3D0TA

Structure of the bnb domain of the hsp70 cochaperone bag2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
84
structure length
77
Chain Sequence
SEESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 2
publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 37
structure length 77
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3d0tA00
3D0TA 3CQXC
chains in the Genus database with same CATH superfamily
1S94A 2X0YA 4GYRA 4IDNA 1HR0T 2ACXA 3ESLA 4B6XA 1HX8A 1OEDA 4XBFB 3RYFE 4F8HA 5JRCA 2IW5B 2M6IA 5TAOA 3D0TA 3ETVA 4UVAB 5L3BB 2BKPA 3N9MA 2YDRA 2XQYA 2KZ7B 4WW0A 2E8IA 4OYJA 1KFYA 2IUBA 4YT0A 3F2EA 4QXHB 4LMKA 2VQFT 2V1DB 2PJQA 2XAGB 4KBMB 2YU1A 4LF4T 1S35A 2ODUA 5FMNA 1ZHCA 2N1GA 5CA1E 3HI2A 2WZHA 5AQGB 5FXVA 3AEGA 4LMJA 2H88A 4EZHA 2E9XD 1MIVA 4QH4A 2H89A 1NENA 5C3JA 3RKGA 5AQFB 2QVAA 3Q2MA 4YJ2E 3K3OA 5AQLB 5ABHA 3K8PC 5L3EB 2WDRA 4HTEA 1I94T 3H3AA 1MMAA 1Z0PA 3GMIA 5HEUA 1OEDC 3NRYA 4IE0A 5FYMA 3SFEA 2JQQA 2BG9B 4WYVA 1YQ4A 5HXEA 2VKJA 5AQVB 1ZKEA 2CRBA 2ZM8A 2ZLYA 2IC9A 5ABGA 3MXZA 4DR7T 5FKYA 2DLRA 2I59A 3LDQB 4WNKA 2ZMAA 5ABFA 2MPKA 4QXCB 3WAJA 5HXCA 3NKZA 1MNEA 3CQCB 5F3JA 5FXWA 4PK4A 1SA0E 5KX5E 4X1KE 3FBZA 5CGMA 1T98A 4L9IA 5HEHA 5IWAT 2YK0A 4AQFC 1W0AA 2FUPA 2W62A 4PJLA 4U7IA 3CKDA 3UUNA 1D1BA 3MK7C 1WR0A 4YY3T 4ZXLA 3LK2B 3MZKB 2J62A 2W4XA 5ABEA 2NTYA 3ZT5A 2XQ3A 4I55E 3QB5K 4YSXA 1YW0A 3TLTA 2BG9E 3OYXA 4NIQA 1HFAA 1Z8UA 4O4IE 4YHJA 1L0VA 5F8PA 2D0UA 2I6HA 5JDFA 1ZV4X 3H3MA 1JNRA 4CZZB 2J1DG 4E7SA 3AE8A 3CWZB 2E9XC 4DBQA 3OVUA 4ANJA 3FZKB 4TZ4C 3RPUA 4AI6A 3QB5A 1QLBA 4ZS3A 1FEWA 2X9XA 3RRWA 3RI5A 4LFBT 1IJ5A 1XWMA 3EDUA 2V7IA 3AEBA 4IE4A 2E5VA 4PFPA 5BR8T 2VL8A 5JDMA 1X79A 3N2OA 3JAEA 2V8SV 3JADA 5FXZA 3PUAA 4NUUA 1U4QA 3RQWA 3EAMA 4DMWA 2P9BA 1BR2A 5J1GA 1KEYA 3QUJA 2HH7A 4YLHA 3W15B 4EGWA 1MIWA 3VRBA 5LP6E 2NTXA 4B3RT 4BA9A 3AE9A 2D2SA 1D1AA 3LK3B 2KSRA 5LHHB 3GN5B 4EZ4A 3AEAA 3B13A 4HFBA 4ILAA 2VB6A 2XHEB 4KUMB 2LM2A 4JUYA 2WP9A 3AECA 3RYHE 3EUHA 4QH1A 3AA7B 2VKHA 2PG8A 3AE6A 1J1JA 4DBRA 3ZMTB 5GONE 3L3PA 5LA6E 2WWVA 2BS2A 5JR9A 3Q5XA 1FIOA 2IC6A 2L8KA 2CHOA 5C2TA 2BDEA 2MBGA 2XAFB 1KF6A 4CXYA 5DQWA 3KV9A 1QSDA 3PUWF 1T72A 3UUMA 1XZYA 3ANWA 1SE7A 4COFA 2CHNA 2L3LA 3NVOA 4KHZF 3EVYA 4MLKA 3RLFF 5AQRB 4A56A 1UGOA 2PFVA 3ZMVB 3TKLB 4HWHA 3PUGA 4TUYE 1IAPA 3TLUA 4UF0A 4IE7A 1MNDA 2VVSA 3LK42 3O1IA 4Z91A 3V5SA 2N2NA 4DR4T 5AQJB 4PNIA 1IJ6A 2ZM2A 2Q9QB 2YEVC 3AEFA 3AVRA 4CI2B 2BZBA 2OLTA 5L47A 5L3DB 2DI4A 4ISSA 5FXXA 4DMVA 4HGAA 2XAJB 3KDSE 3DJBA 3PURA 4B3MT 5JR9C 2NW8A 1BR4A 3RC3A 4ZI2D 5FL1A 1UUSA 1HCIA 2K9AA 4C91A 3KFWX 2V7LA 2WQYA 5AQPB 2HHHT 3Q9DA 3C4WA 4LMLA 2A3DA 5CFBA 2VVNA 1M62A 3OPCA 4YSZA 1UURA 1M7KA 1XMOT 2J4GA 3RIFA 2XAHB 2EHOB 3RRCA 4DV6T 2KWHA 3CVRA 5L4HA 2X9HA 3AA1B 4X1IE 1X9BA 3T1HT 4IE6A 1WYBA 4DV0T 4HWFA 5HCJA 4EEDA 2WU5A 5IHYA 3ZN1B 3ZT6A 5FY7A 4PJNA 2V7MA 2PTFA 2I0MA 2JRKA 4IL9A 3K1SA 2D9DA 2YKSA 4C90A 4ASKA 3OBVE 2H3RA 4UXNB 1JNZA 2J47A 3Q5WA 3M65A 4H9RC 3C4ZA 1MMDA 2NW7A 1ZP0A 5LMNT 3M3ZB 1N36T 5BMVE 5JVDE 3WAKA 3UULA 2DHRA 2XZEA 4QKNA 5M4YA 3BQKA 4U31A 1DU2A 2C5JA 2XQ5A 2UXDT 2JQKA 1QUUA 2CXDA 4U74A 4AKLA 3ZJ2A 3IBPA 4AKIA 4JI4T 3ZC0A 1US7B 4HWIB 2XM1A 3A7MA 3K3QC 1KNPA 1V9DA 5L2LA 3AXJB 5H6QB 2XQ4A 4YSYA 3L8RA 3ABVA 2WS3A 2UXXB 3EDVA 2VL0A 4ZI2C 3ONLC 1D0XA 4IDQA 3AE4A 4UVCB 4HFDA 3AAEB 2JJ9A 4KMCA 1E7PA 2XTLA 3N9PA 4LF8T 4BJNA 2V6YB 4X64T 2BG9A 4DV7T 1IZNB 4EB6E 4GYSA 5HXHA 4GKKT 2C5IT 2JQHA 4U72A 3ETUA 1D0ZA 2FJAA 3O1JA 3B57A 3GWHA 5AQQB 3CMLA 4LF7T 4G63A 4X20E 3UUBA 5L4EA 2BVLA 2VWAA 2W67A 3N5LA 2LSIA 4IDOA 4YHHT 3PU8A 3QK6A 4JLEA 5C8YE 2WZIA 5JH7E 3TLVA 2LT3A 2BVMA 4KP3C 3JAFA 3MA9A 4O4JE 4Z90A 2LKGA 1EZ3A 4U2YA 2KLQA 1SHZC 2JPFA 4PW8A 3BQIA 3AAIA 3LFMA 3OJAA 2W00A 5F5WA 3PU3A 4ZOLE 2XUEA 4JI1T 5LHGB 3U3IA 5J0ZA 3NBXX 5L3CB 3ONXA 4NUVA 5LGNB 2UXBT 3AE1A 2MAWA 2LHNA 5A1LA 1YXRA 1R8IA 3RIAA 4JBWF 1XMQT 3F57A 3WI3A 4EOZB 2AXDS 4GKJT 2XAQB 4CI3B 4DIDB 3SS1A 4TWFA 3ZCIA 5EZYE 3F31A 3PJAA 4MFRA 3ZPOA 3RX6A 4O2BE 2YN6A 5EK2A 4U33A 2WAUA 3H37A 4I4TE 4GK0E 3R84B 4E7ZA 3FXDB 4L5GA 4J2CA 3AE3A 2IIUA 4XZCA 2X0LB 3KVBA 2VKOA 4HE8A 3FZMB 2V5DA 4ILUA 4QX7B 1HS7A 4MHCA 5HXRA 2Z6EA 2W0GA 3SOLA 2ACZA 1HNZT 2V7KA 