L3LA 3AE2A 5JDGA 3QK6A 3UU8A 4KI0F 3OYZA 2X68A 4FI5A 4KMCA 2HPLA 5LBQB 4NPPA 3AE7A 2J4GA 2CM0A 4X1YE 1T98A 5L4EA 4C91A 3NZQA 1MMAA 4UXNB 2WY2A 3QOFA 4O8SA 3AEGA 4IHJE 2RPAA 2NW9A 1NENA 3RI5A 4PNIA 1WRDA 3PUYF 3EUHA 3HKEE 2W00A 3L8RA 3RC3A 3AE6A 5JR9A 1W09A 3ZT7A 5CFBA 2XQ4A 4DV3T 2DWKA 4AIUA 3DJBA 5AQPB 5LXTE 5FXVA 2XQ6A 3ZYLA 4DV6T 4N78D 2WU2A 3HKBE 4M1PA 3ZYMA 2IC9A 5JREA 1UX4A 2CRBA 3AE4A 2K9AA 4MLKA 1HTJF 3N9MA 3HI2A 5EK4A 4WBNE 2IAKA 4YHJA 4JYAT 4OHFA 3SFEA 1KEYA 1XMQT 1VCTA 2WDQA 4ZI3C 4CXYA 1MIVA 2ZM8A 3T1YT 3PDYA 5L3GB 1JNZA 3RHWA 3RIUC 1EZ3A 4IE4A 3AA0B 3SFDA 2V7MA 3GMIA 5L4HA 3FZFB 1HF8A 2D9DA 2XM1A 1T7SA 5AQSB 4AXPA 3ZC1A 2CXDA 4ZI2D 1OEDE 3ZMUB 1S94A 5AQIB 4EXTA 3ZMSB 3N2GE 2W67A 2SPCA 4L0RA 4H9SE 5IWAT 5ETWA 4U72A 3ZCIA 4ANJA 2GK9A 2JJ9A 5JDLA 1M62A 4EYYR 4AQFC 5AQMB 2BKOA 2NWBA 5F3JA 1CHUA 2CWOA 3ZMZB 3L39A 4IE6A 3I0OA 3I1AA 4B3MT 1E2AA 4LF4T 3DTOA 3CX7B 5H6RB 1KK7A 3LSVA 4CN4A 2LKHA 2CCQA 3PE0A 4EZHA 2IHR1 2CHNA 1G8XA 4OFZA 2E8IA 1NWMX 3VR9A 2MYSA 2BBJA 2HH7A 2MBGA 2YINA 1HG5A 4NUVA 2BS3A 3BK9A 4TUYE 3ETVA 5AQQB 3ZPOA 4PW8A 5HWYA 4CXXA 2Z6EA 3OJAA 1D1AA 4IT4A 3E08A 3P4WA 3UQ4A 4TWHA 3ZMVB 2IUBA 3R6NA 4ASKA 3RYFE 4ZI2C 2F4VT 3FZMB 1KNRA 5LG4A 4O4LE 3PUAA 3KDSE 3OKQA 1WCRA 1XZYA 2JQQA 4IE5A 2YK0A 5HXRA 5LMNT 3N5LA 2OLTA 3TLTA 5JDFA 4PK5A 5JQGE 2X9HA 4JI0T 2XSAA 4KP3C 1XNQT 3ESLA 4ZZBA 2VVNA 2H88A 4UEMA 4JI7T 4TX5A 4HFVA 5AQUB 4NUUA 3QC9A 2W66A 4JEUB 2LE8A 2NTYA 5LYJE 3T1HT 5LJMA 3RRWA 1BR0A 4U33A 2LOPA 1LVFA 3CVRA 3Q5WA 2A72A 2Y6XA 2WAUA 2B1EA 3KV5A 4EYUA 2RA1A 4IE0A 4TNVA 4XBFB 4EOZB 3MZKB 1XDOA 3LBXB 3SOLA 2WS3A 3KV9A 4EV6A 1KFYA 3ZKRA 1VCSA 5LCYA 1YKEB 3NVOA 2CHOA 2XZEA 2CA5A 4HFEA 2E9XC 1OXZA 5HXEA 3CQGB 5L3EB 4P09A 3RIAA 4O4JE 1BR1A 2H89A 2IIUA 2V6XA 4YTPA 4TZ4C 4QH5A 1L0VA 2I0MA 2NP9A 2VQFT 3MJXA 5FL0A 3Q2MA 5J1GA 2XM2A 3ZEFB 3RQUA 2J47A 1J5ET 2NTXA 4CI2B 3U78A 3PUWF 3AVRA 4ZS3A 5J2UE 1B7TA 4HEAA 4J2CA 4GK0E 2LSGA 5ABFB 4U31A 4ILBA 4NIQA 1IBLT 3EI0A 4IIJE 4PJMA 4PFOA 5HWXA 2UXCT 3U3IA 4ILCA 1GQEA 2X67A 3K3NA 4WZXA 3OTOT 2Q9QD 3NZPA 3E0ZA 2XQ3A 5J2TE 5JDNA 4LF9T 2LJLA 4MALA 4YXDA 3AA6B 5LHIB 2MAWA 2W61A 4O2AE 1YQ4A 5JDHA 2W0GA 5LBMA 3FB2A 5F8PA 4DR3T 3KVBA 2XQAA 5HCMA 4HFBA 1BR4A 2N1GA 3N9OA 2KINB 2FJDA 4LMLA 4GKKT 2PBIA 1HS7A 2BBHA 2E9XB 3NKZA 4QXCB 3JAEA 3OBVE 5FMNA 4DUYT 4C90A 2CXFA 4YT0A 2V6YA 3Q5XA 4AQGA 1SUMB 5ABGA 5FNVE 1CUNA 4UIGA 1WR6A 5AQKB 4KHZF 3C50A 2MTQA 1J5WA 3C4XA 3CKDA 4LF7T 4IDNA 3H37A 3TLVA 2DLRA 1XDPA 4DO0A 4YY3T 3A7MA 2V26A 4K0UA 1YKHB 4UVAB 1U5PA 4IDQA 4ADZA 4F8HA 1OEDA 2V7LA 4ZEYA 2BG9E 3AEAA 2XQ8A 4HE8A 4DV1T 4DR2T 4EEBA 2VL8A 1VOMA 3RKOA 3PUSA 2XHEB 4B6XA 3HKDE 3KINB 4DMWA 1I94T 3C4WA 4JEHB 4U3CA 5HEUA 5CGMA 2PTFA 4X62T 1BR2A 3D0TA 2LSIA 2XAGB 3OVUA 4YJ3E 3SWHA 3H3MA 2VKOA 4X65T 5BR8T 2LHNA 4LMJA 3K3QC 4LF5T 1LRZA 3ZMTB 2XASB 3UUXB 3VKGA 3P7IA 4E7SA 2NW8A 3AXJB 4HWCA 1D0ZA 5AFUL 1W0AA 2Y8DA 2LT3A 4DV7T 2YEVC 1HG2A 4XZCA 3UU3A 3PUXF 2X51A 1LVKA 5EK3A 3OYXA 2ES0A 4MHCA 4CQIA 1X9BA 4FJOA 2WM9A 4KBMB 3CX8B 4BJMA 3LK42 3P4SA 5F5WA 4I43B 3A8YC 4U2ZA 1UGOA 3AVSA 3O4XE 2DI4A 2W63A 5LP6E 4DBRA 5A1LA 4OX9T 3LK2B 2BG9B 1Z8UA 4AISA 4NXNT 4QX7B 1D1BA 3QB5A 5JDQA 2VKDA 3ZLIA 5L2LA 3K8PC 3S4UA 4HFCA 5IHYA 2C0SA 3PV0F 1Y01A 4HWIB 4UF0A 3GN5B 4GKJT 2WWUA 2FJBA 5HXHA 3O9XA 1OEDC 3ANWB 4IL9A 1HX1B 1NEKA 3UUBA 2BZBA 2WWVA 2VKHA 3AE8A 3M3ZB 4QXBB 3FXEB 2XQYA 2FUPA 4H63H 3PURA 3C4ZA 4O2BE 3IA3A 2A2FX 4UELA 3I9YA 3AECA 4I0UA 2LM2A 2FJAA 4TWFA 5EZYE 2EHOA 2H7VC 3LG7A 3VRAA 3MXZA 1IAPA 2PFVA 5AQFB 4LFCT
chains in the Genus database with same CATH topology
