4GK0E

Crystal structure of human rev3-rev7-rev1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
96
structure length
96
Chain Sequence
b'APNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitotic spindle assembly checkpoint protein MAD2B
molecule tags Transferase
source organism Homo sapiens
publication title Structural insights into the assembly of human translesion polymerase complexes
pubmed doi rcsb
total genus 33
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4gk0E00
2LSIA 2N1GA 4GK0E 3VU7H 4FJOA 4BA9A 4EXTA 2LSYA 2LSKA 4GK5E 2LSGA 2LSJA
chains in the Genus database with same CATH superfamily
3EHZA 4YJ2E 4ZS2A 1UURA 1CUNA 2B1EA 3AEDA 5HAXA 3Q5WA 2LSYA 3RX6A 2D9DA 1UCUA 3AA6B 3CKDA 3QB5K 2DLRA 2ZM0A 4O4HE 2YDSA 2DWGA 2V6YB 1XMOT 4HWHA 4WYVA 2XQ4A 3LBXA 1D0XA 4UF0A 1N33T 2IC9A 2VKJA 3N2OA 4HN9A 4L9IA 3MK7C 4IL9A 5JH7E 4GKKT 5LP6E 3BQIA 2MBGA 4YSZA 2CWOA 1H7CA 3AE1A 3P7IA 2BZBA 4KUMB 2H7VC 3LG7A 4M1PA 1Z0PA 4TUYE 5LCYA 5JQGE 5LMUT 5L3DB 3TLWA 4DVDA 5ABFA 2XZEA 3RIUA 3JAEA 3LK3B 2JQ9A 3EDUA 4UF0B 2NW8A 2UXNB 4GYRA 5AFUL 5J0ZA 4DV3T 2CXFA 4UIGA 1YQ4A 5LHGB 4AKHA 4G2AA 4CI1B 3AE8A 2J4GA 3ANWB 3FZHB 3C4XA 5LOVE 2WBLA 2LKGA 5FVKA 3ZCIA 4BA9A 3JAFA 1D1AA 2WZIA 3AEEA 2MYSA 4U2ZA 4OYKA 3UU6A 1LVKA 2Q9QC 2LJLA 4U3CA 3UU4A 4ZXLA 3CIRA 1FEWA 3KINB 3OYXA 4TV9E 4OX9T 2AE9A 3A7MA 5FL0A 2KWIB 4TNVA 3SFDA 2BVMA 3UUMA 4LFBT 2QVAA 1HR0T 4ISTA 3AAAB 1D0YA 3KBUA 3TKLB 3AEFA 2VVSA 3FZMB 3A8YC 4EEDA 4BAYB 3N9OA 3JC6D 1XMQT 2JRKA 1UK5A 5DABA 4HE8A 3AAIA 3VR9A 3NRXA 2XJ7A 5FMNA 1HNXT 3KDSE 4X1KE 2IDOB 3UQ7A 4HFBA 5L3EB 1OXZA 2XAQB 3RQUA 4DV6T 3AXJB 3WAKA 5HEOA 4LFCT 2FUPA 4X66T 1US7B 2CRBA 4QH1A 3OJAA 4QXCB 5JDFA 1E2AA 2F4VT 3ONXA 5JDMA 4TN7B 3B13A 3SRZA 5KDMC 1MMDA 5AQGB 5L3FB 4X65T 4DV1T 4E7ZA 2HPJA 3HKCE 2AXDS 4MLKA 1YQ3A 4YTMA 4EXTA 2ZM2A 3PUYF 4ILCA 2EHOD 2WZHA 2J62A 2YOEA 4QXHB 5EK3A 2VVNA 3MKDA 3AE9A 4CQIA 2H3RA 5HXSA 4E7SA 3QOFA 1XNRT 4GKJT 2SPCA 1YXRA 2L3LA 3K8PC 1T8BA 3RRWA 2R6GF 3RF1A 2BG9C 2FJEA 2V1DB 4XBFB 3P4PA 1VOMA 3ETUA 4HWIB 2NOXA 4WNKA 5J1GA 2YDRA 2BVLA 3CK6A 4MFRA 2QYWA 5FKYA 3T8OA 4JI0T 2UU9T 5JRCA 1J5ET 2W4XA 3ZT6A 2X9HA 2UUBT 4LFAT 2Q9QB 4UV8B 2J47A 4X64T 1G8XA 3J7Yq 3ZSSA 2XASB 4AQFA 4MALA 3K3QC 3FXDB 5H6RB 2Q9QA 3OPCA 4L5GA 2VL0A 3CQCB 4HWDA 3JCFA 4O2AE 3RYCE 4ZOLE 2OV9A 1WYBA 2CPTA 4DR7T 2CBIA 1T98A 2N9DA 3PU8A 4HEAA 3LBXB 5FXZA 3OVUA 5LYJE 2JQKA 2BG9B 2IHR1 4QX7B 5C3JA 2UXDT 1BR0A 3NZPA 1YKEB 3P4SA 2K9AA 2X68A 4AIUA 2WCAA 1HNWT 3MJXA 5H6QB 5ADXL 2YEVC 4LF6T 1N36T 2X0LB 1HCIA 3CX7B 3B57A 3I1AA 4HGAA 2XSBA 4ADZA 3E22E 2CE7A 5HXRA 3RKOA 4ASKA 2XQ3A 4YJ3E 2UXCT 3PV0F 4KHZF 3HR0A 4DR4T 4PFPA 5LA6E 3AA0B 2LRLA 2Q9QD 3VHLA 3CWZB 4OYJA 4O4IE 2YDQA 4TWFA 2YK0A 3FZFB 3GWHA 4HKAA 4WBOA 3KV4A 3RPUA 1WCRA 2BKNA 1HX8A 3K1SA 3LK42 4DIDB 4C91A 2K5BB 3SFEA 2IAKA 4YSXA 4DV7T 4UELA 2PFVA 1DU2A 2CHNA 4IE6A 2WU2A 4HFHA 2XPKA 2LSKA 4YHJA 5AQUB 1UX5A 1CHUA 3UU8A 4EOZB 3AEBA 1YW0A 3CPZA 3GN5B 3L3PA 3RGLA 1I94T 4LF9T 2Y48B 5CFBA 2UXBT 4TV8E 1MMAA 3JADA 4NUVA 4COFA 3RYIE 3V5UA 2I6HA 4ZS3A 2XAJB 2ES0A 3PTRB 2EHOA 5ABHA 2PJQA 5HYAA 4DV2T 1N34T 5L47A 2UUAT 3B5MA 5JDQA 4PAGA 3IF8B 5EK4A 4HFIA 5AQSB 4CN6A 4GIWA 3UU5A 2W61A 2WU5A 2OLTA 3AE7A 5LB7B 1SE7A 3KVBA 2E9XB 2LM2A 1ZKEA 3CVRA 2VKHA 2A72A 3PUXF 4NUUA 4TWHA 4AQFC 4P0AA 3HKDE 2OA5A 2X67A 3NZQA 5HEJA 2JPFA 2WS3A 4AXPA 1AJ3A 2DCFA 3AE5A 5L4EA 3X1DA 3RIAA 1NWMX 4X1IE 3QK6A 1KEYA 4O8SA 3W15B 4YY3T 5C8YE 2HPLA 1W0BA 1HG5A 3N9LA 2V7MA 3O1HA 2DL1A 1S35A 3AVSA 3O4XE 3AE2A 3P8CD 3PUZF 3ZKRA 2MPKA 4ILUA 2JIWA 3PJAJ 5AQKB 3AEGA 2CXDA 2XM1A 5AQQB 4AQGA 1OEDE 4JI1T 1VCSA 3TLSA 5LGNB 4EYUA 2W62A 2C5KT 2FBWA 5AQVB 2J1DG 1QLBA 2WDRA 1MNDA 2IW5B 1MMNA 3OTOT 2K3WA 4DUYT 1YD8G 3O1JA 2QGSA 2N1GA 4IREA 4YTPA 4B3RT 4AI6A 2N2NA 5DQWA 2KT9A 3N9MA 3TLVA 5FXWA 5LHIB 2JJ9A 4IDZA 2PTFA 3I9WA 4EYYR 5L2LA 4IHJE 4YSYA 4ZI3D 4F6RC 2DWKA 3NVOA 4PJMA 4UVCB 3ZMZB 3ZYLA 4CXXA 4DUZT 3CQXC 1I6ZA 1ZEEA 2WM9A 2H89A 4H9RC 3VRAA 5LG3A 4I0UA 4JI2T 1MIYA 2XQ9A 2XQ7A 3AECA 3HL6A 3NRYA 4CI2B 5HWXA 1UGOA 4KBMB 5TAOA 3GN5A 2QRXA 5AQRB 3DP7A 2E5LT 2HH7A 2XM2A 3Q5XA 5ABFB 5AQOB 2LEHA 2ZM8A 4IIJE 1Y01A 4DR5T 4NXMT 1FMWA 1KF6A 1LKXA 2MTQA 3KV5A 4CXYA 1HS7A 2XUEA 2X0HA 2QA7A 4UV9B 4DV4T 5FL1A 