3T1YT 5KXJA 3C64A 1N33T 2XQ6A 3NRXA 5IYZE 3NWIA 1WCRA 2ES0A 5JREA 4ILBA 2E9XB 1AJ3A 4PK6A 4HFCA 4WZXA 3C98B 2XQ7A 3CIRA 4FJOA 3IEEA 5AQOB 4A97A 2CWOA 4NXNT 2D0TA 3CK6A 2XSAA 4GIWA 5H6RB 2DWGA 2LSGA 4HFHA 4BAYB 3AB3B 1OXZA 4TWHA 3GN5A 4EV6A 2DNXA 3ONJA 2WB5A 3PTRB 3N2KE 1WRDA 1LRZA 3RC8A 2LM9A 4NPPA 1LVKA 5CB4E 5EK4A 4QX8B 3ZKRA 1YKEB 2XY8B 2BS4A 2AE9A 2CBIA 3LBXB 2E5LT 5LCYA 2LSYA 2CWYA 3KBTA 5LG4A 5HWXA 5FVKA 4QHOA 4UV9B 2RA1A 4A5XA 4JI7T 4JV5T 2CLYB 2LEHA 2Q9QD 2XJ7A 5LMUT 4JI2T 2X68A 4X62T 1B7TA 3NZQA 4HKAA 4QWNB 3VR8A 3ZJ1A 2DCFA 3CQGB 2LE8A 4LF5T 2WCAA 3CX7B 1UCUA 3PUQA 1Y01A 4EIWA 5HEGA 5E0OA 4DR5T 3HR0A 3P50A 4AISA 4I43B 1WLXA 3B5MA 3MKDA 3X1DA 3VHLA 4O8SA 3PUYF 2FJDA 4IREA 2CA5A 2Q9QA 5FL0A 3R6NA 3I9YA 5HAXA 5JTGA 2EHOD 3ZYMA 2ZM6T 1O3XA 2KNDA 3A5XA 3FHNA 1IBLT 3C51A 3E0ZA 3RH3A 2VKDA 4P0AA 1FJGT 2QYWA 5KMGP 3UFGA 4FI5A 5AQIB 1BR1A 3PDYA 4PJJA 3C50A 2IMLA 4TNVA 1W0BA 3L09A 3UTKA 3ZMZB 3PJAJ 4N78D 2VK9A 2YDSA 3O1HA 1G8XA 3PE0A 3AAAB 4IIJE 2Y6XA 3FXEB 4IDPA 4OK0A 4AKHA 1VCTA 3JC6C 3KVAA 3AA0B 4YXDA 2WBLA 5JDGA 3RHWA 2EHOA 3QNUA 5HCMA 3RGLA 2IHR1 3A8YC 3VRAA 2SPCA 3SWHA 2N9DA 3RYIE 3CQXC 4IGUA 5LHIB 4HN9A 2UXNB 3VKGA 2RP4A 2K5BB 1HG5A 2OA5A 2Q9QC 4X1YE 5L3FB 4YTMA 5ADXL 3GA8A 4H9QC 4OHFA 4AXPA 4EXTA 3P4SA 1H7CA 2XASB 2WDVA 4X65T 3PUZF 3RIUA 4IL4A 4KI0F 4MALA 1D1CA 2FBWA 3UFEA 2UU9T 1XDPA 2W61A 3J9X1 4TNWA 3ZT7A 4H9SE 5JDNA 2V7JA 4WBOA 2B76A 1J5ET 4I0UA 2DWKA 5JDHA 2WWUA 2EHOC 2PBIA 3P4QA 2WU2A 3AE7A 4YFSA 3AXJA 5FP3A 4JEHB 2W2UA 4G2AA 4XAXB 3IF8B 1XDOA 1VRBA 3N9NA 2V26A 3UU3A 4UVBB 1IBKT 2YU2A 4I50E 4OYKA 3HKBE 4F6RC 5J2TE 2V6YA 2KXPB 4JI5T 5AQNB 2UUBT 3HA4A 2K3WA 2V6XA 2BKNA 3SFDA 1N32T 1U5PA 2YINA 3RQUA 3O9XA 3EABA 4ZEYA 2LKHA 2B1EA 4U7YA 5DQVA 4JYAT 3BQLA 2CEAA 4OFZA 4LF6T 3N9QA 3P4PA 1XNRT 4EAHA 1VOMA 4CXXA 4TV8E 3RYCE 2WM9A 5HEOA 2V5CA 4UIGA 5AQKB 3AE5A 4H9OC 3ZYLA 2X9WA 4H63V 3VR9A 3Q5DA 4KHPT 4HWCA 3FZFB 4HWDA 3UU4A 4PK5A 5LOVE 3UU8A 1WFDA 4ZZCA 1VCSA 3T8OA 4YJ3E 5HEJA 2VURA 3E08A 2WSSV 4CQIA 4PAGA 3FZHB 5AQSB 2UUCT 2QGSA 2VQET 1MIYA 4X5TA 4TN7B 4DVDA 3ZEFB 2X51A 3QOFA 3BK9A 1UK5A 5HXSA 2Y48B 1UX5A 1FMVA 2FJBA 3P4RA 5JDQA 4P1NA 5AQHB 1Y64B 2M67A 3OYZA 2X66A 2LRKA 2RPAA 4AIUA 1NWMX 4WBNE 2LOSA 4AQFA 1OEDB 2CCQA 3VU7H 3AEEA 1SUMB 4DV5T 5JDLA 3PUVF 2NP9A 5JRCB 2K48A 4M1PA 3V5UA 1HNXT 2BS3A 1XNQT 4LF9T 1OWAA 2LSKA 4JI0T 4DUYT 1ZEEA 2LHRA 3KINB 2LRLA 3OKQA 2K24A 4AQYT 3ZC1A 2HPLA 3I1AA 3PV0F 3IHRA 4Q25A 5CJ5A 2BG9C 1HTJF 4DO0A 1YD8G 2A72A 3KV6A 4HEAA 1HX1B 4ZS2A 3LJCA 2X9YA 3K3NA 2VASA 2LJLA 4AKGA 1T8BA 5LJMA 1MMGA 4DR1T 4EYUA 2BBJA 1J5WA 2E9XA 4U3CA 2QA7A 2HN2A 1I6ZA 2FJEA 4ERRA 4BJMA 4CN1A 1CHUA 3CX6B 1MMNA 3EI0A 3S4UA 1OEDE 3HKEE 3PUSA 2F4VT 4IHJE 5JQGE 3DTOA 3LG7A 3FBLA 2MYSA 2NOXA 3ZN0B 4DR3T 2QRXA 3ZYKA 3SRZA 2LOPA 4QH5A 1G73A 4JI8T 4OX9T 3HL6A 1WYCA 3LBXA 3I0OA 3E22E 4ADZA 1HNWT 4UEMA 2HN1A 3UQ7A 3ZSTA 4CXWA 2L9QA 1W9RA 2G0UA 4LFAT 2DL1A 4ZI3D 4PFOA 2Y8DA 4PJMA 2MTQA 4DR2T 5LG3A 2YDQA 4MBQA 3HKCE 5ABFB 4NXMT 5LNKA 4UV8B 2A9UA 1LVFA 4V1Av 3TLWA 4AKRB 4DUZT 2CPTA 1T7SA 3IA3A 2C0SA 3KBUA 5FVLA 3JC6D 5L3GB 2KWIB 1HF8A 2CM0A 4TX5A 5AFUL 2JQ9A 2KT9A 3U78A 2UXCT 5LBMA 5LJNA 5LGUB 3CPZA 2NW9A 1E1HB 5AQTB 3AE2A 1IBMT 3MJXA 4DV4T 4IE5A 2X0HA 2W66A 4O2AE 3QC9A 3J7Yq 3I0QA 3UU6A 2WDQA 3FB2A 4HFVA 3ZMSB 2XSBA 4AQGA 2M6BA 4GK5E 3RF1A 4DV1T 2JIWA 2XQ9A 5HWYA 3HKDE 4B3ST 1YKHB 2CLYC 4O4LE 4YTNA 3N9LA 4A98A 2BBHA 5AQMB 4JEUB 2WY2A 3ZSSA 4K0KT 2YOEA 5FNVE 3RKOA 2UUAT 5DABA 4DNDA 2BKOA 2X67A 3FZLB 3NZPA 2WMOA 3Q5EA 4ISTA 2MOZA 1KK7A 2ZM0A 3P7IA 4GOUA 4Z8XA 4EYYR 4H63H 4CI1B 4ZI3C 3UQ4A 2CE7A 1LKXA 1HG2A 2CXFA 3PUXF 3KV5A 3EHZA 2H7VC 3P8CD 5IUXA 4UELA 4P09A 2OV9A 5LB7B 5KDMC 3UU5A 2XPKA 2C5KT 4P0BA 1FMWA 4DR6T 1GQEA 2NWBA 3C4XA 2CMRA 5J2UE 5LXTE 3LSVA 1D0YA 1E2AA 1UX4A 4CN4A 2JMHA 1ZOYA 4IDZA 4CN6A 5JR9B 1N34T 3DP7A 3ZMUB 2XQAA 4ZI7E 1W09A 2IAKA 3UT5E 3OTOT 2XM2A 3JCFA 2GK9A 1KNRA 4YTPA 3ANWB 2CBJA 5AQUB 3I9WA 2XQ8A 3N9OA 5CA0E 3AA6B 4ZZBA 4H9PC 5HYAA 4QXBB 5LYJE 4B3TT 5DJQC 1KNZA 4DV2T 5EK3A 4LFCT 2CXLA 4UF0B 4X66T 4U2ZA 5ETWA 2E2AA 3MACA 3VKHA 4K0UA 3AEDA 4EEBA 3P4WA 3AVSA 4ILCA 4ZHQE 2A2FX 5FY0A 3CX8B 2W63A 1BR0A 3O4XE 3ZLIA 4KX6A 3N2GE 1NEKA 2LLYA 1YQ3A 4IT4A 2KINB 3L39A 4HFEA 2IDOB 2WMNA 2ODVA 2HPJA 2JMKA 4HFIA 2LSJA 3TLSA 4TWDA 5LGTB 4L0RA 5LBQB 4H9NC 1WR6A 1NAFA 4DV3T 3G06A 2D5UA 2KMFA 3RIUC 2H7OA 5FY1A 3UUXB 4TV9E 1CUNA 3ZCJA 2R6GF 3KV4A 4JI6T 4UR9A 4O4HE 4JI3T 2NR4A
