3D0TA

Structure of the bnb domain of the hsp70 cochaperone bag2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
84
structure length
77
Chain Sequence
b'SEESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAIK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 2
molecule tags Chaperone
source organism Mus musculus
publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2.
pubmed doi rcsb
total genus 37
structure length 77
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3d0tA00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
3C50A 2CA5A 3OJAA 3R6NA 2KNDA 3PDYA 4DMWA 4X64T 3JAFA 4JI1T 5CGMA 1GQEA 5TAOA 2WBLA 4A5XA 3RYFE 1QUUA 2WQYA 2YDRA 3GA8A 4PK6A 4CI2B 1Z8UA 1UCUA 2A9UA 2UUCT 4ZS2A 4EGWA 3V5SA 2HN1A 4TV8E 1WR6A 2B1EA 2X66A 3E0ZA 3E08A 3KVAA 3LSVA 1JNRA 4EEBA 3C4WA 4CXXA 3QUJA 4BJMA 2NW8A 2BBHA 4DR3T 4AIUA 1J5WA 1J5ET 3PUSA 4AISA 2WZIA 2WDQA 2VVNA 3N9NA 4UXNB 3AA1B 4OK0A 1ZKEA 2BVMA 5JDNA 2MOZA 3K3NA 2V7MA 5IWAT 2QA7A 1HFAA 2L9QA 2LEHA 2WWUA 2XM1A 4U2YA 3RIUC 5EK2A 4U33A 3LFMA 3RGLA 5J2TE 4B3ST 2LKHA 4YFSA 2LOSA 3VR9A 2QVAA 3ZYLA 5HWXA 3UQ7A 2CHOA 3CWZB 4WBOA 5JDGA 2ZMAA 3AXJA 3AEDA 3UU8A 3Q5XA 3LK42 5HEOA 3CQXC 1XNRT 3ONXA 1X79A 1KF6A 4ZI3D 1E7PA 2XASB 3AE7A 5AQGB 1SUMB 2BS2A 3MZKB 4UVAB 4ADZA 2LHRA 3AB3B 3RF1A 5ABEA 4YTMA 3SFDA 3JC6D 3AA6B 2JQHA 1KNRA 3EDVA 2BKOA 3JADA 3PUWF 4UEMA 2UXNB 1OEDC 2EHOC 3SRZA 2VL0A 4AQFA 4DV3T 3AE5A 2NR4A 2VKOA 4L9IA 4PW8A 3ZN1B 3ZT6A 3BQKA 2SPCA 1N36T 2J62A 3K1SA 1HNXT 1I6ZA 4ILUA 3X1DA 2X67A 3AEFA 3O4XE 5L3GB 1S35A 2BG9A 2W61A 3E22E 2CLYC 3HKDE 3O1IA 1WYCA 4B3RT 1W9RA 3N2KE 3UT5E 4QH1A 2CBIA 2YDQA 3HL6A 2CCQA 2E9XA 3HKEE 4NXNT 2H7VC 2YINA 2DCFA 3AE1A 1VRBA 3A5XA 5DABA 4UV9B 5L3BB 1YW0A 5F8PA 2AXDS 2WWVA 2UUAT 1LVKA 2V7IA 3CX7B 5KDMC 1KNZA 3RC8A 3F31A 4ILCA 1HTJF 3TKLB 3C4ZA 4YT0A 5CJ5A 5F3JA 1IBLT 3NKZA 4U7YA 3MK7C 4IDNA 1EZ3A 4X1KE 3J9X1 1N33T 2KXPB 4AKLA 3B57A 4AKHA 2W0GA 4HFHA 3PE0A 4WW0A 5HXCA 5ABGA 2VL8A 4ILBA 4DBQA 5HEJA 3PJAA 4DR1T 4EOZB 3QNUA 5CA1E 2WMOA 4PJLA 2HPLA 3AVSA 5AQSB 3RYHE 2XQ4A 2D9DA 2CXLA 5HCMA 3RKOA 3C4XA 3M3ZB 2V26A 4UVBB 1FIOA 5DQWA 5EK3A 4DV7T 2Y8DA 5F5WA 3ESLA 3UU5A 