1YD8G

Complex of human gga3 gat domain and ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
GIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords UBIQUIN
publication title Structural mechanism for ubiquitinated-cargo recognition by the Golgi-localized, {gamma}-ear-containing, ADP-ribosylation-factor-binding proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, chromosomal protein
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yd8G00
2N2NA 1NAFA 1YD8G 1X79A 1OXZA 1WR6A 1WRDA 1O3XA 1NWMX 2N9DA
chains in the Genus database with same CATH superfamily
3AAAB 3F2EA 2VQFT 5FY0A 5L47A 5ABFB 3P4RA 5L4HA 3JC6D 4UXNB 3RGLA 2XY8B 2K5BB 3CWZB 5L3CB 2DWGA 4TX5A 3HR0A 4WBNE 4JI8T 4MBQA 4NPPA 4CXYA 3PUGA 2XZEA 1KNRA 5L2LA 2HH7A 5KXJA 2BVMA 2SPCA 4DMVA 3FZKB 3GN5A 4DR7T 2WU5A 5HEHA 4CN6A 3N9OA 4DR3T 4QWNB 3ANWA 4YTPA 4HWCA 3MA9A 3ZCIA 3RQWA 3TLSA 4U72A 2LLYA 4DO0A 1KNPA 1W0AA 4DUZT 4X20E 3UUMA 3K1SA 4IDNA 2LE8A 5AQTB 5J2TE 4EZ4A 2W0GA 4UV8B 4F6RC 5L3BB 2LM9A 2CRBA 3BQIA 4ZZBA 3L39A 5IHYA 4COFA 4PK5A 4MHCA 2JQQA 4QXBB 4NIQA 1WFDA 3ETUA 3Q5EA 2MAWA 2XQAA 3MXZA 3FZHB 1ZKEA 1G8XA 3T1YT 1NWMX 3GWHA 2LT3A 2MOZA 4CQIA 2C5KT 2XQ6A 3PURA 3ZSTA 4DVDA 4EEBA 4PAGA 3UU8A 3OKQA 2E5VA 1N32T 2LKGA 2DL1A 2FJEA 5F5WA 4AQFA 1NAFA 1OWAA 3MZKB 2NTYA 1E7PA 5FXZA 4JLEA 3AEEA 4UF0B 2HN1A 4I43B 1BR0A 3HKCE 4QXCB 4OYKA 4AI6A 2C5JA 3AXJB 1X9BA 4DR1T 3KFWX 4IGUA 3JCFA 1MIVA 2WZIA 3ZN0B 1US7B 2HPLA 2RP4A 5LBMA 2OV9A 4LFCT 4YT0A 5L3FB 5DJQC 1IAPA 2E9XC 2W63A 3OPCA 3ZJ1A 1GQEA 4IE4A 3ZCJA 4PJNA 5HEUA 3O4XE 1D0XA 1FIOA 5HAXA 3O1HA 2L3LA 1WRDA 5LBQB 3VHLA 1E1HB 3JAEA 3ZYLA 4DR4T 3QB5A 2KT9A 2V5CA 4I4TE 4DR6T 3KBTA 5A1LA 3RKGA 2A3DA 3AB3B 2JQHA 5HEJA 3RX6A 3ZJ2A 1WYCA 2H88A 5JRCB 2VKJA 4H9PC 2K48A 4GK5E 4B3MT 4CI2B 4LFBT 1WYBA 4UVBB 4EGWA 4U31A 2Q9QC 1QSDA 2HN2A 4QXHB 1MNDA 1ZEEA 4CI3B 3FBLA 2JIWA 1I94T 4ZEYA 1MNEA 2WAUA 5CJ5A 2E9XD 3AA6B 2KNDA 3X1DA 3ONJA 4AQYT 2VKHA 3QUJA 3F31A 2VASA 4DV5T 2I6HA 5JDHA 4X1IE 2N9DA 2DCFA 3P4QA 2WDVA 5LHIB 4WYVA 5EK3A 4MALA 2LKHA 2F4VT 3WAKA 5JR9C 2J47A 3FZMB 1O3XA 2UUBT 5LGUB 4UIGA 2XM1A 3KV5A 4AQFC 2LSYA 3P4SA 2VKDA 2IHR1 2ES0A 3A5XA 4DV0T 4ZOLE 2Y8DA 3QC9A 4U3CA 3AE5A 4QHOA 3FXEB 2XAJB 2Q9QD 3IA3A 1IZNB 2H89A 3BK9A 5L4EA 3QOFA 2ZM0A 4B6XA 3AVRA 2V7KA 3DTOA 4I50E 4UVCB 5HXSA 4KUMB 4TWDA 2CCQA 2CWYA 4O4JE 4GOUA 3RIUA 3RYFE 2NOXA 2XAQB 3KV4A 3KINB 5JTGA 2E9XB 2KZ7B 2WWVA 3RC3A 4M1PA 2IUBA 4IL9A 5ADXL 3A7MA 1Y64B 1T98A 2KMFA 4OHFA 5FMNA 1XNRT 2YDRA 2DWKA 3MK7C 1XDPA 3KV9A 3AE1A 5LG4A 3RH3A 5FXVA 3LBXA 4DNDA 3PUQA 5LXTE 4G2AA 3NZPA 5CFBA 2V26A 4O8SA 1S35A 4A56A 3HL6A 4B3ST 2XASB 1HX8A 3ZMVB 5AQQB 3UUXB 2XQ5A 4AKIA 3RYCE 5C3JA 3KV6A 4N78D 1BR2A 3I1AA 1UK5A 4ILAA 3AAIA 4TV9E 4X62T 2Q9QB 2WWUA 2YEVC 2ACXA 3N2GE 4HTEA 2VK9A 4IDOA 3N9QA 3JADA 1NENA 3CMLA 4AKHA 5FY7A 1YQ4A 5LHHB 5HXCA 2YKSA 5LMNT 2UUAT 4HEAA 4DMWA 4ZS3A 4QX7B 1N34T 4KMCA 3AA1B 3AE9A 3KVAA 1HTJF 4TNVA 2XQYA 3GMIA 2CLYB 2KXPB 4ZXLA 5AQKB 3OBVE 2BKNA 2KLQA 3P50A 2LOPA 5JR9B 1VCSA 1H7CA 4CI1B 3PJAJ 2X9YA 2JQKA 2UXBT 1Z0PA 2OLTA 3M65A 2AXDS 3ZN1B 2J1DG 1W09A 4QH4A 2X51A 4DR5T 4PJMA 2CMRA 1UURA 2BVLA 4IT4A 4E7ZA 2XQ7A 3ZT5A 3H37A 4HGAA 5HXHA 2LSKA 1R8IA 1VCTA 4IE7A 3KVBA 3UU5A 2BBJA 1MMGA 4HFCA 3C51A 2IMLA 4ZI7E 3ZC0A 2YK0A 4PFOA 4Z8XA 1BR1A 2D9DA 4OFZA 2LHNA 3RYHE 4UVAB 3VR9A 4Z91A 5AQVB 2IDOB 2BS3A 2M6IA 2E5LT 2UUCT 3NBXX 2LSIA 4YTMA 4DR2T 2BKOA 5KDMC 4AIUA 2JQ9A 2E2AA 5JH7E 1OEDB 4UEMA 2C0SA 2N1GA 1D0ZA 3PU8A 2V6YB 5ABHA 2VL0A 1IBLT 1LVFA 1U5PA 4AXPA 2WS3A 4CN1A 1HNZT 4LF8T 3TLUA 2FBWA 3ZYMA 4PJJA 2LSJA 2W62A 4YHHT 2L9QA 1KF6A 4HWIB 4DV1T 2WU2A 1QUUA 1CHUA 2QVAA 3RIAA 3PUSA 1Z8UA 2UXXB 3UFEA 4AISA 5LMUT 5LP6E 2VVSA 3Q2MA 3QNUA 2A72A 4U7IA 2BG9E 1YXRA 2Y6XA 2D2SA 2N2NA 1YD8G 3AE7A 5H6QB 4HWDA 3P7IA 2V6XA 3AEDA 2ZMAA 1CUNA 2KWIB 5F3JA 2E8IA 5AQMB 4GYRA 2Y48B 4X1YE 4DBQA 3ZPOA 4LFAT 4X5TA 4U7YA 2ODVA 4EB6E 4TV8E 1LVKA 3TLWA 3VRAA 3ZC1A 4JUYA 5FP3A 4HWFA 3C64A 3PU3A 5J0ZA 4KP3C 5L3GB 2EHOC 2CXFA 3AE8A 4WBOA 4GKKT 2WQYA 4EYYR 3UUBA 4JV5T 4DV7T 3P4PA 3D0TA 2XAGB 4AQGA 1NEKA 2V8SV 4BJMA 4YTNA 4ZS2A 3PUVF 3ZEFB 3UU4A 4LF7T 4K0KT 4UV9B 3AAEB 4X1KE 2YU1A 1N36T 5IYZE 1SUMB 2FJAA 1T7SA 1UX4A 2XSBA 4O4LE 1J5WA 1KFYA 2BG9A 2XSAA 