1YD8G

Complex of human gga3 gat domain and ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
GIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural mechanism for ubiquitinated-cargo recognition by the Golgi-localized, {gamma}-ear-containing, ADP-ribosylation-factor-binding proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, chromosomal protein
molecule keywords UBIQUIN
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yd8G00
2N2NA 1O3XA 1X79A 1NWMX 1WRDA 1YD8G 1WR6A 2N9DA 1OXZA 1NAFA
chains in the Genus database with same CATH superfamily
5DQVA 1NEKA 2D0UA 4DV1T 2WMOA 4YJ2E 2CRBA 4CXXA 3V5SA 2LM2A 3AEFA 4GK0E 5BMVE 1HS7A 3CIRA 2MPKA 2SPCA 3GN5B 3PUGA 2WP9A 3OTOT 2CWOA 2XQAA 5L3FB 1NENA 4CXYA 2ZM6T 4HKAA 5FY1A 2MTQA 4TN7B 4UV8B 5AQNB 3QC9A 5BR8T 4B3TT 1V9DA 3AE6A 4TUYE 2WWVA 3UUNA 2UXDT 2M6BA 4PAGA 2HHHT 3RC3A 4X65T 3FZFB 3OYXA 2V7JA 4OX9T 4G63A 4DIDB 2B76A 2JRKA 3PV0F 2MOZA 5FXVA 5AQSB 2BVLA 2XAHB 4U2ZA 4CZZB 2LHNA 1JNRA 2QYWA 3A8YC 5HAXA 2CHNA 4I0UA 1LRZA 4DNDA 2X0HA 3JCFA 5FVLA 3ZJ1A 3A7MA 3PDYA 2UXNB 2WBLA 2PG8A 2N9DA 5E0OA 5LXTE 3B57A 3OKQA 2Y8DA 5ETWA 5ABFA 2N1GA 5LGNB 2YU2A 2CWYA 2VKDA 3A5XA 3ZJ2A 1HCIA 3ZSSA 2D5UA 4TX5A 1KNRA 3LFMA 5JRCB 3AAAB 1T72A 4HWCA 5L2LA 4ADZA 3P4PA 4AQGA 2J1DG 2G0UA 2NW8A 3DJBA 1D0YA 3VRAA 3UUMA 3ZT7A 4UXNB 3HA4A 4U3CA 3UU4A 2VWAA 3PE0A 2XSBA 4CI1B 2OA5A 2DL1A 3N9QA 2YDQA 2V7KA 1OEDB 5J1GA 3PUQA 4DV6T 2LRLA 4BJMA 5L3EB 2BBHA 4IL9A 3EAMA 5LNKA 4JI1T 1Z8UA 3KVAA 4JYAT 4X64T 2H3RA 3LDQB 4F8HA 1IJ5A 2C5IT 4QXBB 3DP7A 3UU8A 2VVSA 2XPKA 2WWUA 3T1YT 4JI6T 3CWZB 2Q9QD 3LBXA 4BJNA 4TV9E 1WR6A 2XQ3A 2A72A 2RPAA 2XJ7A 3BQIA 5HEOA 5CGMA 2JQKA 2WB5A 3IHRA 4QXCB 4BA9A 1HNWT 1MIWA 1M62A 2A2FX 3NRYA 4U74A 3ZCIA 4CQIA 4LMJA 4LF9T 4IHJE 2YN6A 4IT4A 2CLYB 3KBUA 1Z0PA 4JBWF 3MJXA 1AJ3A 3N5LA 3KV4A 4UF0A 3M3ZB 1HFAA 3J9X1 3ZLIA 3ZT6A 4C90A 2LKGA 4P0AA 3R84B 2KLQA 2LOSA 3MACA 4DUYT 2Q9QA 2XQ9A 3AECA 4UVBB 4CN6A 4WZXA 4AKLA 3LBXB 1WLXA 2QGSA 2LRKA 3AE2A 2D0TA 3AE4A 4O4IE 4ZXLA 4GK5E 3TLVA 5J2TE 3ZN0B 4X1IE 1I94T 3UU5A 4GOUA 2ZMAA 3NBXX 4IDPA 3ZYKA 2X66A 1XNQT 2FJBA 2CEAA 1I6ZA 2A9UA 1MIYA 3Q2MA 4ZS3A 2VKJA 3UQ4A 2PFVA 2VB6A 2GK9A 3N9LA 3ZPOA 2LSJA 1EZ3A 2LJLA 4L9IA 4Z91A 4XAXB 4P1NA 3SOLA 5AFUL 2VK9A 5KXJA 5LMNT 5JREA 2BVMA 2K24A 1R8IA 2Q9QC 4HEAA 3RRWA 3ZT5A 1QUUA 4ANJA 4ZEYA 2Z6EA 2X0YA 3MA9A 4P0BA 5GONE 2DNXA 2Q9QB 4H9NC 4KHPT 5IUXA 5H6QB 5JVDE 2LSGA 3EHZA 3TLUA 5C2TA 5J2UE 3UT5E 4ERRA 4KI0F 4DR3T 2V7MA 3CQXC 3H3MA 4A56A 2X0LB 3TLWA 3VRBA 2BS2A 2IUBA 3B5MA 3OBVE 4EYYR 4HWIB 3FZMB 2AE9A 3K3OA 2HH7A 2E5VA 2XAJB 4KHZF 3IBPA 5A1LA 1N36T 4YSXA 3PUAA 3JAFA 5HWYA 4QXHB 3L3PA 3KINB 4OYKA 3TLTA 1UX4A 2BG9C 3N2KE 4ZS2A 2OV9A 3QNUA 3U78A 2VL8A 4JUYA 2WAUA 3OYZA 2XUEA 3AA0B 1HG2A 2E9XC 2NR4A 4PK5A 5HXSA 5LHIB 3ZC0A 3F2EA 1Y01A 3EDUA 3FZLB 5FP3A 1XMOT 2WQYA 2FJAA 4PJJA 3V5UA 3ZMTB 5L4EA 2W63A 4U7IA 4WYVA 2UUAT 1W0BA 2ACXA 2W2UA 2ACZA 3N2OA 4NIQA 3AAEB 4MBQA 1UCUA 5AQMB 2RP4A 2CLYC 1D1CA 2L9QA 2KZ7B 2XQ6A 3AEEA 3O9XA 4LF4T 4K0UA 2UXBT 2XHEB 2H89A 3O1IA 3WI3A 2HN2A 3KVBA 4JEHB 3AVSA 5HEJA 4ZZBA 4PW8A 3L39A 5FMNA 4H9OC 5HXCA 3AVRA 5FXWA 5HXEA 1IBLT 2XQ8A 4AQFA 4KP3C 5KMGP 1UGOA 2L3LA 2UXXB 3T8OA 2CM0A 2JJ9A 3D0TA 5LGTB 5JRCA 1BR2A 4KBMB 3AEGA 3EABA 1W9RA 1YW0A 2C5JA 3TLSA 2QVAA 2FUPA 2ZM0A 3KV6A 1WCRA 2XTLA 4IE5A 3Q9DA 3LSVA 4AQFC 2W61A 2DHRA 4V1Av 2D9DA 2WZHA 4NXMT 5HCMA 3ANWB 1VCSA 2V5CA 4ILBA 3O1JA 1N33T 3VKGA 2JQHA 2LOPA 1YKHB 3RIUA 3ZCJA 2DI4A 2CPTA 4GYRA 4KMCA 4TWDA 3ONJA 1E1HB 5JH7E 4B3MT 3P4WA 2H88A 2XQ7A 1SA0E 3FBZA 4O8SA 5AQHB 3RX6A 4PNIA 5JDLA 3H3AA 2D2SA 3N2GE 4IE6A 4ZHQE 5F3JA 4JI7T 4JV5T 2X9XA 1LKXA 2KXPB 4UIGA 5ABHA 3ABVA 4OHFA 3P4QA 5LHHB 5L47A 1VRBA 2JIWA 1JNZA 2CMRA 3AEAA 3L09A 2IAKA 2C5KT 2BG9A 4AKHA 4JI2T 2W67A 3AAIA 1BR4A 1ZEEA 3FXDB 3Q5EA 1HNXT 2IMLA 3MZKB 2ZM2A 2Y6XA 3GWHA 4I43B 5FXXA 1SUMB 3PUWF 4ZI3C 3IA3A 3AE9A 5FNVE 4ZI2C 2X9HA 3RQUA 2E5LT 2I0MA 3E22E 3AE5A 3RYFE 4UF0B 2IC6A 4Z90A 3RHWA 3PJAA 4ZI3D 2PJQA 4UEMA 2A3DA 2BZBA 4CXWA 5JR9C 4NUVA 2E9XD 5AQOB 2P9BA 3AA6B 5F5WA 2ES0A 5AQJB 3RC8A 2VVNA 3RF1A 2CE7A 1ZKEA 4CI2B 4DV2T 4H9RC 1VOMA 3HKDE 2BG9E 3KBTA 4H9PC 4IE0A 1HTJF 5DJQC 2I59A 1BR0A 2LEHA 4YSYA 2WM9A 5JDFA 5L4HA 3VR8A 3KFWX 4DO0A 