chains in the Genus database with same CATH topology
4UV9B 2RA1A 2YEVC 4EYUA 3AVRA 1S94A 4CI2B 2E9XA 2BZBA 2QA7A 4GYRA 2ACXA 5L3DB 2DI4A 4ISSA 5FXXA 3ESLA 4DMVA 4B6XA 2CLYB 4HGAA 2LEHA 1HX8A 2Q9QD 2XAJB 3KDSE 3DJBA 3PURA 2X68A 5JR9C 2NW8A 4ERRA 4BJMA 4XBFB 1BR4A 3RC3A 1B7TA 4ZI2D 3NZQA 4HKAA 3RYFE 3CX6B 4QWNB 5JRCA 2IW5B 1MMNA 2DCFA 3ZJ1A 3CQGB 1HCIA 5TAOA 3S4UA 3D0TA 3ETVA 3HKEE 2LE8A 4UVAB 5L3BB 3PUSA 2K9AA 3N9MA 4IHJE 4C91A 5JQGE 3KFWX 2XQYA 2KZ7B 2V7LA 3CX7B 4WW0A 2E8IA 1UCUA 3DTOA 3LG7A 3PUQA 4OYJA 4EIWA 3Q9DA 3FBLA 2MYSA 3C4WA 2NOXA 5E0OA 3ZN0B 2A3DA 3ZYKA 3HR0A 3SRZA 3F2EA 4QXHB 2LOPA 1G73A 4I43B 3HL6A 1WLXA 1WYCA 3LBXA 3I0OA 3E22E 4ADZA 2V1DB 3MKDA 2XAHB 4UEMA 3VHLA 2EHOB 4CXWA 4O8SA 2PJQA 3RRCA 2L9QA 2XAGB 2YU1A 4KBMB 2KWHA 3CVRA 2G0UA 2CA5A 1S35A 2X9HA 2ODUA 5FMNA 2Q9QA 3AA1B 4ZI3D 4X1IE 4PFOA 3R6NA 1ZHCA 2N1GA 4IE6A 3HI2A 5CA1E 3I9YA 5HAXA 2Y8DA 4PJMA 1WYBA 2EHOD 3ZYMA 1O3XA 2KNDA 5FXVA 2MTQA 3A5XA 3FHNA 3C51A 4MBQA 3E0ZA 3RH3A 4EZHA 2VKDA 5IHYA 3ZN1B 4P0AA 3HKCE 5FY7A 2E9XD 4PJNA 1MIVA 5LNKA 4UV8B 5KMGP 2V7MA 1LVFA 4V1Av 4FI5A 1BR1A 2JRKA 3PDYA 4AKRB 3Q2MA 4YJ2E 4PJJA 3K3OA 3C50A 3L09A 3K8PC 5L3EB 2C0SA 4C90A 3UTKA 4ASKA 3OBVE 3ZMZB 3KBUA 4HTEA 4N78D 2VK9A 2H3RA 3O1HA 3JC6D 4UXNB 3H3AA 1MMAA 1Z0PA 1G8XA 3GMIA 5L3GB 3PE0A 3AAAB 4IIJE 3NRYA 2Y6XA 3Q5WA 4IE0A 2KWIB 3FXEB 1HF8A 4OK0A 5FYMA 2CM0A 3M65A 4AKHA 4H9RC 2JQQA 3C4ZA 4TX5A 3JC6C 1MMDA 2NW7A 3KVAA 5HXEA 5AFUL 3AA0B 2KT9A 2VKJA 5BMVE 2WBLA 3U78A 5JDGA 5LBMA 1ZKEA 5LJNA 4QHOA 2EHOA 5LGUB 2ZM8A 2ZLYA 3CPZA 5JVDE 3WAKA 2NW9A 3UULA 2DHRA 1E1HB 4QKNA 2IC9A 5M4YA 3BQKA 3MXZA 2C5JA 3MJXA 1QUUA 2SPCA 4IE5A 2DLRA 2CXDA 4U74A 4AKLA 3ZJ2A 3IBPA 3SWHA 4AKIA 4O2AE 2N9DA 3RYIE 2I59A 3ZC0A 1US7B 3QC9A 3CQXC 4IGUA 5LHIB 3J7Yq 3I0QA 4HN9A 4WNKA 2ZMAA 2UXNB 3K3QC 3VKGA 1V9DA 3FB2A 4QXCB 5L2LA 4HFVA 3ZMSB 5H6QB 3WAJA 2RP4A 5HXCA 4AQGA 2K5BB 1HG5A 2OA5A 2Q9QC 1MNEA 3CQCB 4X1YE 5L3FB 5F3JA 5FXWA 4GK5E 4PK4A 5ADXL 1SA0E 2UXXB 3EDVA 3GA8A 5KX5E 4H9QC 4X1KE 3FBZA 4OHFA 1T98A 5HWYA 4L9IA 4ZI2C 1D0XA 4UVCB 3HKDE 4AXPA 2YK0A 4AQFC 4EXTA 1YKHB 2CLYC 2W62A 4O4LE 3AAEB 3N9LA 4PJLA 2JJ9A 4KMCA 3CKDA 1H7CA 2XTLA 1D1BA 2XASB 3MK7C 3UUNA 3N9PA 4BJNA 4JEUB 1IZNB 5FNVE 3RKOA 4EB6E 4GYSA 5HXHA 3LK2B 2C5IT 3MZKB 5DABA 4MALA 1D1CA 4DNDA 2X67A 2NTYA 3UFEA 4U72A 4I55E 3ETUA 1D0ZA 3NZPA 1YW0A 2WMOA 3OYXA 4ISTA 2MOZA 3O1JA 1HFAA 3B57A 3GWHA 1KK7A 2W61A 2ZM0A 4O4IE 3P7IA 3CMLA 4YHJA 4G63A 4X20E 4GOUA 4Z8XA 5F8PA 4EYYR 4H63H 2BVLA 3J9X1 4CI1B 2VWAA 4H9SE 5JDNA 3N5LA 2V7JA 4ZI3C 2D0UA 4WBOA 2LSIA 2DWKA 3PU8A 5JDFA 5JDHA 2CE7A 2WWUA 1LKXA 3QK6A 2EHOC 4JLEA 1ZV4X 5C8YE 2PBIA 4CZZB 2J1DG 4YFSA 1HG2A 4E7SA 2CXFA 5FP3A 3CWZB 4JEHB 5JH7E 2E9XC 4G2AA 3KV5A 4XAXB 4DBQA 3IF8B 2H7VC 2LT3A 3P8CD 1VRBA 2BVMA 4ANJA 4KP3C 3N9NA 2V26A 3MA9A 4P09A 4UELA 4O4JE 4UVBB 4TZ4C 2YU2A 3RPUA 5KDMC 4AI6A 4I50E 4OYKA 2C5KT 3HKBE 4F6RC 1EZ3A 4P0BA 4ZS3A 1FMWA 2KLQA 1SHZC 2JPFA 4PW8A 1FEWA 5J2TE 3BQIA 3AAIA 2KXPB 3LFMA 3OJAA 2X9XA 3RRWA 2W00A 3HA4A 1IJ5A 3PU3A 4ZOLE 2NWBA 2XUEA 3EDUA 5LHGB 3C4XA 3U3IA 2V7IA 1U5PA 2CMRA 2YINA 3O9XA 4IE4A 3NBXX 4PFPA 5J2UE 2B1EA 5L3CB 3ONXA 4NUVA 5DQVA 5LGNB 2VL8A 5LXTE 3BQLA 5JDMA 1X79A 2CEAA 3N2OA 4OFZA 1D0YA 3N9QA 2LHNA 4EAHA 1UX4A 5A1LA 1VOMA 2JMHA 4CXXA 5FXZA 4TV8E 3F57A 4IDZA 3RYCE 3PUAA 3WI3A 5JR9B 2WM9A 4EOZB 4NUUA 1U4QA 3DP7A 3ZMUB 4DMWA 2P9BA 1BR2A 4UIGA 5J1GA 2XAQB 3QUJA 2HH7A 4CI3B 4H9OC 4YLHA 3SS1A 4ZI7E 3W15B 3ZCIA 5EZYE 3ZYLA 1MIWA 3F31A 4MFRA 3ZPOA 2X9WA 2IAKA 5LP6E 4H63V 3UT5E 2NTXA 4BA9A 3RX6A 4O2BE 5EK2A 2GK9A 2WAUA 2D2SA 3H37A 4I4TE 3ANWB 1D1AA 3LK3B 4GK0E 4PK5A 3R84B 5LOVE 3I9WA 4E7ZA 3FXDB 3N9OA 4L5GA 5LHHB 5CA0E 3AA6B 3GN5B 4J2CA 4EZ4A 3T8OA 4H9PC 4XZCA 4YJ3E 5HYAA 3B13A 4QXBB 2X0LB 3E08A 5LYJE 2WSSV 5DJQC 4PAGA 4CQIA 1KNZA 3KVBA 5EK3A 2VKOA 4HE8A 2VB6A 2CXLA 4UF0B 4ILUA 4QX7B 1HS7A 4MHCA 5HXRA 2XHEB 4KUMB 2Z6EA 4JUYA 2W0GA 3RYHE 2QGSA 3EUHA 5ETWA 3SOLA 2V7KA 1MIYA 3MACA 3VKHA 4K0UA 