3CIRA 4XBFB 5AQFB 3UUNA 2UXDT 3K3QC 4V1Av 2H7OA 4KX6A 3I0OA 4CN4A 4XAXB 2JMKA 4BAYB 4HFIA 5FVKA 2YU2A 4U33A 5HXRA 1FJGT 3LDQB 3K8PC 5H6RB 2EHOD 5J1GA 4OX9T 2WZHA 3HI2A 3I9WA 1JNZA 4O2BE 4GK0E 3RF1A 1M62A 4PK4A 2M67A 2IW5B 1QLBA 2NP9A 2BZBA 4BJNA 5HEOA 3AECA 3H3MA 3ZMSB 2JJ9A 3PDYA 5DABA 2X0LB 4IE5A 1ZP0A 1HG5A 1SE7A 2VKOA 3ZLIA 5ABFA 3E22E 3NZQA 4AKLA 1D1CA 1XNQT 5DQVA 4A97A 3ONLC 2W67A 1FMVA 2LHRA 2WDRA 2OA5A 1D1AA 3NWIA 3PUXF 1N33T 3N9PA 3SRZA 2QGSA 2W2UA 2FUPA 2MYSA 2YDQA 5JDGA 5AQPB 5FXWA 3KBUA 2WMOA 3WI3A 3J7Yq 5AQJB 2X67A 3AE6A 4IE0A 4TUYE 5HCJA 5TAOA 4JEUB 2EHOB 2AE9A 2J62A 2CXLA 2ODUA 4JYAT 3K3OA 5FXXA 1HR0T 4G63A 4YY3T 2LSGA 2BKPA 4EYUA 1HNWT 4O2AE 2YDSA 3C98B 1J5ET 2B76A 4P09A 3N2KE 4DV2T 2RA1A 5L3EB 1HNXT 4HFBA 4I55E 4X66T 2CE7A 4JI3T 2VURA 3QB5K 4O4IE 5LA6E 3IHRA 1KNZA 2QYWA 2NWBA 5HYAA 4DV3T 3AA7B 3CK6A 4MFRA 2C5IT 5AQGB 4YJ3E 5AFUL 3LJCA 3VRBA 4LMJA 1Y01A 3ZKRA 4ISSA 2PTFA 3T8OA 4O4HE 4TWHA 4JI5T 2CHOA 4X65T 3JAFA 2MPKA 1FEWA 2HHHT 2XHEB 3CVRA 4UF0A 3ZT7A 1G73A 1SA0E 4HKAA 3AVSA 1M7KA 3NVOA 4ISTA 3AXJA 3F57A 1UX5A 4PNIA 3UULA 3KDSE 3GN5B 4Q25A 3O1IA 3MACA 2WP9A 2X9XA 3EDVA 3SFDA 5BMVE 3EVYA 3ANWB 5HXEA 1KEYA 5J2UE 2XQ9A 4ILUA 3RHWA 5LOVE 2BDEA 4IE6A 3B57A 3FZLB 4ZI2C 5FYMA 2WCAA 2X9HA 3RYIE 2LOSA 3CX7B 2X0HA 5AQRB 4IDZA 4J2CA 5L3DB 2G0UA 3ZYKA 5EZYE 4PJLA 4CZZB 1KK7A 2BS2A 1JNRA 4NXMT 3Q5DA 2H7VC 5JRCA 3AE2A 5IUXA 4H9SE 4U74A 2P9BA 5JREA 4TZ4C 4A98A 3RIFA 1OXZA 4L5GA 3CX6B 5LCYA 4TNWA 3ZSSA 1E2AA 4P0BA 4EEDA 2IC6A 5FL1A 4H9OC 2ZM2A 3CPZA 4JEHB 4YSZA 4JI7T 2CEAA 4HFDA 4MLKA 4U2YA 4ZI2D 4CXWA 2FJDA 4FJOA 2BS4A 5HWYA 2FJBA 3MKDA 2CBJA 3SOLA 3RIUC 4YXDA 2BBHA 4FI5A 4ANJA 4TWFA 4NUUA 5EK4A 4OYJA 1AJ3A 4OK0A 3SWHA 4P0AA 4PK6A 1WLXA 1HS7A 2IC9A 3RRCA 3O1JA 2D5UA 3N9NA 4QH5A 3EHZA 2CPTA 3MJXA 3OTOT 3CKDA 2WM9A 4LF4T 4ADZA 4LMKA 2V1DB 5LG3A 5M4YA 3TLTA 5EK2A 5AQHB 4Z90A 2JPFA 4JI4T 1B7TA 2ZLYA 4ILBA 4XZCA 2QA7A 3L8RA 1MMDA 5LB7B 4JI6T 4HFEA 5AQUB 2E9XA 4YJ2E 4C90A 2L8KA 1T8BA 3PJAA 1S94A 4HN9A 5FNVE 3TLVA 3N9MA 4ILCA 3PUZF 3W15B 3PUAA 3ESLA 1J1JA 1FMWA 1WCRA 5BR8T 4ZI3C 4HE8A 4JBWF 3DJBA 3AE4A 5KX5E 2XQ3A 2W66A 3C4ZA 2ACZA 3DP7A 2K9AA 4YLHA 2ZM8A 3HKBE 4WZXA 4JI1T 2R6GF 1WR6A 3UTKA 5IWAT 4NXNT 2PG8A 2J4GA 4YSXA 3LSVA 4KHPT 4A5XA 2Q9QA 4IHJE 3NKZA 4IDQA 1YKHB 5CA1E 3UU6A 1LRZA 2LJLA 4ZZCA 2ZM6T 3PUYF 4B3RT 3ETVA 4IIJE 2LRLA 4KBMB 3RQUA 1IJ5A 3FZFB 2W00A 3UFGA 4CXXA 5AQSB 4P1NA 2X68A 3ZMTB 2WB5A 4PW8A 1XWMA 5KMGP 4HFHA 1XDOA 1XMQT 3LFMA 4H63H 4EV6A 4DIDB 4ZI3D 3ZMZB 3VU7H 3UT5E 2A2FX 4GYSA 4PFPA 1WR0A 3LG7A 5JR9A 3HA4A 1OEDE 5DQWA 1D0YA 2NW8A 3L3PA 3C4WA 2VQET 3AEBA 3EI0A 1SHZC 2XAFB 2KINB 1VOMA 2CA5A 2H3RA 3NRXA 2IIUA 4U2ZA 1MIWA 2YN6A 3HKEE 4QKNA 2CWOA 2K3WA 2X66A 1ZV4X 5FL0A 3LBXB 3CX8B 5JDFA 2XPKA 3K3NA 3EUHA 3AE3A 2CBIA 2XQ4A 3IF8B 2LM2A 3IEEA 2DNXA 5JDQA 1D1BA 3NRYA 2XQ8A 3WAJA 3RRWA 5LHGB 4LF6T 2VL8A 3RPUA 3ZMUB 2VVNA 3PTRB 3AA0B 1HG2A 2CM0A 1YW0A 4L9IA 3B5MA 2MBGA 3V5UA 1VRBA 2NTXA 5LNKA 2X9WA 5ABGA 5JDNA 4AKGA 1W0BA 1OEDA 3AEGA 4LF9T 4YHJA 2V6YA 3C4XA 4TN7B 1LKXA 3E0ZA 4JI2T 3RKOA 4I0UA 2HPJA 4UR9A 3VKHA 2PBIA 3BQLA 3CQGB 2Z6EA 3L09A 3J9X1 2WY2A 4YFSA 4EAHA 4JI0T 2YINA 3RLFF 1BR4A 2VWAA 2PFVA 4IL4A 5HEGA 3PE0A 5JQGE 3FB2A 3Q9DA 3UQ7A 4K0UA 3PV0F 2LEHA 4L0RA 2LRKA 5LJNA 4HFVA 4EIWA 3N2OA 3E08A 4DV4T 2CLYC 4DUYT 3OJAA 2V7LA 3AEAA 2QRXA 2UXCT 4ASKA 5C2TA 1MIYA 3C50A 4F8HA 3FXDB 4QH1A 4EZHA 3EABA 3Q5WA 3R6NA 3P4WA 2JMHA 4LMLA 4KI0F 2BG9C 3ABVA 5F8PA 3N9LA 2NW7A 3H3AA 2X0YA 4NUVA 2PJQA 3P8CD 5C8YE 3FHNA 3IBPA 2CXDA 2UXNB 3OYZA 3ONXA 3T1HT 3HKDE 5LGNB 1HCIA 3SFEA 2RPAA 4KHZF 4ZHQE 3OYXA 4GKJT 2V7IA 2B1EA 2NR4A 5LJMA 5AQLB 4AKRB 1HX1B 1UGOA 1ZHCA 5AQNB 2WDQA 2DI4A 1W9RA 1U4QA 2I0MA 3I0QA 4WW0A 4IDPA 1UCUA 4H9QC 1YQ3A 4EXTA 3B13A 2A9UA 1OEDC 2W61A 4EOZB 3OVUA 4GIWA 3VKGA 3LK2B 2DLRA 4WNKA 4BA9A 2XM2A 3UU3A 3VR8A 2KSRA 3G06A 4H63V 5JVDE 3FBZA 4UELA 2W4XA 2XUEA 4X64T 4DV6T 2VB6A 3LK3B 4C91A 1DU2A 4YSYA 4DBRA 3N5LA 3EDUA 1L0VA 5ABEA 1EZ3A 2WSSV 5E0OA 3U78A 1X79A 2I59A 4H9NC 1IBMT 3O9XA 3U3IA 2DHRA 3CQCB 5AQOB 4ERRA 3TKLB 1T72A 1XZYA 5FY1A 2GK9A 5GONE 2NW9A 5FVLA 2UU9T 1IJ6A 2KWHA 3RI5A 5CB4E 3S4UA 1MMNA 2WBLA 3QK6A 2JRKA 4B3TT 3AEFA 2D0UA 2MTQA 5JDMA 3CQXC 2XAHB 2YOEA 2V7MA 1HFAA 5AQIB 2D0TA 1V9DA 5JDLA 5ETWA 4LF5T 3EAMA 3GA8A 1XMOT 3SS1A 1MMAA 1I6ZA 4HWHA 2BG9B 3A8YC 2M6BA 3UQ4A 3JC6C 4IREA 1YKEB 3Q5XA 5CGMA 2EHOA 3PUWF 3I9YA 1IBKT 1UUSA 5LGTB 2V7JA 4E7SA 5HWXA 1ZOYA 1HF8A 5LYJE 3RC8A 5FKYA 5HCMA 2WMNA 3LK42 3R84B 2IAKA 3M3ZB 2XTLA 4H9RC 2XJ7A 3BQKA 2K24A 5CA0E 3V5SA 4QX8B 3ZT6A 2V5DA 2CHNA