1H7CA 1HR0T 3I1AA 3C4XA 4H9SE 5EK4A 4BAYB 3H37A 4ISSA 3ESLA 4YSZA 3LJCA 2NTXA 3P4RA 1HX8A 5EK3A 2ODUA 2VKHA 4QH5A 4KX6A 4EGWA 1MMAA 2WCAA 2KWHA 1OXZA 3UU6A 2JMKA 3AB3B 4HFDA 3AXJB 4ZI2D 3HKEE 3P7IA 2V5DA 4HWFA 2CBIA 4B3ST 2WDRA 2XAGB 2W66A 3ETVA 2XASB 2JQ9A 1HF8A 4WBOA 1DU2A 1KFYA 3N9OA 1T8BA 2XAQB 2LE8A 5JR9A 5FY0A 4EOZB 1NWMX 3SWHA 2CCQA 1X9BA 1WYCA 2BS4A 3TKLB 5LP6E 2K3WA 3HL6A 4NUUA 4HFVA 4U7YA 4QH1A 4PK6A 5HXRA 2J47A 3ZEFB 5AQRB 2BDEA 5C8YE 5FL1A 2XQ5A 2W00A 2XZEA 2F4VT 3UFGA 2DLRA 1MMGA 4HE8A 4ISTA 5ADXL 4EEDA 4X62T 3FZKB 3UTKA 1N34T 2IDOB 3ZYLA 3L8RA 3QOFA 4HTEA 1KF6A 5LOVE 1O3XA 3ZMUB 1YQ4A 5L3DB 4IDZA 2XSAA 4AKIA 4CN4A 2Y48B 3UU3A 2IW5B 4COFA 4O2BE 4K0KT 1LVKA 3G06A 4X1KE 4TWFA 5HEGA 4IDOA 5AQVB 2LSIA 3I9WA 4FI5A 3OVUA 4HWDA 5H6RB 2LHRA 4TNVA 3JADA 3WAKA 4I4TE 3I9YA 4ZOLE 3AEBA 3ZN1B 2QRXA 4WNKA 4EXTA 3AA1B 4IGUA 4AISA 2YKSA 2X51A 5JDHA 4JI0T 2N2NA 1MMNA 4HFHA 1OEDA 1FIOA 4KUMB 4EYUA 5LCYA 3ZMSB 4HWHA 4IE4A 4B6XA 4HFEA 2E2AA 5JR9B 4DV0T 2EHOB 2JQQA 1MNEA 3BQLA 2IHR1 1WR0A 4OK0A 4TZ4C 5LA6E 2BS3A 3QB5K 4CN1A 1YKEB 2CXLA 3E0ZA 4YHHT 3PU3A 5AQTB 5LB7B 1FJGT 2C0SA 2V1DB 5AQPB 2NTYA 5DQWA 3CX8B 4N78D 1FEWA 3U3IA 5AQUB 4IL4A 2VQFT 5L3CB 5AQQB 1OWAA 3CQGB 3Q5DA 1YXRA 3AE7A 3Q5WA 3LK42 4HFCA 5LJNA 5CFBA 2XQ4A 2ZM8A 3AA7B 3N9MA 3FZHB 3NWIA 2NW9A 5LBQB 3RKGA 4YY3T 2V8SV 3CX6B 2V6XA 4L0RA 4YTMA 2H7VC 2LSKA 3CVRA 2L8KA 4OYJA 4YLHA 5LYJE 1WRDA 2MAWA 2W62A 3PURA 4E7SA 3UUBA 3J7Yq 4DR4T 5KX5E 1U5PA 2FJDA 3B13A 3CQCB 4YTPA 2HN1A 3NKZA 1OEDE 2MBGA 3ZMZB 1UURA 1ZV4X 2ODVA 2EHOA 3BQKA 1CHUA 4PFOA 3KV5A 4EAHA 2CA5A 5IYZE 4LFCT 1XMQT 2NP9A 4LFAT 2E9XA 3PTRB 2VQET 3OPCA 2J4GA 3WAJA 2W0GA 3HI2A 3PUYF 5L3GB 1HX1B 3PUSA 1N32T 3M65A 5IHYA 5JDQA 1E7PA 3UQ7A 4LF5T 1IZNB 2KWIB 3EDVA 1NAFA 2LSYA 3NVOA 3P50A 2J62A 3MKDA 3OJAA 4LMLA 5FL0A 3RI5A 3UFEA 4Z8XA 1D0XA 5AQIB 5EK2A 2LKHA 3PUXF 2B1EA 2HPLA 4B3RT 2CXDA 2YU1A 1FMVA 4DV3T 2EHOD 2UUBT 1SHZC 4YT0A 2IC9A 1HNZT 2VKOA 2YOEA 2VL0A 1Y64B 4ASKA 3C64A 3S4UA 1IBMT 4JI3T 2YINA 2KINB 4ILUA 4QHOA 5JDNA 3P8CD 5JQGE 4O4JE 3GA8A 4U31A 2XM2A 4LF7T 1CUNA 4TWHA 2RA1A 4YFSA 2AXDS 2BBJA 5M4YA 3JC6D 1LVFA 1IAPA 3RPUA 2KMFA 3AXJA 1KK7A 2FBWA 2VURA 4DUZT 5CB4E 4WW0A 2PBIA 3F31A 4YJ3E 1SE7A 4JI5T 4UVAB 4X1YE 2OLTA 3E08A 3NZPA 4JLEA 4MHCA 1G73A 5AQFB 4LF6T 1KEYA 1QSDA 3HR0A 3QK6A 5FKYA 5HXHA 2UXCT 3GMIA 3KDSE 4FJOA 4LF8T 2M6IA 2CXFA 4WBNE 3I0OA 1XWMA 3FHNA 1XDPA 2WU2A 5LJMA 5F8PA 4TNWA 1FMWA 4PFPA 3K8PC 5ABFB 3RIFA 2DWGA 4DV4T 1T98A 3ETUA 4EZ4A 5CA0E 1ZP0A 5LG4A 1KNPA 3HKCE 3KV9A 3DTOA 4DBQA 2UU9T 1QLBA 4DR2T 3NRXA 3ONLC 3PJAJ 4QKNA 3IEEA 3K3QC 3O4XE 4YTNA 3EVYA 4IREA 5LMUT 2K9AA 2WS3A 4XBFB 3PUVF 3RKOA 3JAEA 5CJ5A 4IIJE 4EEBA 3C4WA 3C98B 3I0QA 3O1HA 3AE8A 1UK5A 4GIWA 3CPZA 3X1DA 4F6RC 4DV5T 1KNZA 1UX5A 2QA7A 2MYSA 4X5TA 1D1BA 3T1HT 3C51A 5LG3A 3GN5A 3HKBE 1T7SA 2XM1A 3RYCE 2NW7A 2ZLYA 4MLKA 3CX7B 4O4HE 3MK7C 5FY7A 3SFEA 4PJNA 3RGLA 3AE3A 4HGAA 5DABA 4Q25A 4MALA 2KSRA 2E9XB 3FXEB 4NPPA 5LHGB 4AI6A 4H9QC 5TAOA 3ZMVB 3K3NA 1S35A 4I50E 3ZC1A 4TV8E 2UUCT 2BKOA 2E8IA 5FYMA 3ANWA 1ZHCA 2IIUA 2XAFB 1VCTA 4ZZCA 4DR7T 3RRCA 1YD8G 4H63V 4L5GA 1S94A 4U72A 4AIUA 4DV7T 1XDOA 4ZI7E 1J1JA 2R6GF 1HG5A 3AEDA 3RLFF 3VKHA 4HFIA 4DR6T 4YXDA 1U4QA 3F57A 4PJLA 2EHOC 4X66T 4DR5T 2X68A 2DCFA 3PU8A 4JI8T 4EB6E 1X79A 2LLYA 4EV6A 3RYHE 5EZYE 2M67A 3W15B 5IWAT 2XQYA 5AQLB 1GQEA 5LBMA 3N9NA 4UR9A 2YEVC 3NZQA 3RIUC 2WY2A 3ZKRA 5KDMC 2X67A 2CBJA 5HEHA 5FXZA 3ZYMA 5C3JA 1E2AA 1OEDC 2XY8B 1WYBA 1XZYA 4ILAA 2K5BB 4J2CA 4JEUB 2PTFA 4A5XA 4AKRB 1UUSA 2CHOA 5JTGA 4G2AA 2LT3A 4O4LE 5J0ZA 3AE1A 2V6YB 3LK3B 4IDQA 4YHJA 1WFDA 1M7KA 3QUJA 1IJ6A 2FJEA 2W4XA 4IDNA 1B7TA 3UUXB 4A98A 4AXPA 2LM9A 2JPFA 3ZSTA 1YQ3A 1IBKT 3P4SA 4I55E 4EIWA 1MIVA 2X9WA 4UV9B 2DWKA 3C4ZA 3K1SA 2HPJA 2I6HA 2WSSV 4MFRA 4X20E 3IF8B 1MMDA 3RH3A 3SS1A 5AQKB 1D1AA 4DMVA 3SFDA 4AKGA 1W09A 2V7IA 4LMKA 3CKDA 3CMLA 4OFZA 2X9YA 1J5WA 4PK4A 4U2YA 4DBRA 4NXNT 3FB2A 1L0VA 2V7LA 4QX7B 3MXZA 4GKJT 4GKKT 4QH4A 2VASA 1D0ZA 3PUZF 3RYIE 4DMWA 1US7B 2BKPA 2BKNA 4HN9A 1W0AA 2JMHA 3VU7H 5LGUB 4AQYT 4CI3B 3BK9A 5JDMA 2V6YA 4H63H 3LG7A 2BG9B 3SRZA 2KT9A 4GYSA 5CA1E 4M1PA 5L3BB 4QWNB 2WMNA 3LK2B 4QX8B 3CK6A 3Q5XA 4UVCB 2YK0A 5AQGB 5ABEA 1BR1A 3RQWA 3FBLA 1J5ET 1MNDA 2H7OA 4JI4T 3UULA 2WU5A 4DVDA 3VHLA 4E7ZA 1ZOYA 2KNDA 4LFBT 4U33A 2K48A 3VR9A 2NOXA 5ABGA 4DR1T 2V26A 4PJMA 3N9PA 4IE7A 5HWXA 2WZIA 4C91A 4HFBA 5HYAA 5HCJA 3RIAA 4ILCA 4EZHA 2WDQA 2YDSA 5JDGA 5FVKA 4O2AE 4XZCA 4A97A 2WDVA 1XNRT 3C50A 2NWBA 3EUHA 3ONXA 4P09A 3QB5A 2YDRA 3JC6C 4UELA 1G8XA 3EI0A 3R6NA 5HEUA