4TN7B 4DVDA 3ZEFB 3AA7B 3C64A 2VKHA 2PG8A 2X51A 3BK9A 4DBRA 3ZMTB 5HXSA 2Y48B 5GONE 3L3PA 3NRXA 5LA6E 1UX5A 1FMVA 5IYZE 5JDQA 3AVSA 5JR9A 3Q5XA 1FIOA 2IC6A 2ES0A 2L8KA 5JREA 2E9XB 1AJ3A 4PK6A 4ZHQE 2A2FX 2BDEA 2MBGA 1Y64B 2M67A 3OYZA 5FY0A 3C98B 3CX8B 2W63A 2X66A 4FJOA 1BR0A 2XAFB 3O4XE 4CXYA 3ZLIA 3IEEA 3N2GE 5DQWA 1NWMX 3KV9A 2CWOA 2LOSA 4WBNE 4AQFA 2D0TA 1QSDA 2CCQA 3VU7H 4GIWA 5H6RB 5JDLA 2DWGA 2LSGA 3UUMA 2KINB 2NP9A 3ANWA 5JRCB 2K48A 4BAYB 3AB3B 4M1PA 3V5UA 2WMNA 2L3LA 2ODVA 3EVYA 2HPJA 1OWAA 4MLKA 2JMKA 1OXZA 2LSKA 4A56A 3GN5A 2LSJA 2PFVA 2DNXA 3PTRB 3ZMVB 3TKLB 3N2KE 1WRDA 1ZEEA 1LRZA 2LHRA 4L0RA 5LGTB 3PUGA 5LBQB 3KINB 4H9NC 3RC8A 1WR6A 1NAFA 4TUYE 2LM9A 3OKQA 2K24A 1LVKA 5CB4E 1IAPA 5EK4A 4UF0A 3ZC1A 4IE7A 4QX8B 1YKEB 2HPLA 1MNDA 3I1AA 2D5UA 2KMFA 3IHRA 3LBXB 2H7OA 5LCYA 1HTJF 3LK42 3O1IA 3V5SA 4DO0A 2N2NA 4TV9E 1CUNA 5FY1A 1YD8G 2A72A 2LSYA 3KV4A 3UUXB 3KV6A 4HEAA 2CWYA 4O4HE 3KBTA 4PNIA 4ZS2A 5LG4A 3LJCA 2X9YA 5HWXA 1IJ6A 3ZCJA 3K3NA 2ZM2A 2VASA 2LJLA 4AKGA 5LJMA 2Q9QB 1MMGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0T A;  3CQX C; 
#chains in the Genus database with same CATH topology
 1S94 A;  2X0Y A;  4GYR A;  4IDN A;  1HR0 T;  2ACX A;  3ESL A;  4B6X A;  1HX8 A;  1OED A;  4XBF B;  3RYF E;  4F8H A;  5JRC A;  2IW5 B;  2M6I A;  5TAO A;  3D0T A;  3ETV A;  4UVA B;  5L3B B;  2BKP A;  3N9M A;  2YDR A;  2XQY A;  2KZ7 B;  4WW0 A;  2E8I A;  4OYJ A;  1KFY A;  2IUB A;  4YT0 A;  3F2E A;  4QXH B;  4LMK A;  2VQF T;  2V1D B;  2PJQ A;  2XAG B;  4KBM B;  2YU1 A;  4LF4 T;  1S35 A;  2ODU A;  5FMN A;  1ZHC A;  2N1G A;  5CA1 E;  3HI2 A;  2WZH A;  5AQG B;  5FXV A;  3AEG A;  4LMJ A;  2H88 A;  4EZH A;  2E9X D;  1MIV A;  4QH4 A;  2H89 A;  1NEN A;  5C3J A;  3RKG A;  5AQF B;  2QVA A;  3Q2M A;  4YJ2 E;  3K3O A;  5AQL B;  5ABH A;  3K8P C;  5L3E B;  2WDR A;  4HTE A;  1I94 T;  3H3A A;  1MMA A;  1Z0P A;  3GMI A;  5HEU A;  1OED C;  3NRY A;  4IE0 A;  5FYM A;  3SFE A;  2JQQ A;  2BG9 B;  4WYV A;  1YQ4 A;  5HXE A;  2VKJ A;  5AQV B;  1ZKE A;  2CRB A;  2ZM8 A;  2ZLY A;  2IC9 A;  5ABG A;  3MXZ A;  4DR7 T;  5FKY A;  2DLR A;  2I59 A;  3LDQ B;  4WNK A;  2ZMA A;  5ABF A;  2MPK A;  4QXC B;  3WAJ A;  5HXC A;  3NKZ A;  1MNE A;  3CQC B;  5F3J A;  5FXW A;  4PK4 A;  1SA0 E;  5KX5 E;  4X1K E;  3FBZ A;  5CGM A;  1T98 A;  4L9I A;  5HEH A;  5IWA T;  2YK0 A;  4AQF C;  1W0A A;  2FUP A;  2W62 A;  4PJL A;  4U7I A;  3CKD A;  3UUN A;  1D1B A;  3MK7 C;  1WR0 A;  4YY3 T;  4ZXL A;  3LK2 B;  3MZK B;  2J62 A;  2W4X A;  5ABE A;  2NTY A;  3ZT5 A;  2XQ3 A;  4I55 E;  3QB5 K;  4YSX A;  1YW0 A;  3TLT A;  2BG9 E;  3OYX A;  4NIQ A;  1HFA A;  1Z8U A;  4O4I E;  4YHJ A;  1L0V A;  5F8P A;  2D0U A;  2I6H A;  5JDF A;  1ZV4 X;  3H3M A;  1JNR A;  4CZZ B;  2J1D G;  4E7S A;  3AE8 A;  3CWZ B;  2E9X C;  4DBQ A;  3OVU A;  4ANJ A;  3FZK B;  4TZ4 C;  3RPU A;  4AI6 A;  3QB5 A;  1QLB A;  4ZS3 A;  1FEW A;  2X9X A;  3RRW A;  3RI5 A;  4LFB T;  1IJ5 A;  1XWM A;  3EDU A;  2V7I A;  3AEB A;  4IE4 A;  2E5V A;  4PFP A;  5BR8 T;  2VL8 A;  5JDM A;  1X79 A;  3N2O A;  3JAE A;  2V8S V;  3JAD A;  5FXZ A;  3PUA A;  4NUU A;  1U4Q A;  3RQW A;  3EAM A;  4DMW A;  2P9B A;  1BR2 A;  5J1G A;  1KEY A;  3QUJ A;  2HH7 A;  4YLH A;  3W15 B;  4EGW A;  1MIW A;  3VRB A;  5LP6 E;  2NTX A;  4B3R T;  4BA9 A;  3AE9 A;  2D2S A;  1D1A A;  3LK3 B;  2KSR A;  5LHH B;  3GN5 B;  4EZ4 A;  3AEA A;  3B13 A;  4HFB A;  4ILA A;  2VB6 A;  2XHE B;  4KUM B;  2LM2 A;  4JUY A;  2WP9 A;  3AEC A;  3RYH E;  3EUH A;  4QH1 A;  3AA7 B;  2VKH A;  2PG8 A;  3AE6 A;  1J1J A;  4DBR A;  3ZMT B;  5GON E;  3L3P A;  5LA6 E;  2WWV A;  2BS2 A;  5JR9 A;  3Q5X A;  1FIO A;  2IC6 A;  2L8K A;  2CHO A;  5C2T A;  2BDE A;  2MBG A;  2XAF B;  1KF6 A;  4CXY A;  5DQW A;  3KV9 A;  1QSD A;  3PUW F;  1T72 A;  3UUM A;  1XZY A;  3ANW A;  1SE7 A;  4COF A;  2CHN A;  2L3L A;  3NVO A;  4KHZ F;  3EVY A;  4MLK A;  3RLF F;  5AQR B;  4A56 A;  1UGO A;  2PFV A;  3ZMV B;  3TKL B;  4HWH A;  3PUG A;  4TUY E;  1IAP A;  3TLU A;  4UF0 A;  4IE7 A;  1MND A;  2VVS A;  3LK4 2;  3O1I A;  4Z91 A;  3V5S A;  2N2N A;  4DR4 T;  5AQJ B;  4PNI A;  1IJ6 A;  2ZM2 A;  2Q9Q B;  2YEV C;  3AEF A;  3AVR A;  4CI2 B;  2BZB A;  2OLT A;  5L47 