3FBZA 5DJQC 4IE0A 3R84B 3WI3A 4B6XA 2PG8A 4H9PC 1N32T 2KMFA 2NTYA 1E7PA 4ILAA 2CHOA 3N2GE 3CX6B 4O4LE 2NR4A 5BR8T 4JI8T 3ZN0B 3KFWX 4YFSA 3RHWA 3ZEFB 3ZYKA 3ABVA 3KV6A 2JMHA 4DR2T 4IT4A 2LHRA 3C98B 2MAWA 3PUGA 1U5PA 5FYMA 4IDPA 3PUWF 4O2BE 2LRKA 4A97A 4AKLA 4ANJA 1R8IA 2RA1A 5FY7A 4X5TA 4IE7A 3RKGA 3E08A 5L3GB 2BG9E 3E0ZA 1XNQT 2NW9A 2VK9A 3PJAA 2XQ5A 4PK5A 4U72A 3V5SA 3S4UA 1NEKA 4WBNE 5KXJA 1ZP0A 2VURA 4ILBA 1D1CA 2KNDA 2E2AA 3A5XA 2D2SA 5F3JA 4QKNA 5AQTB 4DV0T 4GK5E 2ACZA 2W66A 4QH4A 4DBQA 4HFVA 3BQLA 4ZI7E 5FNVE 4CXWA 1BR1A 4X62T 3K3NA 3O1IA 2RP4A 2C5JA 2PBIA 3CX8B 1GQEA 3PUVF 2WB5A 3N2KE 3PDYA 3Q2MA 2HN2A 2FJAA 1Z8UA 5CA1E 1O3XA 4XAXB 4ZI3C 3MACA 3RYHE 1XWMA 5JR9C 4LF4T 3U3IA 4JBWF 4KP3C 5LJNA 1NAFA 3EI0A 3RIFA 3MXZA 4G63A 4H9NC 5JVDE 3ZMSB 2NP9A 1MNEA 3T1HT 2WAUA 2CWYA 3ZMUB 4OHFA 4LMLA 4P1NA 2L9QA 5EK2A 1QSDA 5LHHB 3AA1B 2V7JA 5LGTB 4B3ST 4EAHA 2WWUA 2V5CA 5AQJB 4NXNT 2BS3A 2VB6A 4IL4A 4JLEA 4LMKA 5E0OA 3UULA 2LM9A 1SUMB 3SWHA 2JMKA 3M65A 2XHEB 3HI2A 5AQIB 5AQPB 3UUXB 4A5XA 3ZT7A 4ZI2D 4PFOA 5BMVE 4DR1T 4DMVA 4JYAT 2HHHT 2UUCT 4KI0F 3NBXX 2BBHA 3ONLC 1XZYA 3PURA 4I4TE 2L8KA 2BS4A 3N9QA 4HFDA 5LG4A 2I0MA 3C4WA 4I43B 1KK7A 3GMIA 4QXBB 4PK4A 3BK9A 2VQET 1M7KA 4KHPT 5CA0E 2XQ6A 3ZJ2A 4CN1A 5HEUA 3LK2B 2KINB 3ZSTA 5LMNT 2X9WA 2E9XD 2NWBA 2V7IA 3BQKA 3FB2A 3MZKB 1IJ6A 2FJBA 3QB5A 3PU3A 4Z8XA 1BR2A 4Q25A 3CMLA 5ABEA 3N5LA 3AA7B 3UFEA 3ANWA 3HA4A 1L0VA 1OEDB 2W2UA 2XY8B 4FJOA 3ZPOA 4ZEYA 2V6XA 1VCTA 2W00A 4UXNB 5FY1A 4JI6T 4B3MT 2GK9A 5EZYE 1JNZA 1OWAA 3OBVE 4U74A 1QUUA 5F5WA 5L3CB 2XSAA 4GK0E 5FXXA 5LNKA 3VKHA 1OEDA 1ZHCA 2X9YA 3NWIA 4EZ4A 2K24A 3EAMA 4OK0A 1G73A 1HTJF 4WW0A 3RRCA 4UR9A 3RYFE 3LSVA 5AQFB 3DTOA 5FP3A 2EHOC 3AE4A 2ZLYA 3I0QA 3I9YA 3EVYA 4YLHA 3RIUC 3U78A 4ERRA 4HWFA 3AVRA 3RC8A 3FXEB 3FHNA 1BR4A 3UU3A 1WR0A 4IE4A 1KNZA 5JR9B 2V6YA 1B7TA 2NW7A 4TX5A 5HWYA 3VRBA 1ZV4X 2M6BA 2E9XA 3DJBA 3PUSA 2LHNA 2VKOA 4CI3B 4H9QC 3C50A 1S94A 2WP9A 3SS1A 4BJMA 5HXEA 2VWAA 4DMWA 5FXVA 4EZHA 4Z90A 1IAPA 2DHRA 1W9RA 4EIWA 1J1JA 3ETVA 5DQVA 1WLXA 3ZLIA 2WMOA 5IUXA 4J2CA 2YINA 4L0RA 1FMVA 3FBLA 2D0UA 3VR8A 4DR3T 1XDOA 3C64A 3M3ZB 1YKHB 2H7OA 1IZNB 2A3DA 2V7KA 2VL8A 1WR6A 4OFZA 2FJDA 3UUBA 1T7SA 3ZMVB 4CN4A 2IIUA 4C90A 2IC6A 2B76A 2X9XA 3N9PA 3OYZA 2C5IT 2JQHA 3L8RA 5L4HA 4K0UA 4NPPA 2M6IA 2DNXA 3O9XA 2LKHA 2XAGB 1NENA 3C4ZA 1EZ3A 1X9BA 1SA0E 1V9DA 2IUBA 2KWHA 4EB6E 2WDVA 5LJMA 2V8SV 3UUNA 3QNUA 1LVFA 4N78D 1D0ZA 4GOUA 2A9UA 2E5VA 3IA3A 4O4JE 5CB4E 1IJ5A 4I55E 4DBRA 3HKBE 4AKRB 2WY2A 4Z91A 3UTKA 1FJGT 2MOZA 2UXXB 4H9SE 4JV5T 3QC9A 3EUHA 2D0TA 4PJJA 5HXCA 5LGUB 4YHHT 3AAEB 1IBMT 4JI4T 2EHOB 3Q5DA 3Q5EA 5CGMA 5C2TA 5ABGA 2V26A 1OEDC 2BKPA 2BKOA 4EGWA 1WFDA 4LF5T 4LF7T 2LE8A 2V5DA 2BG9A 2W0GA 2CEAA 2XAFB 2LSIA 5HEGA 4JI7T 2LOSA 1IBKT 4YT0A 3AE3A 3L09A 1Y64B 4HFEA 3G06A 4UVAB 4XZCA 3AXJA 5IYZE 3UQ4A 3ZCJA 4ZZBA 2YN6A 1M62A 3FZLB 4P09A 4QH5A 4QX8B 3ONJA 2DI4A 2Y6XA 1ZOYA 4X20E 1W0AA 2CXLA 2ACXA 2KSRA 3F57A 3FZKB 2KXPB 3H3AA 4IGUA 4LF8T 5HCJA 3TLUA 3Q9DA 3VU7H 3KBTA 1T72A 3PUQA 1HG2A 2E9XC 2JQQA 2XQAA 2Y8DA 3GA8A 4U31A 3RQWA 3ZYMA 4ZZCA 5AQLB 4JEUB 2WWVA 2ZM6T 1J5WA 2I59A 3LDQB 2CBJA 1IBLT 2NTXA 2CLYC 4FI5A 3F31A 2XTLA 3IHRA 4JUYA 4NIQA 4TWDA 4U33A 3RI5A 1HX1B 1WYCA 2CCQA 3AEAA 3H37A 3F2EA 3JC6C 4H63V 4KMCA 1W09A 2X66A 4KX6A 5AQMB 3I0OA 2VQFT 5HCMA 3OKQA 1U4QA 5AQNB 3ZN1B 1VRBA 4H9OC 2XAHB 4GYSA 3KVAA 1LRZA 2YU1A 4HWCA 4ISSA 4ZI2C 2D5UA 3ZT5A 2V7LA 5JDHA 2E8IA 3LJCA 2WMNA 4BJNA 3T1YT 3UT5E 3N9NA 5HXHA 2W63A 3L39A 5GONE 2K48A 4ZHQE 4LMJA 2LT3A 2YKSA 3CQGB 2CLYB 4U2YA 4UVBB 5FY0A 5LXTE 4DR6T 2ZMAA 4PNIA 1X79A 4IE5A 3WAJA 2G0UA 3C51A 2IMLA 1KFYA 3P4WA 4JI5T 1FIOA 2LSJA 3RH3A 4YTNA 3RC3A 3K3OA 3SOLA 2XQ8A 4EV6A 2ODVA 5J2UE 2A2FX 4P0BA 3PUAA 4IDQA 4WZXA 2LLYA 4DV5T 1D1BA 3D0TA 3R6NA 2ODUA 3TLTA 5JRCB 2WQYA 5FVLA 3ZJ1A 3PE0A 2X51A 3EABA 4TNWA 4DNDA 3IBPA 1UUSA 3UFGA 3ZC0A 4X1YE 3IEEA 2WSSV 2CMRA 3P4QA 4H63H 2BBJA 2C0SA 4UEMA 4YXDA 4K0KT 4AKGA 4AQYT 4MBQA 5ETWA 4DO0A 2CM0A 1HF8A 4F8HA 4AISA 5JR9A 5CJ5A 5KX5E 5JREA 1JNRA 2HN1A 3H3MA 5LBMA 1E1HB 2P9BA 5IWAT 2H88A 1KNRA 5J2TE 2CA5A 2BDEA 2BS2A 3LFMA 4IDOA 4A56A 4A98A 2LOPA 5JDLA 4JEHB 4PJNA 2WDQA 2VASA 5F8PA 5HEHA 5M4YA 3AB3B 3KV9A 1HFAA 1XDPA 4CZZB 5JDNA 4JI3T 1MIVA 2Z6EA 4U7IA 2XQYA 2VKDA 3J9X1 4PW8A 2KLQA 4TZ4C 5AQHB 3ZMTB 2W67A 3MA9A 3P50A 4HTEA 4QWNB 4PK6A 5IHYA 2RPAA 4EEBA 5KMGP 4I50E 3NKZA 4QHOA 3EDVA 1KNPA 2KZ7B 3ESLA 1WRDA 2M67A 3ZC1A 1SHZC 4PJLA 2LSGA 3QUJA 3AE6A 1MMGA 4AKIA 2YU2A 5LBQB 3P4RA 4B3TT 5JDGA 4HFCA 1UX4A 4V1Av 3RLFF 5JTGA 4IDNA 1MIWA 4MHCA 1HNZT 5L3BB 3VKGA 2X0YA 3HKEE 4U7YA 5A1LA
