1YD8G

Complex of human gga3 gat domain and ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
b'GIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUIN
molecule tags Protein transport, chromosomal protein
source organism Homo sapiens
publication title Structural mechanism for ubiquitinated-cargo recognition by the Golgi-localized, {gamma}-ear-containing, ADP-ribosylation-factor-binding proteins
pubmed doi rcsb
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yd8G00
1WRDA 1OXZA 1X79A 1WR6A 2N2NA 1O3XA 2N9DA 1NAFA 1NWMX 1YD8G
chains in the Genus database with same CATH superfamily
2WZHA 1J1JA 3IEEA 4DR2T 2LT3A 5ADXL 2V26A 4IIJE 4JI2T 2W2UA 5AQQB 2YEVC 3CPZA 1NAFA 3Q5EA 4MLKA 4AKLA 3EAMA 1N33T 4PJLA 4DV5T 3AAEB 2PJQA 2Q9QA 2H3RA 2IHR1 1SHZC 4PW8A 2V6YA 1LVKA 3LSVA 5LP6E 2UXCT 1ZHCA 2WB5A 4LFAT 4F8HA 2YN6A 1EZ3A 4YT0A 1MNEA 2XSBA 5CFBA 3AA7B 3I0OA 1T98A 3RQWA 3HL6A 1LRZA 4HFEA 2XQ4A 1CHUA 2QYWA 4I55E 2BBHA 5LXTE 3A7MA 2W4XA 5F3JA 4CZZB 3QC9A 4LF5T 3A8YC 1WR6A 2N2NA 1VCSA 2V6YB 3HR0A 3QUJA 4GK5E 3MZKB 4HFIA 3T8OA 3VRBA 4CN1A 2PFVA 2WBLA 2X66A 5KX5E 1YXRA 3N2OA 3AE9A 3JCFA 3WAKA 5HCMA 2EHOC 1ZV4X 4ISTA 4DV1T 4N78D 5ABGA 3NBXX 4DR3T 2IIUA 4H63V 1XNQT 3C50A 4FI5A 4PJMA 5AQGB 4DNDA 4JI6T 3PUAA 3VR8A 5AQFB 1IAPA 1S94A 3EHZA 3LBXB 2SPCA 5F8PA 5L4HA 3HKBE 3R84B 3ETVA 5JVDE 4QX7B 4GIWA 3C51A 4C91A 3Q5WA 2I6HA 4H9PC 3MACA 4YSZA 2CLYB 2CRBA 2FJEA 2G0UA 2NW7A 2WCAA 3AEEA 1VOMA 4NUVA 1ZKEA 2WWVA 1MMGA 5LMNT 4EYYR 1HTJF 4U7IA 2CBJA 4UV9B 2P9BA 1D0XA 2W66A 3FB2A 5BMVE 4GKKT 3PUVF 3PUYF 3W15B 1Y64B 4B3TT 3PDYA 2HPJA 2XM1A 1HX1B 1XDPA 2JQHA 1OEDE 2QA7A 4LMLA 2D2SA 2XASB 4MFRA 2JMHA 2W67A 3UU5A 5JREA 1NENA 4KBMB 4C90A 2CPTA 2I59A 2ZLYA 3FBZA 2QGSA 1QUUA 1BR2A 1MMNA 1UUSA 2VKJA 2ZM2A 3Q5DA 5KDMC 1W0BA 1D1CA 1XNRT 2YDRA 3RIFA 4AXPA 3ZC0A 4B6XA 5DQWA 3PJAA 4GYSA 2EHOA 2VVSA 2YU2A 5ABFA 5JDQA 3K1SA 5L4EA 3N9LA 2JPFA 2NOXA 3JADA 4PFOA 5JH7E 4ILCA 4DBRA 4JYAT 5GONE 3UFGA 2Z6EA 4X1IE 5DJQC 4DMWA 5JQGE 2VKDA 3B5MA 3E0ZA 1XMOT 2FJDA 2X0YA 3PV0F 3FZMB 4OYKA 3RH3A 3TLTA 4AKIA 3C4XA 2BG9E 4TWDA 2BG9A 2VURA 3KV9A 4TN7B 3TLVA 5KMGP 1KK7A 1BR0A 5FYMA 4CI2B 3KINB 3AEGA 4M1PA 4ZI3C 4A56A 3D0TA 3N9OA 4UELA 3TLWA 4DUYT 4DV7T 3GN5A 1NWMX 4YHJA 1DU2A 2J4GA 3RRWA 4ASKA 2A2FX 2DNXA 2C5IT 2K48A 2XAHB 3ABVA 4H9RC 4ZZBA 4HN9A 4ZI2D 2OA5A 5JDGA 3RYFE 3CMLA 2LSJA 3EDVA 3L3PA 1YW0A 3ONLC 1NEKA 2E9XB 3Q2MA 2BG9C 3CKDA 4H9OC 3UU6A 4ZI2C 2QVAA 2KWHA 2ZM6T 3VKHA 4EEBA 4DV3T 4A5XA 2M6BA 4NXNT 1OWAA 5LB7B 3VRAA 4OX9T 3KV6A 1MNDA 1IBLT 3ZLIA 3F57A 1T8BA 2L3LA 3QB5K 3HKEE 2LJLA 3LFMA 4QH1A 3VKGA 4AQYT 4UV8B 4EAHA 1N34T 3OBVE 1M62A 5LGNB 3AE6A 2IMLA 1YQ4A 3KBUA 3CQGB 3O1HA 4QX8B 4U31A 4Z8XA 5HEHA 4G63A 5LBQB 3TLSA 3ZMSB 5EK2A 2FBWA 2MAWA 3E22E 4GKJT 2V6XA 4LF4T 3AE8A 2K9AA 4Z91A 3AAIA 4IE7A 5AQPB 3SOLA 2V7JA 1GQEA 3AVRA 4WYVA 2B76A 4A97A 4EIWA 4TWHA 1E7PA 4X65T 2A9UA 2VQFT 4P0AA 4YHHT 1U4QA 2WU2A 2XQYA 3NWIA 4U2ZA 1WLXA 1T7SA 2JQ9A 2X9XA 2ZMAA 4CN6A 2JJ9A 3N9QA 2V7LA 3AA1B 3PTRB 1U5PA 2DLRA 4L5GA 4YFSA 2DL1A 2XAQB 1Z8UA 3AE1A 3ZPOA 4ZEYA 3HKCE 4XZCA 4IL4A 5FY1A 2UUCT 3I9WA 1LVFA 3ANWB 2KMFA 3I9YA 4JUYA 4AKRB 4CXWA 2LEHA 5A1LA 2V7KA 3J7Yq 4EXTA 3TLUA 2XQ8A 3UFEA 2WS3A 5E0OA 1Y01A 3MJXA 2M67A 2BDEA 3RYHE 3T1HT 1HNXT 2CXLA 4JEHB 2WDVA 2CLYC 2GK9A 2Y48B 3IHRA 4CI1B 4LMKA 4X1KE 2X0LB 3UUBA 2E2AA 4UR9A 4K0KT 2CCQA 3SS1A 2WP9A 1KNPA 5FL1A 2UUBT 4DR7T 4ZHQE 4GYRA 2C0SA 3P4RA 4DUZT 3NRXA 3P7IA 1D1BA 4HEAA 4X5TA 4JI8T 1JNRA 2XQ7A 5J0ZA 4TUYE 2NW9A 2J47A 2NTXA 4PFPA 1HS7A 4U74A 2K24A 4CI3B 3OJAA 3O9XA 4LFCT 5LGUB 1D1AA 4IE4A 5JRCA 2IC9A 2LSKA 3RIUA 2XQ5A 5FXWA 2Q9QC 2FJBA 4I50E 4ILUA 3RYCE 4O2BE 3RC3A 2V7MA 1MIWA 2DWKA 1XWMA 1US7B 2CE7A 2VKOA 2XHEB 4O4HE 2EHOB 3VU7H 3X1DA 4EZ4A 2D0TA 1KNRA 4O4JE 4IL9A 4PK6A 4E7SA 5L47A 4O4LE 3N9MA 4ERRA 3RI5A 5JDNA 1N36T 3ZYMA 4TNVA 4U2YA 3ZSTA 3DP7A 4KUMB 2WQYA 4MHCA 2HN1A 2X68A 4TV9E 3S4UA 4UEMA 4JI5T 4KX6A 4UF0A 2M6IA 2UXBT 2Y6XA 3UTKA 4KHZF 4AQGA 2OLTA 4HFHA 1KFYA 2ODVA 5ABFB 2XM2A 4TZ4C 4QHOA 1ZEEA 1XZYA 2DCFA 4IDZA 2UXXB 4J2CA 5DQVA 2X9WA 3R6NA 3RX6A 1WCRA 4HWDA 3ZMTB 1S35A 3A5XA 5AQRB 2RP4A 3LG7A 5H6QB 2B1EA 2I0MA 4AKGA 4ZS3A 4ILAA 2HN2A 5AQMB 3ZYKA 3KVAA 5HEGA 2W00A 1KNZA 2DWGA 4QWNB 2E5LT 3H37A 