A;  5L3D B;  2DI4 A;  4ISS A;  5FXX A;  4DMV A;  4HGA A;  2XAJ B;  3KDS E;  3DJB A;  3PUR A;  4B3M T;  5JR9 C;  2NW8 A;  1BR4 A;  3RC3 A;  4ZI2 D;  5FL1 A;  1UUS A;  1HCI A;  2K9A A;  4C91 A;  3KFW X;  2V7L A;  2WQY A;  5AQP B;  2HHH T;  3Q9D A;  3C4W A;  4LML A;  2A3D A;  5CFB A;  2VVN A;  1M62 A;  3OPC A;  4YSZ A;  1UUR A;  1M7K A;  1XMO T;  2J4G A;  3RIF A;  2XAH B;  2EHO B;  3RRC A;  4DV6 T;  2KWH A;  3CVR A;  5L4H A;  2X9H A;  3AA1 B;  4X1I E;  1X9B A;  3T1H T;  4IE6 A;  1WYB A;  4DV0 T;  4HWF A;  5HCJ A;  4EED A;  2WU5 A;  5IHY A;  3ZN1 B;  3ZT6 A;  5FY7 A;  4PJN A;  2V7M A;  2PTF A;  2I0M A;  2JRK A;  4IL9 A;  3K1S A;  2D9D A;  2YKS A;  4C90 A;  4ASK A;  3OBV E;  2H3R A;  4UXN B;  1JNZ A;  2J47 A;  3Q5W A;  3M65 A;  4H9R C;  3C4Z A;  1MMD A;  2NW7 A;  1ZP0 A;  5LMN T;  3M3Z B;  1N36 T;  5BMV E;  5JVD E;  3WAK A;  3UUL A;  2DHR A;  2XZE A;  4QKN A;  5M4Y A;  3BQK A;  4U31 A;  1DU2 A;  2C5J A;  2XQ5 A;  2UXD T;  2JQK A;  1QUU A;  2CXD A;  4U74 A;  4AKL A;  3ZJ2 A;  3IBP A;  4AKI A;  4JI4 T;  3ZC0 A;  1US7 B;  4HWI B;  2XM1 A;  3A7M A;  3K3Q C;  1KNP A;  1V9D A;  5L2L A;  3AXJ B;  5H6Q B;  2XQ4 A;  4YSY A;  3L8R A;  3ABV A;  2WS3 A;  2UXX B;  3EDV A;  2VL0 A;  4ZI2 C;  3ONL C;  1D0X A;  4IDQ A;  3AE4 A;  4UVC B;  4HFD A;  3AAE B;  2JJ9 A;  4KMC A;  1E7P A;  2XTL A;  3N9P A;  4LF8 T;  4BJN A;  2V6Y B;  4X64 T;  2BG9 A;  4DV7 T;  1IZN B;  4EB6 E;  4GYS A;  5HXH A;  4GKK T;  2C5I T;  2JQH A;  4U72 A;  3ETU A;  1D0Z A;  2FJA A;  3O1J A;  3B57 A;  3GWH A;  5AQQ B;  3CML A;  4LF7 T;  4G63 A;  4X20 E;  3UUB A;  5L4E A;  2BVL A;  2VWA A;  2W67 A;  3N5L A;  2LSI A;  4IDO A;  4YHH T;  3PU8 A;  3QK6 A;  4JLE A;  5C8Y E;  2WZI A;  5JH7 E;  3TLV A;  2LT3 A;  2BVM A;  4KP3 C;  3JAF A;  3MA9 A;  4O4J E;  4Z90 A;  2LKG A;  1EZ3 A;  4U2Y A;  2KLQ A;  1SHZ C;  2JPF A;  4PW8 A;  3BQI A;  3AAI A;  3LFM A;  3OJA A;  2W00 A;  5F5W A;  3PU3 A;  4ZOL E;  2XUE A;  4JI1 T;  5LHG B;  3U3I A;  5J0Z A;  3NBX X;  5L3C B;  3ONX A;  4NUV A;  5LGN B;  2UXB T;  3AE1 A;  2MAW A;  2LHN A;  5A1L A;  1YXR A;  1R8I A;  3RIA A;  4JBW F;  1XMQ T;  3F57 A;  3WI3 A;  4EOZ B;  2AXD S;  4GKJ T;  2XAQ B;  4CI3 B;  4DID B;  3SS1 A;  4TWF A;  3ZCI A;  5EZY E;  3F31 A;  3PJA A;  4MFR A;  3ZPO A;  3RX6 A;  4O2B E;  2YN6 A;  5EK2 A;  4U33 A;  2WAU A;  3H37 A;  4I4T E;  4GK0 E;  3R84 B;  4E7Z A;  3FXD B;  4L5G A;  4J2C A;  3AE3 A;  2IIU A;  4XZC A;  2X0L B;  3KVB A;  2VKO A;  4HE8 A;  3FZM B;  2V5D A;  4ILU A;  4QX7 B;  1HS7 A;  4MHC A;  5HXR A;  2Z6E A;  2W0G A;  3SOL A;  2ACZ A;  1HNZ T;  2V7K A;  3T1Y T;  5KXJ A;  3C64 A;  1N33 T;  2XQ6 A;  3NRX A;  5IYZ E;  3NWI A;  1WCR A;  2ES0 A;  5JRE A;  4ILB A;  2E9X B;  1AJ3 A;  4PK6 A;  4HFC A;  4WZX A;  3C98 B;  2XQ7 A;  3CIR A;  4FJO A;  3IEE A;  5AQO B;  4A97 A;  2CWO A;  4NXN T;  2D0T A;  3CK6 A;  2XSA A;  4GIW A;  5H6R B;  2DWG A;  2LSG A;  4HFH A;  4BAY B;  3AB3 B;  1OXZ A;  4TWH A;  3GN5 A;  4EV6 A;  2DNX A;  3ONJ A;  2WB5 A;  3PTR B;  3N2K E;  1WRD A;  1LRZ A;  3RC8 A;  2LM9 A;  4NPP A;  1LVK A;  5CB4 E;  5EK4 A;  4QX8 B;  3ZKR A;  1YKE B;  2XY8 B;  2BS4 A;  2AE9 A;  2CBI A;  3LBX B;  2E5L T;  5LCY A;  2LSY A;  2CWY A;  3KBT A;  5LG4 A;  5HWX A;  5FVK A;  4QHO A;  4UV9 B;  2RA1 A;  4A5X A;  4JI7 T;  4JV5 T;  2CLY B;  2LEH A;  2Q9Q D;  2XJ7 A;  5LMU T;  4JI2 T;  2X68 A;  4X62 T;  1B7T A;  3NZQ A;  4HKA A;  4QWN B;  3VR8 A;  3ZJ1 A;  2DCF A;  3CQG B;  2LE8 A;  4LF5 T;  2WCA A;  3CX7 B;  1UCU A;  3PUQ A;  1Y01 A;  4EIW A;  5HEG A;  5E0O A;  4DR5 T;  3HR0 A;  3P50 A;  4AIS A;  4I43 B;  1WLX A;  3B5M A;  3MKD A;  3X1D A;  3VHL A;  4O8S A;  3PUY F;  2FJD A;  4IRE A;  2CA5 A;  2Q9Q A;  5FL0 A;  3R6N A;  3I9Y A;  5HAX A;  5JTG A;  2EHO D;  3ZYM A;  2ZM6 T;  1O3X A;  2KND A;  3A5X A;  3FHN A;  1IBL T;  3C51 A;  3E0Z A;  3RH3 A;  2VKD A;  4P0A A;  1FJG T;  2QYW A;  5KMG P;  3UFG A;  4FI5 A;  5AQI B;  1BR1 A;  3PDY A;  4PJJ A;  3C50 A;  2IML A;  4TNV A;  1W0B A;  3L09 A;  3UTK A;  3ZMZ B;  3PJA J;  4N78 D;  2VK9 A;  2YDS A;  3O1H A;  1G8X A;  3PE0 A;  3AAA B;  4IIJ E;  2Y6X A;  3FXE B;  4IDP A;  4OK0 A;  4AKH A;  1VCT A;  3JC6 C;  3KVA A;  3AA0 B;  4YXD