4GK0E

Crystal structure of human rev3-rev7-rev1 complex
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
96
structure length
96
Chain Sequence
APNLAGAVEFNDVKTLLREWITTISDPMEEDILQVVKYCTDLIEEKDLEKLDLVIKYMKRLMQQSVESVWNMAFDFILDNVQVVLQQTYGSTLKVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Mitotic spindle assembly checkpoint protein MAD2B
publication title Structural insights into the assembly of human translesion polymerase complexes
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 33
structure length 96
sequence length 96
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF16727 REV1_C DNA repair protein REV1 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.1280 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 4gk0E00
4GK5E 4GK0E 3VU7H 4FJOA 2LSYA 2LSIA 2N1GA 2LSGA 4EXTA 4BA9A 2LSKA 2LSJA
chains in the Genus database with same CATH superfamily
2YK0A 4U72A 1S94A 4PFOA 5DQVA 1WR0A 4AXPA 1UGOA 4EZ4A 4KI0F 5IYZE 2N1GA 3J7Yq 2WCAA 2V7KA 2IHR1 5KX5E 2MTQA 2XJ7A 3ZMUB 2L9QA 2A72A 2Y48B 4O4LE 3ETVA 2BZBA 4KBMB 3KFWX 2WSSV 4X64T 4G2AA 4CI1B 2YINA 2LOPA 2C5JA 1HCIA 3NZPA 2ZM8A 3PUWF 4PJLA 2ZM2A 4QKNA 5LP6E 4O2AE 3PUZF 5FL1A 2MBGA 4GK0E 3Q5EA 5ABFB 3WAJA 1FMVA 4HN9A 3GWHA 1XDOA 4CN4A 3RGLA 1E2AA 5ABFA 4AQFA 2H7VC 2XAGB 3RLFF 5GONE 2Q9QA 1S35A 4QX8B 4YLHA 2IDOB 4HFIA 4QH1A 3FHNA 1D0YA 2W0GA 2BVMA 2LSKA 1Z8UA 4YTPA 3AA0B 3FBLA 1EZ3A 4JI3T 4YXDA 4MLKA 5LHHB 1HX1B 4CXYA 2LRKA 5EK4A 1FJGT 5FKYA 2WB5A 3UT5E 4AKHA 3K1SA 5L3BB 3A5XA 3QK6A 5JVDE 5FYMA 1KK7A 5H6QB 5LMNT 3CX6B 4UVCB 2FJBA 1N33T 3H3AA 2WBLA 2XHEB 1HTJF 2XAQB 5F3JA 1MMGA 2OA5A 4HWFA 4LFBT 3AXJA 3ZC0A 5FVKA 5JRCB 4CXXA 4TV9E 5JRCA 5HXRA 2QYWA 4GYRA 1ZV4X 2CMRA 3ONLC 1VCSA 2CXDA 2BS3A 4ZI3C 2XQ7A 3PJAA 4H9PC 4X62T 1NAFA 2NW8A 2XPKA 2N9DA 5FY0A 3PUXF 1XNQT 3ZKRA 3RIAA 2AE9A 3FZFB 5J2TE 4H9OC 5LHIB 4O4JE 3PUQA 5AQVB 3TLVA 4IE0A 3RH3A 3G06A 3O9XA 5LCYA 1LKXA 5DQWA 4EYUA 2WU5A 4TWFA 4DBRA 5HEHA 4O4IE 1XMOT 3SRZA 1VCTA 3AE7A 2KINB 1MNEA 1D0XA 2V5CA 1MIYA 4X20E 4IHJE 2LM9A 1N36T 5E0OA 3RC8A 4ZHQE 2RPAA 2HHHT 1E7PA 3ZSSA 2J1DG 1ZKEA 3OJAA 2JQHA 3BK9A 4IE6A 4H9QC 2C5KT 2MYSA 1HG2A 4WNKA 4TUYE 1NWMX 4DV4T 2WZHA 2VQET 4H63V 3AE4A 1WRDA 4ZI7E 4CQIA 4EYYR 2V7MA 3C98B 3EDUA 4HGAA 4QXHB 3CMLA 5LXTE 1U5PA 4DVDA 5FY1A 4TN7B 4PK5A 3TLUA 4EB6E 5L3DB 2VKJA 2ZMAA 3F2EA 4KX6A 5FVLA 5FXXA 4YY3T 5HXEA 2CHOA 2VL8A 3HI2A 5FXWA 3R6NA 4ZI2D 5L3EB 1YKHB 2YDQA 4JI4T 4L0RA 2R6GF 3Q5XA 2XQ6A 3D0TA 1MMNA 1Y64B 2X0YA 4ZXLA 3FZHB 2WP9A 5AQTB 4OYKA 4OK0A 4LF8T 4YHHT 2E9XB 2J4GA 4IDOA 3KINB 2W2UA 4MFRA 2FUPA 2PJQA 5HWYA 4U2ZA 2NW9A 2MOZA 2BKOA 2KT9A 5JH7E 3DTOA 2WS3A 2W4XA 4P1NA 2D5UA 2WZIA 4EEDA 4CZZB 3P4QA 4P0AA 2YDRA 4JI8T 1R8IA 2KSRA 5JDLA 4I43B 3DP7A 5DABA 3UUMA 2X9HA 1MMDA 5HCMA 2LRLA 5J2UE 1B7TA 2V6YB 2IAKA 2E9XC 1IBMT 2UU9T 1BR4A 2V6YA 3I1AA 3AE6A 2VB6A 3CK6A 3ZYKA 1LVKA 2E5LT 3RHWA 1BR2A 2D2SA 2GK9A 5L3FB 5JREA 4DR7T 5LJMA 2D0TA 2K5BB 3ZEFB 3JAEA 2ZM6T 2XTLA 2XQAA 4L9IA 3ZC1A 4ILBA 4DR1T 1HFAA 4ASKA 3OYZA 4YHJA 2VKDA 4WZXA 1KNZA 4U7IA 2HN2A 4YT0A 1JNRA 5CFBA 3L3PA 1OXZA 4HFBA 3HA4A 3J9X1 2M6IA 4DV6T 3CQGB 4V1Av 1WFDA 3AE1A 3OKQA 2YOEA 1CHUA 5H6RB 2CLYB 2WWUA 2WWVA 4C91A 4ZS3A 4DUYT 2A2FX 4NUVA 1MIWA 5ETWA 1FEWA 1HNWT 2XQ9A 2J62A 3MKDA 3H37A 1UK5A 3BQIA 3AAAB 4EOZB 2XQ8A 3RRCA 4COFA 3QC9A 4DR6T 2WDQA 4C90A 4TV8E 2PFVA 1NENA 5A1LA 2DLRA 3BQKA 4HWCA 4WBOA 4YTMA 5HXCA 3QOFA 5AQPB 2WM9A 2XAHB 5C2TA 4HWHA 4IE4A 1KEYA 3PUAA 1YD8G 4ERRA 5FP3A 2K24A 5CJ5A 1SE7A 2VVNA 2XQ4A 3B13A 4OHFA 2CLYC 2G0UA 5LBMA 4DMVA 1M7KA 3ONXA 1IZNB 3K3OA 5LOVE 4OYJA 3HL6A 3B57A 5JDFA 4YTNA 2W67A 2DWKA 2IC6A 5HEOA 3C4XA 2FJDA 3ZYMA 4QX7B 2PBIA 3N2GE 3FZKB 3RIUA 1OEDE 3U78A 4DO0A 4ZI3D 1HX8A 3T1YT 2CCQA 3P50A 2EHOB 2JJ9A 1N32T 4IGUA 4PK4A 3AVSA 2B1EA 2EHOA 2BS4A 2I59A 4X1IE 3N9NA 3RF1A 3ZLIA 4EGWA 4AQYT 4LMKA 3HR0A 4CN6A 3PURA 4NUUA 2B76A 3NRXA 2JPFA 3WAKA 3FBZA 2NOXA 3ZSTA 2XQ3A 4TWHA 4A56A 1KNPA 5HWXA 3RIUC 2E8IA 2JMKA 2DWGA 2P9BA 2X9XA 5BR8T 4P0BA 3RC3A 3S4UA 4IREA 2EHOC 5AQKB 4KHZF 4EV6A 2H89A 2KWHA 2JRKA 3PDYA 3ETUA 1SUMB 1T7SA 4E7ZA 4KHPT 3PV0F 5AQSB 3CIRA 1N34T 3MZKB 5KMGP 5CB4E 3F31A 3N9OA 2XZEA 2DL1A 4ILUA 4DBQA 3ZCIA 1D1BA 2Q9QB 3M65A 4BAYB 4JI7T 2NTXA 5C3JA 1SHZC 2W63A 1HR0T 4HTEA 3UUXB 4GYSA 2LEHA 