1YD8G

Complex of human gga3 gat domain and ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
GIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport, chromosomal protein
molecule keywords UBIQUIN
publication title Structural mechanism for ubiquitinated-cargo recognition by the Golgi-localized, {gamma}-ear-containing, ADP-ribosylation-factor-binding proteins
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yd8G00
2N2NA 1X79A 1OXZA 1WRDA 1WR6A 1NAFA 1O3XA 1NWMX 2N9DA 1YD8G
chains in the Genus database with same CATH superfamily
3ZJ2A 5JTGA 5JR9A 4EZHA 2BS2A 2LSYA 3LG7A 3PDYA 4TWHA 5AQSB 3AAIA 2L9QA 2Y48B 3C51A 1IZNB 2UXNB 3MXZA 3EUHA 4TV8E 4YY3T 2QYWA 5JR9C 3VKHA 1S35A 2FJAA 3AA7B 2KXPB 4JV5T 3KDSE 3PUAA 3HR0A 5CGMA 2RA1A 3HKCE 3OYXA 2WY2A 2WDQA 2ZLYA 3DJBA 4NUVA 2W00A 3N9QA 3SRZA 2R6GF 5ABHA 1MIYA 2X51A 1UGOA 3IHRA 5HCJA 3CX6B 3ANWB 4EEBA 2CRBA 4GKJT 2XAGB 1YQ3A 2E9XB 4PFOA 4MHCA 1UX5A 2NTYA 4OX9T 1LKXA 2YOEA 1UK5A 3N2KE 1HTJF 4JI5T 3X1DA 2NP9A 3C4WA 2XSBA 3L3PA 2BKPA 5L3CB 4LFBT 2D0TA 2WSSV 4ZS2A 4CXYA 4KI0F 5HEUA 3RIFA 4AQFC 4J2CA 1OEDA 1NENA 1NWMX 2HN2A 4ZI3D 5HWYA 1M7KA 1MNEA 4NIQA 3ZLIA 1MMAA 4DMWA 3UFEA 2WP9A 3L09A 2C5JA 3PE0A 3ZYLA 4CQIA 3JAEA 4IDNA 2NOXA 3ONJA 3OPCA 1HG2A 3NVOA 2QVAA 4EEDA 2KZ7B 3IF8B 4ZOLE 3L39A 3OYZA 3I9YA 5F5WA 3T1YT 3ZJ1A 5KMGP 2H7VC 2J47A 2K3WA 3A7MA 4YHJA 3N5LA 1IBMT 2KLQA 3ZEFB 2LT3A 5J0ZA 4OYKA 2X9YA 2B76A 4UF0A 4DR6T 3OBVE 2EHOC 4IL9A 2J1DG 3ZCIA 2UUBT 1T8BA 3EHZA 5AQFB 2CHOA 4PK4A 5LMNT 2OV9A 4CN6A 4DBRA 5FY1A 3KV9A 5AQJB 3AB3B 3VR8A 2W63A 3RC8A 5ABGA 3I1AA 3CQXC 1JNRA 3CK6A 1B7TA 4DR5T 4K0UA 2X0HA 4OYJA 4OK0A 2Y8DA 4ADZA 4EAHA 1D0YA 2IUBA 4GK5E 1HX8A 3PU8A 3M3ZB 3I0OA 3AVRA 1D1CA 5HCMA 4X65T 2YDRA 4NUUA 2I6HA 1M62A 1FMVA 5FXZA 5HWXA 3I0QA 3O4XE 5LG3A 3CIRA 2VWAA 3FBLA 3Q9DA 3HI2A 4X66T 5HXHA 3HA4A 5LG4A 3NZQA 3U3IA 4TWFA 4I55E 3RYFE 3UUNA 3TLUA 5FVLA 4EYUA 3RRWA 2XHEB 1OXZA 1D0XA 2DNXA 4OFZA 2JMHA 1J5WA 3RC3A 4LF4T 2Z6EA 2V1DB 3KV5A 5JDGA 5LBMA 1QUUA 5AQKB 1IJ5A 2XQ7A 1Y01A 2MBGA 1NAFA 2XQ3A 2P9BA 2LSJA 1MMDA 1IBLT 5HXEA 1J1JA 3RPUA 1G73A 4PJNA 5FY7A 3NRXA 4IE0A 1N32T 4DBQA 5AFUL 1US7B 3C98B 3O1IA 3EABA 2YEVC 1HCIA 2X66A 2YKSA 3N9MA 5H6QB 5AQHB 2LKHA 2UXXB 2K24A 2A9UA 5HXCA 1KF6A 5LYJE 5CA1E 2BG9E 2WU5A 5AQOB 3SWHA 2CBJA 4Z8XA 4F8HA 4KUMB 3ZSSA 3RLFF 2W62A 3Q5EA 3UU3A 2UXDT 4DR3T 3Q5XA 3SS1A 4XBFB 4WZXA 2CE7A 2IDOB 4HGAA 4O4LE 3MA9A 4YLHA 2BS3A 3AVSA 4U7IA 3V5SA 3P4RA 4PAGA 4ZS3A 3OVUA 3HKBE 1KK7A 2WB5A 2XAFB 4JI1T 4UVCB 3CKDA 2VL8A 2CXLA 2WBLA 3JCFA 2L8KA 1WCRA 3RH3A 5F8PA 2XQ4A 2XPKA 4HFVA 1AJ3A 2W2UA 3ZMUB 2BG9B 1BR2A 3BQKA 1BR4A 4WYVA 2CBIA 1XNQT 2YDSA 3RGLA 1HF8A 3H3AA 4O2AE 2ACZA 3LSVA 2KWIB 3N9OA 2CWYA 3TLWA 2LLYA 3FZMB 4LMJA 4IHJE 2LHNA 3DTOA 3PJAJ 1D0ZA 3QB5K 4DR7T 1IBKT 2H3RA 4ILUA 3PUZF 5DQVA 2XTLA 1VCSA 4CXXA 4JLEA 2D2SA 3O1JA 2FJEA 2VVNA 3H3MA 2VASA 4HTEA 4DR2T 5FKYA 4AI6A 4U33A 3BQIA 2Q9QD 3GA8A 5AQVB 3RX6A 3RQUA 3ANWA 3FZLB 3TLTA 3LDQB 3ZC0A 4I43B 2E9XA 2IAKA 5J2TE 4DUZT 2D9DA 2V7MA 1LVFA 4HWHA 2Q9QB 5LP6E 1JNZA 4ILCA 5HEJA 1S94A 2M6BA 3Q5WA 1HG5A 3RIUC 2VKDA 4AXPA 4HFIA 3KBUA 4JYAT 2UUAT 1T98A 3F57A 4LF7T 5BMVE 5L3DB 4P0BA 5M4YA 2IMLA 3PUXF 1FIOA 2BS4A 2XZEA 4MBQA 1W09A 3PUVF 3KINB 4YSXA 2V8SV 1WYBA 2AE9A 3AEBA 2H89A 5ADXL 4QX8B 2WU2A 3UQ4A 5EK4A 4YTMA 1OWAA 5AQUB 2HHHT 1XDOA 1X79A 3PJAA 2ODVA 3UT5E 3JC6C 2CMRA 4EV6A 3H37A 4U3CA 4IREA 3VHLA 2PBIA 4IDPA 2FUPA 4QX7B 4JEHB 4CI1B 1U4QA 5JVDE 2K5BB 3K8PC 4PK6A 4AQFA 2CWOA 1GQEA 5FL0A 3KVAA 2ZMAA 3SOLA 3VU7H 1QLBA 4PFPA 3U78A 4KMCA 4KHPT 5EK2A 3EDUA 4U2YA 1SA0E 4G2AA 2I0MA 3ZN0B 2L3LA 2ZM6T 4GOUA 2XSAA 2XQ5A 3HL6A 2QA7A 2LOPA 2PG8A 3ONLC 2DL1A 2KT9A 3AE8A 2CEAA 5L3GB 3K3QC 3JAFA 4ANJA 2FBWA 4EIWA 2BBHA 1MMGA 2CM0A 1R8IA 3AAEB 4YTPA 1HNXT 3ZMTB 1Z8UA 3AXJB 4AKLA 1OEDE 4UIGA 3VR9A 2XAHB 1E7PA 4AIUA 3TLVA 1XZYA 2EHOA 1U5PA 3UUBA 4YJ2E 3V5UA 3FB2A 3EVYA 4X1YE 3RYHE 5J2UE 2BZBA 4IDZA 4PK5A 5JDMA 5FXVA 3KVBA 2W4XA 2YK0A 4H63V 1XMQT 2JJ9A 2V26A 3C4ZA 3E22E 4COFA 5JREA 4HFEA 4XZCA 4X1KE 3RKGA 3ZYMA 1UUSA 4DVDA 4BJNA 3EI0A 1D1BA 3J7Yq 3PURA 3B5MA 2V6XA 5JRCA 3A8YC 4EB6E 3MACA 3O1HA 2WZIA 4K0KT 3AA1B 4EXTA 1ZV4X 3FHNA 2VKHA 5LHHB 2XM1A 5CJ5A 4CZZB 4YSYA 4QH1A 4UELA 3ZC1A 5JDHA 