5AQVB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
total genus 47
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqvB00
1M7KA 1HX1B 1UGOA 5AQHB 3A8YC 3FZFB 3FZMB 5AQSB 5AQRB 4HWCA 5AQUB 5AQTB 5AQLB 5AQPB 5AQQB 1UK5A 2D9DA 3FZLB 5AQGB 4HWDA 5AQKB 5AQNB 1I6ZA 5AQIB 1T7SA 3FZKB 3LDQB 5AQMB 4HWFA 5AQVB 1M62A 5AQOB 3M3ZB 3FZHB 4HWIB 5AQJB 4HWHA 5AQFB
chains in the Genus database with same CATH superfamily
4DO0A 1E1HB 3OPCA 3P4RA 3CWZB 4PFPA 2LRKA 5GONE 4UIGA 3HR0A 3RC3A 1D0XA 5FNVE 4GKJT 1I6ZA 4YT0A 1LVKA 1SE7A 2FJAA 4JI2T 3C64A 2E5LT 2J4GA 2JQHA 5HEJA 1NWMX 4BA9A 3KVAA 4LFCT 3VR8A 1BR2A 3QB5K 1MNEA 2LOSA 3CX8B 4JI1T 4IDQA 2CRBA 2MAWA 3NKZA 1SUMB 4N78D 1YW0A 5JDMA 1CUNA 1BR0A 5FL0A 2XUEA 2WU2A 3PJAJ 1IJ6A 1U5PA 5FY7A 3LK3B 5LJNA 1OXZA 4QHOA 4H9QC 2BKNA 5AQLB 4X1KE 4ZZBA 2JMHA 2MPKA 4ZI2D 1KF6A 3KDSE 3ZSSA 4WZXA 5HXEA 4YJ3E 1W0BA 4ZS2A 3BK9A 4JI6T 1UGOA 1B7TA 3ZMUB 2X66A 5AQTB 4DUYT 1LKXA 3UUXB 4CN4A 2UXNB 1FMWA 3UU4A 3VKGA 1HNZT 3FHNA 4B3ST 2BS4A 4MHCA 3ZC1A 3KV4A 5HXRA 3JAFA 4QH5A 2LRLA 5JTGA 2X68A 4HFBA 2WY2A 1MMGA 4PW8A 4X64T 3FXEB 2ZMAA 4G63A 2BKPA 3U78A 2FJDA 3GN5A 3AE1A 4UEMA 2VKOA 2MYSA 3LK42 3ZCJA 3RQWA 1XDOA 4HN9A 4ILUA 1KNPA 2C5KT 4TNWA 4CN1A 4XZCA 2UXDT 3TLTA 2XQ8A 3EHZA 3NZPA 2WDQA 4UF0A 2EHOC 3ZC0A 3HI2A 3ETUA 4BJNA 2UXXB 2RPAA 2LOPA 4AKLA 2H7OA 2Q9QC 4UF0B 2UUAT 2CM0A 2D9DA 5HYAA 2BKOA 3AEGA 3UUNA 3PU8A 2WDVA 5AQOB 4IE4A 2V26A 4DV4T 4Z90A 4X62T 5LJMA 4AKHA 3AE3A 2YEVC 1HF8A 5JRCA 5JDNA 4GK5E 5AQKB 1UX4A 3FBZA 2DI4A 2VKDA 4JLEA 3PUGA 3K1SA 1HNWT 2NW8A 5JRCB 1MIVA 2KMFA 2Z6EA 1N32T 2W00A 3UU3A 2YDRA 3R6NA 3P50A 1XNRT 4HFEA 5FYMA 2LE8A 5DQWA 3RIFA 1KEYA 3HKCE 2BBHA 4U2YA 4O4LE 3PTRB 2K3WA 3J9X1 1R8IA 3LJCA 4MFRA 2QYWA 3VR9A 4JBWF 4ADZA 4M1PA 3ZJ2A 4AISA 1VOMA 2DHRA 4ZXLA 2NW7A 3GMIA 2I0MA 1S35A 3RYCE 1HS7A 3AE7A 5L3DB 3CIRA 2C0SA 5HEUA 3GA8A 2CLYB 5LP6E 4QH1A 3D0TA 2XQ3A 3O9XA 4DBQA 2L3LA 2H3RA 4AI6A 4B3RT 2VQFT 5F8PA 5JH7E 3I9WA 1UX5A 2X9XA 5HAXA 3MZKB 4U31A 3N9LA 2V7MA 4YSYA 1KNZA 5L3EB 5JDHA 2BBJA 5J0ZA 4TV8E 3JC6D 2VVSA 3PUWF 3LDQB 3ZCIA 2CWOA 4I4TE 3JC6C 1KNRA 4YSZA 4GK0E 4KI0F 2ACXA 5LHHB 5HEHA 5HCJA 1BR4A 4TNVA 5J2TE 4AQYT 3R84B 3CKDA 4HKAA 4PAGA 5ABEA 1W09A 4PJMA 2DWKA 3CX7B 3ZYLA 2JRKA 3EDVA 4A56A 4UV8B 4YHHT 1HG5A 1E2AA 3ONXA 4JYAT 1IBLT 2CLYC 3CPZA 2UUBT 2WB5A 4ZS3A 2CXFA 1ZHCA 4ZZCA 2HN1A 1US7B 3KVBA 4IE5A 2WMOA 3M65A 3K3QC 4HFHA 5KMGP 2XTLA 3ZN0B 1G8XA 3G06A 4KHZF 3PV0F 2SPCA 3VKHA 3LBXA 3ZSTA 2XAJB 3ZEFB 2XQ6A 2XQ7A 5ABFB 3EUHA 3LBXB 3UTKA 3ZMTB 5AQPB 5KDMC 2QVAA 3SFEA 2WM9A 5LBMA 4B3MT 3SS1A 3CVRA 5BR8T 4LF8T 2D5UA 2M6IA 5JQGE 1HFAA 3AE8A 3OKQA 4YFSA 4O4IE 2CPTA 5L3GB 5LOVE 2VL8A 2XJ7A 4DR6T 4X65T 5HXCA 3L3PA 4C90A 5LCYA 2CA5A 1W0AA 3FZKB 4LF7T 4TN7B 3PUXF 1UUSA 3P4WA 