1YD8G

Complex of human gga3 gat domain and ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'GIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUIN
publication title Structural mechanism for ubiquitinated-cargo recognition by the Golgi-localized, {gamma}-ear-containing, ADP-ribosylation-factor-binding proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, chromosomal protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yd8G00
1NAFA 1X79A 2N2NA 1YD8G 2N9DA 1WRDA 1OXZA 1WR6A 1NWMX 1O3XA
chains in the Genus database with same CATH superfamily
3N9QA 3RYHE 2NWBA 2X0LB 3K3OA 2Y6XA 2KZ7B 4EZ4A 2W4XA 3AAAB 4UXNB 1D1AA 4ILAA 5CA0E 4YXDA 5H6RB 1N36T 4N78D 2YKSA 2VWAA 2NR4A 5HXRA 3CVRA 4DV6T 2XQ8A 2UUBT 4GK5E 4DR2T 3HKDE 5M4YA 4PK5A 5F3JA 4PAGA 2K5BB 3GN5B 5AQPB 3ZT6A 5FKYA 3FBLA 2ZM8A 3UU3A 2V6YA 5JDFA 4AQGA 2BG9B 5ABFB 2Q9QC 1VRBA 3GN5A 3NBXX 3NZPA 1KEYA 4ZHQE 2VKJA 4H9PC 2BG9A 5ABFA 2FJEA 5LHHB 1IBKT 2JRKA 2DNXA 4QH1A 2BBHA 5L2LA 2RA1A 4NPPA 2LSIA 1WR0A 2C0SA 2JQHA 3JAEA 3UU5A 4KX6A 2W67A 4ZZCA 2HN2A 2DL1A 3E22E 1HNWT 2LOPA 3K1SA 4P1NA 1ZV4X 1YKEB 2CPTA 3ZC0A 3C51A 1LKXA 2IUBA 2L3LA 1CUNA 3FHNA 5ABGA 3HKCE 3I1AA 1I94T 1M62A 3WAKA 2ZM6T 1N32T 4HFBA 2Z6EA 5J2UE 3ONLC 4EOZB 2HHHT 4TN7B 3PV0F 3FXDB 4UEMA 4LMLA 1HX8A 2N1GA 1VCTA 3OJAA 1YQ3A 4PK4A 3KV4A 2HN1A 5FL0A 2CHNA 4WZXA 4EXTA 4DV4T 1FMWA 1VCSA 3PJAA 4IDQA 4HFHA 5HEUA 2WP9A 4EB6E 4I50E 2XAQB 2UU9T 2CLYB 1NWMX 2X67A 2AXDS 5L3DB 4DBRA 3B57A 3O1JA 2YN6A 2XAJB 1Y01A 4X64T 2M67A 2CMRA 2XM2A 1GQEA 2K3WA 3ZYKA 3N9NA 2A2FX 3WAJA 2HPLA 4B3MT 3JC6C 2PJQA 3ZCIA 4LFAT 3P50A 3EAMA 4I4TE 3P8CD 2HH7A 3KVBA 2XQ7A 4V1Av 1JNZA 4J2CA 1FMVA 1SHZC 3P4SA 4DBQA 3KVAA 3AA0B 3ZT7A 2W0GA 1UX4A 2EHOB 2ACXA 4TX5A 1W0AA 2NW8A 3RC8A 4TZ4C 4KHZF 2AE9A 2H89A 2DWGA 2EHOA 4CI1B 4AKIA 2Q9QD 1IBMT 4OFZA 2UXBT 1D1CA 2OV9A 2UXDT 2E9XB 3MACA 3CPZA 5HCJA 2FBWA 4ZXLA 1WCRA 1XWMA 3ZLIA 4AKHA 2WU2A 2B76A 3RIUC 2E9XA 5LB7B 2KINB 2LRLA 2LM9A 5LA6E 2VKHA 5HYAA 4ISTA 4I43B 4WW0A 3K8PC 3ZYLA 3FXEB 4WNKA 2XQ4A 3HKEE 2D2SA 2KSRA 2SPCA 2IAKA 1KF6A 3CX7B 5LBQB 5AQLB 3ZJ2A 4CN1A 2K9AA 5LOVE 5C8YE 2VB6A 3IEEA 4X1YE 2YDRA 2WS3A 4JI8T 4HKAA 3ZN1B 4FJOA 2VK9A 4YJ2E 2VURA 3ZN0B 2X66A 3CKDA 5JDNA 1WYCA 4OYKA 2WAUA 3C50A 4AIUA 4DR7T 3TLUA 1YD8G 4JI1T 3DP7A 3IBPA 4JI7T 1X9BA 5LGNB 5IUXA 2X51A 5AQUB 4GK0E 5ETWA 2RPAA 1OXZA 2D9DA 1HCIA 4O4LE 5FNVE 3Q9DA 4TNVA 2WWUA 3DJBA 3N9MA 2CE7A 4HWFA 4LF5T 2N2NA 2BS3A 4ZZBA 3ZEFB 1SUMB 3JC6D 2YDQA 3ZYMA 3RH3A 5JR9B 4QXHB 3ZMVB 3D0TA 3C4WA 2LSKA 1S94A 2PTFA 3F2EA 5ABHA 5JR9A 3ZCJA 4AISA 4IL9A 1U4QA 4AXPA 3Q5XA 3AE2A 2J62A 1VOMA 4CI3B 3RKOA 1T98A 3L8RA 3SOLA 2IMLA 1QSDA 3FZLB 3AECA 3H3MA 2LOSA 1V9DA 2X9XA 1W9RA 2ACZA 4LF6T 4H9OC 5FP3A 4IE6A 2BVLA 4Z8XA 3SRZA 3VKGA 4NUUA 3WI3A 3L09A 4UV8B 3GWHA 5HXHA 4O4HE 4LFBT 2ZM0A 4Q25A 4O2AE 2CEAA 5JVDE 5KMGP 5JQGE 3BQLA 3R6NA 2E5VA 1D0XA 2JMHA 3J7Yq 3FZHB 2LE8A 4YSYA 3MK7C 3U78A 3E08A 2CA5A 1HTJF 4X1IE 5JRCB 4WBOA 3Q2MA 2V6XA 4C91A 1S35A 5JRCA 4BJMA 3CQCB 3VRAA 4LF7T 1YXRA 3HA4A 3RQWA 4IDPA 1OEDE 4NUVA 4PK6A 5FVKA 4JI3T 5JTGA 4JI6T 2M6BA 4OX9T 3IF8B 2LEHA 4LFCT 2BS2A 3ZMSB 3LK42 4IHJE 2QYWA 2BKPA 4U3CA 1KNZA 4KBMB 4C90A 2IDOB 4JBWF 2WM9A 4U31A 4TV8E 2VVNA 5EK2A 3RPUA 1MNEA 4YSXA 5LHGB 4E7SA 3N9PA 4UR9A 4PFPA 3AEGA 3ETUA 3QNUA 1BR2A 4DV0T 2VKDA 1UUSA 5JDLA 2NTYA 4IIJE 5HEHA 2XM1A 3TKLB 3RRWA 2LSGA 4TNWA 4YTPA 4DUZT 5AQGB 1US7B 2OLTA 4KMCA 3NKZA 4YFSA 3P7IA 2WDQA 3KINB 5FVLA 3CQXC 2JJ9A 2WMNA 5IWAT 3RLFF 1XNQT 4YSZA 4ILCA 5FYMA 4PJLA 4AKGA 3SFEA 5AQIB 3UT5E 3RC3A 2PBIA 4G2AA 2V5DA 2WSSV 5AQQB 2V26A 4ZI3C 5JDGA 1UCUA 3H37A 2LT3A 4K0UA 4DV3T 4A5XA 1WRDA 4EEBA 1E7PA 2M6IA 3CIRA 5HEGA 4MFRA 4GIWA 1MMDA 1XZYA 2FJDA 3FBZA 3QB5A 2IW5B 2D0UA 1QUUA 1X79A 4JV5T 4CZZB 4YT0A 3AEBA 5AFUL 4PJMA 3NRXA 3UQ4A 3PUZF 2JQ9A 4KP3C 2JMKA 4TWFA 1MMNA 3FZFB 1XNRT 4LMKA 2D0TA 2E8IA 3ZJ1A 1YQ4A 1XMQT 1Z8UA 2CXLA 1WLXA 4IREA 4H9QC 4EYYR 4U7YA 1WFDA 2NTXA 2MAWA 4PW8A 2WMOA 3SS1A 1HNXT 1G73A 4MALA 4GKJT 5LP6E 4DR6T 5AQHB 5LMUT 3FB2A 4H63V 3IHRA 4HFIA 3ETVA 5AQNB 2RP4A 4F6RC 5HAXA 2ZM2A 3NVOA 2W00A 2CRBA 2V7JA 5BMVE 1HG5A 2V7MA 3LSVA 4ANJA 2JPFA 4K0KT 4OYJA 3ZC1A 4E7ZA 2XASB 2D5UA 3PUWF 2ODUA 1OEDB 3TLSA 3ZMZB 5CJ5A 2XAGB 3OTOT 2C5KT 