3K3NA 3AEAA 2UUCT 4IE7A 4F6RC 1CHUA 3CWZB 4B3TT 3MJXA 3UULA 3KBTA 3AE4A 2CA5A 3GN5B 4E7ZA 2WCAA 3AE2A 1VOMA 4YTNA 4FI5A 3SFDA 1HNZT 1NEKA 2VL0A 5CB4E 4JI7T 5CFBA 1HX1B 3ZYKA 4NXMT 4ASKA 3OKQA 3AE5A 3PU3A 4ZI2C 1WR0A 4UVBB 3QK6A 2MTQA 4HFBA 1WYCA 4UV9B 5C3JA 3SFEA 5JH7E 3QOFA 1L0VA 2IC6A 3UFGA 5EK3A 1FEWA 2YU1A 3J9X1 1Y64B 2Y6XA 4P1NA 3EDVA 2XY8B 2WAUA 2WWVA 3F2EA 2DCFA 3QC9A 4C90A 3LFMA 3VRAA 5L3FB 3ETUA 4UR9A 2LE8A 4I50E 4P0AA 2BG9A 2NW8A 2X0LB 1E1HB 3AA6B 3IA3A 5LB7B 2VQFT 4AKGA 4JI3T 3AEEA 3UU8A 3QUJA 4HFHA 2IHR1 4QH5A 5ABFB 4B3RT 2B1EA 1I6ZA 2FJBA 3NBXX 3ZMZB 2E2AA 3RI5A 2JRKA 2J4GA 2BG9C 4H9RC 4PJMA 1VRBA 1W0BA 2V6YB 4U7YA 5LCYA 5F3JA 4YJ3E 4YXDA 5AQTB 4KBMB 2NW9A 1HS7A 1ZOYA 2KSRA 4TNWA 5LGNB 1WFDA 3CPZA 3HKEE 1Z0PA 4KP3C 2V5CA 1XNRT 3LJCA 1HFAA 2ACXA 5LJMA 3ZT6A 5LNKA 4H9QC 4L0RA 4QWNB 2LJLA 4DR1T 2ZM8A 4HWIB 1FJGT 4DV0T 4PJJA 2C5KT 4BJMA 2UU9T 4Z90A 4LFAT 4DV6T 2IIUA 2FJDA 5LGTB 3P7IA 2N1GA 3FXDB 2MOZA 2WMNA 4HWFA 2X67A 5ABEA 5E0OA 5FY0A 4O4JE 2UXBT 1MMNA 5EZYE 3EAMA 3NWIA 1VCTA 1SE7A 1N36T 4NXNT 1XDPA 3OTOT 4AQYT 4H63H 4TN7B 2Q9QC 2V7JA 4HKAA 5LXTE 2D5UA 3AE9A 1BR1A 4GKKT 3AE1A 5JDLA 4GIWA 4M1PA 5A1LA 2JQHA 5LMUT 2H88A 2LKGA 3M65A 4U2ZA 5KDMC 3BQLA 3G06A 4HE8A 1IAPA 2NR4A 3RRCA 4A97A 4LF9T 2DLRA 5AQPB 2IW5B 4H9OC 3C64A 1HNWT 3FXEB 5FP3A 1V9DA 4DR4T 4AKRB 2KMFA 2YINA 2VQET 4DV4T 3UTKA 4JEUB 3S4UA 2IC9A 3CQCB 2X9WA 4LMLA 3ZCJA 1UCUA 5DABA 3FBZA 5FMNA 2LHRA 3PUQA 4A5XA 2CPTA 3LBXB 1WR6A 3Q5DA 3RIUA 2X0YA 5C8YE 4H9PC 1O3XA 4TWDA 3PUSA 1W0AA 5FNVE 4EZ4A 4UVAB 2OA5A 4PW8A 3UUXB 3P4PA 3CVRA 3ZKRA 4HN9A 4EOZB 1CUNA 3MZKB 2CLYC 4TZ4C 2E5LT 4L5GA 4B6XA 4ZZBA 1LRZA 2HH7A 4ZHQE 2XM2A 2MYSA 3W15B 1XMOT 4IGUA 1T72A 2YU2A 2W0GA 4A98A 2F4VT 5JDQA 5LHIB 1H7CA 5HXRA 3RIAA 1MNDA 5FYMA 4Z91A 3AAAB 1UURA 5KX5E 2VKOA 2W66A 1QSDA 2XQYA 4OHFA 2G0UA 2LM9A 2LRLA 4O2BE 2E8IA 3JADA 4ISSA 4DO0A 4H9SE 3AE3A 5HXSA 2QGSA 3AXJA 3CMLA 4IT4A 3AEDA 4ZI3C 5HEGA 1ZHCA 2CXDA 5JDFA 2DWGA 2LRKA 2KINB 2E9XD 2PTFA 3ABVA 1D1AA 2NWBA 2ODUA 3DP7A 3RYCE 1LVKA 2JIWA 4DV1T 4XAXB 2CLYB 3E0ZA 4LF5T 1E2AA 4YSZA 3UU5A 4JI8T 4C91A 4AQGA 2XQ8A 4JI6T 4AKHA 4HWDA 4DNDA 1KFYA 2LSIA 2WMOA 3R6NA 2BKOA 5H6RB 3AECA 4DMVA 2LSKA 4UV8B 4B3MT 3UU4A 3QB5A 2HPJA 4QXCB 4MLKA 1KNPA 4G63A 4QHOA 4ZEYA 1YD8G 5LGUB 3C4XA 5AQGB 3AEFA 2D0UA 3JC6D 4HEAA 4O8SA 4I4TE 3NZPA 2NTXA 5JR9B 2X9HA 2CCQA 4IL4A 2ZM0A 2RP4A 3P50A 3P8CD 1I94T 4N78D 1OEDC 3GN5A 2VURA 2JMKA 3AE6A 2K9AA 4AISA 4IIJE 3IBPA 1DU2A 4X1IE 3VRBA 5C2TA 2XASB 3NKZA 1WLXA 2BBJA 3MK7C 2YN6A 5FVKA 4JI2T 3LK3B 4DUYT 4ZI7E 2N9DA 3R84B 3VKGA 4CI3B 4GYRA 1X9BA 3KFWX 2X68A 3N9NA 5LBQB 5CA0E 4TV9E 3FZKB 4KHZF 3C50A 5LOVE 4GYSA 2MPKA 2XUEA 1MIVA 4QH4A 3UUMA 2A2FX 3WAJA 1ZKEA 5IWAT 2XQAA 3UQ7A 3K1SA 4HFCA 2BVLA 4A56A 2KNDA 3P4WA 4UEMA 5AQQB 5AQNB 4PJLA 2HN1A 2VK9A 2WWUA 2AXDS 5HEHA 3HKDE 4YHHT 2SPCA 1YKEB 1OEDB 1HR0T 2VVSA 5ABFA 2V5DA 2PJQA 5AQRB 4CN4A 2M67A 3RYIE 2JQKA 3PTRB 5IYZE 2W61A 3A5XA 2V6YA 2X9XA 1YKHB 1N33T 1SHZC 5LHGB 4X64T 4NPPA 5JDNA 2GK9A 4IDOA 3ONXA 2CXFA 4B3ST 2M6IA 2YDQA 3D0TA 2EHOD 4ZZCA 3N2OA 1ZEEA 4IE5A 4X62T 3PUWF 2N2NA 1UX4A 3TKLB 2XQ6A 3PV0F 4TNVA 3AA0B 4IE4A 2A3DA 2EHOB 5AQLB 4TUYE 5HEOA 5IHYA 2LM2A 3O9XA 5DQWA 3IEEA 5FL1A 4X20E 4ISTA 3PUYF 2V7IA 4AKIA 2E5VA 1G8XA 4WBNE 2VKJA 4UF0B 1KEYA 5JQGE 5FXWA 4DIDB 1EZ3A 3T1HT 1W9RA 4CI2B 4Q25A 4KX6A 4H9NC 3WI3A 4DV3T 2WDVA 1XWMA 5L3BB 3I9WA 3ZT5A 5JRCB 4HFDA 2C0SA 4O4HE 2DWKA 2JQ9A 3TLSA 2WM9A 2WZHA 2WDRA 4U31A 4I0UA 5KXJA 5HYAA 4QXHB 4X5TA 4CN1A 4MALA 3WAKA 4ZI2D 3ZMVB 4P09A 4TX5A 2J62A 3L8RA 1WRDA 2H7OA 3CQGB 5AQMB 1ZP0A 4YT0A 3B13A 2VB6A 2CHNA 2I59A 4MFRA 4JUYA 4JI0T 4ERRA 4FJOA 5L2LA 1YW0A 5IUXA 3FZFB 2UXCT 4EGWA 4GK0E 3B57A 3RHWA 4ILAA 1J5ET 2DI4A 3RF1A 5L4EA 4BA9A 4LF6T 2W67A 5J1GA 2JQQA 3CX8B 2K48A 3LBXA 3ETVA 2KWHA 4ZXLA 5HAXA 4JBWF 1YQ4A 4YFSA 3N9PA 2Q9QA 3BK9A 2DHRA 5GONE 3CX7B 3GWHA 2XAQB 4DV2T 1IJ6A 3ESLA 4LF8T 2XQ9A 3N9LA 5AQIB 4IDQA 1N34T 3F31A 5TAOA 3N2GE 4QXBB 3ZPOA 2MAWA 3GMIA 2XAJB 4WW0A 1BR0A 4PNIA 3K3OA 5DJQC 2ES0A 2V7LA 3ZSTA 2LEHA 2RPAA 2C5IT 2HPLA 4UXNB 3NRYA 1T7SA 5LA6E 4O4IE 5LJNA 1FMWA 4U74A 3UU6A 4QKNA 3T8OA 3PUGA 3ZT7A 4DV5T 4WNKA 2BKNA 2LSGA 3FZHB 1MIWA 3AE7A 2PFVA 4JI4T 4V1Av 3KV4A 5ETWA 3LK42 3LK2B 1YXRA 3ZN1B 4DV7T 5L47A 4EYYR 3P4SA 3QNUA 4L9IA 2JPFA 5L4HA 2NW7A 4BAYB 3RQWA 4LMKA 4U72A 5L3EB 5FXXA 2WS3A 3KV6A 3E08A 4CXWA 3RKOA 3MKDA 2LOSA 4ILBA 2BVMA 5BR8T 4LFCT 2WQYA 1KNRA 3OJAA 3Q2MA 4IE6A 2BDEA 2E9XC 2XJ7A 2A72A 2QRXA 4WBOA 1SUMB 2V7KA 4E7SA 2OLTA 1KNZA 2ZM2A 3P4QA 3ZMSB 4HWCA 3AEGA
