1YD8G

Complex of human gga3 gat domain and ubiquitin
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
93
structure length
93
Chain Sequence
GIQKVTKRLHTLEEVNNNVRLLSEMLLHYSQEDSSDGDRELMKELFDQCENKRRTLFKLASETEDNDNSLGDILQASDNLSRVINSYKTIIEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural mechanism for ubiquitinated-cargo recognition by the Golgi-localized, {gamma}-ear-containing, ADP-ribosylation-factor-binding proteins
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport, chromosomal protein
molecule keywords UBIQUIN
total genus 35
structure length 93
sequence length 93
chains with identical sequence H
ec nomenclature
pdb deposition date 2004-12-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF03127 GAT GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.160 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 1yd8G00
1NWMX 1WRDA 1NAFA 1X79A 1OXZA 2N2NA 1WR6A 1YD8G 1O3XA 2N9DA
chains in the Genus database with same CATH superfamily
4TNWA 1X79A 4G63A 2NP9A 2OA5A 4IDZA 4ZZBA 2BKNA 4GOUA 3AA0B 3WAKA 1T72A 3B5MA 3FZKB 3Q9DA 4MBQA 5FXVA 3O9XA 3RC8A 2YKSA 4U33A 3N5LA 2CPTA 2D0UA 3AEDA 3C4ZA 4L0RA 2LOPA 3ONXA 5KDMC 4JI2T 5HWYA 4YSYA 3AE3A 3K3OA 3ETUA 4I0UA 1KNZA 3VKHA 1VOMA 4ZS2A 2KWHA 3PUZF 2JQ9A 4ILUA 3I9YA 2AE9A 5E0OA 5JDFA 1OEDA 2VL8A 4E7ZA 2XY8B 4Z90A 3H3MA 3P4QA 4TNVA 5KMGP 5FNVE 3RIAA 5HWXA 4IT4A 2H3RA 4I4TE 4LFBT 1GQEA 1YQ3A 4JI0T 5J2UE 2MAWA 1IAPA 3P4PA 3CPZA 4ZHQE 5FY0A 3RRCA 5CJ5A 4DR7T 4QXCB 2KZ7B 3UFEA 4C90A 4LF9T 2UXBT 3CX6B 2DWKA 3ZMZB 3ZT5A 5FL0A 4A56A 5CFBA 3FHNA 3MK7C 1CUNA 2CBIA 4JEHB 4HFHA 4O4IE 4QX7B 4OK0A 4Z91A 3UU3A 4JI8T 2DHRA 2KT9A 5FXXA 2K24A 1E2AA 3RYCE 2XAGB 4HWIB 5DQWA 2EHOC 2X68A 2XPKA 4DR1T 4B3ST 1D1AA 3FBZA 4PFPA 5HEUA 3GMIA 1IZNB 2NW7A 2DWGA 1N32T 4K0KT 2W66A 3AB3B 1XMQT 4KHPT 3CQXC 2YDRA 4PFOA 3F31A 1MIVA 4H63V 4WNKA 3TLVA 2A2FX 2CA5A 5EZYE 4QH4A 3TLTA 1X9BA 4EGWA 2RPAA 4YLHA 5CGMA 2YU2A 4HFIA 4EXTA 3KDSE 5M4YA 2J62A 1R8IA 3VKGA 1SE7A 2UXXB 3N9NA 4H9QC 4EB6E 3V5UA 5CA0E 3BQKA 3RX6A 4EYYR 3AXJB 5J0ZA 3ETVA 3UT5E 2VVNA 3NZQA 5HXRA 1O3XA 1YKEB 1YXRA 2L8KA 3SFEA 5ABHA 2VQFT 2WBLA 1HTJF 1NWMX 2BBJA 4ADZA 4EAHA 4JV5T 3A5XA 3WI3A 2GK9A 4GK0E 2W4XA 2V5DA 1U5PA 3AE2A 2CEAA 4YJ3E 4EOZB 5LP6E 5AQMB 5BMVE 5LMNT 4TV8E 4X66T 4JEUB 2YEVC 3C50A 5LMUT 4O8SA 2QA7A 4AKIA 2VK9A 3FZLB 3T8OA 3UU4A 4JYAT 1XDPA 2Y48B 3EDVA 4PJJA 2EHOA 2IHR1 2M6IA 1KFYA 2LSGA 2IAKA 5L3DB 4WBOA 4NUVA 5LG4A 2LHRA 1I94T 1HF8A 5JDHA 4DV0T 4DR4T 4IDQA 2CM0A 2I6HA 3EI0A 3PTRB 3S4UA 2NR4A 4UVCB 3ZEFB 3C4XA 3JCFA 5CB4E 4COFA 4EYUA 4DR6T 1H7CA 1QSDA 3LJCA 4EZ4A 5LYJE 1I6ZA 5JREA 4AKHA 2CRBA 4IDOA 4XAXB 2W0GA 5JVDE 4IE6A 2V6YA 2XUEA 3CQGB 2CWYA 3EUHA 5J1GA 3GN5B 4A5XA 5LHHB 1XMOT 3AA1B 4LF4T 2CXLA 1QLBA 4U31A 2UUCT 3G06A 4TV9E 4DR2T 3PUYF 2H88A 3BQLA 2UUBT 4UVAB 3P50A 4HEAA 3N9OA 3QB5K 1BR1A 4BJNA 1N36T 2E2AA 2CLYB 3TLSA 2LSYA 3ZMVB 4EV6A 1U4QA 1AJ3A 4EZHA 1EZ3A 3AE9A 1UX4A 5HEOA 2VASA 2Q9QC 4IDPA 4ZI2C 3PUQA 1N34T 4WBNE 3K1SA 2JQKA 2WB5A 3H3AA 3HKCE 1XNQT 2QVAA 1IJ5A 3RRWA 4KHZF 4KMCA 4YTNA 5EK3A 2KXPB 5FVLA 5EK2A 2X66A 5JDQA 2BS2A 2G0UA 4X20E 3RKOA 3PJAJ 3FZHB 2BG9C 4AISA 3PUAA 2BZBA 3ZKRA 5BR8T 1OEDB 4IE5A 3T1YT 1HG2A 2QRXA 3HKBE 4F6RC 2NTYA 2NTXA 2W2UA 3AECA 2LRLA 2WMOA 4JI5T 5HXEA 2X9HA 1IJ6A 4EIWA 4P0AA 4N78D 4HKAA 2C5IT 3KFWX 2W00A 1Y64B 3AEFA 4LMLA 1LKXA 4OHFA 3ZYMA 3ZMTB 1LRZA 2WQYA 3HA4A 4OYKA 4AIUA 4O2BE 4TX5A 3FB2A 4U2ZA 4CXWA 2UXDT 1J5ET 4U7YA 2VKOA 2ACZA 4G2AA 1WYBA 3QB5A 2FJAA 4IL4A 4U3CA 4DV5T 4NXNT 1SUMB 2V7LA 3NRYA 4ILAA 4JBWF 2NOXA 2KWIB 3ZJ2A 1UK5A 3MKDA 4PK5A 3ONJA 3NKZA 5FL1A 2N1GA 1JNZA 2RA1A 2V6XA 5FP3A 5JR9B 2CXDA 2LHNA 2AXDS 3EDUA 3EVYA 3GA8A 3CIRA 3KV9A 3SS1A 5L3GB 3PUXF 2BS4A 4HWDA 4PK6A 3ZLIA 3ZT6A 2WY2A 3QOFA 4LF6T 4GK5E 4BA9A 4QXBB 2VWAA 3P7IA 3UULA 3VR9A 4ISTA 4MHCA 4ZI3D 2XQ8A 4ILCA 2E5LT 5FKYA 5IYZE 2K5BB 2WDQA 4CI3B 3ZC1A 2JMKA 3SOLA 2XQ3A 3TLUA 3OTOT 2F4VT 4HGAA 4JI1T 5HXCA 4LF7T 2V26A 4LFAT 1WR0A 3H37A 3PE0A 4ASKA 4DR5T 3EHZA 3O1HA 3AAAB 3RYHE 1IBLT 2DLRA 4OX9T 3Q5XA 3ZN1B 3OYXA 2IDOB 5IWAT 1MMGA 2C5KT 3JAEA 3ZPOA 4F8HA 2IC9A 2M67A 4H63H 3N2KE 2LKHA 3Q2MA 5A1LA 5TAOA 5F8PA 4ZXLA 2KLQA 3NRXA 3QUJA 4GKJT 3AE1A 3ZMUB 2ACXA 2JIWA 2HN2A 4KP3C 4J2CA 4ZI2D 2E8IA 5JDLA 2Q9QB 2YK0A 3LG7A 5DJQC 2XASB 