2YU2A 5JR9C 2CE7A 2EHOB 2VASA 2CA5A 2E9XC 1OXZA 2K5BB 5HXEA 3CQGB 2XTLA 5L3EB 3F57A 4P09A 4O4JE 4X1KE 1QSDA 3KFWX 1BR1A 3PUGA 1HCIA 3GA8A 3HKCE 2BDEA 3V5UA 2PG8A 3I9WA 1UCUA 1FIOA 4X1IE 4TZ4C 2Q9QB 3FBLA 5LA6E 3B57A 4HTEA 2NOXA 3KV6A 2NP9A 1U4QA 2CWYA 3MJXA 2JPFA 3Q2MA 4L5GA 3ZYKA 3JC6C 5J1GA 3WAJA 4QWNB 1WYBA 3ZEFB 3ETUA 2YU1A 3O1JA 3N2OA 3IHRA 4V1Av 4UV9B 5FYMA 2NTXA 4CI2B 4EIWA 2DHRA 3AAEB 2OA5A 3A5XA 1MMGA 3NRYA 3WAKA 5JRCA 3ZJ1A 3U78A 1X79A 1MIYA 3AVRA 3KBUA 1HX8A 4AQFA 4ZS3A 5J2UE 1B7TA 1Z0PA 3IF8B 4HEAA 4J2CA 4GK0E 4GOUA 4ZOLE 5FY7A 1MNDA 2LSGA 4P0AA 5BMVE 5CB4E 4H63V 3UTKA 2WMOA 4I50E 3SS1A 2DWGA 4DVDA 3F31A 2EHOD 5JRCB 1US7B 2KLQA 2N9DA 4QXHB 4ZI3D 3PU8A 2UXXB 4IIJE 4PJMA 4PFOA 2UXNB 4BA9A 3UFEA 5IYZE 3ZN0B 3C98B 4L9IA 5HWXA 3U3IA 1D0YA 2HPJA 4ISSA 2VKJA 1LKXA 5KX5E 2I59A 2X67A 3K3NA 5C8YE 2Q9QD 5HAXA 3RRCA 3NZPA 3SRZA 3E0ZA 5E0OA 2BVLA 5J2TE 1G73A 3R84B 3O1IA 1AJ3A 3N2KE 3NBXX 1ZEEA 2L3LA 3FBZA 4HKAA 5JDGA 5JDNA 2LJLA 3J7Yq 4MALA 3QK6A 3V5SA 3OYZA 2X68A 3LJCA 3RYCE 4FI5A 4KMCA 4GK5E 2LEHA 1KNZA 2HPLA 3AA6B 5LBQB 5LHIB 3K3OA 5LHHB 2KWIB 2A3DA 2CM0A 2H7OA 1O3XA 4ZI7E 4X1YE 5DQWA 1T98A 2W61A 4C91A 3MKDA 4PAGA 3PTRB 2ZLYA 3NZQA 4KUMB 2JMKA 1MMAA 4UXNB 2V7IA 4O2AE 2XAHB 4O8SA 4AKRB 4CI3B 3N9NA 4EZ4A 3AAAB 5JDHA 2W0GA 4JLEA 1YD8G 1YW0A 4IHJE 3RYIE 5LBMA 3FB2A 4PK6A 3CWZB 5F8PA 2NW9A 3EVYA 3KVBA 4PNIA 1WRDA 5FXXA 2X9XA 2RP4A 2W00A 3EUHA 3HKEE 3RC3A 5JR9A 5LNKA 4PK4A 3IBPA 2LSJA 4TV8E 2E9XA 3Q9DA 2DWKA 4BAYB 4F6RC 2C5KT 3NRXA 3DJBA 1BR4A 5FY1A 5LXTE 5FXVA 2K48A 3KV4A 2N1GA 3N9OA 2KINB 4UVBB 4ZHQE 5FY0A 3ZYLA 3DP7A 1IJ5A 4N78D 4G2AA 3HKBE 1FMWA 5JR9B 2VK9A 2PBIA 1HS7A 2Q9QA 1QUUA 4M1PA 3ZYMA 2IC9A 3MACA 5JREA 1UX4A 2E9XB 3BQKA 4MFRA 2ACXA 4QXCB 3OBVE 3CX6B 5FMNA 2K9AA 1VRBA 2JMHA 4MLKA 2KNDA 1HTJF 3KVAA 3N9MA 4C90A 2CXFA 3IEEA 3ONXA 3F2EA 3HI2A 5EK4A 1SHZC 3Q5XA 4WBNE 5GONE 4AQGA 4PJLA 2IAKA 4P0BA 4YHJA 5FNVE 1CUNA 4UIGA 2C5IT 1WR6A 3FHNA 1FMVA 4OHFA 3VHLA 2LSKA 3N9LA 2QA7A 3C50A 3UUNA 5L3BB 3CMLA 1MMNA 2MTQA 3C4XA 4ZI3C 3CKDA 2IC6A 4ISTA 1HFAA 4CXYA 1MIVA 1WYCA 3H37A 3ZC0A 2DCFA 2ZM8A 3PDYA 3CPZA 4UVCB 4AKGA 4DMVA 3ZN1B 3QUJA 2DLRA 5L3GB 4DO0A 2ODVA 2ZM0A 5CA0E 3HL6A 2CXLA 4U74A 3UULA 2V26A 1EZ3A 4K0UA 4IE4A 3AA0B 1YKHB 2V7MA 4UVAB 4TV9E 1U5PA 5KDMC 3BQIA 4H9NC 4A56A 3TKLB 3GMIA 2PJQA 4O4IE 5LHGB 4ADZA 1HF8A 4AI6A 2E9XD 4EB6E 2V7LA 4H9RC 5HXCA 4AXPA 4PFPA 3ZC1A 2CXDA 3AAIA 4ZI2D 1MNEA 5LGTB 3ZMUB 4HE8A 1S94A 3O1HA 4EXTA 4YJ2E 2LOSA 3ZMSB 2CEAA 3VKHA 4ILUA 3N2GE 2VL8A 1VOMA 3MA9A 2SPCA 4L0RA 1UX5A 3RKOA 4JUYA 3ZJ2A 3L09A 3PUSA 4H9SE 5LOVE 5LGNB 5FP3A 5M4YA 2XHEB 3JC6D 4U72A 5ETWA 3ZCIA 5JH7E 4B6XA 3HKDE 2GK9A 3KINB 2JJ9A 4O4HE 4ANJA 4DMWA 3C4WA 5JDLA 2J1DG 4EYYR 4AQFC 3MK7C 3ZCJA 3VU7H 2QGSA 4G63A 3KBTA 4JEHB 3RYHE 2NWBA 5F3JA 2KT9A 4YLHA 2CWOA 3AA7B 3ZMZB 5HXSA 3WI3A 2M67A 5FXZA 3E22E 4IE6A 3I0OA 5LJNA 1BR2A 2D2SA 2WMNA 1S35A 4IDZA 3EDVA 4CZZB 3I1AA 3D0TA 2LSIA 2XAGB 2X66A 4H9PC 3GWHA 2ZMAA 3DTOA 4ERRA 2NW7A 3CX7B 4YJ3E 3SWHA 5H6RB 1KK7A 5JVDE 2VKOA 4I55E 4PJNA 2CCQA 3PE0A 4EZHA 1NAFA 4ZS2A 5KMGP 2Y48B 2LHNA 2VWAA 5TAOA 1G8XA 2KMFA 3K3QC 3N9PA 1MIWA 4OFZA 2D0UA 2E8IA 1LRZA 1NWMX 5L3CB 3ZMTB 4QHOA 1E1HB 2CLYC 3RPUA 2MYSA 2XASB 3UUXB 2HH7A 2MBGA 2V7KA 3VKGA 2YINA 3P7IA 3M65A 1HG5A 2L8KA 4NUVA 2ODUA 4E7SA 2NW8A 5HYAA 2ZM2A 1IJ6A 3BK9A 4TUYE 2WBLA 2P9BA 1D0ZA 3ETVA 3T8OA 3ZPOA 4PW8A 5AFUL 5HWYA 4CXXA 2Z6EA 3OJAA 2X9WA 2Y8DA 3H3AA 2LT3A 1D1AA 2YEVC 2XAJB 5EK2A 1ZHCA 2LM9A 3E08A 2K24A 1HG2A 3UT5E 4MBQA 1WLXA 4AKHA 4XZCA 3ZMVB 1ZV4X 2EHOC 3R6NA 3I0QA 3RX6A 