chains in the Genus database with same CATH topology
2IC6A 3ZJ2A 2XASB 5EK3A 5JR9A 1WLXA 4EZHA 1FEWA 2LSYA 3MK7C 3LK3B 3LG7A 3PDYA 2YU1A 3J9X1 4ZI7E 2N9DA 3R84B 3VKGA 1Y64B 2Y6XA 3EDVA 4CI3B 4GYRA 1BR2A 2WAUA 3AAIA 3BQKA 3F2EA 2DCFA 3KFWX 3QC9A 1BR4A 2L9QA 4C90A 3LFMA 2X68A 3N9NA 2Y48B 3C51A 5L3FB 3ETUA 1IZNB 2UXNB 5LBQB 3MXZA 5CA0E 3EUHA 4TV8E 2LE8A 4TV9E 5JR9C 1HF8A 3H3AA 3VKHA 1S35A 4I50E 4P0AA 3AA7B 2KXPB 2NW8A 2X0LB 3KDSE 3PUAA 1E1HB 3AA6B 3C50A 3HR0A 4O2AE 2RA1A 3HKCE 5LOVE 3OYXA 4GYSA 4AKGA 2ZLYA 3DJBA 2KWIB 3N9OA 4NUVA 2W00A 2XUEA 3QUJA 1MIVA 2CWYA 3N9QA 3UUMA 3SRZA 1MIYA 2B1EA 2X51A 3NBXX 3IHRA 2A2FX 3WAJA 3ZMZB 1ZKEA 2JRKA 4IHJE 2BVLA 2LHNA 3CX6B 3ANWB 3DTOA 4H9RC 4A56A 2KNDA 1D0ZA 4PJMA 1VRBA 4UEMA 4PJLA 2XAGB 2VK9A 2WWUA 2H3RA 4ILUA 2E9XB 5LCYA 5DQVA 2XTLA 3HKDE 4PFOA 4CXXA 4MHCA 1UX5A 2NTYA 2D2SA 1LKXA 4JLEA 5F3JA 3O1JA 2SPCA 1YKEB 3N2KE 4YJ3E 2VASA 4HTEA 1HTJF 4KBMB 4AI6A 2NW9A 2NP9A 1HS7A 3BQIA 3C4WA 2PJQA 2Q9QD 5LGNB 3GA8A 3CPZA 3HKEE 3RX6A 1Z0PA 2M67A 3ANWA 3RYIE 3L3PA 4KP3C 5L3CB 2D0TA 3LJCA 2WSSV 3PTRB 5IYZE 2W61A 4ZS2A 4CXYA 3ZC0A 3A5XA 4I43B 2E9XA 1HFAA 2IAKA 2ACXA 5LJMA 5J2TE 5LNKA 4AQFC 2X9XA 4H9QC 4L0RA 1YKHB 4QWNB 1SHZC 2LJLA 4J2CA 5LHGB 5JDNA 2ZM8A 1NWMX 2GK9A 2V7MA 1LVFA 4ZI3D 3ONXA 2CXFA 5HWYA 2Q9QB 4PJJA 2C5KT 3D0TA 2EHOD 1MNEA 4BJMA 5LP6E 3ZLIA 1MMAA 1S94A 4DMWA 5LGTB 3UFEA 3N2OA 1ZEEA 3Q5WA 4IE5A 1HG5A 3L09A 3P7IA 2N1GA 3FXDB 2MOZA 2WMNA 2N2NA 1UX4A 2VKDA 3TKLB 4AXPA 3KBUA 2C5JA 3PE0A 3ZYLA 4CQIA 2X67A 3AA0B 1T98A 2A3DA 4IE4A 2EHOB 5E0OA 3F57A 5FY0A 4O4JE 4TUYE 2NOXA 5BMVE 5IHYA 5L3DB 1MMNA 3O9XA 4P0BA 5M4YA 5DQWA 3IEEA 1HG2A 4X20E 4ISTA 5EZYE 1FIOA 2V7IA 4AKIA 2KZ7B 3IF8B 4WBNE 1G8XA 4ZOLE 2VKJA 3I9YA 3OYZA 4MBQA 3ZJ1A 4UF0B 4H63H 4TN7B 2Q9QC 5JQGE 2V7JA 5FXWA 5KMGP 2H7VC 3KINB 1WYBA 4HKAA 4YHJA 1EZ3A 5LXTE 2D5UA 4CI2B 3N5LA 2KLQA 4QX8B 5ADXL 1BR1A 5EK4A 4H9NC 3WI3A 3ZEFB 1OWAA 2LT3A 5JDLA 4GIWA 4M1PA 5A1LA 4OYKA 5L3BB 1X79A 2X9YA 3I9WA 5JRCB 2ODVA 3UT5E 3JC6C 3M65A 4UF0A 2C0SA 4O4HE 2DWKA 3OBVE 2CMRA 2EHOC 3H37A 2J1DG 5KDMC 3BQLA 2WM9A 3ZCIA 4HE8A 1IAPA 3VHLA 3RRCA 2PBIA 2DLRA 4QX7B 4JEHB 4PK4A 2IW5B 4H9OC 3C64A 4CI1B 4DBRA 5FY1A 5HYAA 4QXHB 1U4QA 3FXEB 5JVDE 3KV9A 5FP3A 3AB3B 1V9DA 2K5BB 4MALA 3WAKA 3K8PC 4PK6A 3ZMVB 4AQFA 2W63A 4ZI2D 3RC8A 3I1AA 2CWOA 4AKRB 4P09A 4TX5A 3CQXC 2KMFA 2YINA 1B7TA 1WRDA 3UTKA 4K0UA 2H7OA 4JEUB 3CQGB 4OYJA 3S4UA 3KVAA 2ZMAA 4OK0A 2IC9A 3CQCB 3SOLA 3VU7H 2Y8DA 3B13A 4PFPA 3U78A 4KMCA 2X9WA 4ADZA 3ZCJA 1UCUA 4EAHA 1D0YA 5DABA 3FBZA 4GK5E 2VB6A 5EK2A 3EDUA 2LHRA 1SA0E 3PUQA 5FMNA 2I59A 3LBXB 4MFRA 1HX8A 3PU8A 4G2AA 1WR6A 4JUYA 4ERRA 4FJOA 5L2LA 3ZN0B 2L3LA 3I0OA 3AVRA 4GOUA 1YW0A 5C8YE 3HL6A 4H9PC 1O3XA 2QA7A 1D1CA 2LOPA 2PG8A 3PUSA 4GK0E 3B57A 4NUUA 5FNVE 1FMVA 4EZ4A 4UVAB 2OA5A 2DI4A 4PW8A 5FXZA 3UUXB 5HWXA 3I0QA 4BA9A 2KT9A 3CVRA 3O4XE 2CEAA 5L3GB 4HN9A 5J1GA 2JQQA 2VWAA 4EOZB 1CUNA 2K48A 3CX8B 3FBLA 3K3QC 3Q9DA 3MZKB 3LBXA 2CLYC 3ETVA 3HI2A 4TZ4C 2KWHA 4ANJA 4L5GA 5HAXA 3HA4A 4B6XA 5HXHA 5LG4A 3NZQA 4YFSA 3U3IA 3N9PA 2Q9QA 3BK9A 1LRZA 4I55E 4EIWA 2DHRA 2HH7A 4ZHQE 5GONE 3CX7B 1MMGA 2CM0A 3GWHA 2XAQB 3RYFE 2MYSA 3AAEB 3W15B 4IGUA 2YU2A 1IJ6A 3UUNA 2W0GA 5JDQA 5LHIB 3ESLA 3ZMTB 1H7CA 3N9LA 4EYUA 5HXRA 4AKLA 3RRWA 2XHEB 1MNDA 1OXZA 5FYMA 3F31A 5TAOA 3AAAB 4UIGA 1D0XA 2DNXA 4OFZA 3N2GE 2XAHB 2JMHA 4QXBB 5KX5E 3RC3A 2VKOA 3ZPOA 1QSDA 2XQYA 4OHFA 2Z6EA 3GMIA 2V1DB 3KV5A 5JDGA 2EHOA 1QUUA 5LBMA 2G0UA 1U5PA 2LM9A 2XAJB 4WW0A 4O2BE 1BR0A 4YJ2E 2E8IA 4PNIA 4ISSA 3K3OA 3V5UA 5DJQC 1IJ5A 4DO0A 4H9SE 3FB2A 2ES0A 2MBGA 2V7LA 1NAFA 5HXSA 3EVYA 2QGSA 4X1YE 3RYHE 5J2UE 2P9BA 2LEHA 2LSJA 2BZBA 2C5IT 1MMDA 3CMLA 4IDZA 4PK5A 2HPLA 5JDMA 4ZI3C 5HXEA 5FXVA 4UXNB 3NRYA 3RPUA 5LA6E 1G73A 3KVBA 4O4IE 4PJNA 5FY7A 5LJNA 2YK0A 1ZHCA 2CXDA 3NRXA 1FMWA 4U74A 5JDFA 4IE0A 2DWGA 4H63V 2JJ9A 2V26A 3C4ZA 3E22E 2KINB 5JREA 4QKNA 2E9XD 4DBQA 3T8OA 3PUGA 1D1AA 