chains in the Genus database with same CATH topology
4YJ2E 4ZS2A 2B1EA 1CUNA 5HAXA 3Q5WA 2LSYA 3RX6A 1UCUA 3AA6B 3CKDA 2DLRA 2ZM0A 4O4HE 2DWGA 3LBXA 1D0XA 4UF0A 2IC9A 2VKJA 3N2OA 4HN9A 4L9IA 3MK7C 5JH7E 5LP6E 3BQIA 2MBGA 2CWOA 1H7CA 4M1PA 3P7IA 2BZBA 4KUMB 2H7VC 3LG7A 4TUYE 1Z0PA 5LCYA 5JQGE 5L3DB 4DVDA 3LK3B 3EDUA 4UF0B 2NW8A 2UXNB 4GYRA 5AFUL 2CXFA 4UIGA 4AKHA 5LHGB 4G2AA 4CI1B 3ANWB 3C4XA 5LOVE 2WBLA 4BA9A 3ZCIA 1D1AA 2MYSA 4OYKA 1LVKA 2Q9QC 2LJLA 1FEWA 3KINB 3OYXA 4TV9E 3UUMA 2KWIB 2BVMA 4ISTA 3AAAB 1D0YA 3KBUA 4BAYB 3N9OA 3JC6D 2JRKA 5DABA 4HE8A 3AAIA 3NRXA 5FMNA 3KDSE 4X1KE 5L3EB 1OXZA 2XAQB 3WAKA 1US7B 3OJAA 4QXCB 5JDFA 3ONXA 5JDMA 4TN7B 3B13A 3SRZA 5KDMC 1MMDA 5L3FB 4E7ZA 2HPJA 3HKCE 4MLKA 4EXTA 2ZM2A 2EHOD 4QXHB 5EK3A 5HXSA 3MKDA 4CQIA 2H3RA 4E7SA 2SPCA 2L3LA 3K8PC 3RRWA 2V1DB 4XBFB 1VOMA 3ETUA 5J1GA 2NOXA 4WNKA 2BVLA 4MFRA 3T8OA 5JRCA 2X9HA 2Q9QB 4UV8B 1G8XA 3J7Yq 2XASB 4AQFA 4MALA 3K3QC 3FXDB 5H6RB 2Q9QA 4L5GA 3CQCB 3ZN1B 4O2AE 3RYCE 4ZOLE 1WYBA 2N9DA 1T98A 3PU8A 4HEAA 3LBXB 5FXZA 5LYJE 4QX7B 1BR0A 3NZPA 1YKEB 2K9AA 2X68A 3MJXA 5H6QB 5ADXL 2YEVC 2X0LB 3CX7B 1HCIA 3B57A 3I1AA 4HGAA 4ADZA 3E22E 2CE7A 5HXRA 3RKOA 4ASKA 4YJ3E 3HR0A 4PFPA 5LA6E 3AA0B 2Q9QD 3VHLA 3CWZB 4OYJA 4O4IE 2YK0A 4HKAA 3GWHA 4WBOA 3RPUA 3KV4A 4C91A 1HX8A 3LK42 2K5BB 2IAKA 4UELA 2PFVA 4IE6A 4YHJA 2LSKA 1UX5A 4EOZB 1YW0A 3CPZA 3GN5B 3L3PA 2Y48B 4TV8E 1MMAA 4NUVA 3RYIE 3V5UA 4ZS3A 2XAJB 2ES0A 3PTRB 2EHOA 2PJQA 5HYAA 5JDQA 4PAGA 3IF8B 5EK4A 4GIWA 2W61A 3KVBA 2E9XB 3CVRA 1ZKEA 4P0AA 2VKHA 2A72A 4NUUA 4AQFC 3HKDE 2OA5A 2X67A 3NZQA 2JPFA 4AXPA 2DCFA 1NWMX 4X1IE 3QK6A 4O8SA 3W15B 5C8YE 2HPLA 3N9LA 1HG5A 3P8CD 2V7MA 3O1HA 3O4XE 1S35A 3AVSA 4ILUA 2CXDA 4AQGA 5LGNB 4EYUA 2W62A 2C5KT 2J1DG 1MNDA 2IW5B 1MMNA 1YD8G 3O1JA 2QGSA 2N1GA 4AI6A 2N2NA 5DQWA 2KT9A 3N9MA 5FXWA 5LHIB 2JJ9A 4IDZA 3I9WA 4EYYR 5L2LA 4IHJE 4ZI3D 4F6RC 2DWKA 4PJMA 4UVCB 3ZMZB 3ZYLA 4CXXA 3CQXC 1ZEEA 2WM9A 4H9RC 1MIYA 3HL6A 3NRYA 4CI2B 5HWXA 4KBMB 5TAOA 3GN5A 3DP7A 2HH7A 3Q5XA 2LEHA 2ZM8A 4IIJE 1FMWA 1LKXA 3KV5A 2MTQA 4CXYA 1HS7A 2XUEA 2QA7A 4UV9B 3FBZA 5DJQC 4IE0A 3R84B 3WI3A 4B6XA 2PG8A 4H9PC 2KMFA 2NTYA 4O4LE 3N2GE 3CX6B 3ZN0B 3KFWX 4YFSA 3ZYKA 3KV6A 2JMHA 2LHRA 3C98B 3PUGA 1U5PA 5FYMA 4AKLA 4O2BE 4ANJA 2RA1A 5FY7A 4IE7A 3E08A 5L3GB 3E0ZA 2NW9A 2VK9A 4WBNE 4PK5A 4U72A 3V5SA 3S4UA 1D1CA 2KNDA 3A5XA 2D2SA 5F3JA 4QKNA 4GK5E 4HFVA 3BQLA 4ZI7E 5FNVE 4CXWA 1BR1A 3K3NA 3O1IA 2RP4A 2C5JA 2PBIA 3CX8B 3N2KE 3PDYA 3Q2MA 5CA1E 1O3XA 4XAXB 4ZI3C 3MACA 3RYHE 5JR9C 3U3IA 5LJNA 4KP3C 1NAFA 3MXZA 4G63A 4H9NC 5JVDE 3ZMSB 2NP9A 1MNEA 2WAUA 2CWYA 3ZMUB 4OHFA 5EK2A 2L9QA 1QSDA 5LHHB 3AA1B 2V7JA 5LGTB 4EAHA 2WWUA 2VB6A 4JLEA 5E0OA 3UULA 2LM9A 3SWHA 5JDGA 2JMKA 3M65A 2XHEB 3HI2A 3UUXB 4ZI2D 5HXEA 5BMVE 4PFOA 4DMVA 3NBXX 4I4TE 3PURA 2L8KA 3N9QA 5LG4A 3C4WA 4I43B 1KK7A 3GMIA 4QXBB 4PK4A 3BK9A 5CA0E 3ZJ2A 3LK2B 2KINB 2X9WA 2E9XD 2NWBA 2V7IA 3FB2A 3BQKA 3MZKB 1IJ6A 3PU3A 4Z8XA 1BR2A 3CMLA 3N5LA 3AA7B 3UFEA 3ANWA 3HA4A 3ZPOA 4FJOA 2W00A 4UXNB 5FY1A 2GK9A 5EZYE 1OWAA 3OBVE 4U74A 1QUUA 5L3CB 4GK0E 5FXXA 5LNKA 3VKHA 4EZ4A 1ZHCA 2X9YA 2K24A 4OK0A 1G73A 1HTJF 4WW0A 3RRCA 3RYFE 3DTOA 5FP3A 2EHOC 4YLHA 2ZLYA 3I0QA 3I9YA 3EVYA 3U78A 4ERRA 3AVRA 3FXEB 3FHNA 1BR4A 4IE4A 1KNZA 5JR9B 1B7TA 2NW7A 4TX5A 5HWYA 1ZV4X 3DJBA 2E9XA 3PUSA 4CI3B 2LHNA 2VKOA 4H9QC 3C50A 1S94A 3SS1A 4BJMA 2VWAA 4DMWA 5FXVA 4EZHA 1IAPA 2DHRA 4EIWA 3ETVA 5DQVA 1WLXA 3ZLIA 2WMOA 4J2CA 2YINA 4L0RA 1FMVA 3FBLA 2D0UA 3C64A 1YKHB 2H7OA 1IZNB 2A3DA 2V7KA 2VL8A 1WR6A 4OFZA 3ZMVB 4C90A 2IC6A 3N9PA 2X9XA 3OYZA 2C5IT 4K0UA 2DNXA 2XAGB 3C4ZA 1EZ3A 1SA0E 1V9DA 2KWHA 4EB6E 5LJMA 3UUNA 1LVFA 4N78D 1D0ZA 4GOUA 4O4JE 5CB4E 1IJ5A 4I55E 4DBRA 3HKBE 4AKRB 3UTKA 2MOZA 2UXXB 4H9SE 3QC9A 3EUHA 2D0TA 4PJJA 5HXCA 5LGUB 3AAEB 2EHOB 2V26A 2LE8A 2XAFB 2W0GA 2CEAA 2LSIA 2LOSA 3L09A 1Y64B 4XZCA 4UVAB 