3NKZA 5FXVA 1JNZA 1IBKT 4LF6T 2V8SV 2XUEA 3QK6A 5L3GB 3P4PA 2VL0A 3P4SA 4JI3T 3FZFB 2JQKA 3LK42 3O4XE 4EEDA 3DTOA 2CM0A 5CA0E 1HNZT 2XQ3A 3C4ZA 3OPCA 3SRZA 4U7YA 2E9XD 1OEDA 2BS2A 1B7TA 4YTMA 3U3IA 4DVDA 3CX7B 3UU3A 3E08A 3C4WA 3GMIA 4HWHA 4HFCA 4ILBA 4KP3C 2LKGA 5IHYA 4A98A 3AE4A 4JLEA 2WDRA 2LRKA 5L3BB 3RKOA 3PUXF 5AQLB 5KXJA 5L3EB 2X9HA 1VCTA 3C98B 5H6RB 4PAGA 1KEYA 2ODUA 4DIDB 3GN5B 4YSYA 5HEOA 2CHNA 3NVOA 3CX8B 2NW8A 4HWCA 5LA6E 2WM9A 5LHIB 5ABEA 5AFUL 2HH7A 5LJNA 4JV5T 4OYJA 2PG8A 3RRCA 4UVBB 3VHLA 4YY3T 3RHWA 2KT9A 1G73A 3QOFA 5CA1E 3V5SA 4IE5A 3AEFA 1MIVA 2LKHA 5AQKB 4AQFA 1KF6A 2KSRA 2W0GA 3UUMA 4OFZA 4U72A 4DV0T 5JR9A 2XAFB 1OXZA 4DBQA 3KV4A 1J5WA 2WAUA 4O4IE 4HE8A 3N2GE 4HGAA 5ETWA 1YQ3A 3AEAA 3PUSA 2BBJA 5JTGA 3TKLB 3N9NA 2PTFA 4HTEA 1UGOA 2WMNA 3C64A 5JDHA 2RA1A 4K0UA 2A72A 2FJAA 3G06A 4YXDA 5EZYE 3F2EA 2VVNA 2RPAA 5JRCB 4I4TE 2MOZA 3ZN1B 3AAAB 3UQ4A 3UULA 2MPKA 3JAEA 4IDNA 3F31A 3ZYLA 3JAFA 4EV6A 5BR8T 2CXFA 2ES0A 5AQOB 4UIGA 3LJCA 4L9IA 3N2KE 2LSYA 4HWIB 3NZQA 3BQLA 2V5DA 2XY8B 2E8IA 2WDQA 4HFVA 2CBIA 4X62T 2H89A 3PE0A 3GA8A 3Q5XA 1OEDB 3CIRA 4OK0A 5HWYA 2BKNA 3SFEA 3ZN0B 5HXEA 3ZT7A 3LBXA 1WYBA 1VRBA 2DHRA 3RGLA 1ZP0A 3ZSSA 1V9DA 2V7IA 2WZIA 3AE2A 2HPLA 4LMJA 4NXMT 3NZPA 4QH4A 3P4QA 2IUBA 1N32T 4X20E 1O3XA 3RQUA 1LKXA 2HHHT 4KI0F 5LHGB 5HXSA 5AQVB 2Q9QD 3FHNA 3KBTA 4CXYA 5LOVE 2EHOD 2LSGA 4UF0B 1QSDA 3AA6B 2E9XC 5L3FB 1H7CA 1UURA 2Q9QB 1ZOYA 2C5JA 3CX6B 3EI0A 2KINB 3Q9DA 1L0VA 1M7KA 3ESLA 4YJ2E 5LMUT 2MTQA 5AQTB 2LM2A 3O1JA 4O2AE 4L0RA 5AQHB 4IREA 4DR5T 4ZOLE 4PNIA 2LRLA 2CWYA 1UCUA 2L9QA 1YD8G 2XQAA 3GWHA 5FL0A 1IZNB 2XAJB 4AIUA 3OVUA 2KXPB 3QNUA 2UXNB 1BR1A 4BAYB 3IBPA 2UXDT 5J1GA 3U78A 4PJNA 3PU8A 3AA0B 3OKQA 3EUHA 4I43B 4H9SE 4LF7T 2D0UA 2XQ9A 2CEAA 3KFWX 4XAXB 2R6GF 1FJGT 4IT4A 2Y8DA 2CMRA 3M3ZB 5LYJE 3HKDE 3FZHB 4B3ST 1HG5A 4EOZB 2VB6A 3N9PA 4YTNA 3B13A 3CVRA 2VKHA 4X1YE 4YSXA 4PJJA 4DR4T 2OV9A 3KDSE 2IW5B 2CA5A 5JDMA 1J5ET 2UU9T 5AQJB 2YK0A 4ZI3D 3LDQB 2E9XA 4AI6A 4HFDA 2IDOB 4ISSA 4DV4T 1T72A 4E7ZA 5FY0A 1XDOA 3K3QC 4IE0A 4TV8E 3SWHA 1SE7A 4EB6E 2LE8A 1MMDA 2XZEA 1WRDA 2LHNA 3UQ7A 1D0ZA 4CXXA 3L39A 2D5UA 4UXNB 1WR0A 5TAOA 3UU4A 1IJ5A 1HCIA 2NWBA 4X66T 3ETUA 4CQIA 2H7OA 2X9YA 3RIUC 4B3MT 4PK5A 5AQNB 2W63A 4DR1T 4Z90A 3LK3B 2X0HA 3K3NA 3ONJA 2J1DG 4IDQA 2H7VC 2V5CA 4I0UA 4NUUA 3P8CD 1SA0E 2IC6A 2KLQA 1HX8A 2KNDA 1W0AA 3H3MA 3PUZF 5JDFA 4ADZA 4X64T 5HXRA 3AXJA 4XBFB 5EK3A 5FVLA 3PJAJ 3ZJ1A 1G8XA 2JIWA 2XAGB 4DV2T 1UX5A 5IUXA 2KWIB 3FZKB 2D9DA 2CHOA 3PU3A 4H63H 2X67A 3RIAA 4JI4T 4WBOA 2E5VA 2LLYA 1E2AA 3P4WA 3AEBA 5FXZA 3ZMZB 4JI7T 1E1HB 5FP3A 3ZC1A 4YTPA 5CGMA 5DABA 5J2UE 4MALA 2NTYA 3MA9A 4AKHA 2A3DA 4O8SA 5L3DB 1OEDC 2LSIA 1CUNA 3OYZA 2YINA 3BK9A 4P1NA 5LBMA 4DMVA 2N9DA 2ACZA 2BVMA 2N1GA 5FKYA 2ACXA 5LCYA 3RLFF 2PBIA 2XPKA 3K8PC 3M65A 1HR0T 5HXCA 2KZ7B 4HFBA 3WAJA 3L09A 1YKHB 3RKGA 5M4YA 5AQUB 2VL8A 4MBQA 3BQIA 3JC6D 2NR4A 4IHJE 1D0YA 3PUQA 5FNVE 1W9RA 5HEUA 3H3AA 3RPUA 1I6ZA 3ONXA 3JC6C 2LM9A 3CQXC 3DJBA 4GOUA 2BZBA 4UVAB 4DO0A 4HWFA 4WBNE 3AECA 1SUMB 3UUXB 3AE7A 2NP9A 3EVYA 2YU1A 2WMOA 4NPPA 2BKPA 4AISA 3RC8A 1HF8A 1HFAA 5F5WA 3BQKA 5LNKA 2JQQA 2MYSA 4V1Av 4BJNA 4JI0T 4WW0A 4BA9A 2WWUA 2ZM0A 2UUAT 1WYCA 1MMAA 3FBLA 5CJ5A 1UK5A 5HXHA 3AE5A 4P09A 1W09A 4JEUB 2F4VT 5C8YE 1X9BA 3UU8A 3CQCB 2QRXA 2WY2A 3HI2A 3OYXA 5LJMA 3QB5A 4ZXLA 3EDUA 4HKAA 1HG2A 2XSAA 4YJ3E 5L2LA 2LOSA 3AXJB 2JMKA 3MKDA 3PUGA 2ZM8A 2VASA 3AVSA 3UT5E 3I1AA 2YDQA 4KHPT 3AB3B 3FXDB 3IA3A 2K3WA 1AJ3A 2JRKA 4IDPA 3ZT5A 4ZZCA 4DV6T 1XMQT 1R8IA 5HCJA 2YDSA 3AE3A 4AQFC 5JR9B 5IWAT 3HA4A 4QKNA 2MBGA 3MXZA 2C5KT 4QXBB 5EK4A 3ZJ2A 2IAKA 2VQET 1UX4A 1Z0PA 1FIOA 2YOEA 3OTOT 2BS3A 2YKSA 3RF1A 4JBWF 3FZLB 5LHHB 2DI4A 3NRYA 3ZT6A 2CWOA 3IF8B 4G2AA 4ZI7E 3FXEB 3N5LA 5ABHA 5LG3A 4JI1T 2V1DB 3PUWF 4P0BA 4H9QC 5HWXA 4LFBT 2FUPA 2XTLA 4U3CA 2AXDS 5FXXA 5FVKA 4F6RC 3RYIE 4TNWA 4NIQA 5C3JA 5LG4A 4IGUA 1QLBA 4ANJA 4IE6A 5HEJA 2BKOA 3UUNA 4KMCA 2LHRA 4H9NC 3KVBA 3B57A 1BR4A 3MK7C 4Q25A 4TX5A 3VR9A 5JR9C 4U33A 4QXCB 3ZCJA 3ZCIA 5HAXA 4QH5A 4WZXA 1FMWA 4ZS2A 3CWZB 3LK2B 5IYZE 4EYUA 5FY7A 3K3OA 4WNKA 4EGWA 2J62A 1X79A 2W62A 1FEWA 3ANWA 2WSSV 5JDLA 2WU5A 3KV5A 4IDOA 4QXHB 3L8RA 5AQIB 5AQSB 4EZHA 4OHFA 1FMVA 2BG9B 3ZMVB 2XQ6A 2H88A 1I94T 2L8KA 4BJMA 4LF9T 4PK4A 5LGTB 5C2TA 2CXDA 4CN4A 4YLHA 3O1IA 4FJOA 2LOPA 4TWFA 5HYAA 5L3CB 3CK6A 3I0QA 2W61A 5J2TE 2VWAA 3AEDA 5CB4E 3ZMUB 3T1YT 4DR6T 3P50A 3ZKRA 3ZEFB 4UVCB 5FMNA 2XJ7A 3PURA 2BVLA 3V5UA 2VK9A 4GK0E 3J9X1 2BS4A 4COFA 1IBMT 1WFDA 1HNWT 2K5BB 3WI3A 1IJ6A 3EABA 1YKEB 3SFDA 2AE9A 1MIYA 4B3RT 2X51A 4LF8T