3FBLA 1HX1B 2X9YA 3ZT6A 4F6RC 4LMLA 1GQEA 1ZV4X 3LFMA 3P4PA 1J1JA 3KBUA 3W15B 5L47A 2YOEA 3FZLB 3FXDB 5HWYA 4DV3T 4MALA 3IF8B 4JI3T 2JQKA 2K48A 4QKNA 4NUVA 4YHJA 2P9BA 4E7ZA 4DV1T 3C4WA 4F8HA 5DQVA 1XDPA 3AE4A 2KWHA 3PUZF 1ZEEA 4QWNB 2YDQA 4LMJA 2E5VA 3PJAA 5IYZE 3AEFA 4Q25A 3ZMZB 2DL1A 3LG7A 5LBQB 2H89A 1S94A 5LYJE 4DV2T 3PUAA 2X9WA 4JEHB 2XQ4A 2PFVA 2EHOA 4HFVA 2ODVA 4IGUA 4GYSA 4J2CA 3IEEA 1D0ZA 4EOZB 3O1IA 2X9HA 2WQYA 3Q5DA 5KXJA 5L4EA 1YQ4A 3NBXX 4X66T 2Q9QA 3SOLA 2EHOB 3UUMA 2NOXA 3L09A 3AEAA 2LSJA 3VU7H 2BVMA 1YXRA 4P1NA 4B6XA 1D1BA 5FXWA 5M4YA 2Q9QB 2N9DA 2G0UA 1YD8G 4O2BE 3ONLC 3V5UA 2V7LA 2VASA 2D0UA 2W62A 2HPLA 1UURA 1MNDA 2CE7A 2X51A 2W4XA 4H9PC 4NXNT 2J47A 3T8OA 4EEBA 4ILCA 2XQAA 5CJ5A 4X1IE 4ZI2C 3AE9A 3ZJ1A 5C8YE 4LF4T 2YKSA 3RIUA 2E8IA 5F3JA 3I0QA 2PTFA 2BG9E 2K24A 4DMWA 3RYFE 3Q5XA 1G73A 4O4JE 4DBRA 2ZLYA 3C50A 2JPFA 4X5TA 2JQ9A 4MBQA 3H3AA 2NTXA 2XZEA 2W67A 1WR0A 2NR4A 3AEDA 2UXBT 2E9XD 3QC9A 2LEHA 1U4QA 4ZI3D 2KSRA 4HWCA 4IE6A 1W9RA 3AA7B 3AVSA 5ADXL 4IHJE 3UQ7A 1T98A 2C5JA 2K9AA 5AQFB 4PK6A 3JCFA 2VQET 4U72A 5BMVE 3HKDE 3UU8A 3IBPA 3MJXA 2BS3A 1HX8A 3RQUA 5IHYA 1N34T 4H9OC 4HTEA 5CB4E 1MMAA 4HWHA 3ONJA 3RIAA 1SA0E 3NWIA 3QK6A 1QUUA 2JIWA 2BG9C 3PURA 3PUQA 4QXCB 2Y6XA 4O2AE 2YINA 1ZP0A 2WSSV 3AECA 3IA3A 4AQGA 4NUUA 5LHGB 5LMNT 3I0OA 4BJMA 2IIUA 1FMVA 5KX5E 3PUSA 2RA1A 2KZ7B 3FZHB 3RHWA 4CXYA 2V5CA 3AA6B 1Z8UA 4DMVA 2LKGA 3RIUC 3QB5A 4DUZT 2IW5B 3MKDA 1T7SA 5AFUL 3UU6A 2UUCT 4B3TT 4FI5A 4CXWA 3UU5A 2M6BA 2XAGB 2FUPA 1M7KA 4LFAT 4OYKA 4X1YE 3VRAA 4GIWA 4AQFC 4GYRA 3AVRA 1D1AA 2IAKA 4CZZB 5FXVA 4C91A 4G2AA 5FL1A 4FJOA 4QX7B 4OFZA 2H88A 3ANWA 3RH3A 2I59A 4H63H 4MLKA 2Y48B 5J2UE 4IDNA 3C98B 3FZMB 3UFEA 1H7CA 3RKGA 2XAQB 4ASKA 1WLXA 3KINB 3ANWB 2LSIA 4TZ4C 3MA9A 3RYIE 3I1AA 4H9NC 4LFBT 1VRBA 4GKKT 4OHFA 1J5WA 1LRZA 2WZIA 4NPPA 1XMOT 3OYXA 2CCQA 2M67A 4TWDA 5FMNA 1XNQT 2LHRA 2D2SA 3BQIA 5LGTB 3RPUA 2VVNA 5AQSB 1Z0PA 2BVLA 2J1DG 1FIOA 5AQUB 5JDGA 4JI7T 4IE0A 4PJJA 1QSDA 5LHIB 1N36T 3P4QA 1LVFA 4JUYA 3CMLA 3GWHA 2QRXA 4U3CA 5JVDE 3MK7C 1T8BA 2CBJA 4HFIA 4AIUA 4NIQA 3QNUA 5L2LA 2V6YA 3PDYA 3E22E 1NEKA 2IC9A 1WFDA 1OEDB 4ILAA 5LG4A 5L3FB 3N9PA 4AKGA 1CHUA 2XM2A 4AKRB 4OYJA 2V6YB 3C51A 2QGSA 1HG2A 1O3XA 4QXBB 2RP4A 4KMCA 3NZQA 5DABA 3C4XA 4DR2T 2CXDA 1MIWA 5LA6E 2X67A 4AKIA 2IUBA 3LK2B 5JR9C 1OEDE 3N2KE 5EK4A 3CQCB 3VHLA 3RF1A 3H3MA 3N2OA 4CQIA 3ZYKA 3UQ4A 1D1CA 1WR6A 3Q5WA 4JI5T 2AXDS 1YQ3A 3A7MA 2W2UA 4HEAA 3RI5A 3ZMVB 3L39A 4UELA 3ZKRA 4HWDA 5ABFA 5LGNB 4IDZA 2QA7A 1X79A 4A97A 2BS2A 3M3ZB 4DV5T 1IBMT 4PK4A 4TWHA 4QH4A 2VWAA 2LSGA 4ISTA 4DR3T 4WNKA 3EI0A 4QX8B 3EABA 1VCSA 2CHNA 5CA0E 3DTOA 4IIJE 2DWGA 4XBFB 4CN6A 2YN6A 4EXTA 3ABVA 1KFYA 3AE5A 5LG3A 3F57A 4U74A 3FZFB 4DV6T 4EIWA 1OEDC 2CXLA 5LMUT 