4ZS2A 5EK4A 1OEDA 2KLQA 3MJXA 3Q5DA 3N5LA 1FIOA 5LYJE 3C98B 3EI0A 2YK0A 2LRKA 2UUAT 1D0ZA 5FY7A 3ZT5A 2UXCT 2I0MA 1J5WA 5EK3A 3HI2A 3ONJA 3C64A 1WR6A 2W61A 3UULA 4HFEA 5LG3A 4ZI3D 4AQYT 1MIWA 2FUPA 1M7KA 2IHR1 3RYCE 4IGUA 4I55E 2LSJA 2YINA 4YHJA 1YKHB 5LJMA 5DQVA 4NXNT 3PURA 2XJ7A 4DV7T 4YY3T 4DVDA 2CHOA 4UELA 2DLRA 4IDOA 4COFA 2WCAA 5BR8T 1H7CA 3AE4A 1MMGA 3FZMB 3I9WA 3OYZA 2XHEB 2ZMAA 4BJNA 1HNZT 2DCFA 5AQFB 3J9X1 2ZLYA 3P4WA 5EZYE 3KBTA 4YTMA 3B13A 3AB3B 5AQRB 3PDYA 2ODVA 2BG9C 5CGMA 5TAOA 4F8HA 3K3NA 2WY2A 3KBUA 2F4VT 5AQSB 4TWHA 3PJAJ 4ZI2C 3UU6A 3AAIA 2C5JA 1T8BA 5LXTE 5IYZE 3PUXF 3S4UA 5FY1A 3AEEA 3ANWB 3UFGA 2H7OA 5J2TE 3RF1A 2CBJA 2LHRA 3AEDA 3I0OA 1ZKEA 2X68A 3N9LA 3LDQB 4B3ST 3CK6A 2XQYA 1T72A 5GONE 5LMNT 2P9BA 1J5ET 3RIAA 3NWIA 4TWDA 4JI5T 4DV2T 4GKKT 4KI0F 3N2KE 4B3TT 4JEUB 2XQAA 4ZEYA 3EHZA 4O4IE 2LKGA 3OBVE 4BAYB 4ILUA 3M3ZB 4DV5T 4A97A 4ILBA 3LBXB 4EYUA 5DABA 3PU8A 5JDHA 4EIWA 5JH7E 3LBXA 5JDQA 3PUVF 2K48A 4AQFA 1N34T 2OA5A 2NOXA 2BKOA 3AE9A 4LF4T 1R8IA 4DUYT 5FXZA 3K3QC 3M65A 3PU3A 2Q9QB 4DMVA 1EZ3A 3R84B 2CLYC 4IDNA 4B6XA 2IC6A 4HWIB 4HWCA 4DR1T 4PJJA 5DJQC 3ZMUB 3OVUA 4PFOA 4QX7B 4ISSA 2V7IA 5C2TA 2IC9A 4LMJA 4IE7A 2XQ9A 4HEAA 4CI2B 2GK9A 2CXDA 1HFAA 1OWAA 1ZHCA 3I9YA 3QC9A 4DO0A 3AE3A 3EUHA 2XZEA 2CM0A 2MTQA 3AVRA 1NEKA 2W62A 3AXJB 4UVCB 3PUYF 2BS4A 3AXJA 5F8PA 1Z0PA 2EHOC 4P09A 3H3AA 4UVBB 2WQYA 2DWKA 5H6QB 4FI5A 3C4XA 2X0HA 2W2UA 5C3JA 2YOEA 4U2ZA 4JI0T 2QVAA 2YU2A 2W66A 4ZI2D 1HX1B 2Y8DA 2E9XC 4ZOLE 3SWHA 5LJNA 1O3XA 3JADA 3RIFA 1UX5A 2CXFA 2Y48B 3UFEA 3T1YT 1D1BA 4U72A 4CXYA 2WZHA 2A3DA 2XQ3A 1MNDA 3JCFA 4EEDA 3ZMTB 3AAEB 4CN4A 3I0QA 4KHPT 4GYSA 2YDSA 2L9QA 1AJ3A 1NAFA 4A56A 5AQOB 5L4EA 1BR1A 2XAFB 2CCQA 3AE7A 3BQIA 3VU7H 5FXWA 2WZIA 2XQ5A 4LF8T 3ESLA 4PJNA 3TLVA 4QXCB 1W0BA 1D0YA 2H7VC 2WBLA 2QRXA 4EZHA 4DR4T 2UUCT 3C4ZA 3GA8A 4CXXA 2X9WA 4UIGA 5LNKA 3LK2B 1MIYA 4EAHA 5AQJB 1IBLT 2FJAA 1ZEEA 3PE0A 3O4XE 3VR8A 3NRYA 2XAHB 2B1EA 4NXMT 3A8YC 3UUXB 3B5MA 2G0UA 4JLEA 1J1JA 4OHFA 3CX6B 2LSYA 4AKRB 1HS7A 4JYAT 4AQFC 4CQIA 3RQUA 2H88A 1KFYA 5JR9C 1QLBA 3N2OA 3CQGB 1IAPA 1MMAA 1G8XA 3RIUA 2V6YB 3AVSA 1HR0T 3EVYA 3AE5A 4HFDA 5LG4A 4WBNE 2BDEA 4DIDB 2EHOD 5AQTB 3PUGA 2R6GF 1MIVA 5A1LA 4QWNB 2ES0A 3KV6A 4UF0B 2QGSA 2DI4A 4U2YA 3A7MA 5KDMC 3PTRB 5KXJA 2E9XD 3DTOA 3U3IA 3V5SA 4UF0A 2QA7A 5L3FB 2NW7A 4IE5A 4L9IA 3RX6A 3QB5K 1Y64B 5IHYA 2K24A 2IIUA 2JQQA 5F5WA 2XSBA 2UXNB 4HWDA 2FJBA 3KFWX 1I6ZA 2V7LA 2H3RA 4X1KE 1LVFA 3AA6B 5DQWA 3BK9A 2V7KA 2LJLA 3OKQA 3KV9A 3F57A 3Q5EA 2KT9A 2L8KA 4Z91A 4CXWA 3HL6A 2E2AA 5AQMB 3QUJA 1DU2A 1IZNB 3RI5A 3O1HA 5JREA 1XMOT 3Q5WA 4TV9E 4JEHB 5J1GA 1KNRA 4Z90A 5ADXL 1ZOYA 3ABVA 5FY0A 5HWYA 3OPCA 3NZQA 2I6HA 4I0UA 5LHIB 1XDOA 4ZS3A 5FMNA 1UURA 5J0ZA 1NENA 3AA7B 3AEAA 2V8SV 2YU1A 1KNPA 2MPKA 4YHHT 3PUQA 2PG8A 3AE6A 3IA3A 2C5IT 4M1PA 2MYSA 2LLYA 2XUEA 4HTEA 2KNDA 4HN9A 3HKBE 3CMLA 4IE0A 2A9UA 1FEWA 2NW9A 2VL0A 2BBJA 2DHRA 3G06A 2W63A 3UUNA 4QH5A 4DR5T 4QX8B 2KWIB 5FXVA 3HR0A 2J1DG 2BVMA 4X20E 3SFDA 1W09A 3EABA 1XDPA 4IE4A 1T7SA 3EDUA 3W15B 2VVSA 2WWVA 3QK6A 4WYVA 1CHUA 3AE8A 5FL1A 3X1DA 2YEVC 1IJ6A 4P0BA 3UU4A 5LBMA 4XBFB 3BQKA 2CBIA 2V1DB 5LGUB 4X66T 2NP9A 3MZKB 3VKHA 2XPKA 4JUYA 2E5LT 4O4JE 4EV6A 2VQFT 5HXEA 3UUBA 3O1IA 2XTLA 4ZI7E 3LK3B 2LHNA 4GOUA 4QKNA 1YW0A 2JIWA 3RYIE 1E1HB 4MBQA 1LRZA 3RGLA 3ANWA 3RYFE 2XY8B 4NIQA 2MBGA 4QHOA 1HF8A 3ZSSA 3T1HT 3T8OA 1BR4A 5FXXA 4QXBB 3LJCA 4H9NC 2PFVA 4DNDA 1UK5A 5JDMA 2X0YA 2I59A 3VR9A 4AKLA 4UV9B 5L47A 4U7IA 5L4HA 5HEOA 4IDZA 4X5TA 3E0ZA 4QH4A 3RHWA 3TLTA 4HFVA 3RKGA 5KX5E 3UTKA 2UXXB 3N9OA 5AQKB 5HXCA 4JI2T 4HE8A 3AE1A 4MHCA 1HG2A 3FZKB 4DMWA 2HPJA 1SA0E 1L0VA 4P0AA 3UUMA 4AI6A 2J47A 4XAXB 5CB4E 1ZP0A 2WB5A 1IJ5A 1OEDC 3QOFA 4DV1T 3PUSA 4ERRA 4HFCA 4X65T 2KWHA 4X62T 2BG9E 4LF9T 3P4RA 3ONXA 4ADZA 2Q9QA 3TLWA 3L39A 4XZCA 3UQ7A 4U74A 3MKDA 4H63H 5HXSA 3LG7A 2LM2A 1E2AA 2XQ6A 2VKOA 2BZBA 3CX8B 2JQKA 5HWXA 3KV5A 1UGOA 2VL8A 3L3PA 3A5XA 4IL4A 4A98A 2MOZA 2XSAA 1U5PA 4EGWA 4YTNA 4BA9A 4HGAA 2LKHA 3RRCA 3CWZB 2VQET 4H9SE 4IT4A 4PNIA 1JNRA 1BR0A 4O8SA 4DR3T 3EDVA 1LVKA 3P4PA 3UU8A 5CFBA 2A72A 2CWOA 3P4QA 1KK7A 3MXZA 3LFMA 4YJ3E 5L3EB 3ZPOA 4UVAB 2WU5A 5AQVB 3GMIA 4U33A 5L3CB 3ZKRA 3KDSE 4L5GA 1FJGT 4GYRA 3O9XA 3VHLA 3VRBA 2X9HA 3V5UA 5HCMA 4L0RA 2BKNA 4CN6A 2WDVA 5LCYA 2KXPB 3JAFA 5CA1E 1WYBA 3MA9A 3N2GE 1N33T 5ABEA 5HEJA 3PUAA 5E0OA 1SE7A 4B3RT 4KUMB 4ASKA 5LGTB 2KMFA 4HWHA 3AA1B 2VASA 4TUYE 4OK0A 4H9RC 4O2BE 4G63A 5L3BB 1B7TA 2X9YA 4JI4T 2J4GA 4MLKA 3F31A 4YLHA 2CWYA 3AEFA 2N9DA 5L3GB 2V5CA 2WDRA 3OYXA 3ZSTA