A;  2WBL A;  5JDG A;  3RHW A;  2EHO A;  3QNU A;  5HCM A;  3RGL A;  2IHR 1;  3A8Y C;  3VRA A;  2SPC A;  3SWH A;  2N9D A;  3RYI E;  3CQX C;  4IGU A;  5LHI B;  4HN9 A;  2UXN B;  3VKG A;  2RP4 A;  2K5B B;  1HG5 A;  2OA5 A;  2Q9Q C;  4X1Y E;  5L3F B;  4YTM A;  5ADX L;  3GA8 A;  4H9Q C;  4OHF A;  4AXP A;  4EXT A;  3P4S A;  1H7C A;  2XAS B;  2WDV A;  4X65 T;  3PUZ F;  3RIU A;  4IL4 A;  4KI0 F;  4MAL A;  1D1C A;  2FBW A;  3UFE A;  2UU9 T;  1XDP A;  2W61 A;  3J9X 1;  4TNW A;  3ZT7 A;  4H9S E;  5JDN A;  2V7J A;  4WBO A;  2B76 A;  1J5E T;  4I0U A;  2DWK A;  5JDH A;  2WWU A;  2EHO C;  2PBI A;  3P4Q A;  2WU2 A;  3AE7 A;  4YFS A;  3AXJ A;  5FP3 A;  4JEH B;  2W2U A;  4G2A A;  4XAX B;  3IF8 B;  1XDO A;  1VRB A;  3N9N A;  2V26 A;  3UU3 A;  4UVB B;  1IBK T;  2YU2 A;  4I50 E;  4OYK A;  3HKB E;  4F6R C;  5J2T E;  2V6Y A;  2KXP B;  4JI5 T;  5AQN B;  2UUB T;  3HA4 A;  2K3W A;  2V6X A;  2BKN A;  3SFD A;  1N32 T;  1U5P A;  2YIN A;  3RQU A;  3O9X A;  3EAB A;  4ZEY A;  2LKH A;  2B1E A;  4U7Y A;  5DQV A;  4JYA T;  3BQL A;  2CEA A;  4OFZ A;  4LF6 T;  3N9Q A;  3P4P A;  1XNR T;  4EAH A;  1VOM A;  4CXX A;  4TV8 E;  3RYC E;  2WM9 A;  5HEO A;  2V5C A;  4UIG A;  5AQK B;  3AE5 A;  4H9O C;  3ZYL A;  2X9W A;  4H63 V;  3VR9 A;  3Q5D A;  4KHP T;  4HWC A;  3FZF B;  4HWD A;  3UU4 A;  4PK5 A;  5LOV E;  3UU8 A;  1WFD A;  4ZZC A;  1VCS A;  3T8O A;  4YJ3 E;  5HEJ A;  2VUR A;  3E08 A;  2WSS V;  4CQI A;  4PAG A;  3FZH B;  5AQS B;  2UUC T;  2QGS A;  2VQE T;  1MIY A;  4X5T A;  4TN7 B;  4DVD A;  3ZEF B;  2X51 A;  3QOF A;  3BK9 A;  1UK5 A;  5HXS A;  2Y48 B;  1UX5 A;  1FMV A;  2FJB A;  3P4R A;  5JDQ A;  4P1N A;  5AQH B;  1Y64 B;  2M67 A;  3OYZ A;  2X66 A;  2LRK A;  2RPA A;  4AIU A;  1NWM X;  4WBN E;  2LOS A;  4AQF A;  1OED B;  2CCQ A;  3VU7 H;  3AEE A;  1SUM B;  4DV5 T;  5JDL A;  3PUV F;  2NP9 A;  5JRC B;  2K48 A;  4M1P A;  3V5U A;  1HNX T;  2BS3 A;  1XNQ T;  4LF9 T;  1OWA A;  2LSK A;  4JI0 T;  4DUY T;  1ZEE A;  2LHR A;  3KIN B;  2LRL A;  3OKQ A;  2K24 A;  4AQY T;  3ZC1 A;  2HPL A;  3I1A A;  3PV0 F;  3IHR A;  4Q25 A;  5CJ5 A;  2BG9 C;  1HTJ F;  4DO0 A;  1YD8 G;  2A72 A;  3KV6 A;  4HEA A;  1HX1 B;  4ZS2 A;  3LJC A;  2X9Y A;  3K3N A;  2VAS A;  2LJL A;  4AKG A;  1T8B A;  5LJM A;  1MMG A;  4DR1 T;  4EYU A;  2BBJ A;  1J5W A;  2E9X A;  4U3C A;  2QA7 A;  2HN2 A;  1I6Z A;  2FJE A;  4ERR A;  4BJM A;  4CN1 A;  1CHU A;  3CX6 B;  1MMN A;  3EI0 A;  3S4U A;  1OED E;  3HKE E;  3PUS A;  2F4V T;  4IHJ E;  5JQG E;  3DTO A;  3LG7 A;  3FBL A;  2MYS A;  2NOX A;  3ZN0 B;  4DR3 T;  2QRX A;  3ZYK A;  3SRZ A;  2LOP A;  4QH5 A;  1G73 A;  4JI8 T;  4OX9 T;  3HL6 A;  1WYC A;  3LBX A;  3I0O A;  3E22 E;  4ADZ A;  1HNW T;  4UEM A;  2HN1 A;  3UQ7 A;  3ZST A;  4CXW A;  2L9Q A;  1W9R A;  2G0U A;  4LFA T;  2DL1 A;  4ZI3 D;  4PFO A;  2Y8D A;  4PJM A;  2MTQ A;  4DR2 T;  5LG3 A;  2YDQ A;  4MBQ A;  3HKC E;  5ABF B;  4NXM T;  5LNK A;  4UV8 B;  2A9U A;  1LVF A;  4V1A v;  3TLW A;  4AKR B;  4DUZ T;  2CPT A;  1T7S A;  3IA3 A;  2C0S A;  3KBU A;  5FVL A;  3JC6 D;  5L3G B;  2KWI B;  1HF8 A;  2CM0 A;  4TX5 A;  5AFU L;  2JQ9 A;  2KT9 A;  3U78 A;  2UXC T;  5LBM A;  5LJN A;  5LGU B;  3CPZ A;  2NW9 A;  1E1H B;  5AQT B;  3AE2 A;  1IBM T;  3MJX A;  4DV4 T;  4IE5 A;  2X0H A;  2W66 A;  4O2A E;  3QC9 A;  3J7Y q;  3I0Q A;  3UU6 A;  2WDQ A;  3FB2 A;  4HFV A;  3ZMS B;  2XSB A;  4AQG A;  2M6B A;  4GK5 E;  3RF1 A;  4DV1 T;  2JIW A;  2XQ9 A;  5HWY A;  3HKD E;  4B3S T;  1YKH B;  2CLY C;  4O4L E;  4YTN A;  3N9L A;  4A98 A;  2BBH A;  5AQM B;  4JEU B;  2WY2 A;  3ZSS A;  4K0K T;  2YOE A;  5FNV E;  3RKO A;  2UUA T;  5DAB A;  4DND A;  2BKO A;  2X67 A;  3FZL B;  3NZP A;  2WMO A;  3Q5E A;  4IST A;  2MOZ A;  1KK7 A;  2ZM0 A;  3P7I A;  4GOU A;  4Z8X A;  4EYY R;  4H63 H;  4CI1 B;  4ZI3 C;  3UQ4 A;  2CE7 A;  1LKX A;  1HG2 A;  2CXF A;  3PUX F;  3KV5 A;  3EHZ A;  2H7V C;  3P8C D;  5IUX A;  4UEL A;  4P09 A;  2OV9 A;  5LB7 B;  5KDM C;  3UU5 A;  2XPK A;  2C5K T;  4P0B A;  1FMW A;  4DR6 T;  1GQE A;  2NWB A;  3C4X A;  2CMR A;  5J2U E;  5LXT E;  3LSV A;  1D0Y A;  1E2A A;  1UX4 A;  4CN4 A;  2JMH A;  1ZOY A;  4IDZ A;  4CN6 A;  5JR9 B;  1N34 T;  3DP7 A;  3ZMU B;  2XQA A;  4ZI7 E;  1W09 