chains in the Genus database with same CATH topology
3AAAB 5DQWA 2X67A 3F2EA 1D0YA 2NW8A 3L3PA 3C4WA 4IE0A 4TUYE 3AAIA 5TAOA 4JEUB 2EHOB 4TV9E 2Q9QB 2WWUA 5FY0A 2CXLA 2ODUA 3K3OA 2YEVC 1SHZC 5FXXA 2ACXA 3N2GE 2XAFB 4HTEA 2VK9A 4G63A 2KINB 1VOMA 2CA5A 3N9QA 2H3RA 3NRXA 2LSGA 3CMLA 4AKHA 5FY7A 3JC6D 4EYUA 5LHHB 4UXNB 1MIWA 3HKEE 4QKNA 4O2AE 2K5BB 2CWOA 3C98B 5HXCA 2X66A 3CWZB 1ZV4X 4P09A 4HEAA 3N2KE 3LBXB 5L3CB 2RA1A 3CX8B 5JDFA 4DMWA 5L3EB 2DWGA 4TX5A 4ZS3A 4I55E 4QX7B 3HR0A 3K3NA 2CE7A 3EUHA 4KMCA 3AA1B 4WBNE 3KVAA 4MBQA 1HTJF 4CXYA 2XQYA 3GMIA 2CLYB 2KXPB 3IF8B 3PUGA 4O4IE 5LA6E 3IHRA 1KNZA 3OBVE 5L2LA 3IEEA 2DNXA 5JDQA 2HH7A 1D1BA 3NRYA 2BVMA 2KLQA 2SPCA 3GN5A 2NWBA 4DMVA 5HYAA 3AA7B 3WAJA 3RRWA 5LHGB 3N9OA 4MFRA 2C5IT 2LOPA 2VL8A 4QWNB 4YJ3E 3ANWA 3RPUA 5AFUL 3LJCA 5JR9B 3ZMUB 3MA9A 1H7CA 3PTRB 4CI1B 3ZCIA 4ISSA 3AA0B 1HG2A 2X9YA 1Z0PA 4U72A 3M65A 3T8OA 4O4HE 2CM0A 1YW0A 4L9IA 4DO0A 3ZN1B 2J1DG 4X20E 2X51A 3UUMA 4PJMA 2CMRA 2MBGA 3V5UA 2BVLA 4E7ZA 1VRBA 2LE8A 2NTXA 5LNKA 2X9WA 5J2TE 4EZ4A 2W0GA 4UV8B 4F6RC 5L3BB 2LM9A 1FEWA 3H37A 5JDNA 4HGAA 4AKGA 3BQIA 2XHEB 5HXHA 2LSKA 3CVRA 4IE7A 4UF0A 4YHJA 5IHYA 1G73A 4PK5A 3KVBA 1SA0E 4MHCA 4HKAA 3C4XA 3AVSA 2JQQA 4QXBB 4TN7B 1LKXA 4ISTA 3E0ZA 3ETUA 3RKOA 2HPJA 3MXZA 3VKHA 1ZKEA 3F57A 1G8XA 2PBIA 1MMGA 1NWMX 1UX5A 3BQLA 3GWHA 4PNIA 3KDSE 3UULA 3C51A 3CQGB 3GN5B 2Z6EA 3O1IA 3L09A 3MACA 4ZI7E 3ZC0A 2LT3A 3J9X1 2MOZA 2YK0A 4YFSA 4CQIA 2X9XA 3EDVA 4EAHA 5BMVE 2C5KT 4PFOA 2YINA 3ANWB 3EVYA 3PURA 4Z8XA 1BR4A 1BR1A 2VWAA 4DVDA 2PFVA 5HXEA 4OFZA 3PE0A 2LHNA 4PAGA 5JQGE 3FB2A 3RYHE 3Q9DA 3OKQA 5J2UE 4ILUA 5LOVE 4K0UA 2LEHA 4L0RA 2BDEA 4UVAB 4IE6A 4AQFA 3B57A 3NBXX 1NAFA 2LSIA 4ZI2C 5LJNA 1OWAA 4HFVA 5FYMA 3MZKB 2NTYA 4EIWA 3N2OA 5FXZA 5KDMC 3E08A 2X9HA 4JLEA 3RYIE 2LOSA 5JH7E 2CLYC 4UEMA 3CX7B 2C0SA 3OJAA 2V7LA 4UF0B 2N1GA 4IDZA 4J2CA 1D0ZA 3PU8A 4I43B 2G0UA 5L3DB 1BR0A 3ZYKA 5EZYE 4PJLA 4CZZB 4ASKA 1LVFA 3HKCE 1KK7A 4QXCB 4OYKA 4AI6A 2C5JA 1MIYA 1U5PA 3C50A 2H7VC 3FXDB 4AXPA 3KFWX 4EZHA 3Q5WA 4IGUA 3R6NA 5JRCA 3ZYMA 1MIVA 3ZN0B 1US7B 2JMHA 2LSJA 4PJJA 2HPLA 2RP4A 5LBMA 4H9SE 2W62A 2L9QA 4U74A 2P9BA 5JREA 4TZ4C 5F8PA 3N9LA 2NW7A 1OXZA 3H3AA 5L3FB 5DJQC 4L5GA 1IAPA 4NUVA 2E9XC 2PJQA 3CX6B 3P8CD 2W63A 5LCYA 1QUUA 3ZJ1A 4IE4A 4P0BA 3ZCJA 5C8YE 4PJNA 3FHNA 3O4XE 3PUSA 2UXXB 1D0XA 2IC6A 3UFEA 5LP6E 1FIOA 3Q2MA 3IBPA 2ZM2A 3CPZA 3O1HA 4H9OC 4JEHB 5HAXA 2CXDA 2L3LA 2A72A 2UXNB 1WRDA 5LBQB 3OYZA 3VHLA 2Y6XA 3ONXA 1E1HB 2D2SA 2N2NA 3HKDE 1YD8G 3ZYLA 2CEAA 5LGNB 1HCIA 5H6QB 2KT9A 4I4TE 3P7IA 4MLKA 2ZMAA 1CUNA 3KBTA 4ZHQE 3OYXA 5A1LA 2KWIB 2V7IA 2B1EA 2A3DA 5F3JA 3AB3B 4ZI2D 5LJMA 2E8IA 4CXWA 4GYRA 3RX6A 4AKRB 2Y48B 4X1YE 4FJOA 4DBQA 3ZJ2A 3ZPOA 1WYCA 5JRCB 5HWYA 2ODVA 1ZHCA 3MKDA 4TV8E 4EB6E 1LVKA 3SOLA 2VKJA 4H9PC 2DI4A 2K48A 4GK5E 1U4QA 3I0QA 4WW0A 4FI5A 3ZC1A 4CI2B 4JUYA 5FP3A 1WYBA 4ANJA 3C64A 3PU3A 4KP3C 4UVBB 5L3GB 2EHOC 4NUUA 2CXFA 2Q9QC 5EK4A 1QSDA 1UCUA 4H9QC 4WBOA 4EXTA 4OYJA 1AJ3A 4OK0A 4QXHB 4EYYR 1MNDA 1ZEEA 4CI3B 3FBLA 3B13A 2W61A 3SWHA 4EOZB 4P0AA 4PK6A 3D0TA 1WLXA 2XAGB 4GIWA 1HS7A 1MNEA 3VKGA 4AQGA 2IC9A 3LK2B 3RRCA 3O1JA 2WAUA 2D5UA 2DLRA 2E9XD 3N9NA 4WNKA 3AA6B 4BJMA 4BA9A 2KNDA 4ZS2A 3ZEFB 4UV9B 3MJXA 2VKHA 3QUJA 3AAEB 4X1KE 4H63V 5JVDE 2YU1A 3CKDA 3F31A 3FBZA 4UELA 2WM9A 2XUEA 2VASA 5IYZE 4ADZA 2V1DB 2VB6A 3LK3B 5M4YA 5JDHA 1UX4A 4X1IE 2N9DA 4C91A 4DBRA 5EK2A 2DCFA 4O4LE 3N5LA 3EDUA 1EZ3A 5LHIB 2WSSV 5E0OA 2JPFA 3U78A 1B7TA 5EK3A 2ZLYA 1X79A 2I59A 4H9NC 4MALA 4XZCA 3O9XA 4XBFB 3U3IA 2DHRA 3CQCB 2QA7A 4ERRA 1MMDA 3TKLB 3WAKA 3UUNA 5JR9C 1O3XA 3K3QC 4V1Av 2E9XA 2H7OA 5LGUB 5FY1A 4YJ2E 4UIGA 4C90A 2L8KA 2GK9A 3KV5A 3I0OA 4AQFC 2LSYA 5GONE 4XAXB 2NW9A 1S94A 4HN9A 2JMKA 1IJ6A 2KWHA 5FNVE 2VKDA 5CB4E 2ES0A 3S4UA 4BAYB 3N9MA 3A5XA 1MMNA 2WBLA 3QK6A 2JRKA 2YU2A 4ZOLE 2Y8DA 3QC9A 3W15B 5HXRA 3PUAA 3ESLA 1FMWA 3K8PC 4QHOA 2D0UA 