chains in the Genus database with same CATH topology
3KV9A 2X9XA 3N9QA 5TAOA 3K3NA 3F57A 3RYHE 4H9OC 2KT9A 2L8KA 3KBUA 2NWBA 4IE6A 5FP3A 4CXWA 2X0LB 2BVLA 3HL6A 3K3OA 4Z8XA 3SRZA 3VKGA 2Y6XA 4NUUA 3QUJA 2KZ7B 4ZI2C 4EZ4A 3WI3A 3L09A 4UV8B 1IZNB 3AAIA 2C5JA 3AAAB 3GWHA 3O1HA 5HXHA 5JREA 3Q5WA 1D1AA 4O4HE 4UXNB 4TV9E 4JEHB 5LXTE 5IYZE 2ZM0A 4O2AE 5FY1A 5J1GA 3S4UA 2CEAA 3ANWB 5CA0E 5H6RB 5ADXL 5JVDE 4N78D 2H7OA 5FY0A 5HWYA 5KMGP 5J2TE 3NZQA 2LHRA 5JQGE 3BQLA 3I0OA 2VWAA 1ZKEA 5HXRA 3R6NA 2X68A 3N9LA 1D0XA 2XQYA 3CVRA 2JMHA 5LHIB 3J7Yq 4ZS3A 5FMNA 2LE8A 5GONE 3MK7C 4GK5E 3U78A 3HKDE 3E08A 2CA5A 1HTJF 2P9BA 5M4YA 4PK5A 5F3JA 3AA7B 4PAGA 4X1IE 2K5BB 5JRCB 3GN5B 2YU1A 4WBOA 3FBLA 3PUQA 2ZM8A 3Q2MA 3N2KE 2PG8A 2C5IT 4JEUB 5JDFA 4C91A 4AQGA 1S35A 4M1PA 2MYSA 2Q9QC 5JRCA 1VRBA 3GN5A 3NBXX 3NZPA 4O4IE 4BJMA 3CQCB 3OBVE 3HA4A 4ZHQE 2XUEA 2VKJA 4BAYB 4HTEA 4H9PC 2KNDA 4ILUA 4HN9A 3HKBE 3CMLA 5LHHB 4IE0A 2JRKA 3LBXB 4EYUA 1FEWA 5DABA 2NW9A 3PU8A 4NUVA 2DNXA 5JDHA 4PK6A 2DHRA 4EIWA 2W63A 3UUNA 2RA1A 5JH7E 5L2LA 2LSIA 3IF8B 2C0SA 2LEHA 3LBXA 5JDQA 4QX8B 2KWIB 3ZMSB 5FXVA 3HR0A 3LK42 2K48A 4AQFA 4IHJE 2J1DG 2OA5A 2BVMA 4X20E 2NOXA 1KNZA 3E22E 4KBMB 2LOPA 4C90A 5FXZA 4IE4A 3K3QC 1ZV4X 1YKEB 3EDUA 3W15B 2WM9A 3ZC0A 4TV8E 3C51A 1LKXA 5EK2A 3QK6A 3RPUA 3M65A 2L3LA 3PU3A 2Q9QB 1MNEA 4DMVA 1EZ3A 1CUNA 2CLYC 2YEVC 3FHNA 3R84B 5LHGB 4E7SA 3HKCE 1IJ6A 3N9PA 4P0BA 2IC6A 4B6XA 3I1AA 4PFPA 3WAKA 3ETUA 1BR2A 5LBMA 4PJJA 5DJQC 3ZMUB 4XBFB 3BQKA 2VKDA 4PFOA 2Z6EA 4ISSA 4QX7B 5J2UE 5JDLA 2NTYA 4IIJE 2V7IA 2IC9A 3TKLB 4EOZB 4IE7A 3RRWA 2LSGA 4HEAA 4TN7B 3FXDB 4UEMA 2V1DB 4CI2B 5LGUB 2GK9A 1US7B 2CXDA 1HX8A 2N1GA 2NP9A 3MZKB 1HFAA 1OWAA 3VKHA 4KMCA 4JUYA 1ZHCA 3I9YA 3QC9A 4DO0A 4YFSA 3P7IA 4O4JE 3OJAA 3EUHA 3KINB 4PK4A 2CM0A 3KV4A 3CQXC 5HXEA 3AVRA 2MTQA 2JJ9A 2W62A 2WMNA 3O1IA 2XTLA 4ZI7E 3LK3B 2LHNA 4UVCB 4EXTA 4GOUA 4QKNA 1YW0A 3RYIE 1FMWA 1E1HB 4MBQA 5FYMA 4PJLA 1LRZA 5F8PA 3ANWA 3RYFE 1Z0PA 4AKGA 2EHOC 4P09A 3H3AA 3UT5E 3RC3A 4EB6E 4UVBB 2PBIA 4G2AA 4I50E 2MBGA 2WSSV 2XAQB 4QHOA 1HF8A 2DWKA 5H6QB 2V26A 2CLYB 4ZI3C 1NWMX 2X67A 3C4XA 1BR4A 4FI5A 3T8OA 4DBRA 5JDGA 3B57A 1UCUA 3H37A 5L3DB 2LT3A 3O1JA 2XAJB 5FXXA 4QXBB 2M67A 2CMRA 4K0UA 2YU2A 4ZI2D 1WRDA 2Y8DA 3ZYKA 2E9XC 3N9NA 3LJCA 2A2FX 4H9NC 2PFVA 3WAJA 4DNDA 2HPLA 4MFRA 4ZOLE 4GIWA 5JDMA 3SWHA 3JC6C 2I59A 5LJNA 1O3XA 2PJQA 4AKLA 1MMDA 3ZCIA 4UV9B 1UX5A 4I4TE 2CXFA 2Y48B 3FBZA 3UFEA 3P8CD 2IW5B 4IDZA 2D0UA 2HH7A 3E0ZA 3KVBA 1QUUA 1D1BA 1X79A 4V1Av 4J2CA 1FMVA 1SHZC 4HFVA 4CZZB 5KX5E 4PJMA 2UXXB 3N9OA 3NRXA 3UTKA 5AFUL 4DBQA 4U72A 5HXCA 4CXYA 2A3DA 3KVAA 3AA0B 4HE8A 4MHCA 2W0GA 1HG2A 4DMWA 1UX4A 2EHOB 2ACXA 4TX5A 2HPJA 2NW8A 4KP3C 3RC8A 1MNDA 2JMKA 1SA0E 1MMNA 4P0AA 4TZ4C 2D0TA 2E8IA 3ZMTB 3AAEB 3ZJ1A 3I0QA 3UUMA 2DWGA 4AI6A 4XAXB 2EHOA 4GYSA 4CI1B 4AKIA 2Q9QD 2L9QA 1AJ3A 1NAFA 5CB4E 4A56A 2CXLA 4OFZA 1IJ5A 1D1CA 1BR1A 1WLXA 2XAFB 2CCQA 4H9QC 4EYYR 3BQIA 3VU7H 2E9XB 2NTXA 3CPZA 3MACA 5FXWA 4PW8A 2WMOA 3PUSA 4ERRA 3SS1A 1G73A 4MALA 5LP6E 2KWHA 3ZLIA 3ESLA 3ONXA 4AKHA 4PJNA 2E9XA 4QXCB 4ADZA 2KINB 1D0YA 2H7VC 2Q9QA 3FB2A 4H63V 2LM9A 2WBLA 3IHRA 3ETVA 5LA6E 2RP4A 2VKHA 4EZHA 5HYAA 4F6RC 4ISTA 4XZCA 4I43B 4WW0A 5HAXA 2ZM2A 3C4ZA 3GA8A 3MKDA 4H63H 3LG7A 4U74A 4CXXA 2W00A 2X9WA 3K8PC 3ZYLA 5HXSA 3FXEB 4UIGA 4WNKA 5LNKA 3LK2B 2V7JA 1MIYA 5BMVE 1HG5A 2VKOA 3HKEE 2V7MA 2D2SA 4EAHA 2BZBA 3CX8B 1ZEEA 3PE0A 4ANJA 3O4XE 5HWXA 3KV5A 2JPFA 3NRYA 2VL8A 2XAHB 2B1EA 2SPCA 4OYJA 2IAKA 3L3PA 3CX7B 5LBQB 3ZC1A 4E7ZA 2XASB 3A5XA 2MOZA 3ZJ2A 1U5PA 3UUXB 2G0UA 4JLEA 2K9AA 2D5UA 5LOVE 2ODUA 5C8YE 4OHFA 2VB6A 3ZMZB 3CX6B 2LSYA 3IEEA 4X1YE 2XAGB 4BA9A 4AKRB 1HS7A 4HGAA 3RRCA 3CWZB 4H9SE 4HKAA 3ZN1B 4AQFC 4CQIA 2C5KT 4PNIA 4FJOA 4ZS2A 5EK4A 2VK9A 4YJ2E 2KLQA 5JR9C 3N2OA 3CQGB 3MJXA 1BR0A 4O8SA 1IAPA 3ZN0B 1MMAA 1G8XA 2X66A 3CKDA 3EDVA 3N5LA 5JDNA 1LVKA 1WYCA 1FIOA 5LYJE 2A72A 2CWOA 