4XZCA 4WNKA 4X1KE 3ZYMA 4DVDA 5AFUL 2LSGA 4BJNA 2NWBA 1MIWA 2ODUA 1US7B 3C98B 2PFVA 3DP7A 1LVKA 1D1BA 3O1IA 3RYCE 3PURA 3J7Yq 2YEVC 1HCIA 4V1Av 2X66A 3N9MA 3KV4A 4XAXB 5JRCA 2CLYB 4EB6E 3MACA 3O1HA 5H6QB 5ETWA 3E0ZA 3AA1B 3LK42 4EXTA 1ZV4X 2UXXB 4C91A 2K24A 5HXCA 3FHNA 3LK2B 4AQGA 2VKHA 5LYJE 5CA1E 5LHHB 4AKHA 4CZZB 3ZN1B 4UELA 3SWHA 4EYYR 4Z8XA 4L9IA 3ZC1A 4KUMB 4DNDA 5JDHA 2LSIA 2JPFA 3K3NA 2W62A 2WMOA 2NW7A 4BAYB 4IE7A 4F6RC 3CWZB 3R6NA 3MJXA 4U72A 5H6RB 5L3EB 3Q5XA 3UULA 5FXXA 3SS1A 4XBFB 3KBTA 3KV6A 2CE7A 3E08A 2LSKA 4UV8B 4DMVA 4HGAA 4O4LE 3MA9A 4YLHA 3AVSA 2CA5A 2HPJA 3V5SA 4CXWA 4QXCB 3GN5B 4MLKA 3RKOA 4G63A 4E7ZA 4QHOA 4PAGA 3MKDA 1YD8G 2LOSA 4ZS3A 5LGUB 3C4XA 2BVMA 1VOMA 3HKBE 1KK7A 2D0UA 3JC6D 3OJAA 4FI5A 2XAFB 3Q2MA 4IE6A 4HEAA 4O8SA 5CB4E 2BDEA 4I4TE 3NZPA 4UVCB 2NTXA 5JR9B 2E9XC 2X9HA 2CCQA 3CKDA 3ZYKA 2VL8A 2ZM0A 4ASKA 3OKQA 2A72A 2CXLA 2RP4A 2WBLA 3P8CD 4WBOA 2L8KA 4N78D 3GN5A 3RH3A 2JMKA 2V7KA 5F8PA 2K9AA 3PU3A 4ZI2C 4E7SA 4UVBB 4IIJE 1KNZA 4HFVA 3IBPA 1AJ3A 2ZM2A 3QK6A 2MTQA 1WYCA 3ZMSB 3ZMUB 4UV9B 5JH7E 4X1IE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N2N A;  1X79 A;  1OXZ A;  1WRD A;  1WR6 A;  1NAF A;  1O3X A;  1NWM X;  2N9D A;  1YD8 G; 
#chains in the Genus database with same CATH topology
 3ZJ2 A;  5JTG A;  5JR9 A;  4EZH A;  2BS2 A;  2LSY A;  3LG7 A;  3PDY A;  4TWH A;  5AQS B;  3AAI A;  2L9Q A;  2Y48 B;  3C51 A;  1IZN B;  2UXN B;  3MXZ A;  3EUH A;  4TV8 E;  4YY3 T;  2QYW A;  5JR9 C;  3VKH A;  1S35 A;  2FJA A;  3AA7 B;  2KXP B;  4JV5 T;  3KDS E;  3PUA A;  3HR0 A;  5CGM A;  2RA1 A;  3HKC E;  3OYX A;  2WY2 A;  2WDQ A;  2ZLY A;  3DJB A;  4NUV A;  2W00 A;  3N9Q A;  3SRZ A;  2R6G F;  5ABH A;  1MIY A;  2X51 A;  1UGO A;  3IHR A;  5HCJ A;  3CX6 B;  3ANW B;  4EEB A;  2CRB A;  4GKJ T;  2XAG B;  1YQ3 A;  2E9X B;  4PFO A;  4MHC A;  1UX5 A;  2NTY A;  4OX9 T;  1LKX A;  2YOE A;  1UK5 A;  3N2K E;  1HTJ F;  4JI5 T;  3X1D A;  2NP9 A;  3C4W A;  2XSB A;  3L3P A;  2BKP A;  5L3C B;  4LFB T;  2D0T A;  2WSS V;  4ZS2 A;  4CXY A;  4KI0 F;  5HEU A;  3RIF A;  4AQF C;  4J2C A;  1OED A;  1NEN A;  1NWM X;  2HN2 A;  4ZI3 D;  5HWY A;  1M7K A;  1MNE A;  4NIQ A;  3ZLI A;  1MMA A;  4DMW A;  3UFE A;  2WP9 A;  3L09 A;  2C5J A;  3PE0 A;  3ZYL A;  4CQI A;  3JAE A;  4IDN A;  2NOX A;  3ONJ A;  3OPC A;  1HG2 A;  3NVO A;  2QVA A;  4EED A;  2KZ7 B;  3IF8 B;  4ZOL E;  3L39 A;  3OYZ A;  3I9Y A;  5F5W A;  3T1Y T;  3ZJ1 A;  5KMG P;  2H7V C;  2J47 A;  2K3W A;  3A7M A;  4YHJ A;  3N5L A;  1IBM T;  2KLQ A;  3ZEF B;  2LT3 A;  5J0Z A;  4OYK A;  2X9Y A;  2B76 A;  4UF0 A;  4DR6 T;  3OBV E;  2EHO C;  4IL9 A;  2J1D G;  3ZCI A;  2UUB T;  1T8B A;  3EHZ A;  5AQF B;  2CHO A;  4PK4 A;  5LMN T;  2OV9 A;  4CN6 A;  4DBR A;  5FY1 A;  3KV9 A;  5AQJ B;  3AB3 B;  3VR8 A;  2W63 A;  3RC8 A;  5ABG A;  3I1A A;  3CQX C;  1JNR A;  3CK6 A;  1B7T A;  4DR5 T;  4K0U A;  2X0H A;  4OYJ A;  4OK0 A;  2Y8D A;  4ADZ A;  4EAH A;  1D0Y A;  2IUB A;  4GK5 E;  1HX8 A;  3PU8 A;  3M3Z B;  3I0O A;  3AVR A;  1D1C A;  5HCM A;  4X65 T;  2YDR A;  4NUU A;  2I6H A;  1M62 A;  1FMV A;  5FXZ A;  5HWX A;  3I0Q A;  3O4X E;  5LG3 A;  3CIR A;  2VWA A;  3FBL A;  3Q9D A;  3HI2 A;  4X66 T;  5HXH A;  3HA4 A;  5LG4 A;  3NZQ A;  3U3I A;  4TWF A;  4I55 E;  3RYF E;  3UUN A;  3TLU A;  5FVL A;  4EYU A;  3RRW A;  2XHE B;  1OXZ A;  1D0X A;  2DNX A;  4OFZ A;  2JMH A;  1J5W A;  3RC3 A;  4LF4 T;  2Z6E A;  2V1D B;  3KV5 A;  5JDG A;  5LBM A;  1QUU A;  5AQK B;  1IJ5 A;  2XQ7 A;  1Y01 A;  2MBG A;  1NAF A;  2XQ3 A;  2P9B A;  2LSJ A;  1MMD A;  1IBL T;  5HXE A;  1J1J A;  3RPU A;  1G73 A;  4PJN A;  5FY7 A;  3NRX A;  4IE0 A;  1N32 T;  4DBQ A;  5AFU L;  1US7 B;  3C98 B;  3O1I A;  3EAB A;  2YEV C;  1HCI A;  2X66 A;  2YKS A;  3N9M A;  5H6Q B;  5AQH B;  2LKH A;  2UXX B;  2K24 A;  2A9U A;  5HXC A;  1KF6 A;  5LYJ E;  5CA1 E;  2BG9 E;  2WU5 A;  5AQO B;  3SWH A;  2CBJ A;  4Z8X A;  4F8H A;  4KUM B;  3ZSS A;  3RLF F;  2W62 A;  3Q5E A;  3UU3 A;  2UXD T;  4DR3 T;  3Q5X A;  3SS1 A;  4XBF B;  4WZX A;  2CE7 A;  2IDO B;  4HGA A;  4O4L E;  3MA9 A;  4YLH A;  2BS3 A;  3AVS A;  4U7I A;  3V5S A;  3P4R A;  4PAG A;  4ZS3 A;  3OVU A;  3HKB E;  1KK7 A;  2WB5 A;  2XAF B;  4JI1 T;  4UVC B;  3CKD