chains in the Genus database with same CATH topology
3IEEA 2LT3A 5ADXL 2V26A 4IIJE 2YEVC 3CPZA 1NAFA 4MLKA 4AKLA 4PJLA 3AAEB 2PJQA 2Q9QA 2H3RA 1SHZC 4PW8A 5LP6E 1LVKA 1ZHCA 1EZ3A 1MNEA 3AA7B 3I0OA 1T98A 3HL6A 1LRZA 5LXTE 4I55E 5F3JA 4CZZB 3QC9A 1WR6A 2N2NA 3HR0A 3QUJA 4GK5E 3MZKB 3T8OA 2PFVA 2WBLA 2X66A 5KX5E 3N2OA 3WAKA 2EHOC 1ZV4X 4ISTA 4N78D 3NBXX 4H63V 3C50A 4FI5A 4PJMA 4DNDA 3PUAA 1IAPA 1S94A 3LBXB 5F8PA 2SPCA 3HKBE 3R84B 3ETVA 5JVDE 4QX7B 4GIWA 3C51A 4C91A 3Q5WA 4H9PC 3MACA 2CLYB 2G0UA 2NW7A 1VOMA 4NUVA 1ZKEA 1MMGA 4EYYR 1HTJF 4UV9B 2P9BA 1D0XA 3FB2A 5BMVE 1Y64B 3PDYA 2HPJA 4MFRA 2QA7A 2D2SA 2XASB 2JMHA 5JREA 4KBMB 4C90A 2I59A 2ZLYA 3FBZA 2QGSA 1QUUA 1BR2A 1MMNA 2VKJA 2ZM2A 5KDMC 1D1CA 4AXPA 4B6XA 5DQWA 4GYSA 2EHOA 2YU2A 5JDQA 3N9LA 2JPFA 2NOXA 4PFOA 5JH7E 4DBRA 5GONE 2Z6EA 4X1IE 5DJQC 4DMWA 5JQGE 2VKDA 3E0ZA 4OYKA 4AKIA 3RH3A 3C4XA 3KV9A 4TN7B 5KMGP 1BR0A 1KK7A 5FYMA 4CI2B 3KINB 4M1PA 4ZI3C 4A56A 3D0TA 3N9OA 4UELA 3GN5A 1NWMX 4YHJA 3RRWA 2A2FX 2XAHB 2C5IT 2DNXA 2K48A 3ZC0A 4H9RC 5JDGA 4HN9A 4ZI2D 2OA5A 4AI6A 3RYFE 3CMLA 2LSJA 3EDVA 3L3PA 1YW0A 4H9OC 4ASKA 2E9XB 3Q2MA 3CKDA 4ZI2C 2KWHA 3VKHA 1OWAA 3KV6A 1MNDA 3ZLIA 3F57A 2L3LA 3HKEE 2LJLA 3LFMA 3VKGA 4UV8B 4EAHA 3OBVE 5LGNB 3KBUA 4ANJA 3CQGB 3O1HA 4QX8B 4Z8XA 5LBQB 3ZMSB 4G63A 5EK2A 3E22E 2K9AA 3AAIA 4IE7A 3SOLA 4EIWA 2V7JA 3O9XA 3AVRA 4P0AA 1U4QA 2XQYA 1WLXA 4ZHQE 2ZMAA 2X9XA 2JJ9A 3N9QA 2V7LA 3AA1B 3PTRB 1U5PA 2DLRA 4L5GA 4YFSA 2XAQB 3ZPOA 3HKCE 4XZCA 5FY1A 3I9WA 1LVFA 3ANWB 2KMFA 3I9YA 4JUYA 4AKRB 4CXWA 2LEHA 5A1LA 2V7KA 4EXTA 3UFEA 5E0OA 3MJXA 2M67A 2BDEA 3RYHE 2CXLA 4JEHB 2CLYC 2GK9A 2Y48B 3IHRA 4CI1B 4X1KE 2X0LB 2CCQA 3SS1A 4GYRA 2C0SA 3NRXA 3P7IA 1D1BA 4HEAA 4TUYE 2NW9A 2NTXA 4PFPA 1HS7A 4U74A 2K24A 4CI3B 3OJAA 5LGUB 1D1AA 4IE4A 5JRCA 2IC9A 2LSKA 5FXWA 2Q9QC 4I50E 3RYCE 4ILUA 3ZN0B 4O2BE 3RC3A 2VKOA 1MIWA 2DWKA 2V7MA 1US7B 2CE7A 2XHEB 4O4HE 3VU7H 2EHOB 4BJMA 4EZ4A 2D0TA 4O4JE 4PK6A 4E7SA 4O4LE 3N9MA 4ERRA 5JDNA 3ZYMA 3DP7A 4KUMB 4MHCA 2X68A 4TV9E 3S4UA 4UEMA 4UF0A 2Y6XA 3UTKA 4AQGA 2ODVA 4TZ4C 4QHOA 1ZEEA 4J2CA 2DCFA 4IDZA 2UXXB 5DQVA 3R6NA 2X9WA 3RX6A 3ZMTB 1S35A 3A5XA 5H6QB 2RP4A 3LG7A 2B1EA 4AKGA 4ZS3A 3ZYKA 3KVAA 1KNZA 2W00A 2DWGA 4QWNB 3H37A 5FXVA 2XUEA 3QK6A 5L3GB 3LK42 3O4XE 3DTOA 2CM0A 5CA0E 3C4ZA 3SRZA 2E9XD 4DVDA 3U3IA 1B7TA 3CX7B 3E08A 3GMIA 3C4WA 4KP3C 5IHYA 4JLEA 5L3BB 3RKOA 5L3EB 2X9HA 3C98B 5H6RB 4PAGA 2ODUA 3GN5B 3CX8B 2NW8A 5LA6E 2WM9A 5LHIB 5AFUL 2HH7A 5LJNA 4OYJA 2PG8A 3RRCA 4UVBB 3VHLA 5CA1E 2KT9A 1G73A 3V5SA 4IE5A 1MIVA 4AQFA 2W0GA 3UUMA 4OFZA 4U72A 5JR9A 2XAFB 1OXZA 4DBQA 3KV4A 4O4IE 2WAUA 5ETWA 4HE8A 3N2GE 4HGAA 3PUSA 3TKLB 3N9NA 4HTEA 2WMNA 3C64A 5JDHA 2RA1A 4K0UA 2A72A 5EZYE 3F2EA 5JRCB 4I4TE 2MOZA 3ZN1B 3AAAB 3UULA 3ZYLA 3F31A 2CXFA 2ES0A 4UIGA 3LJCA 4L9IA 3N2KE 2LSYA 3NZQA 3BQLA 2E8IA 4HFVA 3Q5XA 3PE0A 3GA8A 4OK0A 5HWYA 3W15B 5HXEA 3LBXA 1WYBA 1VRBA 2DHRA 1V9DA 2V7IA 2HPLA 3NZPA 4X20E 1O3XA 1LKXA 5LHGB 5HXSA 2Q9QD 3FHNA 3KBTA 4CXYA 5LOVE 2EHOD 2LSGA 4UF0B 1QSDA 3AA6B 2E9XC 5L3FB 1H7CA 3CX6B 2Q9QB 2C5JA 3Q9DA 2KINB 3ESLA 4YJ2E 2MTQA 3O1JA 4O2AE 4L0RA 4ZOLE 4PNIA 2CWYA 1UCUA 2L9QA 1YD8G 3GWHA 1IZNB 2XAJB 2KXPB 4BAYB 2UXNB 1BR1A 3IBPA 5J1GA 3U78A 4PJNA 3PU8A 3AA0B 3OKQA 3EUHA 4I43B 4H9SE 2D0UA 2CEAA 3KFWX 4XAXB 2Y8DA 2CMRA 5LYJE 3HKDE 1HG5A 4EOZB 2VB6A 3N9PA 3B13A 3CVRA 2VKHA 4X1YE 4PJJA 3KDSE 2IW5B 2CA5A 5JDMA 2YK0A 4ZI3D 2E9XA 4ISSA 4E7ZA 5FY0A 3K3QC 4IE0A 4TV8E 3SWHA 4EB6E 2LE8A 1MMDA 1WRDA 2LHNA 1D0ZA 4CXXA 4UXNB 2D5UA 5TAOA 1IJ5A 1HCIA 2NWBA 3ETUA 4CQIA 2H7OA 2X9YA 4PK5A 2W63A 3LK3B 4NUUA 3K3NA 2J1DG 2H7VC 3P8CD 1SA0E 2IC6A 2KLQA 1HX8A 2KNDA 5JDFA 3J7Yq 4ADZA 5HXRA 4XBFB 5EK3A 3ZJ1A 1G8XA 2XAGB 1UX5A 2KWIB 3PU3A 4H63H 2X67A 4WBOA 5FXZA 3ZMZB 1E1HB 5FP3A 3ZC1A 5J2UE 5DABA 4MALA 2NTYA 3MA9A 4AKHA 2A3DA 4O8SA 5L3DB 2LSIA 3OYZA 1CUNA 5LBMA 2YINA 3BK9A 4DMVA 2N9DA 