chains in the Genus database with same CATH topology
5DQVA 2D0UA 2WMOA 4YJ2E 4CXXA 3V5SA 4GK0E 5BMVE 1HS7A 2SPCA 3GN5B 3PUGA 2CWOA 5L3FB 4CXYA 4HKAA 5FY1A 2MTQA 4TN7B 4UV8B 3QC9A 1V9DA 4TUYE 3UUNA 4PAGA 3RC3A 3OYXA 2V7JA 4G63A 4XBFB 2JRKA 4CZZB 2MOZA 4EZHA 2BVLA 2XAHB 2LHNA 5HAXA 4DNDA 1LRZA 3ZJ1A 3PDYA 2UXNB 2WBLA 2PG8A 2N9DA 5E0OA 5LXTE 3B57A 3OKQA 2Y8DA 5ETWA 2N1GA 5LGNB 2YU2A 2CWYA 2VKDA 3A5XA 3ZJ2A 1HCIA 2D5UA 4TX5A 3LFMA 5JRCB 3AAAB 5L2LA 4ADZA 4AQGA 2J1DG 2G0UA 2NW8A 3DJBA 1D0YA 3UUMA 4UXNB 3HA4A 4CI1B 2VWAA 3PE0A 2OA5A 3N9QA 2V7KA 5J1GA 3PUQA 4BJMA 5L3EB 5LNKA 3KVAA 2H3RA 1IJ5A 2C5IT 4QXBB 3DP7A 2WWUA 3CWZB 2Q9QD 3LBXA 4BJNA 4TV9E 1WR6A 2A72A 3BQIA 3IHRA 4BA9A 4QXCB 1MIWA 3NRYA 2A2FX 4U74A 3ZCIA 4CQIA 4IHJE 2CLYB 3KBUA 1Z0PA 3MJXA 1AJ3A 3N5LA 3KV4A 4UF0A 1HFAA 3J9X1 3ZLIA 4C90A 4P0AA 3R84B 2KLQA 2LOSA 3MACA 2Q9QA 4UVBB 4AKLA 3LBXB 1WLXA 2QGSA 4O4IE 2D0TA 4GK5E 3ZN0B 4X1IE 4GOUA 2ZMAA 3NBXX 3ZYKA 2X66A 2CEAA 1MIYA 3Q2MA 4ZS3A 2VKJA 2PFVA 2VB6A 2GK9A 3N9LA 3ZPOA 2LSJA 1EZ3A 2LJLA 4L9IA 4XAXB 5AFUL 3SOLA 2VK9A 5JREA 2BVMA 2K24A 2Q9QC 4HEAA 3RRWA 4ANJA 1QUUA 2Z6EA 3MA9A 4P0BA 5GONE 2DNXA 2Q9QB 4H9NC 5H6QB 5JVDE 2LSGA 5J2UE 3UT5E 4ERRA 2V7MA 3CQXC 4A56A 2X0LB 4EYYR 3OBVE 3K3OA 5A1LA 2HH7A 2XAJB 3IBPA 3PUAA 5HWYA 4QXHB 3L3PA 3KINB 4OYKA 1UX4A 3N2KE 4ZS2A 3U78A 2VL8A 4JUYA 2WAUA 3OYZA 2XUEA 3AA0B 1HG2A 2E9XC 4PK5A 5HXSA 5LHIB 3ZC0A 4AI6A 3F2EA 3EDUA 5FP3A 4PJJA 3V5UA 3ZMTB 2W63A 2ACXA 3N2OA 5FXVA 3AAEB 4MBQA 1UCUA 2RP4A 2CLYC 1D1CA 2L9QA 2KZ7B 3O9XA 4K0UA 2XHEB 3O1IA 3WI3A 3KVBA 4JEHB 3AVSA 4PW8A 5FMNA 4H9OC 5HXCA 3AVRA 5FXWA 5HXEA 4AQFA 4KP3C 5KMGP 2L3LA 2UXXB 3T8OA 2CM0A 2JJ9A 3D0TA 5LGTB 5JRCA 1BR2A 4KBMB 1YW0A 2C5JA 2ZM0A 3KV6A 2XTLA 4IE5A 3Q9DA 4AQFC 2W61A 2DHRA 4V1Av 3ANWB 3O1JA 3VKGA 2LOPA 1YKHB 3ZCJA 2DI4A 4GYRA 4KMCA 1E1HB 5JH7E 3RX6A 1SA0E 3FBZA 4O8SA 5JDLA 5JQGE 4PNIA 3H3AA 2D2SA 3N2GE 4IE6A 4ZHQE 5F3JA 2X9XA 1LKXA 2KXPB 4UIGA 5LHHB 5J2TE 4OHFA 1VRBA 2CMRA 3L09A 2IAKA 2C5KT 4AKHA 3AAIA 1BR4A 3FXDB 1ZEEA 3MZKB 2ZM2A 2Y6XA 3GWHA 4I43B 5FXXA 4ZI3C 4ZI2C 5FNVE 2X9HA 3E22E 3RYFE 4UF0B 2IC6A 4ZI3D 2PJQA 4UEMA 2A3DA 2BZBA 4CXWA 5JR9C 4NUVA 2E9XD 3RC8A 2P9BA 3AA6B 2ES0A 2CE7A 1ZKEA 4CI2B 4H9RC 1VOMA 3HKDE 3KBTA 5DJQC 4H9PC 4IE0A 1HTJF 2I59A 1BR0A 2LEHA 2WM9A 5JDFA 3KFWX 4DO0A 1H7CA 3I1AA 3C4XA 4H9SE 5EK4A 4BAYB 3H37A 4ISSA 3ESLA 3LJCA 2NTXA 1HX8A 5EK3A 2ODUA 2VKHA 1MMAA 2KWHA 1OXZA 2JMKA 3AB3B 4ZI2D 3HKEE 3P7IA 2XAGB 3ETVA 2XASB 1HF8A 4WBOA 3N9OA 2XAQB 2LE8A 5JR9A 5FY0A 4EOZB 1NWMX 3SWHA 2CCQA 3TKLB 1WYCA 5LP6E 3HL6A 4NUUA 4HFVA 4PK6A 5HXRA 3ZEFB 5C8YE 2BDEA 2W00A 2DLRA 1MMGA 4HE8A 4ISTA 5ADXL 3UTKA 3ZYLA 5LOVE 4HTEA 3ZMUB 5L3DB 1O3XA 4IDZA 2Y48B 2IW5B 4O2BE 1LVKA 4X1KE 2LSIA 3I9WA 4FI5A 5H6RB 2LHRA 3WAKA 4EXTA 4I4TE 3I9YA 4ZOLE 3ZN1B 5JDHA 4WNKA 3AA1B 4IGUA 2X51A 2N2NA 1MMNA 1FIOA 4KUMB 4EYUA 5LCYA 3ZMSB 4IE4A 5JR9B 2EHOB 2JQQA 1MNEA 3BQLA 5LA6E 4OK0A 4TZ4C 1YKEB 2CXLA 3E0ZA 3PU3A 2C0SA 2V1DB 2NTYA 5DQWA 3CX8B 4N78D 1FEWA 3U3IA 5L3CB 1OWAA 3CQGB 3Q5WA 3LK42 5LJNA 2NW9A 2ZM8A 3AA7B 3N9MA 5LBQB 3CX6B 4L0RA 2H7VC 2LSKA 3CVRA 2L8KA 4OYJA 4YLHA 5LYJE 1WRDA 3PURA 2W62A 4E7SA 3J7Yq 5KX5E 1U5PA 3B13A 3CQCB 3ZMZB 2MBGA 1ZV4X 2ODVA 3BQKA 2EHOA 4PFOA 3KV5A 4EAHA 2CA5A 5IYZE 2NP9A 2E9XA 3PTRB 3WAJA 2W0GA 3HI2A 5L3GB 3PUSA 3M65A 5IHYA 5JDQA 1IZNB 2KWIB 3EDVA 1NAFA 2LSYA 3UFEA 3UULA 3MKDA 3OJAA 5EK2A 4Z8XA 1D0XA 2B1EA 2HPLA 2CXDA 2YU1A 1FMVA 2EHOD 1SHZC 2IC9A 2VKOA 1Y64B 4ASKA 3C64A 3S4UA 2YINA 2KINB 4ILUA 4QHOA 5JDNA 3P8CD 4O4JE 3GA8A 1CUNA 2RA1A 4YFSA 5M4YA 3JC6D 1LVFA 1IAPA 3RPUA 2KMFA 1KK7A 5CB4E 4WW0A 2PBIA 3F31A 4YJ3E 4UVAB 4X1YE 3E08A 3NZPA 4JLEA 4MHCA 1G73A 3QK6A 1QSDA 3HR0A 5HXHA 3GMIA 3KDSE 4FJOA 4WBNE 2CXFA 3I0OA 3FHNA 5LJMA 5F8PA 1FMWA 4PFPA 3K8PC 2DWGA 1T98A 3ETUA 4EZ4A 5CA0E 5LG4A 3HKCE 3KV9A 3DTOA 4DBQA 3NRXA 4QKNA 3IEEA 3K3QC 3O4XE 3EVYA 2K9AA 3RKOA 4IIJE 3C4WA 