4QWNB 5FMNA 1UX4A 2YEVC 3VKGA 3SS1A 3E0ZA 3KV4A 4PJJA 2DI4A 4NXMT 3ZCJA 3ZN0B 5HYAA 5L4EA 5L2LA 2WAUA 3E22E 4DV2T 2VL0A 3ZJ1A 3EUHA 4LF5T 2UXNB 2LKGA 4AQFC 5FNVE 4A97A 1IBKT 4EXTA 4TX5A 2QVAA 2XAJB 3AEAA 3AXJB 2Q9QC 3UU3A 4OFZA 4X1YE 4I50E 3CX8B 3IEEA 4U2YA 3LK42 1W09A 4HFCA 3B5MA 4LF6T 3AAIA 3SWHA 3UQ4A 5HCJA 2CM0A 2NR4A 3ZN1B 3P7IA 4UF0A 5AQLB 3ZMSB 5LGUB 3K3NA 3RYHE 3WI3A 3C50A 3N5LA 4IL4A 2HPLA 2F4VT 1XZYA 3P4PA 2LSJA 4G63A 4BJMA 3LK3B 2OLTA 1XNRT 2E9XD 5AQOB 1UURA 3PUGA 2KLQA 2WQYA 2VKOA 2PTFA 2I6HA 1UUSA 4ANJA 3U3IA 2BS2A 3NRYA 4LMLA 1OEDB 4GIWA 5ABHA 4LF7T 1OEDA 4IIJE 3ZMZB 1FMWA 3A7MA 4DV7T 4BJNA 3RKGA 4DV5T 2MPKA 2IUBA 4AISA 1UX5A 1Z0PA 1MIVA 1US7B 2UXCT 2XAFB 4DR3T 4EIWA 1KNRA 1IBLT 3M3ZB 4QXCB 2UXBT 5L4HA 5LNKA 4DMWA 3PUVF 3TKLB 3UU8A 4OX9T 2FBWA 5FXZA 5AQJB 2WU2A 3TLWA 5LMUT 1OEDC 3SFDA 3ZT6A 1W9RA 2V26A 3ANWA 4J2CA 1H7CA 1WCRA 4KMCA 5AQFB 5AQMB 2BBJA 1ZHCA 3MK7C 4MHCA 2E5VA 2SPCA 2V7JA 5FXVA 2ACXA 2WDRA 4YJ2E 3AE9A 3P4SA 4ZZCA 2A9UA 3AEBA 2HPJA 2LSGA 3EABA 1J1JA 1O3XA 4JLEA 2CPTA 2XQ5A 4ADZA 3CVRA 2JQKA 5LG4A 3UQ7A 2OV9A 2V6XA 4U31A 2CWOA 5ABGA 4K0UA 3T8OA 2W62A 3C4ZA 5EK2A 4CN1A 1V9DA 3PUYF 1MNDA 1IJ6A 4DV0T 3KBUA 3L8RA 4E7SA 4FI5A 2QGSA 4A98A 3Q2MA 2K9AA 4F6RC 4QH5A 3PJAJ 2CHNA 5J1GA 4UVBB 5LA6E 3UUNA 4IDZA 3AEGA 5ADXL 5LYJE 5EK3A 3I0OA 3RI5A 4HFDA 3AA6B 2CBIA 4PAGA 2NP9A 4UV8B 2LM2A 3UFEA 3ZMVB 2FJEA 3PU8A 1Y01A 2UXDT 1JNZA 4HFVA 3T1HT 1BR1A 2IMLA 2LLYA 2XSBA 2DNXA 5AFUL 4X65T 4IDPA 2X66A 3AAEB 4P09A 5JDGA 3PE0A 3V5UA 3NBXX 4NPPA 4H9NC 4I4TE 5FL0A 3GMIA 4UELA 4GKJT 4H9SE 3I0QA 2H88A 4DR2T 3HKEE 4TZ4C 3UU6A 2KNDA 3AEEA 3NVOA 2LOSA 4UV9B 4QHOA 2YN6A 3O1IA 2A3DA 4U7YA 3W15B 4JBWF 2UUBT 2BKPA 3GN5A 1QUUA 2XQYA 3NZQA 2L8KA 2CA5A 2X68A 1YKEB 3EVYA 3LBXB 2JQQA 4XZCA 3OTOT 3JC6C 4M1PA 3A8YC 5CA0E 3LBXA 2JIWA 4UR9A 2QA7A 4JEUB 2BDEA 3PUSA 1X79A 2BG9E 4DUZT 2V7IA 3E08A 1CUNA 4H9RC 4L5GA 2VURA 1XWMA 2W00A 5F5WA 4B3TT 3CWZB 3EDVA 2ES0A 5KXJA 4LF4T 2Q9QD 2X67A 3P4RA 5AQNB 3SOLA 4ILAA 5JDNA 5AQQB 4CXWA 2PG8A 4IE7A 3H3MA 4HEAA 3VR9A 4HWDA 2W61A 5BMVE 3ESLA 2XUEA 3KDSE 2IC9A 3L09A 2D0UA 3QB5A 4GOUA 4ZZBA 2V5DA 2ZLYA 5AQIB 1D1CA 3ZT7A 4DR4T 4JI0T 5JR9B 5LJNA 5JR9A 4PK6A 2JQ9A 2LJLA 4ILCA 3N9PA 4AIUA 4I55E 1LVFA 1FIOA 3X1DA 3AE2A 1X9BA 2AXDS 3HKBE 4ZOLE 1J5WA 3FZMB 3C64A 2XM1A 4MALA 2VKHA 1M62A 2KZ7B 3R84B 5JDMA 1QSDA 3AB3B 4IE5A 4Z8XA 5LBQB 4B3RT 2X9WA 3SFEA 4LFAT 3RYFE 2BKNA 1XDPA 3OVUA 4IDQA 5HEUA 5IUXA 1YW0A 5JR9C 5JTGA 3CQCB 2RP4A 3PTRB 1T72A 4LMJA 2NTYA 3ZT5A 1QLBA 5ABEA 1I94T 3K3QC 2H3RA 1HNZT 2DHRA 4ZS2A 2YU2A 3RRWA 3I9WA 3EHZA 3LK2B 2V8SV 1G8XA 2RA1A 2W66A 3KVAA 3ZJ2A 2BVLA 4HKAA 4Z90A 3JADA 3CPZA 3AE5A 4F8HA 4TNVA 4EEBA 4HFHA 3KV9A 4GKKT 1WYCA 4O8SA 4YJ3E 3N2OA 3CX7B 2X51A 4PFPA 2J47A 3RX6A 2KXPB 1T8BA 4PW8A 3RQWA 4QXBB 3MJXA 4U3CA 2WY2A 3VR8A 3ZMTB 3O1JA 2L3LA 2LE8A 1WYBA 4UF0B 4NIQA 3QB5K 5JQGE 4HE8A 2NW7A 1U4QA 3ZYLA 5LHGB 5HAXA 2KWIB 3O1HA 5L3GB 2BG9B 3IHRA 1NEKA 4DIDB 4JV5T 2BG9A 5CGMA 2VQFT 2WMNA 3HKCE 3BQLA 3HKDE 3C51A 1G73A 1ZP0A 3N2KE 3LSVA 2WMOA 1BR0A 2V1DB 3NWIA 1DU2A 3P8CD 3UU5A 3VRBA 4JI1T 3O4XE 2E2AA 1ZEEA 3AECA 4IT4A 5JDHA 3V5SA 2JMHA 5CA1E 3UFGA 5LGNB 2XSAA 3JAFA 1MMAA 4HFEA 4X1KE 4EAHA 4B3MT 4YFSA 3JCFA 4PJMA 3C4WA 2BG9C 3LG7A 4N78D 1VRBA 2K3WA 2Y6XA 3CKDA 2M6BA 4LF9T 3AEFA 3VKHA 4AKLA 1KF6A 4X66T 2ZM0A 4Z91A 2LSYA 1VOMA 2C5IT 3DJBA 1YQ3A 2LSIA 2YU1A 4PJNA 3I9YA 3ONJA 3P4WA 2CXFA 3AVRA 2H7OA 4NXNT 4UEMA 4HWIB 1IAPA 4FJOA 5AQHB 4JI5T 5TAOA 5AQUB 2VASA 1W0BA 1WLXA 3TLTA 3RYCE 5HEJA 2VVSA 1J5ET 3ANWB 1YQ4A 2FJAA 4JI2T 3NKZA 1T98A 3VU7H 3QNUA 3CQXC 2X0HA 1AJ3A 4GK5E 1D1AA 1XMQT 4MBQA 4AKRB 5KDMC 3IBPA 3JC6D 3N9LA 1D0ZA 2UXXB 3MACA 2CXLA 4O4HE 1HNXT 5HXSA 3EAMA 3IF8B 2HN1A 3Q5WA 1OWAA 2LT3A 2ODVA 5F8PA 4JEHB 5M4YA 3QUJA 2X0LB 1WR6A 4I0UA 1HS7A 4AI6A 2DCFA 3IA3A 1HF8A 3AA1B 5AQRB 4H63H 2X9YA 3GA8A 3RQUA 5FY7A 2LKHA 5C8YE 3F57A 3PU3A 5LGTB 2UUAT 4WBNE 3ZPOA 2VWAA 3FZLB 4AQGA 2E9XA 4DV3T 4WYVA 2IIUA 4XAXB 4TWDA 4CI3B 3KV6A 3L39A 4KP3C 4ZEYA 2XASB 3LDQB 4PNIA 3UUBA 1SA0E 1L0VA 3AEDA 3N9QA 3Q9DA 3VRAA 4YSZA 4YSYA 2ODUA 4QH4A 4JYAT 2I0MA 3AA7B 2C0SA 2N2NA 4IDNA 4UIGA 3UU4A 2LHNA 4KUMB 1W0AA 2D9DA 5L47A 5EZYE 3MXZA 4ISTA 4JI6T 3TLSA 5J0ZA 4A5XA 5AQGB 3FXEB 2KMFA 3RIFA 4U33A 2MAWA 4O2BE 2M67A 1HG5A 2EHOD 4EZHA 1UCUA 4U74A 2CRBA 3VHLA 3LFMA 3UULA 4Q25A 4JUYA 5HXHA 4UVAB 4LFCT 4AKGA 2BBHA 3AE3A 3Q5DA 4UXNB 3OYXA 5IWAT 3MA9A 3LJCA 3GN5B 4YSXA 1IJ5A 1YXRA 3ABVA 2Z6EA 2CBJA 3FB2A 2QRXA 2XM2A 2VK9A 1LRZA 2HH7A 3OPCA 2Y8DA 4WW0A 2K48A 3KBTA 4B3ST 3N9MA 2UUCT 2CEAA 2IW5B 5HEGA 1E1HB 5L3CB 1GQEA 5JDQA 4ZI2C 5LB7B 4DV1T 1KFYA 2ACZA 3UTKA 2YDSA 4K0KT 4X5TA 4AKIA 2LHRA 3RKOA 5IHYA 4DR5T 4DNDA 2WDVA 3RYIE 4ISSA 4CI2B 2CE7A 4BA9A 1ZOYA 3RPUA 5DJQC 2XY8B 5LG3A 2YKSA 3FXDB 4B6XA 3KV5A 3EI0A 2CWYA 2V7LA 1I6ZA 3K8PC 3KVBA 3OBVE 2NWBA 4TNWA 4XBFB 3AE8A 4IL9A