3KBUA 5J1GA 4MFRA 2PJQA 4YLHA 2XZEA 3EDUA 3QB5K 1W0AA 2LT3A 4COFA 4LF7T 2XSBA 3TLSA 3ZC0A 4CQIA 1T7SA 2FJDA 3P4WA 3ZCIA 3ANWA 4OX9T 2P9BA 5CA0E 4H9QC 5JR9B 1D1CA 2YOEA 4Z8XA 4ZS3A 3MACA 3RHWA 4OFZA 4EAHA 4JV5T 4PK4A 3AA7B 2M6IA 3EHZA 4IE0A 5JDMA 3JC6C 3G06A 2H3RA 4LMKA 3U3IA 5FKYA 3IA3A 2FJBA 3NVOA 3T1YT 3FXDB 3UU3A 4UF0A 1LKXA 2V6XA 3C98B 5HYAA 2DNXA 4I43B 1D0ZA 4FI5A 5FXVA 3N2GE 2E9XD 4JUYA 4LF6T 3PUVF 2Q9QA 2NWBA 2QRXA 5CB4E 2NTYA 4F8HA 2F4VT 1N32T 2WZHA 4GIWA 3MKDA 2X51A 3AEBA 5HEHA 1VOMA 4ERRA 1ZV4X 3RQUA 4OYKA 3WAKA 3PV0F 1QSDA 4J2CA 2ZM2A 4YXDA 1LVFA 2V6YA 4ZOLE 2KLQA 2V1DB 3P50A 4EZ4A 2BS4A 1CHUA 2YN6A 4HFEA 1MMAA 3ZYKA 4EYUA 2KINB 3ZSSA 2K48A 3AAAB 3BQIA 3K8PC 2XQ6A 3MXZA 3NZQA 4H63V 4TV9E 4IHJE 1M62A 3ZEFB 1XNQT 2KMFA 2XAJB 1UURA 4UR9A 4CI1B 2H89A 2W63A 4U31A 4NUVA 3ZSTA 4DR5T 5LYJE 2IW5B 1HR0T 3ZT5A 1BR4A 1D0YA 4HWCA 4KX6A 3AE8A 4ASKA 3ETUA 3HA4A 4DV5T 2RP4A 3B13A 2WU5A 3LBXB 3ZMUB 3UULA 1ZEEA 5JREA 4N78D 3CK6A 3FZFB 2IAKA 5A1LA 2ACXA 4X1YE 3AE6A 2H88A 3O1HA 2N9DA 3HI2A 3L39A 1NENA 4IIJE 4O2BE 1HG5A 5EZYE 3SOLA 4YSYA 1W09A 3UU4A 5ABFA 5HXRA 5L3FB 5FL0A 3UTKA 4U72A 4X66T 2G0UA 4GK0E 1S94A 3PURA 1UUSA 1Y01A 3KV6A 3VR8A 2Y6XA 3P4PA 1FJGT 5HEGA 2BG9C 1KEYA 1H7CA 4HFDA 4YJ2E 3OVUA 4UVCB 1YQ4A 3RQWA 4HWDA 4B3MT 4M1PA 5ADXL 2NW9A 2VKJA 5C3JA 2JMKA 5IUXA 2A3DA 2CE7A 3C64A 1DU2A 2DLRA 4A98A 4A97A 2OA5A 4HFIA 3NRYA 3ZT7A 3FZLB 3AE2A 3ZPOA 2E8IA 2KSRA 4H9SE 1OEDB 2NW7A 2VWAA 3H3MA 3RC3A 1UGOA 3CIRA 3PU8A 3VU7H 5JR9C 2JPFA 1E2AA 2Q9QC 1VCTA 3AAEB 5LCYA 3RYIE 4DVDA 2IUBA 3LG7A 5BMVE 3LK3B 3ZCJA 4DV4T 4AXPA 3F2EA 5J0ZA 3P4SA 2J4GA 5JVDE 4JI2T 4Q25A 5AQUB 1YXRA 2LJLA 3AE4A 4TWDA 4QXBB 1HS7A 2D0UA 4MLKA 3CPZA 2W67A 5AQJB 2LKGA 4NXMT 4GYSA 4NUUA 2A2FX 1T98A 2VQET 4K0KT 2V7LA 2BKNA 4HN9A 3R84B 2KWIB 4QWNB 4CN6A 3N5LA 4UV8B 5LJNA 5LHGB 3SFEA 2WP9A 2ODUA 3FXEB 1N34T 4X5TA 2LRKA 4YSZA 5AQLB 3ETVA 2V7KA 3GN5B 1UK5A 1Y64B 2LSGA 3CQCB 4MALA 2NTXA 4B3TT 2XAHB 4EV6A 4GKJT 5LHHB 4X65T 2X0LB 5AQNB 3RRWA 4B6XA 3Q5DA 1HX8A 5FYMA 4IDQA 5HCJA 4CN1A 5AQHB 4DV6T 3VKGA 4P0BA 5EK4A 1WRDA 5IHYA 3A8YC 3PUYF 4E7ZA 2RA1A 2WY2A 4DV2T 4AI6A 5HXSA 3EAMA 3ONJA 3IEEA 4ZXLA 2LE8A 