2BVMA 2N1GA 2ACXA 5LCYA 2PBIA 3K8PC 3M65A 5HXCA 2KZ7B 3WAJA 3L09A 1YKHB 5M4YA 2VL8A 4MBQA 3BQIA 3JC6D 4IHJE 1D0YA 3PUQA 5FNVE 3RPUA 3H3AA 3ONXA 3JC6C 2LM9A 3CQXC 3DJBA 4GOUA 2BZBA 4UVAB 4DO0A 4WBNE 3UUXB 2NP9A 3EVYA 2YU1A 2WMOA 3RC8A 1HF8A 1HFAA 3BQKA 5LNKA 2JQQA 2MYSA 4V1Av 4BJNA 4WW0A 4BA9A 2WWUA 2ZM0A 1WYCA 1MMAA 3FBLA 5HXHA 4P09A 4JEUB 5C8YE 3CQCB 3HI2A 5LJMA 3OYXA 3EDUA 4HKAA 1HG2A 4YJ3E 5L2LA 2LOSA 3MKDA 2JMKA 3PUGA 2ZM8A 2VASA 3AVSA 3UT5E 3I1AA 3AB3B 3FXDB 1AJ3A 2JRKA 5JR9B 4AQFC 3HA4A 4QKNA 2MBGA 3MXZA 2C5KT 4QXBB 5EK4A 3ZJ2A 2IAKA 1UX4A 1Z0PA 1FIOA 5LHHB 2DI4A 3NRYA 2CWOA 3IF8B 4G2AA 4ZI7E 3FXEB 3N5LA 2V1DB 4P0BA 4H9QC 5HWXA 2XTLA 5FXXA 4F6RC 3RYIE 5LG4A 4IGUA 4IE6A 3UUNA 4KMCA 2LHRA 4H9NC 3KVBA 3B57A 1BR4A 3MK7C 4TX5A 5JR9C 3ZCJA 4QXCB 3ZCIA 5HAXA 4ZS2A 1FMWA 5IYZE 3CWZB 3LK2B 4EYUA 5FY7A 3K3OA 4WNKA 1X79A 2W62A 1FEWA 3ANWA 2WSSV 5JDLA 3KV5A 4QXHB 4EZHA 4OHFA 1FMVA 3ZMVB 2L8KA 4PK4A 5LGTB 2CXDA 4YLHA 3O1IA 4FJOA 2LOPA 5HYAA 5L3CB 3I0QA 2W61A 5J2TE 2VWAA 5CB4E 3ZMUB 3ZEFB 4UVCB 5FMNA 3PURA 2BVLA 3V5UA 2VK9A 4GK0E 3J9X1 2K5BB 3WI3A 1IJ6A 1YKEB 1MIYA 2X51A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WRD A;  1OXZ A;  1X79 A;  1WR6 A;  2N2N A;  1O3X A;  2N9D A;  1NAF A;  1NWM X;  1YD8 G; 
#chains in the Genus database with same CATH topology
 2WZH A;  1J1J A;  3IEE A;  4DR2 T;  2LT3 A;  5ADX L;  2V26 A;  4IIJ E;  4JI2 T;  2W2U A;  5AQQ B;  2YEV C;  3CPZ A;  1NAF A;  3Q5E A;  4MLK A;  4AKL A;  3EAM A;  1N33 T;  4PJL A;  4DV5 T;  3AAE B;  2PJQ A;  2Q9Q A;  2H3R A;  2IHR 1;  1SHZ C;  4PW8 A;  2V6Y A;  1LVK A;  3LSV A;  5LP6 E;  2UXC T;  1ZHC A;  2WB5 A;  4LFA T;  4F8H A;  2YN6 A;  1EZ3 A;  4YT0 A;  1MNE A;  2XSB A;  5CFB A;  3AA7 B;  3I0O A;  1T98 A;  3RQW A;  3HL6 A;  1LRZ A;  4HFE A;  2XQ4 A;  1CHU A;  2QYW A;  4I55 E;  2BBH A;  5LXT E;  3A7M A;  2W4X A;  5F3J A;  4CZZ B;  3QC9 A;  4LF5 T;  3A8Y C;  1WR6 A;  2N2N A;  1VCS A;  2V6Y B;  3HR0 A;  3QUJ A;  4GK5 E;  3MZK B;  4HFI A;  3T8O A;  3VRB A;  4CN1 A;  2PFV A;  2WBL A;  2X66 A;  5KX5 E;  1YXR A;  3N2O A;  3AE9 A;  3JCF A;  3WAK A;  5HCM A;  2EHO C;  1ZV4 X;  4IST A;  4DV1 T;  4N78 D;  5ABG A;  3NBX X;  4DR3 T;  2IIU A;  4H63 V;  1XNQ T;  3C50 A;  4FI5 A;  4PJM A;  5AQG B;  4DND A;  4JI6 T;  3PUA A;  3VR8 A;  5AQF B;  1IAP A;  1S94 A;  3EHZ A;  3LBX B;  2SPC A;  5F8P A;  5L4H A;  3HKB E;  3R84 B;  3ETV A;  5JVD E;  4QX7 B;  4GIW A;  3C51 A;  4C91 A;  3Q5W A;  2I6H A;  4H9P C;  3MAC A;  4YSZ A;  2CLY B;  2CRB A;  2FJE A;  2G0U A;  2NW7 A;  2WCA A;  3AEE A;  1VOM A;  4NUV A;  1ZKE A;  2WWV A;  1MMG A;  5LMN T;  4EYY R;  1HTJ F;  4U7I A;  2CBJ A;  4UV9 B;  2P9B A;  1D0X A;  2W66 A;  3FB2 A;  5BMV E;  4GKK T;  3PUV F;  3PUY F;  3W15 B;  1Y64 B;  4B3T T;  3PDY A;  2HPJ A;  2XM1 A;  1HX1 B;  1XDP A;  2JQH A;  1OED E;  2QA7 A;  4LML A;  2D2S A;  2XAS B;  4MFR A;  2JMH A;  2W67 A;  3UU5 A;  5JRE A;  1NEN A;  4KBM B;  4C90 A;  2CPT A;  2I59 A;  2ZLY A;  3FBZ A;  2QGS A;  1QUU A;  1BR2 A;  1MMN A;  1UUS A;  2VKJ A;  2ZM2 A;  3Q5D A;  5KDM C;  1W0B A;  1D1C A;  1XNR T;  2YDR A;  3RIF A;  4AXP A;  3ZC0 A;  4B6X A;  5DQW A;  3PJA A;  4GYS A;  2EHO A;  2VVS A;  2YU2 A;  5ABF A;  5JDQ A;  3K1S A;  5L4E A;  3N9L A;  2JPF A;  2NOX A;  3JAD A;  4PFO A;  5JH7 E;  4ILC A;  4DBR A;  4JYA T;  5GON E;  3UFG A;  2Z6E A;  4X1I E;  5DJQ C;  4DMW A;  5JQG E;  2VKD A;  3B5M A;  3E0Z A;  1XMO T;  2FJD A;  2X0Y A;  3PV0 F;  3FZM B;  4OYK A;  3RH3 A;  3TLT A;  4AKI A;  3C4X A;  2BG9 E;  4TWD A;  2BG9 A;  2VUR A;  3KV9 A;  4TN7 B;  3TLV A;  5KMG P;  1KK7 A;  1BR0 A;  5FYM A;  4CI2 B;  3KIN B;  3AEG A;  4M1P A;  4ZI3 C;  4A56 A;  3D0T A;  3N9O A;  4UEL A;  3TLW A;  4DUY T;  4DV7 T;  3GN5 A;  1NWM X;  4YHJ A;  1DU2 A;  2J4G A;  3RRW A;  4ASK A;  2A2F X;  2DNX A;  2C5I T;  2K48 A;  2XAH B;  3ABV A;  4H9R C;  4ZZB A;  4HN9 A;  4ZI2 D;  2OA5 A;  5JDG A;  3RYF E;  3CML A;  2LSJ A;  3EDV A;  3L3P A;  1YW0 A;  3ONL C;  1NEK A;  2E9X B;  3Q2M A;  2BG9 C;  3CKD A;  4H9O C;  3UU6 A;  4ZI2 C;  2QVA A;  2KWH A;  2ZM6 T;  3VKH A;  4EEB A;  4DV3 T;  4A5X A;  2M6B A;  4NXN T;  1OWA A;  5LB7 B;  3VRA A;  4OX9 T;  3KV6 A;  1MND A;  1IBL T;  3ZLI A;  3F57 A;  1T8B