chains in the Genus database with same CATH topology
1HFAA 4ASKA 4PFPA 3OYZA 2YK0A 4YHJA 4U72A 2KXPB 1S94A 3RX6A 2VKDA 1KNZA 4PFOA 5DQVA 4PW8A 3L3PA 4QXBB 3MJXA 1OXZA 2V26A 3ANWA 4J2CA 3HA4A 3J9X1 4AXPA 1H7CA 3ZMTB 4KMCA 3O1JA 3CQGB 1ZHCA 3MK7C 4V1Av 2L3LA 2LE8A 4MHCA 1WYBA 2SPCA 2V7JA 5FXVA 4UF0B 3OKQA 2ACXA 4EZ4A 4YJ2E 5IYZE 5H6RB 5JQGE 2N1GA 4HE8A 2CLYB 3J7Yq 2NW7A 1U4QA 2WWUA 3ZYLA 4C91A 2V7KA 5LHGB 5HAXA 2HPJA 2KWIB 4ZS3A 3O1HA 5L3GB 2A2FX 4NUVA 3IHRA 1MIWA 5KX5E 2MTQA 5ETWA 1FEWA 3ZMUB 2LSGA 2L9QA 4JLEA 1O3XA 2A72A 3MKDA 2Y48B 3H37A 4O4LE 4ADZA 3ETVA 2WMNA 3CVRA 3HKCE 2BZBA 3BQIA 4KBMB 3AAAB 4EOZB 5LG4A 3RRCA 3BQLA 3QC9A 3HKDE 3KFWX 3C51A 4C90A 4TV8E 2PFVA 2CWOA 2WSSV 4G2AA 1G73A 5A1LA 2DLRA 3BQKA 3N2KE 4K0UA 3T8OA 2WMOA 1BR0A 2W62A 2V1DB 4CI1B 2YINA 4WBOA 2LOPA 3C4ZA 2C5JA 3P8CD 5EK2A 5HXCA 3O4XE 1HCIA 1V9DA 3NZPA 2WM9A 1ZEEA 2ZM8A 4PJLA 1MNDA 3V5SA 5JDHA 2ZM2A 1IJ6A 2JMHA 2XAHB 4QKNA 5CA1E 4O2AE 5LGNB 4IE4A 5LP6E 3KBUA 3PUAA 2MBGA 4GK0E 4E7SA 4FI5A 2QGSA 1MMAA 3WAJA 3Q2MA 1YD8G 1FMVA 5FP3A 2K24A 4HN9A 3B13A 3GWHA 4ERRA 4OHFA 2K9AA 4F6RC 2CLYC 2G0UA 4X1KE 4EAHA 4AQFA 2H7VC 2XAGB 4YFSA 5J1GA 5LBMA 4UVBB 4DMVA 3ONXA 3C4WA 4PJMA 5LA6E 1IZNB 3UUNA 3LG7A 3K3OA 4IDZA 4N78D 5GONE 5ADXL 1VRBA 2Y6XA 3CKDA 5LOVE 3VKHA 2Q9QA 1S35A 4AKLA 4QX8B 2ZM0A 4OYJA 5LYJE 2LSYA 4YLHA 3HL6A 3B57A 5EK3A 1VOMA 3I0OA 5JDFA 3FHNA 2C5IT 2DWKA 2IC6A 1D0YA 2LSIA 2W0GA 3DJBA 3AA6B 2BVMA 2YU1A 2LSKA 3C4XA 4PJNA 3AA0B 3FBLA 3I9YA 3ZYMA 1EZ3A 4PAGA 2NP9A 4UV8B 3UFEA 4MLKA 3ZMVB 5LHHB 2CXFA 3AVRA 2H7OA 3PU8A 4QX7B 2PBIA 4UEMA 3N2GE 4CXYA 1IAPA 5EK4A 4FJOA 5TAOA 3U78A 3UT5E 4AKHA 2VASA 4DO0A 4ZI3D 1HX8A 4HFVA 5L3BB 1WLXA 3A5XA 1BR1A 3QK6A 3RYCE 5JVDE 2CCQA 1KK7A 5FYMA 5H6QB 3ANWB 2DNXA 5AFUL 3CX6B 2EHOB 4UVCB 2JJ9A 2X66A 4IGUA 4PK4A 3AVSA 3AAEB 3H3AA 2WBLA 2XHEB 4P09A 5JDGA 3PE0A 1T98A 2B1EA 2EHOA 3V5UA 3VU7H 1HTJF 3CQXC 2XAQB 5F3JA 1AJ3A 3NBXX 2I59A 4X1IE 1MMGA 4GK5E 3N9NA 4H9NC 4I4TE 1D1AA 2OA5A 3GMIA 3ZLIA 4MBQA 4UELA 3ZC0A 3HR0A 3PURA 4H9SE 3I0QA 4NUUA 4AKRB 5JRCB 3HKEE 3IBPA 3NRXA 3JC6D 4TZ4C 2JPFA 5KDMC 4CXXA 2KNDA 3N9LA 4TV9E 2LOSA 1D0ZA 2UXXB 3MACA 2CXLA 4O4HE 3FBZA 4UV9B 2NOXA 3WAKA 5HXSA 5JRCA 5HXRA 3IF8B 3Q5WA 4GYRA 1ZV4X 2CMRA 4A56A 4QHOA 3O1IA 2A3DA 1OWAA 3W15B 2LT3A 2CXDA 2ODVA 5F8PA 4ZI3C 5HWXA 4JEHB 5M4YA 3QUJA 3GN5A 2X0LB 1WR6A 2E8IA 1HS7A 1QUUA 2XQYA 4H9PC 4AI6A 2DCFA 2JMKA 1NAFA 3NZQA 1HF8A 2L8KA 2NW8A 2N9DA 5FY0A 2DWGA 3AA1B 4H63H 5J2TE 2P9BA 2X9YA 2X9XA 4H9OC 3GA8A 2CA5A 5FY7A 4P0BA 3RC3A 2X68A 3S4UA 5LHIB 4O4JE 2EHOC 5C8YE 3PUQA 3F57A 3PU3A 1YKEB 5LGTB 4IE0A 2KWHA 4WBNE 2JRKA 3EVYA 3LBXB 3RH3A 3ZPOA 2JQQA 3O9XA 3PDYA 5LCYA 1LKXA 2VWAA 5DQWA 4XZCA 4EYUA 4AQGA 3ETUA 3JC6C 4M1PA 2E9XA 5CA0E 3LBXA 4E7ZA 2QA7A 4DBRA 4O4IE 4JEUB 2BDEA 3MZKB 3PUSA 4XAXB 5KMGP 5CB4E 3F31A 1X79A 3N9OA 3SRZA 4ILUA 4DBQA 4CI3B 2KINB 3KV6A 2V7IA 3ZCIA 3E08A 1CUNA 4KP3C 1MNEA 4H9RC 4L5GA 1D0XA 1D1BA 2Q9QB 1MIYA 2XASB 3M65A 4PNIA 4IHJE 4X20E 2W00A 1SA0E 2LM9A 4BAYB 3CWZB 3EDVA 5E0OA 3RC8A 4ZHQE 3N9QA 2ES0A 2NTXA 3Q9DA 1SHZC 2W63A 2Q9QD 2X67A 3SOLA 2J1DG 2ODUA 5JDNA 1ZKEA 3OJAA 4CXWA 4HTEA 3AA7B 2C0SA 3UUXB 2N2NA 2PG8A 4GYSA 3BK9A 4UIGA 4IE7A 4IE6A 2LEHA 2LHNA 4QWNB 5FMNA 1UX4A 2YEVC 4HEAA 4KUMB 3SS1A 3VKGA 3E0ZA 4H9QC 2C5KT 3KV4A 2MYSA 1HG2A 4PJJA 4WNKA 2DI4A 3ZCJA 4TUYE 3ZN0B 1NWMX 2W61A 5HYAA 5BMVE 5L2LA 3ESLA 4H63V 2WAUA 2XUEA 3KDSE 5EZYE 2IC9A 3MXZA 4ISTA 1WRDA 3E22E 4ZI7E 3ZJ1A 3EUHA 4CQIA 3L09A 2D0UA 2UXNB 4EYYR 2V7MA 3C98B 3EDUA 4GOUA 4HGAA 3CMLA 4QXHB 5LXTE 1U5PA 3FXEB 2KMFA 2ZLYA 4AQFC 1D1CA 5FNVE 4O2BE 4DVDA 5FY1A 4EXTA 4TN7B 4TX5A 2M67A 5JR9B 4PK5A 1HG5A 5LJNA 2XAJB 4EB6E 2EHOD 2Q9QC 4EZHA 1UCUA 4U74A 5L3DB 