3PUVF 4KX6A 2VL0A 3O1JA 4ZEYA 4OX9T 5EK2A 3NRXA 2XSBA 4YXDA 3E08A 2FJBA 2V1DB 1JNZA 1XWMA 2WBLA 2XQ5A 3KFWX 5FP3A 4IDPA 2OV9A 3N9MA 2V5DA 5FY0A 5FKYA 4ZHQE 4KBMB 1FJGT 2X0HA 3U3IA 2GK9A 4IL4A 3HA4A 2KNDA 5AQRB 3RKOA 2BDEA 4YJ2E 3UT5E 3NVOA 2WCAA 2YU1A 4LF6T 4O8SA 1NAFA 3F31A 3N9OA 2VKJA 3E0ZA 2UXCT 2WS3A 2DLRA 4UVCB 4U7IA 2XQ9A 4AXPA 2CHOA 2CMRA 3UUBA 3Q9DA 1SHZC 4TUYE 3AXJA 4U33A 3T1HT 4ISSA 3ETVA 2HH7A 1HR0T 2BG9A 2XAFB 4TX5A 4OK0A 3B5MA 2D0TA 2FJEA 3HKBE 3AXJB 2WDRA 4H9RC 3L8RA 4DVDA 1OWAA 1T72A 3X1DA 3WI3A 1M62A 4UR9A 4JV5T 2BG9B 3KV5A 4EZHA 4I0UA 3B13A 3P8CD 3QUJA 2LKHA 3DP7A 1IBKT 5L3CB 3UULA 4A98A 4H9SE 3TLWA 2XQYA 3EVYA 1ZOYA 3O4XE 3TLVA 5H6QB 2LSYA 4P0BA 1MMNA 4ZI7E 2LT3A 2XHEB 5AQGB 2V7KA 4I43B 4DV7T 4UV9B 2NW9A 4Z91A 3C4ZA 4AQFA 3VRBA 2VKHA 2WMNA 4BAYB 1AJ3A 1L0VA 3JAEA 2B76A 4DR5T 1Y01A 2CBIA 2E9XC 4I55E 4UXNB 5F5WA 4ZI3C 3CQXC 4HE8A 3AAEB 1DU2A 2ZM2A 2ZM8A 2PBIA 3AAIA 2AE9A 4GOUA 2XPKA 3Q2MA 3UFGA 2FBWA 1WYCA 3O1HA 5AQQB 1UK5A 2K5BB 3CQGB 3AB3B 4TWFA 2YK0A 2Y8DA 3ZT7A 1UCUA 3MACA 2JMKA 3AA0B 3N5LA 2MTQA 3IHRA 3N9NA 2CWYA 2W61A 4EGWA 1WCRA 2A9UA 2EHOD 5AQNB 4YSXA 1XZYA 4DR1T 3AE2A 3GN5B 2LHNA 1BR1A 2WWVA 2A72A 1HNXT 1WYBA 2YU2A 3J7Yq 3BQLA 2YDSA 4O4HE 3PE0A 2Q9QD 4U2ZA 4EV6A 5ABHA 2N1GA 1KK7A 4JEUB 3P4SA 4ZOLE 2DCFA 5E0OA 5C3JA 4PNIA 3EAMA 5HXHA 4I50E 4HWFA 5AQVB 2LM9A 1X9BA 3NRYA 3ZT5A 5C2TA 5JDLA 4Z8XA 1FEWA 3MXZA 3OJAA 2XM1A 4IL9A 2KINB 4UVBB 1XMQT 2IC6A 2XASB 4EB6E 5LXTE 1EZ3A 3A5XA 1V9DA 5FXXA 3F2EA 4EAHA 4DIDB 1QLBA 2W66A 2WAUA 2H7VC 4L9IA 5IUXA 2NTYA 2HN2A 5J1GA 1VCTA 3RGLA 5CFBA 1D0YA 5JR9A 3TKLB 1Y64B 5JREA 5H6RB 2HHHT 4DR4T 2PJQA 2F4VT 4WBOA 4DR7T 3WAKA 4EYUA 2KWIB 4PJNA 4K0UA 3KV9A 2VK9A 5JR9B 4ANJA 4PFOA 2ZM6T 4HFDA 2L8KA 3TLSA 4NXMT 2L9QA 1YKHB 2OA5A 2DNXA 2V7IA 3JADA 3H37A 4HGAA 4L0RA 4TV9E 4JI8T 2VURA 1JNRA 5TAOA 5LGUB 3OVUA 3T1YT 1NENA 3EDUA 2MBGA 3S4UA 4ILBA 3CK6A 2VB6A 3A8YC 2W0GA 4LF9T 4YTPA 3OTOT 4EZ4A 2ODUA 4CI2B 5IWAT 1I94T 2MOZA 5L4HA 3RRCA 5JDQA 4JI0T 4KHPT 2JJ9A 3PUYF 4IT4A 1OEDA 4KUMB 3SWHA 3FB2A 2N2NA 2XAHB 4IDOA 4EYYR 2IHR1 5CA1E 2KLQA 4IE7A 4WBNE 4DV0T 3HKEE 3DJBA 4CI1B 2NWBA 5FVKA 2LJLA 3N9QA 3QOFA 2A3DA 4V1Av 3Q5EA 4UVAB 2WU5A 5DJQC 2X0LB 3AA1B 3ZYMA 5ETWA 2ES0A 4X20E 2KT9A 2LLYA 3RRWA 5AQMB 2LSKA 2B1EA 2XY8B 2HPJA 1IZNB 3KBTA 4YLHA 4XAXB 2OLTA 3OBVE 4U7YA 2WP9A 2PG8A 3TLUA 5LNKA 2R6GF 1IJ5A 4JI4T 4DNDA 4H63V 5AQHB 4P09A 4P0AA 3I9YA 3RC8A 2V6XA 2ZM0A 3N2GE 4A5XA 3K3OA 3SFDA 4KP3C 4LMKA 2WWUA 2WZHA 3AEEA 4HWIB 3ZPOA 2XSAA 3LSVA 2BZBA 5HWXA 2KXPB 3ESLA 3BQKA 5L3BB 4CXXA 3ZLIA 2E2AA 5EK3A 5FXZA 2IMLA 4EEDA 2IDOB 4PK5A 1ZKEA 3ZMSB 3V5SA 2ACZA 5FY1A 4QXHB 1E7PA 2A2FX 2I6HA 2J62A 3RLFF 5A1LA 3HL6A 1IAPA 2CEAA 3OYZA 5HEOA 2UU9T 4IREA 3K8PC 1J5ET 4E7SA 4ERRA 5LB7B 3AAAB 1WRDA 5HXSA 2NP9A 3P7IA 5AQIB 3WAJA 1MMDA 1YKEB 4WYVA 4COFA 1MIYA 4YTMA 5FVLA 4LF5T 3PU3A 2JQQA 4K0KT 3CX6B 1HCIA 2E9XA 3AE6A 2X0YA 3RX6A 5JDFA 3K3NA 4WW0A 5CGMA 2E9XB 2V7JA 3SRZA 3RYHE 4CI3B 4YY3T 4HFCA 4L5GA 5EZYE 3KV6A 3ZN1B 2LM2A 1N33T 5ABGA 2V8SV 2W63A 5HEGA 3AEBA 3B57A 5HCMA 2C5IT 1HTJF 4YTNA 5AQJB 4PJLA