5IYZE 3O9XA 3ZCJA 4QX8B 4P09A 2DI4A 2Y6XA 4X20E 2CXLA 2ACXA 3F57A 3H3AA 4IGUA 2KXPB 3ZEFB 3VU7H 3Q9DA 3KBTA 3PUQA 3TKLB 1HG2A 2E9XC 2JQQA 3RC8A 3GA8A 2Y8DA 3ZYMA 4AKGA 4JEUB 2I59A 2NTXA 2CLYC 4FI5A 3F31A 2XTLA 3IHRA 4JUYA 4DBQA 2CCQA 1WYCA 3H37A 3F2EA 3JC6C 4H63V 4KMCA 2X66A 3I0OA 3OKQA 1U4QA 1VRBA 4H9OC 2XAHB 4GYSA 3KVAA 1LRZA 2YU1A 4ISSA 4ZI2C 2D5UA 2V7LA 5JDHA 2E8IA 3LJCA 2WMNA 4BJNA 3UT5E 3N9NA 5HXHA 2W63A 5GONE 2K48A 4ZHQE 2LT3A 5FY0A 3CQGB 2CLYB 4UVBB 5LXTE 2ZMAA 4PNIA 1X79A 4IE5A 3WAJA 2G0UA 3C51A 3RH3A 1FIOA 2LSJA 3RC3A 3K3OA 3SOLA 5J2UE 2ODVA 2A2FX 4P0BA 3PUAA 1D1BA 3D0TA 3R6NA 2ODUA 5JRCB 3ZJ1A 3PE0A 2X51A 4DNDA 3IBPA 3ZC0A 4X1YE 3IEEA 2WSSV 2CMRA 4H63H 4UEMA 2C0SA 4MBQA 5ETWA 4DO0A 2CM0A 1HF8A 1AJ3A 5JR9A 5KX5E 5JREA 5LBMA 1E1HB 2P9BA 5J2TE 2CA5A 2BDEA 3LFMA 4A56A 2LOPA 5JDLA 4JEHB 4PJNA 5F8PA 2VASA 5M4YA 3AB3B 3KV9A 1HFAA 4CZZB 5JDNA 1MIVA 2Z6EA 3J9X1 2XQYA 2VKDA 4PW8A 2KLQA 4TZ4C 3ZMTB 3MA9A 4HTEA 4QWNB 4PK6A 5IHYA 5KMGP 4I50E 4QHOA 3ESLA 3EDVA 2KZ7B 1WRDA 2M67A 3ZC1A 1SHZC 4PJLA 2LSGA 3QUJA 1MMGA 4AKIA 2YU2A 5LBQB 4V1Av 1UX4A 1MIWA 4MHCA 5L3BB 3VKGA 3HKEE 5A1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSI A;  2N1G A;  4GK0 E;  3VU7 H;  4FJO A;  4BA9 A;  4EXT A;  2LSY A;  2LSK A;  4GK5 E;  2LSG A;  2LSJ A; 
#chains in the Genus database with same CATH topology
 3EHZ A;  4YJ2 E;  4ZS2 A;  1UUR A;  1CUN A;  2B1E A;  3AED A;  5HAX A;  3Q5W A;  2LSY A;  3RX6 A;  2D9D A;  1UCU A;  3AA6 B;  3CKD A;  3QB5 K;  2DLR A;  2ZM0 A;  4O4H E;  2YDS A;  2DWG A;  2V6Y B;  1XMO T;  4HWH A;  4WYV A;  2XQ4 A;  3LBX A;  1D0X A;  4UF0 A;  1N33 T;  2IC9 A;  2VKJ A;  3N2O A;  4HN9 A;  4L9I A;  3MK7 C;  4IL9 A;  5JH7 E;  4GKK T;  5LP6 E;  3BQI A;  2MBG A;  4YSZ A;  2CWO A;  1H7C A;  3AE1 A;  3P7I A;  2BZB A;  4KUM B;  2H7V C;  3LG7 A;  4M1P A;  1Z0P A;  4TUY E;  5LCY A;  5JQG E;  5LMU T;  5L3D B;  3TLW A;  4DVD A;  5ABF A;  2XZE A;  3RIU A;  3JAE A;  3LK3 B;  2JQ9 A;  3EDU A;  4UF0 B;  2NW8 A;  2UXN B;  4GYR A;  5AFU L;  5J0Z A;  4DV3 T;  2CXF A;  4UIG A;  1YQ4 A;  5LHG B;  4AKH A;  4G2A A;  4CI1 B;  3AE8 A;  2J4G A;  3ANW B;  3FZH B;  3C4X A;  5LOV E;  2WBL A;  2LKG A;  5FVK A;  3ZCI A;  4BA9 A;  3JAF A;  1D1A A;  2WZI A;  3AEE A;  2MYS A;  4U2Z A;  4OYK A;  3UU6 A;  1LVK A;  2Q9Q C;  2LJL A;  4U3C A;  3UU4 A;  4ZXL A;  3CIR A;  1FEW A;  3KIN B;  3OYX A;  4TV9 E;  4OX9 T;  2AE9 A;  3A7M A;  5FL0 A;  2KWI B;  4TNV A;  3SFD A;  2BVM A;  3UUM A;  4LFB T;  2QVA A;  1HR0 T;  4IST A;  3AAA B;  1D0Y A;  3KBU A;  3TKL B;  3AEF A;  2VVS A;  3FZM B;  3A8Y C;  4EED A;  4BAY B;  3N9O A;  3JC6 D;  1XMQ T;  2JRK A;  1UK5 A;  5DAB A;  4HE8 A;  3AAI A;  3VR9 A;  3NRX A;  2XJ7 A;  5FMN A;  1HNX T;  3KDS E;  4X1K E;  2IDO B;  3UQ7 A;  4HFB A;  5L3E B;  1OXZ A;  2XAQ B;  3RQU A;  4DV6 T;  3AXJ B;  3WAK A;  5HEO A;  4LFC T;  2FUP A;  4X66 T;  1US7 B;  2CRB A;  4QH1 A;  3OJA A;  4QXC B;  5JDF A;  1E2A A;  2F4V T;  3ONX A;  5JDM A;  4TN7 B;  3B13 A;  3SRZ A;  5KDM C;  1MMD A;  5AQG B;  5L3F B;  4X65 T;  4DV1 T;  4E7Z A;  2HPJ A;  3HKC E;  2AXD S;  4MLK A;  1YQ3 A;  4YTM A;  4EXT A;  2ZM2 A;  3PUY F;  4ILC A;  2EHO D;  2WZH A;  2J62 A;  2YOE A;  4QXH B;  5EK3 A;  2VVN A;  3MKD A;  3AE9 A;  4CQI A;  2H3R A;  5HXS A;  4E7S A;  3QOF A;  1XNR T;  4GKJ T;  2SPC A;  1YXR A;  2L3L A;  3K8P C;  1T8B A;  3RRW A;  2R6G F;  3RF1 A;  2BG9 C;  2FJE A;  2V1D B;  4XBF B;  3P4P A;  1VOM A;  3ETU A;  4HWI B;  2NOX A;  4WNK A;  5J1G A;  2YDR A;  2BVL A;  3CK6 A;  4MFR A;  2QYW A;  5FKY A;  3T8O A;  4JI0 T;  2UU9 T;  5JRC A;  1J5E T;  2W4X A;  3ZT6 A;  2X9H A;  2UUB T;  4LFA T;  2Q9Q B;  4UV8 B;  2J47 A;  4X64 T;  1G8X A;  3J7Y q;  3ZSS A;  2XAS B;  4AQF A;  4MAL A;  3K3Q C;  3FXD B;  5H6R B;  2Q9Q A;  3OPC A;  4L5G A;  2VL0 A;  3CQC B;  4HWD A;  3JCF A;  4O2A E;  3RYC E;  4ZOL E;  2OV9 A;  1WYB A;  2CPT A;  4DR7 T;  2CBI A;  1T98 A;  2N9D A;  3PU8 A;  4HEA A;  3LBX B;  5FXZ A;  3OVU A;  5LYJ E;  2JQK A;  2BG9 B;  2IHR 1;  4QX7 B;  5C3J A;  2UXD T;  1BR0 A;  3NZP A;  1YKE B;  3P4S A;  2K9A A;  2X68 A;  4AIU A;  2WCA A;  1HNW T;  3MJX A;  5H6Q B;  5ADX L;  2YEV C;  4LF6 T;  1N36 T;  2X0L B;  1HCI A;  3CX7 B;  3B57 A;  3I1A A;  4HGA