5H6RB 3FXEB 2EHOD 4ZI3C 4HE8A 2XAJB 3DJBA 2Q9QD 5J1GA 1IZNB 2MTQA 3HI2A 3I9WA 5JDMA 3CQXC 4O2BE 3BK9A 2XAHB 4GK0E 4B6XA 2ZM0A 5KX5E 3AVRA 2V7KA 2V7MA 1HFAA 3C4ZA 4PK4A 3DTOA 2D0TA 3DP7A 4I50E 2K9AA 4UVCB 2M67A 1V9DA 5JDLA 5ETWA 5HXSA 4YLHA 4KUMB 2IW5B 2ZM8A 3HKBE 3GA8A 2NP9A 2CCQA 2BZBA 3SS1A 2CWYA 1MMAA 4O4JE 1WR6A 3UTKA 4GOUA 3RYFE 4BJNA 2NOXA 2XAQB 3KV4A 3KINB 3JC6C 2PG8A 1YKEB 3Q5XA 2E9XB 2KZ7B 3ZMSB 3RC3A 2JJ9A 3PDYA 4M1PA 2EHOA 5DABA 5ADXL 2X0LB 4IE5A 2Q9QA 1HG5A 2VKOA 4IHJE 3ZLIA 3I9YA 1Y64B 1T98A 2KMFA 4OHFA 1YKHB 5FMNA 5LGTB 5CA1E 2V7JA 4E7SA 5HWXA 3E22E 3NZQA 4AKLA 1D1CA 1LRZA 2LJLA 2DWKA 5DQVA 3MK7C 3ETVA 1HF8A 4IIJE 5LYJE 4KBMB 3RC8A 1IJ5A 3KV9A 2WMNA 5LG4A 3RH3A 2W00A 1FMVA 2LHRA 3LK42 3LBXA 5FXVA 3R84B 4DNDA 2OA5A 3PUQA 5LXTE 4G2AA 3NZPA 1D1AA 4CXXA 2IAKA 2V26A 4O8SA 1S35A 2X68A 3N9PA 3SRZA 2QGSA 3HL6A 3ZMTB 4A56A 4PW8A 2XTLA 2XASB 1HX8A 3ZMVB 5KMGP 2MYSA 4H9RC 3UUXB 3LFMA 4H63H 5JDGA 3BQKA 2K24A 4ZI3D 3RYCE 3VU7H 3ZMZB 5CA0E 4AKIA 3V5SA 3UT5E 4QX8B 3KV6A 2A2FX 4GYSA 4N78D 3KBUA 1BR2A 5FXWA 3I1AA 2WMOA 4PFPA 3WI3A 3LG7A 3J7Yq 5JR9A 3HA4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  1NAF A;  1YD8 G;  1X79 A;  1OXZ A;  1WR6 A;  1WRD A;  1O3X A;  1NWM X;  2N9D A; 
#chains in the Genus database with same CATH topology
 3AAA B;  3F2E A;  2VQF T;  5FY0 A;  5L47 A;  5ABF B;  3P4R A;  5L4H A;  3JC6 D;  4UXN B;  3RGL A;  2XY8 B;  2K5B B;  3CWZ B;  5L3C B;  2DWG A;  4TX5 A;  3HR0 A;  4WBN E;  4JI8 T;  4MBQ A;  4NPP A;  4CXY A;  3PUG A;  2XZE A;  1KNR A;  5L2L A;  2HH7 A;  5KXJ A;  2BVM A;  2SPC A;  4DMV A;  3FZK B;  3GN5 A;  4DR7 T;  2WU5 A;  5HEH A;  4CN6 A;  3N9O A;  4DR3 T;  4QWN B;  3ANW A;  4YTP A;  4HWC A;  3MA9 A;  3ZCI A;  3RQW A;  3TLS A;  4U72 A;  2LLY A;  4DO0 A;  1KNP A;  1W0A A;  4DUZ T;  4X20 E;  3UUM A;  3K1S A;  4IDN A;  2LE8 A;  5AQT B;  5J2T E;  4EZ4 A;  2W0G A;  4UV8 B;  4F6R C;  5L3B B;  2LM9 A;  2CRB A;  3BQI A;  4ZZB A;  3L39 A;  5IHY A;  4COF A;  4PK5 A;  4MHC A;  2JQQ A;  4QXB B;  4NIQ A;  1WFD A;  3ETU A;  3Q5E A;  2MAW A;  2XQA A;  3MXZ A;  3FZH B;  1ZKE A;  1G8X A;  3T1Y T;  1NWM X;  3GWH A;  2LT3 A;  2MOZ A;  4CQI A;  2C5K T;  2XQ6 A;  3PUR A;  3ZST A;  4DVD A;  4EEB A;  4PAG A;  3UU8 A;  3OKQ A;  2E5V A;  1N32 T;  2LKG A;  2DL1 A;  2FJE A;  5F5W A;  4AQF A;  1NAF A;  1OWA A;  3MZK B;  2NTY A;  1E7P A;  5FXZ A;  4JLE A;  3AEE A;  4UF0 B;  2HN1 A;  4I43 B;  1BR0 A;  3HKC E;  4QXC B;  4OYK A;  4AI6 A;  2C5J A;  3AXJ B;  1X9B A;  4DR1 T;  3KFW X;  4IGU A;  3JCF A;  1MIV A;  2WZI A;  3ZN0 B;  1US7 B;  2HPL A;  2RP4 A;  5LBM A;  2OV9 A;  4LFC T;  4YT0 A;  5L3F B;  5DJQ C;  1IAP A;  2E9X C;  2W63 A;  3OPC A;  3ZJ1 A;  1GQE A;  4IE4 A;  3ZCJ A;  4PJN A;  5HEU A;  3O4X E;  1D0X A;  1FIO A;  5HAX A;  3O1H A;  2L3L A;  1WRD A;  5LBQ B;  3VHL A;  1E1H B;  3JAE A;  3ZYL A;  4DR4 T;  3QB5 A;  2KT9 A;  2V5C A;  4I4T E;  4DR6 T;  3KBT A;  5A1L A;  3RKG A;  2A3D A;  3AB3 B;  2JQH A;  5HEJ A;  3RX6 A;  3ZJ2 A;  1WYC A;  2H88 A;  5JRC B;  2VKJ A;  4H9P C;  2K48 A;  4GK5 E;  4B3M T;  4CI2 B;  4LFB T;  1WYB A;  4UVB B;  4EGW A;  4U31 A;  2Q9Q C;  1QSD A;  2HN2 A;  4QXH B;  1MND A;  1ZEE A;  4CI3 B;  3FBL A;  2JIW A;  1I94 T;  4ZEY A;  1MNE A;  2WAU A;  5CJ5 A;  2E9X D;  3AA6 B;  2KND A;  3X1D A;  3ONJ A;  4AQY T;  2VKH A;  3QUJ A;  3F31 A;  2VAS A;  4DV5 T;  2I6H A;  5JDH A;  4X1I E;  2N9D A;  2DCF A;  3P4Q A;  2WDV A;  5LHI B;  4WYV A;  5EK3 A;  4MAL A;  2LKH A;  2F4V T;  3WAK A;  5JR9 C;  2J47 A;  3FZM B;  1O3X A;  2UUB T;  5LGU B;  4UIG A;  2XM1 A;  3KV5 A;  4AQF C;  2LSY A;  3P4S A;  2VKD A;  2IHR 1;  2ES0 A;  3A5X A;  4DV0 T;  4ZOL E;  2Y8D A;  3QC9 A;  4U3C A;  3AE5 A;  4QHO A;  3FXE B;  2XAJ B;  2Q9Q D;  3IA3 A;  1IZN B;  2H89 A;  3BK9 A;  5L4E A;  3QOF A;  2ZM0 A;  4B6X A;  3AVR A;  2V7K A;  3DTO A;  4I50 E;  4UVC B;  5HXS A;  4KUM B;  4TWD A;  2CCQ A;  2CWY A;  4O4J E;  4GOU A;  3RIU A;  3RYF E;  2NOX A;  2XAQ B;  3KV4 A;  3KIN B;  5JTG A;  2E9X B;  2KZ7 B;  2WWV A;  3RC3 A;  4M1P A;  2IUB A;  4IL9 A;  5ADX L;  3A7M A;  1Y64 B;  1T98 A;  2KMF A;  4OHF A;  5FMN A;  1XNR T;  2YDR A;  2DWK A;  3MK7 C;  1XDP A;  3KV9 A;  3AE1 A;  5LG4 A;  3RH3 A;  5FXV