chains in the Genus database with same CATH topology
1M7KA 1HX1B 1UGOA 5AQHB 3A8YC 3FZFB 3FZMB 5AQSB 5AQRB 4HWCA 5AQUB 5AQTB 5AQLB 5AQPB 5AQQB 1UK5A 2D9DA 3FZLB 5AQGB 4HWDA 5AQKB 5AQNB 1I6ZA 5AQIB 1T7SA 3FZKB 3LDQB 5AQMB 4HWFA 5AQVB 1M62A 5AQOB 3M3ZB 3FZHB 4HWIB 5AQJB 4HWHA 5AQFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7K A;  1HX1 B;  1UGO A;  5AQH B;  3A8Y C;  3FZF B;  3FZM B;  5AQS B;  5AQR B;  4HWC A;  5AQU B;  5AQT B;  5AQL B;  5AQP B;  5AQQ B;  1UK5 A;  2D9D A;  3FZL B;  5AQG B;  4HWD A;  5AQK B;  5AQN B;  1I6Z A;  5AQI B;  1T7S A;  3FZK B;  3LDQ B;  5AQM B;  4HWF A;  5AQV B;  1M62 A;  5AQO B;  3M3Z B;  3FZH B;  4HWI B;  5AQJ B;  4HWH A;  5AQF B; 
#chains in the Genus database with same CATH topology
 4DO0 A;  1E1H B;  3OPC A;  3P4R A;  3CWZ B;  4PFP A;  2LRK A;  5GON E;  4UIG A;  3HR0 A;  3RC3 A;  1D0X A;  5FNV E;  4GKJ T;  1I6Z A;  4YT0 A;  1LVK A;  1SE7 A;  2FJA A;  4JI2 T;  3C64 A;  2E5L T;  2J4G A;  2JQH A;  5HEJ A;  1NWM X;  4BA9 A;  3KVA A;  4LFC T;  3VR8 A;  1BR2 A;  3QB5 K;  1MNE A;  2LOS A;  3CX8 B;  4JI1 T;  4IDQ A;  2CRB A;  2MAW A;  3NKZ A;  1SUM B;  4N78 D;  1YW0 A;  5JDM A;  1CUN A;  1BR0 A;  5FL0 A;  2XUE A;  2WU2 A;  3PJA J;  1IJ6 A;  1U5P A;  5FY7 A;  3LK3 B;  5LJN A;  1OXZ A;  4QHO A;  4H9Q C;  2BKN A;  5AQL B;  4X1K E;  4ZZB A;  2JMH A;  2MPK A;  4ZI2 D;  1KF6 A;  3KDS E;  3ZSS A;  4WZX A;  5HXE A;  4YJ3 E;  1W0B A;  4ZS2 A;  3BK9 A;  4JI6 T;  1UGO A;  1B7T A;  3ZMU B;  2X66 A;  5AQT B;  4DUY T;  1LKX A;  3UUX B;  4CN4 A;  2UXN B;  1FMW A;  3UU4 A;  3VKG A;  1HNZ T;  3FHN A;  4B3S T;  2BS4 A;  4MHC A;  3ZC1 A;  3KV4 A;  5HXR A;  3JAF A;  4QH5 A;  2LRL A;  5JTG A;  2X68 A;  4HFB A;  2WY2 A;  1MMG A;  4PW8 A;  4X64 T;  3FXE B;  2ZMA A;  4G63 A;  2BKP A;  3U78 A;  2FJD A;  3GN5 A;  3AE1 A;  4UEM A;  2VKO A;  2MYS A;  3LK4 2;  3ZCJ A;  3RQW A;  1XDO A;  4HN9 A;  4ILU A;  1KNP A;  2C5K T;  4TNW A;  4CN1 A;  4XZC A;  2UXD T;  3TLT A;  2XQ8 A;  3EHZ A;  3NZP A;  2WDQ A;  4UF0 A;  2EHO C;  3ZC0 A;  3HI2 A;  3ETU A;  4BJN A;  2UXX B;  2RPA A;  2LOP A;  4AKL A;  2H7O A;  2Q9Q C;  4UF0 B;  2UUA T;  2CM0 A;  2D9D A;  5HYA A;  2BKO A;  3AEG A;  3UUN A;  3PU8 A;  2WDV A;  5AQO B;  4IE4 A;  2V26 A;  4DV4 T;  4Z90 A;  4X62 T;  5LJM A;  4AKH A;  3AE3 A;  2YEV C;  1HF8 A;  5JRC A;  5JDN A;  4GK5 E;  5AQK B;  1UX4 A;  3FBZ A;  2DI4 A;  2VKD A;  4JLE A;  3PUG A;  3K1S A;  1HNW T;  2NW8 