3C98B 3I0QA 3O1HA 4GIWA 3CPZA 4F6RC 1KNZA 1UX5A 2QA7A 2MYSA 1D1BA 3C51A 3GN5A 3HKBE 3RYCE 2NW7A 2ZLYA 4MLKA 3CX7B 4O4HE 3MK7C 5FY7A 4PJNA 4HGAA 5DABA 4MALA 2E9XB 3FXEB 5LHGB 4H9QC 5TAOA 3ZMVB 3K3NA 1S35A 4I50E 3ZC1A 4TV8E 5FYMA 2E8IA 3ANWA 1ZHCA 2XAFB 3RRCA 1YD8G 4H63V 4L5GA 1S94A 4U72A 4ZI7E 1HG5A 3VKHA 1U4QA 3F57A 4PJLA 2EHOC 2X68A 2DCFA 3PU8A 4EB6E 1X79A 3RYHE 5EZYE 2M67A 3W15B 2XQYA 5LBMA 3N9NA 2YEVC 3NZQA 5KDMC 2X67A 5FXZA 3ZYMA 4B6XA 1WYBA 4J2CA 4JEUB 2K5BB 4AKRB 4AKIA 4G2AA 2LT3A 4O4LE 3LK3B 4YHJA 3QUJA 1IJ6A 1B7TA 3UUXB 4AXPA 2LM9A 2JPFA 4I55E 4EIWA 1MIVA 2X9WA 4UV9B 2DWKA 3C4ZA 2HPJA 2WSSV 4MFRA 4X20E 3IF8B 1MMDA 3RH3A 3SS1A 1D1AA 4DMVA 4AKGA 2V7IA 3CKDA 3CMLA 4OFZA 2X9YA 4PK4A 4DBRA 3FB2A 2V7LA 4QX7B 3MXZA 2VASA 1D0ZA 3RYIE 4DMWA 1US7B 4HN9A 2JMHA 3VU7H 5LGUB 4CI3B 3BK9A 5JDMA 4H63H 3LG7A 3SRZA 2KT9A 4GYSA 5CA1E 4M1PA 5L3BB 4QWNB 2WMNA 3LK2B 4QX8B 3Q5XA 4UVCB 2YK0A 1BR1A 3FBLA 1MNDA 2H7OA 4DVDA 3VHLA 4E7ZA 2KNDA 2K48A 2NOXA 2V26A 4PJMA 3N9PA 4IE7A 5HWXA 4C91A 5HYAA 5JDGA 4O2AE 4XZCA 3C50A 2NWBA 3EUHA 3ONXA 4P09A 4UELA 3JC6C 1G8XA 3R6NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  1O3X A;  1X79 A;  1NWM X;  1WRD A;  1YD8 G;  1WR6 A;  2N9D A;  1OXZ A;  1NAF A; 
#chains in the Genus database with same CATH topology
 5DQV A;  1NEK A;  2D0U A;  4DV1 T;  2WMO A;  4YJ2 E;  2CRB A;  4CXX A;  3V5S A;  2LM2 A;  3AEF A;  4GK0 E;  5BMV E;  1HS7 A;  3CIR A;  2MPK A;  2SPC A;  3GN5 B;  3PUG A;  2WP9 A;  3OTO T;  2CWO A;  2XQA A;  5L3F B;  1NEN A;  4CXY A;  2ZM6 T;  4HKA A;  5FY1 A;  2MTQ A;  4TN7 B;  4UV8 B;  5AQN B;  3QC9 A;  5BR8 T;  4B3T T;  1V9D A;  3AE6 A;  4TUY E;  2WWV A;  3UUN A;  2UXD T;  2M6B A;  4PAG A;  2HHH T;  3RC3 A;  4X65 T;  3FZF B;  3OYX A;  2V7J A;  4OX9 T;  4G63 A;  4DID B;  2B76 A;  2JRK A;  3PV0 F;  2MOZ A;  5FXV A;  5AQS B;  2BVL A;  2XAH B;  4U2Z A;  4CZZ B;  2LHN A;  1JNR A;  2QYW A;  3A8Y C;  5HAX A;  2CHN A;  4I0U A;  1LRZ A;  4DND A;  2X0H A;  3JCF A;  5FVL A;  3ZJ1 A;  3A7M A;  3PDY A;  2UXN B;  2WBL A;  2PG8 A;  2N9D A;  5E0O A;  5LXT E;  3B57 A;  3OKQ A;  2Y8D A;  5ETW A;  5ABF A;  2N1G A;  5LGN B;  2YU2 A;  2CWY A;  2VKD A;  3A5X A;  3ZJ2 A;  1HCI A;  3ZSS A;  2D5U A;  4TX5 A;  1KNR A;  3LFM A;  5JRC B;  3AAA B;  1T72 A;  4HWC A;  5L2L A;  4ADZ A;  3P4P A;  4AQG A;  2J1D G;  2G0U A;  2NW8 A;  3DJB A;  1D0Y A;  3VRA A;  3UUM A;  3ZT7 A;  4UXN B;  3HA4 A;  4U3C A;  3UU4 A;  2VWA A;  3PE0 A;  2XSB A;  4CI1 B;  2OA5 A;  2DL1 A;  3N9Q A;  2YDQ A;  2V7K A;  1OED B;  5J1G A;  3PUQ A;  4DV6 T;  2LRL A;  4BJM A;  5L3E B;  2BBH A;  4IL9 A;  3EAM A;  5LNK A;  4JI1 T;  1Z8U A;  3KVA A;  4JYA T;  4X64 T;  2H3R A;  3LDQ B;  4F8H A;  1IJ5 A;  2C5I T;  4QXB B;  3DP7 A;  3UU8 A;  2VVS A;  2XPK A;  2WWU A;  3T1Y T;  4JI6 T;  3CWZ B;  2Q9Q D;  3LBX A;  4BJN A;  4TV9 E;  1WR6 A;  2XQ3 A;  2A72 A;  2RPA A;  2XJ7 A;  3BQI A;  5HEO A;  5CGM A;  2JQK A;  2WB5 A;  3IHR A;  4QXC B;  4BA9 A;  1HNW T;  1MIW A;  1M62 A;  2A2F X;  3NRY A;  4U74 A;  3ZCI A;  4CQI A;  4LMJ A;  4LF9 T;  4IHJ E;  2YN6 A;  4IT4 A;  2CLY B;  3KBU A;  1Z0P A;  4JBW F;  3MJX A;  1AJ3 A;  3N5L A;  3KV4 A;  4UF0 A;  3M3Z B;  1HFA A;  3J9X 1;  3ZLI A;  3ZT6 A;  4C90 A;  2LKG A;  4P0A A;  3R84 B;  2KLQ A;  2LOS A;  3MAC A;  4DUY T;  2Q9Q A;  2XQ9 A;  3AEC A;  4UVB B;  4CN6 A;  4WZX A;  4AKL A;  3LBX B;  1WLX A;  2QGS A;  2LRK A;  3AE2 A;  2D0T A;  3AE4 A;  4O4I E;  4ZXL A;  4GK5 E;  3TLV A;  5J2T E;  3ZN0 B;  4X1I E;  1I94 T;  3UU5 A;  4GOU A;  2ZMA A;  3NBX X;  4IDP A;  3ZYK A;  2X66 A;  1XNQ T;  2FJB A;  2CEA A;  1I6Z A;  2A9U A;  1MIY A;  3Q2M A;  4ZS3 A;  2VKJ A;  3UQ4 A;  2PFV A;  2VB6 A;  2GK9 A;  3N9L A;  3ZPO A;  2LSJ A;  1EZ3 A;  2LJL A;  4L9I A;  4Z91 A;  4XAX B;  4P1N A;  3SOL A;  5AFU L;  2VK9 A;  5KXJ A;  5LMN T;  5JRE A;  2BVM A;  2K24 A;  1R8I A;  2Q9Q C;  4HEA A;  3RRW A;  3ZT5 A;  1QUU A;  4ANJ A;  4ZEY A;  2Z6E A;  2X0Y A;  3MA9 A;  4P0B A;  5GON E;  2DNX A;  2Q9Q B;  4H9N C;  4KHP T;  5IUX A;  5H6Q B;  5JVD E;  2LSG A;  3EHZ A;  3TLU A;  5C2T A;  5J2U E;  3UT5 E;  4ERR A;  4KI0 F;  4DR3 T;  2V7M A;  3CQX C;  3H3M A;  4A56 A;  2X0L B;  3TLW A;  3VRB A;  2BS2 A;  2IUB A;  3B5M A;  