2V6YB 3TLWA 3A7MA 4LF9T 2FBWA 4H9RC 4TNVA 4GKKT 3GWHA 3WAJA 4IE7A 3RPUA 4BAYB 1XWMA 4ISSA 3UUBA 2KZ7B 4U2ZA 5IYZE 5ETWA 2K5BB 2NOXA 2QGSA 4HWHA 4LFCT 5H6QB 5JDLA 1UX4A 2XHEB 2X0HA 4IE4A 1W0BA 4ZI2C 5JTGA 2UXBT 1YKHB 2PTFA 2M67A 4IL9A 5FXWA 1WYBA 3DP7A 3I9YA 5M4YA 2D2SA 3SS1A 4ZZCA 2LSIA 4QXCB 3AXJB 4X62T 2LM9A 1OEDA 2EHOA 2X9XA 4QXHB 4WZXA 5LBMA 4AQFC 3IBPA 2J47A 3LDQB 5JQGE 1IBMT 3CQGB 3ZMTB 2HH7A 5KXJA 5LGUB 5FNVE 5AQTB 4DNDA 2MYSA 2XSAA 4YTNA 5ABHA 3UFGA 5LOVE 1IJ5A 3K3QC 3P7IA 4I0UA 4DO0A 3KV5A 4EXTA 4JI8T 2WSSV 5HWYA 2DI4A 4P09A 2OLTA 3PTRB 5AQIB 5JR9A 3OPCA 4ZI7E 4H9OC 2WCAA 1IAPA 3ZLIA 2W62A 3UUXB 2CRBA 2VQFT 3OBVE 2E5LT 3N9QA 5LNKA 5HXHA 1D1BA 2DHRA 4LFBT 2YKSA 1MMGA 1IBKT 2BG9E 3Q5EA 4DUZT 4DV0T 4QKNA 2H7OA 2D0TA 3CKDA 4EZHA 3HKCE 3CMLA 4HE8A 2BVLA 4TZ4C 4LF8T 3HKBE 2ZLYA 4TUYE 4YY3T 1FMWA 2FUPA 4JEHB 1D0XA 3KBTA 3CX8B 4HEAA 3EUHA 5LGNB 5JDHA 2R6GF 4JBWF 1MNDA 3N2OA 1QLBA 5HEUA 4IE5A 3CX6B 4MBQA 4TWHA 1YKEB 4JI5T 4HWFA 5FL1A 3O1JA 2V8SV 2XTLA 3KFWX 4HFCA 2V7JA 3LJCA 5LMUT 3PJAJ 1IZNB 4O8SA 3UU6A 3PUAA 4JI0T 3H37A 2MAWA 3PUGA 4L0RA 5LJMA 2WAUA 2HPJA 3ABVA 1KFYA 3Q9DA 4PJJA 2JJ9A 2E9XC 2XM2A 3LBXA 1WFDA 3FZKB 1ZP0A 3HR0A 3P4RA 2YU1A 3RH3A 3JAEA 3FBZA 4WNKA 4ZI2D 2XQ3A 3MJXA 4PJMA 4CN4A 1CUNA 4YJ3E 2PBIA 4C91A 1B7TA 3Q2MA 3QOFA 3I0OA 2YK0A 5DJQC 4XZCA 1OXZA 1XDPA 4YSXA 1VCSA 3I1AA 5FXZA 1U4QA 2HN2A 4GYRA 4JI4T 4LF5T 4KP3C 3QK6A 3GN5A 5HXEA 5H6RB 3FHNA 5AQFB 2HHHT 1BR2A 1V9DA 4NPPA 2ACZA 4H9PC 4JI3T 2CPTA 3I0QA 3KV4A 2XAGB 4FJOA 4LFAT 4G2AA 4WYVA 2I59A 2XAQB 4UF0B 3ZKRA 4YHHT 2X9YA 2W66A 2FJAA 2I6HA 3AEAA 2WU2A 2V5DA 5LGTB 2AE9A 5LP6E 4V1Av 5L3EB 2LSKA 2VURA 3F57A 4QX7B 4XAXB 2LSJA 5FY0A 4IE6A 4EIWA 2Q9QB 3FZHB 3W15B 5LHIB 2Z6EA 3T8OA 2IDOB 4EEDA 4QHOA 1JNZA 1NWMX 1MIYA 2CM0A 3L8RA 4JEUB 4O4JE 4KHZF 1HG2A 2UXXB 2IMLA 5JRCB 3UUNA 3AVRA 2N2NA 2QYWA 1MIVA 1XZYA 3D0TA 4Z90A 3J7Yq 2UXCT 2JQKA 1G73A 2KT9A 3AEEA 5LA6E 3KV9A 2YEVC 1XMQT 4ZEYA 2PFVA 4DR4T 3K3OA 4AQGA 2VASA 4DV1T 4KI0F 1XMOT 3P8CD 4PK5A 2MBGA 4JI6T 4DR6T 3EVYA 4HWIB 5KX5E 3CVRA 3N9OA 3H3AA 3RIAA 5JDQA 4QH4A 3RI5A 1MMDA 3TLVA 2LRLA 2XQYA 3ZJ1A 2CXFA 3ANWB 3EI0A 3L3PA 4TX5A 3KINB 1T72A 