5FY7A 3MA9A 5F5WA 2JPFA 3EABA 1UURA 3RF1A 5FVKA 2D2SA 1SHZC 1T8BA 2XQAA 2XM1A 1OEDC 1Y01A 2Z6EA 3FXDB 3LBXA 4HFEA 5LJNA 2YN6A 5L2LA 3UU5A 4IGUA 1NENA 2D9DA 5AQPB 2D0TA 2ODUA 1J5WA 3F2EA 2E9XA 4QX8B 2IC6A 5JQGE 4Q25A 3ABVA 2UXCT 5LGTB 2VL0A 2JQHA 3OYZA 4PK4A 4AQFA 2X0YA 3A7MA 4LF5T 4QKNA 3L3PA 4UF0B 2J4GA 5CA1E 5LGUB 2CE7A 3FXEB 1MNDA 3RI5A 4U7IA 3UTKA 4DV2T 4AQYT 4L5GA 3JAFA 4DBRA 2W62A 2XQ9A 3M65A 1HNWT 4UR9A 2BKPA 5AQJB 3VU7H 4H9OC 2N2NA 2L3LA 2MOZA 5C3JA 5GONE 2XZEA 2K3WA 2ES0A 4UV9B 2V5CA 4L9IA 4DIDB 2LSKA 4V1Av 5AQUB 4O4JE 4LMJA 4P09A 4UXNB 5JR9C 4MALA 4TUYE 2Y8DA 2JJ9A 4CN1A 5JRCA 2VURA 2DNXA 4CZZB 1MIYA 4ZI7E 2BVMA 3F57A 3RH3A 2XJ7A 3HI2A 1W0BA 3N2GE 1V9DA 4O4LE 2BG9A 4QWNB 2YINA 4CN4A 4LMKA 4DMWA 4ILBA 5ADXL 4AKGA 2H7VC 1ZV4X 1NEKA 4A98A 1YD8G 4U72A 3AE5A 2LM2A 4O4HE 1YQ4A 2PFVA 5FXWA 1HR0T 2I59A 3U3IA 3AAIA 2A72A 5ABFB 2VB6A 2X0LB 4WZXA 1UUSA 3GN5A 4AQFC 5ABFA 2ZM6T 4EEBA 3IBPA 4DV6T 3O1JA 4YSXA 1XZYA 2FJBA 5L47A 3J7Yq 4H9NC 3FZFB 1QUUA 3R84B 3HKEE 5LG3A 2FJEA 3PUWF 4HFDA 3VRBA 3T1HT 4X65T 2E9XC 2WM9A 2MPKA 3CVRA 4QXHB 1D0ZA 2HH7A 4DVDA 3DJBA 4M1PA 5LA6E 4YXDA 3ZC0A 3RKGA 2XQ4A 3CX8B 5AQSB 3AEAA 3RGLA 2XAFB 3UUBA 2H89A 5IHYA 2WZIA 5AQNB 2CWOA 3AEBA 3LFMA 3LDQB 4H9SE 1M7KA 4JI7T 2B76A 2Y6XA 4O2AE 2X67A 3ZMSB 4AXPA 2EHOB 4JLEA 5L4HA 2QYWA 3Q5DA 3TLWA 2LSJA 2V7IA 5AQFB 3ZT7A 2DI4A 2XAHB 4YHJA 3JADA 4HWFA 2V6YB 2R6GF 3L09A 4PJNA 3CQCB 3I0QA 4DBQA 4EEDA 2V7JA 2J47A 2YDQA 3HKDE 4YHHT 4GIWA 5AQRB 1FJGT 2H7OA 3B57A 4DR3T 5H6RB 1IBMT 2D5UA 1OXZA 2M6BA 3O1IA 2XSBA 2YU1A 3ZSSA 4DV7T 1WR6A 3E0ZA 1HX1B 2WU5A 1MIWA 3VR8A 5KXJA 2P9BA 1HS7A 2XAJB 1FMVA 1T98A 2WMNA 4JI6T 2VKJA 1YW0A 2YOEA 1VCSA 3C64A 3CX7B 4U2YA 2V1DB 3AVSA 3ANWB 3KVBA 3PUVF 5JDGA 3OPCA 1HG5A 4CXYA 5AQOB 3JC6D 3P4RA 3HL6A 4HTEA 2IMLA 4NIQA 5ABGA 1MMAA 4UELA 4KBMB 4AKLA 4GYSA 3KBUA 2EHOD 2XSAA 4X1KE 3P4SA 1UGOA 3LK3B 4FI5A 5LBQB 4ZZCA 4XBFB 2JQQA 3GWHA 1YKHB 2BG9E 2LE8A 4ZOLE 2NW8A 1ZOYA 5HCMA 4YY3T 2HHHT 3X1DA 2HPJA 3V5SA 1WRDA 5AQKB 5C8YE 4XZCA 1KNPA 2VQET 1HNXT 1HCIA 3IA3A 1N33T 2A3DA 5AQLB 3AE6A 5JDMA 3IEEA 5IUXA 4DV1T 1HFAA 3I9WA 3ONLC 4X1IE 3UQ7A 4HFBA 2W67A 3ZN0B 3D0TA 2C0SA 4YT0A 3N9PA 2LRKA 4KUMB 2UXNB 2XQ6A 4TZ4C 4KX6A 4IREA 5C2TA 2BG9B 1HNZT 4B3MT 2E5VA 3M3ZB 1US7B 2KNDA 1WLXA 2KSRA 3NVOA 4H9RC 4PJLA 4AQGA 4DV3T 2LOSA 4QH1A 2RP4A 4I50E 3VRAA 2E9XB 1E1HB 4ISSA 2X9XA 2J1DG 2VKHA 3OVUA 5JDNA 3RYIE 4QHOA 3QK6A 3LSVA 3L39A 2NW9A 4I55E 4IIJE 2UUAT 4TN7B 2QGSA 3FZMB 3B13A 4E7SA 2BBHA 3HR0A 3UFGA 3ZYKA 4C91A 2LT3A 2K48A 2Q9QA 1VCTA 4P0BA 1W9RA 4A97A 4JI3T 4DUZT 4NPPA 1D0XA 5HXHA 2CXFA 2L9QA 4UVBB 3C51A 3P8CD 4IE4A 2W63A 4PJMA 5HEGA 4DO0A 4YSZA 4PW8A 2LM9A 5HAXA 1M62A 2WWUA 3CWZB 4DNDA 1D0YA 3RQUA 4TWDA 2CMRA 5FY1A 3ZYLA 5LHIB 2ZM2A 4IHJE 5ABEA 2KINB 2XTLA 5JRCB 1KNRA 5LHGB 5HCJA 3LBXB 2VKDA 1MMDA 3UUXB 3NBXX 2FBWA 2WSSV 3QNUA 1T7SA 4CQIA 3I1AA 1G8XA 3CKDA 5JTGA 3I0OA 5L3BB 2MTQA 4ERRA 2V7MA 2XQ7A 4BAYB 1L0VA 2B1EA 2Q9QD 3KV4A 2DL1A 4HWCA 5HXSA 2X0HA 2JRKA 5HYAA 1UX5A 1W0AA 3R6NA 1XNRT 4UF0A 1OEDE 3WAJA 1S94A 4MLKA 4B3TT 1ZHCA 3OJAA 2ODVA 5JR9A 4DUYT 1KK7A 1UCUA 3MJXA 4DMVA 2FUPA 4HWHA 5AQHB 2ZM8A 1G73A 1XDOA 3FBLA 3RYFE 5FMNA 2CHNA 2V8SV 5L3EB 4U74A 2PTFA 2CCQA 3IF8B 3QC9A 5LCYA 3AE7A 1BR2A 3W15B 3A8YC 3AE4A 3K8PC 5DABA 2HN1A 4YFSA 1VRBA 3O4XE 1J1JA 5L3FB 3AEEA 1Z0PA 3CMLA 3MACA 2VVSA 3P4WA 4HE8A 4H9PC 3MXZA 4UV8B 4YTMA 2MYSA 4PNIA 4ZI3C 1WFDA 5LB7B 4WW0A 4NUUA 3E08A 4TWHA 2MBGA 3ZJ1A 2LSIA 2XQYA 3RQWA 3E22E 1ZEEA 2CLYC 2OV9A 4HFCA 2WP9A 3AE8A 3AEGA 5AQVB 5L3CB 1D1BA 4LFCT 3LK42 2WDVA 1ZKEA 2X51A 4NXMT 2X9WA 4PAGA 4UIGA 4TWFA 4X62T 5J2TE 3PURA 3NWIA 2CBJA 5FYMA 4B3RT 2A9UA 2PBIA 5LNKA 2K9AA 2IW5B 5JH7E 4MFRA 1KEYA 3ZCIA 3KV6A 3LK2B 2FJDA 2PJQA 3MZKB 3AVRA 4UEMA 3RIUA 3UU6A 4ZEYA 3N2OA 2N9DA 1KF6A 5LOVE 3PJAA 2LJLA 1IBKT 2ZLYA 1CHUA 3UU8A 3DTOA 5AFUL 4IE0A 1W09A 2XM2A 2IIUA 3PUGA 4P1NA 5LGNB 2YDSA 4JUYA 2E9XD 5ETWA 3EAMA 4OFZA 3RPUA 3U78A 4OYJA 2JMHA 2IUBA 4Z8XA 3PU8A 2ZM0A 5LBMA 4LF8T 1NAFA 5H6QB 2I0MA 2WWVA 3RC3A 5HEHA 4BJMA 3Q5WA 4GKKT 2WZHA 3PV0F 4K0UA 2BKOA 1BR4A 2XQ5A 4DV4T 3SRZA 1WCRA 5FXZA 3ZSTA 4CI1B 5HEJA 3AAEB 4X5TA 1FEWA 1XWMA 5LXTE 3OBVE 3RHWA 2BVLA 3OKQA 2ZMAA 5AQTB 3RIUC 3SWHA 4CXXA 3CK6A 2WCAA 4I43B 4JI4T 1FMWA 4IDNA 4IL9A 4B6XA 2X9YA 5AQQB 3ANWA 3N9MA 4WYVA 2KMFA 3BK9A 3PDYA 2WDRA 3AA6B 1DU2A 3N9LA 5L4EA 2OLTA 3BQIA 4AI6A 2CHOA 4CN6A 4YJ2E 2BS3A 5KX5E 1WYCA 1S35A 3C4WA 3L8RA 1HX8A 2WS3A 3SFDA 1LVKA 3UQ4A 1ZP0A 3UUNA 5DQVA 3KBTA 3KV5A 1OWAA 2PG8A 1E7PA 3J9X1 2W61A 1MNEA 3K3NA 4HN9A 4ZS3A 2XHEB 5AQGB 2HPLA 1FIOA 3JC6C 3PUSA 4IE7A 2UU9T 2LLYA 5AQIB 2C5JA 4ANJA 1JNRA 2WU2A 5LJMA 3VHLA 3DP7A 3N9QA 3IHRA 4FJOA 1LVFA 3ZCJA 3C98B 2LKGA 4CI2B 3PU3A 1B7TA 1D1CA 3RLFF 4AKRB 3Q5EA 1MMNA 3K3QC 4X64T 2BDEA 2XAQB 3KVAA 3KINB 1BR0A 4HFVA 5EK4A 4KI0F 2V7KA 5F3JA 3AXJA 3NZPA 1SA0E 1Z8UA 2DCFA 2SPCA 3RIFA 3UUMA 4QH5A 3AA7B 4X1YE 2NWBA 4GYRA 3TKLB 3ESLA 2WAUA 4YTPA 2LEHA