A;  3LBX A;  4DND A;  3PUQ A;  5LXT E;  4G2A A;  3NZP A;  5CFB A;  2V26 A;  4O8S A;  1S35 A;  4A56 A;  3HL6 A;  4B3S T;  2XAS B;  1HX8 A;  3ZMV B;  5AQQ B;  3UUX B;  2XQ5 A;  4AKI A;  3RYC E;  5C3J A;  3KV6 A;  4N78 D;  1BR2 A;  3I1A A;  1UK5 A;  4ILA A;  3AAI A;  4TV9 E;  4X62 T;  2Q9Q B;  2WWU A;  2YEV C;  2ACX A;  3N2G E;  4HTE A;  2VK9 A;  4IDO A;  3N9Q A;  3JAD A;  1NEN A;  3CML A;  4AKH A;  5FY7 A;  1YQ4 A;  5LHH B;  5HXC A;  2YKS A;  5LMN T;  2UUA T;  4HEA A;  4DMW A;  4ZS3 A;  4QX7 B;  1N34 T;  4KMC A;  3AA1 B;  3AE9 A;  3KVA A;  1HTJ F;  4TNV A;  2XQY A;  3GMI A;  2CLY B;  2KXP B;  4ZXL A;  5AQK B;  3OBV E;  2BKN A;  2KLQ A;  3P50 A;  2LOP A;  5JR9 B;  1VCS A;  1H7C A;  4CI1 B;  3PJA J;  2X9Y A;  2JQK A;  2UXB T;  1Z0P A;  2OLT A;  3M65 A;  2AXD S;  3ZN1 B;  2J1D G;  1W09 A;  4QH4 A;  2X51 A;  4DR5 T;  4PJM A;  2CMR A;  1UUR A;  2BVL A;  4IT4 A;  4E7Z A;  2XQ7 A;  3ZT5 A;  3H37 A;  4HGA A;  5HXH A;  2LSK A;  1R8I A;  1VCT A;  4IE7 A;  3KVB A;  3UU5 A;  2BBJ A;  1MMG A;  4HFC A;  3C51 A;  2IML A;  4ZI7 E;  3ZC0 A;  2YK0 A;  4PFO A;  4Z8X A;  1BR1 A;  2D9D A;  4OFZ A;  2LHN A;  3RYH E;  4UVA B;  3VR9 A;  4Z91 A;  5AQV B;  2IDO B;  2BS3 A;  2M6I A;  2E5L T;  2UUC T;  3NBX X;  2LSI A;  4YTM A;  4DR2 T;  2BKO A;  5KDM C;  4AIU A;  2JQ9 A;  2E2A A;  5JH7 E;  1OED B;  4UEM A;  2C0S A;  2N1G A;  1D0Z A;  3PU8 A;  2V6Y B;  5ABH A;  2VL0 A;  1IBL T;  1LVF A;  1U5P A;  4AXP A;  2WS3 A;  4CN1 A;  1HNZ T;  4LF8 T;  3TLU A;  2FBW A;  3ZYM A;  4PJJ A;  2LSJ A;  2W62 A;  4YHH T;  2L9Q A;  1KF6 A;  4HWI B;  4DV1 T;  2WU2 A;  1QUU A;  1CHU A;  2QVA A;  3RIA A;  3PUS A;  1Z8U A;  2UXX B;  3UFE A;  4AIS A;  5LMU T;  5LP6 E;  2VVS A;  3Q2M A;  3QNU A;  2A72 A;  4U7I A;  2BG9 E;  1YXR A;  2Y6X A;  2D2S A;  2N2N A;  1YD8 G;  3AE7 A;  5H6Q B;  4HWD A;  3P7I A;  2V6X A;  3AED A;  2ZMA A;  1CUN A;  2KWI B;  5F3J A;  2E8I A;  5AQM B;  4GYR A;  2Y48 B;  4X1Y E;  4DBQ A;  3ZPO A;  4LFA T;  4X5T A;  4U7Y A;  2ODV A;  4EB6 E;  4TV8 E;  1LVK A;  3TLW A;  3VRA A;  3ZC1 A;  4JUY A;  5FP3 A;  4HWF A;  3C64 A;  3PU3 A;  5J0Z A;  4KP3 C;  5L3G B;  2EHO C;  2CXF A;  3AE8 A;  4WBO A;  4GKK T;  2WQY A;  4EYY R;  3UUB A;  4JV5 T;  4DV7 T;  3P4P A;  3D0T A;  2XAG B;  4AQG A;  1NEK A;  2V8S V;  4BJM A;  4YTN A;  4ZS2 A;  3PUV F;  3ZEF B;  3UU4 A;  4LF7 T;  4K0K T;  4UV9 B;  3AAE B;  4X1K E;  2YU1 A;  1N36 T;  5IYZ E;  1SUM B;  2FJA A;  1T7S A;  1UX4 A;  2XSB A;  4O4L E;  1J5W A;  1KFY A;  2BG9 A;  2XSA A;  3CIR A;  4XBF B;  5AQF B;  3UUN A;  2UXD T;  3K3Q C;  4V1A v;  2H7O A;  4KX6 A;  3I0O A;  4CN4 A;  4XAX B;  2JMK A;  4BAY B;  4HFI A;  5FVK A;  2YU2 A;  4U33 A;  5HXR A;  1FJG T;  3LDQ B;  3K8P C;  5H6R B;  2EHO D;  5J1G A;  4OX9 T;  2WZH A;  3HI2 A;  3I9W A;  1JNZ A;  4O2B E;  4GK0 E;  3RF1 A;  1M62 A;  4PK4 A;  2M67 A;  2IW5 B;  1QLB A;  2NP9 A;  2BZB A;  4BJN A;  5HEO A;  3AEC A;  3H3M A;  3ZMS B;  2JJ9 A;  3PDY A;  5DAB A;  2X0L B;  4IE5 A;  1ZP0 A;  1HG5 A;  1SE7 A;  2VKO A;  3ZLI A;  5ABF A;  3E22 E;  3NZQ A;  4AKL A;  1D1C A;  1XNQ T;  5DQV A;  4A97 A;  3ONL C;  2W67 A;  1FMV A;  2LHR A;  2WDR A;  2OA5 A;  1D1A A;  3NWI A;  3PUX F;  1N33 T;  3N9P A;  3SRZ A;  2QGS A;  2W2U A;  2FUP A;  2MYS A;  2YDQ A;  5JDG A;  5AQP B;  5FXW A;  3KBU A;  2WMO A;  3WI3 A;  3J7Y q;  5AQJ B;  2X67 A;  3AE6 A;  4IE0 A;  4TUY E;  5HCJ A;  5TAO A;  4JEU B;  2EHO B;  2AE9 A;  2J62 A;  2CXL A;  2ODU A;  4JYA T;  3K3O A;  5FXX A;  1HR0 T;  4G63 A;  4YY3 T;  2LSG A;  2BKP A;  4EYU A;  1HNW T;  4O2A E;  2YDS A;  3C98 B;  1J5E T;  2B76 A;  4P09 A;  3N2K E;  4DV2 T;  2RA1 A;  5L3E B;  1HNX T;  4HFB A;  4I55 E;  4X66 T;  2CE7 A;  4JI3 T;  2VUR A;  3QB5 K;  4O4I E;  5LA6 E;  3IHR A;  1KNZ A;  2QYW A;  2NWB A;  5HYA A;  4DV3 T;  3AA7 B;  3CK6 A;  4MFR A;  2C5I T;  5AQG B;  4YJ3 E;  5AFU L;  3LJC A;  3VRB A;  4LMJ A;  1Y01 A;  3ZKR A;  4ISS A;  2PTF A;  3T8O A;  4O4H E;  4TWH A;  4JI5 T;  2CHO A;  4X65 T;  3JAF A;  2MPK A;  1FEW A;  2HHH T;  2XHE B;  3CVR A;  4UF0 A;  3ZT7 A;  1G73 A;  1SA0 E;  4HKA A;  3AVS A;  1M7K A;  3NVO A;  4IST A;  3AXJ A;  3F57 A;  1UX5 A;  4PNI A;  3UUL A;  3KDS E;  3GN5 B;  4Q25 A;  3O1I A;  3MAC A;  2WP9 