5LG3A 1MIWA 4O4LE 2BDEA 2BKPA 3O9XA 2VKDA 5LB7B 5JRCA 3NBXX 1KK7A 2JIWA 3WI3A 3I9WA 4CXWA 2XQAA 3N9LA 4I4TE 4KBMB 5AQQB 3UFEA 2E2AA 3GMIA 2XQ8A 2C5JA 3ZJ2A 3M65A 4U7IA 4HTEA 4ANJA 4PNIA 4AKIA 4LMLA 5J2UE 2XJ7A 5C2TA 5AFUL 4QX8B 2X0YA 2CWYA 3PUQA 3AA0B 4ZHQE 2C5IT 2NP9A 3T1HT 4DBRA 1O3XA 2BG9B 2JMHA 4IDOA 2ZM8A 1G8XA 1WR0A 2XQ5A 1Z0PA 1J1JA 3KVBA 1SE7A 1HNWT 5FY1A 4GOUA 4CZZB 1NEKA 4DIDB 4O2AE 2VK9A 3AEGA 3RYCE 1FEWA 2UXDT 2VVSA 2WDVA 4OHFA 2K3WA 2MTQA 2L8KA 3VRAA 4P0AA 4H63H 2E9XB 3RX6A 3ZMZB 2IC9A 4YHJA 4HFVA 3PUZF 3NZPA 5FP3A 4CI3B 5AQKB 3ONLC 5L4HA 4C90A 3ZN0B 2J1DG 4QH5A 3UQ4A 5KMGP 2YU2A 5L4EA 1I94T 1XDOA 5LBQB 4E7SA 1ZOYA 4MHCA 2CHNA 2CEAA 2ES0A 5L2LA 1YQ3A 3Q5WA 4K0UA 5C8YE 5AQPB 2CBJA 5GONE 1SHZC 2YDSA 5BR8T 1UX5A 4KHPT 2UU9T 1US7B 4EYYR 2Y48B 4AKGA 1OWAA 4LMJA 2XAFB 3V5UA 2B76A 2DL1A 2BZBA 3VHLA 4BJNA 3OTOT 3C51A 4P1NA 3AAIA 2XY8B 4PFPA 3S4UA 2UUBT 3BQLA 2PG8A 1FMVA 3AE9A 3ZMSB 2A72A 2CLYB 2CMRA 2X68A 1U5PA 2EHOD 2W00A 3ZYMA 5LG4A 4X20E 4HKAA 4EB6E 4ILAA 2VKHA 4AQYT 5HAXA 3DJBA 2L3LA 2WB5A 1MNEA 3N9PA 4U74A 4PAGA 2MPKA 4DR7T 2GK9A 2BS3A 2D5UA 4TWFA 4I55E 5LXTE 4F6RC 3DTOA 4CXYA 4PFOA 3UUMA 2LLYA 1BR1A 1R8IA 4O4IE 4DR2T 5L3DB 4TN7B 2DWKA 3BK9A 3B5MA 5JH7E 2XQ7A 3RRCA 2I0MA 3IHRA 5JDFA 2DWGA 4PJNA 1M7KA 4O4HE 3TLTA 4IDPA 1MMNA 1ZHCA 2K24A 1E1HB 3QB5A 4JLEA 4UELA 4UIGA 4GK5E 2CWOA 4JI7T 3FBLA 3MA9A 3VRBA 4DMVA 2WDRA 2C0SA 5FMNA 4KUMB 3ZC1A 4AKRB 4Z91A 2V5CA 5ABFB 2M6BA 1AJ3A 4IDZA 4IREA 1BR0A 2LM2A 4G63A 5AQVB 2CXDA 3RIFA 3ZMVB 4U3CA 2Q9QD 1WLXA 1LRZA 2JQ9A 4ISTA 5LMNT 4YTPA 2E5VA 4HGAA 1HF8A 2EHOB 2JQQA 4KMCA 3PUXF 3RIUA 2ZM6T 4XBFB 3OYXA 2LHNA 5AQMB 5FXXA 3P4QA 1HX1B 4I50E 4IT4A 2C5KT 2RPAA 1T8BA 2LOPA 2XQ9A 1WCRA 5L3CB 2KWHA 3AE3A 4LF4T 3FB2A 3RLFF 3KDSE 2BBJA 1OEDE 3U78A 2JRKA 2W4XA 2ZM0A 2WS3A 5FVKA 5FVLA 5E0OA 4H9NC 3JCFA 3NWIA 2VB6A 4WBNE 1D1AA 2X9HA 3OYZA 4IGUA 4HFBA 5FY7A 4NIQA 2XPKA 1L0VA 3SWHA 4IL4A 1HNZT 3IF8B 2W2UA 2WM9A 4OYJA 4X1IE 2OV9A 2XUEA 3OKQA 3PU3A 3RKGA 1X9BA 2ODVA 2IC6A 4DUYT 2N1GA 3L09A 3NRXA 3VKHA 5AQRB 2IIUA 3EABA 4ZI3C 4A56A 1IJ6A 1KNPA 2WMNA 4TNWA 5L47A 2K9AA 5AQOB 1SA0E 1NAFA 2FJEA 4L5GA 1YD8G 3N9MA 5CFBA 4JYAT 2X9WA 3QC9A 2IHR1 1HCIA 3TLUA 3FZMB 4BA9A 5DQVA 4ZZBA 2LSYA 3AECA 3LK2B