chains in the Genus database with same CATH topology
1X79A 4G63A 2NP9A 2OA5A 4IDZA 4GOUA 3AA0B 3WAKA 3Q9DA 5FXVA 3O9XA 3RC8A 4MBQA 3N5LA 3C4ZA 2D0UA 4L0RA 2LOPA 3ONXA 5KDMC 5HWYA 3K3OA 3ETUA 3VKHA 1KNZA 1VOMA 4ZS2A 2KWHA 5E0OA 4ILUA 5JDFA 3I9YA 4E7ZA 2VL8A 5KMGP 5FNVE 5HWXA 2H3RA 4I4TE 5J2UE 1IAPA 4ZHQE 3CPZA 5FY0A 3RRCA 4QXCB 2KZ7B 3UFEA 4C90A 3CX6B 2DWKA 3ZMZB 4A56A 3FHNA 3MK7C 1CUNA 4JEHB 4O4IE 4QX7B 4OK0A 2DHRA 2KT9A 5FXXA 2K24A 3RYCE 2XAGB 5DQWA 2EHOC 2X68A 1D1AA 3FBZA 4PFPA 3GMIA 1IZNB 2NW7A 2DWGA 3AB3B 3CQXC 4PFOA 4WNKA 3F31A 1MIVA 4H63V 2A2FX 2CA5A 5EZYE 4YLHA 2YU2A 4EXTA 3KDSE 5M4YA 3VKGA 2UXXB 3N9NA 4H9QC 4EB6E 3V5UA 5CA0E 3BQKA 3RX6A 4EYYR 3ETVA 3UT5E 3NZQA 5HXRA 1O3XA 1YKEB 2L8KA 2WBLA 1HTJF 1NWMX 4ADZA 4EAHA 3A5XA 3WI3A 2GK9A 4GK0E 1U5PA 2CEAA 4YJ3E 4EOZB 5LP6E 5BMVE 4TV8E 4JEUB 2YEVC 3C50A 4O8SA 2QA7A 4AKIA 2VK9A 3T8OA 2Y48B 3EDVA 4PJJA 2EHOA 2LSGA 2IAKA 5L3DB 4WBOA 4NUVA 5LG4A 2LHRA 1HF8A 5JDHA 2CM0A 3PTRB 3S4UA 4UVCB 3ZEFB 3C4XA 5CB4E 4EYUA 1H7CA 1QSDA 3LJCA 4EZ4A 5LYJE 5JREA 4AKHA 4XAXB 2W0GA 5JVDE 4IE6A 2XUEA 3CQGB 2CWYA 3EUHA 5J1GA 3GN5B 5LHHB 3AA1B 2CXLA 4TV9E 3BQLA 4UVAB 4HEAA 3N9OA 1BR1A 4BJNA 2CLYB 2LSYA 3ZMVB 1U4QA 1AJ3A 4EZHA 1EZ3A 1UX4A 2VASA 2Q9QC 4ZI2C 3PUQA 4WBNE 3H3AA 3HKCE 1IJ5A 3RRWA 4KMCA 5EK3A 2KXPB 5EK2A 2X66A 5JDQA 2G0UA 4X20E 3RKOA 3PUAA 2BZBA 4IE5A 1HG2A 3HKBE 4F6RC 2NTYA 2NTXA 2WMOA 5HXEA 2X9HA 1IJ6A 4EIWA 4P0AA 4N78D 4HKAA 2C5IT 3KFWX 2W00A 1Y64B 1LKXA 4OHFA 3ZYMA 3ZMTB 1LRZA 3HA4A 4OYKA 4CXWA 4O2BE 4TX5A 3FB2A 2VKOA 4G2AA 1WYBA 2V7LA 3NRYA 2NOXA 2KWIB 3ZJ2A 3MKDA 4PK5A 2N1GA 2RA1A 5FP3A 5JR9B 2CXDA 2LHNA 3EDUA 3KV9A 3EVYA 3GA8A 3SS1A 5L3GB 4PK6A 3ZLIA 4GK5E 4BA9A 4QXBB 2VWAA 3P7IA 3UULA 4ZI3D 4ISTA 4MHCA 5IYZE 2K5BB 4CI3B 3ZC1A 2JMKA 3SOLA 4HGAA 5HXCA 2V26A 3H37A 3PE0A 4ASKA 3O1HA 3AAAB 3RYHE 2DLRA 3Q5XA 3ZN1B 3OYXA 1MMGA 2C5KT 3ZPOA 2IC9A 2M67A 4H63H 3N2KE 3Q2MA 5A1LA 5TAOA 5F8PA 2KLQA 3NRXA 3QUJA 3ZMUB 4ZI2D 2ACXA 4KP3C 4J2CA 5JDLA 2E8IA 2Q9QB 2YK0A 3LG7A 5DJQC 2XASB 5FY7A 3MA9A 2JPFA 2D2SA 1SHZC 2Z6EA 3LBXA 3FXDB 5LJNA 5L2LA 4IGUA 2D0TA 2ODUA 3F2EA 4QX8B 2E9XA 2IC6A 5JQGE 5LGTB 3OYZA 4PK4A 4AQFA 4QKNA 3L3PA 4UF0B 5LGUB 5CA1E 2CE7A 3FXEB 1MNDA 3UTKA 4L5GA 4DBRA 2W62A 3M65A 3VU7H 4H9OC 2N2NA 2L3LA 2MOZA 5GONE 2ES0A 4UV9B 4L9IA 2LSKA 4V1Av 5JR9C 4O4JE 4P09A 4UXNB 4MALA 4TUYE 2Y8DA 2JJ9A 5JRCA 4CZZB 2DNXA 1MIYA 4ZI7E 3F57A 2BVMA 3RH3A 3HI2A 3N2GE 4O4LE 1V9DA 4DMWA 4QWNB 5ADXL 2YINA 4AKGA 2H7VC 1ZV4X 1YD8G 4U72A 4O4HE 2PFVA 5FXWA 2I59A 3U3IA 3AAIA 2A72A 2VB6A 2X0LB 3GN5A 4AQFC 3IBPA 3O1JA 3J7Yq 4H9NC 1QUUA 3R84B 3HKEE 2E9XC 2WM9A 3CVRA 4QXHB 4DVDA 1D0ZA 2HH7A 3DJBA 4M1PA 5LA6E 3ZC0A 3CX8B 2XAFB 5IHYA 2CWOA 4H9SE 3LFMA 2Y6XA 4O2AE 2X67A 3ZMSB 4AXPA 2EHOB 4JLEA 2LSJA 2V7IA 2DI4A 2XAHB 4YHJA 3L09A 4PJNA 3CQCB 3I0QA 4DBQA 2V7JA 3HKDE 4GIWA 2H7OA 3B57A 5H6RB 2D5UA 1OXZA 3O1IA 2YU1A 1WR6A 3E0ZA 1MIWA 1HS7A 2P9BA 2XAJB 1FMVA 1T98A 2WMNA 2VKJA 3CX7B 1YW0A 3C64A 5LBQB 2V1DB 3AVSA 3ANWB 3KVBA 5JDGA 1HG5A 4CXYA 3JC6D 3HL6A 4HTEA 1MMAA 4UELA 4KBMB 4AKLA 4GYSA 3KBUA 2EHOD 4X1KE 3LK3B 4FI5A 4XBFB 2JQQA 3GWHA 1YKHB 2LE8A 4ZOLE 2NW8A 2HPJA 3V5SA 1WRDA 5C8YE 4XZCA 1HCIA 2A3DA 5JDMA 3IEEA 1HFAA 3I9WA 4X1IE 3ZN0B 3D0TA 2C0SA 3N9PA 4KUMB 2UXNB 4TZ4C 1US7B 2KNDA 1WLXA 4H9RC 4AQGA 4PJLA 2LOSA 2RP4A 4I50E 2E9XB 1E1HB 4ISSA 2X9XA 2J1DG 2VKHA 5JDNA 3RYIE 4QHOA 3QK6A 2NW9A 4I55E 4IIJE 4TN7B 2QGSA 3B13A 4E7SA 3HR0A 3ZYKA 4C91A 2LT3A 2K48A 2Q9QA 4P0BA 1D0XA 5HXHA 2CXFA 2L9QA 4UVBB 3C51A 3P8CD 4IE4A 2W63A 4PJMA 4DO0A 4PW8A 2LM9A 5HAXA 2WWUA 3CWZB 4DNDA 1D0YA 2CMRA 5FY1A 3ZYLA 5LHIB 2ZM2A 4IHJE 2KINB 2XTLA 5JRCB 