5AQVB

Fragment-based screening of hsp70 sheds light on the functional role of atp-binding site residues
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
115
structure length
115
Chain Sequence
GPLGSNSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A fragment-based approach applied to a highly flexible target: Insights and challenges towards the inhibition of HSP70 isoforms.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords HEAT SHOCK COGNATE 71 KDA PROTEIN
total genus 47
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2015-09-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02179 BAG BAG domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.120 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 BAG domain 5aqvB00
1M7KA 1HX1B 4HWCA 5AQHB 5AQPB 4HWDA 5AQIB 1UGOA 5AQOB 5AQMB 5AQSB 2D9DA 3LDQB 5AQKB 1UK5A 5AQRB 3M3ZB 5AQFB 1I6ZA 5AQUB 5AQLB 3A8YC 5AQVB 3FZLB 5AQNB 4HWIB 5AQGB 4HWFA 1M62A 3FZMB 1T7SA 3FZKB 3FZFB 5AQJB 5AQTB 3FZHB 5AQQB 4HWHA
chains in the Genus database with same CATH superfamily
1WR0A 2WBLA 3GMIA 4HN9A 2ACZA 2AXDS 2V26A 2XAJB 5AQIB 3ZLIA 5C3JA 4DR1T 5JDHA 2CLYB 4B3ST 4ZI2D 4U7YA 3PUYF 2W4XA 5HYAA 4F8HA 3AE7A 3ZYKA 5JDQA 2HHHT 4IHJE 2KZ7B 4IDOA 3NBXX 2IC6A 5AQLB 1Y64B 2ODUA 4AQFC 3KV9A 1WR6A 4WBNE 5JH7E 5ABFB 1BR0A 4KHPT 4CN4A 3AXJB 2VWAA 4PFPA 3PUVF 5J0ZA 4UXNB 4E7ZA 4UVBB 3VRAA 3F57A 4IL4A 3SRZA 4DMWA 2PG8A 4AQGA 2BS3A 3AEAA 4UV8B 2W66A 4IE5A 4O4LE 4HFEA 4C91A 1WFDA 2JMHA 3FZHB 2C5IT 3UU4A 3E22E 1UX5A 3PJAA 3AE9A 5BR8T 3DP7A 4JEHB 3EVYA 4L5GA 4QXCB 4PJLA 3E0ZA 4UIGA 2DL1A 2Q9QB 1J5ET 1CHUA 2IHR1 1U5PA 2I0MA 2OLTA 4UF0A 3M3ZB 5AQFB 1ZKEA 2M6IA 3IBPA 4P09A 5HWYA 2VL8A 2LOSA 1XNQT 3UFEA 3RHWA 1HCIA 2ES0A 3AA0B 3KINB 4X64T 1OEDE 2X67A 2CBJA 4ASKA 3L39A 3I0OA 2XSAA 4HWIB 4H9SE 3AE1A 3ZSSA 4P0AA 5JRCB 2H7VC 1OEDA 4MBQA 4BJNA 1U4QA 4I0UA 1T7SA 5AQJB 4CN6A 3OTOT 2JQKA 1IJ5A 2YKSA 4ZHQE 5ETWA 2IUBA 4LMKA 2LHRA 4PJNA 5LMUT 2LLYA 3M65A 4IE0A 3KV6A 3PU3A 1UK5A 2DCFA 1XDPA 3CWZB 4EXTA 1IBKT 3B5MA 1MIVA 1D0ZA 4UF0B 4EYUA 2V1DB 5KDMC 5DQVA 3QB5K 4YSXA 5LJMA 2E9XC 4DR6T 4U74A 3L3PA 2XQ7A 2K3WA 1YQ4A 3O4XE 4X1YE 4HFVA 4CXYA 5LBQB 3BQKA 2V8SV 2I59A 3OJAA 4DUYT 1HNZT 3PUQA 3RX6A 4DV2T 4PW8A 1NWMX 4P0BA 3RC8A 3ANWB 4O8SA 4UV9B 4DV4T 2L3LA 5F8PA 3CKDA 4JI3T 4U2ZA 3CQGB 1M62A 3DJBA 2WAUA 4IIJE 1QUUA 4FJOA 4IDQA 4EZHA 5JDLA 2VASA 3UU8A 1QLBA 4L0RA 4NXNT 2LSKA 4IL9A 3T1HT 4DBRA 4K0UA 2YU2A 4AQFA 4YJ3E 4EIWA 4G63A 4TN7B 1HX1B 4KMCA 1S35A 3NKZA 5HCMA 1D0XA 2CA5A 4LF7T 3MKDA 4I4TE 3AE4A 1KK7A 4QH5A 3PUGA 1LVFA 4TV8E 5HXEA 3C50A 4WZXA 4C90A 4Z90A 2VKHA 2HH7A 3MA9A 3FHNA 1FIOA 3RI5A 4DBQA 2MAWA 2YK0A 3AVRA 3N2KE 5CGMA 4DR3T 4AI6A 3CX7B 1Z8UA 5LA6E 1XWMA 3CIRA 4TX5A 5IHYA 4A97A 4X1IE 5L3DB 3KVBA 3P8CD 1R8IA 2WCAA 2CPTA 4EEDA 3WAJA 3AEGA 1FMWA 3KFWX 4DIDB 3O9XA 4OX9T 