4OYKA 3C98B 2WAUA 3C50A 2YK0A 1YD8G 3AVSA 3PDYA 3DP7A 3IBPA 1D0ZA 1KK7A 3EVYA 3MXZA 3LFMA 4YJ3E 5FY7A 5L3EB 3ZPOA 4UVAB 5LG4A 5LGNB 4WBNE 2BDEA 2EHOD 5EK3A 2X51A 3HI2A 3PUGA 3C64A 3GMIA 1WR6A 4GK0E 5L3CB 2W61A 5ETWA 3UULA 3KDSE 4L5GA 1OXZA 1MIVA 4GYRA 1HCIA 3O9XA 4ZI3D 3VHLA 5A1LA 4QWNB 1MIWA 4O4LE 2ES0A 2X9HA 3KV6A 3V5UA 4L0RA 3RYCE 5FNVE 3Q9DA 4IGUA 4I55E 4UF0B 2WWUA 3DJBA 2LSJA 2YINA 4YHJA 2QGSA 2DI4A 3N9MA 1YKHB 5LCYA 5LJMA 2CE7A 5DQVA 5KDMC 2KXPB 3PTRB 3PURA 2E9XD 5CA1E 1WYBA 2N2NA 3MA9A 3DTOA 3N2GE 3PUAA 3U3IA 3V5SA 3ZEFB 4UF0A 2QA7A 5L3FB 2NW7A 3JC6D 3ZYMA 5E0OA 3RH3A 4KUMB 5JR9B 4IE5A 4DVDA 4QXHB 4L9IA 4ASKA 3RX6A 5LGTB 2KMFA 3AA1B 3ZMVB 3D0TA 2VASA 4UELA 2DLRA 3C4WA 1Y64B 2LSKA 4TUYE 1S94A 3F2EA 5JR9A 3ZCJA 5IHYA 2K24A 1U4QA 4OK0A 4AXPA 2JQQA 1H7CA 4H9RC 3Q5XA 1MMGA 4O2BE 1VOMA 3I9WA 2UXNB 3OYZA 4CI3B 2XHEB 2ZMAA 4G63A 4BJNA 5L3BB 3RKOA 1B7TA 1T98A 2DCFA 3KFWX 2V7LA 2H3RA 3J9X1 4X1KE 3SOLA 1QSDA 1LVFA 2X9YA 3AA6B 2ZLYA 5EZYE 3KBTA 4MLKA 5DQWA 2LOSA 3F31A 3BK9A 4YLHA 3B13A 2CWYA 3AB3B 2N9DA 1V9DA 5L3GB 2V7KA 2LJLA 3OKQA 3OYXA 2ODVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NAF A;  1X79 A;  2N2N A;  1YD8 G;  2N9D A;  1WRD A;  1OXZ A;  1WR6 A;  1NWM X;  1O3X A; 
#chains in the Genus database with same CATH topology
 3N9Q A;  3RYH E;  2NWB A;  2X0L B;  3K3O A;  2Y6X A;  2KZ7 B;  4EZ4 A;  2W4X A;  3AAA B;  4UXN B;  1D1A A;  4ILA A;  5CA0 E;  4YXD A;  5H6R B;  1N36 T;  4N78 D;  2YKS A;  2VWA A;  2NR4 A;  5HXR A;  3CVR A;  4DV6 T;  2XQ8 A;  2UUB T;  4GK5 E;  4DR2 T;  3HKD E;  5M4Y A;  4PK5 A;  5F3J A;  4PAG A;  2K5B B;  3GN5 B;  5AQP B;  3ZT6 A;  5FKY A;  3FBL A;  2ZM8 A;  3UU3 A;  2V6Y A;  5JDF A;  4AQG A;  2BG9 B;  5ABF B;  2Q9Q C;  1VRB A;  3GN5 A;  3NBX X;  3NZP A;  1KEY A;  4ZHQ E;  2VKJ A;  4H9P C;  2BG9 A;  5ABF A;  2FJE A;  5LHH B;  1IBK T;  2JRK A;  2DNX A;  4QH1 A;  2BBH A;  5L2L A;  2RA1 A;  4NPP A;  2LSI A;  1WR0 A;  2C0S A;  2JQH A;  3JAE A;  3UU5 A;  4KX6 A;  2W67 A;  4ZZC A;  2HN2 A;  2DL1 A;  3E22 E;  1HNW T;  2LOP A;  3K1S A;  4P1N A;  1ZV4 X;  1YKE B;  2CPT A;  3ZC0 A;  3C51 A;  1LKX A;  2IUB A;  2L3L A;  1CUN A;  3FHN A;  5ABG A;  3HKC E;  3I1A A;  1I94 T;  1M62 A;  3WAK A;  2ZM6 T;  1N32 T;  4HFB A;  2Z6E A;  5J2U E;  3ONL C;  4EOZ B;  2HHH T;  4TN7 B;  3PV0 F;  3FXD B;  4UEM A;  4LML A;  1HX8 A;  2N1G A;  1VCT A;  3OJA A;  1YQ3 A;  4PK4 A;  3KV4 A;  2HN1 A;  5FL0 A;  2CHN A;  4WZX A;  4EXT A;  4DV4 T;  1FMW A;  1VCS A;  3PJA A;  4IDQ A;  4HFH A;  5HEU A;  2WP9 A;  4EB6 E;  4I50 E;  2XAQ B;  2UU9 T;  2CLY B;  1NWM X;  2X67 A;  2AXD S;  5L3D B;  4DBR A;  3B57 A;  3O1J A;  2YN6 A;  2XAJ B;  1Y01 A;  4X64 T;  2M67 A;  2CMR A;  2XM2 A;  1GQE A;  2K3W A;  3ZYK A;  3N9N A;  2A2F X;  3WAJ A;  2HPL A;  4B3M T;  3JC6 C;  2PJQ A;  3ZCI A;  4LFA T;  3P50 A;  3EAM A;  4I4T E;  3P8C D;  2HH7 A;  3KVB A;  2XQ7 A;  4V1A v;  1JNZ A;  4J2C A;  1FMV A;  1SHZ C;  3P4S A;  4DBQ A;  3KVA A;  3AA0 B;  3ZT7 A;  2W0G A;  1UX4 A;  2EHO B;  2ACX A;  4TX5 A;  1W0A A;  2NW8 A;  3RC8 A;  4TZ4 C;  4KHZ F;  2AE9 A;  2H89 A;  2DWG A;  2EHO A;  4CI1 B;  4AKI A;  2Q9Q D;  1IBM T;  4OFZ A;  2UXB T;  1D1C A;  2OV9 A;  2UXD T;  2E9X B;  3MAC A;  3CPZ A;  5HCJ A;  2FBW A;  4ZXL A;  1WCR A;  1XWM A;  3ZLI A;  4AKH A;  2WU2 A;  2B76 A;  3RIU C;  2E9X A;  5LB7 B;  2KIN B;  2LRL A;  2LM9 A;  5LA6 E;  2VKH A;  5HYA A;  4IST A;  4I43 B;  4WW0 A;  3K8P C;  3ZYL A;  3FXE B;  4WNK A;  2XQ4 A;  3HKE E;  2D2S A;  2KSR A;  2SPC A;  2IAK A;  1KF6 A;  3CX7 B;  5LBQ B;  5AQL B;  3ZJ2 A;  4CN1 A;  2K9A A;  5LOV E;  5C8Y E;  2VB6 A;  3IEE A;  4X1Y E;  2YDR A;  2WS3 A;  4JI8 T;  4HKA A;  3ZN1 B;  4FJO A;  2VK9 A;  4YJ2 E;  2VUR A;  3ZN0 B;  2X66 A;  3CKD A;  5JDN A;  1WYC A;  4OYK A;  2WAU A;  3C50 A;  4AIU A;  4DR7 T;  3TLU A;  1YD8 G;  4JI1 T;  3DP7 A;  3IBP A;  4JI7 T;  1X9B A;  5LGN B;  5IUX A;  2X51 A;  5AQU B;  4GK0 E;  5ETW A;  2RPA A;  1OXZ A;  2D9D A;  1HCI A;  4O4L E;  5FNV E;  3Q9D A;  4TNV A;  2WWU A;  3DJB A;  3N9M A;  2CE7 A;  4HWF A;  4LF5 T;  2N2N A;  2BS3 A;  4ZZB A;  3ZEF B;  1SUM B;  3JC6 D;  2YDQ A;  3ZYM A;  3RH3 A;  5JR9 B;  4QXH B;  3ZMV B;  3D0T A;  3C4W A;  2LSK A;  1S94 