A;  2XSB A;  4ADZ A;  3E22 E;  2CE7 A;  5HXR A;  3RKO A;  4ASK A;  2XQ3 A;  4YJ3 E;  2UXC T;  3PV0 F;  4KHZ F;  3HR0 A;  4DR4 T;  4PFP A;  5LA6 E;  3AA0 B;  2LRL A;  2Q9Q D;  3VHL A;  3CWZ B;  4OYJ A;  4O4I E;  2YDQ A;  4TWF A;  2YK0 A;  3FZF B;  3GWH A;  4HKA A;  4WBO A;  3KV4 A;  3RPU A;  1WCR A;  2BKN A;  1HX8 A;  3K1S A;  3LK4 2;  4DID B;  4C91 A;  2K5B B;  3SFE A;  2IAK A;  4YSX A;  4DV7 T;  4UEL A;  2PFV A;  1DU2 A;  2CHN A;  4IE6 A;  2WU2 A;  4HFH A;  2XPK A;  2LSK A;  4YHJ A;  5AQU B;  1UX5 A;  1CHU A;  3UU8 A;  4EOZ B;  3AEB A;  1YW0 A;  3CPZ A;  3GN5 B;  3L3P A;  3RGL A;  1I94 T;  4LF9 T;  2Y48 B;  5CFB A;  2UXB T;  4TV8 E;  1MMA A;  3JAD A;  4NUV A;  4COF A;  3RYI E;  3V5U A;  2I6H A;  4ZS3 A;  2XAJ B;  2ES0 A;  3PTR B;  2EHO A;  5ABH A;  2PJQ A;  5HYA A;  4DV2 T;  1N34 T;  5L47 A;  2UUA T;  3B5M A;  5JDQ A;  4PAG A;  3IF8 B;  5EK4 A;  4HFI A;  5AQS B;  4CN6 A;  4GIW A;  3UU5 A;  2W61 A;  2WU5 A;  2OLT A;  3AE7 A;  5LB7 B;  1SE7 A;  3KVB A;  2E9X B;  2LM2 A;  1ZKE A;  3CVR A;  2VKH A;  2A72 A;  3PUX F;  4NUU A;  4TWH A;  4AQF C;  4P0A A;  3HKD E;  2OA5 A;  2X67 A;  3NZQ A;  5HEJ A;  2JPF A;  2WS3 A;  4AXP A;  1AJ3 A;  2DCF A;  3AE5 A;  5L4E A;  3X1D A;  3RIA A;  1NWM X;  4X1I E;  3QK6 A;  1KEY A;  4O8S A;  3W15 B;  4YY3 T;  5C8Y E;  2HPL A;  1W0B A;  1HG5 A;  3N9L A;  2V7M A;  3O1H A;  2DL1 A;  1S35 A;  3AVS A;  3O4X E;  3AE2 A;  3P8C D;  3PUZ F;  3ZKR A;  2MPK A;  4ILU A;  2JIW A;  3PJA J;  5AQK B;  3AEG A;  2CXD A;  2XM1 A;  5AQQ B;  4AQG A;  1OED E;  4JI1 T;  1VCS A;  3TLS A;  5LGN B;  4EYU A;  2W62 A;  2C5K T;  2FBW A;  5AQV B;  2J1D G;  1QLB A;  2WDR A;  1MND A;  2IW5 B;  1MMN A;  3OTO T;  2K3W A;  4DUY T;  1YD8 G;  3O1J A;  2QGS A;  2N1G A;  4IRE A;  4YTP A;  4B3R T;  4AI6 A;  2N2N A;  5DQW A;  2KT9 A;  3N9M A;  3TLV A;  5FXW A;  5LHI B;  2JJ9 A;  4IDZ A;  2PTF A;  3I9W A;  4EYY R;  5L2L A;  4IHJ E;  4YSY A;  4ZI3 D;  4F6R C;  2DWK A;  3NVO A;  4PJM A;  4UVC B;  3ZMZ B;  3ZYL A;  4CXX A;  4DUZ T;  3CQX C;  1I6Z A;  1ZEE A;  2WM9 A;  2H89 A;  4H9R C;  3VRA A;  5LG3 A;  4I0U A;  4JI2 T;  1MIY A;  2XQ9 A;  2XQ7 A;  3AEC A;  3HL6 A;  3NRY A;  4CI2 B;  5HWX A;  1UGO A;  4KBM B;  5TAO A;  3GN5 A;  2QRX A;  5AQR B;  3DP7 A;  2E5L T;  2HH7 A;  2XM2 A;  3Q5X A;  5ABF B;  5AQO B;  2LEH A;  2ZM8 A;  4IIJ E;  1Y01 A;  4DR5 T;  4NXM T;  1FMW A;  1KF6 A;  1LKX A;  2MTQ A;  3KV5 A;  4CXY A;  1HS7 A;  2XUE A;  2X0H A;  2QA7 A;  4UV9 B;  4DV4 T;  5FL1 A;  3FBZ A;  5DJQ C;  4IE0 A;  3R84 B;  3WI3 A;  4B6X A;  2PG8 A;  4H9P C;  1N32 T;  2KMF A;  2NTY A;  1E7P A;  4ILA A;  2CHO A;  3N2G E;  3CX6 B;  4O4L E;  2NR4 A;  5BR8 T;  4JI8 T;  3ZN0 B;  3KFW X;  4YFS A;  3RHW A;  3ZEF B;  3ZYK A;  3ABV A;  3KV6 A;  2JMH A;  4DR2 T;  4IT4 A;  2LHR A;  3C98 B;  2MAW A;  3PUG A;  1U5P A;  5FYM A;  4IDP A;  3PUW F;  4O2B E;  2LRK A;  4A97 A;  4AKL A;  4ANJ A;  1R8I A;  2RA1 A;  5FY7 A;  4X5T A;  4IE7 A;  3RKG A;  3E08 A;  5L3G B;  2BG9 E;  3E0Z A;  1XNQ T;  2NW9 A;  2VK9 A;  3PJA A;  2XQ5 A;  4PK5 A;  4U72 A;  3V5S A;  3S4U A;  1NEK A;  4WBN E;  5KXJ A;  1ZP0 A;  2VUR A;  4ILB A;  1D1C A;  2KND A;  2E2A A;  3A5X A;  2D2S A;  5F3J A;  4QKN A;  5AQT B;  4DV0 T;  4GK5 E;  2ACZ A;  2W66 A;  4QH4 A;  4DBQ A;  4HFV A;  3BQL A;  4ZI7 E;  5FNV E;  4CXW A;  1BR1 A;  4X62 T;  3K3N A;  3O1I A;  2RP4 A;  2C5J A;  2PBI A;  3CX8 B;  1GQE A;  3PUV F;  2WB5 A;  3N2K E;  3PDY A;  3Q2M A;  2HN2 A;  2FJA A;  1Z8U A;  5CA1 E;  1O3X A;  4XAX B;  4ZI3 C;  3MAC A;  3RYH E;  1XWM A;  5JR9 C;  4LF4 T;  3U3I A;  4JBW F;  4KP3 C;  5LJN A;  1NAF A;  3EI0 A;  3RIF A;  3MXZ A;  4G63 A;  4H9N C;  5JVD E;  3ZMS B;  2NP9 A;  1MNE A;  3T1H T;  2WAU A;  2CWY A;  3ZMU B;  4OHF A;  4LML A;  4P1N A;  2L9Q A;  5EK2 A;  1QSD A;  5LHH B;  3AA1 B;  2V7J A;  5LGT B;  4B3S T;  4EAH A;  2WWU A;  2V5C A;  5AQJ B;  4NXN T;  2BS3 A;  2VB6 A;  4IL4 A;  4JLE A;  4LMK A;  5E0O A;  3UUL A;  2LM9 A;  1SUM B;  3SWH A;  2JMK A;  3M65 A;  2XHE B;  3HI2 A;  5AQI B;  5AQP B;  3UUX B;  4A5X A;  3ZT7 A;  4ZI2 D;  4PFO A;  5BMV E;  4DR1 T;  4DMV A;  4JYA T;  2HHH T;  2UUC T;  4KI0 F;  3NBX X;  2BBH A;  3ONL C;  1XZY A;  3PUR A;  4I4T E;  2L8K A;  2BS4 A;  3N9Q