5AQVB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 47
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqvB00
1HX1B 3A8YC 5AQTB 5AQOB 4HWFA 4HWDA 5AQRB 1UK5A 1M62A 5AQNB 3M3ZB 5AQJB 3LDQB 5AQSB 1I6ZA 2D9DA 4HWCA 3FZMB 3FZFB 4HWHA 3FZKB 5AQKB 5AQVB 1UGOA 5AQGB 5AQQB 5AQUB 5AQLB 4HWIB 5AQPB 5AQHB 5AQFB 5AQIB 5AQMB 1M7KA 1T7SA 3FZHB 3FZLB
chains in the Genus database with same CATH superfamily
4P1NA 3GN5A 3MK7C 2XHEB 1WR6A 3B13A 2VKDA 2Y8DA 2CBIA 4TZ4C 2XAFB 1MMNA 2NOXA 2BZBA 1QSDA 2FJEA 4BJMA 3QUJA 3QNUA 4HFHA 2WCAA 3B5MA 3RQWA 3R6NA 2YDRA 4YY3T 2ZM0A 5ABHA 2XM2A 2YEVC 5ETWA 2E9XD 3TKLB 1OWAA 5AQJB 5LG4A 2WZHA 3QB5K 1XNQT 5A1LA 1WLXA 2BG9B 4DUZT 3NRXA 5AQIB 3CX8B 1UX5A 3ZYKA 2Q9QD 2V6YA 2V26A 5CJ5A 1BR1A 5HEOA 4A98A 3K3NA 4CXWA 3JCFA 1WRDA 5C2TA 2XJ7A 3RKGA 2UXNB 2LKHA 1HF8A 2VASA 2DLRA 2Z6EA 2NW7A 1NWMX 2BG9C 4EEBA 4NXMT 1UCUA 4QH1A 4OYKA 2WMNA 3RX6A 1E7PA 5FY7A 4PJLA 2E5VA 4MHCA 3UU4A 3VU7H 1IAPA 4PAGA 3P50A 2J4GA 4MLKA 2XQ4A 1VRBA 2OV9A 4ZI2D 3CKDA 3EABA 3RF1A 3EUHA 4Z91A 2CLYB 3OJAA 2V8SV 2D0TA 3PJAJ 2B76A 4ZOLE 4UF0B 3O1JA 1H7CA 3L39A 4ILUA 4COFA 4DV0T 2NTXA 3ANWA 2CXDA 4LFCT 3RLFF 1YD8G 3PUZF 2LSGA 5EK3A 2V7KA 4XZCA 2YN6A 2LLYA 4DO0A 4QH5A 4DV6T 2WWUA 3ZMSB 1SUMB 3RPUA 2LE8A 3E08A 2P9BA 5JR9C 2OA5A 5L3FB 2N2NA 2CLYC 1JNZA 2JPFA 5AQGB 4KHPT 3UQ4A 4AQFA 4CZZB 3RIAA 2H3RA 4IE4A 5CGMA 4IE6A 2CM0A 4JV5T 4UVAB 3AE6A 2DCFA 2A3DA 2BG9E 2QRXA 3H37A 2V7IA 5IHYA 3RGLA 4PFPA 3HKBE 4ILBA 1GQEA 1N33T 5LCYA 2BDEA 1S35A 3M65A 1KK7A 4QKNA 5BR8T 3R84B 5JREA 2WDVA 3KV6A 2C0SA 3LFMA 3PV0F 2WBLA 1U4QA 4CI2B 4O2BE 4H9QC 2DL1A 5LMUT 3ZPOA 4IDOA 2BKNA 4ZHQE 3J9X1 5DJQC 5AQRB 5IYZE 2E9XA 3O1HA 2MAWA 4X20E 1SA0E 5HEHA 5CB4E 2W67A 1W0AA 5HXHA 2CBJA 4U3CA 2BS3A 4HWFA 4UELA 4DR7T 3AA7B 2XQ9A 3JC6C 2V5CA 1T72A 2AE9A 2LSKA 2Q9QA 1J1JA 3KBTA 5IUXA 1D0ZA 4YTNA 4O4IE 2G0UA 4QWNB 1ZEEA 1NEKA 4JLEA 1VOMA 5J2UE 5FYMA 4JI7T 1LKXA 2IHR1 4DV3T 5AQUB 2BVMA 1OEDA 4UV8B 5L3BB 2E5LT 3RYFE 2UXDT 2X9XA 5L4EA 3AAEB 4HGAA 3Q9DA 2HPJA 3PJAA 4O4LE 2V6XA 5FY0A 2JIWA 5F5WA 1XMOT 5FXWA 2CHNA 1XDPA 2BVLA 2K48A 3OBVE 3AEBA 4DR4T 2PTFA 4ADZA 2KINB 5AQKB 1MMDA 3AVRA 2CMRA 2XAJB 3PUQA 1ZKEA 3AE1A 2YDSA 3LSVA 1FMVA 3AEGA 3CVRA 4BAYB 2UUCT 4GKKT 4TWHA 1OXZA 4YT0A 2H7OA 3C4XA 4JI1T 2CWOA 4I0UA 2A2FX 4FJOA 2XTLA 1D1AA 2C5KT 5ABGA 2KMFA 3IHRA 4H9SE 4EYYR 2WY2A 4V1Av 3QOFA 5HAXA 4DNDA 4KMCA 4ISSA 3RYCE 2YDQA 4TV8E 4H63V 2XSAA 3EHZA 3SRZA 4B3RT 3AEDA 2FJDA 3UFEA 2VKHA 3A5XA 4N78D 3I0OA 3L09A 2I59A 3TLVA 3PUGA 3AB3B 2NW9A 4PJNA 3ZCIA 3ESLA 3SS1A 2WU5A 3AE9A 4X1KE 3S4UA 3UT5E 4IL9A 4YXDA 5JDLA 4I55E 3NVOA 3ZC1A 4AISA 5LGNB 3K1SA 2XQ6A 4DBQA 4EXTA 1I6ZA 2BS4A 2WSSV 4DV5T 3ZYMA 2ODVA 1KFYA 4YSZA 3Q5WA 4GOUA 2EHOB 4EOZB 4JI3T 3ONJA 2UUBT 3EI0A 1T7SA 1XNRT 