A;  5JRC B;  1MIV A;  2KMF A;  2Z6E A;  1N32 T;  2W00 A;  3UU3 A;  2YDR A;  3R6N A;  3P50 A;  1XNR T;  4HFE A;  5FYM A;  2LE8 A;  5DQW A;  3RIF A;  1KEY A;  3HKC E;  2BBH A;  4U2Y A;  4O4L E;  3PTR B;  2K3W A;  3J9X 1;  1R8I A;  3LJC A;  4MFR A;  2QYW A;  3VR9 A;  4JBW F;  4ADZ A;  4M1P A;  3ZJ2 A;  4AIS A;  1VOM A;  2DHR A;  4ZXL A;  2NW7 A;  3GMI A;  2I0M A;  1S35 A;  3RYC E;  1HS7 A;  3AE7 A;  5L3D B;  3CIR A;  2C0S A;  5HEU A;  3GA8 A;  2CLY B;  5LP6 E;  4QH1 A;  3D0T A;  2XQ3 A;  3O9X A;  4DBQ A;  2L3L A;  2H3R A;  4AI6 A;  4B3R T;  2VQF T;  5F8P A;  5JH7 E;  3I9W A;  1UX5 A;  2X9X A;  5HAX A;  3MZK B;  4U31 A;  3N9L A;  2V7M A;  4YSY A;  1KNZ A;  5L3E B;  5JDH A;  2BBJ A;  5J0Z A;  4TV8 E;  3JC6 D;  2VVS A;  3PUW F;  3LDQ B;  3ZCI A;  2CWO A;  4I4T E;  3JC6 C;  1KNR A;  4YSZ A;  4GK0 E;  4KI0 F;  2ACX A;  5LHH B;  5HEH A;  5HCJ A;  1BR4 A;  4TNV A;  5J2T E;  4AQY T;  3R84 B;  3CKD A;  4HKA A;  4PAG A;  5ABE A;  1W09 A;  4PJM A;  2DWK A;  3CX7 B;  3ZYL A;  2JRK A;  3EDV A;  4A56 A;  4UV8 B;  4YHH T;  1HG5 A;  1E2A A;  3ONX A;  4JYA T;  1IBL T;  2CLY C;  3CPZ A;  2UUB T;  2WB5 A;  4ZS3 A;  2CXF A;  1ZHC A;  4ZZC A;  2HN1 A;  1US7 B;  3KVB A;  4IE5 A;  2WMO A;  3M65 A;  3K3Q C;  4HFH A;  5KMG P;  2XTL A;  3ZN0 B;  1G8X A;  3G06 A;  4KHZ F;  3PV0 F;  2SPC A;  3VKH A;  3LBX A;  3ZST A;  2XAJ B;  3ZEF B;  2XQ6 A;  2XQ7 A;  5ABF B;  3EUH A;  3LBX B;  3UTK A;  3ZMT B;  5AQP B;  5KDM C;  2QVA A;  3SFE A;  2WM9 A;  5LBM A;  4B3M T;  3SS1 A;  3CVR A;  5BR8 T;  4LF8 T;  2D5U A;  2M6I A;  5JQG E;  1HFA A;  3AE8 A;  3OKQ A;  4YFS A;  4O4I E;  2CPT A;  5L3G B;  5LOV E;  2VL8 A;  2XJ7 A;  4DR6 T;  4X65 T;  5HXC A;  3L3P A;  4C90 A;  5LCY A;  2CA5 A;  1W0A A;  3FZK B;  4LF7 T;  4TN7 B;  3PUX F;  1UUS A;  3P4W A;  3FBL A;  1HX1 B;  2X9Y A;  3ZT6 A;  4F6R C;  4LML A;  1GQE A;  1ZV4 X;  3LFM A;  3P4P A;  1J1J A;  3KBU A;  3W15 B;  5L47 A;  2YOE A;  3FZL B;  3FXD B;  5HWY A;  4DV3 T;  4MAL A;  3IF8 B;  4JI3 T;  2JQK A;  2K48 A;  4QKN A;  4NUV A;  4YHJ A;  2P9B A;  4E7Z A;  4DV1 T;  3C4W A;  4F8H A;  5DQV A;  1XDP A;  3AE4 A;  2KWH A;  3PUZ F;  1ZEE A;  4QWN B;  2YDQ A;  4LMJ A;  2E5V A;  3PJA A;  5IYZ E;  3AEF A;  4Q25 A;  3ZMZ B;  2DL1 A;  3LG7 A;  5LBQ B;  2H89 A;  1S94 A;  5LYJ E;  4DV2 T;  3PUA A;  2X9W A;  4JEH B;  2XQ4 A;  2PFV A;  2EHO A;  4HFV A;  2ODV A;  4IGU A;  4GYS A;  4J2C A;  3IEE A;  1D0Z A;  4EOZ B;  3O1I A;  2X9H A;  2WQY A;  3Q5D A;  5KXJ A;  5L4E A;  1YQ4 A;  3NBX X;  4X66 T;  2Q9Q A;  3SOL A;  2EHO B;  3UUM A;  2NOX A;  3L09 A;  3AEA A;  2LSJ A;  3VU7 H;  2BVM A;  1YXR A;  4P1N A;  4B6X A;  1D1B A;  5FXW A;  5M4Y A;  2Q9Q B;  2N9D A;  2G0U A;  1YD8 G;  4O2B E;  3ONL C;  3V5U A;  2V7L A;  2VAS A;  