A;  2X9X A;  3EDV A;  3SFD A;  5BMV E;  3EVY A;  3ANW B;  5HXE A;  1KEY A;  5J2U E;  2XQ9 A;  4ILU A;  3RHW A;  5LOV E;  2BDE A;  4IE6 A;  3B57 A;  3FZL B;  4ZI2 C;  5FYM A;  2WCA A;  2X9H A;  3RYI E;  2LOS A;  3CX7 B;  2X0H A;  5AQR B;  4IDZ A;  4J2C A;  5L3D B;  2G0U A;  3ZYK A;  5EZY E;  4PJL A;  4CZZ B;  1KK7 A;  2BS2 A;  1JNR A;  4NXM T;  3Q5D A;  2H7V C;  5JRC A;  3AE2 A;  5IUX A;  4H9S E;  4U74 A;  2P9B A;  5JRE A;  4TZ4 C;  4A98 A;  3RIF A;  1OXZ A;  4L5G A;  3CX6 B;  5LCY A;  4TNW A;  3ZSS A;  1E2A A;  4P0B A;  4EED A;  2IC6 A;  5FL1 A;  4H9O C;  2ZM2 A;  3CPZ A;  4JEH B;  4YSZ A;  4JI7 T;  2CEA A;  4HFD A;  4MLK A;  4U2Y A;  4ZI2 D;  4CXW A;  2FJD A;  4FJO A;  2BS4 A;  5HWY A;  2FJB A;  3MKD A;  2CBJ A;  3SOL A;  3RIU C;  4YXD A;  2BBH A;  4FI5 A;  4ANJ A;  4TWF A;  4NUU A;  5EK4 A;  4OYJ A;  1AJ3 A;  4OK0 A;  3SWH A;  4P0A A;  4PK6 A;  1WLX A;  1HS7 A;  2IC9 A;  3RRC A;  3O1J A;  2D5U A;  3N9N A;  4QH5 A;  3EHZ A;  2CPT A;  3MJX A;  3OTO T;  3CKD A;  2WM9 A;  4LF4 T;  4ADZ A;  4LMK A;  2V1D B;  5LG3 A;  5M4Y A;  3TLT A;  5EK2 A;  5AQH B;  4Z90 A;  2JPF A;  4JI4 T;  1B7T A;  2ZLY A;  4ILB A;  4XZC A;  2QA7 A;  3L8R A;  1MMD A;  5LB7 B;  4JI6 T;  4HFE A;  5AQU B;  2E9X A;  4YJ2 E;  4C90 A;  2L8K A;  1T8B A;  3PJA A;  1S94 A;  4HN9 A;  5FNV E;  3TLV A;  3N9M A;  4ILC A;  3PUZ F;  3W15 B;  3PUA A;  3ESL A;  1J1J A;  1FMW A;  1WCR A;  5BR8 T;  4ZI3 C;  4HE8 A;  4JBW F;  3DJB A;  3AE4 A;  5KX5 E;  2XQ3 A;  2W66 A;  3C4Z A;  2ACZ A;  3DP7 A;  2K9A A;  4YLH A;  2ZM8 A;  3HKB E;  4WZX A;  4JI1 T;  2R6G F;  1WR6 A;  3UTK A;  5IWA T;  4NXN T;  2PG8 A;  2J4G A;  4YSX A;  3LSV A;  4KHP T;  4A5X A;  2Q9Q A;  4IHJ E;  3NKZ A;  4IDQ A;  1YKH B;  5CA1 E;  3UU6 A;  1LRZ A;  2LJL A;  4ZZC A;  2ZM6 T;  3PUY F;  4B3R T;  3ETV A;  4IIJ E;  2LRL A;  4KBM B;  3RQU A;  1IJ5 A;  3FZF B;  2W00 A;  3UFG A;  4CXX A;  5AQS B;  4P1N A;  2X68 A;  3ZMT B;  2WB5 A;  4PW8 A;  1XWM A;  5KMG P;  4HFH A;  1XDO A;  1XMQ T;  3LFM A;  4H63 H;  4EV6 A;  4DID B;  4ZI3 D;  3ZMZ B;  3VU7 H;  3UT5 E;  2A2F X;  4GYS A;  4PFP A;  1WR0 A;  3LG7 A;  5JR9 A;  3HA4 A;  1OED E;  5DQW A;  1D0Y A;  2NW8 A;  3L3P A;  3C4W A;  2VQE T;  3AEB A;  3EI0 A;  1SHZ C;  2XAF B;  2KIN B;  1VOM A;  2CA5 A;  2H3R A;  3NRX A;  2IIU A;  4U2Z A;  1MIW A;  2YN6 A;  3HKE E;  4QKN A;  2CWO A;  2K3W A;  2X66 A;  1ZV4 X;  5FL0 A;  3LBX B;  3CX8 B;  5JDF A;  2XPK A;  3K3N A;  3EUH A;  3AE3 A;  2CBI A;  2XQ4 A;  3IF8 B;  2LM2 A;  3IEE A;  2DNX A;  5JDQ A;  1D1B A;  3NRY A;  2XQ8 A;  3WAJ A;  3RRW A;  5LHG B;  4LF6 T;  2VL8 A;  3RPU A;  3ZMU B;  2VVN A;  3PTR B;  3AA0 B;  1HG2 A;  2CM0 A;  1YW0 A;  4L9I A;  3B5M A;  2MBG A;  3V5U A;  1VRB A;  2NTX A;  5LNK A;  2X9W A;  5ABG A;  5JDN A;  4AKG A;  1W0B A;  1OED A;  3AEG A;  4LF9 T;  4YHJ A;  2V6Y A;  3C4X A;  4TN7 B;  1LKX A;  3E0Z A;  4JI2 T;  3RKO A;  4I0U A;  2HPJ A;  4UR9 A;  3VKH A;  2PBI A;  3BQL A;  3CQG B;  2Z6E A;  3L09 A;  3J9X 1;  2WY2 A;  4YFS A;  4EAH A;  4JI0 T;  2YIN A;  3RLF F;  1BR4 A;  2VWA A;  2PFV A;  4IL4 A;  5HEG A;  3PE0 A;  5JQG E;  3FB2 A;  3Q9D A;  3UQ7 A;  4K0U A;  3PV0 F;  2LEH A;  4L0R A;  2LRK A;  5LJN A;  4HFV A;  4EIW A;  3N2O A;  3E08 A;  4DV4 T;  2CLY C;  4DUY T;  3OJA A;  2V7L A;  3AEA A;  2QRX A;  2UXC T;  4ASK A;  5C2T A;  1MIY A;  3C50 A;  4F8H A;  3FXD B;  4QH1 A;  4EZH A;  3EAB A;  3Q5W A;  3R6N A;  3P4W A;  2JMH A;  4LML A;  4KI0 F;  2BG9 C;  3ABV A;  5F8P A;  3N9L A;  2NW7 A;  3H3A A;  2X0Y A;  4NUV A;  2PJQ A;  3P8C D;  5C8Y E;  3FHN A;  3IBP A;  2CXD A;  2UXN B;  3OYZ A;  3ONX A;  3T1H T;  3HKD E;  5LGN B;  1HCI A;  3SFE A;  2RPA A;  4KHZ F;  4ZHQ E;  3OYX A;  4GKJ T;  2V7I A;  2B1E A;  2NR4 A;  5LJM A;  5AQL B;  4AKR B;  1HX1 B;  1UGO A;  1ZHC A;  5AQN B;  2WDQ A;  2DI4 A;  1W9R A;  1U4Q A;  2I0M A;  3I0Q A;  4WW0 A;  4IDP A;  1UCU A;  4H9Q C;  1YQ3 A;  4EXT A;  3B13 A;  2A9U A;  1OED C;  2W61 A;  4EOZ B;  3OVU A;  4GIW A;  3VKG A;  3LK2 B;  2DLR A;  4WNK A;  4BA9 A;  2XM2 A;  3UU3 A;  3VR8 A;  2KSR A;  3G06 A;  4H63 V;  5JVD E;  3FBZ A;  4UEL A;  2W4X A;  2XUE A;  4X64 T;  4DV6 T;  2VB6 A;  3LK3 B;  4C91 A;  1DU2 A;  4YSY A;  4DBR A;  3N5L A;  3EDU