A;  2VL8 A;  2CXL A;  2WBL A;  3JCF A;  2L8K A;  1WCR A;  3RH3 A;  5F8P A;  2XQ4 A;  2XPK A;  4HFV A;  1AJ3 A;  2W2U A;  3ZMU B;  2BG9 B;  1BR2 A;  3BQK A;  1BR4 A;  4WYV A;  2CBI A;  1XNQ T;  2YDS A;  3RGL A;  1HF8 A;  3H3A A;  4O2A E;  2ACZ A;  3LSV A;  2KWI B;  3N9O A;  2CWY A;  3TLW A;  2LLY A;  3FZM B;  4LMJ A;  4IHJ E;  2LHN A;  3DTO A;  3PJA J;  1D0Z A;  3QB5 K;  4DR7 T;  1IBK T;  2H3R A;  4ILU A;  3PUZ F;  5DQV A;  2XTL A;  1VCS A;  4CXX A;  4JLE A;  2D2S A;  3O1J A;  2FJE A;  2VVN A;  3H3M A;  2VAS A;  4HTE A;  4DR2 T;  5FKY A;  4AI6 A;  4U33 A;  3BQI A;  2Q9Q D;  3GA8 A;  5AQV B;  3RX6 A;  3RQU A;  3ANW A;  3FZL B;  3TLT A;  3LDQ B;  3ZC0 A;  4I43 B;  2E9X A;  2IAK A;  5J2T E;  4DUZ T;  2D9D A;  2V7M A;  1LVF A;  4HWH A;  2Q9Q B;  5LP6 E;  1JNZ A;  4ILC A;  5HEJ A;  1S94 A;  2M6B A;  3Q5W A;  1HG5 A;  3RIU C;  2VKD A;  4AXP A;  4HFI A;  3KBU A;  4JYA T;  2UUA T;  1T98 A;  3F57 A;  4LF7 T;  5BMV E;  5L3D B;  4P0B A;  5M4Y A;  2IML A;  3PUX F;  1FIO A;  2BS4 A;  2XZE A;  4MBQ A;  1W09 A;  3PUV F;  3KIN B;  4YSX A;  2V8S V;  1WYB A;  2AE9 A;  3AEB A;  2H89 A;  5ADX L;  4QX8 B;  2WU2 A;  3UQ4 A;  5EK4 A;  4YTM A;  1OWA A;  5AQU B;  2HHH T;  1XDO A;  1X79 A;  3PJA A;  2ODV A;  3UT5 E;  3JC6 C;  2CMR A;  4EV6 A;  3H37 A;  4U3C A;  4IRE A;  3VHL A;  2PBI A;  4IDP A;  2FUP A;  4QX7 B;  4JEH B;  4CI1 B;  1U4Q A;  5JVD E;  2K5B B;  3K8P C;  4PK6 A;  4AQF A;  2CWO A;  1GQE A;  5FL0 A;  3KVA A;  2ZMA A;  3SOL A;  3VU7 H;  1QLB A;  4PFP A;  3U78 A;  4KMC A;  4KHP T;  5EK2 A;  3EDU A;  4U2Y A;  1SA0 E;  4G2A A;  2I0M A;  3ZN0 B;  2L3L A;  2ZM6 T;  4GOU A;  2XSA A;  2XQ5 A;  3HL6 A;  2QA7 A;  2LOP A;  2PG8 A;  3ONL C;  2DL1 A;  2KT9 A;  3AE8 A;  2CEA A;  5L3G B;  3K3Q C;  3JAF A;  4ANJ A;  2FBW A;  4EIW A;  2BBH A;  1MMG A;  2CM0 A;  1R8I A;  3AAE B;  4YTP A;  1HNX T;  3ZMT B;  1Z8U A;  3AXJ B;  4AKL A;  1OED E;  4UIG A;  3VR9 A;  2XAH B;  1E7P A;  4AIU A;  3TLV A;  1XZY A;  2EHO A;  1U5P A;  3UUB A;  4YJ2 E;  3V5U A;  3FB2 A;  3EVY A;  4X1Y E;  3RYH E;  5J2U E;  2BZB A;  4IDZ A;  4PK5 A;  5JDM A;  5FXV A;  3KVB A;  2W4X A;  2YK0 A;  4H63 V;  1XMQ T;  2JJ9 A;  2V26 A;  3C4Z A;  3E22 E;  4COF A;  5JRE A;  4HFE A;  4XZC A;  4X1K E;  3RKG A;  3ZYM A;  1UUS A;  4DVD A;  4BJN A;  3EI0 A;  1D1B A;  3J7Y q;  3PUR A;  3B5M A;  2V6X A;  5JRC A;  3A8Y C;  4EB6 E;  3MAC A;  3O1H A;  2WZI A;  4K0K T;  3AA1 B;  4EXT A;  1ZV4 X;  3FHN A;  2VKH A;  5LHH B;  2XM1 A;  5CJ5 A;  4CZZ B;  4YSY A;  4QH1 A;  4UEL A;  3ZC1 A;  5JDH A;  3K3N A;  3AEA A;  2UUC T;  4IE7 A;  4F6R C;  1CHU A;  3CWZ B;  4B3T T;  3MJX A;  3UUL A;  3KBT A;  3AE4 A;  2CA5 A;  3GN5 B;  4E7Z A;  2WCA A;  3AE2 A;  1VOM A;  4YTN A;  4FI5 A;  3SFD A;  1HNZ T;  1NEK A;  2VL0 A;  5CB4 E;  4JI7 T;  5CFB A;  1HX1 B;  3ZYK A;  4NXM T;  4ASK A;  3OKQ A;  3AE5 A;  3PU3 A;  4ZI2 C;  1WR0 A;  4UVB B;  3QK6 A;  2MTQ A;  4HFB A;  1WYC A;  4UV9 B;  5C3J A;  3SFE A;  5JH7 E;  3QOF A;  1L0V A;  2IC6 A;  3UFG A;  5EK3 A;  1FEW A;  2YU1 A;  3J9X 1;  1Y64 B;  2Y6X A;  4P1N A;  3EDV A;  2XY8 B;  2WAU A;  2WWV A;  3F2E A;  2DCF A;  3QC9 A;  4C90 A;  3LFM A;  3VRA A;  5L3F B;  3ETU A;  4UR9 A;  2LE8 A;  4I50 E;  4P0A A;  2BG9 A;  2NW8 A;  2X0L B;  1E1H B;  3AA6 B;  3IA3 A;  5LB7 B;  2VQF T;  4AKG A;  4JI3 T;  3AEE A;  3UU8 A;  3QUJ A;  4HFH A;  2IHR 1;  4QH5 A;  5ABF B;  4B3R T;  2B1E A;  1I6Z A;  2FJB A;  3NBX X;  3ZMZ B;  2E2A A;  3RI5 A;  2JRK A;  2J4G A;  2BG9 C;  4H9R C;  4PJM A;  1VRB A;  1W0B A;  2V6Y B;  4U7Y A;  5LCY A;  5F3J A;  4YJ3 E;  4YXD A;  5AQT B;  4KBM B;  2NW9 A;  1HS7 A;  1ZOY A;  2KSR A;  4TNW A;  5LGN B;  1WFD A;  3CPZ A;  3HKE E;  1Z0P A;  4KP3 C;  2V5C A;  1XNR T;  3LJC A;  1HFA A;  2ACX A;  5LJM A;  3ZT6 A;  5LNK A;  4H9Q C;  4L0R A;  4QWN B;  2LJL A;  4DR1 T;  2ZM8 A;  4HWI B;  1FJG T;  4DV0 T;  4PJJ A;  2C5K T;  4BJM A;  2UU9 T;  4Z90 A;  4LFA T;  4DV6 T;  2IIU A;  2FJD A;  5LGT B;  3P7I A;  2N1G A;  3FXD B;  2MOZ A;  2WMN A;  4HWF A;  2X67 A;  5ABE A;  5E0O A;  5FY0 A;  4O4J E;  2UXB T;  1MMN A;  5EZY E;  3EAM A;  3NWI A;  1VCT A;  1SE7 A;  1N36 T;  4NXN T;  1XDP A;  3OTO T;  4AQY T;  4H63 H;  4TN7 B;  2Q9Q C;  2V7J A;  4HKA