3LK3B 2H3RA 3J9X1 4ASKA 2X51A 3RYFE 4I4TE 2LSYA 1LVKA 4ZI2C 4HGAA 4DBQA 5EK3A 3OYXA 4CI1B 2ES0A 3UUMA 2XAFB 4MHCA 5LG4A 1OWAA 4FJOA 4CQIA 3L3PA 2Q9QC 2XAQB 4O4LE 2V7JA 3PUAA 3W15B 4DNDA 2G0UA 2WM9A 3KDSE 3OKQA 4KBMB 3CX8B 4BJMA 1IZNB 1D0XA 2XUEA 3B13A 3LK42 4IGUA 2JQQA 4H9OC 4IE5A 4CXWA 4I43B 2YK0A 5HXRA 3BQLA 1H7CA 3N5LA 2BVMA 4GYSA 3AVSA 3O4XE 4H9QC 2DI4A 2W63A 4PK5A 4TN7B 5JDFA 5JQGE 2X9HA 2KZ7B 5LP6E 5DJQC 4DBRA 4KP3C 2D0TA 2W62A 4HN9A 5A1LA 1SA0E 4QX8B 3C51A 3ESLA 4X20E 3AB3B 3LK2B 5JDMA 3RH3A 3C64A 5DABA 3FXDB 3GN5A 4UEMA 3RC8A 1V9DA 4TX5A 2X0LB 2KXPB 4HFVA 4QX7B 4NUUA 1D1BA 3ANWA 3QC9A 5JDQA 2X9YA 4GIWA 2VKDA 3ZLIA 5L2LA 4JEUB 4OK0A 3K8PC 3S4UA 5IHYA 2C0SA 4AKIA 4UF0A 2LE8A 2L9QA 3GN5B 2NTYA 2IW5B 2WWUA 5HXHA 5LYJE 2V1DB 3PU3A 2JRKA 3O9XA 4OYKA 5ADXL 3ANWB 4AKLA 5LJMA 5CA1E 2BZBA 5H6QB 3CQXC 5L3DB 2LHRA 2CMRA 4E7ZA 2D5UA 2VKHA 5DQVA 4UF0B 3RRWA 4GYRA 4QXBB 1BR0A 3PUQA 2LOPA 3FXEB 1LVFA 4WNKA 2XQYA 2N2NA 2WSSV 3CVRA 4WBOA 2VB6A 3Q5WA 4IE7A 2DNXA 3LFMA 4H63H 2KWHA 2MOZA 2A72A 3PURA 2Y6XA 3C4ZA 4XAXB 1FEWA 3LBXA 5FXWA 2WAUA 1MMDA 2B1EA 3KV5A 3P8CD 4EYUA 2RA1A 2CLYB 4O2BE 4IE0A 3CQCB 4XBFB 4EOZB 4Z8XA 4OYJA 5L3FB 3AA1B 3MZKB 4PJJA 2A2FX 4UELA 3N9QA 4EAHA 1ZKEA 3I9YA 4WW0A 5EZYE 4BJNA 4UV8B 4YFSA 2EHOA 2H7VC 3HR0A 3LG7A 3LBXB 3SOLA 3KV9A 5LGUB 3MXZA 1IAPA 3EDUA 5LCYA 2PFVA 1YKEB 3HA4A 1D1CA 1Y64B 2C5JA 4QKNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSK A;  2LSI A;  4BA9 A;  4GK5 E;  2N1G A;  2LSY A;  4GK0 E;  4FJO A;  3VU7 H;  4EXT A;  2LSJ A;  2LSG A; 
#chains in the Genus database with same CATH topology
 2JQK A;  5JR9 C;  2CE7 A;  3CK6 A;  4QH1 A;  1T8B A;  4CN6 A;  1HCI A;  2BDE A;  2PG8 A;  3I9W A;  1FIO A;  5LA6 E;  3KV6 A;  2XPK A;  2JIW A;  4L5G A;  3WAJ A;  1WYB A;  3ETU A;  3O1J A;  3N2O A;  2WCA A;  3IHR A;  2LKG A;  4YTN A;  5FYM A;  2XQ7 A;  3AAE B;  3A5X A;  3NRY A;  1SE7 A;  2UUC T;  3KBU A;  2WZH A;  1HX8 A;  4ZOL E;  2QVA A;  1MND A;  4H63 V;  3UTK A;  4I50 E;  3SS1 A;  2EHO D;  5JRC B;  2IDO B;  1US7 B;  3TLS A;  3RKG A;  4QXH B;  4JBW F;  5HEO A;  3ABV A;  4BA9 A;  1N34 T;  3AEB A;  4HWH A;  3UFE A;  5IYZ E;  4JI5 T;  3C98 B;  1D0Y A;  3ZSS A;  4ISS A;  2VKJ A;  3PJA A;  2CPT A;  3EAM A;  5C8Y E;  5HAX A;  3RRC A;  3JCF A;  1G73 A;  3R84 B;  3ZT6 A;  3N2K E;  3J7Y q;  3NBX X;  1ZEE A;  3FBZ A;  4HKA A;  4DV0 T;  4A97 A;  3V5S A;  1ZOY A;  2QRX A;  1KNZ A;  4DR7 T;  2MPK A;  2A3D A;  1O3X A;  4ZI7 E;  5DQW A;  3MKD A;  4PAG A;  3PTR B;  3UU6 A;  4X66 T;  2JMK A;  4AKR B;  4EZ4 A;  5C2T A;  1YD8 G;  1YW0 A;  3RYI E;  5KXJ A;  4PK6 A;  4NXM T;  2M6I A;  2RP4 A;  3PUV F;  5LNK A;  4PK4 A;  2LSJ A;  3TLW A;  3Q9D A;  2XY8 B;  3QNU A;  2AXD S;  2C5K T;  3NRX A;  1E7P A;  1JNR A;  4X64 T;  3KV4 A;  4UVB B;  1FMW A;  5JR9 B;  2VK9 A;  2Q9Q A;  1QUU A;  2WB5 A;  3BQK A;  2ACX A;  3LDQ B;  3RIF A;  3ONX A;  4ZZC A;  2C5I T;  3FHN A;  4LF8 T;  4JV5 T;  1FMV A;  2LSK A;  3UUN A;  1MMN A;  3CML A;  3VR8 A;  1HFA A;  1WYC A;  3ZC0 A;  2DCF A;  4AQY T;  3CPZ A;  4UVC B;  4AKG A;  4DMV A;  3ZN1 B;  5FVK A;  2LRK A;  3QUJ A;  3HL6 A;  3UFG A;  3UUL A;  4TV9 E;  5KDM C;  3BQI A;  3TKL B;  2PJQ A;  5LHG B;  2V5C A;  4AI6 A;  2W4X A;  5HXC A;  2ACZ A;  5LGT B;  3ONL C;  3O1H A;  2CEA A;  3VKH A;  4ILU A;  4JI1 T;  4TWD A;  4JUY A;  3ZJ2 A;  5LOV E;  3B5M A;  5FP3 A;  3JC6 D;  2YN6 A;  5AQT B;  2QGS A;  4G63 A;  3RYH E;  1FJG T;  2KT9 A;  4YLH A;  3AA7 B;  4EGW A;  5AQG B;  5ABE A;  2M67 A;  4CZZ B;  1HNZ T;  5IUX A;  4Z90 A;  2X66 A;  5C3J A;  4H9P