A;  2L3L A;  3QB5 K;  3HKE E;  2LJL A;  3LFM A;  4QH1 A;  3VKG A;  4AQY T;  4UV8 B;  4EAH A;  1N34 T;  3OBV E;  1M62 A;  5LGN B;  3AE6 A;  2IML A;  1YQ4 A;  3KBU A;  3CQG B;  3O1H A;  4QX8 B;  4U31 A;  4Z8X A;  5HEH A;  4G63 A;  5LBQ B;  3TLS A;  3ZMS B;  5EK2 A;  2FBW A;  2MAW A;  3E22 E;  4GKJ T;  2V6X A;  4LF4 T;  3AE8 A;  2K9A A;  4Z91 A;  3AAI A;  4IE7 A;  5AQP B;  3SOL A;  2V7J A;  1GQE A;  3AVR A;  4WYV A;  2B76 A;  4A97 A;  4EIW A;  4TWH A;  1E7P A;  4X65 T;  2A9U A;  2VQF T;  4P0A A;  4YHH T;  1U4Q A;  2WU2 A;  2XQY A;  3NWI A;  4U2Z A;  1WLX A;  1T7S A;  2JQ9 A;  2X9X A;  2ZMA A;  4CN6 A;  2JJ9 A;  3N9Q A;  2V7L A;  3AA1 B;  3PTR B;  1U5P A;  2DLR A;  4L5G A;  4YFS A;  2DL1 A;  2XAQ B;  1Z8U A;  3AE1 A;  3ZPO A;  4ZEY A;  3HKC E;  4XZC A;  4IL4 A;  5FY1 A;  2UUC T;  3I9W A;  1LVF A;  3ANW B;  2KMF A;  3I9Y A;  4JUY A;  4AKR B;  4CXW A;  2LEH A;  5A1L A;  2V7K A;  3J7Y q;  4EXT A;  3TLU A;  2XQ8 A;  3UFE A;  2WS3 A;  5E0O A;  1Y01 A;  3MJX A;  2M67 A;  2BDE A;  3RYH E;  3T1H T;  1HNX T;  2CXL A;  4JEH B;  2WDV A;  2CLY C;  2GK9 A;  2Y48 B;  3IHR A;  4CI1 B;  4LMK A;  4X1K E;  2X0L B;  3UUB A;  2E2A A;  4UR9 A;  4K0K T;  2CCQ A;  3SS1 A;  2WP9 A;  1KNP A;  5FL1 A;  2UUB T;  4DR7 T;  4ZHQ E;  4GYR A;  2C0S A;  3P4R A;  4DUZ T;  3NRX A;  3P7I A;  1D1B A;  4HEA A;  4X5T A;  4JI8 T;  1JNR A;  2XQ7 A;  5J0Z A;  4TUY E;  2NW9 A;  2J47 A;  2NTX A;  4PFP A;  1HS7 A;  4U74 A;  2K24 A;  4CI3 B;  3OJA A;  3O9X A;  4LFC T;  5LGU B;  1D1A A;  4IE4 A;  5JRC A;  2IC9 A;  2LSK A;  3RIU A;  2XQ5 A;  5FXW A;  2Q9Q C;  2FJB A;  4I50 E;  4ILU A;  3RYC E;  4O2B E;  3RC3 A;  2V7M A;  1MIW A;  2DWK A;  1XWM A;  1US7 B;  2CE7 A;  2VKO A;  2XHE B;  4O4H E;  2EHO B;  3VU7 H;  3X1D A;  4EZ4 A;  2D0T A;  1KNR A;  4O4J E;  4IL9 A;  4PK6 A;  4E7S A;  5L47 A;  4O4L E;  3N9M A;  4ERR A;  3RI5 A;  5JDN A;  1N36 T;  3ZYM A;  4TNV A;  4U2Y A;  3ZST A;  3DP7 A;  4KUM B;  2WQY A;  4MHC A;  2HN1 A;  2X68 A;  4TV9 E;  3S4U A;  4UEM A;  4JI5 T;  4KX6 A;  4UF0 A;  2M6I A;  2UXB T;  2Y6X A;  3UTK A;  4KHZ F;  4AQG A;  2OLT A;  4HFH A;  1KFY A;  2ODV A;  5ABF B;  2XM2 A;  4TZ4 C;  4QHO A;  1ZEE A;  1XZY A;  2DCF A;  4IDZ A;  2UXX B;  4J2C A;  5DQV A;  2X9W A;  3R6N A;  3RX6 A;  1WCR A;  4HWD A;  3ZMT B;  1S35 A;  3A5X A;  5AQR B;  2RP4 A;  3LG7 A;  5H6Q B;  2B1E A;  2I0M A;  4AKG A;  4ZS3 A;  4ILA A;  2HN2 A;  5AQM B;  3ZYK A;  3KVA A;  5HEG A;  2W00 A;  1KNZ A;  2DWG A;  4QWN B;  2E5L T;  3H37 A;  3NKZ A;  5FXV A;  1JNZ A;  1IBK T;  4LF6 T;  2V8S V;  2XUE A;  3QK6 A;  5L3G B;  3P4P A;  2VL0 A;  3P4S A;  4JI3 T;  3FZF B;  2JQK A;  3LK4 2;  3O4X E;  4EED A;  3DTO A;  2CM0 A;  5CA0 E;  1HNZ T;  2XQ3 A;  3C4Z A;  3OPC A;  3SRZ A;  4U7Y A;  2E9X D;  1OED A;  2BS2 A;  1B7T A;  4YTM A;  3U3I A;  4DVD A;  3CX7 B;  3UU3 A;  3E08 A;  3C4W A;  3GMI A;  4HWH A;  4HFC A;  4ILB A;  4KP3 C;  2LKG A;  5IHY A;  4A98 A;  3AE4 A;  4JLE A;  2WDR A;  2LRK A;  5L3B B;  3RKO A;  3PUX F;  5AQL B;  5KXJ A;  5L3E B;  2X9H A;  1VCT A;  3C98 B;  5H6R B;  4PAG A;  1KEY A;  2ODU A;  4DID B;  3GN5 B;  4YSY A;  5HEO A;  2CHN A;  3NVO A;  3CX8 B;  2NW8 A;  4HWC A;  5LA6 E;  2WM9 A;  5LHI B;  5ABE A;  5AFU L;  2HH7 A;  5LJN A;  4JV5 T;  4OYJ A;  2PG8 A;  3RRC A;  4UVB B;  3VHL A;  4YY3 T;  3RHW A;  2KT9 A;  1G73 A;  3QOF A;  5CA1 E;  3V5S A;  4IE5 A;  3AEF A;  1MIV A;  2LKH A;  5AQK B;  4AQF A;  1KF6 A;  2KSR A;  2W0G A;  3UUM A;  4OFZ A;  4U72 A;  4DV0 T;  5JR9 A;  2XAF B;  1OXZ A;  4DBQ A;  3KV4 A;  1J5W A;  2WAU A;  4O4I E;  4HE8 A;  3N2G E;  4HGA A;  5ETW A;  1YQ3 A;  3AEA A;  3PUS A;  2BBJ A;  5JTG A;  3TKL B;  3N9N A;  2PTF A;  4HTE A;  1UGO A;  2WMN A;  3C64 A;  5JDH A;  2RA1 A;  4K0U A;  2A72 A;  2FJA A;  3G06 A;  4YXD A;  5EZY E;  3F2E A;  2VVN A;  2RPA A;  5JRC B;  4I4T E;  2MOZ A;  3ZN1 B;  3AAA B;  3UQ4 A;  3UUL A;  2MPK A;  3JAE A;  4IDN A;  3F31 A;  3ZYL A;  3JAF A;  4EV6 A;  5BR8 T;  2CXF A;  2ES0 A;  5AQO B;  4UIG A;  3LJC A;  4L9I A;  3N2K E;  2LSY A;  4HWI B;  3NZQ A;  3BQL A;  2V5D A;  2XY8 B;  2E8I A;  2WDQ A;  4HFV A;  2CBI A;  4X62 T;  2H89 A;  3PE0 A;  3GA8 A;  3Q5X A;  1OED B;  3CIR A;  4OK0 A;  5HWY A;  2BKN A;  3SFE A;  3ZN0 