A;  5LXT E;  2D5U A;  3AE9 A;  1BR1 A;  4GKK T;  3AE1 A;  5JDL A;  4GIW A;  4M1P A;  5A1L A;  2JQH A;  5LMU T;  2H88 A;  2LKG A;  3M65 A;  4U2Z A;  5KDM C;  3BQL A;  3G06 A;  4HE8 A;  1IAP A;  2NR4 A;  3RRC A;  4A97 A;  4LF9 T;  2DLR A;  5AQP B;  2IW5 B;  4H9O C;  3C64 A;  1HNW T;  3FXE B;  5FP3 A;  1V9D A;  4DR4 T;  4AKR B;  2KMF A;  2YIN A;  2VQE T;  4DV4 T;  3UTK A;  4JEU B;  3S4U A;  2IC9 A;  3CQC B;  2X9W A;  4LML A;  3ZCJ A;  1UCU A;  5DAB A;  3FBZ A;  5FMN A;  2LHR A;  3PUQ A;  4A5X A;  2CPT A;  3LBX B;  1WR6 A;  3Q5D A;  3RIU A;  2X0Y A;  5C8Y E;  4H9P C;  1O3X A;  4TWD A;  3PUS A;  1W0A A;  5FNV E;  4EZ4 A;  4UVA B;  2OA5 A;  4PW8 A;  3UUX B;  3P4P A;  3CVR A;  3ZKR A;  4HN9 A;  4EOZ B;  1CUN A;  3MZK B;  2CLY C;  4TZ4 C;  2E5L T;  4L5G A;  4B6X A;  4ZZB A;  1LRZ A;  2HH7 A;  4ZHQ E;  2XM2 A;  2MYS A;  3W15 B;  1XMO T;  4IGU A;  1T72 A;  2YU2 A;  2W0G A;  4A98 A;  2F4V T;  5JDQ A;  5LHI B;  1H7C A;  5HXR A;  3RIA A;  1MND A;  5FYM A;  4Z91 A;  3AAA B;  1UUR A;  5KX5 E;  2VKO A;  2W66 A;  1QSD A;  2XQY A;  4OHF A;  2G0U A;  2LM9 A;  2LRL A;  4O2B E;  2E8I A;  3JAD A;  4ISS A;  4DO0 A;  4H9S E;  3AE3 A;  5HXS A;  2QGS A;  3AXJ A;  3CML A;  4IT4 A;  3AED A;  4ZI3 C;  5HEG A;  1ZHC A;  2CXD A;  5JDF A;  2DWG A;  2LRK A;  2KIN B;  2E9X D;  2PTF A;  3ABV A;  1D1A A;  2NWB A;  2ODU A;  3DP7 A;  3RYC E;  1LVK A;  2JIW A;  4DV1 T;  4XAX B;  2CLY B;  3E0Z A;  4LF5 T;  1E2A A;  4YSZ A;  3UU5 A;  4JI8 T;  4C91 A;  4AQG A;  2XQ8 A;  4JI6 T;  4AKH A;  4HWD A;  4DND A;  1KFY A;  2LSI A;  2WMO A;  3R6N A;  2BKO A;  5H6R B;  3AEC A;  4DMV A;  2LSK A;  4UV8 B;  4B3M T;  3UU4 A;  3QB5 A;  2HPJ A;  4QXC B;  4MLK A;  1KNP A;  4G63 A;  4QHO A;  4ZEY A;  1YD8 G;  5LGU B;  3C4X A;  5AQG B;  3AEF A;  2D0U A;  3JC6 D;  4HEA A;  4O8S A;  4I4T E;  3NZP A;  2NTX A;  5JR9 B;  2X9H A;  2CCQ A;  4IL4 A;  2ZM0 A;  2RP4 A;  3P50 A;  3P8C D;  1I94 T;  4N78 D;  1OED C;  3GN5 A;  2VUR A;  2JMK A;  3AE6 A;  2K9A A;  4AIS A;  4IIJ E;  3IBP A;  1DU2 A;  4X1I E;  3VRB A;  5C2T A;  2XAS B;  3NKZ A;  1WLX A;  2BBJ A;  3MK7 C;  2YN6 A;  5FVK A;  4JI2 T;  3LK3 B;  4DUY T;  4ZI7 E;  2N9D A;  3R84 B;  3VKG A;  4CI3 B;  4GYR A;  1X9B A;  3KFW X;  2X68 A;  3N9N A;  5LBQ B;  5CA0 E;  4TV9 E;  3FZK B;  4KHZ F;  3C50 A;  5LOV E;  4GYS A;  2MPK A;  2XUE A;  1MIV A;  4QH4 A;  3UUM A;  2A2F X;  3WAJ A;  1ZKE A;  5IWA T;  2XQA A;  3UQ7 A;  3K1S A;  4HFC A;  2BVL A;  4A56 A;  2KND A;  3P4W A;  4UEM A;  5AQQ B;  5AQN B;  4PJL A;  2HN1 A;  2VK9 A;  2WWU A;  2AXD S;  5HEH A;  3HKD E;  4YHH T;  2SPC A;  1YKE B;  1OED B;  1HR0 T;  2VVS A;  5ABF A;  2V5D A;  2PJQ A;  5AQR B;  4CN4 A;  2M67 A;  3RYI E;  2JQK A;  3PTR B;  5IYZ E;  2W61 A;  3A5X A;  2V6Y A;  2X9X A;  1YKH B;  1N33 T;  1SHZ C;  5LHG B;  4X64 T;  4NPP A;  5JDN A;  2GK9 A;  4IDO A;  3ONX A;  2CXF A;  4B3S T;  2M6I A;  2YDQ A;  3D0T A;  2EHO D;  4ZZC A;  3N2O A;  1ZEE A;  4IE5 A;  4X62 T;  3PUW F;  2N2N A;  1UX4 A;  3TKL B;  2XQ6 A;  3PV0 F;  4TNV A;  3AA0 B;  4IE4 A;  2A3D A;  2EHO B;  5AQL B;  4TUY E;  5HEO A;  5IHY A;  2LM2 A;  3O9X A;  5DQW A;  3IEE A;  5FL1 A;  4X20 E;  4IST A;  3PUY F;  2V7I A;  4AKI A;  2E5V A;  1G8X A;  4WBN E;  2VKJ A;  4UF0 B;  1KEY A;  5JQG E;  5FXW A;  4DID B;  1EZ3 A;  3T1H T;  1W9R A;  4CI2 B;  4Q25 A;  4KX6 A;  4H9N C;  3WI3 A;  4DV3 T;  2WDV A;  1XWM A;  5L3B B;  3I9W A;  3ZT5 A;  5JRC B;  4HFD A;  2C0S A;  4O4H E;  2DWK A;  2JQ9 A;  3TLS A;  2WM9 A;  2WZH A;  2WDR A;  4U31 A;  4I0U A;  5KXJ A;  5HYA A;  4QXH B;  4X5T A;  4CN1 A;  4MAL A;  3WAK A;  4ZI2 D;  3ZMV B;  4P09 A;  4TX5 A;  2J62 A;  3L8R A;  1WRD A;  2H7O A;  3CQG B;  5AQM B;  1ZP0 A;  4YT0 A;  3B13 A;  2VB6 A;  2CHN A;  2I59 A;  4MFR A;  4JUY A;  4JI0 T;  4ERR A;  4FJO A;  5L2L A;  1YW0 A;  5IUX A;  3FZF B;  2UXC T;  4EGW A;  4GK0 E;  3B57 A;  3RHW A;  4ILA A;  1J5E T;  2DI4 A;  3RF1 A;  5L4E A;  4BA9 A;  4LF6 T;  2W67 A;  5J1G A;  2JQQ A;  3CX8 B;  2K48 A;  3LBX A;  3ETV A;  2KWH A;  4ZXL A;  5HAX A;  4JBW F;  1YQ4 A;  4YFS A;  3N9P A;  2Q9Q A;  3BK9 A;  2DHR A;  5GON E;  3CX7 B;  3GWH A;  2XAQ B;  4DV2 T;  1IJ6 A;  3ESL A;  4LF8 T;  2XQ9 A;  3N9L A;  5AQI B;  4IDQ A;  1N34 