A;  4HFD A;  5LG4 A;  2I0M A;  3C4W A;  4I43 B;  1KK7 A;  3GMI A;  4QXB B;  4PK4 A;  3BK9 A;  2VQE T;  1M7K A;  4KHP T;  5CA0 E;  2XQ6 A;  3ZJ2 A;  4CN1 A;  5HEU A;  3LK2 B;  2KIN B;  3ZST A;  5LMN T;  2X9W A;  2E9X D;  2NWB A;  2V7I A;  3BQK A;  3FB2 A;  3MZK B;  1IJ6 A;  2FJB A;  3QB5 A;  3PU3 A;  4Z8X A;  1BR2 A;  4Q25 A;  3CML A;  5ABE A;  3N5L A;  3AA7 B;  3UFE A;  3ANW A;  3HA4 A;  1L0V A;  1OED B;  2W2U A;  2XY8 B;  4FJO A;  3ZPO A;  4ZEY A;  2V6X A;  1VCT A;  2W00 A;  4UXN B;  5FY1 A;  4JI6 T;  4B3M T;  2GK9 A;  5EZY E;  1JNZ A;  1OWA A;  3OBV E;  4U74 A;  1QUU A;  5F5W A;  5L3C B;  2XSA A;  4GK0 E;  5FXX A;  5LNK A;  3VKH A;  1OED A;  1ZHC A;  2X9Y A;  3NWI A;  4EZ4 A;  2K24 A;  3EAM A;  4OK0 A;  1G73 A;  1HTJ F;  4WW0 A;  3RRC A;  4UR9 A;  3RYF E;  3LSV A;  5AQF B;  3DTO A;  5FP3 A;  2EHO C;  3AE4 A;  2ZLY A;  3I0Q A;  3I9Y A;  3EVY A;  4YLH A;  3RIU C;  3U78 A;  4ERR A;  4HWF A;  3AVR A;  3RC8 A;  3FXE B;  3FHN A;  1BR4 A;  3UU3 A;  1WR0 A;  4IE4 A;  1KNZ A;  5JR9 B;  2V6Y A;  1B7T A;  2NW7 A;  4TX5 A;  5HWY A;  3VRB A;  1ZV4 X;  2M6B A;  2E9X A;  3DJB A;  3PUS A;  2LHN A;  2VKO A;  4CI3 B;  4H9Q C;  3C50 A;  1S94 A;  2WP9 A;  3SS1 A;  4BJM A;  5HXE A;  2VWA A;  4DMW A;  5FXV A;  4EZH A;  4Z90 A;  1IAP A;  2DHR A;  1W9R A;  4EIW A;  1J1J A;  3ETV A;  5DQV A;  1WLX A;  3ZLI A;  2WMO A;  5IUX A;  4J2C A;  2YIN A;  4L0R A;  1FMV A;  3FBL A;  2D0U A;  3VR8 A;  4DR3 T;  1XDO A;  3C64 A;  3M3Z B;  1YKH B;  2H7O A;  1IZN B;  2A3D A;  2V7K A;  2VL8 A;  1WR6 A;  4OFZ A;  2FJD A;  3UUB A;  1T7S A;  3ZMV B;  4CN4 A;  2IIU A;  4C90 A;  2IC6 A;  2B76 A;  2X9X A;  3N9P A;  3OYZ A;  2C5I T;  2JQH A;  3L8R A;  5L4H A;  4K0U A;  4NPP A;  2M6I A;  2DNX A;  3O9X A;  2LKH A;  2XAG B;  1NEN A;  3C4Z A;  1EZ3 A;  1X9B A;  1SA0 E;  1V9D A;  2IUB A;  2KWH A;  4EB6 E;  2WDV A;  5LJM A;  2V8S V;  3UUN A;  3QNU A;  1LVF A;  4N78 D;  1D0Z A;  4GOU A;  2A9U A;  2E5V A;  3IA3 A;  4O4J E;  5CB4 E;  1IJ5 A;  4I55 E;  4DBR A;  3HKB E;  4AKR B;  2WY2 A;  4Z91 A;  3UTK A;  1FJG T;  2MOZ A;  2UXX B;  4H9S E;  4JV5 T;  3QC9 A;  3EUH A;  2D0T A;  4PJJ A;  5HXC A;  5LGU B;  4YHH T;  3AAE B;  1IBM T;  4JI4 T;  2EHO B;  3Q5D A;  3Q5E A;  5CGM A;  5C2T A;  5ABG A;  2V26 A;  1OED C;  2BKP A;  2BKO A;  4EGW A;  1WFD A;  4LF5 T;  4LF7 T;  2LE8 A;  2V5D A;  2BG9 A;  2W0G A;  2CEA A;  2XAF B;  2LSI A;  5HEG A;  4JI7 T;  2LOS A;  1IBK T;  4YT0 A;  3AE3 A;  3L09 A;  1Y64 B;  4HFE A;  3G06 A;  4UVA B;  4XZC A;  3AXJ A;  5IYZ E;  3UQ4 A;  3ZCJ A;  4ZZB A;  2YN6 A;  1M62 A;  3FZL B;  4P09 A;  4QH5 A;  4QX8 B;  3ONJ A;  2DI4 A;  2Y6X A;  1ZOY A;  4X20 E;  1W0A A;  2CXL A;  2ACX A;  2KSR A;  3F57 A;  3FZK B;  2KXP B;  3H3A A;  4IGU A;  4LF8 T;  5HCJ A;  3TLU A;  3Q9D A;  3VU7 H;  3KBT A;  1T72 A;  3PUQ A;  1HG2 A;  2E9X C;  2JQQ A;  2XQA A;  2Y8D A;  3GA8 A;  4U31 A;  3RQW A;  3ZYM A;  4ZZC A;  5AQL B;  4JEU B;  2WWV A;  2ZM6 T;  1J5W A;  2I59 A;  3LDQ B;  2CBJ A;  1IBL T;  2NTX A;  2CLY C;  4FI5 A;  3F31 A;  2XTL A;  3IHR A;  4JUY A;  4NIQ A;  4TWD A;  4U33 A;  3RI5 A;  1HX1 B;  1WYC A;  2CCQ A;  3AEA A;  3H37 A;  3F2E A;  3JC6 C;  4H63 V;  4KMC A;  1W09 A;  2X66 A;  4KX6 A;  5AQM B;  3I0O A;  2VQF T;  5HCM A;  3OKQ A;  1U4Q A;  5AQN B;  3ZN1 B;  1VRB A;  4H9O C;  2XAH B;  4GYS A;  3KVA A;  1LRZ A;  2YU1 A;  4HWC A;  4ISS A;  4ZI2 C;  2D5U A;  3ZT5 A;  2V7L A;  5JDH A;  2E8I A;  3LJC A;  2WMN A;  4BJN A;  3T1Y T;  3UT5 E;  3N9N A;  5HXH A;  2W63 A;  3L39 A;  5GON E;  2K48 A;  4ZHQ E;  4LMJ A;  2LT3 A;  2YKS A;  3CQG B;  2CLY B;  4U2Y A;  4UVB B;  5FY0 A;  5LXT E;  4DR6 T;  2ZMA A;  4PNI A;  1X79 A;  4IE5 A;  3WAJ A;  2G0U A;  3C51 A;  2IML A;  1KFY A;  3P4W A;  4JI5 T;  1FIO A;  2LSJ A;  3RH3 A;  4YTN A;  3RC3 A;  3K3O A;  3SOL A;  2XQ8 A;  4EV6 A;  2ODV A;  5J2U E;  2A2F X;  4P0B A;  3PUA A;  4IDQ A;  4WZX A;  2LLY A;  4DV5 T;  1D1B A;  3D0T A;  3R6N A;  2ODU A;  3TLT A;  5JRC B;  2WQY A;  5FVL A;  3ZJ1 A;  3PE0 A;  2X51 A;  3EAB A;  4TNW A;  4DND A;  3IBP A;  1UUS A;  3UFG A;  3ZC0 A;  4X1Y E;  3IEE A;  2WSS V;  2CMR A;  3P4Q A;  4H63 H;  2BBJ A;  2C0S A;  4UEM A;  4YXD A;  4K0K T;  4AKG A;  4AQY T;  4MBQ A;  5ETW A;  4DO0 