5JR9A 4PK6A 2VKJA 2ZMAA 3F2EA 3VHLA 4OFZA 4X1YE 3LFMA 2LJLA 4I50E 3CX8B 3IEEA 3UULA 3N9PA 4JUYA 5HXHA 5FXXA 4UVAB 3LK42 4AKGA 4I55E 1LVFA 5HXEA 1FIOA 2VL8A 3HI2A 4UXNB 3OYXA 3MA9A 5FXWA 3LJCA 3R6NA 4ZI2D 5L3EB 3GN5B 1YKHB 3AAIA 3SWHA 3HKBE 1IJ5A 4ZOLE 2CM0A 2Z6EA 3ZN1B 3C64A 4L0RA 3FB2A 3P7IA 4MALA 2VKHA 4UF0A 2KZ7B 3R84B 3Q5XA 3ZMSB 5LGUB 5JDMA 1QSDA 2VK9A 1LRZA 2HH7A 3AB3B 3K3NA 3D0TA 4IE5A 1MMNA 1Y64B 4Z8XA 3RYHE 2Y8DA 3WI3A 3C50A 3N5LA 4WW0A 2K48A 5LBQB 3KBTA 2X9WA 4OYKA 3N9MA 3RYFE 4OK0A 2E9XB 2HPLA 1YW0A 2CEAA 2LSJA 5JR9C 4G63A 4BJMA 3KINB 3LK3B 2IW5B 4MFRA 3CQCB 2PJQA 5HWYA 2NW9A 2E9XD 1E1HB 3PUGA 5L3CB 2KLQA 2MOZA 5JDQA 4ZI2C 2VKOA 2KT9A 5JH7E 3UTKA 2RP4A 3DTOA 3PTRB 4ANJA 3U3IA 3NRYA 2NTYA 2D5UA 4AKIA 2LHRA 4GIWA 3K3QC 4CZZB 2H3RA 3RKOA 2DHRA 5IHYA 4ZS2A 4P0AA 2YU2A 4IIJE 3ZMZB 4DNDA 1FMWA 3RRWA 3I9WA 5JDLA 4I43B 3RYIE 3DP7A 3LK2B 5DABA 4BJNA 4ISSA 3UUMA 2X9HA 1MMDA 4CI2B 1G8XA 2CE7A 2RA1A 4BA9A 3KVAA 5J2UE 3RPUA 5DJQC 1UX5A 3ZJ2A 1Z0PA 2BVLA 4HKAA 1MIVA 1B7TA 3FXDB 1US7B 4B6XA 2IAKA 2E9XC 2XAFB 3CPZA 4EIWA 1BR4A 3I1AA 4QXCB 2VB6A 3KV5A 3ZYKA 2CWYA 5LNKA 1LVKA 4DMWA 2V7LA 3K8PC 3KVBA 3TKLB 1BR2A 2NWBA 3OBVE 2D2SA 2GK9A 5L3FB 5JREA 4XBFB 5FXZA 5LJMA 2D0TA 3KV9A 2K5BB 3ZEFB 1WYCA 2XTLA 4O8SA 4YJ3E 4L9IA 3N2OA 3ZC1A 3CX7B 2X51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GK5 E;  4GK0 E;  3VU7 H;  4FJO A;  2LSY A;  2LSI A;  2N1G A;  2LSG A;  4EXT A;  4BA9 A;  2LSK A;  2LSJ A; 
#chains in the Genus database with same CATH topology
 2YK0 A;  4U72 A;  1S94 A;  4PFO A;  5DQV A;  1WR0 A;  4AXP A;  1UGO A;  4EZ4 A;  4KI0 F;  5IYZ E;  2N1G A;  3J7Y q;  2WCA A;  2V7K A;  2IHR 1;  5KX5 E;  2MTQ A;  2XJ7 A;  3ZMU B;  2L9Q A;  2A72 A;  2Y48 B;  4O4L E;  3ETV A;  2BZB A;  4KBM B;  3KFW X;  2WSS V;  4X64 T;  4G2A A;  4CI1 B;  2YIN A;  2LOP A;  2C5J A;  1HCI A;  3NZP A;  2ZM8 A;  3PUW F;  4PJL A;  2ZM2 A;  4QKN A;  5LP6 E;  4O2A E;  3PUZ F;  5FL1 A;  2MBG A;  4GK0 E;  3Q5E A;  5ABF B;  3WAJ A;  1FMV A;  4HN9 A;  3GWH A;  1XDO A;  4CN4 A;  3RGL A;  1E2A A;  5ABF A;  4AQF A;  2H7V C;  2XAG B;  3RLF F;  5GON E;  2Q9Q A;  1S35 A;  4QX8 B;  4YLH A;  2IDO B;  4HFI A;  4QH1 A;  3FHN A;  1D0Y A;  2W0G A;  2BVM A;  2LSK A;  1Z8U A;  4YTP A;  3AA0 B;  3FBL A;  1EZ3 A;  4JI3 T;  4YXD A;  4MLK A;  5LHH B;  1HX1 B;  4CXY A;  2LRK A;  5EK4 A;  1FJG T;  5FKY A;  2WB5 A;  3UT5 E;  4AKH A;  3K1S A;  5L3B B;  3A5X A;  3QK6 A;  5JVD E;  5FYM A;  1KK7 A;  5H6Q B;  5LMN T;  3CX6 B;  4UVC B;  2FJB A;  1N33 T;  3H3A A;  2WBL A;  2XHE B;  1HTJ F;  2XAQ B;  5F3J A;  1MMG A;  2OA5 A;  4HWF A;  4LFB T;  3AXJ A;  3ZC0 A;  5FVK A;  5JRC B;  4CXX A;  4TV9 E;  5JRC A;  5HXR A;  2QYW A;  4GYR A;  1ZV4 X;  2CMR A;  3ONL C;  1VCS A;  2CXD A;  2BS3 A;  4ZI3 C;  2XQ7 A;  3PJA A;  4H9P C;  4X62 T;  1NAF A;  2NW8 A;  2XPK A;  2N9D A;  5FY0 A;  3PUX F;  1XNQ T;  3ZKR A;  3RIA A;  2AE9 A;  3FZF B;  5J2T E;  4H9O C;  5LHI B;  4O4J E;  3PUQ A;  5AQV B;  3TLV A;  4IE0 A;  3RH3 A;  3G06 A;  3O9X A;  5LCY A;  1LKX A;  5DQW A;  4EYU A;  2WU5 A;  4TWF A;  4DBR A;  5HEH A;  4O4I E;  1XMO T;  3SRZ A;  1VCT A;  3AE7 A;  2KIN B;  1MNE A;  1D0X A;  2V5C A;  1MIY A;  4X20 E;  4IHJ E;  2LM9 A;  1N36 T;  5E0O A;  3RC8 A;  4ZHQ E;  2RPA A;  2HHH T;  1E7P A;  3ZSS A;  2J1D G;  1ZKE A;  3OJA A;  2JQH A;  3BK9 A;  4IE6 A;  4H9Q C;  2C5K T;  2MYS A;  1HG2 A;  4WNK A;  4TUY E;  1NWM X;  4DV4 T;  2WZH A;  2VQE T;  4H63 V;  3AE4 A;  1WRD A;  4ZI7 E;  4CQI A;  4EYY R;  2V7M A;  3C98 B;  3EDU A;  4HGA A;  4QXH B;  3CML A;  5LXT E;  1U5P A;  4DVD A;  5FY1 A;  4TN7 B;  4PK5 A;  3TLU A;  4EB6 E;  5L3D B;  2VKJ A;  2ZMA A;  3F2E A;  4KX6 A;  5FVL A;  5FXX A;  4YY3 T;  5HXE A;  2CHO A;  2VL8 A;  3HI2 A;  5FXW A;  3R6N A;  4ZI2 D;  5L3E B;  1YKH B;  2YDQ A;  4JI4 T;  4L0R A;  2R6G F;  3Q5X A;  2XQ6 A;  3D0T A;  1MMN A;  1Y64 B;  2X0Y A;  4ZXL A;  3FZH B;  2WP9 A;  5AQT B;  4OYK A;  4OK0 A;  4LF8 T;  4YHH T;  2E9X B;  2J4G A;  4IDO A;  3KIN B;  2W2U A;  4MFR A;  2FUP A;  2PJQ A;  5HWY A;  4U2Z A;  2NW9 A;  2MOZ A;  2BKO A;  2KT9 A;  5JH7 E;  3DTO A;  2WS3 A;  2W4X A;  4P1N A;  2D5U A;  2WZI A;  4EED A;  4CZZ B;  3P4Q A;  4P0A A;  2YDR A;  4JI8 T;  1R8I A;  2KSR A;  5JDL A;  4I43 B;  3DP7 A;  