C;  3GWH A;  4ERR A;  2NW7 A;  1YXR A;  5KMG P;  2Y48 B;  3FZL B;  2VWA A;  5L3C B;  4QHO A;  3RPU A;  2B76 A;  2HN2 A;  4LF6 T;  2V7K A;  4JI4 T;  3M65 A;  1W0B A;  2ODU A;  5HCJ A;  4A5X A;  1IJ6 A;  2P9B A;  2BS2 A;  4DR6 T;  4U2Y A;  3H3A A;  1ZHC A;  2LM9 A;  2JQ9 A;  3P4Q A;  3AE3 A;  1ZV4 X;  5HEG A;  3I0Q A;  3RX6 A;  3LK3 B;  2BS4 A;  4HGA A;  4DBQ A;  4P1N A;  3UUM A;  2Q9Q C;  3W15 B;  2XUE A;  4IGU A;  4H9O C;  4CXW A;  4A98 A;  3AE9 A;  2XQ9 A;  4DR5 T;  3BQL A;  1H7C A;  2BVM A;  4GYS A;  4H9Q C;  5AQV B;  2KZ7 B;  2XSB A;  2D0T A;  2W62 A;  1SA0 E;  2YDS A;  3C51 A;  4X20 E;  3RH3 A;  5DAB A;  3FXD B;  3RC8 A;  5AQR B;  3P4P A;  3EHZ A;  4TNW A;  4GIW A;  1R8I A;  4OK0 A;  4AKI A;  3NWI A;  2IW5 B;  3UU5 A;  2UUA T;  3Q5E A;  1WR0 A;  2LRL A;  2JRK A;  4AKL A;  5H6Q B;  2LHR A;  2CMR A;  4E7Z A;  5CJ5 A;  5DQV A;  3PUQ A;  3AE1 A;  2WSS V;  2VB6 A;  2UUB T;  4JI3 T;  4DUZ T;  2KWH A;  4X5T A;  4XAX B;  1FEW A;  1WFD A;  3LBX A;  5FXW A;  3P8C D;  3CQC B;  2WP9 A;  4Z8X A;  4OYJ A;  5L3F B;  4PJJ A;  5FVL A;  4EAH A;  2M6B A;  2E5L T;  4WW0 A;  2JQH A;  4UV8 B;  4YSY A;  3HR0 A;  5LGU B;  3EDU A;  2HHH T;  4YTM A;  2LLY A;  3HA4 A;  1D1C A;  2X0Y A;  2KSR A;  2C5J A;  2YU2 A;  2YDR A;  2V5D A;  2XTL A;  4IDP A;  3X1D A;  3F57 A;  4Z91 A;  4X1K E;  3KFW X;  3PUG A;  2AE9 A;  2Q9Q B;  3FBL A;  3B57 A;  3RF1 A;  2NR4 A;  4DV2 T;  5ABF A;  2BKN A;  2OA5 A;  3RLF F;  3ZJ1 A;  1X79 A;  1MIY A;  2X0H A;  2FJE A;  2WDV A;  1Z0P A;  3IF8 B;  5FY7 A;  5BMV E;  5CB4 E;  4JI8 T;  2WMO A;  2DWG A;  4DVD A;  2W2U A;  2KLQ A;  2K3W A;  4YHH T;  3PU8 A;  2UXX B;  3ZN0 B;  2V8S V;  5JTG A;  4LMK A;  2VVS A;  1LKX A;  2UU9 T;  2WQY A;  3O1I A;  4HFI A;  3RQW A;  4DV5 T;  4IL4 A;  5LB7 B;  3LJC A;  3RYC E;  4GK5 E;  2LEH A;  3K3O A;  5LHH B;  2KWI B;  2H7O A;  3TLU A;  4LFB T;  2ZLY A;  4KUM B;  3UU4 A;  5LMU T;  1XMO T;  2V7I A;  2HN1 A;  2XAH B;  1IBK T;  4CI3 B;  3N9N A;  3AAA B;  4JLE A;  1XWM A;  3CWZ B;  3EVY A;  5FXX A;  2X9X A;  2VQE T;  3IBP A;  4TV8 E;  2E9X A;  4HFD A;  4BAY B;  4F6R C;  5FY1 A;  2K48 A;  1HR0 T;  4ZHQ E;  5FY0 A;  3DP7 A;  1IJ5 A;  1ZP0 A;  4G2A A;  3CIR A;  3MAC A;  4MFR A;  1DU2 A;  3CX6 B;  1VRB A;  2JMH A;  2KND A;  4CN1 A;  2CBI A;  3KVA A;  4HWF A;  3IEE A;  1QLB A;  2YKS A;  3F2E A;  1SHZ C;  3AEF A;  5GON E;  4PJL A;  2E5V A;  4P0B A;  5L47 A;  3VHL A;  3N9L A;  2QA7 A;  5L3B B;  5FKY A;  2IC6 A;  4IST A;  2V6Y B;  5LG3 A;  2ODV A;  2ZM0 A;  5CA0 E;  2CXL A;  4U74 A;  4EED A;  3AE5 A;  4H9N C;  4A56 A;  5AQN B;  4O4I E;  2UXD T;  2E9X D;  4EB6 E;  4H9R C;  4PFP A;  3AAI A;  1MNE A;  4YJ2 E;  2LOS A;  3K1S A;  1KNP A;  3MA9 A;  1OED B;  1UX5 A;  2WU5 A;  3L09 A;  5M4Y A;  5LGN B;  2E2A A;  2CBJ A;  5AQO B;  1I6Z A;  5JH7 E;  4O4H E;  2J1D G;  3FZK B;  3MK7 C;  3ZCJ A;  3VU7 H;  3KBT A;  3QB5 K;  5ABH A;  4IDO A;  4COF A;  5HXS A;  3WI3 A;  2ZM6 T;  4KX6 A;  5FXZ A;  3RGL A;  3E22 E;  5LJN A;  2D2S A;  2VUR A;  1S35 A;  2WMN A;  3EDV A;  4IDZ A;  2IML A;  2ZMA A;  5JVD E;  4I55 E;  1UUS A;  4PJN A;  3G06 A;  1HNW T;  3AXJ A;  1NAF A;  4ZS2 A;  3Q5D A;  4DID B;  5TAO A;  2KMF A;  3N9P A;  1MIW A;  3ZST A;  2D0U A;  1M7K A;  2WDR A;  1E1H B;  2CLY C;  2DL1 A;  4YSX A;  3UQ7 A;  5HYA A;  2L8K A;  2ZM2 A;  2WBL A;  3T8O A;  2X9W A;  5J0Z A;  4B3T T;  2XAJ B;  4KHP T;  5EK2 A;  2K24 A;  3UT5 E;  4YSZ A;  4MBQ A;  1WLX A;  4AKH A;  1KF6 A;  2EHO C;  3JAF A;  2H3R A;  4UR9 A;  3J9X 1;  3PUZ F;  2LSY A;  4I4T E;  4DR4 T;  4CI1 B;  2XAF B;  