chains in the Genus database with same CATH topology
3C50A 2CA5A 3OJAA 3R6NA 2KNDA 3PDYA 4DMWA 5TAOA 2WBLA 3RYFE 1QUUA 4PK6A 4CI2B 3GA8A 1UCUA 4ZS2A 3V5SA 4TV8E 1WR6A 2B1EA 2X66A 3E0ZA 3E08A 3KVAA 3C4WA 4CXXA 3QUJA 4BJMA 2NW8A 3PUSA 3N9NA 4UXNB 3AA1B 4OK0A 1ZKEA 2BVMA 5JDNA 2MOZA 3K3NA 2V7MA 2QA7A 1HFAA 2L9QA 2LEHA 2WWUA 5EK2A 5J2TE 3LFMA 4YFSA 2LOSA 3ZYLA 5HWXA 3CWZB 4WBOA 5JDGA 2ZMAA 3Q5XA 3LK42 3CQXC 3ONXA 1X79A 4ZI3D 2XASB 3MZKB 4UVAB 4ADZA 2LHRA 3AB3B 3JC6D 3AA6B 3EDVA 4UEMA 2UXNB 3SRZA 2EHOC 4AQFA 2VKOA 4L9IA 4PW8A 3ZN1B 3BQKA 2SPCA 4ILUA 2X67A 3O4XE 5L3GB 1S35A 2W61A 3E22E 2CLYC 3HKDE 3O1IA 1WYCA 3N2KE 3UT5E 3HL6A 2CCQA 2E9XA 3HKEE 2H7VC 2YINA 2DCFA 1VRBA 3A5XA 5DABA 4UV9B 5L3BB 1YW0A 5F8PA 1LVKA 2V7IA 3CX7B 5KDMC 1KNZA 3RC8A 3F31A 1HTJF 5F3JA 3C4ZA 3J9X1 3MK7C 1EZ3A 4X1KE 2KXPB 4AKLA 3B57A 4AKHA 2W0GA 4WW0A 3PE0A 5HXCA 2VL8A 4DBQA 4EOZB 5CA1E 2WMOA 4PJLA 2HPLA 3AVSA 3RYHE 2CXLA 3RKOA 3C4XA 2V26A 4UVBB 1FIOA 5DQWA 5EK3A 2Y8DA 3ESLA 3KBUA 5J1GA 4MFRA 2PJQA 4YLHA 3EDUA 2LT3A 3ZC0A 4CQIA 3ZCIA 3ANWA 2P9BA 5CA0E 4H9QC 5JR9B 1D1CA 4Z8XA 4ZS3A 4EAHA 3MACA 4OFZA 4PK4A 3AA7B 4IE0A 5JDMA 3JC6C 2H3RA 3U3IA 3FXDB 4UF0A 1LKXA 3C98B 5HYAA 2DNXA 4I43B 1D0ZA 4FI5A 5FXVA 3N2GE 2E9XD 4JUYA 2Q9QA 2NWBA 5CB4E 2NTYA 4GIWA 3MKDA 2X51A 1VOMA 4ERRA 1ZV4X 3WAKA 4OYKA 4J2CA 1QSDA 2ZM2A 1LVFA 4ZOLE 2KLQA 2V1DB 4EZ4A 1MMAA 3ZYKA 4EYUA 2KINB 2K48A 3AAAB 3BQIA 3K8PC 3NZQA 3MXZA 4H63V 4TV9E 3ZEFB 4IHJE 5LHIB 2KMFA 2XAJB 4CI1B 2W63A 4NUVA 5LYJE 2IW5B 1BR4A 1D0YA 4ASKA 3ETUA 3HA4A 2RP4A 3B13A 3ZMUB 3LBXB 3UULA 1ZEEA 5JREA 4N78D 2IAKA 5A1LA 2ACXA 4X1YE 3O1HA 2N9DA 3HI2A 4O2BE 4IIJE 3SOLA 1HG5A 5EZYE 5L3FB 5HXRA 3UTKA 4U72A 2G0UA 4GK0E 1S94A 3PURA 3KV6A 2Y6XA 1H7CA 4YJ2E 4UVCB 4M1PA 5ADXL 2NW9A 2VKJA 2JMKA 2A3DA 2CE7A 3C64A 2DLRA 2OA5A 3NRYA 3ZPOA 2E8IA 4H9SE 2NW7A 2VWAA 3RC3A 3PU8A 3VU7H 5JR9C 2JPFA 2Q9QC 3AAEB 5LCYA 3RYIE 4DVDA 5BMVE 3LG7A 3LK3B 3ZCJA 4AXPA 3F2EA 5JVDE 2LJLA 4QXBB 1HS7A 2D0UA 4MLKA 3CPZA 4GYSA 4NUUA 2A2FX 1T98A 2V7LA 4HN9A 3R84B 2KWIB 4QWNB 5LJNA 3N5LA 4UV8B 5LHGB 2ODUA 3FXEB 3ETVA 