3OBV E;  4EYY R;  4HWI B;  3FZM B;  2AE9 A;  3K3O A;  2HH7 A;  2E5V A;  2XAJ B;  4KHZ F;  3IBP A;  5A1L A;  1N36 T;  4YSX A;  3PUA A;  3JAF A;  5HWY A;  4QXH B;  3L3P A;  3KIN B;  4OYK A;  3TLT A;  1UX4 A;  2BG9 C;  3N2K E;  4ZS2 A;  2OV9 A;  3QNU A;  3U78 A;  2VL8 A;  4JUY A;  2WAU A;  3OYZ A;  2XUE A;  3AA0 B;  1HG2 A;  2E9X C;  2NR4 A;  4PK5 A;  5HXS A;  5LHI B;  3ZC0 A;  3F2E A;  1Y01 A;  3EDU A;  3FZL B;  5FP3 A;  1XMO T;  2WQY A;  2FJA A;  4PJJ A;  3V5U A;  3ZMT B;  5L4E A;  2W63 A;  4U7I A;  4WYV A;  2UUA T;  1W0B A;  2ACX A;  2W2U A;  2ACZ A;  3N2O A;  4NIQ A;  3AAE B;  4MBQ A;  1UCU A;  5AQM B;  2RP4 A;  2CLY C;  1D1C A;  2L9Q A;  2KZ7 B;  2XQ6 A;  3AEE A;  3O9X A;  4LF4 T;  4K0U A;  2UXB T;  2XHE B;  2H89 A;  3O1I A;  3WI3 A;  2HN2 A;  3KVB A;  4JEH B;  3AVS A;  5HEJ A;  4ZZB A;  4PW8 A;  3L39 A;  5FMN A;  4H9O C;  5HXC A;  3AVR A;  5FXW A;  5HXE A;  1IBL T;  2XQ8 A;  4AQF A;  4KP3 C;  5KMG P;  1UGO A;  2L3L A;  2UXX B;  3T8O A;  2CM0 A;  2JJ9 A;  3D0T A;  5LGT B;  5JRC A;  1BR2 A;  4KBM B;  3AEG A;  3EAB A;  1W9R A;  1YW0 A;  2C5J A;  3TLS A;  2QVA A;  2FUP A;  2ZM0 A;  3KV6 A;  1WCR A;  2XTL A;  4IE5 A;  3Q9D A;  3LSV A;  4AQF C;  2W61 A;  2DHR A;  4V1A v;  2D9D A;  2WZH A;  4NXM T;  5HCM A;  3ANW B;  1VCS A;  2V5C A;  4ILB A;  3O1J A;  1N33 T;  3VKG A;  2JQH A;  2LOP A;  1YKH B;  3RIU A;  3ZCJ A;  2DI4 A;  2CPT A;  4GYR A;  4KMC A;  4TWD A;  3ONJ A;  1E1H B;  5JH7 E;  4B3M T;  3P4W A;  2H88 A;  2XQ7 A;  1SA0 E;  3FBZ A;  4O8S A;  5AQH B;  3RX6 A;  4PNI A;  5JDL A;  3H3A A;  2D2S A;  3N2G E;  4IE6 A;  4ZHQ E;  5F3J A;  4JI7 T;  4JV5 T;  2X9X A;  1LKX A;  2KXP B;  4UIG A;  5ABH A;  3ABV A;  4OHF A;  3P4Q A;  5LHH B;  5L47 A;  1VRB A;  2JIW A;  1JNZ A;  2CMR A;  3AEA A;  3L09 A;  2IAK A;  2C5K T;  2BG9 A;  4AKH A;  4JI2 T;  2W67 A;  3AAI A;  1BR4 A;  1ZEE A;  3FXD B;  3Q5E A;  1HNX T;  2IML A;  3MZK B;  2ZM2 A;  2Y6X A;  3GWH A;  4I43 B;  5FXX A;  1SUM B;  3PUW F;  4ZI3 C;  3IA3 A;  3AE9 A;  5FNV E;  4ZI2 C;  2X9H A;  3RQU A;  2E5L T;  2I0M A;  3E22 E;  3AE5 A;  3RYF E;  4UF0 B;  2IC6 A;  4Z90 A;  3RHW A;  3PJA A;  4ZI3 D;  2PJQ A;  4UEM A;  2A3D A;  2BZB A;  4CXW A;  5JR9 C;  4NUV A;  2E9X D;  5AQO B;  2P9B A;  3AA6 B;  5F5W A;  2ES0 A;  5AQJ B;  3RC8 A;  2VVN A;  3RF1 A;  2CE7 A;  1ZKE A;  4CI2 B;  4DV2 T;  4H9R C;  1VOM A;  3HKD E;  2BG9 E;  3KBT A;  4H9P C;  4IE0 A;  1HTJ F;  5DJQ C;  2I59 A;  1BR0 A;  2LEH A;  4YSY A;  2WM9 A;  5JDF A;  5L4H A;  3VR8 A;  3KFW X;  4DO0 A;  1H7C A;  1HR0 T;  3I1A A;  3C4X A;  4H9S E;  5EK4 A;  4BAY B;  3H37 A;  4ISS A;  3ESL A;  4YSZ A;  3LJC A;  2NTX A;  3P4R A;  1HX8 A;  5EK3 A;  2ODU A;  2VKH A;  4QH5 A;  4KX6 A;  4EGW A;  1MMA A;  2WCA A;  2KWH A;  1OXZ A;  3UU6 A;  2JMK A;  3AB3 B;  4HFD A;  3AXJ B;  4ZI2 D;  3HKE E;  3P7I A;  2V5D A;  4HWF A;  2CBI A;  4B3S T;  2WDR A;  2XAG B;  2W66 A;  3ETV A;  2XAS B;  2JQ9 A;  1HF8 A;  4WBO A;  1DU2 A;  1KFY A;  3N9O A;  1T8B A;  2XAQ B;  2LE8 A;  5JR9 A;  5FY0 A;  4EOZ B;  1NWM X;  3SWH A;  2CCQ A;  1X9B A;  1WYC A;  2BS4 A;  3TKL B;  5LP6 E;  2K3W A;  3HL6 A;  4NUU A;  4HFV A;  4U7Y A;  4QH1 A;  4PK6 A;  5HXR A;  2J47 A;  3ZEF B;  5AQR B;  2BDE A;  5C8Y E;  5FL1 A;  2XQ5 A;  2W00 A;  2XZE A;  2F4V T;  3UFG A;  2DLR A;  1MMG A;  4HE8 A;  4IST A;  5ADX L;  4EED A;  4X62 T;  3FZK B;  3UTK A;  1N34 T;  2IDO B;  3ZYL A;  3L8R A;  3QOF A;  4HTE A;  1KF6 A;  5LOV E;  1O3X A;  3ZMU B;  1YQ4 A;  5L3D B;  4IDZ A;  2XSA A;  4AKI A;  4CN4 A;  2Y48 B;  3UU3 A;  2IW5 B;  4COF A;  4O2B E;  4K0K T;  1LVK A;  3G06 A;  4X1K E;  4TWF A;  5HEG A;  4IDO A;  5AQV B;  2LSI A;  3I9W A;  4FI5 A;  3OVU A;  4HWD A;  5H6R B;  2LHR A;  4TNV A;  3JAD A;  3WAK A;  4I4T E;  3I9Y A;  4ZOL E;  3AEB A;  3ZN1 B;  2QRX A;  4WNK A;  4EXT A;  3AA1 B;  4IGU A;  4AIS A;  2YKS A;  2X51 A;  5JDH A;  4JI0 T;  2N2N A;  1MMN A;  4HFH A;  1OED A;  1FIO A;  4KUM B;  4EYU A;  5LCY A;  3ZMS B;  4HWH A;  4IE4 A;  4B6X A;  4HFE A;  2E2A A;  5JR9 B;  4DV0 T;  2EHO B;  2JQQ A;  1MNE A;  3BQL A;  2IHR 1;  1WR0 A;  4OK0 A;  4TZ4 C;  5LA6 E;  2BS3 A;  3QB5 K;  4CN1 A;  1YKE B;  2CXL A;  3E0Z A;  4YHH T;  3PU3 A;  5AQT B;  5LB7 B;  1FJG T;  