3AEE A;  1OWA A;  3L3P A;  2XAQ B;  2V7J A;  4DR1 T;  4DND A;  2G0U A;  2WZI A;  1IZN B;  1D0X A;  3B13 A;  4ILA A;  4ZXL A;  4DV4 T;  1N33 T;  2YOE A;  2BG9 A;  4B3R T;  4TN7 B;  2FBW A;  1N32 T;  5HEH A;  5DJQ C;  2A9U A;  4HN9 A;  4QX8 B;  4IRE A;  5JDM A;  3AB3 B;  1J1J A;  3C64 A;  4K0K T;  3GN5 A;  4JI2 T;  1V9D A;  2X0L B;  2KXP B;  4U7I A;  3ANW A;  3ZT5 A;  2X9Y A;  1XNR T;  4B3S T;  1UUR A;  4WYV A;  3ONJ A;  4HWD A;  2QYW A;  2L9Q A;  2XJ7 A;  3EAB A;  2VL0 A;  3OPC A;  2V1D B;  3PU3 A;  4OYK A;  5ADX L;  3AED A;  5CA1 E;  5AQJ B;  3CQX C;  5L3D B;  2D5U A;  4UF0 B;  4GYR A;  4JI6 T;  4WNK A;  2N2N A;  4WBO A;  4IE7 A;  2DNX A;  3LFM A;  2MOZ A;  1MMD A;  2CLY B;  5AQH B;  2XQ5 A;  3AA1 B;  3FZH B;  3N9Q A;  1ZKE A;  3JAD A;  4BJN A;  4YFS A;  2UXB T;  1Y64 B;  4QKN A;  3PJA J;  2EHO B;  2VAS A;  3RIU A;  2K5B B;  5HEJ A;  1QSD A;  1UK5 A;  5AQL B;  3GA8 A;  3HKC E;  4U7Y A;  1IBM T;  3V5U A;  4LFA T;  1UCU A;  4X1I E;  3P50 A;  4HTE A;  2NOX A;  1T72 A;  1U4Q A;  2CWY A;  2JPF A;  3ZYK A;  4Q25 A;  3JC6 C;  4QWN B;  4QH4 A;  2YU1 A;  4V1A v;  4UV9 B;  4EIW A;  2DHR A;  3WAK A;  1MMG A;  5JRC A;  4HFH A;  2YDQ A;  4AQF A;  2R6G F;  1YQ3 A;  5FL1 A;  4GOU A;  4P0A A;  3F31 A;  2I6H A;  2J62 A;  2N9D A;  3P4R A;  4ZI3 D;  2BKP A;  2UXN B;  1W9R A;  4L9I A;  2OV9 A;  1HNX T;  2HPJ A;  5KX5 E;  2I59 A;  3VRB A;  3SRZ A;  5E0O A;  2BVL A;  2BG9 C;  1AJ3 A;  1N36 T;  2L3L A;  3AE2 A;  5JDG A;  3QK6 A;  3UU8 A;  4KI0 F;  3OYZ A;  2X68 A;  4FI5 A;  4KMC A;  2HPL A;  5LBQ B;  4NPP A;  3AE7 A;  2J4G A;  2CM0 A;  4X1Y E;  1T98 A;  5L4E A;  4C91 A;  3NZQ A;  1MMA A;  4UXN B;  2WY2 A;  3QOF A;  4O8S A;  3AEG A;  4IHJ E;  2RPA A;  2NW9 A;  1NEN A;  3RI5 A;  4PNI A;  1WRD A;  3PUY F;  3EUH A;  3HKE E;  2W00 A;  3L8R A;  3RC3 A;  3AE6 A;  5JR9 A;  1W09 A;  3ZT7 A;  5CFB A;  2XQ4 A;  4DV3 T;  2DWK A;  4AIU A;  3DJB A;  5AQP B;  5LXT E;  5FXV A;  2XQ6 A;  3ZYL A;  4DV6 T;  4N78 D;  2WU2 A;  3HKB E;  4M1P A;  3ZYM A;  2IC9 A;  5JRE A;  1UX4 A;  2CRB A;  3AE4 A;  2K9A A;  4MLK A;  1HTJ F;  3N9M A;  3HI2 A;  5EK4 A;  4WBN E;  2IAK A;  4YHJ A;  4JYA T;  4OHF A;  3SFE A;  1KEY A;  1XMQ T;  1VCT A;  2WDQ A;  4ZI3 C;  4CXY A;  1MIV A;  2ZM8 A;  3T1Y T;  3PDY A;  5L3G B;  1JNZ A;  3RHW A;  3RIU C;  1EZ3 A;  4IE4 A;  3AA0 B;  3SFD A;  2V7M A;  3GMI A;  5L4H A;  3FZF B;  1HF8 A;  2D9D A;  2XM1 A;  1T7S A;  5AQS B;  4AXP A;  3ZC1 A;  2CXD A;  4ZI2 D;  1OED E;  3ZMU B;  1S94 A;  5AQI B;  4EXT A;  3ZMS B;  3N2G E;  2W67 A;  2SPC A;  4L0R A;  4H9S E;  5IWA T;  5ETW A;  4U72 A;  3ZCI A;  4ANJ A;  2GK9 A;  2JJ9 A;  5JDL A;  1M62 A;  4EYY R;  4AQF C;  5AQM B;  2BKO A;  2NWB A;  5F3J A;  1CHU A;  2CWO A;  3ZMZ B;  3L39 A;  4IE6 A;  3I0O A;  3I1A A;  4B3M T;  1E2A A;  4LF4 T;  3DTO A;  3CX7 B;  5H6R B;  1KK7 A;  3LSV A;  4CN4 A;  2LKH A;  2CCQ A;  3PE0 A;  4EZH A;  2IHR 1;  2CHN A;  1G8X A;  4OFZ A;  2E8I A;  1NWM X;  3VR9 A;  2MYS A;  2BBJ A;  2HH7 A;  2MBG A;  2YIN A;  1HG5 A;  4NUV A;  2BS3 A;  3BK9 A;  4TUY E;  3ETV A;  5AQQ B;  3ZPO A;  4PW8 A;  5HWY A;  4CXX A;  2Z6E A;  3OJA A;  1D1A A;  4IT4 A;  3E08 A;  3P4W A;  3UQ4 A;  4TWH A;  3ZMV B;  2IUB A;  3R6N A;  4ASK A;  3RYF E;  4ZI2 C;  2F4V T;  3FZM B;  1KNR A;  5LG4 A;  4O4L E;  3PUA A;  3KDS E;  3OKQ A;  1WCR A;  1XZY A;  2JQQ A;  4IE5 A;  2YK0 A;  5HXR A;  5LMN T;  3N5L A;  2OLT A;  3TLT A;  5JDF A;  4PK5 A;  5JQG E;  2X9H A;  4JI0 T;  2XSA A;  4KP3 C;  1XNQ T;  3ESL A;  4ZZB A;  2VVN A;  2H88 A;  4UEM A;  4JI7 T;  4TX5 A;  4HFV