5LHGB 3LBXB 2VKDA 1MMDA 3UUXB 3NBXX 2WSSV 4CQIA 3I1AA 1G8XA 3CKDA 3I0OA 5L3BB 2MTQA 4ERRA 2V7MA 4BAYB 2B1EA 2Q9QD 3KV4A 5HXSA 2JRKA 5HYAA 1UX5A 3R6NA 4UF0A 3WAJA 1S94A 4MLKA 1ZHCA 3OJAA 2ODVA 5JR9A 1KK7A 1UCUA 3MJXA 4DMVA 2ZM8A 1G73A 3FBLA 3RYFE 5FMNA 5L3EB 4U74A 3QC9A 2CCQA 3IF8B 5LCYA 3W15B 1BR2A 3K8PC 5DABA 4YFSA 1VRBA 3O4XE 5L3FB 3CMLA 1Z0PA 4HE8A 3MACA 4UV8B 4H9PC 3MXZA 4ZI3C 2MYSA 4PNIA 2MBGA 3ZJ1A 4WW0A 4NUUA 3E08A 2LSIA 2XQYA 3E22E 1ZEEA 2CLYC 5L3CB 1D1BA 3LK42 1ZKEA 2X51A 2X9WA 4PAGA 4UIGA 5J2TE 3PURA 5FYMA 2PBIA 5LNKA 2K9AA 2IW5B 5JH7E 4MFRA 3ZCIA 3KV6A 3LK2B 2PJQA 3MZKB 3AVRA 4UEMA 3N2OA 2N9DA 5LOVE 2LJLA 2ZLYA 5AFUL 3DTOA 4IE0A 3PUGA 5LGNB 4JUYA 3RPUA 2E9XD 5ETWA 4OFZA 3U78A 4OYJA 2JMHA 4Z8XA 3PU8A 2ZM0A 5LBMA 1NAFA 5H6QB 4BJMA 3RC3A 3Q5WA 4K0UA 1BR4A 3SRZA 5FXZA 4CI1B 3AAEB 1FEWA 5LXTE 3OBVE 2BVLA 3OKQA 2ZMAA 3SWHA 4CXXA 4I43B 1FMWA 4B6XA 2X9YA 3ANWA 3N9MA 2KMFA 3BK9A 3PDYA 3AA6B 3N9LA 3BQIA 4AI6A 4YJ2E 5KX5E 1WYCA 1S35A 3C4WA 1HX8A 1LVKA 3UUNA 5DQVA 3KBTA 3KV5A 1OWAA 2PG8A 3J9X1 2W61A 1MNEA 3K3NA 4HN9A 4ZS3A 2XHEB 2HPLA 1FIOA 3JC6C 3PUSA 4IE7A 2C5JA 4ANJA 5LJMA 3VHLA 3DP7A 3N9QA 3IHRA 4FJOA 1LVFA 3ZCJA 3C98B 4CI2B 3PU3A 1B7TA 1D1CA 4AKRB 1MMNA 3K3QC 2BDEA 2XAQB 3KVAA 3KINB 1BR0A 4HFVA 5EK4A 2V7KA 5F3JA 3NZPA 1SA0E 2DCFA 2SPCA 3UUMA 3AA7B 4X1YE 2NWBA 4GYRA 3TKLB 3ESLA 2WAUA 2LEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NWM X;  1WRD A;  1NAF A;  1X79 A;  1OXZ A;  2N2N A;  1WR6 A;  1YD8 G;  1O3X A;  2N9D A; 
#chains in the Genus database with same CATH topology
 4TNW A;  1X79 A;  4G63 A;  2NP9 A;  2OA5 A;  4IDZ A;  4ZZB A;  2BKN A;  4GOU A;  3AA0 B;  3WAK A;  1T72 A;  3B5M A;  3FZK B;  3Q9D A;  4MBQ A;  5FXV A;  3O9X A;  3RC8 A;  2YKS A;  4U33 A;  3N5L A;  2CPT A;  2D0U A;  3AED A;  3C4Z A;  4L0R A;  2LOP A;  3ONX A;  5KDM C;  4JI2 T;  5HWY A;  4YSY A;  3AE3 A;  3K3O A;  3ETU A;  4I0U A;  1KNZ A;  3VKH A;  1VOM A;  4ZS2 A;  2KWH A;  3PUZ F;  2JQ9 A;  4ILU A;  3I9Y A;  2AE9 A;  5E0O A;  5JDF A;  1OED A;  2VL8 A;  4E7Z A;  2XY8 B;  4Z90 A;  3H3M A;  3P4Q A;  4TNV A;  5KMG P;  5FNV E;  3RIA A;  5HWX A;  4IT4 A;  2H3R A;  4I4T E;  4LFB T;  1GQE A;  1YQ3 A;  4JI0 T;  5J2U E;  2MAW A;  1IAP A;  3P4P A;  3CPZ A;  4ZHQ E;  5FY0 A;  3RRC A;  5CJ5 A;  4DR7 T;  4QXC B;  2KZ7 B;  3UFE A;  4C90 A;  4LF9 T;  2UXB T;  3CX6 B;  2DWK A;  3ZMZ B;  3ZT5 A;  5FL0 A;  4A56 A;  5CFB A;  3FHN A;  3MK7 C;  1CUN A;  2CBI A;  4JEH B;  4HFH A;  4O4I E;  4QX7 B;  4OK0 A;  4Z91 A;  3UU3 A;  4JI8 T;  2DHR A;  2KT9 A;  5FXX A;  2K24 A;  1E2A A;  3RYC E;  2XAG B;  4HWI B;  5DQW A;  2EHO C;  2X68 A;  2XPK A;  4DR1 T;  4B3S T;  1D1A A;  3FBZ A;  4PFP A;  5HEU A;  3GMI A;  1IZN B;  2NW7 A;  2DWG A;  1N32 T;  4K0K T;  2W66 A;  3AB3 B;  1XMQ T;  4KHP T;  3CQX C;  2YDR A;  4PFO A;  3F31 A;  1MIV A;  4H63 V;  4WNK A;  3TLV A;  2A2F X;  2CA5 A;  5EZY E;  4QH4 A;  3TLT A;  1X9B A;  4EGW A;  2RPA A;  4YLH A;  5CGM A;  2YU2 A;  4HFI A;  4EXT A;  3KDS E;  5M4Y A;  2J62 A;  1R8I A;  3VKG A;  1SE7 A;  2UXX B;  3N9N A;  4H9Q C;  4EB6 E;  3V5U A;  5CA0 E;  3BQK A;  3RX6 A;  4EYY R;  3AXJ B;  5J0Z A;  3ETV A;  3UT5 E;  2VVN A;  3NZQ A;  5HXR A;  1O3X A;  1YKE B;  1YXR A;  2L8K A;  3SFE A;  5ABH A;  2VQF T;  2WBL A;  1HTJ F;  1NWM X;  2BBJ A;  4ADZ A;  4EAH A;  4JV5 T;  3A5X A;  3WI3 A;  2GK9 A;  4GK0 E;  2W4X A;  2V5D A;  1U5P A;  3AE2 A;  2CEA A;  4YJ3 E;  4EOZ B;  5LP6 E;  5AQM B;  5BMV E;  5LMN T;  4TV8 E;  4X66 T;  4JEU B;  2YEV C;  3C50 A;  5LMU T;  4O8S A;  2QA7 A;  4AKI A;  2VK9 A;  3FZL B;  3T8O A;  3UU4 A;  4JYA T;  1XDP A;  2Y48 B;  3EDV A;  4PJJ A;  2EHO A;  2IHR 1;  2M6I A;  1KFY A;  2LSG A;  2IAK A;  5L3D B;  4WBO A;  4NUV A;  5LG4 A;  2LHR A;  1I94 T;  1HF8 A;  5JDH A;  4DV0 T;  4DR4 T;  4IDQ A;  2CM0 A;  2I6H A;  3EI0 A;  3PTR B;  3S4U A;  2NR4 A;  4UVC B;  3ZEF B;  3C4X A;  3JCF A;  5CB4 E;  4COF A;  4EYU A;  4DR6 T;  1H7C A;  1QSD A;  3LJC A;  4EZ4 A;  5LYJ E;  1I6Z A;  5JRE A;  4AKH A;  2CRB A;  4IDO A;  4XAX B;  2W0G A;  5JVD E;  4IE6 A;  2V6Y A;  2XUE A;  3CQG B;  2CWY A;  3EUH A;  5J1G A;  3GN5 B;  4A5X A;  5LHH B;  1XMO T;  3AA1 B;  4LF4 T;  2CXL A;  1QLB A;  4U31 A;  2UUC T;  3G06 A;  4TV9 E;  4DR2 T;  3PUY F;  2H88 A;  3BQL A;  