1MNDA 5HXRA 4HE8A 3AEAA 4OFZA 3AXJB 5AQNB 4HFVA 3RC8A 1I94T 5JH7E 2MTQA 2WP9A 3CX6B 4IDQA 4JUYA 2IMLA 3P4RA 4YHJA 3F57A 2XQ7A 4KHZF 4AKLA 3PTRB 2W62A 4YSXA 5J0ZA 2EHOC 1FJGT 2X51A 2QVAA 2VURA 4UIGA 5LNKA 5LA6E 1UGOA 3HL6A 2YKSA 1WYCA 3JC6D 3IA3A 1WFDA 4KX6A 3WI3A 1KF6A 4DVDA 4AQGA 3TLSA 2UXXB 1AJ3A 2IC6A 2K24A 2LHRA 1Y01A 3LK2B 1E1HB 1V9DA 4CN1A 4JI2T 4DR6T 2WWVA 3LG7A 4C91A 4HFIA 3ZN1B 3CQCB 1YQ3A 5JVDE 1S94A 3C98B 2UU9T 5HWYA 3U78A 4X62T 3QB5A 5ABEA 4X1IE 4CXYA 4ZZCA 2N1GA 3FB2A 5GONE 4JYAT 3KINB 3EDVA 5AFUL 3UUXB 3ZJ1A 3ZSSA 3Q2MA 4K0KT 4LMJA 2NP9A 4GK0E 2V7LA 3QK6A 2X9HA 5JTGA 3N9LA 5LP6E 3BK9A 3BQIA 3MXZA 4X64T 4C90A 5AQLB 3P4SA 1MIWA 3HKDE 3AE5A 3I9YA 1L0VA 3GN5B 5LGUB 2FJBA 5LYJE 4YHHT 2XSBA 3PUSA 2VVSA 5EZYE 3ZT6A 2JQQA 2VWAA 4BA9A 2KWIB 3DTOA 4WZXA 3AE3A 3RHWA 3RIUC 3F2EA 2WM9A 1YKHB 5JR9A 3TLUA 1XDOA 4LFAT 1IJ6A 3MACA 1HNXT 5HEGA 3NZQA 3ZT5A 3VR9A 1HNWT 4GK5E 4G63A 1HTJF 4IE7A 2Y6XA 3EDUA 2ZM8A 3P4QA 2XAQB 4QXBB 2VQET 5FVKA 3QC9A 3C51A 2V6YB 5L3EB 4XBFB 4X65T 2JQ9A 2WMOA 3OYXA 3KDSE 2CA5A 3ZMTB 1QLBA 1X9BA 4EYUA 3AEEA 4AQYT 3K3OA 4UEMA 2XQYA 2ACXA 3VKGA 4EZ4A 2ZLYA 2XY8B 4L0RA 2NR4A 4OYJA 1UX4A 1W09A 2A9UA 1EZ3A 3N2GE 2JQKA 5AQVB 1ZV4X 4PK4A 2XQ5A 5JRCA 3B57A 4GYRA 4P0BA 3HKEE 1W9RA 3ZEFB 2WAUA 5L3GB 4QX8B 4PK5A 4H9OC 3EVYA 3RC3A 5LBQB 4IL4A 3OVUA 4O4HE 1DU2A 3NBXX 3PURA 3LK3B 4EV6A 1FIOA 2BBJA 3DJBA 3PDYA 1HG5A 5HXEA 5JDGA 3Q5DA 3AVSA 2LSIA 3IF8B 5DQWA 4GYSA 1E2AA 3BQLA 2CHOA 2JMKA 3ANWB 3AA1B 5AQTB 3HR0A 3V5UA 4TUYE 3PUVF 1KNZA 2DWKA 1N34T 2HH7A 1N32T 2FJAA 1Z0PA 1MNEA 4WW0A 4WYVA 3RYIE 4CQIA 5AQOB 4IDNA 4ZI7E 4ZS2A 3T8OA 5ABFA 1BR0A 1VCTA 2ZM2A 3X1DA 4IDPA 2V5DA 5F3JA 4U7IA 4EEDA 3PE0A 2D9DA 5L2LA 3CIRA 2H7VC 3UUBA 5LHHB 5KMGP 3N9OA 1SHZC 1MIVA 2HN2A 2J62A 5JDHA 1HX1B 5FL1A 5LJMA 4EZHA 5LOVE 2VKJA 4ZI3C 4CI1B 4X5TA 1W0BA 2XZEA 5AQPB 3ONLC 5LMNT 2CPTA 4MALA 4NUUA 2E9XB 3IBPA 4AKGA 4UV9B 4G2AA 4DMVA 4HWCA 1MMGA 2KWHA 3C4WA 2GK9A 2X0HA 2YK0A 2Q9QB 2X0YA 4A97A 2X9YA 2FUPA 5JDMA 1X79A 3Q5XA 2VKOA 5AQSB 4EGWA 4CXXA 2E8IA 3FZKB 2YOEA 2ODUA 3RRWA 3CX7B 4X66T 4HFBA 3F31A 5E0OA 3TLWA 2PBIA 1O3XA 2PG8A 5HEUA 3N2OA 3M3ZB 3AE4A 3N9NA 3FZMB 1OEDB 2CEAA 5L4HA 3MZKB 3ZJ2A 3AA6B 4U33A 5LHIB 2L3LA 2YINA 3VKHA 4YFSA 5JDQA 5L47A 2QGSA 5FP3A 4H9PC 3KV5A 2UXCT 1KNPA 4F8HA 3MA9A 3AE2A 2X0LB 4YTPA 4H9RC 2VL0A 3CMLA 2XASB 2X67A 5HCJA 4ILAA 4I4TE 4NIQA 1OEDC 4MBQA 3LBXA 2EHOA 3VR8A 4CN4A 4IREA 1HR0T 3RH3A 2SPCA 1IJ5A 2W63A 3SOLA 4ZI2C 1XWMA 2XQAA 4DUYT 1N36T 4PW8A 3K8PC 4P09A 4Z8XA 2W4XA 1QUUA 1Y64B 3CK6A 2W2UA 4NUVA 2KSRA 3PU3A 2DHRA 2E2AA 1YW0A 1J5ET 2VK9A 4F6RC 1LRZA 2YU1A 2X66A 5L3DB 2I6HA 3O4XE 4YLHA 3PUWF 2LKGA 4HN9A 2K9AA 5CFBA 1HG2A 4DR2T 3ZMZB 4WBOA 3AE7A 1UK5A 3HKCE 3MKDA 1Z8UA 2DI4A 3EAMA 1B7TA 1HS7A 3D0TA 