3JCFA 2WU2A 3QB5A 4CXXA 2BKPA 1IZNB 2HPLA 1YKHB 3MJXA 4TNWA 4MFRA 1N32T 3PTRB 2JQ9A 3PE0A 3UULA 5LYJE 1N33T 1T72A 5FVLA 3BQIA 4EB6E 4DV7T 3GA8A 4O2BE 4AQYT 3ZMSB 5AQHB 4CQIA 2LEHA 1MIWA 3GN5B 4HWDA 5DJQC 2V7IA 2W0GA 2RPAA 3AE3A 5AQPB 3JAFA 3OBVE 3RYHE 3LSVA 4DR4T 4TWHA 3PURA 2RP4A 3EAMA 1N34T 4LMLA 5HXRA 5L47A 2J62A 3UTKA 2NW8A 3I9YA 3ZT6A 4YJ2E 4AKHA 2J47A 3A8YC 5FXWA 3ZJ2A 1WCRA 4IE6A 1D1AA 3OPCA 3OVUA 3Q5XA 3RIAA 4LF9T 2VK9A 2XQ4A 3AA7B 4MALA 4DV3T 1ZEEA 3P4PA 4KBMB 5LOVE 3C4WA 3H3AA 4JI6T 1US7B 1XMOT 2LRKA 3CMLA 2WP9A 3O1HA 5AQGB 1J5WA 4M1PA 3UUBA 3ANWA 2WZHA 3MXZA 4WYVA 3N9OA 3Q2MA 4JI2T 3JAEA 3ZCJA 4BA9A 1MMDA 1EZ3A 3EDUA 3I0QA 4MHCA 3FZMB 3IF8B 2FUPA 2Q9QD 5FP3A 3RLFF 2EHOA 2X9XA 3VU7H 3IA3A 4EGWA 2EHOC 4YTPA 5KX5E 4COFA 2JIWA 1MNDA 3ZT7A 3RGLA 2DHRA 5ABGA 3RQUA 5ABEA 1HR0T 3KVAA 1KF6A 3QUJA 2D0UA 4AIUA 2FJDA 3K3QC 2Y8DA 5E0OA 4LF8T 4JEUB 4AISA 2XAQB 1FJGT 2WS3A 3ETUA 1KNRA 5JR9C 2G0UA 2LRLA 3RYCE 3ZSTA 4AKIA 4JBWF 5JR9A 4LF5T 4TZ4C 5JVDE 4H9OC 4YHHT 1GQEA 2D2SA 3TLVA 3IEEA 3NZPA 2XQ9A 3ONLC 4ILCA 2W00A 2MYSA 2LE8A 2YN6A 1WRDA 4JLEA 4DR7T 4DV1T 1WYCA 4PK5A 4AKLA 4DR2T 4YHJA 2KWHA 4GOUA 4A5XA 3UT5E 2XM2A 3F31A 3UU3A 5FXXA 3NRXA 2HPJA 5ABHA 4ZS2A 5LCYA 2E9XA 2XPKA 1ZP0A 1JNZA 1J1JA 1W0AA 3QC9A 4TUYE 3AE2A 5LGNB 4JI4T 5ABFA 4AKGA 2BG9A 1D1CA 2V6XA 4I50E 3AXJA 3PU8A 4EYYR 4X62T 1HFAA 4H63H 1OWAA 2QA7A 1UX4A 4L9IA 2IDOB 4UVCB 2P9BA 3ZMTB 2XAFB 1Z0PA 1X79A 4IREA 3UU5A 5L3FB 1BR2A 4JYAT 3MZKB 3VKGA 4ZI2C 3UQ7A 4QHOA 2XUEA 3CQXC 3JC6C 1LKXA 3TKLB 4J2CA 5LHIB 2UXDT 2H89A 4LFCT 3FZLB 5AQNB 2W2UA 4TV9E 3AVSA 3N2GE 4XZCA 2N2NA 2L9QA 2LSGA 3AEEA 5LMNT 2CHOA 3AB3B 4KHZF 3RRWA 3SFEA 3HKDE 3DTOA 1VCSA 4P1NA 3N9LA 2ZM2A 3AAEB 4ZEYA 2UUAT 3T8OA 4HKAA 3L09A 3MACA 1M7KA 5L2LA 4CI1B 2WDQA 4QWNB 2X68A 4O4IE 2ODVA 4FI5A 1MIYA 2ZMAA 5FY7A 3RYFE 4X65T 3OYXA 5KMGP 2W61A 2ZM8A 2E8IA 2E2AA 3EDVA 4HE8A 4I55E 3P4WA 5AFUL 3O1IA 4ZI3C 2IAKA 3G06A 4ILBA 2JQQA 5EK3A 5FXZA 2V6YA 5LB7B 2NW9A 5HXHA 3ZN0B 4DV5T 4YT0A 3Q5WA 2PTFA 4A98A 2UXBT 1XZYA 2K9AA 5F5WA 3WAKA 2XJ7A 3Q5DA 2VQFT 5CJ5A 4CZZB 3U78A 5JREA 2W62A 1KNPA 3OKQA 5EK4A 5FMNA 1WLXA 2A3DA 4HFCA 2KXPB 3QOFA 4U7IA 1L0VA 4EEBA 5C2TA 5CA1E 2ZLYA 4KP3C 2UXCT 3TLSA 3P4RA 5C8YE 5FL1A 2CXDA 1E7PA 2A9UA 4MLKA 2K24A 4JI1T 3W15B 3ZPOA 4EOZB 4UELA 3D0TA 1LVKA 3A5XA 5GONE 5J1GA 4E7SA 1ZV4X 4ZZBA 1YKEB 2D0TA 5FXVA 5AQOB 3AECA 3C64A 2Y48B 2NTYA 3V5UA 3AE8A 2Y6XA 2X0HA 2XHEB 3SOLA 3C4ZA 3UUNA 3WI3A 3H3MA 3EI0A 2N9DA 4G2AA 1XDOA 3RC3A 2XQAA 3K3NA 4IE7A 5H6QB 4DVDA 2XAGB 3PUAA 3I1AA 5CA0E 2SPCA 2CHNA 2H3RA 3ZT5A 4DUZT 3FBZA 2KWIB 4ADZA 4B3TT 1HNWT 5HEUA 3RPUA 3UQ4A 3ZEFB 4XAXB 3QNUA 4ANJA 4U72A 1T8BA 5J2TE 2CXLA 2JPFA 2VKOA 5AQQB 4HWHA 5F3JA 2WU5A 2QRXA 2KMFA 3HA4A 5JDNA 1D1BA 2YDSA 5JDGA 1BR1A 2IW5B 4X1KE 4NUVA 2CMRA 2BZBA 3LDQB 1HF8A 1X9BA 3CQCB 3KBTA 4H63V 4LFBT 