A;  2PTF A;  3F2E A;  5ABH A;  5JR9 A;  3ZCJ A;  4AIS A;  4IL9 A;  1U4Q A;  4AXP A;  3Q5X A;  3AE2 A;  2J62 A;  1VOM A;  4CI3 B;  3RKO A;  1T98 A;  3L8R A;  3SOL A;  2IML A;  1QSD A;  3FZL B;  3AEC A;  3H3M A;  2LOS A;  1V9D A;  2X9X A;  1W9R A;  2ACZ A;  4LF6 T;  4H9O C;  5FP3 A;  4IE6 A;  2BVL A;  4Z8X A;  3SRZ A;  3VKG A;  4NUU A;  3WI3 A;  3L09 A;  4UV8 B;  3GWH A;  5HXH A;  4O4H E;  4LFB T;  2ZM0 A;  4Q25 A;  4O2A E;  2CEA A;  5JVD E;  5KMG P;  5JQG E;  3BQL A;  3R6N A;  2E5V A;  1D0X A;  2JMH A;  3J7Y q;  3FZH B;  2LE8 A;  4YSY A;  3MK7 C;  3U78 A;  3E08 A;  2CA5 A;  1HTJ F;  4X1I E;  5JRC B;  4WBO A;  3Q2M A;  2V6X A;  4C91 A;  1S35 A;  5JRC A;  4BJM A;  3CQC B;  3VRA A;  4LF7 T;  1YXR A;  3HA4 A;  3RQW A;  4IDP A;  1OED E;  4NUV A;  4PK6 A;  5FVK A;  4JI3 T;  5JTG A;  4JI6 T;  2M6B A;  4OX9 T;  3IF8 B;  2LEH A;  4LFC T;  2BS2 A;  3ZMS B;  3LK4 2;  4IHJ E;  2QYW A;  2BKP A;  4U3C A;  1KNZ A;  4KBM B;  4C90 A;  2IDO B;  4JBW F;  2WM9 A;  4U31 A;  4TV8 E;  2VVN A;  5EK2 A;  3RPU A;  1MNE A;  4YSX A;  5LHG B;  4E7S A;  3N9P A;  4UR9 A;  4PFP A;  3AEG A;  3ETU A;  3QNU A;  1BR2 A;  4DV0 T;  2VKD A;  1UUS A;  5JDL A;  2NTY A;  4IIJ E;  5HEH A;  2XM1 A;  3TKL B;  3RRW A;  2LSG A;  4TNW A;  4YTP A;  4DUZ T;  5AQG B;  1US7 B;  2OLT A;  4KMC A;  3NKZ A;  4YFS A;  3P7I A;  2WDQ A;  3KIN B;  5FVL A;  3CQX C;  2JJ9 A;  2WMN A;  5IWA T;  3RLF F;  1XNQ T;  4YSZ A;  4ILC A;  5FYM A;  4PJL A;  4AKG A;  3SFE A;  5AQI B;  3UT5 E;  3RC3 A;  2PBI A;  4G2A A;  2V5D A;  2WSS V;  5AQQ B;  2V26 A;  4ZI3 C;  5JDG A;  1UCU A;  3H37 A;  2LT3 A;  4K0U A;  4DV3 T;  4A5X A;  1WRD A;  4EEB A;  1E7P A;  2M6I A;  3CIR A;  5HEG A;  4MFR A;  4GIW A;  1MMD A;  1XZY A;  2FJD A;  3FBZ A;  3QB5 A;  2IW5 B;  2D0U A;  1QUU A;  1X79 A;  4JV5 T;  4CZZ B;  4YT0 A;  3AEB A;  5AFU L;  4PJM A;  3NRX A;  3UQ4 A;  3PUZ F;  2JQ9 A;  4KP3 C;  2JMK A;  4TWF A;  1MMN A;  3FZF B;  1XNR T;  4LMK A;  2D0T A;  2E8I A;  3ZJ1 A;  1YQ4 A;  1XMQ T;  1Z8U A;  2CXL A;  1WLX A;  4IRE A;  4H9Q C;  4EYY R;  4U7Y A;  1WFD A;  2NTX A;  2MAW A;  4PW8 A;  2WMO A;  3SS1 A;  1HNX T;  1G73 A;  4MAL A;  4GKJ T;  5LP6 E;  4DR6 T;  5AQH B;  5LMU T;  3FB2 A;  4H63 V;  3IHR A;  4HFI A;  3ETV A;  5AQN B;  2RP4 A;  4F6R C;  5HAX A;  2ZM2 A;  3NVO A;  2W00 A;  2CRB A;  2V7J A;  5BMV E;  1HG5 A;  2V7M A;  3LSV A;  4ANJ A;  2JPF A;  4K0K T;  4OYJ A;  3ZC1 A;  4E7Z A;  2XAS B;  2D5U A;  3PUW F;  2ODU A;  1OED B;  3TLS A;  3ZMZ B;  5CJ5 A;  2XAG B;  3OTO T;  2C5K T;  4ZS2 A;  5EK4 A;  1OED A;  2KLQ A;  3MJX A;  3Q5D A;  3N5L A;  1FIO A;  5LYJ E;  3C98 B;  3EI0 A;  2YK0 A;  2LRK A;  2UUA T;  1D0Z A;  5FY7 A;  3ZT5 A;  2UXC T;  2I0M A;  1J5W A;  5EK3 A;  3HI2 A;  3ONJ A;  3C64 A;  1WR6 A;  2W61 A;  3UUL A;  4HFE A;  5LG3 A;  4ZI3 D;  4AQY T;  1MIW A;  2FUP A;  1M7K A;  2IHR 1;  3RYC E;  4IGU A;  4I55 E;  2LSJ A;  2YIN A;  4YHJ A;  1YKH B;  5LJM A;  5DQV A;  4NXN T;  3PUR A;  2XJ7 A;  4DV7 T;  4YY3 T;  4DVD A;  2CHO A;  4UEL A;  2DLR A;  4IDO A;  4COF A;  2WCA A;  5BR8 T;  1H7C A;  3AE4 A;  1MMG A;  3FZM B;  3I9W A;  3OYZ A;  2XHE B;  2ZMA A;  4BJN A;  1HNZ T;  2DCF A;  5AQF B;  3J9X 1;  2ZLY A;  3P4W A;  5EZY E;  3KBT A;  4YTM A;  3B13 A;  3AB3 B;  5AQR B;  3PDY A;  2ODV A;  2BG9 C;  5CGM A;  5TAO A;  4F8H A;  3K3N A;  2WY2 A;  3KBU A;  2F4V T;  5AQS B;  4TWH A;  3PJA J;  4ZI2 C;  3UU6 A;  3AAI A;  2C5J A;  1T8B A;  5LXT E;  5IYZ E;  3PUX F;  3S4U A;  5FY1 A;  3AEE A;  3ANW B;  3UFG A;  2H7O A;  5J2T E;  3RF1 A;  2CBJ A;  2LHR A;  3AED A;  3I0O A;  1ZKE A;  2X68 A;  3N9L A;  3LDQ B;  4B3S T;  3CK6 A;  2XQY A;  1T72 A;  5GON E;  5LMN T;  2P9B A;  1J5E T;  3RIA A;  3NWI A;  4TWD A;  4JI5 T;  4DV2 T;  4GKK T;  4KI0 F;  3N2K E;  4B3T T;  4JEU B;  2XQA A;  4ZEY A;  3EHZ A;  4O4I E;  2LKG A;  3OBV E;  4BAY B;  4ILU A;  3M3Z B;  4DV5 T;  4A97 A;  4ILB A;  3LBX B;  4EYU A;  5DAB A;  3PU8 A;  5JDH A;  4EIW A;  5JH7 E;  3LBX A;  5JDQ A;  3PUV F;  2K48 A;  4AQF A;  1N34 T;  2OA5 A;  2NOX A;  2BKO A;  3AE9 A;  4LF4 T;  1R8I A;  4DUY T;  5FXZ A;  3K3Q C;  3M65 A;  3PU3 A;  2Q9Q B;  4DMV A;  1EZ3 A;  3R84 B;  2CLY C;  4IDN A;  4B6X A;  2IC6 A;  4HWI B;  4HWC A;  4DR1 