B;  5HXE A;  3ZT7 A;  3LBX A;  1WYB A;  1VRB A;  2DHR A;  3RGL A;  1ZP0 A;  3ZSS A;  1V9D A;  2V7I A;  2WZI A;  3AE2 A;  2HPL A;  4LMJ A;  4NXM T;  3NZP A;  4QH4 A;  3P4Q A;  2IUB A;  1N32 T;  4X20 E;  1O3X A;  3RQU A;  1LKX A;  2HHH T;  4KI0 F;  5LHG B;  5HXS A;  5AQV B;  2Q9Q D;  3FHN A;  3KBT A;  4CXY A;  5LOV E;  2EHO D;  2LSG A;  4UF0 B;  1QSD A;  3AA6 B;  2E9X C;  5L3F B;  1H7C A;  1UUR A;  2Q9Q B;  1ZOY A;  2C5J A;  3CX6 B;  3EI0 A;  2KIN B;  3Q9D A;  1L0V A;  1M7K A;  3ESL A;  4YJ2 E;  5LMU T;  2MTQ A;  5AQT B;  2LM2 A;  3O1J A;  4O2A E;  4L0R A;  5AQH B;  4IRE A;  4DR5 T;  4ZOL E;  4PNI A;  2LRL A;  2CWY A;  1UCU A;  2L9Q A;  1YD8 G;  2XQA A;  3GWH A;  5FL0 A;  1IZN B;  2XAJ B;  4AIU A;  3OVU A;  2KXP B;  3QNU A;  2UXN B;  1BR1 A;  4BAY B;  3IBP A;  2UXD T;  5J1G A;  3U78 A;  4PJN A;  3PU8 A;  3AA0 B;  3OKQ A;  3EUH A;  4I43 B;  4H9S E;  4LF7 T;  2D0U A;  2XQ9 A;  2CEA A;  3KFW X;  4XAX B;  2R6G F;  1FJG T;  4IT4 A;  2Y8D A;  2CMR A;  3M3Z B;  5LYJ E;  3HKD E;  3FZH B;  4B3S T;  1HG5 A;  4EOZ B;  2VB6 A;  3N9P A;  4YTN A;  3B13 A;  3CVR A;  2VKH A;  4X1Y E;  4YSX A;  4PJJ A;  4DR4 T;  2OV9 A;  3KDS E;  2IW5 B;  2CA5 A;  5JDM A;  1J5E T;  2UU9 T;  5AQJ B;  2YK0 A;  4ZI3 D;  3LDQ B;  2E9X A;  4AI6 A;  4HFD A;  2IDO B;  4ISS A;  4DV4 T;  1T72 A;  4E7Z A;  5FY0 A;  1XDO A;  3K3Q C;  4IE0 A;  4TV8 E;  3SWH A;  1SE7 A;  4EB6 E;  2LE8 A;  1MMD A;  2XZE A;  1WRD A;  2LHN A;  3UQ7 A;  1D0Z A;  4CXX A;  3L39 A;  2D5U A;  4UXN B;  1WR0 A;  5TAO A;  3UU4 A;  1IJ5 A;  1HCI A;  2NWB A;  4X66 T;  3ETU A;  4CQI A;  2H7O A;  2X9Y A;  3RIU C;  4B3M T;  4PK5 A;  5AQN B;  2W63 A;  4DR1 T;  4Z90 A;  3LK3 B;  2X0H A;  3K3N A;  3ONJ A;  2J1D G;  4IDQ A;  2H7V C;  2V5C A;  4I0U A;  4NUU A;  3P8C D;  1SA0 E;  2IC6 A;  2KLQ A;  1HX8 A;  2KND A;  1W0A A;  3H3M A;  3PUZ F;  5JDF A;  4ADZ A;  4X64 T;  5HXR A;  3AXJ A;  4XBF B;  5EK3 A;  5FVL A;  3PJA J;  3ZJ1 A;  1G8X A;  2JIW A;  2XAG B;  4DV2 T;  1UX5 A;  5IUX A;  2KWI B;  3FZK B;  2D9D A;  2CHO A;  3PU3 A;  4H63 H;  2X67 A;  3RIA A;  4JI4 T;  4WBO A;  2E5V A;  2LLY A;  1E2A A;  3P4W A;  3AEB A;  5FXZ A;  3ZMZ B;  4JI7 T;  1E1H B;  5FP3 A;  3ZC1 A;  4YTP A;  5CGM A;  5DAB A;  5J2U E;  4MAL A;  2NTY A;  3MA9 A;  4AKH A;  2A3D A;  4O8S A;  5L3D B;  1OED C;  2LSI A;  1CUN A;  3OYZ A;  2YIN A;  3BK9 A;  4P1N A;  5LBM A;  4DMV A;  2N9D A;  2ACZ A;  2BVM A;  2N1G A;  5FKY A;  2ACX A;  5LCY A;  3RLF F;  2PBI A;  2XPK A;  3K8P C;  3M65 A;  1HR0 T;  5HXC A;  2KZ7 B;  4HFB A;  3WAJ A;  3L09 A;  1YKH B;  3RKG A;  5M4Y A;  5AQU B;  2VL8 A;  4MBQ A;  3BQI A;  3JC6 D;  2NR4 A;  4IHJ E;  1D0Y A;  3PUQ A;  5FNV E;  1W9R A;  5HEU A;  3H3A A;  3RPU A;  1I6Z A;  3ONX A;  3JC6 C;  2LM9 A;  3CQX C;  3DJB A;  4GOU A;  2BZB A;  4UVA B;  4DO0 A;  4HWF A;  4WBN E;  3AEC A;  1SUM B;  3UUX B;  3AE7 A;  2NP9 A;  3EVY A;  2YU1 A;  2WMO A;  4NPP A;  2BKP A;  4AIS A;  3RC8 A;  1HF8 A;  1HFA A;  5F5W A;  3BQK A;  5LNK A;  2JQQ A;  2MYS A;  4V1A v;  4BJN A;  4JI0 T;  4WW0 A;  4BA9 A;  2WWU A;  2ZM0 A;  2UUA T;  1WYC A;  1MMA A;  3FBL A;  5CJ5 A;  1UK5 A;  5HXH A;  3AE5 A;  4P09 A;  1W09 A;  4JEU B;  2F4V T;  5C8Y E;  1X9B A;  3UU8 A;  3CQC B;  2QRX A;  2WY2 A;  3HI2 A;  3OYX A;  5LJM A;  3QB5 A;  4ZXL A;  3EDU A;  4HKA A;  1HG2 A;  2XSA A;  4YJ3 E;  5L2L A;  2LOS A;  3AXJ B;  2JMK A;  3MKD A;  3PUG A;  2ZM8 A;  2VAS A;  3AVS A;  3UT5 E;  3I1A A;  2YDQ A;  4KHP T;  3AB3 B;  3FXD B;  3IA3 A;  2K3W A;  1AJ3 A;  2JRK A;  4IDP A;  3ZT5 A;  4ZZC A;  4DV6 T;  1XMQ T;  1R8I A;  5HCJ A;  2YDS A;  3AE3 A;  4AQF C;  5JR9 B;  5IWA T;  3HA4 A;  4QKN A;  2MBG A;  3MXZ A;  2C5K T;  4QXB B;  5EK4 A;  3ZJ2 A;  2IAK A;  2VQE T;  1UX4 A;  1Z0P A;  1FIO A;  2YOE A;  3OTO T;  2BS3 A;  2YKS A;  3RF1 A;  4JBW F;  3FZL B;  5LHH B;  2DI4 A;  3NRY A;  3ZT6 A;  2CWO A;  3IF8 B;  4G2A A;  4ZI7 E;  3FXE B;  3N5L A;  5ABH A;  5LG3 A;  4JI1 T;  2V1D B;  3PUW F;  4P0B A;  4H9Q C;  5HWX A;  4LFB T;  2FUP A;  2XTL A;  4U3C A;  2AXD S;  5FXX A;  5FVK A;  4F6R C;  3RYI E;  4TNW A;  4NIQ A;  5C3J A;  5LG4 A;  4IGU A;  1QLB A;  4ANJ A;  4IE6 A;  5HEJ A;  2BKO A;  3UUN A;  4KMC A;  2LHR A;  4H9N C;  3KVB A;  3B57 A;  