2V7KA 3GN5B 1Y64B 2LSGA 3CQCB 4MALA 2NTXA 2XAHB 5LHHB 2X0LB 3RRWA 4B6XA 3VKGA 1HX8A 5FYMA 4P0BA 5EK4A 1WRDA 5IHYA 4E7ZA 2RA1A 4AI6A 5HXSA 3IEEA 2LE8A 4H9RC 3GWHA 3WAJA 4IE7A 3RPUA 4BAYB 4ISSA 2KZ7B 5IYZE 5ETWA 2K5BB 2NOXA 2QGSA 5H6QB 5JDLA 2XHEB 1UX4A 4IE4A 4ZI2C 1YKHB 5FXWA 2M67A 1WYBA 3DP7A 3I9YA 5M4YA 2D2SA 3SS1A 2LSIA 4QXCB 2LM9A 5LBMA 2EHOA 2X9XA 4QXHB 4AQFC 3IBPA 5JQGE 3CQGB 3ZMTB 2HH7A 5LGUB 5FNVE 4DNDA 2MYSA 5LOVE 1IJ5A 3K3QC 3P7IA 4DO0A 3KV5A 4EXTA 2WSSV 5HWYA 2DI4A 4P09A 3PTRB 5JR9A 4ZI7E 4H9OC 3ZLIA 1IAPA 2W62A 3UUXB 3OBVE 3N9QA 5LNKA 5HXHA 1D1BA 2DHRA 1MMGA 4QKNA 2H7OA 2D0TA 3CKDA 4EZHA 3HKCE 3CMLA 4HE8A 2BVLA 4TZ4C 3HKBE 2ZLYA 4TUYE 1FMWA 4JEHB 1D0XA 3KBTA 3CX8B 4HEAA 3EUHA 5LGNB 5JDHA 3TKLB 1MNDA 3N2OA 4IE5A 3CX6B 4MBQA 1YKEB 3O1JA 2XTLA 3KFWX 2V7JA 3LJCA 4O8SA 1IZNB 3PUAA 3H37A 3PUGA 4L0RA 5LJMA 2WAUA 2HPJA 3Q9DA 4PJJA 2JJ9A 2E9XC 3LBXA 3HR0A 3RH3A 2YU1A 4ZI2D 3FBZA 4WNKA 3MJXA 4PJMA 1CUNA 4YJ3E 2PBIA 4C91A 1B7TA 3Q2MA 3I0OA 2YK0A 5DJQC 4XZCA 1OXZA 3I1AA 5FXZA 1U4QA 4GYRA 4KP3C 3QK6A 3GN5A 5HXEA 5H6RB 3FHNA 1BR2A 1V9DA 4H9PC 3I0QA 3KV4A 2XAGB 4FJOA 4G2AA 2I59A 2XAQB 4UF0B 2X9YA 5LP6E 5LGTB 4V1Av 5L3EB 2LSKA 3F57A 4QX7B 4XAXB 2LSJA 5FY0A 4IE6A 4EIWA 2Q9QB 3W15B 2Z6EA 3T8OA 4QHOA 2CM0A 1NWMX 1MIYA 4O4JE 4JEUB 1HG2A 2UXXB 5JRCB 3UUNA 3AVRA 2N2NA 3D0TA 1MIVA 3J7Yq 1G73A 2KT9A 5LA6E 3KV9A 2YEVC 2PFVA 3K3OA 4AQGA 2VASA 3P8CD 4PK5A 2MBGA 3EVYA 5KX5E 3CVRA 3N9OA 3H3AA 5JDQA 1MMDA 2XQYA 3ZJ1A 2CXFA 3ANWB 3L3PA 4TX5A 3KINB 1MIWA 4O4LE 2BDEA 3O9XA 2VKDA 5JRCA 3NBXX 1KK7A 3WI3A 3I9WA 4CXWA 4I4TE 3N9LA 4KBMB 3UFEA 3GMIA 2C5JA 3ZJ2A 3M65A 4HTEA 4ANJA 4PNIA 4AKIA 5J2UE 5AFUL 4QX8B 2CWYA 3PUQA 3AA0B 4ZHQE 2C5IT 2NP9A 4DBRA 1O3XA 2JMHA 2ZM8A 1G8XA 3KVBA 1Z0PA 5FY1A 4GOUA 4CZZB 4O2AE 2VK9A 3RYCE 1FEWA 4OHFA 4P0AA 2MTQA 2L8KA 4H63H 2E9XB 3RX6A 3ZMZB 2IC9A 4YHJA 4HFVA 5FP3A 3NZPA 4CI3B 4C90A 3ZN0B 2J1DG 5KMGP 2YU2A 5LBQB 4E7SA 4MHCA 2CEAA 2ES0A 5L2LA 3Q5WA 5C8YE 4K0UA 5GONE 1SHZC 1UX5A 1US7B 4EYYR 2Y48B 4AKGA 1OWAA 2XAFB 3V5UA 3VHLA 4BJNA 2BZBA 3C51A 3AAIA 4PFPA 3S4UA 3BQLA 2PG8A 1FMVA 3ZMSB 2A72A 2CLYB 2CMRA 2X68A 1U5PA 2EHOD 2W00A 3ZYMA 5LG4A 4X20E 