5DAB A;  3UUM A;  2X9H A;  1MMD A;  5HCM A;  2LRL A;  5J2U E;  1B7T A;  2V6Y B;  2IAK A;  2E9X C;  1IBM T;  2UU9 T;  1BR4 A;  2V6Y A;  3I1A A;  3AE6 A;  2VB6 A;  3CK6 A;  3ZYK A;  1LVK A;  2E5L T;  3RHW A;  1BR2 A;  2D2S A;  2GK9 A;  5L3F B;  5JRE A;  4DR7 T;  5LJM A;  2D0T A;  2K5B B;  3ZEF B;  3JAE A;  2ZM6 T;  2XTL A;  2XQA A;  4L9I A;  3ZC1 A;  4ILB A;  4DR1 T;  1HFA A;  4ASK A;  3OYZ A;  4YHJ A;  2VKD A;  4WZX A;  1KNZ A;  4U7I A;  2HN2 A;  4YT0 A;  1JNR A;  5CFB A;  3L3P A;  1OXZ A;  4HFB A;  3HA4 A;  3J9X 1;  2M6I A;  4DV6 T;  3CQG B;  4V1A v;  1WFD A;  3AE1 A;  3OKQ A;  2YOE A;  1CHU A;  5H6R B;  2CLY B;  2WWU A;  2WWV A;  4C91 A;  4ZS3 A;  4DUY T;  2A2F X;  4NUV A;  1MIW A;  5ETW A;  1FEW A;  1HNW T;  2XQ9 A;  2J62 A;  3MKD A;  3H37 A;  1UK5 A;  3BQI A;  3AAA B;  4EOZ B;  2XQ8 A;  3RRC A;  4COF A;  3QC9 A;  4DR6 T;  2WDQ A;  4C90 A;  4TV8 E;  2PFV A;  1NEN A;  5A1L A;  2DLR A;  3BQK A;  4HWC A;  4WBO A;  4YTM A;  5HXC A;  3QOF A;  5AQP B;  2WM9 A;  2XAH B;  5C2T A;  4HWH A;  4IE4 A;  1KEY A;  3PUA A;  1YD8 G;  4ERR A;  5FP3 A;  2K24 A;  5CJ5 A;  1SE7 A;  2VVN A;  2XQ4 A;  3B13 A;  4OHF A;  2CLY C;  2G0U A;  5LBM A;  4DMV A;  1M7K A;  3ONX A;  1IZN B;  3K3O A;  5LOV E;  4OYJ A;  3HL6 A;  3B57 A;  5JDF A;  4YTN A;  2W67 A;  2DWK A;  2IC6 A;  5HEO A;  3C4X A;  2FJD A;  3ZYM A;  4QX7 B;  2PBI A;  3N2G E;  3FZK B;  3RIU A;  1OED E;  3U78 A;  4DO0 A;  4ZI3 D;  1HX8 A;  3T1Y T;  2CCQ A;  3P50 A;  2EHO B;  2JJ9 A;  1N32 T;  4IGU A;  4PK4 A;  3AVS A;  2B1E A;  2EHO A;  2BS4 A;  2I59 A;  4X1I E;  3N9N A;  3RF1 A;  3ZLI A;  4EGW A;  4AQY T;  4LMK A;  3HR0 A;  4CN6 A;  3PUR A;  4NUU A;  2B76 A;  3NRX A;  2JPF A;  3WAK A;  3FBZ A;  2NOX A;  3ZST A;  2XQ3 A;  4TWH A;  4A56 A;  1KNP A;  5HWX A;  3RIU C;  2E8I A;  2JMK A;  2DWG A;  2P9B A;  2X9X A;  5BR8 T;  4P0B A;  3RC3 A;  3S4U A;  4IRE A;  2EHO C;  5AQK B;  4KHZ F;  4EV6 A;  2H89 A;  2KWH A;  2JRK A;  3PDY A;  3ETU A;  1SUM B;  1T7S A;  4E7Z A;  4KHP T;  3PV0 F;  5AQS B;  3CIR A;  1N34 T;  3MZK B;  5KMG P;  5CB4 E;  3F31 A;  3N9O A;  2XZE A;  2DL1 A;  4ILU A;  4DBQ A;  3ZCI A;  1D1B A;  2Q9Q B;  3M65 A;  4BAY B;  4JI7 T;  2NTX A;  5C3J A;  1SHZ C;  2W63 A;  1HR0 T;  4HTE A;  3UUX B;  4GYS A;  2LEH A;  4QWN B;  5FMN A;  1UX4 A;  2YEV C;  3VKG A;  3SS1 A;  3E0Z A;  3KV4 A;  4PJJ A;  2DI4 A;  4NXM T;  3ZCJ A;  3ZN0 B;  5HYA A;  5L4E A;  5L2L A;  2WAU A;  3E22 E;  4DV2 T;  2VL0 A;  3ZJ1 A;  3EUH A;  4LF5 T;  2UXN B;  2LKG A;  4AQF C;  5FNV E;  4A97 A;  1IBK T;  4EXT A;  4TX5 A;  2QVA A;  2XAJ B;  3AEA A;  3AXJ B;  2Q9Q C;  3UU3 A;  4OFZ A;  4X1Y E;  4I50 E;  3CX8 B;  3IEE A;  4U2Y A;  3LK4 2;  1W09 A;  4HFC A;  3B5M A;  4LF6 T;  3AAI A;  3SWH A;  3UQ4 A;  5HCJ A;  2CM0 A;  2NR4 A;  3ZN1 B;  3P7I A;  4UF0 A;  5AQL B;  3ZMS B;  5LGU B;  3K3N A;  3RYH E;  3WI3 A;  3C50 A;  3N5L A;  4IL4 A;  2HPL A;  2F4V T;  1XZY A;  3P4P A;  2LSJ A;  4G63 A;  4BJM A;  3LK3 B;  2OLT A;  1XNR T;  2E9X D;  5AQO B;  1UUR A;  3PUG A;  2KLQ A;  2WQY A;  2VKO A;  2PTF A;  2I6H A;  1UUS A;  4ANJ A;  3U3I A;  2BS2 A;  3NRY A;  4LML A;  1OED B;  4GIW A;  5ABH A;  4LF7 T;  1OED A;  4IIJ E;  3ZMZ B;  1FMW A;  3A7M A;  4DV7 T;  4BJN A;  3RKG A;  4DV5 T;  2MPK A;  2IUB A;  4AIS A;  1UX5 A;  1Z0P A;  1MIV A;  1US7 B;  2UXC T;  2XAF B;  4DR3 T;  4EIW A;  1KNR A;  1IBL T;  3M3Z B;  4QXC B;  2UXB T;  5L4H A;  5LNK A;  4DMW A;  3PUV F;  3TKL B;  3UU8 A;  4OX9 T;  2FBW A;  5FXZ A;  5AQJ B;  2WU2 A;  3TLW A;  5LMU T;  1OED C;  3SFD A;  3ZT6 A;  1W9R A;  2V26 A;  3ANW A;  4J2C A;  1H7C A;  1WCR A;  4KMC A;  5AQF B;  5AQM B;  2BBJ A;  1ZHC A;  3MK7 C;  4MHC A;  2E5V A;  2SPC A;  2V7J A;  5FXV A;  2ACX A;  2WDR A;  4YJ2 E;  3AE9 A;  3P4S A;  4ZZC A;  2A9U A;  3AEB A;  2HPJ A;  2LSG A;  3EAB A;  1J1J A;  1O3X A;  4JLE A;  2CPT A;  2XQ5 A;  4ADZ A;  3CVR A;  2JQK A;  5LG4 A;  3UQ7 A;  2OV9 A;  2V6X A;  4U31 A;  2CWO A;  5ABG A;  4K0U A;  3T8O A;  2W62 A;  3C4Z A;  5EK2 A;  4CN1 A;  1V9D A;  3PUY F;  1MND A;  1IJ6 A;  4DV0 T;  3KBU A;  3L8R A;  4E7S A;  4FI5 A;  2QGS A;  4A98 A;  3Q2M A;  2K9A A;  4F6R C;  4QH5 A;  3PJA J;  2CHN A;  5J1G A;  4UVB B;  5LA6 E;  3UUN A;  4IDZ A;  3AEG A;  5ADX L;  5LYJ E;  5EK3 A;  3I0O