A;  5AQU B;  4NUU A;  3QC9 A;  2W66 A;  4JEU B;  2LE8 A;  2NTY A;  5LYJ E;  3T1H T;  5LJM A;  3RRW A;  1BR0 A;  4U33 A;  2LOP A;  1LVF A;  3CVR A;  3Q5W A;  2A72 A;  2Y6X A;  2WAU A;  2B1E A;  3KV5 A;  4EYU A;  2RA1 A;  4IE0 A;  4TNV A;  4XBF B;  4EOZ B;  3MZK B;  1XDO A;  3LBX B;  3SOL A;  2WS3 A;  3KV9 A;  4EV6 A;  1KFY A;  3ZKR A;  1VCS A;  5LCY A;  1YKE B;  3NVO A;  2CHO A;  2XZE A;  2CA5 A;  4HFE A;  2E9X C;  1OXZ A;  5HXE A;  3CQG B;  5L3E B;  4P09 A;  3RIA A;  4O4J E;  1BR1 A;  2H89 A;  2IIU A;  2V6X A;  4YTP A;  4TZ4 C;  4QH5 A;  1L0V A;  2I0M A;  2NP9 A;  2VQF T;  3MJX A;  5FL0 A;  3Q2M A;  5J1G A;  2XM2 A;  3ZEF B;  3RQU A;  2J47 A;  1J5E T;  2NTX A;  4CI2 B;  3U78 A;  3PUW F;  3AVR A;  4ZS3 A;  5J2U E;  1B7T A;  4HEA A;  4J2C A;  4GK0 E;  2LSG A;  5ABF B;  4U31 A;  4ILB A;  4NIQ A;  1IBL T;  3EI0 A;  4IIJ E;  4PJM A;  4PFO A;  5HWX A;  2UXC T;  3U3I A;  4ILC A;  1GQE A;  2X67 A;  3K3N A;  4WZX A;  3OTO T;  2Q9Q D;  3NZP A;  3E0Z A;  2XQ3 A;  5J2T E;  5JDN A;  4LF9 T;  2LJL A;  4MAL A;  4YXD A;  3AA6 B;  5LHI B;  2MAW A;  2W61 A;  4O2A E;  1YQ4 A;  5JDH A;  2W0G A;  5LBM A;  3FB2 A;  5F8P A;  4DR3 T;  3KVB A;  2XQA A;  5HCM A;  4HFB A;  1BR4 A;  2N1G A;  3N9O A;  2KIN B;  2FJD A;  4LML A;  4GKK T;  2PBI A;  1HS7 A;  2BBH A;  2E9X B;  3NKZ A;  4QXC B;  3JAE A;  3OBV E;  5FMN A;  4DUY T;  4C90 A;  2CXF A;  4YT0 A;  2V6Y A;  3Q5X A;  4AQG A;  1SUM B;  5ABG A;  5FNV E;  1CUN A;  4UIG A;  1WR6 A;  5AQK B;  4KHZ F;  3C50 A;  2MTQ A;  1J5W A;  3C4X A;  3CKD A;  4LF7 T;  4IDN A;  3H37 A;  3TLV A;  2DLR A;  1XDP A;  4DO0 A;  4YY3 T;  3A7M A;  2V26 A;  4K0U A;  1YKH B;  4UVA B;  1U5P A;  4IDQ A;  4ADZ A;  4F8H A;  1OED A;  2V7L A;  4ZEY A;  2BG9 E;  3AEA A;  2XQ8 A;  4HE8 A;  4DV1 T;  4DR2 T;  4EEB A;  2VL8 A;  1VOM A;  3RKO A;  3PUS A;  2XHE B;  4B6X A;  3HKD E;  3KIN B;  4DMW A;  1I94 T;  3C4W A;  4JEH B;  4U3C A;  5HEU A;  5CGM A;  2PTF A;  4X62 T;  1BR2 A;  3D0T A;  2LSI A;  2XAG B;  3OVU A;  4YJ3 E;  3SWH A;  3H3M A;  2VKO A;  4X65 T;  5BR8 T;  2LHN A;  4LMJ A;  3K3Q C;  4LF5 T;  1LRZ A;  3ZMT B;  2XAS B;  3UUX B;  3VKG A;  3P7I A;  4E7S A;  2NW8 A;  3AXJ B;  4HWC A;  1D0Z A;  5AFU L;  1W0A A;  2Y8D A;  2LT3 A;  4DV7 T;  2YEV C;  1HG2 A;  4XZC A;  3UU3 A;  3PUX F;  2X51 A;  1LVK A;  5EK3 A;  3OYX A;  2ES0 A;  4MHC A;  4CQI A;  1X9B A;  4FJO A;  2WM9 A;  4KBM B;  3CX8 B;  4BJM A;  3LK4 2;  3P4S A;  5F5W A;  4I43 B;  3A8Y C;  4U2Z A;  1UGO A;  3AVS A;  3O4X E;  2DI4 A;  2W63 A;  5LP6 E;  4DBR A;  5A1L A;  4OX9 T;  3LK2 B;  2BG9 B;  1Z8U A;  4AIS A;  4NXN T;  4QX7 B;  1D1B A;  3QB5 A;  5JDQ A;  2VKD A;  3ZLI A;  5L2L A;  3K8P C;  3S4U A;  4HFC A;  5IHY A;  2C0S A;  3PV0 F;  1Y01 A;  4HWI B;  4UF0 A;  3GN5 B;  4GKJ T;  2WWU A;  2FJB A;  5HXH A;  3O9X A;  1OED C;  3ANW B;  4IL9 A;  1HX1 B;  1NEK A;  3UUB A;  2BZB A;  2WWV A;  2VKH A;  3AE8 A;  3M3Z B;  4QXB B;  3FXE B;  2XQY A;  2FUP A;  4H63 H;  3PUR A;  3C4Z A;  4O2B E;  3IA3 A;  2A2F X;  4UEL A;  3I9Y A;  3AEC A;  4I0U A;  2LM2 A;  2FJA A;  4TWF A;  5EZY E;  2EHO A;  2H7V C;  3LG7 A;  3VRA A;  3MXZ A;  1IAP A;  2PFV A;  5AQF B;  4LFC T; 
#chains in the Genus database with same CATH homology
 2YU2 A;  5JR9 C;  2CE7 A;  2EHO B;  2VAS A;  2CA5 A;  2E9X C;  1OXZ A;  2K5B B;  5HXE A;  3CQG B;  2XTL A;  5L3E B;  3F57 A;  4P09 A;  4O4J E;  4X1K E;  1QSD A;  3KFW X;  1BR1 A;  3PUG A;  1HCI A;  3GA8 A;  3HKC E;  2BDE A;  3V5U A;  2PG8 A;  3I9W A;  1UCU A;  1FIO A;  4X1I E;  4TZ4 C;  2Q9Q B;  3FBL A;  5LA6 E;  3B57 A;  4HTE A;  2NOX A;  3KV6 A;  2NP9 A;  1U4Q A;  2CWY A;  3MJX A;  2JPF A;  3Q2M A;  4L5G A;  3ZYK A;  3JC6 C;  5J1G A;  3WAJ A;  4QWN B;  1WYB A;  3ZEF B;  3ETU A;  2YU1 A;  3O1J A;  3N2O A;  3IHR A;  4V1A v;  4UV9 B;  5FYM A;  2NTX A;  4CI2 B;  4EIW A;  2DHR A;  3AAE B;  2OA5 A;  3A5X A;  1MMG A;  3NRY A;  3WAK A;  5JRC A;  3ZJ1 A;  3U78 A;  1X79 A;  1MIY A;  3AVR A;  3KBU A;  1HX8 A;  4AQF A;  4ZS3 A;  5J2U E;  1B7T A;  1Z0P A;  3IF8 B;  4HEA A;  4J2C A;  4GK0 E;  4GOU A;  4ZOL E;  5FY7 A;  1MND A;  2LSG A;  4P0A A;  5BMV E;  5CB4 E;  4H63 V;  3UTK A;  2WMO A;  4I50 E;  3SS1 A;  2DWG A;  4DVD A;  3F31 A;  2EHO D;  5JRC B;  1US7 B;  2KLQ A;  2N9D A;  4QXH B;  4ZI3 D;  3PU8 A;  2UXX B;  4IIJ E;  4PJM A;  4PFO A;  2UXN B;  4BA9 A;  3UFE A;  5IYZ E;  3ZN0 B;  3C98 B;  4L9I A;  5HWX A;  3U3I A;  1D0Y A;  2HPJ A;  4ISS A;  2VKJ A;  1LKX A;  5KX5 E;  2I59 A;  2X67 A;  3K3N A;  5C8Y E;  2Q9Q D;  5HAX A;  3RRC A;  3NZP A;  3SRZ A;  3E0Z A;  5E0O A;  2BVL A;  5J2T E;  1G73 A;  3R84 B;  3O1I A;  1AJ3 A;  3N2K E;  3NBX X;  1ZEE A;  2L3L A;  3FBZ A;  4HKA A;  5JDG A;  5JDN A;  2LJL A;  3J7Y q;  4MAL A;  3QK6 A;  3V5S A;  3OYZ A;  2X68 A;  3LJC A;  3RYC E;  4FI5 A;  4KMC A;  4GK5 E;  2LEH A;  1KNZ A;  2HPL A;  3AA6 B;  5LBQ B;  5LHI B;  3K3O A;  5LHH B;  2KWI B;  2A3D A;  2CM0 A;  2H7O A;  1O3X A;  4ZI7 E;  4X1Y E;  5DQW A;  1T98 A;  2W61 A;  4C91 A;  3MKD A;  4PAG A;  3PTR B;  2ZLY A;  3NZQ A;  4KUM B;  2JMK A;  1MMA A;  4UXN B;  2V7I A;  4O2A E;  2XAH B;  4O8S A;  4AKR B;  4CI3 B;  3N9N A;  4EZ4 A;  3AAA B;  5JDH A;  2W0G A;  4JLE A;  1YD8 G;  1YW0 A;  4IHJ E;  3RYI E;  5LBM A;  3FB2 A;  4PK6 A;  3CWZ B;  5F8P A;  2NW9 A;  3EVY A;  3KVB A;  4PNI A;  1WRD A;  5FXX A;  2X9X A;  2RP4 A;  2W00 A;  3EUH A;  3HKE E;  3RC3 A;  5JR9 A;  5LNK A;  4PK4 A;  3IBP A;  2LSJ A;  4TV8 E;  2E9X A;  3Q9D A;  2DWK A;  4BAY B;  4F6R C;  2C5K T;  3NRX A;  3DJB A;  1BR4 A;  5FY1 A;  5LXT E;  5FXV A;  2K48 A;  3KV4 A;  2N1G A;  3N9O A;  2KIN B;  4UVB B;  4ZHQ E;  5FY0 A;  3ZYL A;  3DP7 A;  1IJ5 A;  4N78 D;  4G2A A;  3HKB E;  1FMW A;  5JR9 B;  2VK9 A;  2PBI A;  1HS7 A;  2Q9Q A;  1QUU A;  4M1P A;  3ZYM A;  2IC9 A;  3MAC A;  5JRE A;  1UX4 A;  2E9X B;  3BQK A;  4MFR A;  2ACX A;  4QXC B;  3OBV E;  3CX6 B;  5FMN A;  2K9A A;  1VRB A;  2JMH A;  4MLK A;  2KND A;  1HTJ F;  3KVA A;  3N9M A;  4C90 A;  2CXF A;  3IEE A;  3ONX A;  3F2E A;  3HI2 A;  5EK4 A;  1SHZ C;  3Q5X A;  4WBN E;  5GON E;  4AQG A;  4PJL A;  2IAK A;  4P0B A;  4YHJ A;  5FNV E;  1CUN A;  4UIG A;  2C5I T;  1WR6 A;  3FHN A;  1FMV A;  4OHF A;  3VHL A;  2LSK A;  3N9L A;  2QA7 A;  3C50 A;  3UUN A;  5L3B B;  3CML A;  1MMN A;  2MTQ A;  3C4X A;  4ZI3 C;  3CKD A;  2IC6 A;  4IST A;  1HFA A;  4CXY A;  1MIV A;  1WYC A;  3H37 A;  3ZC0 A;  2DCF A;  2ZM8 A;  3PDY A;  3CPZ A;  4UVC B;  4AKG A;  4DMV A;  3ZN1 B;  3QUJ A;  2DLR A;  5L3G B;  4DO0 A;  2ODV A;  2ZM0 A;  5CA0 E;  3HL6 A;  2CXL A;  4U74 A;  3UUL A;  2V26 A;  1EZ3 A;  4K0U A;  4IE4 A;  3AA0 B;  1YKH B;  2V7M A;  4UVA B;  4TV9 E;  1U5P A;  5KDM C;  3BQI A;  4H9N C;  4A56 A;  3TKL B;  3GMI A;  2PJQ A;  4O4I E;  5LHG B;  4ADZ A;  1HF8 A;  4AI6 A;  2E9X D;  4EB6 E;  2V7L A;  4H9R C;  5HXC A;  4AXP A;  4PFP A;  3ZC1 A;  2CXD A;  3AAI A;  4ZI2 D;  1MNE A;  5LGT B;  3ZMU B;  4HE8 A;  1S94 A;  3O1H A;  4EXT A;  4YJ2 E;  2LOS A;  3ZMS B;  2CEA A;  3VKH A;  4ILU A;  3N2G E;  2VL8 A;  1VOM A;  3MA9 A;  2SPC A;  4L0R A;  1UX5 A;  3RKO A;  4JUY A;  3ZJ2 A;  3L09 A;  3PUS A;  4H9S E;  5LOV E;  5LGN B;  5FP3 A;  