A;  1L0V A;  5ABE A;  1EZ3 A;  2WSS V;  5E0O A;  3U78 A;  1X79 A;  2I59 A;  4H9N C;  1IBM T;  3O9X A;  3U3I A;  2DHR A;  3CQC B;  5AQO B;  4ERR A;  3TKL B;  1T72 A;  1XZY A;  5FY1 A;  2GK9 A;  5GON E;  2NW9 A;  5FVL A;  2UU9 T;  1IJ6 A;  2KWH A;  3RI5 A;  5CB4 E;  3S4U A;  1MMN A;  2WBL A;  3QK6 A;  2JRK A;  4B3T T;  3AEF A;  2D0U A;  2MTQ A;  5JDM A;  3CQX C;  2XAH B;  2YOE A;  2V7M A;  1HFA A;  5AQI B;  2D0T A;  1V9D A;  5JDL A;  5ETW A;  4LF5 T;  3EAM A;  3GA8 A;  1XMO T;  3SS1 A;  1MMA A;  1I6Z A;  4HWH A;  2BG9 B;  3A8Y C;  2M6B A;  3UQ4 A;  3JC6 C;  4IRE A;  1YKE B;  3Q5X A;  5CGM A;  2EHO A;  3PUW F;  3I9Y A;  1IBK T;  1UUS A;  5LGT B;  2V7J A;  4E7S A;  5HWX A;  1ZOY A;  1HF8 A;  5LYJ E;  3RC8 A;  5FKY A;  5HCM A;  2WMN A;  3LK4 2;  3R84 B;  2IAK A;  3M3Z B;  2XTL A;  4H9R C;  2XJ7 A;  3BQK A;  2K24 A;  5CA0 E;  3V5S A;  4QX8 B;  3ZT6 A;  2V5D A;  2CHN A; 
#chains in the Genus database with same CATH homology
 3AAA B;  5DQW A;  2X67 A;  3F2E A;  1D0Y A;  2NW8 A;  3L3P A;  3C4W A;  4IE0 A;  4TUY E;  3AAI A;  5TAO A;  4JEU B;  2EHO B;  4TV9 E;  2Q9Q B;  2WWU A;  5FY0 A;  2CXL A;  2ODU A;  3K3O A;  2YEV C;  1SHZ C;  5FXX A;  2ACX A;  3N2G E;  2XAF B;  4HTE A;  2VK9 A;  4G63 A;  2KIN B;  1VOM A;  2CA5 A;  3N9Q A;  2H3R A;  3NRX A;  2LSG A;  3CML A;  4AKH A;  5FY7 A;  3JC6 D;  4EYU A;  5LHH B;  4UXN B;  1MIW A;  3HKE E;  4QKN A;  4O2A E;  2K5B B;  2CWO A;  3C98 B;  5HXC A;  2X66 A;  3CWZ B;  1ZV4 X;  4P09 A;  4HEA A;  3N2K E;  3LBX B;  5L3C B;  2RA1 A;  3CX8 B;  5JDF A;  4DMW A;  5L3E B;  2DWG A;  4TX5 A;  4ZS3 A;  4I55 E;  4QX7 B;  3HR0 A;  3K3N A;  2CE7 A;  3EUH A;  4KMC A;  3AA1 B;  4WBN E;  3KVA A;  4MBQ A;  1HTJ F;  4CXY A;  2XQY A;  3GMI A;  2CLY B;  2KXP B;  3IF8 B;  3PUG A;  4O4I E;  5LA6 E;  3IHR A;  1KNZ A;  3OBV E;  5L2L A;  3IEE A;  2DNX A;  5JDQ A;  2HH7 A;  1D1B A;  3NRY A;  2BVM A;  2KLQ A;  2SPC A;  3GN5 A;  2NWB A;  4DMV A;  5HYA A;  3AA7 B;  3WAJ A;  3RRW A;  5LHG B;  3N9O A;  4MFR A;  2C5I T;  2LOP A;  2VL8 A;  4QWN B;  4YJ3 E;  3ANW A;  3RPU A;  5AFU L;  3LJC A;  5JR9 B;  3ZMU B;  3MA9 A;  1H7C A;  3PTR B;  4CI1 B;  3ZCI A;  4ISS A;  3AA0 B;  1HG2 A;  2X9Y A;  1Z0P A;  4U72 A;  3M65 A;  3T8O A;  4O4H E;  2CM0 A;  1YW0 A;  4L9I A;  4DO0 A;  3ZN1 B;  2J1D G;  4X20 E;  2X51 A;  3UUM A;  4PJM A;  2CMR A;  2MBG A;  3V5U A;  2BVL A;  4E7Z A;  1VRB A;  2LE8 A;  2NTX A;  5LNK A;  2X9W A;  5J2T E;  4EZ4 A;  2W0G A;  4UV8 B;  4F6R C;  5L3B B;  2LM9 A;  1FEW A;  3H37 A;  5JDN A;  4HGA A;  4AKG A;  3BQI A;  2XHE B;  5HXH A;  2LSK A;  3CVR A;  4IE7 A;  4UF0 A;  4YHJ A;  5IHY A;  1G73 A;  4PK5 A;  3KVB A;  1SA0 E;  4MHC A;  4HKA A;  3C4X A;  3AVS A;  2JQQ A;  4QXB B;  4TN7 B;  1LKX A;  4IST A;  3E0Z A;  3ETU A;  3RKO A;  2HPJ A;  3MXZ A;  3VKH A;  1ZKE A;  3F57 A;  1G8X A;  2PBI A;  1MMG A;  1NWM X;  1UX5 A;  3BQL A;  3GWH A;  4PNI A;  3KDS E;  3UUL A;  3C51 A;  3CQG B;  3GN5 B;  2Z6E A;  3O1I A;  3L09 A;  3MAC A;  4ZI7 E;  3ZC0 A;  2LT3 A;  3J9X 1;  2MOZ A;  2YK0 A;  4YFS A;  4CQI A;  2X9X A;  3EDV A;  4EAH A;  5BMV E;  2C5K T;  4PFO A;  2YIN A;  3ANW B;  3EVY A;  3PUR A;  4Z8X A;  1BR4 A;  1BR1 A;  2VWA A;  4DVD A;  2PFV A;  5HXE A;  4OFZ A;  3PE0 A;  2LHN A;  4PAG A;  5JQG E;  3FB2 A;  3RYH E;  3Q9D A;  3OKQ A;  5J2U E;  4ILU A;  5LOV E;  4K0U A;  2LEH A;  4L0R A;  2BDE A;  4UVA B;  4IE6 A;  4AQF A;  3B57 A;  3NBX X;  1NAF A;  2LSI A;  4ZI2 C;  5LJN A;  1OWA A;  4HFV A;  5FYM A;  3MZK B;  2NTY A;  4EIW A;  3N2O A;  5FXZ A;  5KDM C;  3E08 A;  2X9H A;  4JLE A;  3RYI E;  2LOS A;  5JH7 E;  2CLY C;  4UEM A;  3CX7 B;  2C0S A;  3OJA A;  2V7L A;  4UF0 B;  2N1G A;  4IDZ A;  4J2C A;  1D0Z A;  3PU8 A;  4I43 B;  2G0U A;  5L3D B;  1BR0 A;  3ZYK A;  5EZY E;  4PJL A;  4CZZ B;  4ASK A;  1LVF A;  3HKC E;  1KK7 A;  4QXC B;  4OYK A;  4AI6 A;  2C5J A;  1MIY A;  1U5P A;  3C50 A;  2H7V C;  3FXD B;  4AXP A;  3KFW X;  4EZH A;  3Q5W A;  4IGU A;  3R6N A;  5JRC A;  3ZYM A;  1MIV A;  3ZN0 B;  1US7 B;  2JMH A;  2LSJ A;  4PJJ A;  2HPL A;  2RP4 A;  5LBM A;  4H9S E;  2W62 A;  2L9Q A;  4U74 A;  2P9B A;  5JRE A;  4TZ4 C;  5F8P A;  3N9L A;  2NW7 A;  1OXZ A;  3H3A A;  5L3F B;  5DJQ C;  4L5G A;  1IAP