2IMLA 3UFGA 1VCTA 4ILAA 2YOEA 1ZOYA 3AEBA 4ILUA 4WW0A 2E9XB 3PJAJ 2WWVA 4YLHA 3ZCIA 4LF6T 3V5SA 4IDNA 1YW0A 2FJBA 2J1DG 2WQYA 3FXDB 3K8PC 1IAPA 4GYSA 4ISSA 4EZ4A 1V9DA 2LKHA 2VB6A 4ISTA 3JC6D 3VR8A 2F4VT 5H6RB 2JQHA 2BVMA 2Q9QC 3F2EA 3SFDA 1DU2A 1YQ3A 4WNKA 2OA5A 1UUSA 2V5CA 2BG9C 3N9MA 5FNVE 3RRCA 3K3OA 1IBLT 3R6NA 3NVOA 3HR0A 3NZQA 5L4EA 4B3RT 2XASB 4QXBB 4WBOA 2K5BB 3ZN1B 5A1LA 4HTEA 3KBUA 5EZYE 3VKHA 2LHNA 2MPKA 3SWHA 4HEAA 2M6BA 2XM1A 2VURA 3AA1B 2XQ3A 3HL6A 5AQKB 4QKNA 4ERRA 4K0KT 1WYBA 1KNZA 1HG5A 5AQRB 2I6HA 2LOPA 2NW7A 3N9QA 5HXCA 2ZM0A 5LNKA 5JDFA 1NAFA 2NTXA 4JI7T 2X9HA 1MMAA 2JRKA 4H9QC 3AA6B 2VL0A 5AQUB 3RYIE 2UUBT 3PUWF 4OYJA 3RKOA 2Z6EA 3TLWA 2V7LA 3PV0F 3MK7C 4GYRA 3GWHA 3ZC0A 3U3IA 3GN5A 5DABA 1XNRT 2CWOA 2WB5A 2HN1A 4LMJA 1HS7A 2KLQA 2KSRA 1OXZA 3J9X1 4GKJT 3LBXB 5DQWA 3RIUC 4DV0T 4NXMT 2W67A 3PUSA 4IE4A 3FZKB 4PJJA 5LXTE 5CFBA 4Z91A 3RQWA 5HEJA 2FBWA 2QVAA 3E08A 4NUUA 2YINA 2XAHB 2XSBA 3B13A 2LM2A 4PAGA 4U2YA 2VKJA 2UUCT 4QH1A 2XQ8A 2D9DA 2NR4A 4U33A 3JADA 5FL0A 3FXEB 2CXFA 3HKBE 4PK6A 4UR9A 5LBMA 2CEAA 4JI0T 2WY2A 4OYKA 1FEWA 2ACXA 2PJQA 2V5DA 4JI5T 3RIFA 3LJCA 2WWUA 3LK3B 3EHZA 1Y01A 2DI4A 1W9RA 2WDRA 3ZKRA 4X66T 5M4YA 2X66A 2RA1A 3ONJA 1UCUA 5L3EB 5LHHB 4H9PC 2R6GF 3HKCE 2IIUA 4TWFA 5HEHA 5JRCA 2OV9A 4PK4A 3UUMA 2QYWA 2V7KA 5CB4E 4BAYB 4QX8B 4GIWA 3ESLA 3C51A 3N5LA 4ZI7E 4ZZCA 2XQ5A 3A7MA 5HXSA 2LSJA 4YSYA 3KDSE 4PFOA 4YXDA 3CVRA 3P4QA 2BG9E 4X5TA 5IWAT 5HAXA 3H37A 1NEKA 2DWKA 4YTMA 3CPZA 2C0SA 1G8XA 1MMGA 2KT9A 4GK5E 4OHFA 5ADXL 2E5VA 2X51A 3VR9A 5AQSB 5IUXA 1KEYA 3HKEE 2X9WA 3OYZA 2YU1A 4UEMA 2XQ6A 3AEFA 2L8KA 3AE6A 1QSDA 1E1HB 1VOMA 4DNDA 2WMNA 2XQYA 4IDZA 4LF4T 5FY0A 4KI0F 1I6ZA 2BKOA 5HEGA 2PBIA 3ZYLA 1UURA 4YY3T 2D5UA 2E5LT 4AXPA 5JDMA 3UUXB 1IJ6A 2NOXA 1SHZC 1SUMB 3AAAB 4O4HE 5LG3A 3PDYA 4U3CA 2UXXB 5KXJA 3T1YT 2CLYC 5L3CB 3PUXF 1YD8G 2PFVA 2XZEA 4CI3B 1W09A 1I94T 2C5JA 2E9XD 2YDQA 3HI2A 1W0BA 4TNVA 3C4XA 4B3MT 3FB2A 1SA0E 4CXWA 4UVAB 4A56A 2CWYA 1HX8A 4ZS3A 5AQTB 3CX8B 3K1SA 5L4HA 3TLTA 4ZI3D 2EHOB 5FY1A 2BDEA 2V6YB 4Z8XA 5L3GB 3CX6B 4HFHA 4IDPA 5TAOA 4YSZA 1HTJF 1UGOA 2V7MA 2V7JA 2A72A 3L8RA 3N9PA 1D0YA 3KV4A 3AE5A 1VRBA 1T98A 5FKYA 2K48A 2BBHA 4H9RC 3RIUA 3P50A 4GKKT 2XTLA 2VKDA 4PJMA 3RF1A 3R84B 1JNRA 5HWXA 5HEOA 2JMKA 1NENA 2DNXA 3IHRA 4V1Av 5FYMA 3LK2B 3J7Yq 1HG2A 5HCJA 4CI2B 1N36T 2X9YA 2BKNA 2KNDA 2LM9A 3AAIA 1OEDB 2QGSA 3ETVA 4QX7B 5AQVB 5IYZE 4EV6A 3ONXA 2UXNB 4HWFA 3ZC1A 2BBJA 5LG4A 4KX6A 2LSIA 2LKGA 2N1GA 5LHGB 3ZMZB 4DMVA 3VRBA 2WDVA 1O3XA 3Q9DA 1LRZA 4HWCA 3ZMUB 2MOZA 3PUZF 1AJ3A 1FMVA 3Q5EA 1OEDC 5AQMB 4JUYA 2MTQA 4O4JE 4OFZA 3AEDA 1YXRA 2VVSA 2WZIA 4TWDA 2VQET 4YFSA 4DR5T 1IBMT 5LGUB 3X1DA 4YTNA 3LBXA 4F6RC 4U31A 4HFDA 5JTGA 2IC9A 2LJLA 2BS2A 3ZYMA 4KUMB 5FVKA 1H7CA 3RKGA 2J4GA 2X0LB 3NWIA 2YDRA 4H9NC 4Q25A 1CUNA 2NWBA 3KV5A 4N78D 3SS1A 