T;  4PJJ A;  5DJQ C;  3ZMU B;  3OVU A;  4PFO A;  4QX7 B;  4ISS A;  2V7I A;  5C2T A;  2IC9 A;  4LMJ A;  4IE7 A;  2XQ9 A;  4HEA A;  4CI2 B;  2GK9 A;  2CXD A;  1HFA A;  1OWA A;  1ZHC A;  3I9Y A;  3QC9 A;  4DO0 A;  3AE3 A;  3EUH A;  2XZE A;  2CM0 A;  2MTQ A;  3AVR A;  1NEK A;  2W62 A;  3AXJ B;  4UVC B;  3PUY F;  2BS4 A;  3AXJ A;  5F8P A;  1Z0P A;  2EHO C;  4P09 A;  3H3A A;  4UVB B;  2WQY A;  2DWK A;  5H6Q B;  4FI5 A;  3C4X A;  2X0H A;  2W2U A;  5C3J A;  2YOE A;  4U2Z A;  4JI0 T;  2QVA A;  2YU2 A;  2W66 A;  4ZI2 D;  1HX1 B;  2Y8D A;  2E9X C;  4ZOL E;  3SWH A;  5LJN A;  1O3X A;  3JAD A;  3RIF A;  1UX5 A;  2CXF A;  2Y48 B;  3UFE A;  3T1Y T;  1D1B A;  4U72 A;  4CXY A;  2WZH A;  2A3D A;  2XQ3 A;  1MND A;  3JCF A;  4EED A;  3ZMT B;  3AAE B;  4CN4 A;  3I0Q A;  4KHP T;  4GYS A;  2YDS A;  2L9Q A;  1AJ3 A;  1NAF A;  4A56 A;  5AQO B;  5L4E A;  1BR1 A;  2XAF B;  2CCQ A;  3AE7 A;  3BQI A;  3VU7 H;  5FXW A;  2WZI A;  2XQ5 A;  4LF8 T;  3ESL A;  4PJN A;  3TLV A;  4QXC B;  1W0B A;  1D0Y A;  2H7V C;  2WBL A;  2QRX A;  4EZH A;  4DR4 T;  2UUC T;  3C4Z A;  3GA8 A;  4CXX A;  2X9W A;  4UIG A;  5LNK A;  3LK2 B;  1MIY A;  4EAH A;  5AQJ B;  1IBL T;  2FJA A;  1ZEE A;  3PE0 A;  3O4X E;  3VR8 A;  3NRY A;  2XAH B;  2B1E A;  4NXM T;  3A8Y C;  3UUX B;  3B5M A;  2G0U A;  4JLE A;  1J1J A;  4OHF A;  3CX6 B;  2LSY A;  4AKR B;  1HS7 A;  4JYA T;  4AQF C;  4CQI A;  3RQU A;  2H88 A;  1KFY A;  5JR9 C;  1QLB A;  3N2O A;  3CQG B;  1IAP A;  1MMA A;  1G8X A;  3RIU A;  2V6Y B;  3AVS A;  1HR0 T;  3EVY A;  3AE5 A;  4HFD A;  5LG4 A;  4WBN E;  2BDE A;  4DID B;  2EHO D;  5AQT B;  3PUG A;  2R6G F;  1MIV A;  5A1L A;  4QWN B;  2ES0 A;  3KV6 A;  4UF0 B;  2QGS A;  2DI4 A;  4U2Y A;  3A7M A;  5KDM C;  3PTR B;  5KXJ A;  2E9X D;  3DTO A;  3U3I A;  3V5S A;  4UF0 A;  2QA7 A;  5L3F B;  2NW7 A;  4IE5 A;  4L9I A;  3RX6 A;  3QB5 K;  1Y64 B;  5IHY A;  2K24 A;  2IIU A;  2JQQ A;  5F5W A;  2XSB A;  2UXN B;  4HWD A;  2FJB A;  3KFW X;  1I6Z A;  2V7L A;  2H3R A;  4X1K E;  1LVF A;  3AA6 B;  5DQW A;  3BK9 A;  2V7K A;  2LJL A;  3OKQ A;  3KV9 A;  3F57 A;  3Q5E A;  2KT9 A;  2L8K A;  4Z91 A;  4CXW A;  3HL6 A;  2E2A A;  5AQM B;  3QUJ A;  1DU2 A;  1IZN B;  3RI5 A;  3O1H A;  5JRE A;  1XMO T;  3Q5W A;  4TV9 E;  4JEH B;  5J1G A;  1KNR A;  4Z90 A;  5ADX L;  1ZOY A;  3ABV A;  5FY0 A;  5HWY A;  3OPC A;  3NZQ A;  2I6H A;  4I0U A;  5LHI B;  1XDO A;  4ZS3 A;  5FMN A;  1UUR A;  5J0Z A;  1NEN A;  3AA7 B;  3AEA A;  2V8S V;  2YU1 A;  1KNP A;  2MPK A;  4YHH T;  3PUQ A;  2PG8 A;  3AE6 A;  3IA3 A;  2C5I T;  4M1P A;  2MYS A;  2LLY A;  2XUE A;  4HTE A;  2KND A;  4HN9 A;  3HKB E;  3CML A;  4IE0 A;  2A9U A;  1FEW A;  2NW9 A;  2VL0 A;  2BBJ A;  2DHR A;  3G06 A;  2W63 A;  3UUN A;  4QH5 A;  4DR5 T;  4QX8 B;  2KWI B;  5FXV A;  3HR0 A;  2J1D G;  2BVM A;  4X20 E;  3SFD A;  1W09 A;  3EAB A;  1XDP A;  4IE4 A;  1T7S A;  3EDU A;  3W15 B;  2VVS A;  2WWV A;  3QK6 A;  4WYV A;  1CHU A;  3AE8 A;  5FL1 A;  3X1D A;  2YEV C;  1IJ6 A;  4P0B A;  3UU4 A;  5LBM A;  4XBF B;  3BQK A;  2CBI A;  2V1D B;  5LGU B;  4X66 T;  2NP9 A;  3MZK B;  3VKH A;  2XPK A;  4JUY A;  2E5L T;  4O4J E;  4EV6 A;  2VQF T;  5HXE A;  3UUB A;  3O1I A;  2XTL A;  4ZI7 E;  3LK3 B;  2LHN A;  4GOU A;  4QKN A;  1YW0 A;  2JIW A;  3RYI E;  1E1H B;  4MBQ A;  1LRZ A;  3RGL A;  3ANW A;  3RYF E;  2XY8 B;  4NIQ A;  2MBG A;  4QHO A;  1HF8 A;  3ZSS A;  3T1H T;  3T8O A;  1BR4 A;  5FXX A;  4QXB B;  3LJC A;  4H9N C;  2PFV A;  4DND A;  1UK5 A;  5JDM A;  2X0Y A;  2I59 A;  3VR9 A;  4AKL A;  4UV9 B;  5L47 A;  4U7I A;  5L4H A;  5HEO A;  4IDZ A;  4X5T A;  3E0Z A;  4QH4 A;  3RHW A;  3TLT A;  4HFV A;  3RKG A;  5KX5 E;  3UTK A;  2UXX B;  3N9O A;  5AQK B;  5HXC A;  4JI2 T;  4HE8 A;  3AE1 A;  4MHC A;  1HG2 A;  3FZK B;  4DMW A;  2HPJ A;  1SA0 E;  1L0V A;  4P0A A;  3UUM A;  4AI6 A;  2J47 A;  4XAX B;  5CB4 E;  1ZP0 A;  2WB5 A;  1IJ5 A;  1OED C;  3QOF A;  4DV1 T;  3PUS A;  4ERR A;  4HFC A;  4X65 T;  2KWH A;  4X62 T;  2BG9 E;  4LF9 T;  3P4R A;  3ONX A;  4ADZ A;  2Q9Q A;  3TLW A;  3L39 A;  4XZC A;  3UQ7 A;  4U74 A;  3MKD A;  4H63 H;  5HXS A;  3LG7 A;  2LM2 A;  1E2A A;  2XQ6 A;  2VKO A;  2BZB A;  3CX8 B;  2JQK A;  5HWX A;  3KV5 A;  1UGO A;  2VL8 A;  3L3P A;  3A5X