2UUB T;  4UVA B;  3P50 A;  4HEA A;  3N9O A;  3QB5 K;  1BR1 A;  4BJN A;  1N36 T;  2E2A A;  2CLY B;  3TLS A;  2LSY A;  3ZMV B;  4EV6 A;  1U4Q A;  1AJ3 A;  4EZH A;  1EZ3 A;  3AE9 A;  1UX4 A;  5HEO A;  2VAS A;  2Q9Q C;  4IDP A;  4ZI2 C;  3PUQ A;  1N34 T;  4WBN E;  3K1S A;  2JQK A;  2WB5 A;  3H3A A;  3HKC E;  1XNQ T;  2QVA A;  1IJ5 A;  3RRW A;  4KHZ F;  4KMC A;  4YTN A;  5EK3 A;  2KXP B;  5FVL A;  5EK2 A;  2X66 A;  5JDQ A;  2BS2 A;  2G0U A;  4X20 E;  3RKO A;  3PJA J;  3FZH B;  2BG9 C;  4AIS A;  3PUA A;  2BZB A;  3ZKR A;  5BR8 T;  1OED B;  4IE5 A;  3T1Y T;  1HG2 A;  2QRX A;  3HKB E;  4F6R C;  2NTY A;  2NTX A;  2W2U A;  3AEC A;  2LRL A;  2WMO A;  4JI5 T;  5HXE A;  2X9H A;  1IJ6 A;  4EIW A;  4P0A A;  4N78 D;  4HKA A;  2C5I T;  3KFW X;  2W00 A;  1Y64 B;  3AEF A;  4LML A;  1LKX A;  4OHF A;  3ZYM A;  3ZMT B;  1LRZ A;  2WQY A;  3HA4 A;  4OYK A;  4AIU A;  4O2B E;  4TX5 A;  3FB2 A;  4U2Z A;  4CXW A;  2UXD T;  1J5E T;  4U7Y A;  2VKO A;  2ACZ A;  4G2A A;  1WYB A;  3QB5 A;  2FJA A;  4IL4 A;  4U3C A;  4DV5 T;  4NXN T;  1SUM B;  2V7L A;  3NRY A;  4ILA A;  4JBW F;  2NOX A;  2KWI B;  3ZJ2 A;  1UK5 A;  3MKD A;  4PK5 A;  3ONJ A;  3NKZ A;  5FL1 A;  2N1G A;  1JNZ A;  2RA1 A;  2V6X A;  5FP3 A;  5JR9 B;  2CXD A;  2LHN A;  2AXD S;  3EDU A;  3EVY A;  3GA8 A;  3CIR A;  3KV9 A;  3SS1 A;  5L3G B;  3PUX F;  2BS4 A;  4HWD A;  4PK6 A;  3ZLI A;  3ZT6 A;  2WY2 A;  3QOF A;  4LF6 T;  4GK5 E;  4BA9 A;  4QXB B;  2VWA A;  3P7I A;  3UUL A;  3VR9 A;  4IST A;  4MHC A;  4ZI3 D;  2XQ8 A;  4ILC A;  2E5L T;  5FKY A;  5IYZ E;  2K5B B;  2WDQ A;  4CI3 B;  3ZC1 A;  2JMK A;  3SOL A;  2XQ3 A;  3TLU A;  3OTO T;  2F4V T;  4HGA A;  4JI1 T;  5HXC A;  4LF7 T;  2V26 A;  4LFA T;  1WR0 A;  3H37 A;  3PE0 A;  4ASK A;  4DR5 T;  3EHZ A;  3O1H A;  3AAA B;  3RYH E;  1IBL T;  2DLR A;  4OX9 T;  3Q5X A;  3ZN1 B;  3OYX A;  2IDO B;  5IWA T;  1MMG A;  2C5K T;  3JAE A;  3ZPO A;  4F8H A;  2IC9 A;  2M67 A;  4H63 H;  3N2K E;  2LKH A;  3Q2M A;  5A1L A;  5TAO A;  5F8P A;  4ZXL A;  2KLQ A;  3NRX A;  3QUJ A;  4GKJ T;  3AE1 A;  3ZMU B;  2ACX A;  2JIW A;  2HN2 A;  4KP3 C;  4J2C A;  4ZI2 D;  2E8I A;  5JDL A;  2Q9Q B;  2YK0 A;  3LG7 A;  5DJQ C;  2XAS B;  5FY7 A;  3MA9 A;  5F5W A;  2JPF A;  3EAB A;  1UUR A;  3RF1 A;  5FVK A;  2D2S A;  1SHZ C;  1T8B A;  2XQA A;  2XM1 A;  1OED C;  1Y01 A;  2Z6E A;  3FXD B;  3LBX A;  4HFE A;  5LJN A;  2YN6 A;  5L2L A;  3UU5 A;  4IGU A;  1NEN A;  2D9D A;  5AQP B;  2D0T A;  2ODU A;  1J5W A;  3F2E A;  2E9X A;  4QX8 B;  2IC6 A;  5JQG E;  4Q25 A;  3ABV A;  2UXC T;  5LGT B;  2VL0 A;  2JQH A;  3OYZ A;  4PK4 A;  4AQF A;  2X0Y A;  3A7M A;  4LF5 T;  4QKN A;  3L3P A;  4UF0 B;  2J4G A;  5CA1 E;  5LGU B;  2CE7 A;  3FXE B;  1MND A;  3RI5 A;  4U7I A;  3UTK A;  4DV2 T;  4AQY T;  4L5G A;  3JAF A;  4DBR A;  2W62 A;  2XQ9 A;  3M65 A;  1HNW T;  4UR9 A;  2BKP A;  5AQJ B;  3VU7 H;  4H9O C;  2N2N A;  2L3L A;  2MOZ A;  5C3J A;  5GON E;  2XZE A;  2K3W A;  2ES0 A;  4UV9 B;  2V5C A;  4L9I A;  4DID B;  2LSK A;  4V1A v;  5AQU B;  4O4J E;  4LMJ A;  4P09 A;  4UXN B;  5JR9 C;  4MAL A;  4TUY E;  2Y8D A;  2JJ9 A;  4CN1 A;  5JRC A;  2VUR A;  2DNX A;  4CZZ B;  1MIY A;  4ZI7 E;  2BVM A;  3F57 A;  3RH3 A;  2XJ7 A;  3HI2 A;  1W0B A;  3N2G E;  1V9D A;  4O4L E;  2BG9 A;  4QWN B;  2YIN A;  4CN4 A;  4LMK A;  4DMW A;  4ILB A;  5ADX L;  4AKG A;  2H7V C;  1ZV4 X;  1NEK A;  4A98 A;  1YD8 G;  4U72 A;  3AE5 A;  2LM2 A;  4O4H E;  1YQ4 A;  2PFV A;  5FXW A;  1HR0 T;  2I59 A;  3U3I A;  3AAI A;  2A72 A;  5ABF B;  2VB6 A;  2X0L B;  4WZX A;  1UUS A;  3GN5 A;  4AQF C;  5ABF A;  2ZM6 T;  4EEB A;  3IBP A;  4DV6 T;  3O1J A;  4YSX A;  1XZY A;  2FJB A;  5L47 A;  3J7Y q;  4H9N C;  3FZF B;  1QUU A;  3R84 B;  3HKE E;  5LG3 A;  2FJE A;  3PUW F;  4HFD A;  3VRB A;  3T1H T;  4X65 T;  2E9X C;  2WM9 A;  2MPK A;  3CVR A;  4QXH B;  1D0Z A;  2HH7 A;  4DVD A;  3DJB A;  4M1P A;  5LA6 E;  4YXD A;  3ZC0 A;  3RKG A;  2XQ4 A;  3CX8 B;  5AQS B;  3AEA A;  3RGL A;  2XAF B;  3UUB A;  2H89 A;  5IHY A;  2WZI A;  5AQN B;  2CWO A;  3AEB A;  3LFM A;  3LDQ B;  4H9S E;  1M7K A;  4JI7 T;  2B76 A;  2Y6X A;  4O2A E;  2X67 A;  3ZMS B;  4AXP A;  2EHO B;  4JLE A;  5L4H A;  2QYW A;  3Q5D A;  3TLW A;  2LSJ A;  2V7I A;  5AQF B;  3ZT7 A;  2DI4 A;  2XAH B;  4YHJ A;  3JAD A;  4HWF A;  