3ZJ1A 3BK9A 2B1EA 3O1JA 2CE7A 2W63A 2XY8B 5L3BB 4X20E 2CBIA 5EK2A 1SE7A 2BVLA 3FBLA 4HFBA 4NPPA 1MMNA 2KINB 3FZFB 2HN2A 5J2UE 5JQGE 5JR9B 3RH3A 5LGTB 3C98B 3S4UA 2DWGA 3UU6A 2WMOA 4ZOLE 2UU9T 4AKRB 5LP6E 4JI8T 1G73A 2B76A 4CN1A 2MBGA 2BS4A 1KFYA 2FJEA 1BR4A 3LFMA 3LK42 4HGAA 4NIQA 4PNIA 3ZMVB 4IT4A 2AE9A 3N2OA 3QK6A 1ZHCA 2YEVC 3TLUA 2CM0A 2H88A 3NRYA 3N9NA 1HNXT 2EHOD 3VHLA 4HFIA 1S94A 4QXHB 2A2FX 3BQLA 2CCQA 2M67A 3I9WA 3P4SA 4B6XA 2LT3A 4JV5T 4IGUA 4EAHA 4QH4A 4I43B 2DLRA 2GK9A 2JJ9A 2H7OA 2C5KT 3B57A 3ABVA 1MNEA 4BJMA 2WSSV 2CRBA 4O2AE 3EABA 4LFAT 2ZM6T 4ZXLA 1E2AA 2VVNA 3LG7A 4OK0A 2BG9B 4DO0A 5BMVE 2WM9A 2NP9A 1XMQT 2Q9QA 3CK6A 3P7IA 4XBFB 2LSYA 3EUHA 5LJNA 2FJAA 4DV6T 4GK0E 1B7TA 2X0YA
chains in the Genus database with same CATH topology
1M7KA 1HX1B 4HWCA 5AQHB 5AQPB 4HWDA 5AQIB 1UGOA 5AQOB 5AQMB 5AQSB 2D9DA 3LDQB 5AQKB 1UK5A 5AQRB 3M3ZB 5AQFB 1I6ZA 5AQUB 5AQLB 3A8YC 5AQVB 3FZLB 5AQNB 4HWIB 5AQGB 4HWFA 1M62A 3FZMB 1T7SA 3FZKB 3FZFB 5AQJB 5AQTB 3FZHB 5AQQB 4HWHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7K A;  1HX1 B;  4HWC A;  5AQH B;  5AQP B;  4HWD A;  5AQI B;  1UGO A;  5AQO B;  5AQM B;  5AQS B;  2D9D A;  3LDQ B;  5AQK B;  1UK5 A;  5AQR B;  3M3Z B;  5AQF B;  1I6Z A;  5AQU B;  5AQL B;  3A8Y C;  5AQV B;  3FZL B;  5AQN B;  4HWI B;  5AQG B;  4HWF A;  1M62 A;  3FZM B;  1T7S A;  3FZK B;  3FZF B;  5AQJ B;  5AQT B;  3FZH B;  5AQQ B;  4HWH A; 
#chains in the Genus database with same CATH topology
 1WR0 A;  2WBL A;  3GMI A;  4HN9 A;  2ACZ A;  2AXD S;  2V26 A;  2XAJ B;  5AQI B;  3ZLI A;  5C3J A;  4DR1 T;  5JDH A;  2CLY B;  4B3S T;  4ZI2 D;  4U7Y A;  3PUY F;  2W4X A;  5HYA A;  4F8H A;  3AE7 A;  3ZYK A;  5JDQ A;  2HHH T;  4IHJ E;  2KZ7 B;  4IDO A;  3NBX X;  2IC6 A;  5AQL B;  1Y64 B;  2ODU A;  4AQF C;  3KV9 A;  1WR6 A;  4WBN E;  5JH7 E;  5ABF B;  1BR0 A;  4KHP T;  4CN4 A;  3AXJ B;  2VWA A;  4PFP A;  3PUV F;  5J0Z A;  4UXN B;  4E7Z A;  4UVB B;  3VRA A;  3F57 A;  4IL4 A;  3SRZ A;  4DMW A;  2PG8 A;  4AQG A;  2BS3 A;  3AEA A;  4UV8 B;  2W66 A;  4IE5 A;  4O4L E;  4HFE A;  4C91 A;  1WFD A;  2JMH A;  3FZH B;  2C5I T;  3UU4 A;  3E22 E;  1UX5 A;  3PJA A;  3AE9 A;  5BR8 T;  3DP7 A;  4JEH B;  3EVY A;  4L5G A;  4QXC B;  4PJL A;  3E0Z A;  4UIG A;  2DL1 A;  2Q9Q B;  1J5E T;  1CHU A;  2IHR 1;  1U5P A;  2I0M A;  2OLT A;  4UF0 A;  3M3Z B;  5AQF B;  1ZKE A;  2M6I A;  3IBP A;  4P09 A;  5HWY A;  2VL8 A;  2LOS A;  1XNQ T;  3UFE A;  3RHW A;  1HCI A;  2ES0 A;  3AA0 B;  3KIN B;  4X64 T;  1OED E;  2X67 A;  2CBJ A;  4ASK A;  3L39 A;  3I0O A;  2XSA A;  4HWI B;  4H9S E;  3AE1 A;  3ZSS A;  4P0A A;  5JRC B;  2H7V C;  1OED A;  4MBQ A;  4BJN A;  1U4Q A;  4I0U A;  1T7S A;  5AQJ B;  4CN6 A;  3OTO T;  2JQK A;  1IJ5 A;  2YKS A;  4ZHQ E;  5ETW A;  2IUB A;  4LMK A;  2LHR A;  4PJN A;  5LMU T;  2LLY A;  3M65 A;  4IE0 