4AI6A 1D0YA 1ZHCA 3UU6A 1HNZT 4OHFA 1G73A 1US7B 5KDMC 3ABVA 2ZMAA 2HPLA 2UUAT 4ZS3A 4TWFA 5HCMA 5FXZA 4IDZA 3ETUA 3WAJA 4ERRA 5DABA 3ZLIA 1ZP0A 3CQGB 4X1YE 1FEWA 4YJ2E 3JADA 2IUBA 3JAFA 5AQFB 2KZ7B 2IDOB 5FKYA 1OEDE 3FXEB 3NWIA 2IIUA 3KVBA 4YTMA 5KX5E 1HCIA 4HWHA 1BR4A 3SFDA 4ASKA 5L3CB 3RIUA 4AKIA 4B6XA 3N5LA 3KV9A 4IT4A 1WR0A 3CQXC 2K5BB 3TLTA 4O2AE 4U2YA 2BG9A 3I0QA 4PJMA 2LOSA 1YKEB 3VHLA 2WZIA 4LF4T 3AAIA 4JEHB 1YQ4A 3KVAA 4DR5T 2XQ8A 5J1GA 4DR1T 2WDQA 4EB6E 4ZXLA 3L3PA 4DV2T 3AECA 3RQUA 2CCQA 3FBLA 4LFBT 4PK6A 2CXLA 4KUMB 4DV4T 2IC9A 1IBMT 1YXRA 3PUAA 1T8BA 2K3WA 3GMIA 3ZSTA 2MBGA 3UULA 3WAKA 3T1YT 3UU3A 3H3MA 1MIYA 4DMWA 2RPAA 2L9QA 4WBNE 2BBHA 3C50A 4JEUB 1XZYA 2LHNA 1M62A 4UF0A 2JQHA 3FZFB 2X68A 4HFDA 2LSYA 3AAAB 3RIFA 2M6BA 5LB7B 1MMAA 3ONXA 2LEHA 3UU8A 4QXCB 3ETVA 5H6RB 3UU5A 4DIDB 5JQGE 5CA0E 4O4JE 1D0XA 3L8RA 3MJXA 2DNXA 4UVBB 4TWDA 4LF7T 5FXXA 1D1CA 3IEEA 1T98A 3V5SA 1HX8A 5KXJA 4JI4T 3UUMA 2YU2A 3C4ZA 2D5UA 3P7IA 1UURA 2JMHA 5JR9B 4HWIB 2ES0A 3ZC0A 4JI5T 4DV7T 4TX5A 4ILCA 4XAXB 2WU2A 5FXVA 3O9XA 4EAHA 2W00A 3Q5EA 2CE7A 5HEJA 1WCRA 4QHOA 3OYZA 4DBRA 4JI8T 3RKOA 5FMNA 1KNRA 4U7YA 2WDRA 4IGUA 3FZLB 3T1HT 2VVNA 1IZNB 2I0MA 4CN6A 2C5JA 4GKJT 2H88A 3NZPA 2LM2A 2LRLA 1WYBA 1ZOYA 3KFWX 3FXDB 2EHOD 2XUEA 4IE5A 5ADXL 3PU8A 1LVKA 2IAKA 4HTEA 1M7KA 4PJJA 4HKAA 4Q25A 4LF6T 1UUSA 1G8XA 5LGTB 4K0UA 5AQQB 4L9IA 3ZMUB 1LVFA 4GIWA 3OTOT 1FMWA 2L8KA 2W61A 2CXFA 3CPZA 3H3AA 5LBMA 5JRCB 4UXNB 2MPKA 4NPPA 2D0UA 3LJCA 3KV4A 4QXHB 2V7JA 2NW8A 1D1BA 2VQFT 4LMLA 4UVCB 3P8CD 4IIJE 3HA4A 3N9QA 3I9WA 4WNKA 2WS3A 2JJ9A 2LM9A 4H63H 2RP4A 3A8YC 2R6GF 5LJNA 2J47A 3G06A 2HN1A 2V7MA 3C64A 3RI5A 3PUXF 2MOZA 4KBMB 5DQVA 3RYHE 4JBWF 2KXPB 1NAFA 3BQKA 5AQHB 5EK2A 4AQFC 1J5WA 1CHUA 5AQMB 3DP7A 1NENA 3UTKA 2B1EA 4UR9A 2LRKA 5HXSA 5C8YE 2W66A 4EIWA 5LHGB 2LT3A 5CA1E 4DR3T 3JAEA 3SWHA 3ZN0B 3N9PA 4KP3C 2F4VT 3VRBA 4B3MT 2RA1A 3HI2A 4HEAA 5ABFB 3GWHA 2VL8A 3E22E 1HFAA 2XAGB 3VRAA 2WB5A 4AKHA 3AA0B 1XMQT 4I50E 3CWZB 4M1PA 4JI0T 4LF8T 4B3TT 1JNRA 5HYAA 3AE8A 4ISTA 4HWDA 4OK0A 2PFVA 4TNVA 4ZEYA 2FBWA 2PJQA 4ANJA 2E9XC 5LXTE 3UUNA 4U2ZA 3I1AA 4KI0F 3P4PA 2XPKA 4LMKA 2OLTA 3LDQB 2KT9A 3FHNA 3PUYF 3NKZA 5H6QB 2Q9QC 4IE0A 3N2KE 1SE7A 5TAOA 2KLQA 4QH4A 2BKPA 2XQ3A 3ZMVB 4E7ZA 4ZZBA 1IBKT 2KNDA 4NXNT 4L5GA 4TV9E 3A7MA 4DV1T 3K3QC 3UQ7A 5FVLA 4TN7B 2D2SA 4A5XA 5FNVE 1U5PA 3LK42 5FY1A 4YJ3E 3AXJA 2IW5B 2NTYA 5HWXA 2CWYA 3OKQA 4J2CA 4CI3B 2HHHT 5C3JA 2X9WA 2BS2A 3UFGA 3ZYLA 2MYSA 3ZCJA 2M67A 2M6IA 4QX7B 3U3IA 2AXDS 2N9DA 3OPCA 3O1IA 4FI5A 2QA7A 5JDNA 1R8IA 4B3ST 4U31A 4H9NC 2LOPA 2VB6A 3FZHB 3N9MA 5M4YA 4LF9T 2NWBA 5FL0A 4I43B 3KBUA 1KEYA 4A56A 3LBXB 4OX9T 2Y48B 3GA8A 3W15B 2UXBT 2J1DG 4Z90A 2QYWA 3E0ZA 3P4WA 4HFEA 3FBZA 4O8SA 2LJLA 3SFEA 5EK4A 5HXCA 4U72A 4YSYA 4P0AA 2XM1A 4AXPA 3AEFA 4PNIA 5LG3A 5BMVE 2DWGA 1VCSA 4TNWA 4U74A 3ZKRA 4BJNA 5JDFA 2V1DB 5F8PA 2ZM6T 5IWAT 2W0GA 4IHJE 4AIUA 2H89A 4E7SA 5J2TE 2WQYA 2XAHB 4AKRB 4JI6T 1CUNA 2C5IT 3RRCA 2BKOA 1IBLT 2A72A 2JRKA 4HFCA 2CRBA 2ACZA 4MFRA 3ZT7A 4ZI3D 1BR2A 4PFOA 2LSJA 4LF5T 3J7Yq 3NRYA