5M4Y A;  2XHE B;  3JC6 D;  4U72 A;  5ETW A;  3ZCI A;  5JH7 E;  4B6X A;  3HKD E;  2GK9 A;  3KIN B;  2JJ9 A;  4O4H E;  4ANJ A;  4DMW A;  3C4W A;  5JDL A;  2J1D G;  4EYY R;  4AQF C;  3MK7 C;  3ZCJ A;  3VU7 H;  2QGS A;  4G63 A;  3KBT A;  4JEH B;  3RYH E;  2NWB A;  5F3J A;  2KT9 A;  4YLH A;  2CWO A;  3AA7 B;  3ZMZ B;  5HXS A;  3WI3 A;  2M67 A;  5FXZ A;  3E22 E;  4IE6 A;  3I0O A;  5LJN A;  1BR2 A;  2D2S A;  2WMN A;  1S35 A;  4IDZ A;  3EDV A;  4CZZ B;  3I1A A;  3D0T A;  2LSI A;  2XAG B;  2X66 A;  4H9P C;  3GWH A;  2ZMA A;  3DTO A;  4ERR A;  2NW7 A;  3CX7 B;  4YJ3 E;  3SWH A;  5H6R B;  1KK7 A;  5JVD E;  2VKO A;  4I55 E;  4PJN A;  2CCQ A;  3PE0 A;  4EZH A;  1NAF A;  4ZS2 A;  5KMG P;  2Y48 B;  2LHN A;  2VWA A;  5TAO A;  1G8X A;  2KMF A;  3K3Q C;  3N9P A;  1MIW A;  4OFZ A;  2D0U A;  2E8I A;  1LRZ A;  1NWM X;  5L3C B;  3ZMT B;  4QHO A;  1E1H B;  2CLY C;  3RPU A;  2MYS A;  2XAS B;  3UUX B;  2HH7 A;  2MBG A;  2V7K A;  3VKG A;  2YIN A;  3P7I A;  3M65 A;  1HG5 A;  2L8K A;  4NUV A;  2ODU A;  4E7S A;  2NW8 A;  5HYA A;  2ZM2 A;  1IJ6 A;  3BK9 A;  4TUY E;  2WBL A;  2P9B A;  1D0Z A;  3ETV A;  3T8O A;  3ZPO A;  4PW8 A;  5AFU L;  5HWY A;  4CXX A;  2Z6E A;  3OJA A;  2X9W A;  2Y8D A;  3H3A A;  2LT3 A;  1D1A A;  2YEV C;  2XAJ B;  5EK2 A;  1ZHC A;  2LM9 A;  3E08 A;  2K24 A;  1HG2 A;  3UT5 E;  4MBQ A;  1WLX A;  4AKH A;  4XZC A;  3ZMV B;  1ZV4 X;  2EHO C;  3R6N A;  3I0Q A;  3RX6 A;  3LK3 B;  2H3R A;  3J9X 1;  4ASK A;  2X51 A;  3RYF E;  4I4T E;  2LSY A;  1LVK A;  4ZI2 C;  4HGA A;  4DBQ A;  5EK3 A;  3OYX A;  4CI1 B;  2ES0 A;  3UUM A;  2XAF B;  4MHC A;  5LG4 A;  1OWA A;  4FJO A;  4CQI A;  3L3P A;  2Q9Q C;  2XAQ B;  4O4L E;  2V7J A;  3PUA A;  3W15 B;  4DND A;  2G0U A;  2WM9 A;  3KDS E;  3OKQ A;  4KBM B;  3CX8 B;  4BJM A;  1IZN B;  1D0X A;  2XUE A;  3B13 A;  3LK4 2;  4IGU A;  2JQQ A;  4H9O C;  4IE5 A;  4CXW A;  4I43 B;  2YK0 A;  5HXR A;  3BQL A;  1H7C A;  3N5L A;  2BVM A;  4GYS A;  3AVS A;  3O4X E;  4H9Q C;  2DI4 A;  2W63 A;  4PK5 A;  4TN7 B;  5JDF A;  5JQG E;  2X9H A;  2KZ7 B;  5LP6 E;  5DJQ C;  4DBR A;  4KP3 C;  2D0T A;  2W62 A;  4HN9 A;  5A1L A;  1SA0 E;  4QX8 B;  3C51 A;  3ESL A;  4X20 E;  3AB3 B;  3LK2 B;  5JDM A;  3RH3 A;  3C64 A;  5DAB A;  3FXD B;  3GN5 A;  4UEM A;  3RC8 A;  1V9D A;  4TX5 A;  2X0L B;  2KXP B;  4HFV A;  4QX7 B;  4NUU A;  1D1B A;  3ANW A;  3QC9 A;  5JDQ A;  2X9Y A;  4GIW A;  2VKD A;  3ZLI A;  5L2L A;  4JEU B;  4OK0 A;  3K8P C;  3S4U A;  5IHY A;  2C0S A;  4AKI A;  4UF0 A;  2LE8 A;  2L9Q A;  3GN5 B;  2NTY A;  2IW5 B;  2WWU A;  5HXH A;  5LYJ E;  2V1D B;  3PU3 A;  2JRK A;  3O9X A;  4OYK A;  5ADX L;  3ANW B;  4AKL A;  5LJM A;  5CA1 E;  2BZB A;  5H6Q B;  3CQX C;  5L3D B;  2LHR A;  2CMR A;  4E7Z A;  2D5U A;  2VKH A;  5DQV A;  4UF0 B;  3RRW A;  4GYR A;  4QXB B;  1BR0 A;  3PUQ A;  2LOP A;  3FXE B;  1LVF A;  4WNK A;  2XQY A;  2N2N A;  2WSS V;  3CVR A;  4WBO A;  2VB6 A;  3Q5W A;  4IE7 A;  2DNX A;  3LFM A;  4H63 H;  2KWH A;  2MOZ A;  2A72 A;  3PUR A;  2Y6X A;  3C4Z A;  4XAX B;  1FEW A;  3LBX A;  5FXW A;  2WAU A;  1MMD A;  2B1E A;  3KV5 A;  3P8C D;  4EYU A;  2RA1 A;  2CLY B;  4O2B E;  4IE0 A;  3CQC B;  4XBF B;  4EOZ B;  4Z8X A;  4OYJ A;  5L3F B;  3AA1 B;  3MZK B;  4PJJ A;  2A2F X;  4UEL A;  3N9Q A;  4EAH A;  1ZKE A;  3I9Y A;  4WW0 A;  5EZY E;  4BJN A;  4UV8 B;  4YFS A;  2EHO A;  2H7V C;  3HR0 A;  3LG7 A;  3LBX B;  3SOL A;  3KV9 A;  5LGU B;  3MXZ A;  1IAP A;  3EDU A;  5LCY A;  2PFV A;  1YKE B;  3HA4 A;  1D1C A;  1Y64 B;  2C5J A;  4QKN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...