2D0U A;  2W62 A;  2HPL A;  1UUR A;  1MND A;  2CE7 A;  2X51 A;  2W4X A;  4H9P C;  4NXN T;  2J47 A;  3T8O A;  4EEB A;  4ILC A;  2XQA A;  5CJ5 A;  4X1I E;  4ZI2 C;  3AE9 A;  3ZJ1 A;  5C8Y E;  4LF4 T;  2YKS A;  3RIU A;  2E8I A;  5F3J A;  3I0Q A;  2PTF A;  2BG9 E;  2K24 A;  4DMW A;  3RYF E;  3Q5X A;  1G73 A;  4O4J E;  4DBR A;  2ZLY A;  3C50 A;  2JPF A;  4X5T A;  2JQ9 A;  4MBQ A;  3H3A A;  2NTX A;  2XZE A;  2W67 A;  1WR0 A;  2NR4 A;  3AED A;  2UXB T;  2E9X D;  3QC9 A;  2LEH A;  1U4Q A;  4ZI3 D;  2KSR A;  4HWC A;  4IE6 A;  1W9R A;  3AA7 B;  3AVS A;  5ADX L;  4IHJ E;  3UQ7 A;  1T98 A;  2C5J A;  2K9A A;  5AQF B;  4PK6 A;  3JCF A;  2VQE T;  4U72 A;  5BMV E;  3HKD E;  3UU8 A;  3IBP A;  3MJX A;  2BS3 A;  1HX8 A;  3RQU A;  5IHY A;  1N34 T;  4H9O C;  4HTE A;  5CB4 E;  1MMA A;  4HWH A;  3ONJ A;  3RIA A;  1SA0 E;  3NWI A;  3QK6 A;  1QUU A;  2JIW A;  2BG9 C;  3PUR A;  3PUQ A;  4QXC B;  2Y6X A;  4O2A E;  2YIN A;  1ZP0 A;  2WSS V;  3AEC A;  3IA3 A;  4AQG A;  4NUU A;  5LHG B;  5LMN T;  3I0O A;  4BJM A;  2IIU A;  1FMV A;  5KX5 E;  3PUS A;  2RA1 A;  2KZ7 B;  3FZH B;  3RHW A;  4CXY A;  2V5C A;  3AA6 B;  1Z8U A;  4DMV A;  2LKG A;  3RIU C;  3QB5 A;  4DUZ T;  2IW5 B;  3MKD A;  1T7S A;  5AFU L;  3UU6 A;  2UUC T;  4B3T T;  4FI5 A;  4CXW A;  3UU5 A;  2M6B A;  2XAG B;  2FUP A;  1M7K A;  4LFA T;  4OYK A;  4X1Y E;  3VRA A;  4GIW A;  4AQF C;  4GYR A;  3AVR A;  1D1A A;  2IAK A;  4CZZ B;  5FXV A;  4C91 A;  4G2A A;  5FL1 A;  4FJO A;  4QX7 B;  4OFZ A;  2H88 A;  3ANW A;  3RH3 A;  2I59 A;  4H63 H;  4MLK A;  2Y48 B;  5J2U E;  4IDN A;  3C98 B;  3FZM B;  3UFE A;  1H7C A;  3RKG A;  2XAQ B;  4ASK A;  1WLX A;  3KIN B;  3ANW B;  2LSI A;  4TZ4 C;  3MA9 A;  3RYI E;  3I1A A;  4H9N C;  4LFB T;  1VRB A;  4GKK T;  4OHF A;  1J5W A;  1LRZ A;  2WZI A;  4NPP A;  1XMO T;  3OYX A;  2CCQ A;  2M67 A;  4TWD A;  5FMN A;  1XNQ T;  2LHR A;  2D2S A;  3BQI A;  5LGT B;  3RPU A;  2VVN A;  5AQS B;  1Z0P A;  2BVL A;  2J1D G;  1FIO A;  5AQU B;  5JDG A;  4JI7 T;  4IE0 A;  4PJJ A;  1QSD A;  5LHI B;  1N36 T;  3P4Q A;  1LVF A;  4JUY A;  3CML A;  3GWH A;  2QRX A;  4U3C A;  5JVD E;  3MK7 C;  1T8B A;  2CBJ A;  4HFI A;  4AIU A;  4NIQ A;  3QNU A;  5L2L A;  2V6Y A;  3PDY A;  3E22 E;  1NEK A;  2IC9 A;  1WFD A;  1OED B;  4ILA A;  5LG4 A;  5L3F B;  3N9P A;  4AKG A;  1CHU A;  2XM2 A;  4AKR B;  4OYJ A;  2V6Y B;  3C51 A;  2QGS A;  1HG2 A;  1O3X A;  4QXB B;  2RP4 A;  4KMC A;  3NZQ A;  5DAB A;  3C4X A;  4DR2 T;  2CXD A;  1MIW A;  5LA6 E;  2X67 A;  4AKI A;  2IUB A;  3LK2 B;  5JR9 C;  1OED E;  3N2K E;  5EK4 A;  3CQC B;  3VHL A;  3RF1 A;  3H3M A;  3N2O A;  4CQI A;  3ZYK A;  3UQ4 A;  1D1C A;  1WR6 A;  3Q5W A;  4JI5 T;  2AXD S;  1YQ3 A;  3A7M A;  2W2U A;  4HEA A;  3RI5 A;  3ZMV B;  3L39 A;  4UEL