chains in the Genus database with same CATH topology
1HX1B 3A8YC 5AQTB 5AQOB 4HWFA 4HWDA 5AQRB 1UK5A 1M62A 5AQNB 3M3ZB 5AQJB 3LDQB 5AQSB 1I6ZA 2D9DA 4HWCA 3FZMB 3FZFB 4HWHA 3FZKB 5AQKB 5AQVB 1UGOA 5AQGB 5AQQB 5AQUB 5AQLB 4HWIB 5AQPB 5AQHB 5AQFB 5AQIB 5AQMB 1M7KA 1T7SA 3FZHB 3FZLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HX1 B;  3A8Y C;  5AQT B;  5AQO B;  4HWF A;  4HWD A;  5AQR B;  1UK5 A;  1M62 A;  5AQN B;  3M3Z B;  5AQJ B;  3LDQ B;  5AQS B;  1I6Z A;  2D9D A;  4HWC A;  3FZM B;  3FZF B;  4HWH A;  3FZK B;  5AQK B;  5AQV B;  1UGO A;  5AQG B;  5AQQ B;  5AQU B;  5AQL B;  4HWI B;  5AQP B;  5AQH B;  5AQF B;  5AQI B;  5AQM B;  1M7K A;  1T7S A;  3FZH B;  3FZL B; 
#chains in the Genus database with same CATH topology
 4P1N A;  3GN5 A;  3MK7 C;  2XHE B;  1WR6 A;  3B13 A;  2VKD A;  2Y8D A;  2CBI A;  4TZ4 C;  2XAF B;  1MMN A;  2NOX A;  2BZB A;  1QSD A;  2FJE A;  4BJM A;  3QUJ A;  3QNU A;  4HFH A;  2WCA A;  3B5M A;  3RQW A;  3R6N A;  2YDR A;  4YY3 T;  2ZM0 A;  5ABH A;  2XM2 A;  2YEV C;  5ETW A;  2E9X D;  3TKL B;  1OWA A;  5AQJ B;  5LG4 A;  2WZH A;  3QB5 K;  1XNQ T;  5A1L A;  1WLX A;  2BG9 B;  4DUZ T;  3NRX A;  5AQI B;  3CX8 B;  1UX5 A;  3ZYK A;  2Q9Q D;  2V6Y A;  2V26 A;  5CJ5 A;  1BR1 A;  5HEO A;  4A98 A;  3K3N A;  4CXW A;  3JCF A;  1WRD A;  5C2T A;  2XJ7 A;  3RKG A;  2UXN B;  2LKH A;  1HF8 A;  2VAS A;  2DLR A;  2Z6E A;  2NW7 A;  1NWM X;  2BG9 C;  4EEB A;  4NXM T;  1UCU A;  4QH1 A;  4OYK A;  2WMN A;  3RX6 A;  1E7P A;  5FY7 A;  4PJL A;  2E5V A;  4MHC A;  3UU4 A;  3VU7 H;  1IAP A;  4PAG A;  3P50 A;  2J4G A;  4MLK A;  2XQ4 A;  1VRB A;  2OV9 A;  4ZI2 D;  3CKD A;  3EAB A;  3RF1 A;  3EUH A;  4Z91 A;  2CLY B;  3OJA A;  2V8S V;  2D0T A;  3PJA J;  2B76 A;  4ZOL E;  4UF0 B;  3O1J A;  1H7C A;  3L39 A;  4ILU A;  4COF A;  4DV0 T;  2NTX A;  3ANW A;  2CXD A;  4LFC T;  3RLF F;  1YD8 G;  3PUZ F;  2LSG A;  5EK3 A;  2V7K A;  4XZC A;  2YN6 A;  2LLY A;  4DO0 A;  4QH5 A;  4DV6 T;  2WWU A;  3ZMS B;  1SUM B;  3RPU A;  2LE8 A;  3E08 A;  2P9B A;  5JR9 C;  2OA5 A;  5L3F B;  2N2N A;  2CLY C;  1JNZ A;  2JPF A;  5AQG B;  4KHP T;  3UQ4 A;  4AQF A;  4CZZ B;  3RIA A;  2H3R A;  4IE4 A;  5CGM A;  4IE6 A;  2CM0 A;  4JV5 T;  4UVA B;  3AE6 A;  2DCF A;  2A3D A;  2BG9 E;  2QRX A;  3H37 A;  2V7I A;  5IHY A;  3RGL A;  4PFP A;  3HKB E;  4ILB A;  1GQE A;  1N33 T;  5LCY A;  2BDE A;  1S35 A;  3M65 A;  1KK7 A;  4QKN A;  5BR8 T;  3R84 B;  5JRE A;  2WDV A;  