T;  3F31 A;  5TAO A;  3N2G E;  4QXB B;  3ZPO A;  2MAW A;  3GMI A;  2XAJ B;  4WW0 A;  1BR0 A;  4PNI A;  3K3O A;  5DJQ C;  2ES0 A;  2V7L A;  3ZST A;  2LEH A;  2RPA A;  2C5I T;  2HPL A;  4UXN B;  3NRY A;  1T7S A;  5LA6 E;  4O4I E;  5LJN A;  1FMW A;  4U74 A;  3UU6 A;  4QKN A;  3T8O A;  3PUG A;  3ZT7 A;  4DV5 T;  4WNK A;  2BKN A;  2LSG A;  3FZH B;  1MIW A;  3AE7 A;  2PFV A;  4JI4 T;  4V1A v;  3KV4 A;  5ETW A;  3LK4 2;  3LK2 B;  1YXR A;  3ZN1 B;  4DV7 T;  5L47 A;  4EYY R;  3P4S A;  3QNU A;  4L9I A;  2JPF A;  5L4H A;  2NW7 A;  4BAY B;  3RQW A;  4LMK A;  4U72 A;  5L3E B;  5FXX A;  2WS3 A;  3KV6 A;  3E08 A;  4CXW A;  3RKO A;  3MKD A;  2LOS A;  4ILB A;  2BVM A;  5BR8 T;  4LFC T;  2WQY A;  1KNR A;  3OJA A;  3Q2M A;  4IE6 A;  2BDE A;  2E9X C;  2XJ7 A;  2A72 A;  2QRX A;  4WBO A;  1SUM B;  2V7K A;  4E7S A;  2OLT A;  1KNZ A;  2ZM2 A;  3P4Q A;  3ZMS B;  4HWC A;  3AEG A; 
#chains in the Genus database with same CATH homology
 2IC6 A;  3ZJ2 A;  2XAS B;  5EK3 A;  5JR9 A;  1WLX A;  4EZH A;  1FEW A;  2LSY A;  3MK7 C;  3LK3 B;  3LG7 A;  3PDY A;  2YU1 A;  3J9X 1;  4ZI7 E;  2N9D A;  3R84 B;  3VKG A;  1Y64 B;  2Y6X A;  3EDV A;  4CI3 B;  4GYR A;  1BR2 A;  2WAU A;  3AAI A;  3BQK A;  3F2E A;  2DCF A;  3KFW X;  3QC9 A;  1BR4 A;  2L9Q A;  4C90 A;  3LFM A;  2X68 A;  3N9N A;  2Y48 B;  3C51 A;  5L3F B;  3ETU A;  1IZN B;  2UXN B;  5LBQ B;  3MXZ A;  5CA0 E;  3EUH A;  4TV8 E;  2LE8 A;  4TV9 E;  5JR9 C;  1HF8 A;  3H3A A;  3VKH A;  1S35 A;  4I50 E;  4P0A A;  3AA7 B;  2KXP B;  2NW8 A;  2X0L B;  3KDS E;  3PUA A;  1E1H B;  3AA6 B;  3C50 A;  3HR0 A;  4O2A E;  2RA1 A;  3HKC E;  5LOV E;  3OYX A;  4GYS A;  4AKG A;  2ZLY A;  3DJB A;  2KWI B;  3N9O A;  4NUV A;  2W00 A;  2XUE A;  3QUJ A;  1MIV A;  2CWY A;  3N9Q A;  3UUM A;  3SRZ A;  1MIY A;  2B1E A;  2X51 A;  3NBX X;  3IHR A;  2A2F X;  3WAJ A;  3ZMZ B;  1ZKE A;  2JRK A;  4IHJ E;  2BVL A;  2LHN A;  3CX6 B;  3ANW B;  3DTO A;  4H9R C;  4A56 A;  2KND A;  1D0Z A;  4PJM A;  1VRB A;  4UEM A;  4PJL A;  2XAG B;  2VK9 A;  2WWU A;  2H3R A;  4ILU A;  2E9X B;  5LCY A;  5DQV A;  2XTL A;  3HKD E;  4PFO A;  4CXX A;  4MHC A;  1UX5 A;  2NTY A;  2D2S A;  1LKX A;  4JLE A;  5F3J A;  3O1J A;  2SPC A;  1YKE B;  3N2K E;  4YJ3 E;  2VAS A;  4HTE A;  1HTJ F;  4KBM B;  4AI6 A;  2NW9 A;  2NP9 A;  1HS7 A;  3BQI A;  3C4W A;  2PJQ A;  2Q9Q D;  5LGN B;  3GA8 A;  3CPZ A;  3HKE E;  3RX6 A;  1Z0P A;  2M67 A;  3ANW A;  3RYI E;  3L3P A;  4KP3 C;  5L3C B;  2D0T A;  3LJC A;  2WSS V;  3PTR B;  5IYZ E;  2W61 A;  4ZS2 A;  4CXY A;  3ZC0 A;  3A5X A;  4I43 B;  2E9X A;  1HFA A;  2IAK A;  2ACX A;  5LJM A;  5J2T E;  5LNK A;  4AQF C;  2X9X A;  4H9Q C;  4L0R A;  1YKH B;  4QWN B;  1SHZ C;  2LJL A;  4J2C A;  5LHG B;  5JDN A;  2ZM8 A;  1NWM X;  2GK9 A;  2V7M A;  1LVF A;  4ZI3 D;  3ONX A;  2CXF A;  5HWY A;  2Q9Q B;  4PJJ A;  2C5K T;  3D0T A;  2EHO D;  1MNE A;  4BJM A;  5LP6 E;  3ZLI A;  1MMA A;  1S94 A;  4DMW A;  5LGT B;  3UFE A;  3N2O A;  1ZEE A;  3Q5W A;  4IE5 A;  1HG5 A;  3L09 A;  3P7I A;  2N1G A;  3FXD B;  2MOZ A;  2WMN A;  2N2N A;  1UX4 A;  2VKD A;  3TKL B;  4AXP A;  3KBU A;  2C5J A;  3PE0 A;  3ZYL A;  4CQI A;  2X67 A;  3AA0 B;  1T98 A;  2A3D A;  4IE4 A;  2EHO B;  5E0O A;  3F57 A;  5FY0 A;  4O4J E;  4TUY E;  2NOX A;  5BMV E;  5IHY A;  5L3D B;  1MMN A;  3O9X A;  4P0B A;  5M4Y A;  5DQW A;  3IEE A;  1HG2 A;  4X20 E;  4IST A;  5EZY E;  1FIO A;  2V7I A;  4AKI A;  2KZ7 B;  3IF8 B;  4WBN E;  1G8X A;  4ZOL E;  2VKJ A;  3I9Y A;  3OYZ A;  4MBQ A;  3ZJ1 A;  4UF0 B;  4H63 H;  4TN7 B;  2Q9Q C;  5JQG E;  2V7J A;  5FXW A;  5KMG P;  2H7V C;  3KIN B;  1WYB A;  4HKA A;  4YHJ A;  1EZ3 A;  5LXT E;  2D5U A;  4CI2 B;  3N5L A;  2KLQ A;  4QX8 B;  5ADX L;  1BR1 A;  5EK4 A;  4H9N C;  3WI3 A;  3ZEF B;  1OWA A;  2LT3 A;  5JDL A;  4GIW A;  4M1P A;  5A1L A;  4OYK A;  5L3B B;  1X79 A;  2X9Y A;  3I9W A;  5JRC B;  2ODV A;  3UT5 E;  3JC6 C;  3M65 A;  4UF0 A;  2C0S A;  4O4H E;  2DWK A;  3OBV E;  2CMR A;  2EHO C;  3H37 A;  2J1D G;  5KDM C;  3BQL A;  2WM9 A;  3ZCI A;  4HE8 A;  1IAP A;  3VHL A;  3RRC A;  2PBI A;  2DLR A;  4QX7 B;  4JEH B;  4PK4 A;  2IW5 B;  4H9O C;  3C64 A;  4CI1 B;  4DBR A;  5FY1 A;  5HYA A;  4QXH B;  1U4Q A;  3FXE B;  5JVD E;  3KV9 A;  