2V6Y B;  2R6G F;  3L09 A;  4PJN A;  3CQC B;  3I0Q A;  4DBQ A;  4EED A;  2V7J A;  2J47 A;  2YDQ A;  3HKD E;  4YHH T;  4GIW A;  5AQR B;  1FJG T;  2H7O A;  3B57 A;  4DR3 T;  5H6R B;  1IBM T;  2D5U A;  1OXZ A;  2M6B A;  3O1I A;  2XSB A;  2YU1 A;  3ZSS A;  4DV7 T;  1WR6 A;  3E0Z A;  1HX1 B;  2WU5 A;  1MIW A;  3VR8 A;  5KXJ A;  2P9B A;  1HS7 A;  2XAJ B;  1FMV A;  1T98 A;  2WMN A;  4JI6 T;  2VKJ A;  1YW0 A;  2YOE A;  1VCS A;  3C64 A;  3CX7 B;  4U2Y A;  2V1D B;  3AVS A;  3ANW B;  3KVB A;  3PUV F;  5JDG A;  3OPC A;  1HG5 A;  4CXY A;  5AQO B;  3JC6 D;  3P4R A;  3HL6 A;  4HTE A;  2IML A;  4NIQ A;  5ABG A;  1MMA A;  4UEL A;  4KBM B;  4AKL A;  4GYS A;  3KBU A;  2EHO D;  2XSA A;  4X1K E;  3P4S A;  1UGO A;  3LK3 B;  4FI5 A;  5LBQ B;  4ZZC A;  4XBF B;  2JQQ A;  3GWH A;  1YKH B;  2BG9 E;  2LE8 A;  4ZOL E;  2NW8 A;  1ZOY A;  5HCM A;  4YY3 T;  2HHH T;  3X1D A;  2HPJ A;  3V5S A;  1WRD A;  5AQK B;  5C8Y E;  4XZC A;  1KNP A;  2VQE T;  1HNX T;  1HCI A;  3IA3 A;  1N33 T;  2A3D A;  5AQL B;  3AE6 A;  5JDM A;  3IEE A;  5IUX A;  4DV1 T;  1HFA A;  3I9W A;  3ONL C;  4X1I E;  3UQ7 A;  4HFB A;  2W67 A;  3ZN0 B;  3D0T A;  2C0S A;  4YT0 A;  3N9P A;  2LRK A;  4KUM B;  2UXN B;  2XQ6 A;  4TZ4 C;  4KX6 A;  4IRE A;  5C2T A;  2BG9 B;  1HNZ T;  4B3M T;  2E5V A;  3M3Z B;  1US7 B;  2KND A;  1WLX A;  2KSR A;  3NVO A;  4H9R C;  4PJL A;  4AQG A;  4DV3 T;  2LOS A;  4QH1 A;  2RP4 A;  4I50 E;  3VRA A;  2E9X B;  1E1H B;  4ISS A;  2X9X A;  2J1D G;  2VKH A;  3OVU A;  5JDN A;  3RYI E;  4QHO A;  3QK6 A;  3LSV A;  3L39 A;  2NW9 A;  4I55 E;  4IIJ E;  2UUA T;  4TN7 B;  2QGS A;  3FZM B;  3B13 A;  4E7S A;  2BBH A;  3HR0 A;  3UFG A;  3ZYK A;  4C91 A;  2LT3 A;  2K48 A;  2Q9Q A;  1VCT A;  4P0B A;  1W9R A;  4A97 A;  4JI3 T;  4DUZ T;  4NPP A;  1D0X A;  5HXH A;  2CXF A;  2L9Q A;  4UVB B;  3C51 A;  3P8C D;  4IE4 A;  2W63 A;  4PJM A;  5HEG A;  4DO0 A;  4YSZ A;  4PW8 A;  2LM9 A;  5HAX A;  1M62 A;  2WWU A;  3CWZ B;  4DND A;  1D0Y A;  3RQU A;  4TWD A;  2CMR A;  5FY1 A;  3ZYL A;  5LHI B;  2ZM2 A;  4IHJ E;  5ABE A;  2KIN B;  2XTL A;  5JRC B;  1KNR A;  5LHG B;  5HCJ A;  3LBX B;  2VKD A;  1MMD A;  3UUX B;  3NBX X;  2FBW A;  2WSS V;  3QNU A;  1T7S A;  4CQI A;  3I1A A;  1G8X A;  3CKD A;  5JTG A;  3I0O A;  5L3B B;  2MTQ A;  4ERR A;  2V7M A;  2XQ7 A;  4BAY B;  1L0V A;  2B1E A;  2Q9Q D;  3KV4 A;  2DL1 A;  4HWC A;  5HXS A;  2X0H A;  2JRK A;  5HYA A;  1UX5 A;  1W0A A;  3R6N A;  1XNR T;  4UF0 A;  1OED E;  3WAJ A;  1S94 A;  4MLK A;  4B3T T;  1ZHC A;  3OJA A;  2ODV A;  5JR9 A;  4DUY T;  1KK7 A;  1UCU A;  3MJX A;  4DMV A;  2FUP A;  4HWH A;  5AQH B;  2ZM8 A;  1G73 A;  1XDO A;  3FBL A;  3RYF E;  5FMN A;  2CHN A;  2V8S V;  5L3E B;  4U74 A;  2PTF A;  2CCQ A;  3IF8 B;  3QC9 A;  5LCY A;  3AE7 A;  1BR2 A;  3W15 B;  3A8Y C;  3AE4 A;  3K8P C;  5DAB A;  2HN1 A;  4YFS A;  1VRB A;  3O4X E;  1J1J A;  5L3F B;  3AEE A;  1Z0P A;  3CML A;  3MAC A;  2VVS A;  3P4W A;  4HE8 A;  4H9P C;  3MXZ A;  4UV8 B;  4YTM A;  2MYS A;  4PNI A;  4ZI3 C;  1WFD A;  5LB7 B;  4WW0 A;  4NUU A;  3E08 A;  4TWH A;  2MBG A;  3ZJ1 A;  2LSI A;  2XQY A;  3RQW A;  3E22 E;  1ZEE A;  2CLY C;  2OV9 A;  4HFC A;  2WP9 A;  3AE8 A;  3AEG A;  5AQV B;  5L3C B;  1D1B A;  4LFC T;  3LK4 2;  2WDV A;  1ZKE A;  2X51 A;  4NXM T;  2X9W A;  4PAG A;  4UIG A;  4TWF A;  4X62 T;  5J2T E;  3PUR A;  3NWI A;  2CBJ A;  5FYM A;  4B3R T;  2A9U A;  2PBI A;  5LNK A;  2K9A A;  2IW5 B;  5JH7 E;  4MFR A;  1KEY A;  3ZCI A;  3KV6 A;  3LK2 B;  2FJD A;  2PJQ A;  3MZK B;  3AVR A;  4UEM A;  3RIU A;  3UU6 A;  4ZEY A;  3N2O A;  2N9D A;  1KF6 A;  5LOV E;  3PJA A;  2LJL A;  1IBK T;  2ZLY A;  1CHU A;  3UU8 A;  3DTO A;  5AFU L;  4IE0 A;  1W09 A;  2XM2 A;  2IIU A;  3PUG A;  4P1N A;  5LGN B;  2YDS A;  4JUY A;  2E9X D;  5ETW A;  3EAM A;  4OFZ A;  3RPU A;  3U78 A;  4OYJ A;  2JMH A;  2IUB A;  4Z8X A;  3PU8 A;  2ZM0 A;  5LBM A;  4LF8 T;  1NAF A;  5H6Q B;  2I0M A;  2WWV A;  3RC3 A;  5HEH A;  4BJM A;  3Q5W A;  4GKK T;  2WZH A;  3PV0 F;  4K0U A;  2BKO A;  1BR4 A;  2XQ5 A;  4DV4 T;  3SRZ A;  1WCR A;  5FXZ A;  3ZST A;  4CI1 B;  5HEJ A;  3AAE B;  4X5T A;  1FEW A;  1XWM A;  5LXT E;  3OBV E;  3RHW A;  2BVL A;  3OKQ A;  2ZMA A;  5AQT B;  3RIU C;  3SWH A;  4CXX A;  3CK6 A;  2WCA A;  4I43 B;  4JI4 T;  1FMW A;  4IDN