2C0S A;  2V1D B;  5AQP B;  2NTY A;  5DQW A;  3CX8 B;  4N78 D;  1FEW A;  3U3I A;  5AQU B;  4IL4 A;  2VQF T;  5L3C B;  5AQQ B;  1OWA A;  3CQG B;  3Q5D A;  1YXR A;  3AE7 A;  3Q5W A;  3LK4 2;  4HFC A;  5LJN A;  5CFB A;  2XQ4 A;  2ZM8 A;  3AA7 B;  3N9M A;  3FZH B;  3NWI A;  2NW9 A;  5LBQ B;  3RKG A;  4YY3 T;  2V8S V;  3CX6 B;  2V6X A;  4L0R A;  4YTM A;  2H7V C;  2LSK A;  3CVR A;  2L8K A;  4OYJ A;  4YLH A;  5LYJ E;  1WRD A;  2MAW A;  2W62 A;  3PUR A;  4E7S A;  3UUB A;  3J7Y q;  4DR4 T;  5KX5 E;  1U5P A;  2FJD A;  3B13 A;  3CQC B;  4YTP A;  2HN1 A;  3NKZ A;  1OED E;  2MBG A;  3ZMZ B;  1UUR A;  1ZV4 X;  2ODV A;  2EHO A;  3BQK A;  1CHU A;  4PFO A;  3KV5 A;  4EAH A;  2CA5 A;  5IYZ E;  4LFC T;  1XMQ T;  2NP9 A;  4LFA T;  2E9X A;  3PTR B;  2VQE T;  3OPC A;  2J4G A;  3WAJ A;  2W0G A;  3HI2 A;  3PUY F;  5L3G B;  1HX1 B;  3PUS A;  1N32 T;  3M65 A;  5IHY A;  5JDQ A;  1E7P A;  3UQ7 A;  4LF5 T;  1IZN B;  2KWI B;  3EDV A;  1NAF A;  2LSY A;  3NVO A;  3P50 A;  2J62 A;  3MKD A;  3OJA A;  4LML A;  5FL0 A;  3RI5 A;  3UFE A;  4Z8X A;  1D0X A;  5AQI B;  5EK2 A;  2LKH A;  3PUX F;  2B1E A;  2HPL A;  4B3R T;  2CXD A;  2YU1 A;  1FMV A;  4DV3 T;  2EHO D;  2UUB T;  1SHZ C;  4YT0 A;  2IC9 A;  1HNZ T;  2VKO A;  2YOE A;  2VL0 A;  1Y64 B;  4ASK A;  3C64 A;  3S4U A;  1IBM T;  4JI3 T;  2YIN A;  2KIN B;  4ILU A;  4QHO A;  5JDN A;  3P8C D;  5JQG E;  4O4J E;  3GA8 A;  4U31 A;  2XM2 A;  4LF7 T;  1CUN A;  4TWH A;  2RA1 A;  4YFS A;  2AXD S;  2BBJ A;  5M4Y A;  3JC6 D;  1LVF A;  1IAP A;  3RPU A;  2KMF A;  3AXJ A;  1KK7 A;  2FBW A;  2VUR A;  4DUZ T;  5CB4 E;  4WW0 A;  2PBI A;  3F31 A;  4YJ3 E;  1SE7 A;  4JI5 T;  4UVA B;  4X1Y E;  2OLT A;  3E08 A;  3NZP A;  4JLE A;  4MHC A;  1G73 A;  5AQF B;  4LF6 T;  1KEY A;  1QSD A;  3HR0 A;  3QK6 A;  5FKY A;  5HXH A;  2UXC T;  3GMI A;  3KDS E;  4FJO A;  4LF8 T;  2M6I A;  2CXF A;  4WBN E;  3I0O A;  1XWM A;  3FHN A;  1XDP A;  2WU2 A;  5LJM A;  5F8P A;  4TNW A;  1FMW A;  4PFP A;  3K8P C;  5ABF B;  3RIF A;  2DWG A;  4DV4 T;  1T98 A;  3ETU A;  4EZ4 A;  5CA0 E;  1ZP0 A;  5LG4 A;  1KNP A;  3HKC E;  3KV9 A;  3DTO A;  4DBQ A;  2UU9 T;  1QLB A;  4DR2 T;  3NRX A;  3ONL C;  3PJA J;  4QKN A;  3IEE A;  3K3Q C;  3O4X E;  4YTN A;  3EVY A;  4IRE A;  5LMU T;  2K9A A;  2WS3 A;  4XBF B;  3PUV F;  3RKO A;  3JAE A;  5CJ5 A;  4IIJ E;  4EEB A;  3C4W A;  3C98 B;  3I0Q A;  3O1H A;  3AE8 A;  1UK5 A;  4GIW A;  3CPZ A;  3X1D A;  4F6R C;  4DV5 T;  1KNZ A;  1UX5 A;  2QA7 A;  2MYS A;  4X5T A;  1D1B A;  3T1H T;  3C51 A;  5LG3 A;  3GN5 A;  3HKB E;  1T7S A;  2XM1 A;  3RYC E;  2NW7 A;  2ZLY A;  4MLK A;  3CX7 B;  4O4H E;  3MK7 C;  5FY7 A;  3SFE A;  4PJN A;  3RGL A;  3AE3 A;  4HGA A;  5DAB A;  4Q25 A;  4MAL A;  2KSR A;  2E9X B;  3FXE B;  4NPP A;  5LHG B;  4AI6 A;  4H9Q C;  5TAO A;  3ZMV B;  3K3N A;  1S35 A;  4I50 E;  3ZC1 A;  4TV8 E;  2UUC T;  2BKO A;  2E8I A;  5FYM A;  3ANW A;  1ZHC A;  2IIU A;  2XAF B;  1VCT A;  4ZZC A;  4DR7 T;  3RRC A;  1YD8 G;  4H63 V;  4L5G A;  1S94 A;  4U72 A;  4AIU A;  4DV7 T;  1XDO A;  4ZI7 E;  1J1J A;  2R6G F;  1HG5 A;  3AED A;  3RLF F;  3VKH A;  4HFI A;  4DR6 T;  4YXD A;  1U4Q A;  3F57 A;  4PJL A;  2EHO C;  4X66 T;  4DR5 T;  2X68 A;  2DCF A;  3PU8 A;  4JI8 T;  4EB6 E;  1X79 A;  2LLY A;  4EV6 A;  3RYH E;  5EZY E;  2M67 A;  3W15 B;  5IWA T;  2XQY A;  5AQL B;  1GQE A;  5LBM A;  3N9N A;  4UR9 A;  2YEV C;  3NZQ A;  3RIU C;  2WY2 A;  3ZKR A;  5KDM C;  2X67 A;  2CBJ A;  5HEH A;  5FXZ A;  3ZYM A;  5C3J A;  1E2A A;  1OED C;  2XY8 B;  1WYB A;  1XZY A;  4ILA A;  2K5B B;  4J2C A;  4JEU B;  2PTF A;  4A5X A;  4AKR B;  1UUS A;  2CHO A;  5JTG A;  4G2A A;  2LT3 A;  4O4L E;  5J0Z A;  3AE1 A;  2V6Y B;  3LK3 B;  4IDQ A;  4YHJ A;  1WFD A;  1M7K A;  3QUJ A;  1IJ6 A;  2FJE A;  2W4X A;  4IDN A;  1B7T A;  3UUX B;  4A98 A;  4AXP A;  2LM9 A;  2JPF A;  3ZST A;  1YQ3 A;  1IBK T;  3P4S A;  4I55 E;  4EIW A;  1MIV A;  2X9W A;  4UV9 B;  2DWK A;  3C4Z A;  3K1S A;  2HPJ A;  2I6H A;  2WSS V;  4MFR A;  4X20 E;  3IF8 B;  1MMD A;  3RH3 A;  3SS1 A;  5AQK B;  1D1A A;  4DMV A;  3SFD A;  4AKG A;  1W09 A;  2V7I A;  4LMK A;  3CKD A;  3CML A;  4OFZ A;  2X9Y A;  1J5W A;  4PK4 A;  4U2Y A;  4DBR A;  4NXN T;  3FB2 A;  1L0V A;  2V7L A;  4QX7 B;  