A;  4IL4 A;  4A98 A;  2MOZ A;  2XSA A;  1U5P A;  4EGW A;  4YTN A;  4BA9 A;  4HGA A;  2LKH A;  3RRC A;  3CWZ B;  2VQE T;  4H9S E;  4IT4 A;  4PNI A;  1JNR A;  1BR0 A;  4O8S A;  4DR3 T;  3EDV A;  1LVK A;  3P4P A;  3UU8 A;  5CFB A;  2A72 A;  2CWO A;  3P4Q A;  1KK7 A;  3MXZ A;  3LFM A;  4YJ3 E;  5L3E B;  3ZPO A;  4UVA B;  2WU5 A;  5AQV B;  3GMI A;  4U33 A;  5L3C B;  3ZKR A;  3KDS E;  4L5G A;  1FJG T;  4GYR A;  3O9X A;  3VHL A;  3VRB A;  2X9H A;  3V5U A;  5HCM A;  4L0R A;  2BKN A;  4CN6 A;  2WDV A;  5LCY A;  2KXP B;  3JAF A;  5CA1 E;  1WYB A;  3MA9 A;  3N2G E;  1N33 T;  5ABE A;  5HEJ A;  3PUA A;  5E0O A;  1SE7 A;  4B3R T;  4KUM B;  4ASK A;  5LGT B;  2KMF A;  4HWH A;  3AA1 B;  2VAS A;  4TUY E;  4OK0 A;  4H9R C;  4O2B E;  4G63 A;  5L3B B;  1B7T A;  2X9Y A;  4JI4 T;  2J4G A;  4MLK A;  3F31 A;  4YLH A;  2CWY A;  3AEF A;  2N9D A;  5L3G B;  2V5C A;  2WDR A;  3OYX A;  3ZST A; 
#chains in the Genus database with same CATH homology
 3KV9 A;  2X9X A;  3N9Q A;  5TAO A;  3K3N A;  3F57 A;  3RYH E;  4H9O C;  2KT9 A;  2L8K A;  3KBU A;  2NWB A;  4IE6 A;  5FP3 A;  4CXW A;  2X0L B;  2BVL A;  3HL6 A;  3K3O A;  4Z8X A;  3SRZ A;  3VKG A;  2Y6X A;  4NUU A;  3QUJ A;  2KZ7 B;  4ZI2 C;  4EZ4 A;  3WI3 A;  3L09 A;  4UV8 B;  1IZN B;  3AAI A;  2C5J A;  3AAA B;  3GWH A;  3O1H A;  5HXH A;  5JRE A;  3Q5W A;  1D1A A;  4O4H E;  4UXN B;  4TV9 E;  4JEH B;  5LXT E;  5IYZ E;  2ZM0 A;  4O2A E;  5FY1 A;  5J1G A;  3S4U A;  2CEA A;  3ANW B;  5CA0 E;  5H6R B;  5ADX L;  5JVD E;  4N78 D;  2H7O A;  5FY0 A;  5HWY A;  5KMG P;  5J2T E;  3NZQ A;  2LHR A;  5JQG E;  3BQL A;  3I0O A;  2VWA A;  1ZKE A;  5HXR A;  3R6N A;  2X68 A;  3N9L A;  1D0X A;  2XQY A;  3CVR A;  2JMH A;  5LHI B;  3J7Y q;  4ZS3 A;  5FMN A;  2LE8 A;  5GON E;  3MK7 C;  4GK5 E;  3U78 A;  3HKD E;  3E08 A;  2CA5 A;  1HTJ F;  2P9B A;  5M4Y A;  4PK5 A;  5F3J A;  3AA7 B;  4PAG A;  4X1I E;  2K5B B;  5JRC B;  3GN5 B;  2YU1 A;  4WBO A;  3FBL A;  3PUQ A;  2ZM8 A;  3Q2M A;  3N2K E;  2PG8 A;  2C5I T;  4JEU B;  5JDF A;  4C91 A;  4AQG A;  1S35 A;  4M1P A;  2MYS A;  2Q9Q C;  5JRC A;  1VRB A;  3GN5 A;  3NBX X;  3NZP A;  4O4I E;  4BJM A;  3CQC B;  3OBV E;  3HA4 A;  4ZHQ E;  2XUE A;  2VKJ A;  4BAY B;  4HTE A;  4H9P C;  2KND A;  4ILU A;  4HN9 A;  3HKB E;  3CML A;  5LHH B;  4IE0 A;  2JRK A;  3LBX B;  4EYU A;  1FEW A;  5DAB A;  2NW9 A;  3PU8 A;  4NUV A;  2DNX A;  5JDH A;  4PK6 A;  2DHR A;  4EIW A;  2W63 A;  3UUN A;  2RA1 A;  5JH7 E;  5L2L A;  2LSI A;  3IF8 B;  2C0S A;  2LEH A;  3LBX A;  5JDQ A;  4QX8 B;  2KWI B;  3ZMS B;  5FXV A;  3HR0 A;  3LK4 2;  2K48 A;  4AQF A;  4IHJ E;  2J1D G;  2OA5 A;  2BVM A;  4X20 E;  2NOX A;  1KNZ A;  3E22 E;  4KBM B;  2LOP A;  4C90 A;  5FXZ A;  4IE4 A;  3K3Q C;  1ZV4 X;  1YKE B;  3EDU A;  3W15 B;  2WM9 A;  3ZC0 A;  4TV8 E;  3C51 A;  1LKX A;  5EK2 A;  3QK6 A;  3RPU A;  3M65 A;  2L3L A;  3PU3 A;  2Q9Q B;  1MNE A;  4DMV A;  1EZ3 A;  1CUN A;  2CLY C;  2YEV C;  3FHN A;  3R84 B;  5LHG B;  4E7S A;  3HKC E;  1IJ6 A;  3N9P A;  4P0B A;  2IC6 A;  4B6X A;  3I1A A;  4PFP A;  3WAK A;  3ETU A;  1BR2 A;  5LBM A;  4PJJ A;  5DJQ C;  3ZMU B;  4XBF B;  3BQK A;  2VKD A;  4PFO A;  2Z6E A;  4ISS A;  4QX7 B;  5J2U E;  5JDL A;  2NTY A;  4IIJ E;  2V7I A;  2IC9 A;  3TKL B;  4EOZ B;  4IE7 A;  3RRW A;  2LSG A;  4HEA A;  4TN7 B;  3FXD B;  4UEM A;  2V1D B;  4CI2 B;  5LGU B;  2GK9 A;  1US7 B;  2CXD A;  1HX8 A;  2N1G A;  2NP9 A;  3MZK B;  1HFA A;  1OWA A;  3VKH A;  4KMC A;  4JUY A;  1ZHC A;  3I9Y A;  3QC9 A;  4DO0 A;  4YFS A;  3P7I A;  4O4J E;  3OJA A;  3EUH A;  3KIN B;  4PK4 A;  2CM0 A;  3KV4 A;  3CQX C;  5HXE A;  3AVR A;  2MTQ A;  2JJ9 A;  2W62 A;  2WMN A;  3O1I A;  2XTL A;  4ZI7 E;  3LK3 B;  2LHN A;  4UVC B;  4EXT A;  4GOU A;  4QKN A;  1YW0 A;  3RYI E;  1FMW A;  1E1H B;  4MBQ A;  5FYM A;  4PJL A;  1LRZ A;  5F8P A;  3ANW A;  3RYF E;  1Z0P A;  4AKG A;  2EHO C;  4P09 A;  3H3A A;  3UT5 E;  3RC3 A;  4EB6 E;  4UVB B;  2PBI A;  4G2A A;  4I50 E;  2MBG A;  2WSS V;  2XAQ B;  4QHO A;  1HF8 A;  2DWK A;  5H6Q B;  2V26 A;  2CLY B;  4ZI3 C;  1NWM X;  2X67 A;  3C4X A;  1BR4 A;  4FI5 A;  3T8O A;  4DBR A;  5JDG A;  3B57 A;  1UCU A;  3H37 A;  5L3D B;  2LT3 A;  3O1J A;  2XAJ B;  5FXX A;  4QXB B;  2M67 A;  2CMR