5FP3 A;  3AB3 B;  1V9D A;  2K5B B;  4MAL A;  3WAK A;  3K8P C;  4PK6 A;  3ZMV B;  4AQF A;  2W63 A;  4ZI2 D;  3RC8 A;  3I1A A;  2CWO A;  4AKR B;  4P09 A;  4TX5 A;  3CQX C;  2KMF A;  2YIN A;  1B7T A;  1WRD A;  3UTK A;  4K0U A;  2H7O A;  4JEU B;  3CQG B;  4OYJ A;  3S4U A;  3KVA A;  2ZMA A;  4OK0 A;  2IC9 A;  3CQC B;  3SOL A;  3VU7 H;  2Y8D A;  3B13 A;  4PFP A;  3U78 A;  4KMC A;  2X9W A;  4ADZ A;  3ZCJ A;  1UCU A;  4EAH A;  1D0Y A;  5DAB A;  3FBZ A;  4GK5 E;  2VB6 A;  5EK2 A;  3EDU A;  2LHR A;  1SA0 E;  3PUQ A;  5FMN A;  2I59 A;  3LBX B;  4MFR A;  1HX8 A;  3PU8 A;  4G2A A;  1WR6 A;  4JUY A;  4ERR A;  4FJO A;  5L2L A;  3ZN0 B;  2L3L A;  3I0O A;  3AVR A;  4GOU A;  1YW0 A;  5C8Y E;  3HL6 A;  4H9P C;  1O3X A;  2QA7 A;  1D1C A;  2LOP A;  2PG8 A;  3PUS A;  4GK0 E;  3B57 A;  4NUU A;  5FNV E;  1FMV A;  4EZ4 A;  4UVA B;  2OA5 A;  2DI4 A;  4PW8 A;  5FXZ A;  3UUX B;  5HWX A;  3I0Q A;  4BA9 A;  2KT9 A;  3CVR A;  3O4X E;  2CEA A;  5L3G B;  4HN9 A;  5J1G A;  2JQQ A;  2VWA A;  4EOZ B;  1CUN A;  2K48 A;  3CX8 B;  3FBL A;  3K3Q C;  3Q9D A;  3MZK B;  3LBX A;  2CLY C;  3ETV A;  3HI2 A;  4TZ4 C;  2KWH A;  4ANJ A;  4L5G A;  5HAX A;  3HA4 A;  4B6X A;  5HXH A;  5LG4 A;  3NZQ A;  4YFS A;  3U3I A;  3N9P A;  2Q9Q A;  3BK9 A;  1LRZ A;  4I55 E;  4EIW A;  2DHR A;  2HH7 A;  4ZHQ E;  5GON E;  3CX7 B;  1MMG A;  2CM0 A;  3GWH A;  2XAQ B;  3RYF E;  2MYS A;  3AAE B;  3W15 B;  4IGU A;  2YU2 A;  1IJ6 A;  3UUN A;  2W0G A;  5JDQ A;  5LHI B;  3ESL A;  3ZMT B;  1H7C A;  3N9L A;  4EYU A;  5HXR A;  4AKL A;  3RRW A;  2XHE B;  1MND A;  1OXZ A;  5FYM A;  3F31 A;  5TAO A;  3AAA B;  4UIG A;  1D0X A;  2DNX A;  4OFZ A;  3N2G E;  2XAH B;  2JMH A;  4QXB B;  5KX5 E;  3RC3 A;  2VKO A;  3ZPO A;  1QSD A;  2XQY A;  4OHF A;  2Z6E A;  3GMI A;  2V1D B;  3KV5 A;  5JDG A;  2EHO A;  1QUU A;  5LBM A;  2G0U A;  1U5P A;  2LM9 A;  2XAJ B;  4WW0 A;  4O2B E;  1BR0 A;  4YJ2 E;  2E8I A;  4PNI A;  4ISS A;  3K3O A;  3V5U A;  5DJQ C;  1IJ5 A;  4DO0 A;  4H9S E;  3FB2 A;  2ES0 A;  2MBG A;  2V7L A;  1NAF A;  5HXS A;  3EVY A;  2QGS A;  4X1Y E;  3RYH E;  5J2U E;  2P9B A;  2LEH A;  2LSJ A;  2BZB A;  2C5I T;  1MMD A;  3CML A;  4IDZ A;  4PK5 A;  2HPL A;  5JDM A;  4ZI3 C;  5HXE A;  5FXV A;  4UXN B;  3NRY A;  3RPU A;  5LA6 E;  1G73 A;  3KVB A;  4O4I E;  4PJN A;  5FY7 A;  5LJN A;  2YK0 A;  1ZHC A;  2CXD A;  3NRX A;  1FMW A;  4U74 A;  5JDF A;  4IE0 A;  2DWG A;  4H63 V;  2JJ9 A;  2V26 A;  3C4Z A;  3E22 E;  2KIN B;  5JRE A;  4QKN A;  2E9X D;  4DBQ A;  3T8O A;  3PUG A;  1D1A A;  4XZC A;  4WNK A;  4X1K E;  3ZYM A;  4DVD A;  5AFU L;  2LSG A;  4BJN A;  2NWB A;  1MIW A;  2ODU A;  1US7 B;  3C98 B;  2PFV A;  3DP7 A;  1LVK A;  1D1B A;  3O1I A;  3RYC E;  3PUR A;  3J7Y q;  2YEV C;  1HCI A;  4V1A v;  2X66 A;  3N9M A;  3KV4 A;  4XAX B;  5JRC A;  2CLY B;  4EB6 E;  3MAC A;  3O1H A;  5H6Q B;  5ETW A;  3E0Z A;  3AA1 B;  3LK4 2;  4EXT A;  1ZV4 X;  2UXX B;  4C91 A;  2K24 A;  5HXC A;  3FHN A;  3LK2 B;  4AQG A;  2VKH A;  5LYJ E;  5CA1 E;  5LHH B;  4AKH A;  4CZZ B;  3ZN1 B;  4UEL A;  3SWH A;  4EYY R;  4Z8X A;  4L9I A;  3ZC1 A;  4KUM B;  4DND A;  5JDH A;  2LSI A;  2JPF A;  3K3N A;  2W62 A;  2WMO A;  2NW7 A;  4BAY B;  4IE7 A;  4F6R C;  3CWZ B;  3R6N A;  3MJX A;  4U72 A;  5H6R B;  5L3E B;  3Q5X A;  3UUL A;  5FXX A;  3SS1 A;  4XBF B;  3KBT A;  3KV6 A;  2CE7 A;  3E08 A;  2LSK A;  4UV8 B;  4DMV A;  4HGA A;  4O4L E;  3MA9 A;  4YLH A;  3AVS A;  2CA5 A;  2HPJ A;  3V5S A;  4CXW A;  4QXC B;  3GN5 B;  4MLK A;  3RKO A;  4G63 A;  4E7Z A;  4QHO A;  4PAG A;  3MKD A;  1YD8 G;  2LOS A;  4ZS3 A;  5LGU B;  3C4X A;  2BVM A;  1VOM A;  3HKB E;  1KK7 A;  2D0U A;  3JC6 D;  3OJA A;  4FI5 A;  2XAF B;  3Q2M A;  4IE6 A;  4HEA A;  4O8S A;  5CB4 E;  2BDE A;  4I4T E;  3NZP A;  4UVC B;  2NTX A;  5JR9 B;  2E9X C;  2X9H A;  2CCQ A;  3CKD A;  3ZYK A;  2VL8 A;  2ZM0 A;  4ASK A;  3OKQ A;  2A72 A;  2CXL A;  2RP4 A;  2WBL A;  3P8C D;  4WBO A;  2L8K A;  4N78 D;  3GN5 A;  3RH3 A;  2JMK A;  2V7K A;  5F8P A;  2K9A A;  3PU3 A;  4ZI2 C;  4E7S A;  4UVB B;  4IIJ E;  1KNZ A;  4HFV A;  3IBP A;  1AJ3 A;  2ZM2 A;  3QK6 A;  2MTQ A;  1WYC A;  3ZMS B;  3ZMU B;  4UV9 B;  5JH7 E;  4X1I E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...