A;  3RI5 A;  4HFD A;  3AA6 B;  2CBI A;  4PAG A;  2NP9 A;  4UV8 B;  2LM2 A;  3UFE A;  3ZMV B;  2FJE A;  3PU8 A;  1Y01 A;  2UXD T;  1JNZ A;  4HFV A;  3T1H T;  1BR1 A;  2IML A;  2LLY A;  2XSB A;  2DNX A;  5AFU L;  4X65 T;  4IDP A;  2X66 A;  3AAE B;  4P09 A;  5JDG A;  3PE0 A;  3V5U A;  3NBX X;  4NPP A;  4H9N C;  4I4T E;  5FL0 A;  3GMI A;  4UEL A;  4GKJ T;  4H9S E;  3I0Q A;  2H88 A;  4DR2 T;  3HKE E;  4TZ4 C;  3UU6 A;  2KND A;  3AEE A;  3NVO A;  2LOS A;  4UV9 B;  4QHO A;  2YN6 A;  3O1I A;  2A3D A;  4U7Y A;  3W15 B;  4JBW F;  2UUB T;  2BKP A;  3GN5 A;  1QUU A;  2XQY A;  3NZQ A;  2L8K A;  2CA5 A;  2X68 A;  1YKE B;  3EVY A;  3LBX B;  2JQQ A;  4XZC A;  3OTO T;  3JC6 C;  4M1P A;  3A8Y C;  5CA0 E;  3LBX A;  2JIW A;  4UR9 A;  2QA7 A;  4JEU B;  2BDE A;  3PUS A;  1X79 A;  2BG9 E;  4DUZ T;  2V7I A;  3E08 A;  1CUN A;  4H9R C;  4L5G A;  2VUR A;  1XWM A;  2W00 A;  5F5W A;  4B3T T;  3CWZ B;  3EDV A;  2ES0 A;  5KXJ A;  4LF4 T;  2Q9Q D;  2X67 A;  3P4R A;  5AQN B;  3SOL A;  4ILA A;  5JDN A;  5AQQ B;  4CXW A;  2PG8 A;  4IE7 A;  3H3M A;  4HEA A;  3VR9 A;  4HWD A;  2W61 A;  5BMV E;  3ESL A;  2XUE A;  3KDS E;  2IC9 A;  3L09 A;  2D0U A;  3QB5 A;  4GOU A;  4ZZB A;  2V5D A;  2ZLY A;  5AQI B;  1D1C A;  3ZT7 A;  4DR4 T;  4JI0 T;  5JR9 B;  5LJN A;  5JR9 A;  4PK6 A;  2JQ9 A;  2LJL A;  4ILC A;  3N9P A;  4AIU A;  4I55 E;  1LVF A;  1FIO A;  3X1D A;  3AE2 A;  1X9B A;  2AXD S;  3HKB E;  4ZOL E;  1J5W A;  3FZM B;  3C64 A;  2XM1 A;  4MAL A;  2VKH A;  1M62 A;  2KZ7 B;  3R84 B;  5JDM A;  1QSD A;  3AB3 B;  4IE5 A;  4Z8X A;  5LBQ B;  4B3R T;  2X9W A;  3SFE A;  4LFA T;  3RYF E;  2BKN A;  1XDP A;  3OVU A;  4IDQ A;  5HEU A;  5IUX A;  1YW0 A;  5JR9 C;  5JTG A;  3CQC B;  2RP4 A;  3PTR B;  1T72 A;  4LMJ A;  2NTY A;  3ZT5 A;  1QLB A;  5ABE A;  1I94 T;  3K3Q C;  2H3R A;  1HNZ T;  2DHR A;  4ZS2 A;  2YU2 A;  3RRW A;  3I9W A;  3EHZ A;  3LK2 B;  2V8S V;  1G8X A;  2RA1 A;  2W66 A;  3KVA A;  3ZJ2 A;  2BVL A;  4HKA A;  4Z90 A;  3JAD A;  3CPZ A;  3AE5 A;  4F8H A;  4TNV A;  4EEB A;  4HFH A;  3KV9 A;  4GKK T;  1WYC A;  4O8S A;  4YJ3 E;  3N2O A;  3CX7 B;  2X51 A;  4PFP A;  2J47 A;  3RX6 A;  2KXP B;  1T8B A;  4PW8 A;  3RQW A;  4QXB B;  3MJX A;  4U3C A;  2WY2 A;  3VR8 A;  3ZMT B;  3O1J A;  2L3L A;  2LE8 A;  1WYB A;  4UF0 B;  4NIQ A;  3QB5 K;  5JQG E;  4HE8 A;  2NW7 A;  1U4Q A;  3ZYL A;  5LHG B;  5HAX A;  2KWI B;  3O1H A;  5L3G B;  2BG9 B;  3IHR A;  1NEK A;  4DID B;  4JV5 T;  2BG9 A;  5CGM A;  2VQF T;  2WMN A;  3HKC E;  3BQL A;  3HKD E;  3C51 A;  1G73 A;  1ZP0 A;  3N2K E;  3LSV A;  2WMO A;  1BR0 A;  2V1D B;  3NWI A;  1DU2 A;  3P8C D;  3UU5 A;  3VRB A;  4JI1 T;  3O4X E;  2E2A A;  1ZEE A;  3AEC A;  4IT4 A;  5JDH A;  3V5S A;  2JMH A;  5CA1 E;  3UFG A;  5LGN B;  2XSA A;  3JAF A;  1MMA A;  4HFE A;  4X1K E;  4EAH A;  4B3M T;  4YFS A;  3JCF A;  4PJM A;  3C4W A;  2BG9 C;  3LG7 A;  4N78 D;  1VRB A;  2K3W A;  2Y6X A;  3CKD A;  2M6B A;  4LF9 T;  3AEF A;  3VKH A;  4AKL A;  1KF6 A;  4X66 T;  2ZM0 A;  4Z91 A;  2LSY A;  1VOM A;  2C5I T;  3DJB A;  1YQ3 A;  2LSI A;  2YU1 A;  4PJN A;  3I9Y A;  3ONJ A;  3P4W A;  2CXF A;  3AVR A;  2H7O A;  4NXN T;  4UEM A;  4HWI B;  1IAP A;  4FJO A;  5AQH B;  4JI5 T;  5TAO A;  5AQU B;  2VAS A;  1W0B A;  1WLX A;  3TLT A;  3RYC E;  5HEJ A;  2VVS A;  1J5E T;  3ANW B;  1YQ4 A;  2FJA A;  4JI2 T;  3NKZ A;  1T98 A;  3VU7 H;  3QNU A;  3CQX C;  2X0H A;  1AJ3 A;  4GK5 E;  1D1A A;  1XMQ T;  4MBQ A;  4AKR B;  5KDM C;  3IBP A;  3JC6 D;  3N9L A;  1D0Z A;  2UXX B;  3MAC A;  2CXL A;  4O4H E;  1HNX T;  5HXS A;  3EAM A;  3IF8 B;  2HN1 A;  3Q5W A;  1OWA A;  2LT3 A;  2ODV A;  5F8P A;  4JEH B;  5M4Y A;  3QUJ A;  2X0L B;  1WR6 A;  4I0U A;  1HS7 A;  4AI6 A;  2DCF A;  3IA3 A;  1HF8 A;  3AA1 B;  5AQR B;  4H63 H;  2X9Y A;  3GA8 A;  3RQU A;  5FY7 A;  2LKH A;  5C8Y E;  3F57 A;  3PU3 A;  5LGT B;  2UUA T;  4WBN E;  3ZPO A;  2VWA A;  3FZL B;  4AQG A;  2E9X A;  4DV3 T;  4WYV A;  2IIU A;  4XAX B;  4TWD A;  4CI3 B;  3KV6 A;  3L39 A;  4KP3 C;  4ZEY A;  2XAS B;  3LDQ B;  4PNI A;  3UUB A;  1SA0 E;  1L0V A;  3AED A;  3N9Q A;  3Q9D A;  3VRA A;  4YSZ A;  4YSY A;  2ODU A;  4QH4 A;  4JYA T;  2I0M A;  3AA7 B;  2C0S A;  2N2N A;  4IDN A;  4UIG A;  3UU4 A;  2LHN A;  4KUM B;  1W0A A;  2D9D A;  5L47 A;  5EZY E;  3MXZ A;  4IST A;  4JI6 T;  3TLS A;  5J0Z A;  4A5X A;  5AQG B;  3FXE B;  2KMF A;  3RIF A;  4U33 A;  2MAW A;  4O2B E;  2M67 A;  1HG5 A;  2EHO D;  4EZH A;  1UCU A;  4U74 A;  2CRB A;  3VHL A;  3LFM A;  3UUL A;  4Q25 A;  4JUY A;  5HXH A;  4UVA B;  4LFC T;  4AKG A;  2BBH A;  3AE3 A;  3Q5D A;  4UXN B;  3OYX A;  5IWA T;  3MA9 A;  3LJC A;  3GN5 B;  4YSX A;  1IJ5 A;  1YXR A;  3ABV A;  2Z6E A;  2CBJ A;  3FB2 A;  2QRX A;  2XM2 A;  2VK9 A;  1LRZ A;  2HH7 A;  3OPC A;  2Y8D A;  4WW0 A;  2K48 A;  3KBT A;  4B3S T;  3N9M A;  2UUC T;  2CEA A;  2IW5 B;  5HEG A;  1E1H B;  5L3C B;  1GQE A;  5JDQ A;  4ZI2 C;  5LB7 B;  4DV1 T;  1KFY A;  2ACZ A;  3UTK A;  2YDS A;  4K0K T;  4X5T A;  4AKI A;  2LHR A;  3RKO A;  5IHY A;  4DR5 T;  4DND A;  2WDV A;  3RYI E;  4ISS A;  4CI2 B;  2CE7 A;  4BA9 A;  1ZOY A;  3RPU A;  5DJQ C;  2XY8 B;  5LG3 A;  2YKS A;  3FXD B;  4B6X A;  3KV5 A;  3EI0 A;  2CWY A;  2V7L A;  1I6Z A;  3K8P C;  3KVB A;  3OBV E;  2NWB A;  4TNW A;  4XBF B;  3AE8 A;  4IL9 A; 
#chains in the Genus database with same CATH homology
 1HFA A;  4ASK A;  4PFP A;  3OYZ A;  2YK0 A;  4YHJ A;  4U72 A;  2KXP B;  1S94 A;  3RX6 A;  2VKD A;  1KNZ A;  4PFO A;  5DQV A;  4PW8 A;  3L3P A;  4QXB B;  3MJX A;  1OXZ A;  2V26 A;  3ANW A;  4J2C A;  3HA4 A;  3J9X 1;  4AXP A;  1H7C A;  3ZMT B;  4KMC A;  3O1J A;  3CQG B;  1ZHC A;  3MK7 C;  4V1A v;  2L3L A;  2LE8 A;  4MHC A;  1WYB A;  2SPC A;  2V7J A;  5FXV A;  4UF0 B;  3OKQ A;  2ACX A;  4EZ4 A;  4YJ2 E;  5IYZ E;  5H6R B;  5JQG E;  2N1G A;  4HE8 A;  2CLY B;  3J7Y q;  2NW7 A;  1U4Q A;  2WWU A;  3ZYL A;  4C91 A;  2V7K A;  5LHG B;  5HAX A;  2HPJ A;  2KWI B;  4ZS3 A;  3O1H A;  5L3G B;  2A2F X;  4NUV A;  3IHR A;  1MIW A;  5KX5 E;  2MTQ A;  5ETW A;  1FEW A;  3ZMU B;  2LSG A;  2L9Q A;  4JLE A;  1O3X A;  2A72 A;  3MKD A;  2Y48 B;  3H37 A;  4O4L E;  4ADZ A;  3ETV A;  2WMN A;  3CVR A;  3HKC E;  2BZB A;  3BQI A;  4KBM B;  3AAA B;  4EOZ B;  5LG4 A;  3RRC A;  3BQL A;  3QC9 A;  3HKD E;  3KFW X;  3C51 A;  4C90 A;  4TV8 E;  2PFV A;  2CWO A;  2WSS V;  4G2A A;  1G73 A;  5A1L A;  2DLR A;  3BQK A;  3N2K E;  4K0U A;  3T8O A;  2WMO A;  1BR0 A;  2W62 A;  2V1D B;  4CI1 B;  2YIN A;  4WBO A;  2LOP A;  3C4Z A;  2C5J A;  3P8C D;  5EK2 A;  5HXC A;  3O4X E;  1HCI A;  1V9D A;  3NZP A;  2WM9 A;  1ZEE A;  2ZM8 A;  4PJL A;  1MND A;  3V5S A;  5JDH A;  2ZM2 A;  1IJ6 A;  2JMH A;  2XAH B;  4QKN A;  5CA1 E;  4O2A E;  5LGN B;  4IE4 A;  5LP6 E;  3KBU A;  3PUA A;  2MBG A;  4GK0 E;  4E7S A;  4FI5 A;  2QGS A;  1MMA A;  3WAJ A;  3Q2M A;  1YD8 G;  1FMV A;  5FP3 A;  2K24 A;  4HN9 A;  3B13 A;  3GWH A;  4ERR A;  4OHF A;  2K9A A;  4F6R C;  2CLY C;  2G0U A;  4X1K E;  4EAH A;  4AQF A;  2H7V C;  2XAG B;  4YFS A;  5J1G A;  5LBM A;  4UVB B;  4DMV A;  3ONX A;  3C4W A;  4PJM A;  5LA6 E;  1IZN B;  3UUN A;  3LG7 A;  3K3O A;  4IDZ A;  4N78 D;  5GON E;  5ADX L;  1VRB A;  2Y6X A;  3CKD A;  5LOV E;  3VKH A;  2Q9Q A;  1S35 A;  4AKL A;  4QX8 B;  2ZM0 A;  4OYJ A;  5LYJ E;  2LSY A;  4YLH A;  3HL6 A;  3B57 A;  5EK3 A;  1VOM A;  3I0O A;  5JDF A;  3FHN A;  2C5I T;  2DWK A;  2IC6 A;  1D0Y A;  2LSI A;  2W0G A;  3DJB A;  3AA6 B;  2BVM A;  2YU1 A;  2LSK A;  3C4X A;  4PJN A;  3AA0 B;  3FBL A;  3I9Y A;  3ZYM A;  1EZ3 A;  4PAG A;  2NP9 A;  4UV8 B;  3UFE A;  4MLK A;  3ZMV B;  5LHH B;  2CXF A;  3AVR A;  2H7O A;  3PU8 A;  4QX7 B;  2PBI A;  4UEM A;  3N2G E;  4CXY A;  1IAP A;  5EK4 A;  4FJO A;  5TAO A;  3U78 A;  3UT5 E;  4AKH A;  2VAS A;  4DO0 A;  4ZI3 D;  1HX8 A;  4HFV A;  5L3B B;  1WLX A;  3A5X A;  1BR1 A;  3QK6 A;  3RYC E;  5JVD E;  2CCQ A;  1KK7 A;  5FYM A;  5H6Q B;  3ANW B;  2DNX A;  5AFU L;  3CX6 B;  2EHO B;  4UVC B;  2JJ9 A;  2X66 A;  4IGU A;  4PK4 A;  3AVS A;  3AAE B;  3H3A A;  2WBL A;  2XHE B;  4P09 A;  5JDG A;  3PE0 A;  1T98 A;  2B1E A;  2EHO A;  3V5U A;  3VU7 H;  1HTJ F;  3CQX C;  2XAQ B;  5F3J A;  1AJ3 A;  3NBX X;  2I59 A;  4X1I E;  1MMG A;  4GK5 E;  3N9N A;  4H9N C;  4I4T E;  1D1A A;  2OA5 A;  3GMI A;  3ZLI A;  4MBQ A;  4UEL A;  3ZC0 A;  3HR0 A;  3PUR A;  4H9S E;  3I0Q A;  4NUU A;  4AKR B;  5JRC B;  3HKE E;  3IBP A;  3NRX A;  3JC6 D;  4TZ4 C;  2JPF A;  5KDM C;  4CXX A;  2KND A;  3N9L A;  4TV9 E;  2LOS A;  1D0Z A;  2UXX B;  3MAC A;  2CXL A;  4O4H E;  3FBZ A;  4UV9 B;  2NOX A;  3WAK A;  5HXS A;  