A;  4K0U A;  2YU2 A;  4ZI2 D;  1WRD A;  2Y8D A;  3ZYK A;  2E9X C;  3N9N A;  3LJC A;  2A2F X;  4H9N C;  2PFV A;  3WAJ A;  4DND A;  2HPL A;  4MFR A;  4ZOL E;  4GIW A;  5JDM A;  3SWH A;  3JC6 C;  2I59 A;  5LJN A;  1O3X A;  2PJQ A;  4AKL A;  1MMD A;  3ZCI A;  4UV9 B;  1UX5 A;  4I4T E;  2CXF A;  2Y48 B;  3FBZ A;  3UFE A;  3P8C D;  2IW5 B;  4IDZ A;  2D0U A;  2HH7 A;  3E0Z A;  3KVB A;  1QUU A;  1D1B A;  1X79 A;  4V1A v;  4J2C A;  1FMV A;  1SHZ C;  4HFV A;  4CZZ B;  5KX5 E;  4PJM A;  2UXX B;  3N9O A;  3NRX A;  3UTK A;  5AFU L;  4DBQ A;  4U72 A;  5HXC A;  4CXY A;  2A3D A;  3KVA A;  3AA0 B;  4HE8 A;  4MHC A;  2W0G A;  1HG2 A;  4DMW A;  1UX4 A;  2EHO B;  2ACX A;  4TX5 A;  2HPJ A;  2NW8 A;  4KP3 C;  3RC8 A;  1MND A;  2JMK A;  1SA0 E;  1MMN A;  4P0A A;  4TZ4 C;  2D0T A;  2E8I A;  3ZMT B;  3AAE B;  3ZJ1 A;  3I0Q A;  3UUM A;  2DWG A;  4AI6 A;  4XAX B;  2EHO A;  4GYS A;  4CI1 B;  4AKI A;  2Q9Q D;  2L9Q A;  1AJ3 A;  1NAF A;  5CB4 E;  4A56 A;  2CXL A;  4OFZ A;  1IJ5 A;  1D1C A;  1BR1 A;  1WLX A;  2XAF B;  2CCQ A;  4H9Q C;  4EYY R;  3BQI A;  3VU7 H;  2E9X B;  2NTX A;  3CPZ A;  3MAC A;  5FXW A;  4PW8 A;  2WMO A;  3PUS A;  4ERR A;  3SS1 A;  1G73 A;  4MAL A;  5LP6 E;  2KWH A;  3ZLI A;  3ESL A;  3ONX A;  4AKH A;  4PJN A;  2E9X A;  4QXC B;  4ADZ A;  2KIN B;  1D0Y A;  2H7V C;  2Q9Q A;  3FB2 A;  4H63 V;  2LM9 A;  2WBL A;  3IHR A;  3ETV A;  5LA6 E;  2RP4 A;  2VKH A;  4EZH A;  5HYA A;  4F6R C;  4IST A;  4XZC A;  4I43 B;  4WW0 A;  5HAX A;  2ZM2 A;  3C4Z A;  3GA8 A;  3MKD A;  4H63 H;  3LG7 A;  4U74 A;  4CXX A;  2W00 A;  2X9W A;  3K8P C;  3ZYL A;  5HXS A;  3FXE B;  4UIG A;  4WNK A;  5LNK A;  3LK2 B;  2V7J A;  1MIY A;  5BMV E;  1HG5 A;  2VKO A;  3HKE E;  2V7M A;  2D2S A;  4EAH A;  2BZB A;  3CX8 B;  1ZEE A;  3PE0 A;  4ANJ A;  3O4X E;  5HWX A;  3KV5 A;  2JPF A;  3NRY A;  2VL8 A;  2XAH B;  2B1E A;  2SPC A;  4OYJ A;  2IAK A;  3L3P A;  3CX7 B;  5LBQ B;  3ZC1 A;  4E7Z A;  2XAS B;  3A5X A;  2MOZ A;  3ZJ2 A;  1U5P A;  3UUX B;  2G0U A;  4JLE A;  2K9A A;  2D5U A;  5LOV E;  2ODU A;  5C8Y E;  4OHF A;  2VB6 A;  3ZMZ B;  3CX6 B;  2LSY A;  3IEE A;  4X1Y E;  2XAG B;  4BA9 A;  4AKR B;  1HS7 A;  4HGA A;  3RRC A;  3CWZ B;  4H9S E;  4HKA A;  3ZN1 B;  4AQF C;  4CQI A;  2C5K T;  4PNI A;  4FJO A;  4ZS2 A;  5EK4 A;  2VK9 A;  4YJ2 E;  2KLQ A;  5JR9 C;  3N2O A;  3CQG B;  3MJX A;  1BR0 A;  4O8S A;  1IAP A;  3ZN0 B;  1MMA A;  1G8X A;  2X66 A;  3CKD A;  3EDV A;  3N5L A;  5JDN A;  1LVK A;  1WYC A;  1FIO A;  5LYJ E;  2A72 A;  2CWO A;  4OYK A;  3C98 B;  2WAU A;  3C50 A;  2YK0 A;  1YD8 G;  3AVS A;  3PDY A;  3DP7 A;  3IBP A;  1D0Z A;  1KK7 A;  3EVY A;  3MXZ A;  3LFM A;  4YJ3 E;  5FY7 A;  5L3E B;  3ZPO A;  4UVA B;  5LG4 A;  5LGN B;  4WBN E;  2BDE A;  2EHO D;  5EK3 A;  2X51 A;  3HI2 A;  3PUG A;  3C64 A;  3GMI A;  1WR6 A;  4GK0 E;  5L3C B;  2W61 A;  5ETW A;  3UUL A;  3KDS E;  4L5G A;  1OXZ A;  1MIV A;  4GYR A;  1HCI A;  3O9X A;  4ZI3 D;  3VHL A;  5A1L A;  4QWN B;  1MIW A;  4O4L E;  2ES0 A;  2X9H A;  3KV6 A;  3V5U A;  4L0R A;  3RYC E;  5FNV E;  3Q9D A;  4IGU A;  4I55 E;  4UF0 B;  2WWU A;  3DJB A;  2LSJ A;  2YIN A;  4YHJ A;  2QGS A;  2DI4 A;  3N9M A;  1YKH B;  5LCY A;  5LJM A;  2CE7 A;  5DQV A;  5KDM C;  2KXP B;  3PTR B;  3PUR A;  2E9X D;  5CA1 E;  1WYB A;  2N2N A;  3MA9 A;  3DTO A;  3N2G E;  3PUA A;  3U3I A;  3V5S A;  3ZEF B;  4UF0 A;  2QA7 A;  5L3F B;  2NW7 A;  3JC6 D;  3ZYM A;  5E0O A;  3RH3 A;  4KUM B;  5JR9 B;  4IE5 A;  4DVD A;  4QXH B;  4L9I A;  4ASK A;  3RX6 A;  5LGT B;  2KMF A;  3AA1 B;  3ZMV B;  3D0T A;  2VAS A;  4UEL A;  2DLR A;  3C4W A;  1Y64 B;  2LSK A;  4TUY E;  1S94 A;  3F2E A;  5JR9 A;  3ZCJ A;  5IHY A;  2K24 A;  1U4Q A;  4OK0 A;  4AXP A;  2JQQ A;  1H7C A;  4H9R C;  3Q5X A;  1MMG A;  4O2B E;  1VOM A;  3I9W A;  2UXN B;  3OYZ A;  4CI3 B;  2XHE B;  2ZMA A;  4G63 A;  4BJN A;  5L3B B;  3RKO A;  1B7T A;  1T98 A;  2DCF A;  3KFW X;  2V7L A;  2H3R A;  3J9X 1;  4X1K E;  3SOL A;  1QSD A;  1LVF A;  2X9Y A;  3AA6 B;  2ZLY A;  5EZY E;  3KBT A;  4MLK A;  5DQW A;  2LOS A;  3F31 A;  3BK9 A;  4YLH A;  3B13 A;  2CWY A;  3AB3 B;  2N9D A;  1V9D A;  5L3G B;  2V7K A;  2LJL A;  3OKQ A;  3OYX A;  2ODV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...