4HKAA 4EB6E 2VKHA 5HAXA 3DJBA 2L3LA 3N9PA 1MNEA 4U74A 4PAGA 2GK9A 2D5UA 4I55E 5LXTE 4F6RC 3DTOA 4CXYA 4PFOA 3UUMA 1BR1A 4O4IE 5L3DB 4TN7B 2DWKA 3BK9A 5JH7E 3RRCA 3IHRA 5JDFA 2DWGA 4PJNA 4O4HE 4UIGA 1MMNA 1ZHCA 2K24A 1E1HB 4JLEA 4UELA 4GK5E 2CWOA 3FBLA 3MA9A 4DMVA 2C0SA 5FMNA 4KUMB 3ZC1A 4AKRB 1BR0A 1AJ3A 4IDZA 4G63A 2CXDA 3ZMVB 2Q9QD 1WLXA 1LRZA 4ISTA 4HGAA 4KMCA 1HF8A 2EHOB 2JQQA 4XBFB 3OYXA 2LHNA 5FXXA 4I50E 2C5KT 2LOPA 5L3CB 2KWHA 3FB2A 3KDSE 3U78A 2JRKA 2ZM0A 5E0OA 4H9NC 2VB6A 4WBNE 1D1AA 2X9HA 3OYZA 4IGUA 5FY7A 3SWHA 3IF8B 2WM9A 4OYJA 4X1IE 2XUEA 3OKQA 3PU3A 2ODVA 2IC6A 2N1GA 3L09A 3NRXA 3VKHA 4ZI3C 4A56A 1IJ6A 2WMNA 2K9AA 1SA0E 1NAFA 4L5GA 1YD8G 3N9MA 2X9WA 3QC9A 1HCIA 4BA9A 5DQVA 2LSYA 3LK2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 3C50 A;  2CA5 A;  3OJA A;  3R6N A;  2KND A;  3PDY A;  4DMW A;  4X64 T;  3JAF A;  4JI1 T;  5CGM A;  1GQE A;  5TAO A;  2WBL A;  4A5X A;  3RYF E;  1QUU A;  2WQY A;  2YDR A;  3GA8 A;  4PK6 A;  4CI2 B;  1Z8U A;  1UCU A;  2A9U A;  2UUC T;  4ZS2 A;  4EGW A;  3V5S A;  2HN1 A;  4TV8 E;  1WR6 A;  2B1E A;  2X66 A;  3E0Z A;  3E08 A;  3KVA A;  3LSV A;  1JNR A;  4EEB A;  3C4W A;  4CXX A;  3QUJ A;  4BJM A;  2NW8 A;  2BBH A;  4DR3 T;  4AIU A;  1J5W A;  1J5E T;  3PUS A;  4AIS A;  2WZI A;  2WDQ A;  2VVN A;  3N9N A;  4UXN B;  3AA1 B;  4OK0 A;  1ZKE A;  2BVM A;  5JDN A;  2MOZ A;  3K3N A;  2V7M A;  5IWA T;  2QA7 A;  1HFA A;  2L9Q A;  2LEH A;  2WWU A;  2XM1 A;  4U2Y A;  3RIU C;  5EK2 A;  4U33 A;  3LFM A;  3RGL A;  5J2T E;  4B3S T;  2LKH A;  4YFS A;  2LOS A;  3VR9 A;  2QVA A;  3ZYL A;  5HWX A;  3UQ7 A;  2CHO A;  3CWZ B;  4WBO A;  5JDG A;  2ZMA A;  3AXJ A;  3AED A;  3UU8 A;  3Q5X A;  3LK4 2;  5HEO A;  3CQX C;  1XNR T;  3ONX A;  1X79 A;  1KF6 A;  4ZI3 D;  1E7P A;  2XAS B;  3AE7 A;  5AQG B;  1SUM B;  2BS2 A;  3MZK B;  4UVA B;  4ADZ A;  2LHR A;  3AB3 B;  3RF1 A;  5ABE A;  4YTM A;  3SFD A;  3JC6 D;  3AA6 B;  2JQH A;  1KNR A;  3EDV A;  2BKO A;  3JAD A;  3PUW F;  4UEM A;  2UXN B;  1OED C;  2EHO C;  3SRZ A;  2VL0 A;  4AQF A;  4DV3 T;  3AE5 A;  2NR4 A;  2VKO A;  4L9I A;  4PW8 A;  3ZN1 B;  3ZT6 A;  3BQK A;  2SPC A;  1N36 T;  2J62 A;  