1BR4 A;  3MK7 C;  4Q25 A;  4TX5 A;  3VR9 A;  5JR9 C;  4U33 A;  4QXC B;  3ZCJ A;  3ZCI A;  5HAX A;  4QH5 A;  4WZX A;  1FMW A;  4ZS2 A;  3CWZ B;  3LK2 B;  5IYZ E;  4EYU A;  5FY7 A;  3K3O A;  4WNK A;  4EGW A;  2J62 A;  1X79 A;  2W62 A;  1FEW A;  3ANW A;  2WSS V;  5JDL A;  2WU5 A;  3KV5 A;  4IDO A;  4QXH B;  3L8R A;  5AQI B;  5AQS B;  4EZH A;  4OHF A;  1FMV A;  2BG9 B;  3ZMV B;  2XQ6 A;  2H88 A;  1I94 T;  2L8K A;  4BJM A;  4LF9 T;  4PK4 A;  5LGT B;  5C2T A;  2CXD A;  4CN4 A;  4YLH A;  3O1I A;  4FJO A;  2LOP A;  4TWF A;  5HYA A;  5L3C B;  3CK6 A;  3I0Q A;  2W61 A;  5J2T E;  2VWA A;  3AED A;  5CB4 E;  3ZMU B;  3T1Y T;  4DR6 T;  3P50 A;  3ZKR A;  3ZEF B;  4UVC B;  5FMN A;  2XJ7 A;  3PUR A;  2BVL A;  3V5U A;  2VK9 A;  4GK0 E;  3J9X 1;  2BS4 A;  4COF A;  1IBM T;  1WFD A;  1HNW T;  2K5B B;  3WI3 A;  1IJ6 A;  3EAB A;  1YKE B;  3SFD A;  2AE9 A;  1MIY A;  4B3R T;  2X51 A;  4LF8 T; 
#chains in the Genus database with same CATH homology
 3IEE A;  2LT3 A;  5ADX L;  2V26 A;  4IIJ E;  2YEV C;  3CPZ A;  1NAF A;  4MLK A;  4AKL A;  4PJL A;  3AAE B;  2PJQ A;  2Q9Q A;  2H3R A;  1SHZ C;  4PW8 A;  5LP6 E;  1LVK A;  1ZHC A;  1EZ3 A;  1MNE A;  3AA7 B;  3I0O A;  1T98 A;  3HL6 A;  1LRZ A;  5LXT E;  4I55 E;  5F3J A;  4CZZ B;  3QC9 A;  1WR6 A;  2N2N A;  3HR0 A;  3QUJ A;  4GK5 E;  3MZK B;  3T8O A;  2PFV A;  2WBL A;  2X66 A;  5KX5 E;  3N2O A;  3WAK A;  2EHO C;  1ZV4 X;  4IST A;  4N78 D;  3NBX X;  4H63 V;  3C50 A;  4FI5 A;  4PJM A;  4DND A;  3PUA A;  1IAP A;  1S94 A;  3LBX B;  5F8P A;  2SPC A;  3HKB E;  3R84 B;  3ETV A;  5JVD E;  4QX7 B;  4GIW A;  3C51 A;  4C91 A;  3Q5W A;  4H9P C;  3MAC A;  2CLY B;  2G0U A;  2NW7 A;  1VOM A;  4NUV A;  1ZKE A;  1MMG A;  4EYY R;  1HTJ F;  4UV9 B;  2P9B A;  1D0X A;  3FB2 A;  5BMV E;  1Y64 B;  3PDY A;  2HPJ A;  4MFR A;  2QA7 A;  2D2S A;  2XAS B;  2JMH A;  5JRE A;  4KBM B;  4C90 A;  2I59 A;  2ZLY A;  3FBZ A;  2QGS A;  1QUU A;  1BR2 A;  1MMN A;  2VKJ A;  2ZM2 A;  5KDM C;  1D1C A;  4AXP A;  4B6X A;  5DQW A;  4GYS A;  2EHO A;  2YU2 A;  5JDQ A;  3N9L A;  2JPF A;  2NOX A;  4PFO A;  5JH7 E;  4DBR A;  5GON E;  2Z6E A;  4X1I E;  5DJQ C;  4DMW A;  5JQG E;  2VKD A;  3E0Z A;  4OYK A;  4AKI A;  3RH3 A;  3C4X A;  3KV9 A;  4TN7 B;  5KMG P;  1BR0 A;  1KK7 A;  5FYM A;  4CI2 B;  3KIN B;  4M1P A;  4ZI3 C;  4A56 A;  3D0T A;  3N9O A;  4UEL A;  3GN5 A;  1NWM X;  4YHJ A;  3RRW A;  2A2F X;  2XAH B;  2C5I T;  2DNX A;  2K48 A;  3ZC0 A;  4H9R C;  5JDG A;  4HN9 A;  4ZI2 D;  2OA5 A;  4AI6 A;  3RYF E;  3CML A;  2LSJ A;  3EDV A;  3L3P A;  1YW0 A;  4H9O C;  4ASK A;  2E9X B;  3Q2M A;  3CKD A;  4ZI2 C;  2KWH A;  3VKH A;  1OWA A;  3KV6 A;  1MND A;  3ZLI A;  3F57 A;  2L3L A;  3HKE E;  2LJL A;  3LFM A;  3VKG A;  4UV8 B;  4EAH A;  3OBV E;  5LGN B;  3KBU A;  4ANJ A;  3CQG B;  3O1H A;  4QX8 B;  4Z8X A;  5LBQ B;  3ZMS B;  4G63 A;  5EK2 A;  3E22 E;  2K9A A;  3AAI A;  4IE7 A;  3SOL A;  4EIW A;  2V7J A;  3O9X A;  3AVR A;  4P0A A;  1U4Q A;  2XQY A;  1WLX A;  4ZHQ E;  2ZMA A;  2X9X A;  2JJ9 A;  3N9Q A;  2V7L A;  3AA1 B;  3PTR B;  1U5P A;  2DLR A;  4L5G A;  4YFS A;  2XAQ B;  3ZPO A;  3HKC E;  4XZC A;  5FY1 A;  3I9W A;  1LVF A;  3ANW B;  2KMF A;  3I9Y A;  4JUY A;  4AKR B;  4CXW A;  2LEH A;  5A1L A;  2V7K A;  4EXT A;  3UFE A;  5E0O A;  3MJX A;  2M67 A;  2BDE A;  3RYH E;  2CXL A;  4JEH B;  2CLY C;  2GK9 A;  2Y48 B;  3IHR A;  4CI1 B;  4X1K E;  2X0L B;  2CCQ A;  3SS1 A;  4GYR A;  2C0S A;  3NRX A;  3P7I A;  1D1B A;  4HEA A;  4TUY E;  2NW9 A;  2NTX A;  4PFP A;  1HS7 A;  4U74 A;  2K24 A;  4CI3 B;  3OJA A;  5LGU B;  1D1A A;  4IE4 A;  5JRC A;  2IC9 A;  2LSK A;  5FXW A;  2Q9Q C;  4I50 E;  3RYC E;  4ILU A;  3ZN0 B;  4O2B E;  3RC3 A;  2VKO A;  1MIW A;  2DWK A;  2V7M A;  1US7 B;  2CE7 A;  2XHE B;  4O4H E;  3VU7 H;  2EHO B;  4BJM A;  4EZ4 A;  2D0T A;  4O4J E;  4PK6 A;  4E7S A;  4O4L E;  3N9M A;  4ERR A;  5JDN A;  3ZYM A;  3DP7 A;  4KUM B;  4MHC A;  2X68 A;  4TV9 E;  3S4U A;  4UEM A;  4UF0 A;  2Y6X A;  3UTK A;  4AQG A;  2ODV A;  4TZ4 C;  4QHO A;  1ZEE A;  4J2C A;  2DCF A;  4IDZ A;  2UXX B;  5DQV A;  3R6N A;  2X9W A;  3RX6 A;  3ZMT B;  1S35 A;  3A5X A;  5H6Q B;  2RP4 A;  3LG7 A;  2B1E A;  4AKG A;  4ZS3 A;  3ZYK A;  3KVA A;  1KNZ A;  2W00 A;  