A;  3KV6 A;  3PU3 A;  1UK5 A;  2DCF A;  1XDP A;  3CWZ B;  4EXT A;  1IBK T;  3B5M A;  1MIV A;  1D0Z A;  4UF0 B;  4EYU A;  2V1D B;  5KDM C;  5DQV A;  3QB5 K;  4YSX A;  5LJM A;  2E9X C;  4DR6 T;  4U74 A;  3L3P A;  2XQ7 A;  2K3W A;  1YQ4 A;  3O4X E;  4X1Y E;  4HFV A;  4CXY A;  5LBQ B;  3BQK A;  2V8S V;  2I59 A;  3OJA A;  4DUY T;  1HNZ T;  3PUQ A;  3RX6 A;  4DV2 T;  4PW8 A;  1NWM X;  4P0B A;  3RC8 A;  3ANW B;  4O8S A;  4UV9 B;  4DV4 T;  2L3L A;  5F8P A;  3CKD A;  4JI3 T;  4U2Z A;  3CQG B;  1M62 A;  3DJB A;  2WAU A;  4IIJ E;  1QUU A;  4FJO A;  4IDQ A;  4EZH A;  5JDL A;  2VAS A;  3UU8 A;  1QLB A;  4L0R A;  4NXN T;  2LSK A;  4IL9 A;  3T1H T;  4DBR A;  4K0U A;  2YU2 A;  4AQF A;  4YJ3 E;  4EIW A;  4G63 A;  4TN7 B;  1HX1 B;  4KMC A;  1S35 A;  3NKZ A;  5HCM A;  1D0X A;  2CA5 A;  4LF7 T;  3MKD A;  4I4T E;  3AE4 A;  1KK7 A;  4QH5 A;  3PUG A;  1LVF A;  4TV8 E;  5HXE A;  3C50 A;  4WZX A;  4C90 A;  4Z90 A;  2VKH A;  2HH7 A;  3MA9 A;  3FHN A;  1FIO A;  3RI5 A;  4DBQ A;  2MAW A;  2YK0 A;  3AVR A;  3N2K E;  5CGM A;  4DR3 T;  4AI6 A;  3CX7 B;  1Z8U A;  5LA6 E;  1XWM A;  3CIR A;  4TX5 A;  5IHY A;  4A97 A;  4X1I E;  5L3D B;  3KVB A;  3P8C D;  1R8I A;  2WCA A;  2CPT A;  4EED A;  3WAJ A;  3AEG A;  1FMW A;  3KFW X;  4DID B;  3O9X A;  4OX9 T;  3JCF A;  2WU2 A;  3QB5 A;  4CXX A;  2BKP A;  1IZN B;  2HPL A;  1YKH B;  3MJX A;  4TNW A;  4MFR A;  1N32 T;  3PTR B;  2JQ9 A;  3PE0 A;  3UUL A;  5LYJ E;  1N33 T;  1T72 A;  5FVL A;  3BQI A;  4EB6 E;  4DV7 T;  3GA8 A;  4O2B E;  4AQY T;  3ZMS B;  5AQH B;  4CQI A;  2LEH A;  1MIW A;  3GN5 B;  4HWD A;  5DJQ C;  2V7I A;  2W0G A;  2RPA A;  3AE3 A;  5AQP B;  3JAF A;  3OBV E;  3RYH E;  3LSV A;  4DR4 T;  4TWH A;  3PUR A;  2RP4 A;  3EAM A;  1N34 T;  4LML A;  5HXR A;  5L47 A;  2J62 A;  3UTK A;  2NW8 A;  3I9Y A;  3ZT6 A;  4YJ2 E;  4AKH A;  2J47 A;  3A8Y C;  5FXW A;  3ZJ2 A;  1WCR A;  4IE6 A;  1D1A A;  3OPC A;  3OVU A;  3Q5X A;  3RIA A;  4LF9 T;  2VK9 A;  2XQ4 A;  3AA7 B;  4MAL A;  4DV3 T;  1ZEE A;  3P4P A;  4KBM B;  5LOV E;  3C4W A;  3H3A A;  4JI6 T;  1US7 B;  1XMO T;  2LRK A;  3CML A;  2WP9 A;  3O1H A;  5AQG B;  1J5W A;  4M1P A;  3UUB A;  3ANW A;  2WZH A;  3MXZ A;  4WYV A;  3N9O A;  3Q2M A;  4JI2 T;  3JAE A;  3ZCJ A;  4BA9 A;  1MMD A;  1EZ3 A;  3EDU A;  3I0Q A;  4MHC A;  3FZM B;  3IF8 B;  2FUP A;  2Q9Q D;  5FP3 A;  3RLF F;  2EHO A;  2X9X A;  3VU7 H;  3IA3 A;  4EGW A;  2EHO C;  4YTP A;  5KX5 E;  4COF A;  2JIW A;  1MND A;  3ZT7 A;  3RGL A;  2DHR A;  5ABG A;  3RQU A;  5ABE A;  1HR0 T;  3KVA A;  1KF6 A;  3QUJ A;  2D0U A;  4AIU A;  2FJD A;  3K3Q C;  2Y8D A;  5E0O A;  4LF8 T;  4JEU B;  4AIS A;  2XAQ B;  1FJG T;  2WS3 A;  3ETU A;  1KNR A;  5JR9 C;  2G0U A;  2LRL A;  3RYC E;  3ZST A;  4AKI A;  4JBW F;  5JR9 A;  4LF5 T;  4TZ4 C;  5JVD E;  4H9O C;  4YHH T;  1GQE A;  2D2S A;  3TLV A;  3IEE A;  