A;  4IL9 A;  4B6X A;  2X9Y A;  5AQQ B;  3ANW A;  3N9M A;  4WYV A;  2KMF A;  3BK9 A;  3PDY A;  2WDR A;  3AA6 B;  1DU2 A;  3N9L A;  5L4E A;  2OLT A;  3BQI A;  4AI6 A;  2CHO A;  4CN6 A;  4YJ2 E;  2BS3 A;  5KX5 E;  1WYC A;  1S35 A;  3C4W A;  3L8R A;  1HX8 A;  2WS3 A;  3SFD A;  1LVK A;  3UQ4 A;  1ZP0 A;  3UUN A;  5DQV A;  3KBT A;  3KV5 A;  1OWA A;  2PG8 A;  1E7P A;  3J9X 1;  2W61 A;  1MNE A;  3K3N A;  4HN9 A;  4ZS3 A;  2XHE B;  5AQG B;  2HPL A;  1FIO A;  3JC6 C;  3PUS A;  4IE7 A;  2UU9 T;  2LLY A;  5AQI B;  2C5J A;  4ANJ A;  1JNR A;  2WU2 A;  5LJM A;  3VHL A;  3DP7 A;  3N9Q A;  3IHR A;  4FJO A;  1LVF A;  3ZCJ A;  3C98 B;  2LKG A;  4CI2 B;  3PU3 A;  1B7T A;  1D1C A;  3RLF F;  4AKR B;  3Q5E A;  1MMN A;  3K3Q C;  4X64 T;  2BDE A;  2XAQ B;  3KVA A;  3KIN B;  1BR0 A;  4HFV A;  5EK4 A;  4KI0 F;  2V7K A;  5F3J A;  3AXJ A;  3NZP A;  1SA0 E;  1Z8U A;  2DCF A;  2SPC A;  3RIF A;  3UUM A;  4QH5 A;  3AA7 B;  4X1Y E;  2NWB A;  4GYR A;  3TKL B;  3ESL A;  2WAU A;  4YTP A;  2LEH A; 
#chains in the Genus database with same CATH homology
 1X79 A;  4G63 A;  2NP9 A;  2OA5 A;  4IDZ A;  4GOU A;  3AA0 B;  3WAK A;  3Q9D A;  5FXV A;  3O9X A;  3RC8 A;  4MBQ A;  3N5L A;  3C4Z A;  2D0U A;  4L0R A;  2LOP A;  3ONX A;  5KDM C;  5HWY A;  3K3O A;  3ETU A;  3VKH A;  1KNZ A;  1VOM A;  4ZS2 A;  2KWH A;  5E0O A;  4ILU A;  5JDF A;  3I9Y A;  4E7Z A;  2VL8 A;  5KMG P;  5FNV E;  5HWX A;  2H3R A;  4I4T E;  5J2U E;  1IAP A;  4ZHQ E;  3CPZ A;  5FY0 A;  3RRC A;  4QXC B;  2KZ7 B;  3UFE A;  4C90 A;  3CX6 B;  2DWK A;  3ZMZ B;  4A56 A;  3FHN A;  3MK7 C;  1CUN A;  4JEH B;  4O4I E;  4QX7 B;  4OK0 A;  2DHR A;  2KT9 A;  5FXX A;  2K24 A;  3RYC E;  2XAG B;  5DQW A;  2EHO C;  2X68 A;  1D1A A;  3FBZ A;  4PFP A;  3GMI A;  1IZN B;  2NW7 A;  2DWG A;  3AB3 B;  3CQX C;  4PFO A;  4WNK A;  3F31 A;  1MIV A;  4H63 V;  2A2F X;  2CA5 A;  5EZY E;  4YLH A;  2YU2 A;  4EXT A;  3KDS E;  5M4Y A;  3VKG A;  2UXX B;  3N9N A;  4H9Q C;  4EB6 E;  3V5U A;  5CA0 E;  3BQK A;  3RX6 A;  4EYY R;  3ETV A;  3UT5 E;  3NZQ A;  5HXR A;  1O3X A;  1YKE B;  2L8K A;  2WBL A;  1HTJ F;  1NWM X;  4ADZ A;  4EAH A;  3A5X A;  3WI3 A;  2GK9 A;  4GK0 E;  1U5P A;  2CEA A;  4YJ3 E;  4EOZ B;  5LP6 E;  5BMV E;  4TV8 E;  4JEU B;  2YEV C;  3C50 A;  4O8S A;  2QA7 A;  4AKI A;  2VK9 A;  3T8O A;  2Y48 B;  3EDV A;  4PJJ A;  2EHO A;  2LSG A;  2IAK A;  5L3D B;  4WBO A;  4NUV A;  5LG4 A;  2LHR A;  1HF8 A;  5JDH A;  2CM0 A;  3PTR B;  3S4U A;  4UVC B;  3ZEF B;  3C4X A;  5CB4 E;  4EYU A;  1H7C A;  1QSD A;  3LJC A;  4EZ4 A;  5LYJ E;  5JRE A;  4AKH A;  4XAX B;  2W0G A;  5JVD E;  4IE6 A;  2XUE A;  3CQG B;  2CWY A;  3EUH A;  5J1G A;  3GN5 B;  5LHH B;  3AA1 B;  2CXL A;  4TV9 E;  3BQL A;  4UVA B;  4HEA A;  3N9O A;  1BR1 A;  4BJN A;  2CLY B;  2LSY A;  3ZMV B;  1U4Q A;  1AJ3 A;  4EZH A;  1EZ3 A;  1UX4 A;  2VAS A;  2Q9Q C;  4ZI2 C;  3PUQ A;  4WBN E;  3H3A A;  3HKC E;  1IJ5 A;  3RRW A;  4KMC A;  5EK3 A;  2KXP B;  5EK2 A;  2X66 A;  5JDQ A;  2G0U A;  4X20 E;  3RKO A;  3PUA A;  2BZB A;  4IE5 A;  1HG2 A;  3HKB E;  4F6R C;  2NTY A;  2NTX A;  2WMO A;  5HXE A;  2X9H A;  1IJ6 A;  4EIW A;  4P0A A;  4N78 D;  4HKA A;  2C5I T;  3KFW X;  2W00 A;  1Y64 B;  1LKX A;  4OHF A;  3ZYM A;  3ZMT B;  1LRZ A;  3HA4 A;  4OYK A;  4CXW A;  4O2B E;  4TX5 A;  3FB2 A;  2VKO A;  4G2A A;  1WYB A;  2V7L A;  3NRY A;  2NOX A;  2KWI B;  3ZJ2 A;  3MKD A;  4PK5 A;  2N1G A;  2RA1 A;  5FP3 A;  5JR9 B;  2CXD A;  2LHN A;  3EDU A;  3KV9 A;  3EVY A;  3GA8 A;  3SS1 A;  5L3G B;  4PK6 A;  3ZLI A;  4GK5 E;  4BA9 A;  4QXB B;  2VWA A;  3P7I A;  3UUL A;  4ZI3 D;  4IST A;  4MHC A;  5IYZ E;  2K5B B;  4CI3 B;  3ZC1 A;  2JMK A;  3SOL A;  4HGA A;  5HXC A;  2V26 A;  3H37 A;  3PE0 A;  4ASK A;  3O1H A;  3AAA B;  3RYH E;  2DLR A;  3Q5X A;  3ZN1 B;  3OYX A;  1MMG A;  2C5K T;  3ZPO A;  2IC9 A;  2M67 A;  4H63 H;  3N2K E;  3Q2M A;  5A1L A;  5TAO A;  5F8P A;  2KLQ A;  3NRX A;  3QUJ A;  3ZMU B;  4ZI2 D;  2ACX A;  4KP3 C;  4J2C A;  5JDL A;  2E8I A;  2Q9Q B;  2YK0 A;  3LG7 A;  5DJQ C;  2XAS B;  5FY7 A;  3MA9 A;  2JPF A;  2D2S A;  1SHZ C;  2Z6E A;  3LBX A;  3FXD B;  5LJN A;  5L2L A;  4IGU A;  2D0T A;  2ODU A;  3F2E A;  4QX8 B;  2E9X A;  2IC6 A;  5JQG E;  5LGT B;  3OYZ A;  4PK4 A;  4AQF A;  4QKN A;  3L3P A;  4UF0 B;  5LGU B;  