3KV6 A;  2C0S A;  3LFM A;  3PV0 F;  2WBL A;  1U4Q A;  4CI2 B;  4O2B E;  4H9Q C;  2DL1 A;  5LMU T;  3ZPO A;  4IDO A;  2BKN A;  4ZHQ E;  3J9X 1;  5DJQ C;  5AQR B;  5IYZ E;  2E9X A;  3O1H A;  2MAW A;  4X20 E;  1SA0 E;  5HEH A;  5CB4 E;  2W67 A;  1W0A A;  5HXH A;  2CBJ A;  4U3C A;  2BS3 A;  4HWF A;  4UEL A;  4DR7 T;  3AA7 B;  2XQ9 A;  3JC6 C;  2V5C A;  1T72 A;  2AE9 A;  2LSK A;  2Q9Q A;  1J1J A;  3KBT A;  5IUX A;  1D0Z A;  4YTN A;  4O4I E;  2G0U A;  4QWN B;  1ZEE A;  1NEK A;  4JLE A;  1VOM A;  5J2U E;  5FYM A;  4JI7 T;  1LKX A;  2IHR 1;  4DV3 T;  5AQU B;  2BVM A;  1OED A;  4UV8 B;  5L3B B;  2E5L T;  3RYF E;  2UXD T;  2X9X A;  5L4E A;  3AAE B;  4HGA A;  3Q9D A;  2HPJ A;  3PJA A;  4O4L E;  2V6X A;  5FY0 A;  2JIW A;  5F5W A;  1XMO T;  5FXW A;  2CHN A;  1XDP A;  2BVL A;  2K48 A;  3OBV E;  3AEB A;  4DR4 T;  2PTF A;  4ADZ A;  2KIN B;  5AQK B;  1MMD A;  3AVR A;  2CMR A;  2XAJ B;  3PUQ A;  1ZKE A;  3AE1 A;  2YDS A;  3LSV A;  1FMV A;  3AEG A;  3CVR A;  4BAY B;  2UUC T;  4GKK T;  4TWH A;  1OXZ A;  4YT0 A;  2H7O A;  3C4X A;  4JI1 T;  2CWO A;  4I0U A;  2A2F X;  4FJO A;  2XTL A;  1D1A A;  2C5K T;  5ABG A;  2KMF A;  3IHR A;  4H9S E;  4EYY R;  2WY2 A;  4V1A v;  3QOF A;  5HAX A;  4DND A;  4KMC A;  4ISS A;  3RYC E;  2YDQ A;  4TV8 E;  4H63 V;  2XSA A;  3EHZ A;  3SRZ A;  4B3R T;  3AED A;  2FJD A;  3UFE A;  2VKH A;  3A5X A;  4N78 D;  3I0O A;  3L09 A;  2I59 A;  3TLV A;  3PUG A;  3AB3 B;  2NW9 A;  4PJN A;  3ZCI A;  3ESL A;  3SS1 A;  2WU5 A;  3AE9 A;  4X1K E;  3S4U A;  3UT5 E;  4IL9 A;  4YXD A;  5JDL A;  4I55 E;  3NVO A;  3ZC1 A;  4AIS A;  5LGN B;  3K1S A;  2XQ6 A;  4DBQ A;  4EXT A;  1I6Z A;  2BS4 A;  2WSS V;  4DV5 T;  3ZYM A;  2ODV A;  1KFY A;  4YSZ A;  3Q5W A;  4GOU A;  2EHO B;  4EOZ B;  4JI3 T;  3ONJ A;  2UUB T;  3EI0 A;  1T7S A;  1XNR T;  1MND A;  5HXR A;  4HE8 A;  3AEA A;  4OFZ A;  3AXJ B;  5AQN B;  4HFV A;  3RC8 A;  1I94 T;  5JH7 E;  2MTQ A;  2WP9 A;  3CX6 B;  4IDQ A;  4JUY A;  2IML A;  3P4R A;  4YHJ A;  3F57 A;  2XQ7 A;  4KHZ F;  4AKL A;  3PTR B;  2W62 A;  4YSX A;  5J0Z A;  2EHO C;  1FJG T;  2X51 A;  2QVA A;  2VUR A;  4UIG A;  5LNK A;  5LA6 E;  1UGO A;  3HL6 A;  2YKS A;  1WYC A;  3JC6 D;  3IA3 A;  1WFD A;  4KX6 A;  3WI3 A;  1KF6 A;  4DVD A;  4AQG A;  3TLS A;  2UXX B;  1AJ3 A;  2IC6 A;  2K24 A;  2LHR A;  1Y01 A;  3LK2 B;  1E1H B;  1V9D A;  4CN1 A;  4JI2 T;  4DR6 T;  2WWV A;  3LG7 A;  4C91 A;  4HFI A;  3ZN1 B;  3CQC B;  1YQ3 A;  5JVD E;  1S94 A;  3C98 B;  2UU9 T;  5HWY A;  3U78 A;  4X62 T;  3QB5 A;  5ABE A;  4X1I E;  4CXY A;  4ZZC A;  2N1G A;  3FB2 A;  5GON E;  4JYA T;  3KIN B;  3EDV A;  5AFU L;  3UUX B;  3ZJ1 A;  3ZSS A;  3Q2M A;  4K0K T;  4LMJ A;  2NP9 A;  4GK0 E;  2V7L A;  3QK6 A;  2X9H A;  5JTG A;  3N9L A;  5LP6 E;  3BK9 