3MXZ A;  4GKJ T;  4GKK T;  4QH4 A;  2VAS A;  1D0Z A;  3PUZ F;  3RYI E;  4DMW A;  1US7 B;  2BKP A;  2BKN A;  4HN9 A;  1W0A A;  2JMH A;  3VU7 H;  5LGU B;  4AQY T;  4CI3 B;  3BK9 A;  5JDM A;  2V6Y A;  4H63 H;  3LG7 A;  2BG9 B;  3SRZ A;  2KT9 A;  4GYS A;  5CA1 E;  4M1P A;  5L3B B;  4QWN B;  2WMN A;  3LK2 B;  4QX8 B;  3CK6 A;  3Q5X A;  4UVC B;  2YK0 A;  5AQG B;  5ABE A;  1BR1 A;  3RQW A;  3FBL A;  1J5E T;  1MND A;  2H7O A;  4JI4 T;  3UUL A;  2WU5 A;  4DVD A;  3VHL A;  4E7Z A;  1ZOY A;  2KND A;  4LFB T;  4U33 A;  2K48 A;  3VR9 A;  2NOX A;  5ABG A;  4DR1 T;  2V26 A;  4PJM A;  3N9P A;  4IE7 A;  5HWX A;  2WZI A;  4C91 A;  4HFB A;  5HYA A;  5HCJ A;  3RIA A;  4ILC A;  4EZH A;  2WDQ A;  2YDS A;  5JDG A;  5FVK A;  4O2A E;  4XZC A;  4A97 A;  2WDV A;  1XNR T;  3C50 A;  2NWB A;  3EUH A;  3ONX A;  4P09 A;  3QB5 A;  2YDR A;  3JC6 C;  4UEL A;  1G8X A;  3EI0 A;  3R6N A;  5HEU A; 
#chains in the Genus database with same CATH homology
 5DQV A;  2D0U A;  2WMO A;  4YJ2 E;  4CXX A;  3V5S A;  4GK0 E;  5BMV E;  1HS7 A;  2SPC A;  3GN5 B;  3PUG A;  2CWO A;  5L3F B;  4CXY A;  4HKA A;  5FY1 A;  2MTQ A;  4TN7 B;  4UV8 B;  3QC9 A;  1V9D A;  4TUY E;  3UUN A;  4PAG A;  3RC3 A;  3OYX A;  2V7J A;  4G63 A;  4XBF B;  2JRK A;  4CZZ B;  2MOZ A;  4EZH A;  2BVL A;  2XAH B;  2LHN A;  5HAX A;  4DND A;  1LRZ A;  3ZJ1 A;  3PDY A;  2UXN B;  2WBL A;  2PG8 A;  2N9D A;  5E0O A;  5LXT E;  3B57 A;  3OKQ A;  2Y8D A;  5ETW A;  2N1G A;  5LGN B;  2YU2 A;  2CWY A;  2VKD A;  3A5X A;  3ZJ2 A;  1HCI A;  2D5U A;  4TX5 A;  3LFM A;  5JRC B;  3AAA B;  5L2L A;  4ADZ A;  4AQG A;  2J1D G;  2G0U A;  2NW8 A;  3DJB A;  1D0Y A;  3UUM A;  4UXN B;  3HA4 A;  4CI1 B;  2VWA A;  3PE0 A;  2OA5 A;  3N9Q A;  2V7K A;  5J1G A;  3PUQ A;  4BJM A;  5L3E B;  5LNK A;  3KVA A;  2H3R A;  1IJ5 A;  2C5I T;  4QXB B;  3DP7 A;  2WWU A;  3CWZ B;  2Q9Q D;  3LBX A;  4BJN A;  4TV9 E;  1WR6 A;  2A72 A;  3BQI A;  3IHR A;  4BA9 A;  4QXC B;  1MIW A;  3NRY A;  2A2F X;  4U74 A;  3ZCI A;  4CQI A;  4IHJ E;  2CLY B;  3KBU A;  1Z0P A;  3MJX A;  1AJ3 A;  3N5L A;  3KV4 A;  4UF0 A;  1HFA A;  3J9X 1;  3ZLI A;  4C90 A;  4P0A A;  3R84 B;  2KLQ A;  2LOS A;  3MAC A;  2Q9Q A;  4UVB B;  4AKL A;  3LBX B;  1WLX A;  2QGS A;  4O4I E;  2D0T A;  4GK5 E;  3ZN0 B;  4X1I E;  4GOU A;  2ZMA A;  3NBX X;  3ZYK A;  2X66 A;  2CEA A;  1MIY A;  3Q2M A;  4ZS3 A;  2VKJ A;  2PFV A;  2VB6 A;  2GK9 A;  3N9L A;  3ZPO A;  2LSJ A;  1EZ3 A;  2LJL A;  4L9I A;  4XAX B;  5AFU L;  3SOL A;  2VK9 A;  5JRE A;  2BVM A;  2K24 A;  2Q9Q C;  4HEA A;  3RRW A;  4ANJ A;  1QUU A;  2Z6E A;  3MA9 A;  4P0B A;  5GON E;  2DNX A;  2Q9Q B;  4H9N C;  5H6Q B;  5JVD E;  2LSG A;  5J2U E;  3UT5 E;  4ERR A;  2V7M A;  3CQX C;  4A56 A;  2X0L B;  4EYY R;  3OBV E;  3K3O A;  5A1L A;  2HH7 A;  2XAJ B;  3IBP A;  3PUA A;  5HWY A;  4QXH B;  3L3P A;  3KIN B;  4OYK A;  1UX4 A;  3N2K E;  4ZS2 A;  3U78 A;  2VL8 A;  4JUY A;  2WAU A;  3OYZ A;  2XUE A;  3AA0 B;  1HG2 A;  2E9X C;  4PK5 A;  5HXS A;  5LHI B;  3ZC0 A;  4AI6 A;  3F2E A;  3EDU A;  5FP3 A;  4PJJ A;  3V5U A;  3ZMT B;  2W63 A;  2ACX A;  3N2O A;  5FXV A;  3AAE B;  4MBQ A;  1UCU A;  2RP4 A;  2CLY C;  1D1C A;  2L9Q A;  2KZ7 B;  3O9X A;  4K0U A;  2XHE B;  3O1I A;  3WI3 A;  3KVB A;  4JEH B;  3AVS A;  4PW8 A;  5FMN A;  4H9O C;  5HXC A;  3AVR A;  5FXW A;  5HXE A;  4AQF A;  4KP3 C;  5KMG P;  2L3L A;  2UXX B;  3T8O A;  2CM0 A;  2JJ9 A;  3D0T A;  5LGT B;  5JRC A;  1BR2 A;  4KBM B;  1YW0 A;  2C5J A;  2ZM0 A;  3KV6 A;  2XTL A;  4IE5 A;  3Q9D A;  4AQF C;  2W61 A;  2DHR A;  4V1A v;  3ANW B;  3O1J A;  3VKG A;  2LOP A;  1YKH B;  3ZCJ A;  2DI4 A;  4GYR A;  4KMC A;  1E1H B;  5JH7 E;  3RX6 A;  1SA0 E;  3FBZ A;  4O8S A;  5JDL A;  5JQG E;  4PNI A;  3H3A A;  2D2S A;  3N2G E;  4IE6 A;  4ZHQ E;  5F3J A;  2X9X A;  1LKX A;  2KXP B;  4UIG A;  5LHH B;  5J2T E;  4OHF A;  1VRB A;  2CMR A;  3L09 A;  2IAK A;  2C5K T;  4AKH A;  3AAI A;  1BR4 A;  3FXD B;  1ZEE A;  3MZK B;  2ZM2 A;  2Y6X A;  3GWH A;  4I43 B;  5FXX A;  4ZI3 C;  4ZI2 C;  5FNV E;  2X9H A;  3E22 E;  3RYF E;  4UF0 B;  2IC6 A;  4ZI3 D;  2PJQ A;  4UEM A;  2A3D A;  2BZB A;  4CXW A;  5JR9 C;  4NUV A;  2E9X D;  3RC8 A;  2P9B A;  3AA6 B;  2ES0 A;  2CE7 A;  1ZKE A;  4CI2 B;  4H9R