3NZP A;  2XQ9 A;  3ONL C;  4ILC A;  2W00 A;  2MYS A;  2LE8 A;  2YN6 A;  1WRD A;  4JLE A;  4DR7 T;  4DV1 T;  1WYC A;  4PK5 A;  4AKL A;  4DR2 T;  4YHJ A;  2KWH A;  4GOU A;  4A5X A;  3UT5 E;  2XM2 A;  3F31 A;  3UU3 A;  5FXX A;  3NRX A;  2HPJ A;  5ABH A;  4ZS2 A;  5LCY A;  2E9X A;  2XPK A;  1ZP0 A;  1JNZ A;  1J1J A;  1W0A A;  3QC9 A;  4TUY E;  3AE2 A;  5LGN B;  4JI4 T;  5ABF A;  4AKG A;  2BG9 A;  1D1C A;  2V6X A;  4I50 E;  3AXJ A;  3PU8 A;  4EYY R;  4X62 T;  1HFA A;  4H63 H;  1OWA A;  2QA7 A;  1UX4 A;  4L9I A;  2IDO B;  4UVC B;  2P9B A;  3ZMT B;  2XAF B;  1Z0P A;  1X79 A;  4IRE A;  3UU5 A;  5L3F B;  1BR2 A;  4JYA T;  3MZK B;  3VKG A;  4ZI2 C;  3UQ7 A;  4QHO A;  2XUE A;  3CQX C;  3JC6 C;  1LKX A;  3TKL B;  4J2C A;  5LHI B;  2UXD T;  2H89 A;  4LFC T;  3FZL B;  5AQN B;  2W2U A;  4TV9 E;  3AVS A;  3N2G E;  4XZC A;  2N2N A;  2L9Q A;  2LSG A;  3AEE A;  5LMN T;  2CHO A;  3AB3 B;  4KHZ F;  3RRW A;  3SFE A;  3HKD E;  3DTO A;  1VCS A;  4P1N A;  3N9L A;  2ZM2 A;  3AAE B;  4ZEY A;  2UUA T;  3T8O A;  4HKA A;  3L09 A;  3MAC A;  1M7K A;  5L2L A;  4CI1 B;  2WDQ A;  4QWN B;  2X68 A;  4O4I E;  2ODV A;  4FI5 A;  1MIY A;  2ZMA A;  5FY7 A;  3RYF E;  4X65 T;  3OYX A;  5KMG P;  2W61 A;  2ZM8 A;  2E8I A;  2E2A A;  3EDV A;  4HE8 A;  4I55 E;  3P4W A;  5AFU L;  3O1I A;  4ZI3 C;  2IAK A;  3G06 A;  4ILB A;  2JQQ A;  5EK3 A;  5FXZ A;  2V6Y A;  5LB7 B;  2NW9 A;  5HXH A;  3ZN0 B;  4DV5 T;  4YT0 A;  3Q5W A;  2PTF A;  4A98 A;  2UXB T;  1XZY A;  2K9A A;  5F5W A;  3WAK A;  2XJ7 A;  3Q5D A;  2VQF T;  5CJ5 A;  4CZZ B;  3U78 A;  5JRE A;  2W62 A;  1KNP A;  3OKQ A;  5EK4 A;  5FMN A;  1WLX A;  2A3D A;  4HFC A;  2KXP B;  3QOF A;  4U7I A;  1L0V A;  4EEB A;  5C2T A;  5CA1 E;  2ZLY A;  4KP3 C;  2UXC T;  3TLS A;  3P4R A;  5C8Y E;  5FL1 A;  2CXD A;  1E7P A;  2A9U A;  4MLK A;  2K24 A;  4JI1 T;  3W15 B;  3ZPO A;  4EOZ B;  4UEL A;  3D0T A;  1LVK A;  3A5X A;  5GON E;  5J1G A;  4E7S A;  1ZV4 X;  4ZZB A;  1YKE B;  2D0T A;  5FXV A;  5AQO B;  3AEC A;  3C64 A;  2Y48 B;  2NTY A;  3V5U A;  3AE8 A;  2Y6X A;  2X0H A;  2XHE B;  3SOL A;  3C4Z A;  3UUN A;  3WI3 A;  3H3M A;  3EI0 A;  2N9D A;  4G2A A;  1XDO A;  3RC3 A;  2XQA A;  3K3N A;  4IE7 A;  5H6Q B;  4DVD A;  2XAG B;  3PUA A;  3I1A A;  5CA0 E;  2SPC A;  2CHN A;  2H3R A;  3ZT5 A;  4DUZ T;  3FBZ A;  2KWI B;  4ADZ A;  4B3T T;  1HNW T;  5HEU A;  3RPU A;  3UQ4 A;  3ZEF B;  4XAX B;  3QNU A;  4ANJ A;  4U72 A;  1T8B A;  5J2T E;  2CXL A;  2JPF A;  2VKO A;  5AQQ B;  4HWH A;  5F3J A;  2WU5 A;  2QRX A;  2KMF A;  3HA4 A;  5JDN A;  1D1B A;  2YDS A;  5JDG A;  1BR1 A;  2IW5 B;  4X1K E;  4NUV A;  2CMR A;  2BZB A;  3LDQ B;  1HF8 A;  1X9B A;  3CQC B;  3KBT A;  4H63 V;  4LFB T;  2IML A;  3UFG A;  1VCT A;  4ILA A;  2YOE A;  1ZOY A;  3AEB A;  4ILU A;  4WW0 A;  2E9X B;  3PJA J;  2WWV A;  4YLH A;  3ZCI A;  4LF6 T;  