A;  2IAK A;  3UT5 E;  3OTO T;  2XM2 A;  3JCF A;  2GK9 A;  1KNR A;  4YTP A;  3ANW B;  2CBJ A;  5AQU B;  3I9W A;  2XQ8 A;  3N9O A;  5CA0 E;  3AA6 B;  4ZZB A;  4H9P C;  5HYA A;  4QXB B;  5LYJ E;  4B3T T;  5DJQ C;  1KNZ A;  4DV2 T;  5EK3 A;  4LFC T;  2CXL A;  4UF0 B;  4X66 T;  4U2Z A;  5ETW A;  2E2A A;  3MAC A;  3VKH A;  4K0U A;  3AED A;  4EEB A;  3P4W A;  3AVS A;  4ILC A;  4ZHQ E;  2A2F X;  5FY0 A;  3CX8 B;  2W63 A;  1BR0 A;  3O4X E;  3ZLI A;  4KX6 A;  3N2G E;  1NEK A;  2LLY A;  1YQ3 A;  4IT4 A;  2KIN B;  3L39 A;  4HFE A;  2IDO B;  2WMN A;  2ODV A;  2HPJ A;  2JMK A;  4HFI A;  2LSJ A;  3TLS A;  4TWD A;  5LGT B;  4L0R A;  5LBQ B;  4H9N C;  1WR6 A;  1NAF A;  4DV3 T;  3G06 A;  2D5U A;  2KMF A;  3RIU C;  2H7O A;  5FY1 A;  3UUX B;  4TV9 E;  1CUN A;  3ZCJ A;  2R6G F;  3KV4 A;  4JI6 T;  4UR9 A;  4O4H E;  4JI3 T;  2NR4 A; 
#chains in the Genus database with same CATH homology
 4UV9 B;  2RA1 A;  2YEV C;  4EYU A;  3AVR A;  1S94 A;  4CI2 B;  2E9X A;  2BZB A;  2QA7 A;  4GYR A;  2ACX A;  5L3D B;  2DI4 A;  4ISS A;  5FXX A;  3ESL A;  4DMV A;  4B6X A;  2CLY B;  4HGA A;  2LEH A;  1HX8 A;  2Q9Q D;  2XAJ B;  3KDS E;  3DJB A;  3PUR A;  2X68 A;  5JR9 C;  2NW8 A;  4ERR A;  4BJM A;  4XBF B;  1BR4 A;  3RC3 A;  1B7T A;  4ZI2 D;  3NZQ A;  4HKA A;  3RYF E;  3CX6 B;  4QWN B;  5JRC A;  2IW5 B;  1MMN A;  2DCF A;  3ZJ1 A;  3CQG B;  1HCI A;  5TAO A;  3S4U A;  3D0T A;  3ETV A;  3HKE E;  2LE8 A;  4UVA B;  5L3B B;  3PUS A;  2K9A A;  3N9M A;  4IHJ E;  4C91 A;  5JQG E;  3KFW X;  2XQY A;  2KZ7 B;  2V7L A;  3CX7 B;  4WW0 A;  2E8I A;  1UCU A;  3DTO A;  3LG7 A;  3PUQ A;  4OYJ A;  4EIW A;  3Q9D A;  3FBL A;  2MYS A;  3C4W A;  2NOX A;  5E0O A;  3ZN0 B;  2A3D A;  3ZYK A;  3HR0 A;  3SRZ A;  3F2E A;  4QXH B;  2LOP A;  1G73 A;  4I43 B;  3HL6 A;  1WLX A;  1WYC A;  3LBX A;  3I0O A;  3E22 E;  4ADZ A;  2V1D B;  3MKD A;  2XAH B;  4UEM A;  3VHL A;  2EHO B;  4CXW A;  4O8S A;  2PJQ A;  3RRC A;  2L9Q A;  2XAG B;  2YU1 A;  4KBM B;  2KWH A;  3CVR A;  2G0U A;  2CA5 A;  1S35 A;  2X9H A;  2ODU A;  5FMN A;  2Q9Q A;  3AA1 B;  4ZI3 D;  4X1I E;  4PFO A;  3R6N A;  1ZHC A;  2N1G A;  4IE6 A;  3HI2 A;  5CA1 E;  3I9Y A;  5HAX A;  2Y8D A;  4PJM A;  1WYB A;  2EHO D;  3ZYM A;  1O3X A;  2KND A;  5FXV A;  2MTQ A;  3A5X A;  3FHN A;  3C51 A;  4MBQ A;  3E0Z A;  3RH3 A;  4EZH A;  2VKD A;  5IHY A;  3ZN1 B;  4P0A A;  3HKC E;  5FY7 A;  2E9X D;  4PJN A;  1MIV A;  5LNK A;  4UV8 B;  5KMG P;  2V7M A;  1LVF A;  4V1A v;  4FI5 A;  1BR1 A;  2JRK A;  3PDY A;  4AKR B;  3Q2M A;  4YJ2 E;  4PJJ A;  3K3O A;  3C50 A;  3L09 A;  3K8P C;  5L3E B;  2C0S A;  4C90 A;  3UTK A;  4ASK A;  3OBV E;  3ZMZ B;  3KBU A;  4HTE A;  4N78 D;  2VK9 A;  2H3R A;  3O1H A;  3JC6 D;  4UXN B;  3H3A A;  1MMA A;  1Z0P A;  1G8X A;  3GMI A;  5L3G B;  3PE0 A;  3AAA B;  4IIJ E;  3NRY A;  2Y6X A;  3Q5W A;  4IE0 A;  2KWI B;  3FXE B;  1HF8 A;  4OK0 A;  5FYM A;  2CM0 A;  3M65 A;  4AKH A;  4H9R C;  2JQQ A;  3C4Z A;  4TX5 A;  3JC6 C;  1MMD A;  2NW7 A;  3KVA A;  5HXE A;  5AFU L;  3AA0 B;  2KT9 A;  2VKJ A;  5BMV E;  2WBL A;  3U78 A;  5JDG A;  5LBM A;  1ZKE A;  5LJN A;  4QHO A;  2EHO A;  5LGU B;  2ZM8 A;  2ZLY A;  3CPZ A;  5JVD E;  3WAK A;  2NW9 A;  3UUL A;  2DHR A;  1E1H B;  4QKN A;  2IC9 A;  5M4Y A;  3BQK A;  3MXZ A;  2C5J A;  3MJX A;  1QUU A;  2SPC A;  4IE5 A;  2DLR A;  2CXD A;  4U74 A;  4AKL A;  3ZJ2 A;  3IBP A;  3SWH A;  4AKI A;  4O2A E;  2N9D A;  3RYI E;  2I59 A;  3ZC0 A;  1US7 B;  3QC9 A;  3CQX C;  4IGU A;  5LHI B;  3J7Y q;  3I0Q A;  4HN9 A;  4WNK A;  2ZMA A;  2UXN B;  3K3Q C;  3VKG A;  1V9D A;  3FB2 A;  4QXC B;  5L2L A;  4HFV A;  3ZMS B;  5H6Q B;  3WAJ A;  2RP4 A;  5HXC A;  4AQG A;  2K5B B;  1HG5 A;  2OA5 A;  2Q9Q C;  1MNE A;  3CQC B;  4X1Y E;  5L3F B;  5F3J A;  5FXW A;  4GK5 E;  4PK4 A;  5ADX L;  1SA0 E;  2UXX B;  3EDV A;  3GA8 A;  5KX5 E;  4H9Q C;  4X1K E;  3FBZ A;  4OHF A;  1T98 A;  5HWY A;  4L9I A;  4ZI2 C;  1D0X A;  4UVC B;  3HKD E;  4AXP A;  2YK0 A;  4AQF C;  4EXT A;  1YKH B;  2CLY C;  2W62 A;  4O4L E;  3AAE B;  3N9L A;  4PJL A;  2JJ9 A;  4KMC A;  3CKD A;  1H7C A;  2XTL A;  1D1B A;  2XAS B;  3MK7 C;  3UUN A;  3N9P A;  4BJN A;  4JEU B;  1IZN B;  5FNV E;  3RKO A;  4EB6 E;  4GYS