A;  2CM0 A;  1HF8 A;  4F8H A;  4AIS A;  5JR9 A;  5CJ5 A;  5KX5 E;  5JRE A;  1JNR A;  2HN1 A;  3H3M A;  5LBM A;  1E1H B;  2P9B A;  5IWA T;  2H88 A;  1KNR A;  5J2T E;  2CA5 A;  2BDE A;  2BS2 A;  3LFM A;  4IDO A;  4A56 A;  4A98 A;  2LOP A;  5JDL A;  4JEH B;  4PJN A;  2WDQ A;  2VAS A;  5F8P A;  5HEH A;  5M4Y A;  3AB3 B;  3KV9 A;  1HFA A;  1XDP A;  4CZZ B;  5JDN A;  4JI3 T;  1MIV A;  2Z6E A;  4U7I A;  2XQY A;  2VKD A;  3J9X 1;  4PW8 A;  2KLQ A;  4TZ4 C;  5AQH B;  3ZMT B;  2W67 A;  3MA9 A;  3P50 A;  4HTE A;  4QWN B;  4PK6 A;  5IHY A;  2RPA A;  4EEB A;  5KMG P;  4I50 E;  3NKZ A;  4QHO A;  3EDV A;  1KNP A;  2KZ7 B;  3ESL A;  1WRD A;  2M67 A;  3ZC1 A;  1SHZ C;  4PJL A;  2LSG A;  3QUJ A;  3AE6 A;  1MMG A;  4AKI A;  2YU2 A;  5LBQ B;  3P4R A;  4B3T T;  5JDG A;  4HFC A;  1UX4 A;  4V1A v;  3RLF F;  5JTG A;  4IDN A;  1MIW A;  4MHC A;  1HNZ T;  5L3B B;  3VKG A;  2X0Y A;  3HKE E;  4U7Y A;  5A1L A; 
#chains in the Genus database with same CATH homology
 4YJ2 E;  4ZS2 A;  2B1E A;  1CUN A;  5HAX A;  3Q5W A;  2LSY A;  3RX6 A;  1UCU A;  3AA6 B;  3CKD A;  2DLR A;  2ZM0 A;  4O4H E;  2DWG A;  3LBX A;  1D0X A;  4UF0 A;  2IC9 A;  2VKJ A;  3N2O A;  4HN9 A;  4L9I A;  3MK7 C;  5JH7 E;  5LP6 E;  3BQI A;  2MBG A;  2CWO A;  1H7C A;  4M1P A;  3P7I A;  2BZB A;  4KUM B;  2H7V C;  3LG7 A;  4TUY E;  1Z0P A;  5LCY A;  5JQG E;  5L3D B;  4DVD A;  3LK3 B;  3EDU A;  4UF0 B;  2NW8 A;  2UXN B;  4GYR A;  5AFU L;  2CXF A;  4UIG A;  4AKH A;  5LHG B;  4G2A A;  4CI1 B;  3ANW B;  3C4X A;  5LOV E;  2WBL A;  4BA9 A;  3ZCI A;  1D1A A;  2MYS A;  4OYK A;  1LVK A;  2Q9Q C;  2LJL A;  1FEW A;  3KIN B;  3OYX A;  4TV9 E;  3UUM A;  2KWI B;  2BVM A;  4IST A;  3AAA B;  1D0Y A;  3KBU A;  4BAY B;  3N9O A;  3JC6 D;  2JRK A;  5DAB A;  4HE8 A;  3AAI A;  3NRX A;  5FMN A;  3KDS E;  4X1K E;  5L3E B;  1OXZ A;  2XAQ B;  3WAK A;  1US7 B;  3OJA A;  4QXC B;  5JDF A;  3ONX A;  5JDM A;  4TN7 B;  3B13 A;  3SRZ A;  5KDM C;  1MMD A;  5L3F B;  4E7Z A;  2HPJ A;  3HKC E;  4MLK A;  4EXT A;  2ZM2 A;  2EHO D;  4QXH B;  5EK3 A;  5HXS A;  3MKD A;  4CQI A;  2H3R A;  4E7S A;  2SPC A;  2L3L A;  3K8P C;  3RRW A;  2V1D B;  4XBF B;  1VOM A;  3ETU A;  5J1G A;  2NOX A;  4WNK A;  2BVL A;  4MFR A;  3T8O A;  5JRC A;  2X9H A;  2Q9Q B;  4UV8 B;  1G8X A;  3J7Y q;  2XAS B;  4AQF A;  4MAL A;  3K3Q C;  3FXD B;  5H6R B;  2Q9Q A;  4L5G A;  3CQC B;  3ZN1 B;  4O2A E;  3RYC E;  4ZOL E;  1WYB A;  2N9D A;  1T98 A;  3PU8 A;  4HEA A;  3LBX B;  5FXZ A;  5LYJ E;  4QX7 B;  1BR0 A;  3NZP A;  1YKE B;  2K9A A;  2X68 A;  3MJX A;  5H6Q B;  5ADX L;  2YEV C;  2X0L B;  3CX7 B;  1HCI A;  3B57 A;  3I1A A;  4HGA A;  4ADZ A;  3E22 E;  2CE7 A;  5HXR A;  3RKO A;  4ASK A;  4YJ3 E;  3HR0 A;  4PFP A;  5LA6 E;  3AA0 B;  2Q9Q D;  3VHL A;  3CWZ B;  4OYJ A;  4O4I E;  2YK0 A;  4HKA A;  3GWH A;  4WBO A;  3RPU A;  3KV4 A;  4C91 A;  1HX8 A;  3LK4 2;  2K5B B;  2IAK A;  4UEL A;  2PFV A;  4IE6 A;  4YHJ A;  2LSK A;  1UX5 A;  4EOZ B;  1YW0 A;  3CPZ A;  3GN5 B;  3L3P A;  2Y48 B;  4TV8 E;  1MMA A;  4NUV A;  3RYI E;  3V5U A;  4ZS3 A;  2XAJ B;  2ES0 A;  3PTR B;  2EHO A;  2PJQ A;  5HYA A;  5JDQ A;  4PAG A;  3IF8 B;  5EK4 A;  4GIW A;  2W61 A;  3KVB A;  2E9X B;  3CVR A;  1ZKE A;  4P0A A;  2VKH A;  2A72 A;  4NUU A;  4AQF C;  3HKD E;  2OA5 A;  2X67 A;  3NZQ A;  2JPF A;  4AXP A;  2DCF A;  1NWM X;  4X1I E;  3QK6 A;  4O8S A;  3W15 B;  5C8Y E;  2HPL A;  3N9L A;  1HG5 A;  3P8C D;  2V7M A;  3O1H A;  3O4X E;  1S35 A;  3AVS A;  4ILU A;  2CXD A;  4AQG A;  5LGN B;  4EYU A;  2W62 A;  2C5K T;  2J1D G;  1MND A;  2IW5 B;  1MMN A;  1YD8 G;  3O1J A;  2QGS A;  2N1G A;  4AI6 A;  2N2N A;  5DQW A;  2KT9 A;  3N9M A;  5FXW A;  5LHI B;  2JJ9 A;  4IDZ A;  3I9W A;  4EYY R;  5L2L A;  4IHJ E;  4ZI3 D;  4F6R C;  2DWK A;  4PJM A;  4UVC B;  3ZMZ B;  3ZYL A;  4CXX A;  3CQX C;  1ZEE A;  2WM9 A;  4H9R C;  1MIY A;  3HL6 A;  3NRY A;  4CI2 B;  5HWX A;  4KBM B;  5TAO A;  3GN5 A;  3DP7 A;  2HH7 A;  3Q5X A;  2LEH A;  2ZM8 A;  4IIJ E;  1FMW A;  1LKX A;  3KV5 A;  2MTQ A;  4CXY A;  1HS7 A;  2XUE A;  2QA7 A;  4UV9 B;  3FBZ A;  5DJQ C;  4IE0 A;  3R84 B;  3WI3 A;  4B6X A;  2PG8 A;  4H9P C;  2KMF A;  2NTY A;  4O4L E;  3N2G E;  3CX6 B;  3ZN0 B;  3KFW X;  4YFS A;  3ZYK A;  3KV6 A;  2JMH