C;  1VOM A;  3HKD E;  3KBT A;  5DJQ C;  4H9P C;  4IE0 A;  1HTJ F;  2I59 A;  1BR0 A;  2LEH A;  2WM9 A;  5JDF A;  3KFW X;  4DO0 A;  1H7C A;  3I1A A;  3C4X A;  4H9S E;  5EK4 A;  4BAY B;  3H37 A;  4ISS A;  3ESL A;  3LJC A;  2NTX A;  1HX8 A;  5EK3 A;  2ODU A;  2VKH A;  1MMA A;  2KWH A;  1OXZ A;  2JMK A;  3AB3 B;  4ZI2 D;  3HKE E;  3P7I A;  2XAG B;  3ETV A;  2XAS B;  1HF8 A;  4WBO A;  3N9O A;  2XAQ B;  2LE8 A;  5JR9 A;  5FY0 A;  4EOZ B;  1NWM X;  3SWH A;  2CCQ A;  3TKL B;  1WYC A;  5LP6 E;  3HL6 A;  4NUU A;  4HFV A;  4PK6 A;  5HXR A;  3ZEF B;  5C8Y E;  2BDE A;  2W00 A;  2DLR A;  1MMG A;  4HE8 A;  4IST A;  5ADX L;  3UTK A;  3ZYL A;  5LOV E;  4HTE A;  3ZMU B;  5L3D B;  1O3X A;  4IDZ A;  2Y48 B;  2IW5 B;  4O2B E;  1LVK A;  4X1K E;  2LSI A;  3I9W A;  4FI5 A;  5H6R B;  2LHR A;  3WAK A;  4EXT A;  4I4T E;  3I9Y A;  4ZOL E;  3ZN1 B;  5JDH A;  4WNK A;  3AA1 B;  4IGU A;  2X51 A;  2N2N A;  1MMN A;  1FIO A;  4KUM B;  4EYU A;  5LCY A;  3ZMS B;  4IE4 A;  5JR9 B;  2EHO B;  2JQQ A;  1MNE A;  3BQL A;  5LA6 E;  4OK0 A;  4TZ4 C;  1YKE B;  2CXL A;  3E0Z A;  3PU3 A;  2C0S A;  2V1D B;  2NTY A;  5DQW A;  3CX8 B;  4N78 D;  1FEW A;  3U3I A;  5L3C B;  1OWA A;  3CQG B;  3Q5W A;  3LK4 2;  5LJN A;  2NW9 A;  2ZM8 A;  3AA7 B;  3N9M A;  5LBQ B;  3CX6 B;  4L0R A;  2H7V C;  2LSK A;  3CVR A;  2L8K A;  4OYJ A;  4YLH A;  5LYJ E;  1WRD A;  3PUR A;  2W62 A;  4E7S A;  3J7Y q;  5KX5 E;  1U5P A;  3B13 A;  3CQC B;  3ZMZ B;  2MBG A;  1ZV4 X;  2ODV A;  3BQK A;  2EHO A;  4PFO A;  3KV5 A;  4EAH A;  2CA5 A;  5IYZ E;  2NP9 A;  2E9X A;  3PTR B;  3WAJ A;  2W0G A;  3HI2 A;  5L3G B;  3PUS A;  3M65 A;  5IHY A;  5JDQ A;  1IZN B;  2KWI B;  3EDV A;  1NAF A;  2LSY A;  3UFE A;  3UUL A;  3MKD A;  3OJA A;  5EK2 A;  4Z8X A;  1D0X A;  2B1E A;  2HPL A;  2CXD A;  2YU1 A;  1FMV A;  2EHO D;  1SHZ C;  2IC9 A;  2VKO A;  1Y64 B;  4ASK A;  3C64 A;  3S4U A;  2YIN A;  2KIN B;  4ILU A;  4QHO A;  5JDN A;  3P8C D;  4O4J E;  3GA8 A;  1CUN A;  2RA1 A;  4YFS A;  5M4Y A;  3JC6 D;  1LVF A;  1IAP A;  3RPU A;  2KMF A;  1KK7 A;  5CB4 E;  4WW0 A;  2PBI A;  3F31 A;  4YJ3 E;  4UVA B;  4X1Y E;  3E08 A;  3NZP A;  4JLE A;  4MHC A;  1G73 A;  3QK6 A;  1QSD A;  3HR0 A;  5HXH A;  3GMI A;  3KDS E;  4FJO A;  4WBN E;  2CXF A;  3I0O A;  3FHN A;  5LJM A;  5F8P A;  1FMW A;  4PFP A;  3K8P C;  2DWG A;  1T98 A;  3ETU A;  4EZ4 A;  5CA0 E;  5LG4 A;  3HKC E;  3KV9 A;  3DTO A;  4DBQ A;  3NRX A;  4QKN A;  3IEE A;  3K3Q C;  3O4X E;  3EVY A;  2K9A A;  3RKO A;  4IIJ E;  3C4W A;  3C98 B;  3I0Q A;  3O1H A;  4GIW A;  3CPZ A;  4F6R C;  1KNZ A;  1UX5 A;  2QA7 A;  2MYS A;  1D1B A;  3C51 A;  3GN5 A;  3HKB E;  3RYC E;  2NW7 A;  2ZLY A;  4MLK A;  3CX7 B;  4O4H E;  3MK7 C;  5FY7 A;  4PJN A;  4HGA A;  5DAB A;  4MAL A;  2E9X B;  3FXE B;  5LHG B;  4H9Q C;  5TAO A;  3ZMV B;  3K3N A;  1S35 A;  4I50 E;  3ZC1 A;  4TV8 E;  5FYM A;  2E8I A;  3ANW A;  1ZHC A;  2XAF B;  3RRC A;  1YD8 G;  4H63 V;  4L5G A;  1S94 A;  4U72 A;  4ZI7 E;  1HG5 A;  3VKH A;  1U4Q A;  3F57 A;  4PJL A;  2EHO C;  2X68 A;  2DCF A;  3PU8 A;  4EB6 E;  1X79 A;  3RYH E;  5EZY E;  2M67 A;  3W15 B;  2XQY A;  5LBM A;  3N9N A;  2YEV C;  3NZQ A;  5KDM C;  2X67 A;  5FXZ A;  3ZYM A;  4B6X A;  1WYB A;  4J2C A;  4JEU B;  2K5B B;  4AKR B;  4AKI A;  4G2A A;  2LT3 A;  4O4L E;  3LK3 B;  4YHJ A;  3QUJ A;  1IJ6 A;  1B7T A;  3UUX B;  4AXP A;  2LM9 A;  2JPF A;  4I55 E;  4EIW A;  1MIV A;  2X9W A;  4UV9 B;  2DWK A;  3C4Z A;  2HPJ A;  2WSS V;  4MFR A;  4X20 E;  3IF8 B;  1MMD A;  3RH3 A;  3SS1 A;  1D1A A;  4DMV A;  4AKG A;  2V7I A;  3CKD A;  3CML A;  4OFZ A;  2X9Y A;  4PK4 A;  4DBR A;  3FB2 A;  2V7L A;  4QX7 B;  3MXZ A;  2VAS A;  1D0Z A;  3RYI E;  4DMW A;  1US7 B;  4HN9 A;  2JMH A;  3VU7 H;  5LGU B;  4CI3 B;  3BK9 A;  5JDM A;  4H63 H;  3LG7 A;  3SRZ A;  2KT9 A;  4GYS A;  5CA1 E;  4M1P A;  5L3B B;  4QWN B;  2WMN A;  3LK2 B;  4QX8 B;  3Q5X A;  4UVC B;  2YK0 A;  1BR1 A;  3FBL A;  1MND A;  2H7O A;  4DVD A;  3VHL A;  4E7Z A;  2KND A;  2K48 A;  2NOX A;  2V26 A;  4PJM A;  3N9P A;  4IE7 A;  5HWX A;  4C91 A;  5HYA A;  5JDG A;  4O2A E;  4XZC A;  3C50 A;  2NWB A;  3EUH A;  3ONX A;  4P09 A;  4UEL A;  3JC6 C;  1G8X A;  3R6N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...