A;  3ZKR A;  4HWD A;  5ABF A;  5LGN B;  4IDZ A;  2QA7 A;  1X79 A;  4A97 A;  2BS2 A;  3M3Z B;  4DV5 T;  1IBM T;  4PK4 A;  4TWH A;  4QH4 A;  2VWA A;  2LSG A;  4IST A;  4DR3 T;  4WNK A;  3EI0 A;  4QX8 B;  3EAB A;  1VCS A;  2CHN A;  5CA0 E;  3DTO A;  4IIJ E;  2DWG A;  4XBF B;  4CN6 A;  2YN6 A;  4EXT A;  3ABV A;  1KFY A;  3AE5 A;  5LG3 A;  3F57 A;  4U74 A;  3FZF B;  4DV6 T;  4EIW A;  1OED C;  2CXL A;  5LMU T;  3PUV F;  4KX6 A;  2VL0 A;  3O1J A;  4ZEY A;  4OX9 T;  5EK2 A;  3NRX A;  2XSB A;  4YXD A;  3E08 A;  2FJB A;  2V1D B;  1JNZ A;  1XWM A;  2WBL A;  2XQ5 A;  3KFW X;  5FP3 A;  4IDP A;  2OV9 A;  3N9M A;  2V5D A;  5FY0 A;  5FKY A;  4ZHQ E;  4KBM B;  1FJG T;  2X0H A;  3U3I A;  2GK9 A;  4IL4 A;  3HA4 A;  2KND A;  5AQR B;  3RKO A;  2BDE A;  4YJ2 E;  3UT5 E;  3NVO A;  2WCA A;  2YU1 A;  4LF6 T;  4O8S A;  1NAF A;  3F31 A;  3N9O A;  2VKJ A;  3E0Z A;  2UXC T;  2WS3 A;  2DLR A;  4UVC B;  4U7I A;  2XQ9 A;  4AXP A;  2CHO A;  2CMR A;  3UUB A;  3Q9D A;  1SHZ C;  4TUY E;  3AXJ A;  4U33 A;  3T1H T;  4ISS A;  3ETV A;  2HH7 A;  1HR0 T;  2BG9 A;  2XAF B;  4TX5 A;  4OK0 A;  3B5M A;  2D0T A;  2FJE A;  3HKB E;  3AXJ B;  2WDR A;  4H9R C;  3L8R A;  4DVD A;  1OWA A;  1T72 A;  3X1D A;  3WI3 A;  1M62 A;  4UR9 A;  4JV5 T;  2BG9 B;  3KV5 A;  4EZH A;  4I0U A;  3B13 A;  3P8C D;  3QUJ A;  2LKH A;  3DP7 A;  1IBK T;  5L3C B;  3UUL A;  4A98 A;  4H9S E;  3TLW A;  2XQY A;  3EVY A;  1ZOY A;  3O4X E;  3TLV A;  5H6Q B;  2LSY A;  4P0B A;  1MMN A;  4ZI7 E;  2LT3 A;  2XHE B;  5AQG B;  2V7K A;  4I43 B;  4DV7 T;  4UV9 B;  2NW9 A;  4Z91 A;  3C4Z A;  4AQF A;  3VRB A;  2VKH A;  2WMN A;  4BAY B;  1AJ3 A;  1L0V A;  3JAE A;  2B76 A;  4DR5 T;  1Y01 A;  2CBI A;  2E9X C;  4I55 E;  4UXN B;  5F5W A;  4ZI3 C;  3CQX C;  4HE8 A;  3AAE B;  1DU2 A;  2ZM2 A;  2ZM8 A;  2PBI A;  3AAI A;  2AE9 A;  4GOU A;  2XPK A;  3Q2M A;  3UFG A;  2FBW A;  1WYC A;  3O1H A;  5AQQ B;  1UK5 A;  2K5B B;  3CQG B;  3AB3 B;  4TWF A;  2YK0 A;  2Y8D A;  3ZT7 A;  1UCU A;  3MAC A;  2JMK A;  3AA0 B;  3N5L A;  2MTQ A;  3IHR A;  3N9N A;  2CWY A;  2W61 A;  4EGW A;  1WCR A;  2A9U A;  2EHO D;  5AQN B;  4YSX A;  1XZY A;  4DR1 T;  3AE2 A;  3GN5 B;  2LHN A;  1BR1 A;  2WWV A;  2A72 A;  1HNX T;  1WYB A;  2YU2 A;  3J7Y q;  3BQL A;  2YDS A;  4O4H E;  3PE0 A;  2Q9Q D;  4U2Z A;  4EV6 A;  5ABH A;  2N1G A;  1KK7 A;  4JEU B;  3P4S A;  4ZOL E;  2DCF A;  5E0O A;  5C3J A;  4PNI A;  3EAM A;  5HXH A;  4I50 E;  4HWF A;  5AQV B;  2LM9 A;  1X9B A;  3NRY A;  3ZT5 A;  5C2T A;  5JDL A;  4Z8X A;  1FEW A;  3MXZ A;  3OJA A;  2XM1 A;  4IL9 A;  2KIN B;  4UVB B;  1XMQ T;  2IC6 A;  2XAS B;  4EB6 E;  5LXT E;  1EZ3 A;  3A5X A;  1V9D A;  5FXX A;  3F2E A;  4EAH A;  4DID B;  1QLB A;  2W66 A;  2WAU A;  2H7V C;  4L9I A;  5IUX A;  2NTY A;  