A;  2LHR A;  3C98 B;  3PUG A;  1U5P A;  5FYM A;  4AKL A;  4O2B E;  4ANJ A;  2RA1 A;  5FY7 A;  4IE7 A;  3E08 A;  5L3G B;  3E0Z A;  2NW9 A;  2VK9 A;  4WBN E;  4PK5 A;  4U72 A;  3V5S A;  3S4U A;  1D1C A;  2KND A;  3A5X A;  2D2S A;  5F3J A;  4QKN A;  4GK5 E;  4HFV A;  3BQL A;  4ZI7 E;  5FNV E;  4CXW A;  1BR1 A;  3K3N A;  3O1I A;  2RP4 A;  2C5J A;  2PBI A;  3CX8 B;  3N2K E;  3PDY A;  3Q2M A;  5CA1 E;  1O3X A;  4XAX B;  4ZI3 C;  3MAC A;  3RYH E;  5JR9 C;  3U3I A;  5LJN A;  4KP3 C;  1NAF A;  3MXZ A;  4G63 A;  4H9N C;  5JVD E;  3ZMS B;  2NP9 A;  1MNE A;  2WAU A;  2CWY A;  3ZMU B;  4OHF A;  5EK2 A;  2L9Q A;  1QSD A;  5LHH B;  3AA1 B;  2V7J A;  5LGT B;  4EAH A;  2WWU A;  2VB6 A;  4JLE A;  5E0O A;  3UUL A;  2LM9 A;  3SWH A;  5JDG A;  2JMK A;  3M65 A;  2XHE B;  3HI2 A;  3UUX B;  4ZI2 D;  5HXE A;  5BMV E;  4PFO A;  4DMV A;  3NBX X;  4I4T E;  3PUR A;  2L8K A;  3N9Q A;  5LG4 A;  3C4W A;  4I43 B;  1KK7 A;  3GMI A;  4QXB B;  4PK4 A;  3BK9 A;  5CA0 E;  3ZJ2 A;  3LK2 B;  2KIN B;  2X9W A;  2E9X D;  2NWB A;  2V7I A;  3FB2 A;  3BQK A;  3MZK B;  1IJ6 A;  3PU3 A;  4Z8X A;  1BR2 A;  3CML A;  3N5L A;  3AA7 B;  3UFE A;  3ANW A;  3HA4 A;  3ZPO A;  4FJO A;  2W00 A;  4UXN B;  5FY1 A;  2GK9 A;  5EZY E;  1OWA A;  3OBV E;  4U74 A;  1QUU A;  5L3C B;  4GK0 E;  5FXX A;  5LNK A;  3VKH A;  4EZ4 A;  1ZHC A;  2X9Y A;  2K24 A;  4OK0 A;  1G73 A;  1HTJ F;  4WW0 A;  3RRC A;  3RYF E;  3DTO A;  5FP3 A;  2EHO C;  4YLH A;  2ZLY A;  3I0Q A;  3I9Y A;  3EVY A;  3U78 A;  4ERR A;  3AVR A;  3FXE B;  3FHN A;  1BR4 A;  4IE4 A;  1KNZ A;  5JR9 B;  1B7T A;  2NW7 A;  4TX5 A;  5HWY A;  1ZV4 X;  3DJB A;  2E9X A;  3PUS A;  4CI3 B;  2LHN A;  2VKO A;  4H9Q C;  3C50 A;  1S94 A;  3SS1 A;  4BJM A;  2VWA A;  4DMW A;  5FXV A;  4EZH A;  1IAP A;  2DHR A;  4EIW A;  3ETV A;  5DQV A;  1WLX A;  3ZLI A;  2WMO A;  4J2C A;  2YIN A;  4L0R A;  1FMV A;  3FBL A;  2D0U A;  3C64 A;  1YKH B;  2H7O A;  1IZN B;  2A3D A;  2V7K A;  2VL8 A;  1WR6 A;  4OFZ A;  3ZMV B;  4C90 A;  2IC6 A;  3N9P A;  2X9X A;  3OYZ A;  2C5I T;  4K0U A;  2DNX A;  2XAG B;  3C4Z A;  1EZ3 A;  1SA0 E;  1V9D A;  2KWH A;  4EB6 E;  5LJM A;  3UUN A;  1LVF A;  4N78 D;  1D0Z A;  4GOU A;  4O4J E;  5CB4 E;  1IJ5 A;  4I55 E;  4DBR A;  3HKB E;  4AKR B;  3UTK A;  2MOZ A;  2UXX B;  4H9S E;  3QC9 A;  3EUH A;  2D0T A;  4PJJ A;  5HXC A;  5LGU B;  3AAE B;  2EHO B;  2V26 A;  2LE8 A;  2XAF B;  2W0G A;  2CEA A;  2LSI A;  2LOS A;  3L09 A;  1Y64 B;  4XZC A;  4UVA B;  5IYZ E;  3O9X A;  3ZCJ A;  4QX8 B;  4P09 A;  2DI4 A;  2Y6X A;  4X20 E;  2CXL A;  2ACX A;  3F57 A;  3H3A A;  4IGU A;  2KXP B;  3ZEF B;  3VU7 H;  3Q9D A;  3KBT A;  3PUQ A;  3TKL B;  1HG2 A;  2E9X C;  2JQQ A;  3RC8 A;  3GA8 A;  2Y8D A;  3ZYM A;  4AKG A;  4JEU B;  2I59 A;  2NTX A;  2CLY C;  4FI5 A;  3F31 A;  2XTL A;  3IHR A;  4JUY A;  4DBQ A;  2CCQ A;  1WYC A;  3H37 A;  3F2E A;  3JC6 C;  4H63 V;  4KMC A;  2X66 A;  3I0O A;  3OKQ A;  1U4Q A;  1VRB A;  4H9O C;  2XAH B;  4GYS A;  3KVA A;  1LRZ A;  2YU1 A;  4ISS A;  4ZI2 C;  2D5U A;  2V7L A;  5JDH A;  2E8I A;  3LJC A;  2WMN A;  4BJN A;  3UT5 E;  3N9N A;  5HXH A;  2W63 A;  5GON E;  2K48 A;  4ZHQ E;  2LT3 A;  5FY0 A;  3CQG B;  2CLY B;  4UVB B;  5LXT E;  2ZMA A;  4PNI A;  1X79 A;  4IE5 A;  3WAJ A;  2G0U A;  3C51 A;  3RH3 A;  1FIO A;  2LSJ A;  3RC3 A;  3K3O A;  3SOL A;  5J2U E;  2ODV A;  2A2F X;  4P0B A;  3PUA A;  1D1B A;  3D0T A;  3R6N A;  2ODU A;  5JRC B;  3ZJ1 A;  3PE0 A;  2X51 A;  4DND A;  3IBP A;  3ZC0 A;  4X1Y E;  3IEE A;  2WSS V;  2CMR A;  4H63 H;  4UEM A;  2C0S A;  4MBQ A;  5ETW A;  4DO0 A;  2CM0 A;  1HF8 A;  1AJ3 A;  5JR9 A;  5KX5 E;  5JRE A;  5LBM A;  1E1H B;  2P9B A;  5J2T E;  2CA5 A;  2BDE A;  3LFM A;  4A56 A;  2LOP A;  5JDL A;  4JEH B;  4PJN A;  5F8P A;  2VAS A;  5M4Y A;  3AB3 B;  3KV9 A;  1HFA A;  4CZZ B;  5JDN A;  1MIV A;  2Z6E A;  3J9X 1;  2XQY A;  2VKD A;  4PW8 A;  2KLQ A;  4TZ4 C;  3ZMT B;  3MA9 A;  4HTE A;  4QWN B;  4PK6 A;  5IHY A;  5KMG P;  4I50 E;  4QHO A;  3ESL A;  3EDV A;  2KZ7 B;  1WRD A;  2M67 A;  3ZC1 A;  1SHZ C;  4PJL A;  2LSG A;  3QUJ A;  1MMG A;  4AKI A;  2YU2 A;  5LBQ B;  4V1A v;  1UX4 A;  1MIW A;  4MHC A;  5L3B B;  3VKG A;  3HKE E;  5A1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...