5JRC A;  5HXR A;  3IF8 B;  3Q5W A;  4GYR A;  1ZV4 X;  2CMR A;  4A56 A;  4QHO A;  3O1I A;  2A3D A;  1OWA A;  3W15 B;  2LT3 A;  2CXD A;  2ODV A;  5F8P A;  4ZI3 C;  5HWX A;  4JEH B;  5M4Y A;  3QUJ A;  3GN5 A;  2X0L B;  1WR6 A;  2E8I A;  1HS7 A;  1QUU A;  2XQY A;  4H9P C;  4AI6 A;  2DCF A;  2JMK A;  1NAF A;  3NZQ A;  1HF8 A;  2L8K A;  2NW8 A;  2N9D A;  5FY0 A;  2DWG A;  3AA1 B;  4H63 H;  5J2T E;  2P9B A;  2X9Y A;  2X9X A;  4H9O C;  3GA8 A;  2CA5 A;  5FY7 A;  4P0B A;  3RC3 A;  2X68 A;  3S4U A;  5LHI B;  4O4J E;  2EHO C;  5C8Y E;  3PUQ A;  3F57 A;  3PU3 A;  1YKE B;  5LGT B;  4IE0 A;  2KWH A;  4WBN E;  2JRK A;  3EVY A;  3LBX B;  3RH3 A;  3ZPO A;  2JQQ A;  3O9X A;  3PDY A;  5LCY A;  1LKX A;  2VWA A;  5DQW A;  4XZC A;  4EYU A;  4AQG A;  3ETU A;  3JC6 C;  4M1P A;  2E9X A;  5CA0 E;  3LBX A;  4E7Z A;  2QA7 A;  4DBR A;  4O4I E;  4JEU B;  2BDE A;  3MZK B;  3PUS A;  4XAX B;  5KMG P;  5CB4 E;  3F31 A;  1X79 A;  3N9O A;  3SRZ A;  4ILU A;  4DBQ A;  4CI3 B;  2KIN B;  3KV6 A;  2V7I A;  3ZCI A;  3E08 A;  1CUN A;  4KP3 C;  1MNE A;  4H9R C;  4L5G A;  1D0X A;  1D1B A;  2Q9Q B;  1MIY A;  2XAS B;  3M65 A;  4PNI A;  4IHJ E;  4X20 E;  2W00 A;  1SA0 E;  2LM9 A;  4BAY B;  3CWZ B;  3EDV A;  5E0O A;  3RC8 A;  4ZHQ E;  3N9Q A;  2ES0 A;  2NTX A;  3Q9D A;  1SHZ C;  2W63 A;  2Q9Q D;  2X67 A;  3SOL A;  2J1D G;  2ODU A;  5JDN A;  1ZKE A;  3OJA A;  4CXW A;  4HTE A;  3AA7 B;  2C0S A;  3UUX B;  2N2N A;  2PG8 A;  4GYS A;  3BK9 A;  4UIG A;  4IE7 A;  4IE6 A;  2LEH A;  2LHN A;  4QWN B;  5FMN A;  1UX4 A;  2YEV C;  4HEA A;  4KUM B;  3SS1 A;  3VKG A;  3E0Z A;  4H9Q C;  2C5K T;  3KV4 A;  2MYS A;  1HG2 A;  4PJJ A;  4WNK A;  2DI4 A;  3ZCJ A;  4TUY E;  3ZN0 B;  1NWM X;  2W61 A;  5HYA A;  5BMV E;  5L2L A;  3ESL A;  4H63 V;  2WAU A;  2XUE A;  3KDS E;  5EZY E;  2IC9 A;  3MXZ A;  4IST A;  1WRD A;  3E22 E;  4ZI7 E;  3ZJ1 A;  3EUH A;  4CQI A;  3L09 A;  2D0U A;  2UXN B;  4EYY R;  2V7M A;  3C98 B;  3EDU A;  4GOU A;  4HGA A;  3CML A;  4QXH B;  5LXT E;  1U5P A;  3FXE B;  2KMF A;  2ZLY A;  4AQF C;  1D1C A;  5FNV E;  4O2B E;  4DVD A;  5FY1 A;  4EXT A;  4TN7 B;  4TX5 A;  2M67 A;  5JR9 B;  4PK5 A;  1HG5 A;  5LJN A;  2XAJ B;  4EB6 E;  2EHO D;  2Q9Q C;  4EZH A;  1UCU A;  4U74 A;  5L3D B;  5JR9 A;  4PK6 A;  2VKJ A;  2ZMA A;  3F2E A;  3VHL A;  4OFZ A;  4X1Y E;  3LFM A;  2LJL A;  4I50 E;  3CX8 B;  3IEE A;  3UUL A;  3N9P A;  4JUY A;  5HXH A;  5FXX A;  4UVA B;  3LK4 2;  4AKG A;  4I55 E;  1LVF A;  5HXE A;  1FIO A;  2VL8 A;  3HI2 A;  4UXN B;  3OYX A;  3MA9 A;  5FXW A;  3LJC A;  3R6N A;  4ZI2 D;  5L3E B;  3GN5 B;  1YKH B;  3AAI A;  3SWH A;  3HKB E;  1IJ5 A;  4ZOL E;  2CM0 A;  2Z6E A;  3ZN1 B;  3C64 A;  4L0R A;  3FB2 A;  3P7I A;  4MAL A;  2VKH A;  4UF0 A;  2KZ7 B;  3R84 B;  3Q5X A;  3ZMS B;  5LGU B;  5JDM A;  1QSD A;  2VK9 A;  1LRZ A;  2HH7 A;  3AB3 B;  3K3N A;  3D0T A;  4IE5 A;  1MMN A;  1Y64 B;  4Z8X A;  3RYH E;  2Y8D A;  3WI3 A;  3C50 A;  3N5L A;  4WW0 A;  2K48 A;  5LBQ B;  3KBT A;  2X9W A;  4OYK A;  3N9M A;  3RYF E;  4OK0 A;  2E9X B;  2HPL A;  1YW0 A;  2CEA A;  2LSJ A;  5JR9 C;  4G63 A;  4BJM A;  3KIN B;  3LK3 B;  2IW5 B;  4MFR A;  3CQC B;  2PJQ A;  5HWY A;  2NW9 A;  2E9X D;  1E1H B;  3PUG A;  5L3C B;  2KLQ A;  2MOZ A;  5JDQ A;  4ZI2 C;  2VKO A;  2KT9 A;  5JH7 E;  3UTK A;  2RP4 A;  3DTO A;  3PTR B;  4ANJ A;  3U3I A;  3NRY A;  2NTY A;  2D5U A;  4AKI A;  2LHR A;  4GIW A;  3K3Q C;  4CZZ B;  2H3R A;  3RKO A;  2DHR A;  5IHY A;  4ZS2 A;  4P0A A;  2YU2 A;  4IIJ E;  3ZMZ B;  4DND A;  1FMW A;  3RRW A;  3I9W A;  5JDL A;  4I43 B;  3RYI E;  3DP7 A;  3LK2 B;  5DAB A;  4BJN A;  4ISS A;  3UUM A;  2X9H A;  1MMD A;  4CI2 B;  1G8X A;  2CE7 A;  2RA1 A;  4BA9 A;  3KVA A;  5J2U E;  3RPU A;  5DJQ C;  1UX5 A;  3ZJ2 A;  1Z0P A;  2BVL A;  4HKA A;  1MIV A;  1B7T A;  3FXD B;  1US7 B;  4B6X A;  2IAK A;  2E9X C;  2XAF B;  3CPZ A;  4EIW A;  1BR4 A;  3I1A A;  4QXC B;  2VB6 A;  3KV5 A;  3ZYK A;  2CWY A;  5LNK A;  1LVK A;  4DMW A;  2V7L A;  3K8P C;  3KVB A;  3TKL B;  1BR2 A;  2NWB A;  3OBV E;  2D2S A;  2GK9 A;  5L3F B;  5JRE A;  4XBF B;  5FXZ A;  5LJM A;  2D0T A;  3KV9 A;  2K5B B;  3ZEF B;  1WYC A;  2XTL A;  4O8S A;  4YJ3 E;  4L9I A;  3N2O A;  3ZC1 A;  3CX7 B;  2X51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...