A;  5HXH A;  3LK2 B;  2C5I T;  3MZK B;  5DAB A;  4MAL A;  1D1C A;  4DND A;  2X67 A;  2NTY A;  3UFE A;  4U72 A;  4I55 E;  3ETU A;  1D0Z A;  3NZP A;  1YW0 A;  2WMO A;  3OYX A;  4IST A;  2MOZ A;  3O1J A;  1HFA A;  3B57 A;  3GWH A;  1KK7 A;  2W61 A;  2ZM0 A;  4O4I E;  3P7I A;  3CML A;  4YHJ A;  4G63 A;  4X20 E;  4GOU A;  4Z8X A;  5F8P A;  4EYY R;  4H63 H;  2BVL A;  3J9X 1;  4CI1 B;  2VWA A;  4H9S E;  5JDN A;  3N5L A;  2V7J A;  4ZI3 C;  2D0U A;  4WBO A;  2LSI A;  2DWK A;  3PU8 A;  5JDF A;  5JDH A;  2CE7 A;  2WWU A;  1LKX A;  3QK6 A;  2EHO C;  4JLE A;  1ZV4 X;  5C8Y E;  2PBI A;  4CZZ B;  2J1D G;  4YFS A;  1HG2 A;  4E7S A;  2CXF A;  5FP3 A;  3CWZ B;  4JEH B;  5JH7 E;  2E9X C;  4G2A A;  3KV5 A;  4XAX B;  4DBQ A;  3IF8 B;  2H7V C;  2LT3 A;  3P8C D;  1VRB A;  2BVM A;  4ANJ A;  4KP3 C;  3N9N A;  2V26 A;  3MA9 A;  4P09 A;  4UEL A;  4O4J E;  4UVB B;  4TZ4 C;  2YU2 A;  3RPU A;  5KDM C;  4AI6 A;  4I50 E;  4OYK A;  2C5K T;  3HKB E;  4F6R C;  1EZ3 A;  4P0B A;  4ZS3 A;  1FMW A;  2KLQ A;  1SHZ C;  2JPF A;  4PW8 A;  1FEW A;  5J2T E;  3BQI A;  3AAI A;  2KXP B;  3LFM A;  3OJA A;  2X9X A;  3RRW A;  2W00 A;  3HA4 A;  1IJ5 A;  3PU3 A;  4ZOL E;  2NWB A;  2XUE A;  3EDU A;  5LHG B;  3C4X A;  3U3I A;  2V7I A;  1U5P A;  2CMR A;  2YIN A;  3O9X A;  4IE4 A;  3NBX X;  4PFP A;  5J2U E;  2B1E A;  5L3C B;  3ONX A;  4NUV A;  5DQV A;  5LGN B;  2VL8 A;  5LXT E;  3BQL A;  5JDM A;  1X79 A;  2CEA A;  3N2O A;  4OFZ A;  1D0Y A;  3N9Q A;  2LHN A;  4EAH A;  1UX4 A;  5A1L A;  1VOM A;  2JMH A;  4CXX A;  5FXZ A;  4TV8 E;  3F57 A;  4IDZ A;  3RYC E;  3PUA A;  3WI3 A;  5JR9 B;  2WM9 A;  4EOZ B;  4NUU A;  1U4Q A;  3DP7 A;  3ZMU B;  4DMW A;  2P9B A;  1BR2 A;  4UIG A;  5J1G A;  2XAQ B;  3QUJ A;  2HH7 A;  4CI3 B;  4H9O C;  4YLH A;  3SS1 A;  4ZI7 E;  3W15 B;  3ZCI A;  5EZY E;  3ZYL A;  1MIW A;  3F31 A;  4MFR A;  3ZPO A;  2X9W A;  2IAK A;  5LP6 E;  4H63 V;  3UT5 E;  2NTX A;  4BA9 A;  3RX6 A;  4O2B E;  5EK2 A;  2GK9 A;  2WAU A;  2D2S A;  3H37 A;  4I4T E;  3ANW B;  1D1A A;  3LK3 B;  4GK0 E;  4PK5 A;  3R84 B;  5LOV E;  3I9W A;  4E7Z A;  3FXD B;  3N9O A;  4L5G A;  5LHH B;  5CA0 E;  3AA6 B;  3GN5 B;  4J2C A;  4EZ4 A;  3T8O A;  4H9P C;  4XZC A;  4YJ3 E;  5HYA A;  3B13 A;  4QXB B;  2X0L B;  3E08 A;  5LYJ E;  2WSS V;  5DJQ C;  4PAG A;  4CQI A;  1KNZ A;  3KVB A;  5EK3 A;  2VKO A;  4HE8 A;  2VB6 A;  2CXL A;  4UF0 B;  4ILU A;  4QX7 B;  1HS7 A;  4MHC A;  5HXR A;  2XHE B;  4KUM B;  2Z6E A;  4JUY A;  2W0G A;  3RYH E;  2QGS A;  3EUH A;  5ETW A;  3SOL A;  2V7K A;  1MIY A;  3MAC A;  3VKH A;  4K0U A;  4TN7 B;  4DVD A;  3ZEF B;  3AA7 B;  3C64 A;  2VKH A;  2PG8 A;  2X51 A;  3BK9 A;  4DBR A;  3ZMT B;  5HXS A;  2Y48 B;  5GON E;  3L3P A;  3NRX A;  5LA6 E;  1UX5 A;  1FMV A;  5IYZ E;  5JDQ A;  3AVS A;  5JR9 A;  3Q5X A;  1FIO A;  2IC6 A;  2ES0 A;  2L8K A;  5JRE A;  2E9X B;  1AJ3 A;  4PK6 A;  4ZHQ E;  2A2F X;  2BDE A;  2MBG A;  1Y64 B;  2M67 A;  3OYZ A;  5FY0 A;  3C98 B;  3CX8 B;  2W63 A;  2X66 A;  4FJO A;  1BR0 A;  2XAF B;  3O4X E;  4CXY A;  3ZLI A;  3IEE A;  3N2G E;  5DQW A;  1NWM X;  3KV9 A;  2CWO A;  2LOS A;  4WBN E;  4AQF A;  2D0T A;  1QSD A;  2CCQ A;  3VU7 H;  4GIW A;  5H6R B;  5JDL A;  2DWG A;  2LSG A;  3UUM A;  2KIN B;  2NP9 A;  3ANW A;  5JRC B;  2K48 A;  4BAY B;  3AB3 B;  4M1P A;  3V5U A;  2WMN A;  2L3L A;  2ODV A;  3EVY A;  2HPJ A;  1OWA A;  4MLK A;  2JMK A;  1OXZ A;  2LSK A;  4A56 A;  3GN5 A;  2LSJ A;  2PFV A;  2DNX A;  3PTR B;  3ZMV B;  3TKL B;  3N2K E;  1WRD A;  1ZEE A;  1LRZ A;  2LHR A;  4L0R A;  5LGT B;  3PUG A;  5LBQ B;  3KIN B;  4H9N C;  3RC8 A;  1WR6 A;  1NAF A;  4TUY E;  2LM9 A;  3OKQ A;  2K24 A;  1LVK A;  5CB4 E;  1IAP A;  5EK4 A;  4UF0 A;  3ZC1 A;  4IE7 A;  4QX8 B;  1YKE B;  2HPL A;  1MND A;  3I1A A;  2D5U A;  2KMF A;  3IHR A;  3LBX B;  2H7O A;  5LCY A;  1HTJ F;  3LK4 2;  3O1I A;  3V5S A;  4DO0 A;  2N2N A;  4TV9 E;  1CUN A;  5FY1 A;  1YD8 G;  2A72 A;  2LSY A;  3KV4 A;  3UUX B;  3KV6 A;  4HEA A;  2CWY A;  4O4H E;  3KBT A;  4PNI A;  4ZS2 A;  5LG4 A;  3LJC A;  2X9Y A;  5HWX A;  1IJ6 A;  3ZCJ A;  3K3N A;  2ZM2 A;  2VAS A;  2LJL A;  4AKG A;  5LJM A;  2Q9Q B;  1MMG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...