3V5S A;  4IDN A;  1YW0 A;  2FJB A;  2J1D G;  2WQY A;  3FXD B;  3K8P C;  1IAP A;  4GYS A;  4ISS A;  4EZ4 A;  1V9D A;  2LKH A;  2VB6 A;  4IST A;  3JC6 D;  3VR8 A;  2F4V T;  5H6R B;  2JQH A;  2BVM A;  2Q9Q C;  3F2E A;  3SFD A;  1DU2 A;  1YQ3 A;  4WNK A;  2OA5 A;  1UUS A;  2V5C A;  2BG9 C;  3N9M A;  5FNV E;  3RRC A;  3K3O A;  1IBL T;  3R6N A;  3NVO A;  3HR0 A;  3NZQ A;  5L4E A;  4B3R T;  2XAS B;  4QXB B;  4WBO A;  2K5B B;  3ZN1 B;  5A1L A;  4HTE A;  3KBU A;  5EZY E;  3VKH A;  2LHN A;  2MPK A;  3SWH A;  4HEA A;  2M6B A;  2XM1 A;  2VUR A;  3AA1 B;  2XQ3 A;  3HL6 A;  5AQK B;  4QKN A;  4ERR A;  4K0K T;  1WYB A;  1KNZ A;  1HG5 A;  5AQR B;  2I6H A;  2LOP A;  2NW7 A;  3N9Q A;  5HXC A;  2ZM0 A;  5LNK A;  5JDF A;  1NAF A;  2NTX A;  4JI7 T;  2X9H A;  1MMA A;  2JRK A;  4H9Q C;  3AA6 B;  2VL0 A;  5AQU B;  3RYI E;  2UUB T;  3PUW F;  4OYJ A;  3RKO A;  2Z6E A;  3TLW A;  2V7L A;  3PV0 F;  3MK7 C;  4GYR A;  3GWH A;  3ZC0 A;  3U3I A;  3GN5 A;  5DAB A;  1XNR T;  2CWO A;  2WB5 A;  2HN1 A;  4LMJ A;  1HS7 A;  2KLQ A;  2KSR A;  1OXZ A;  3J9X 1;  4GKJ T;  3LBX B;  5DQW A;  3RIU C;  4DV0 T;  4NXM T;  2W67 A;  3PUS A;  4IE4 A;  3FZK B;  4PJJ A;  5LXT E;  5CFB A;  4Z91 A;  3RQW A;  5HEJ A;  2FBW A;  2QVA A;  3E08 A;  4NUU A;  2YIN A;  2XAH B;  2XSB A;  3B13 A;  2LM2 A;  4PAG A;  4U2Y A;  2VKJ A;  2UUC T;  4QH1 A;  2XQ8 A;  2D9D A;  2NR4 A;  4U33 A;  3JAD A;  5FL0 A;  3FXE B;  2CXF A;  3HKB E;  4PK6 A;  4UR9 A;  5LBM A;  2CEA A;  4JI0 T;  2WY2 A;  4OYK A;  1FEW A;  2ACX A;  2PJQ A;  2V5D A;  4JI5 T;  3RIF A;  3LJC A;  2WWU A;  3LK3 B;  3EHZ A;  1Y01 A;  2DI4 A;  1W9R A;  2WDR A;  3ZKR A;  4X66 T;  5M4Y A;  2X66 A;  2RA1 A;  3ONJ A;  1UCU A;  5L3E B;  5LHH B;  4H9P C;  2R6G F;  3HKC E;  2IIU A;  4TWF A;  5HEH A;  5JRC A;  2OV9 A;  4PK4 A;  3UUM A;  2QYW A;  2V7K A;  5CB4 E;  4BAY B;  4QX8 B;  4GIW A;  3ESL A;  3C51 A;  3N5L A;  4ZI7 E;  4ZZC A;  2XQ5 A;  3A7M A;  5HXS A;  2LSJ A;  4YSY A;  3KDS E;  4PFO A;  4YXD A;  3CVR A;  3P4Q A;  2BG9 E;  4X5T A;  5IWA T;  5HAX A;  3H37 A;  1NEK A;  2DWK A;  4YTM A;  3CPZ A;  2C0S A;  1G8X A;  1MMG A;  2KT9 A;  4GK5 E;  4OHF A;  5ADX L;  2E5V A;  2X51 A;  3VR9 A;  5AQS B;  5IUX A;  1KEY A;  3HKE E;  2X9W A;  3OYZ A;  2YU1 A;  4UEM A;  2XQ6 A;  3AEF A;  2L8K A;  3AE6 A;  1QSD A;  1E1H B;  1VOM A;  4DND A;  2WMN A;  2XQY A;  4IDZ A;  4LF4 T;  5FY0 A;  4KI0 F;  1I6Z A;  2BKO A;  5HEG A;  2PBI A;  3ZYL A;  1UUR A;  4YY3 T;  2D5U A;  2E5L T;  4AXP A;  5JDM A;  3UUX B;  1IJ6 A;  2NOX A;  1SHZ C;  1SUM B;  3AAA B;  4O4H E;  5LG3 A;  3PDY A;  4U3C A;  2UXX B;  5KXJ A;  3T1Y T;  2CLY C;  5L3C B;  3PUX F;  1YD8 G;  2PFV A;  2XZE A;  4CI3 B;  1W09 A;  1I94 T;  2C5J A;  2E9X D;  2YDQ A;  3HI2 A;  1W0B A;  4TNV A;  3C4X A;  4B3M T;  3FB2 A;  1SA0 E;  4CXW A;  4UVA B;  4A56 A;  2CWY A;  1HX8 