2DWG A;  4QWN B;  3H37 A;  5FXV A;  2XUE A;  3QK6 A;  5L3G B;  3LK4 2;  3O4X E;  3DTO A;  2CM0 A;  5CA0 E;  3C4Z A;  3SRZ A;  2E9X D;  4DVD A;  3U3I A;  1B7T A;  3CX7 B;  3E08 A;  3GMI A;  3C4W A;  4KP3 C;  5IHY A;  4JLE A;  5L3B B;  3RKO A;  5L3E B;  2X9H A;  3C98 B;  5H6R B;  4PAG A;  2ODU A;  3GN5 B;  3CX8 B;  2NW8 A;  5LA6 E;  2WM9 A;  5LHI B;  5AFU L;  2HH7 A;  5LJN A;  4OYJ A;  2PG8 A;  3RRC A;  4UVB B;  3VHL A;  5CA1 E;  2KT9 A;  1G73 A;  3V5S A;  4IE5 A;  1MIV A;  4AQF A;  2W0G A;  3UUM A;  4OFZ A;  4U72 A;  5JR9 A;  2XAF B;  1OXZ A;  4DBQ A;  3KV4 A;  4O4I E;  2WAU A;  5ETW A;  4HE8 A;  3N2G E;  4HGA A;  3PUS A;  3TKL B;  3N9N A;  4HTE A;  2WMN A;  3C64 A;  5JDH A;  2RA1 A;  4K0U A;  2A72 A;  5EZY E;  3F2E A;  5JRC B;  4I4T E;  2MOZ A;  3ZN1 B;  3AAA B;  3UUL A;  3ZYL A;  3F31 A;  2CXF A;  2ES0 A;  4UIG A;  3LJC A;  4L9I A;  3N2K E;  2LSY A;  3NZQ A;  3BQL A;  2E8I A;  4HFV A;  3Q5X A;  3PE0 A;  3GA8 A;  4OK0 A;  5HWY A;  3W15 B;  5HXE A;  3LBX A;  1WYB A;  1VRB A;  2DHR A;  1V9D A;  2V7I A;  2HPL A;  3NZP A;  4X20 E;  1O3X A;  1LKX A;  5LHG B;  5HXS A;  2Q9Q D;  3FHN A;  3KBT A;  4CXY A;  5LOV E;  2EHO D;  2LSG A;  4UF0 B;  1QSD A;  3AA6 B;  2E9X C;  5L3F B;  1H7C A;  3CX6 B;  2Q9Q B;  2C5J A;  3Q9D A;  2KIN B;  3ESL A;  4YJ2 E;  2MTQ A;  3O1J A;  4O2A E;  4L0R A;  4ZOL E;  4PNI A;  2CWY A;  1UCU A;  2L9Q A;  1YD8 G;  3GWH A;  1IZN B;  2XAJ B;  2KXP B;  4BAY B;  2UXN B;  1BR1 A;  3IBP A;  5J1G A;  3U78 A;  4PJN A;  3PU8 A;  3AA0 B;  3OKQ A;  3EUH A;  4I43 B;  4H9S E;  2D0U A;  2CEA A;  3KFW X;  4XAX B;  2Y8D A;  2CMR A;  5LYJ E;  3HKD E;  1HG5 A;  4EOZ B;  2VB6 A;  3N9P A;  3B13 A;  3CVR A;  2VKH A;  4X1Y E;  4PJJ A;  3KDS E;  2IW5 B;  2CA5 A;  5JDM A;  2YK0 A;  4ZI3 D;  2E9X A;  4ISS A;  4E7Z A;  5FY0 A;  3K3Q C;  4IE0 A;  4TV8 E;  3SWH A;  4EB6 E;  2LE8 A;  1MMD A;  1WRD A;  2LHN A;  1D0Z A;  4CXX A;  4UXN B;  2D5U A;  5TAO A;  1IJ5 A;  1HCI A;  2NWB A;  3ETU A;  4CQI A;  2H7O A;  2X9Y A;  4PK5 A;  2W63 A;  3LK3 B;  4NUU A;  3K3N A;  2J1D G;  2H7V C;  3P8C D;  1SA0 E;  2IC6 A;  2KLQ A;  1HX8 A;  2KND A;  5JDF A;  3J7Y q;  4ADZ A;  5HXR A;  4XBF B;  5EK3 A;  3ZJ1 A;  1G8X A;  2XAG B;  1UX5 A;  2KWI B;  3PU3 A;  4H63 H;  2X67 A;  4WBO A;  5FXZ A;  3ZMZ B;  1E1H B;  5FP3 A;  3ZC1 A;  5J2U E;  5DAB A;  4MAL A;  2NTY A;  3MA9 A;  4AKH A;  2A3D A;  4O8S A;  5L3D B;  2LSI A;  3OYZ A;  1CUN A;  5LBM A;  2YIN A;  3BK9 A;  4DMV A;  2N9D A;  2BVM A;  2N1G A;  2ACX A;  5LCY A;  2PBI A;  3K8P C;  3M65 A;  5HXC A;  2KZ7 B;  3WAJ A;  3L09 A;  1YKH B;  5M4Y A;  2VL8 A;  4MBQ A;  3BQI A;  3JC6 D;  4IHJ E;  1D0Y A;  3PUQ A;  5FNV E;  3RPU A;  3H3A A;  3ONX A;  3JC6 C;  2LM9 A;  3CQX C;  3DJB A;  4GOU A;  2BZB A;  4UVA B;  4DO0 A;  4WBN E;  3UUX B;  2NP9 A;  3EVY A;  2YU1 A;  2WMO A;  3RC8 A;  1HF8 A;  1HFA A;  3BQK A;  5LNK A;  2JQQ A;  2MYS A;  4V1A v;  4BJN A;  4WW0 A;  4BA9 A;  2WWU A;  2ZM0 A;  1WYC A;  1MMA A;  3FBL A;  5HXH A;  4P09 A;  4JEU B;  5C8Y E;  3CQC B;  3HI2 A;  5LJM A;  3OYX A;  3EDU A;  4HKA A;  1HG2 A;  4YJ3 E;  5L2L A;  2LOS A;  3MKD A;  2JMK A;  3PUG A;  2ZM8 A;  2VAS A;  3AVS A;  3UT5 E;  3I1A A;  3AB3 B;  3FXD B;  1AJ3 A;  2JRK A;  5JR9 B;  4AQF C;  3HA4 A;  4QKN A;  2MBG A;  3MXZ A;  2C5K T;  4QXB B;  5EK4 A;  3ZJ2 A;  2IAK A;  1UX4 A;  1Z0P A;  1FIO A;  5LHH B;  2DI4 A;  3NRY A;  2CWO A;  3IF8 B;  4G2A A;  4ZI7 E;  3FXE B;  3N5L A;  2V1D B;  4P0B A;  4H9Q C;  5HWX A;  2XTL A;  5FXX A;  4F6R C;  3RYI E;  5LG4 A;  4IGU A;  4IE6 A;  3UUN A;  4KMC A;  2LHR A;  4H9N C;  3KVB A;  3B57 A;  1BR4 A;  3MK7 C;  4TX5 A;  5JR9 C;  3ZCJ A;  4QXC B;  3ZCI A;  5HAX A;  4ZS2 A;  1FMW A;  5IYZ E;  3CWZ B;  3LK2 B;  4EYU A;  5FY7 A;  3K3O A;  4WNK A;  1X79 A;  2W62 A;  1FEW A;  3ANW A;  2WSS V;  5JDL A;  3KV5 A;  4QXH B;  4EZH A;  4OHF A;  1FMV A;  3ZMV B;  2L8K A;  4PK4 A;  5LGT B;  2CXD A;  4YLH A;  3O1I A;  4FJO A;  2LOP A;  5HYA A;  5L3C B;  3I0Q A;  2W61 A;  5J2T E;  2VWA A;  5CB4 E;  3ZMU B;  3ZEF B;  4UVC B;  5FMN A;  3PUR A;  2BVL A;  3V5U A;  2VK9 A;  4GK0 E;  3J9X 1;  2K5B B;  3WI3 A;  1IJ6 A;  1YKE B;  1MIY A;  2X51 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...