2HN2 A;  5J1G A;  1VCT A;  3RGL A;  5CFB A;  1D0Y A;  5JR9 A;  3TKL B;  1Y64 B;  5JRE A;  5H6R B;  2HHH T;  4DR4 T;  2PJQ A;  2F4V T;  4WBO A;  4DR7 T;  3WAK A;  4EYU A;  2KWI B;  4PJN A;  4K0U A;  3KV9 A;  2VK9 A;  5JR9 B;  4ANJ A;  4PFO A;  2ZM6 T;  4HFD A;  2L8K A;  3TLS A;  4NXM T;  2L9Q A;  1YKH B;  2OA5 A;  2DNX A;  2V7I A;  3JAD A;  3H37 A;  4HGA A;  4L0R A;  4TV9 E;  4JI8 T;  2VUR A;  1JNR A;  5TAO A;  5LGU B;  3OVU A;  3T1Y T;  1NEN A;  3EDU A;  2MBG A;  3S4U A;  4ILB A;  3CK6 A;  2VB6 A;  3A8Y C;  2W0G A;  4LF9 T;  4YTP A;  3OTO T;  4EZ4 A;  2ODU A;  4CI2 B;  5IWA T;  1I94 T;  2MOZ A;  5L4H A;  3RRC A;  5JDQ A;  4JI0 T;  4KHP T;  2JJ9 A;  3PUY F;  4IT4 A;  1OED A;  4KUM B;  3SWH A;  3FB2 A;  2N2N A;  2XAH B;  4IDO A;  4EYY R;  2IHR 1;  5CA1 E;  2KLQ A;  4IE7 A;  4WBN E;  4DV0 T;  3HKE E;  3DJB A;  4CI1 B;  2NWB A;  5FVK A;  2LJL A;  3N9Q A;  3QOF A;  2A3D A;  4V1A v;  3Q5E A;  4UVA B;  2WU5 A;  5DJQ C;  2X0L B;  3AA1 B;  3ZYM A;  5ETW A;  2ES0 A;  4X20 E;  2KT9 A;  2LLY A;  3RRW A;  5AQM B;  2LSK A;  2B1E A;  2XY8 B;  2HPJ A;  1IZN B;  3KBT A;  4YLH A;  4XAX B;  2OLT A;  3OBV E;  4U7Y A;  2WP9 A;  2PG8 A;  3TLU A;  5LNK A;  2R6G F;  1IJ5 A;  4JI4 T;  4DND A;  4H63 V;  5AQH B;  4P09 A;  4P0A A;  3I9Y A;  3RC8 A;  2V6X A;  2ZM0 A;  3N2G E;  4A5X A;  3K3O A;  3SFD A;  4KP3 C;  4LMK A;  2WWU A;  2WZH A;  3AEE A;  4HWI B;  3ZPO A;  2XSA A;  3LSV A;  2BZB A;  5HWX A;  2KXP B;  3ESL A;  3BQK A;  5L3B B;  4CXX A;  3ZLI A;  2E2A A;  5EK3 A;  5FXZ A;  2IML A;  4EED A;  2IDO B;  4PK5 A;  1ZKE A;  3ZMS B;  3V5S A;  2ACZ A;  5FY1 A;  4QXH B;  1E7P A;  2A2F X;  2I6H A;  2J62 A;  3RLF F;  5A1L A;  3HL6 A;  1IAP A;  2CEA A;  3OYZ A;  5HEO A;  2UU9 T;  4IRE A;  3K8P C;  1J5E T;  4E7S A;  4ERR A;  5LB7 B;  3AAA B;  1WRD A;  5HXS A;  2NP9 A;  3P7I A;  5AQI B;  3WAJ A;  1MMD A;  1YKE B;  4WYV A;  4COF A;  1MIY A;  4YTM A;  5FVL A;  4LF5 T;  3PU3 A;  2JQQ A;  4K0K T;  3CX6 B;  1HCI A;  2E9X A;  3AE6 A;  2X0Y A;  3RX6 A;  5JDF A;  3K3N A;  4WW0 A;  5CGM A;  2E9X B;  2V7J A;  3SRZ A;  3RYH E;  4CI3 B;  4YY3 T;  4HFC A;  4L5G A;  5EZY E;  3KV6 A;  3ZN1 B;  2LM2 A;  1N33 T;  5ABG A;  2V8S V;  2W63 A;  5HEG A;  3AEB A;  3B57 A;  5HCM A;  2C5I T;  1HTJ F;  4YTN A;  5AQJ B;  4PJL A; 
#chains in the Genus database with same CATH homology
 1M7K A;  1HX1 B;  1UGO A;  5AQH B;  3A8Y C;  3FZF B;  3FZM B;  5AQS B;  5AQR B;  4HWC A;  5AQU B;  5AQT B;  5AQL B;  5AQP B;  5AQQ B;  1UK5 A;  2D9D A;  3FZL B;  5AQG B;  4HWD A;  5AQK B;  5AQN B;  1I6Z A;  5AQI B;  1T7S A;  3FZK B;  3LDQ B;  5AQM B;  4HWF A;  5AQV B;  1M62 A;  5AQO B;  3M3Z B;  3FZH B;  4HWI B;  5AQJ B;  4HWH A;  5AQF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...