A;  3BQI A;  3MXZ A;  4X64 T;  4C90 A;  5AQL B;  3P4S A;  1MIW A;  3HKD E;  3AE5 A;  3I9Y A;  1L0V A;  3GN5 B;  5LGU B;  2FJB A;  5LYJ E;  4YHH T;  2XSB A;  3PUS A;  2VVS A;  5EZY E;  3ZT6 A;  2JQQ A;  2VWA A;  4BA9 A;  2KWI B;  3DTO A;  4WZX A;  3AE3 A;  3RHW A;  3RIU C;  3F2E A;  2WM9 A;  1YKH B;  5JR9 A;  3TLU A;  1XDO A;  4LFA T;  1IJ6 A;  3MAC A;  1HNX T;  5HEG A;  3NZQ A;  3ZT5 A;  3VR9 A;  1HNW T;  4GK5 E;  4G63 A;  1HTJ F;  4IE7 A;  2Y6X A;  3EDU A;  2ZM8 A;  3P4Q A;  2XAQ B;  4QXB B;  2VQE T;  5FVK A;  3QC9 A;  3C51 A;  2V6Y B;  5L3E B;  4XBF B;  4X65 T;  2JQ9 A;  2WMO A;  3OYX A;  3KDS E;  2CA5 A;  3ZMT B;  1QLB A;  1X9B A;  4EYU A;  3AEE A;  4AQY T;  3K3O A;  4UEM A;  2XQY A;  2ACX A;  3VKG A;  4EZ4 A;  2ZLY A;  2XY8 B;  4L0R A;  2NR4 A;  4OYJ A;  1UX4 A;  1W09 A;  2A9U A;  1EZ3 A;  3N2G E;  2JQK A;  5AQV B;  1ZV4 X;  4PK4 A;  2XQ5 A;  5JRC A;  3B57 A;  4GYR A;  4P0B A;  3HKE E;  1W9R A;  3ZEF B;  2WAU A;  5L3G B;  4QX8 B;  4PK5 A;  4H9O C;  3EVY A;  3RC3 A;  5LBQ B;  4IL4 A;  3OVU A;  4O4H E;  1DU2 A;  3NBX X;  3PUR A;  3LK3 B;  4EV6 A;  1FIO A;  2BBJ A;  3DJB A;  3PDY A;  1HG5 A;  5HXE A;  5JDG A;  3Q5D A;  3AVS A;  2LSI A;  3IF8 B;  5DQW A;  4GYS A;  1E2A A;  3BQL A;  2CHO A;  2JMK A;  3ANW B;  3AA1 B;  5AQT B;  3HR0 A;  3V5U A;  4TUY E;  3PUV F;  1KNZ A;  2DWK A;  1N34 T;  2HH7 A;  1N32 T;  2FJA A;  1Z0P A;  1MNE A;  4WW0 A;  4WYV A;  3RYI E;  4CQI A;  5AQO B;  4IDN A;  4ZI7 E;  4ZS2 A;  3T8O A;  5ABF A;  1BR0 A;  1VCT A;  2ZM2 A;  3X1D A;  4IDP A;  2V5D A;  5F3J A;  4U7I A;  4EED A;  3PE0 A;  2D9D A;  5L2L A;  3CIR A;  2H7V C;  3UUB A;  5LHH B;  5KMG P;  3N9O A;  1SHZ C;  1MIV A;  2HN2 A;  2J62 A;  5JDH A;  1HX1 B;  5FL1 A;  5LJM A;  4EZH A;  5LOV E;  2VKJ A;  4ZI3 C;  4CI1 B;  4X5T A;  1W0B A;  2XZE A;  5AQP B;  3ONL C;  5LMN T;  2CPT A;  4MAL A;  4NUU A;  2E9X B;  3IBP A;  4AKG A;  4UV9 B;  4G2A A;  4DMV A;  4HWC A;  1MMG A;  2KWH A;  3C4W A;  2GK9 A;  2X0H A;  2YK0 A;  2Q9Q B;  2X0Y A;  4A97 A;  2X9Y A;  2FUP A;  5JDM A;  1X79 A;  3Q5X A;  2VKO A;  5AQS B;  4EGW A;  4CXX A;  2E8I A;  3FZK B;  2YOE A;  2ODU A;  3RRW A;  3CX7 B;  4X66 T;  4HFB A;  3F31 A;  5E0O A;  3TLW A;  2PBI A;  1O3X A;  2PG8 A;  5HEU A;  3N2O A;  3M3Z B;  3AE4 A;  3N9N A;  3FZM B;  1OED B;  2CEA A;  5L4H A;  3MZK B;  3ZJ2 A;  3AA6 B;  4U33 A;  5LHI B;  2L3L A;  2YIN A;  3VKH A;  4YFS A;  5JDQ A;  5L47 A;  2QGS A;  5FP3 A;  4H9P C;  3KV5 A;  2UXC T;  1KNP A;  4F8H A;  3MA9 A;  3AE2 A;  2X0L B;  4YTP A;  4H9R C;  2VL0 A;  3CML A;  2XAS B;  2X67 A;  5HCJ A;  4ILA A;  4I4T E;  4NIQ A;  1OED C;  4MBQ A;  3LBX A;  2EHO A;  3VR8 A;  4CN4 A;  4IRE A;  1HR0 T;  3RH3 A;  2SPC A;  1IJ5 A;  2W63 A;  3SOL A;  4ZI2 C;  1XWM A;  