A;  4ZS3 A;  5AQT B;  3CX8 B;  3K1S A;  5L4H A;  3TLT A;  4ZI3 D;  2EHO B;  5FY1 A;  2BDE A;  2V6Y B;  4Z8X A;  5L3G B;  3CX6 B;  4HFH A;  4IDP A;  5TAO A;  4YSZ A;  1HTJ F;  1UGO A;  2V7M A;  2V7J A;  2A72 A;  3L8R A;  3N9P A;  1D0Y A;  3KV4 A;  3AE5 A;  1VRB A;  1T98 A;  5FKY A;  2K48 A;  2BBH A;  4H9R C;  3RIU A;  3P50 A;  4GKK T;  2XTL A;  2VKD A;  4PJM A;  3RF1 A;  3R84 B;  1JNR A;  5HWX A;  5HEO A;  2JMK A;  1NEN A;  2DNX A;  3IHR A;  4V1A v;  5FYM A;  3LK2 B;  3J7Y q;  1HG2 A;  5HCJ A;  4CI2 B;  1N36 T;  2X9Y A;  2BKN A;  2KND A;  2LM9 A;  3AAI A;  1OED B;  2QGS A;  3ETV A;  4QX7 B;  5AQV B;  5IYZ E;  4EV6 A;  3ONX A;  2UXN B;  4HWF A;  3ZC1 A;  2BBJ A;  5LG4 A;  4KX6 A;  2LSI A;  2LKG A;  2N1G A;  5LHG B;  3ZMZ B;  4DMV A;  3VRB A;  2WDV A;  1O3X A;  3Q9D A;  1LRZ A;  4HWC A;  3ZMU B;  2MOZ A;  3PUZ F;  1AJ3 A;  1FMV A;  3Q5E A;  1OED C;  5AQM B;  4JUY A;  2MTQ A;  4O4J E;  4OFZ A;  3AED A;  1YXR A;  2VVS A;  2WZI A;  4TWD A;  2VQE T;  4YFS A;  4DR5 T;  1IBM T;  5LGU B;  3X1D A;  4YTN A;  3LBX A;  4F6R C;  4U31 A;  4HFD A;  5JTG A;  2IC9 A;  2LJL A;  2BS2 A;  3ZYM A;  4KUM B;  5FVK A;  1H7C A;  3RKG A;  2J4G A;  2X0L B;  3NWI A;  2YDR A;  4H9N C;  4Q25 A;  1CUN A;  2NWB A;  3KV5 A;  4N78 D;  3SS1 A;  3ZJ1 A;  3BK9 A;  2B1E A;  3O1J A;  2CE7 A;  2W63 A;  2XY8 B;  5L3B B;  4X20 E;  2CBI A;  5EK2 A;  1SE7 A;  2BVL A;  3FBL A;  4HFB A;  4NPP A;  1MMN A;  2KIN B;  3FZF B;  2HN2 A;  5J2U E;  5JQG E;  5JR9 B;  3RH3 A;  5LGT B;  3C98 B;  3S4U A;  2DWG A;  3UU6 A;  2WMO A;  4ZOL E;  2UU9 T;  4AKR B;  5LP6 E;  4JI8 T;  1G73 A;  2B76 A;  4CN1 A;  2MBG A;  2BS4 A;  1KFY A;  2FJE A;  1BR4 A;  3LFM A;  3LK4 2;  4HGA A;  4NIQ A;  4PNI A;  3ZMV B;  4IT4 A;  2AE9 A;  3N2O A;  3QK6 A;  1ZHC A;  2YEV C;  3TLU A;  2CM0 A;  2H88 A;  3NRY A;  3N9N A;  1HNX T;  2EHO D;  3VHL A;  4HFI A;  1S94 A;  4QXH B;  2A2F X;  3BQL A;  2CCQ A;  2M67 A;  3I9W A;  3P4S A;  4B6X A;  2LT3 A;  4JV5 T;  4IGU A;  4EAH A;  4QH4 A;  4I43 B;  2DLR A;  2GK9 A;  2JJ9 A;  2H7O A;  2C5K T;  3B57 A;  3ABV A;  1MNE A;  4BJM A;  2WSS V;  2CRB A;  4O2A E;  3EAB A;  4LFA T;  2ZM6 T;  4ZXL A;  1E2A A;  2VVN A;  3LG7 A;  4OK0 A;  2BG9 B;  4DO0 A;  5BMV E;  2WM9 A;  2NP9 A;  1XMQ T;  2Q9Q A;  3CK6 A;  3P7I A;  4XBF B;  2LSY A;  3EUH A;  5LJN A;  2FJA A;  4DV6 T;  4GK0 E;  1B7T A;  2X0Y A; 
#chains in the Genus database with same CATH homology
 1M7K A;  1HX1 B;  4HWC A;  5AQH B;  5AQP B;  4HWD A;  5AQI B;  1UGO A;  5AQO B;  5AQM B;  5AQS B;  2D9D A;  3LDQ B;  5AQK B;  1UK5 A;  5AQR B;  3M3Z B;  5AQF B;  1I6Z A;  5AQU B;  5AQL B;  3A8Y C;  5AQV B;  3FZL B;  5AQN B;  4HWI B;  5AQG B;  4HWF A;  1M62 A;  3FZM B;  1T7S A;  3FZK B;  3FZF B;  5AQJ B;  5AQT B;  3FZH B;  5AQQ B;  4HWH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...