5CA1 E;  2CE7 A;  3FXE B;  1MND A;  3UTK A;  4L5G A;  4DBR A;  2W62 A;  3M65 A;  3VU7 H;  4H9O C;  2N2N A;  2L3L A;  2MOZ A;  5GON E;  2ES0 A;  4UV9 B;  4L9I A;  2LSK A;  4V1A v;  5JR9 C;  4O4J E;  4P09 A;  4UXN B;  4MAL A;  4TUY E;  2Y8D A;  2JJ9 A;  5JRC A;  4CZZ B;  2DNX A;  1MIY A;  4ZI7 E;  3F57 A;  2BVM A;  3RH3 A;  3HI2 A;  3N2G E;  4O4L E;  1V9D A;  4DMW A;  4QWN B;  5ADX L;  2YIN A;  4AKG A;  2H7V C;  1ZV4 X;  1YD8 G;  4U72 A;  4O4H E;  2PFV A;  5FXW A;  2I59 A;  3U3I A;  3AAI A;  2A72 A;  2VB6 A;  2X0L B;  3GN5 A;  4AQF C;  3IBP A;  3O1J A;  3J7Y q;  4H9N C;  1QUU A;  3R84 B;  3HKE E;  2E9X C;  2WM9 A;  3CVR A;  4QXH B;  4DVD A;  1D0Z A;  2HH7 A;  3DJB A;  4M1P A;  5LA6 E;  3ZC0 A;  3CX8 B;  2XAF B;  5IHY A;  2CWO A;  4H9S E;  3LFM A;  2Y6X A;  4O2A E;  2X67 A;  3ZMS B;  4AXP A;  2EHO B;  4JLE A;  2LSJ A;  2V7I A;  2DI4 A;  2XAH B;  4YHJ A;  3L09 A;  4PJN A;  3CQC B;  3I0Q A;  4DBQ A;  2V7J A;  3HKD E;  4GIW A;  2H7O A;  3B57 A;  5H6R B;  2D5U A;  1OXZ A;  3O1I A;  2YU1 A;  1WR6 A;  3E0Z A;  1MIW A;  1HS7 A;  2P9B A;  2XAJ B;  1FMV A;  1T98 A;  2WMN A;  2VKJ A;  3CX7 B;  1YW0 A;  3C64 A;  5LBQ B;  2V1D B;  3AVS A;  3ANW B;  3KVB A;  5JDG A;  1HG5 A;  4CXY A;  3JC6 D;  3HL6 A;  4HTE A;  1MMA A;  4UEL A;  4KBM B;  4AKL A;  4GYS A;  3KBU A;  2EHO D;  4X1K E;  3LK3 B;  4FI5 A;  4XBF B;  2JQQ A;  3GWH A;  1YKH B;  2LE8 A;  4ZOL E;  2NW8 A;  2HPJ A;  3V5S A;  1WRD A;  5C8Y E;  4XZC A;  1HCI A;  2A3D A;  5JDM A;  3IEE A;  1HFA A;  3I9W A;  4X1I E;  3ZN0 B;  3D0T A;  2C0S A;  3N9P A;  4KUM B;  2UXN B;  4TZ4 C;  1US7 B;  2KND A;  1WLX A;  4H9R C;  4AQG A;  4PJL A;  2LOS A;  2RP4 A;  4I50 E;  2E9X B;  1E1H B;  4ISS A;  2X9X A;  2J1D G;  2VKH A;  5JDN A;  3RYI E;  4QHO A;  3QK6 A;  2NW9 A;  4I55 E;  4IIJ E;  4TN7 B;  2QGS A;  3B13 A;  4E7S A;  3HR0 A;  3ZYK A;  4C91 A;  2LT3 A;  2K48 A;  2Q9Q A;  4P0B A;  1D0X A;  5HXH A;  2CXF A;  2L9Q A;  4UVB B;  3C51 A;  3P8C D;  4IE4 A;  2W63 A;  4PJM A;  4DO0 A;  4PW8 A;  2LM9 A;  5HAX A;  2WWU A;  3CWZ B;  4DND A;  1D0Y A;  2CMR A;  5FY1 A;  3ZYL A;  5LHI B;  2ZM2 A;  4IHJ E;  2KIN B;  2XTL A;  5JRC B;  5LHG B;  3LBX B;  2VKD A;  1MMD A;  3UUX B;  3NBX X;  2WSS V;  4CQI A;  3I1A A;  1G8X A;  3CKD A;  3I0O A;  5L3B B;  2MTQ A;  4ERR A;  2V7M A;  4BAY B;  2B1E A;  2Q9Q D;  3KV4 A;  5HXS A;  2JRK A;  5HYA A;  1UX5 A;  3R6N A;  4UF0 A;  3WAJ A;  1S94 A;  4MLK A;  1ZHC A;  3OJA A;  2ODV A;  5JR9 A;  1KK7 A;  1UCU A;  3MJX A;  4DMV A;  2ZM8 A;  1G73 A;  3FBL A;  3RYF E;  5FMN A;  5L3E B;  4U74 A;  3QC9 A;  2CCQ A;  3IF8 B;  5LCY A;  3W15 B;  1BR2 A;  3K8P C;  5DAB A;  4YFS A;  1VRB A;  3O4X E;  5L3F B;  3CML A;  1Z0P A;  4HE8 A;  3MAC A;  4UV8 B;  4H9P C;  3MXZ A;  4ZI3 C;  2MYS A;  4PNI A;  2MBG A;  3ZJ1 A;  4WW0 A;  4NUU A;  3E08 A;  2LSI A;  2XQY A;  3E22 E;  1ZEE A;  2CLY C;  5L3C B;  1D1B A;  3LK4 2;  1ZKE A;  2X51 A;  2X9W A;  4PAG A;  4UIG A;  5J2T E;  3PUR A;  5FYM A;  2PBI A;  5LNK A;  2K9A A;  2IW5 B;  5JH7 E;  4MFR A;  3ZCI A;  3KV6 A;  3LK2 B;  2PJQ A;  3MZK B;  3AVR A;  4UEM A;  3N2O A;  2N9D A;  5LOV E;  2LJL A;  2ZLY A;  5AFU L;  3DTO A;  4IE0 A;  3PUG A;  5LGN B;  4JUY A;  3RPU A;  2E9X D;  5ETW A;  4OFZ A;  3U78 A;  4OYJ A;  2JMH A;  4Z8X A;  3PU8 A;  2ZM0 A;  5LBM A;  1NAF A;  5H6Q B;  4BJM A;  3RC3 A;  3Q5W A;  4K0U A;  1BR4 A;  3SRZ A;  5FXZ A;  4CI1 B;  3AAE B;  1FEW A;  5LXT E;  3OBV E;  2BVL A;  3OKQ A;  2ZMA A;  3SWH A;  4CXX A;  4I43 B;  1FMW A;  4B6X A;  2X9Y A;  3ANW A;  3N9M A;  2KMF A;  3BK9 A;  3PDY A;  3AA6 B;  3N9L A;  3BQI A;  4AI6 A;  4YJ2 E;  5KX5 E;  1WYC A;  1S35 A;  3C4W A;  1HX8 A;  1LVK A;  3UUN A;  5DQV A;  3KBT A;  3KV5 A;  1OWA A;  2PG8 A;  3J9X 1;  2W61 A;  1MNE A;  3K3N A;  4HN9 A;  4ZS3 A;  2XHE B;  2HPL A;  1FIO A;  3JC6 C;  3PUS A;  4IE7 A;  2C5J A;  4ANJ A;  5LJM A;  3VHL A;  3DP7 A;  3N9Q A;  3IHR A;  4FJO A;  1LVF A;  3ZCJ A;  3C98 B;  4CI2 B;  3PU3 A;  1B7T A;  1D1C A;  4AKR B;  1MMN A;  3K3Q C;  2BDE A;  2XAQ B;  3KVA A;  3KIN B;  1BR0 A;  4HFV A;  5EK4 A;  2V7K A;  5F3J A;  3NZP A;  1SA0 E;  2DCF A;  2SPC A;  3UUM A;  3AA7 B;  4X1Y E;  2NWB A;  4GYR A;  3TKL B;  3ESL A;  2WAU A;  2LEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...