2XQA A;  4DUY T;  1N36 T;  4PW8 A;  3K8P C;  4P09 A;  4Z8X A;  2W4X A;  1QUU A;  1Y64 B;  3CK6 A;  2W2U A;  4NUV A;  2KSR A;  3PU3 A;  2DHR A;  2E2A A;  1YW0 A;  1J5E T;  2VK9 A;  4F6R C;  1LRZ A;  2YU1 A;  2X66 A;  5L3D B;  2I6H A;  3O4X E;  4YLH A;  3PUW F;  2LKG A;  4HN9 A;  2K9A A;  5CFB A;  1HG2 A;  4DR2 T;  3ZMZ B;  4WBO A;  3AE7 A;  1UK5 A;  3HKC E;  3MKD A;  1Z8U A;  2DI4 A;  3EAM A;  1B7T A;  1HS7 A;  3D0T A;  4AI6 A;  1D0Y A;  1ZHC A;  3UU6 A;  1HNZ T;  4OHF A;  1G73 A;  1US7 B;  5KDM C;  3ABV A;  2ZMA A;  2HPL A;  2UUA T;  4ZS3 A;  4TWF A;  5HCM A;  5FXZ A;  4IDZ A;  3ETU A;  3WAJ A;  4ERR A;  5DAB A;  3ZLI A;  1ZP0 A;  3CQG B;  4X1Y E;  1FEW A;  4YJ2 E;  3JAD A;  2IUB A;  3JAF A;  5AQF B;  2KZ7 B;  2IDO B;  5FKY A;  1OED E;  3FXE B;  3NWI A;  2IIU A;  3KVB A;  4YTM A;  5KX5 E;  1HCI A;  4HWH A;  1BR4 A;  3SFD A;  4ASK A;  5L3C B;  3RIU A;  4AKI A;  4B6X A;  3N5L A;  3KV9 A;  4IT4 A;  1WR0 A;  3CQX C;  2K5B B;  3TLT A;  4O2A E;  4U2Y A;  2BG9 A;  3I0Q A;  4PJM A;  2LOS A;  1YKE B;  3VHL A;  2WZI A;  4LF4 T;  3AAI A;  4JEH B;  1YQ4 A;  3KVA A;  4DR5 T;  2XQ8 A;  5J1G A;  4DR1 T;  2WDQ A;  4EB6 E;  4ZXL A;  3L3P A;  4DV2 T;  3AEC A;  3RQU A;  2CCQ A;  3FBL A;  4LFB T;  4PK6 A;  2CXL A;  4KUM B;  4DV4 T;  2IC9 A;  1IBM T;  1YXR A;  3PUA A;  1T8B A;  2K3W A;  3GMI A;  3ZST A;  2MBG A;  3UUL A;  3WAK A;  3T1Y T;  3UU3 A;  3H3M A;  1MIY A;  4DMW A;  2RPA A;  2L9Q A;  4WBN E;  2BBH A;  3C50 A;  4JEU B;  1XZY A;  2LHN A;  1M62 A;  4UF0 A;  2JQH A;  3FZF B;  2X68 A;  4HFD A;  2LSY A;  3AAA B;  3RIF A;  2M6B A;  5LB7 B;  1MMA A;  3ONX A;  2LEH A;  3UU8 A;  4QXC B;  3ETV A;  5H6R B;  3UU5 A;  4DID B;  5JQG E;  5CA0 E;  4O4J E;  1D0X A;  3L8R A;  3MJX A;  2DNX A;  4UVB B;  4TWD A;  4LF7 T;  5FXX A;  1D1C A;  3IEE A;  1T98 A;  3V5S A;  1HX8 A;  5KXJ A;  4JI4 T;  3UUM A;  2YU2 A;  3C4Z A;  2D5U A;  3P7I A;  1UUR A;  2JMH A;  5JR9 B;  4HWI B;  2ES0 A;  3ZC0 A;  4JI5 T;  4DV7 T;  4TX5 A;  4ILC A;  4XAX B;  2WU2 A;  5FXV A;  3O9X A;  4EAH A;  2W00 A;  3Q5E A;  2CE7 A;  5HEJ A;  1WCR A;  4QHO A;  3OYZ A;  4DBR A;  4JI8 T;  3RKO A;  5FMN A;  1KNR A;  4U7Y A;  2WDR A;  4IGU A;  3FZL B;  3T1H T;  2VVN A;  1IZN B;  2I0M A;  4CN6 A;  2C5J A;  4GKJ T;  2H88 A;  3NZP A;  2LM2 A;  2LRL A;  1WYB A;  1ZOY A;  3KFW X;  3FXD B;  2EHO D;  2XUE A;  4IE5 A;  5ADX L;  3PU8 A;  1LVK A;  2IAK A;  4HTE A;  1M7K A;  4PJJ A;  4HKA A;  4Q25 A;  4LF6 T;  1UUS A;  1G8X A;  5LGT B;  4K0U A;  5AQQ B;  4L9I A;  3ZMU B;  1LVF A;  4GIW A;  3OTO T;  1FMW A;  2L8K A;  2W61 A;  2CXF A;  3CPZ A;  3H3A A;  5LBM A;  5JRC B;  4UXN B;  2MPK A;  4NPP A;  2D0U A;  3LJC A;  3KV4 A;  4QXH B;  2V7J A;  2NW8 A;  1D1B A;  2VQF T;  4LML A;  4UVC B;  3P8C