A;  4NUV A;  2E9X C;  2PJQ A;  3CX6 B;  3P8C D;  2W63 A;  5LCY A;  1QUU A;  3ZJ1 A;  4IE4 A;  4P0B A;  3ZCJ A;  5C8Y E;  4PJN A;  3FHN A;  3O4X E;  3PUS A;  2UXX B;  1D0X A;  2IC6 A;  3UFE A;  5LP6 E;  1FIO A;  3Q2M A;  3IBP A;  2ZM2 A;  3CPZ A;  3O1H A;  4H9O C;  4JEH B;  5HAX A;  2CXD A;  2L3L A;  2A72 A;  2UXN B;  1WRD A;  5LBQ B;  3OYZ A;  3VHL A;  2Y6X A;  3ONX A;  1E1H B;  2D2S A;  2N2N A;  3HKD E;  1YD8 G;  3ZYL A;  2CEA A;  5LGN B;  1HCI A;  5H6Q B;  2KT9 A;  4I4T E;  3P7I A;  4MLK A;  2ZMA A;  1CUN A;  3KBT A;  4ZHQ E;  3OYX A;  5A1L A;  2KWI B;  2V7I A;  2B1E A;  2A3D A;  5F3J A;  3AB3 B;  4ZI2 D;  5LJM A;  2E8I A;  4CXW A;  4GYR A;  3RX6 A;  4AKR B;  2Y48 B;  4X1Y E;  4FJO A;  4DBQ A;  3ZJ2 A;  3ZPO A;  1WYC A;  5JRC B;  5HWY A;  2ODV A;  1ZHC A;  3MKD A;  4TV8 E;  4EB6 E;  1LVK A;  3SOL A;  2VKJ A;  4H9P C;  2DI4 A;  2K48 A;  4GK5 E;  1U4Q A;  3I0Q A;  4WW0 A;  4FI5 A;  3ZC1 A;  4CI2 B;  4JUY A;  5FP3 A;  1WYB A;  4ANJ A;  3C64 A;  3PU3 A;  4KP3 C;  4UVB B;  5L3G B;  2EHO C;  4NUU A;  2CXF A;  2Q9Q C;  5EK4 A;  1QSD A;  1UCU A;  4H9Q C;  4WBO A;  4EXT A;  4OYJ A;  1AJ3 A;  4OK0 A;  4QXH B;  4EYY R;  1MND A;  1ZEE A;  4CI3 B;  3FBL A;  3B13 A;  2W61 A;  3SWH A;  4EOZ B;  4P0A A;  4PK6 A;  3D0T A;  1WLX A;  2XAG B;  4GIW A;  1HS7 A;  1MNE A;  3VKG A;  4AQG A;  2IC9 A;  3LK2 B;  3RRC A;  3O1J A;  2WAU A;  2D5U A;  2DLR A;  2E9X D;  3N9N A;  4WNK A;  3AA6 B;  4BJM A;  4BA9 A;  2KND A;  4ZS2 A;  3ZEF B;  4UV9 B;  3MJX A;  2VKH A;  3QUJ A;  3AAE B;  4X1K E;  4H63 V;  5JVD E;  2YU1 A;  3CKD A;  3F31 A;  3FBZ A;  4UEL A;  2WM9 A;  2XUE A;  2VAS A;  5IYZ E;  4ADZ A;  2V1D B;  2VB6 A;  3LK3 B;  5M4Y A;  5JDH A;  1UX4 A;  4X1I E;  2N9D A;  4C91 A;  4DBR A;  5EK2 A;  2DCF A;  4O4L E;  3N5L A;  3EDU A;  1EZ3 A;  5LHI B;  2WSS V;  5E0O A;  2JPF A;  3U78 A;  1B7T A;  5EK3 A;  2ZLY A;  1X79 A;  2I59 A;  4H9N C;  4MAL A;  4XZC A;  3O9X A;  4XBF B;  3U3I A;  2DHR A;  3CQC B;  2QA7 A;  4ERR A;  1MMD A;  3TKL B;  3WAK A;  3UUN A;  5JR9 C;  1O3X A;  3K3Q C;  4V1A v;  2E9X A;  2H7O A;  5LGU B;  5FY1 A;  4YJ2 E;  4UIG A;  4C90 A;  2L8K A;  2GK9 A;  3KV5 A;  3I0O A;  4AQF C;  2LSY A;  5GON E;  4XAX B;  2NW9 A;  1S94 A;  4HN9 A;  2JMK A;  1IJ6 A;  2KWH A;  5FNV E;  2VKD A;  5CB4 E;  2ES0 A;  3S4U A;  4BAY B;  3N9M A;  3A5X A;  1MMN A;  2WBL A;  3QK6 A;  2JRK A;  2YU2 A;  4ZOL E;  2Y8D A;  3QC9 A;  3W15 B;  5HXR A;  3PUA A;  3ESL A;  1FMW A;  3K8P C;  4QHO A;  2D0U A;  5H6R B;  3FXE B;  2EHO D;  4ZI3 C;  4HE8 A;  2XAJ B;  3DJB A;  2Q9Q D;  5J1G A;  1IZN B;  2MTQ A;  3HI2 A;  3I9W A;  5JDM A;  3CQX C;  4O2B E;  3BK9 A;  2XAH B;  4GK0 E;  4B6X A;  2ZM0 A;  5KX5 E;  3AVR A;  2V7K A;  2V7M A;  1HFA A;  3C4Z A;  4PK4 A;  3DTO A;  2D0T A;  3DP7 A;  4I50 E;  2K9A A;  4UVC B;  2M67 A;  1V9D A;  5JDL A;  5ETW A;  5HXS A;  4YLH A;  4KUM B;  2IW5 B;  2ZM8 A;  3HKB E;  3GA8 A;  2NP9 A;  2CCQ A;  2BZB A;  3SS1 A;  2CWY A;  1MMA A;  4O4J E;  1WR6 A;  3UTK A;  4GOU A;  3RYF E;  4BJN A;  2NOX A;  2XAQ B;  3KV4 A;  3KIN B;  3JC6 C;  2PG8 A;  1YKE B;  3Q5X A;  2E9X B;  2KZ7 B;  3ZMS B;  3RC3 A;  2JJ9 A;  3PDY A;  4M1P A;  2EHO A;  5DAB A;  5ADX L;  2X0L B;  4IE5 A;  2Q9Q A;  1HG5 A;  2VKO A;  4IHJ E;  3ZLI A;  3I9Y A;  1Y64 B;  1T98 A;  2KMF A;  4OHF A;  1YKH B;  5FMN A;  5LGT B;  5CA1 E;  2V7J A;  4E7S A;  5HWX A;  3E22 E;  3NZQ A;  4AKL A;  1D1C A;  1LRZ A;  2LJL A;  2DWK A;  5DQV A;  3MK7 C;  3ETV A;  1HF8 A;  4IIJ E;  5LYJ E;  4KBM B;  3RC8 A;  1IJ5 A;  3KV9 A;  2WMN A;  5LG4 A;  3RH3 A;  2W00 A;  1FMV A;  2LHR A;  3LK4 2;  3LBX A;  5FXV A;  3R84 B;  4DND A;  2OA5 A;  3PUQ A;  5LXT E;  4G2A A;  3NZP A;  1D1A A;  4CXX A;  2IAK A;  2V26 A;  4O8S A;  1S35 A;  2X68 A;  3N9P A;  3SRZ A;  2QGS A;  3HL6 A;  3ZMT B;  4A56 A;  4PW8 A;  2XTL A;  2XAS B;  1HX8 A;  3ZMV B;  5KMG P;  2MYS A;  4H9R C;  3UUX B;  3LFM A;  4H63 H;  5JDG A;  3BQK A;  2K24 A;  4ZI3 D;  3RYC E;  3VU7 H;  3ZMZ B;  5CA0 E;  4AKI A;  3V5S A;  3UT5 E;  4QX8 B;  3KV6 A;  2A2F X;  4GYS A;  4N78 D;  3KBU A;  1BR2 A;  5FXW A;  3I1A A;  2WMO A;  4PFP A;  3WI3 A;  3LG7 A;  3J7Y q;  5JR9 A;  3HA4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...