D;  4IIJ E;  3HA4 A;  3N9Q A;  3I9W A;  4WNK A;  2WS3 A;  2JJ9 A;  2LM9 A;  4H63 H;  2RP4 A;  3A8Y C;  2R6G F;  5LJN A;  2J47 A;  3G06 A;  2HN1 A;  2V7M A;  3C64 A;  3RI5 A;  3PUX F;  2MOZ A;  4KBM B;  5DQV A;  3RYH E;  4JBW F;  2KXP B;  1NAF A;  3BQK A;  5AQH B;  5EK2 A;  4AQF C;  1J5W A;  1CHU A;  5AQM B;  3DP7 A;  1NEN A;  3UTK A;  2B1E A;  4UR9 A;  2LRK A;  5HXS A;  5C8Y E;  2W66 A;  4EIW A;  5LHG B;  2LT3 A;  5CA1 E;  4DR3 T;  3JAE A;  3SWH A;  3ZN0 B;  3N9P A;  4KP3 C;  2F4V T;  3VRB A;  4B3M T;  2RA1 A;  3HI2 A;  4HEA A;  5ABF B;  3GWH A;  2VL8 A;  3E22 E;  1HFA A;  2XAG B;  3VRA A;  2WB5 A;  4AKH A;  3AA0 B;  1XMQ T;  4I50 E;  3CWZ B;  4M1P A;  4JI0 T;  4LF8 T;  4B3T T;  1JNR A;  5HYA A;  3AE8 A;  4IST A;  4HWD A;  4OK0 A;  2PFV A;  4TNV A;  4ZEY A;  2FBW A;  2PJQ A;  4ANJ A;  2E9X C;  5LXT E;  3UUN A;  4U2Z A;  3I1A A;  4KI0 F;  3P4P A;  2XPK A;  4LMK A;  2OLT A;  3LDQ B;  2KT9 A;  3FHN A;  3PUY F;  3NKZ A;  5H6Q B;  2Q9Q C;  4IE0 A;  3N2K E;  1SE7 A;  5TAO A;  2KLQ A;  4QH4 A;  2BKP A;  2XQ3 A;  3ZMV B;  4E7Z A;  4ZZB A;  1IBK T;  2KND A;  4NXN T;  4L5G A;  4TV9 E;  3A7M A;  4DV1 T;  3K3Q C;  3UQ7 A;  5FVL A;  4TN7 B;  2D2S A;  4A5X A;  5FNV E;  1U5P A;  3LK4 2;  5FY1 A;  4YJ3 E;  3AXJ A;  2IW5 B;  2NTY A;  5HWX A;  2CWY A;  3OKQ A;  4J2C A;  4CI3 B;  2HHH T;  5C3J A;  2X9W A;  2BS2 A;  3UFG A;  3ZYL A;  2MYS A;  3ZCJ A;  2M67 A;  2M6I A;  4QX7 B;  3U3I A;  2AXD S;  2N9D A;  3OPC A;  3O1I A;  4FI5 A;  2QA7 A;  5JDN A;  1R8I A;  4B3S T;  4U31 A;  4H9N C;  2LOP A;  2VB6 A;  3FZH B;  3N9M A;  5M4Y A;  4LF9 T;  2NWB A;  5FL0 A;  4I43 B;  3KBU A;  1KEY A;  4A56 A;  3LBX B;  4OX9 T;  2Y48 B;  3GA8 A;  3W15 B;  2UXB T;  2J1D G;  4Z90 A;  2QYW A;  3E0Z A;  3P4W A;  4HFE A;  3FBZ A;  4O8S A;  2LJL A;  3SFE A;  5EK4 A;  5HXC A;  4U72 A;  4YSY A;  4P0A A;  2XM1 A;  4AXP A;  3AEF A;  4PNI A;  5LG3 A;  5BMV E;  2DWG A;  1VCS A;  4TNW A;  4U74 A;  3ZKR A;  4BJN A;  5JDF A;  2V1D B;  5F8P A;  2ZM6 T;  5IWA T;  2W0G A;  4IHJ E;  4AIU A;  2H89 A;  4E7S A;  5J2T E;  2WQY A;  2XAH B;  4AKR B;  4JI6 T;  1CUN A;  2C5I T;  3RRC A;  2BKO A;  1IBL T;  2A72 A;  2JRK A;  4HFC A;  2CRB A;  2ACZ A;  4MFR A;  3ZT7 A;  4ZI3 D;  1BR2 A;  4PFO A;  2LSJ A;  4LF5 T;  3J7Y q;  3NRY A; 
#chains in the Genus database with same CATH homology
 1HX1 B;  3A8Y C;  5AQT B;  5AQO B;  4HWF A;  4HWD A;  5AQR B;  1UK5 A;  1M62 A;  5AQN B;  3M3Z B;  5AQJ B;  3LDQ B;  5AQS B;  1I6Z A;  2D9D A;  4HWC A;  3FZM B;  3FZF B;  4HWH A;  3FZK B;  5AQK B;  5AQV B;  1UGO A;  5AQG B;  5AQQ B;  5AQU B;  5AQL B;  4HWI B;  5AQP B;  5AQH B;  5AQF B;  5AQI B;  5AQM B;  1M7K A;  1T7S A;  3FZH B;  3FZL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...