3K1S A;  1HNX T;  1I6Z A;  4ILU A;  3X1D A;  2X67 A;  3AEF A;  3O4X E;  5L3G B;  1S35 A;  2BG9 A;  2W61 A;  3E22 E;  2CLY C;  3HKD E;  3O1I A;  1WYC A;  4B3R T;  1W9R A;  3N2K E;  3UT5 E;  4QH1 A;  2CBI A;  2YDQ A;  3HL6 A;  2CCQ A;  2E9X A;  3HKE E;  4NXN T;  2H7V C;  2YIN A;  2DCF A;  3AE1 A;  1VRB A;  3A5X A;  5DAB A;  4UV9 B;  5L3B B;  1YW0 A;  5F8P A;  2AXD S;  2WWV A;  2UUA T;  1LVK A;  2V7I A;  3CX7 B;  5KDM C;  1KNZ A;  3RC8 A;  3F31 A;  4ILC A;  1HTJ F;  3TKL B;  3C4Z A;  4YT0 A;  5CJ5 A;  5F3J A;  1IBL T;  3NKZ A;  4U7Y A;  3MK7 C;  4IDN A;  1EZ3 A;  4X1K E;  3J9X 1;  1N33 T;  2KXP B;  4AKL A;  3B57 A;  4AKH A;  2W0G A;  4HFH A;  3PE0 A;  4WW0 A;  5HXC A;  5ABG A;  2VL8 A;  4ILB A;  4DBQ A;  5HEJ A;  3PJA A;  4DR1 T;  4EOZ B;  3QNU A;  5CA1 E;  2WMO A;  4PJL A;  2HPL A;  3AVS A;  5AQS B;  3RYH E;  2XQ4 A;  2D9D A;  2CXL A;  5HCM A;  3RKO A;  3C4X A;  3M3Z B;  2V26 A;  4UVB B;  1FIO A;  5DQW A;  5EK3 A;  4DV7 T;  2Y8D A;  5F5W A;  3ESL A;  3UU5 A;  3KBU A;  5J1G A;  4MFR A;  2PJQ A;  4YLH A;  2XZE A;  3EDU A;  3QB5 K;  1W0A A;  2LT3 A;  4COF A;  4LF7 T;  2XSB A;  3TLS A;  3ZC0 A;  4CQI A;  1T7S A;  2FJD A;  3P4W A;  3ZCI A;  3ANW A;  4OX9 T;  2P9B A;  5CA0 E;  4H9Q C;  5JR9 B;  1D1C A;  2YOE A;  4Z8X A;  4ZS3 A;  3MAC A;  3RHW A;  4OFZ A;  4EAH A;  4JV5 T;  4PK4 A;  3AA7 B;  2M6I A;  3EHZ A;  4IE0 A;  5JDM A;  3JC6 C;  3G06 A;  2H3R A;  4LMK A;  3U3I A;  5FKY A;  3IA3 A;  2FJB A;  3NVO A;  3T1Y T;  3FXD B;  3UU3 A;  4UF0 A;  1LKX A;  2V6X A;  3C98 B;  5HYA A;  2DNX A;  4I43 B;  1D0Z A;  4FI5 A;  5FXV A;  3N2G E;  2E9X D;  4JUY A;  4LF6 T;  3PUV F;  2Q9Q A;  2NWB A;  2QRX A;  5CB4 E;  2NTY A;  4F8H A;  2F4V T;  1N32 T;  2WZH A;  4GIW A;  3MKD A;  2X51 A;  3AEB A;  5HEH A;  1VOM A;  4ERR A;  1ZV4 X;  3RQU A;  4OYK A;  3WAK A;  3PV0 F;  1QSD A;  4J2C A;  2ZM2 A;  4YXD A;  1LVF A;  2V6Y A;  4ZOL E;  2KLQ A;  2V1D B;  3P50 A;  4EZ4 A;  2BS4 A;  1CHU A;  2YN6 A;  4HFE A;  1MMA A;  3ZYK A;  4EYU A;  2KIN B;  3ZSS A;  2K48 A;  3AAA B;  3BQI A;  3K8P C;  2XQ6 A;  3MXZ A;  3NZQ A;  4H63 V;  4TV9 E;  4IHJ E;  1M62 A;  3ZEF B;  1XNQ T;  2KMF A;  2XAJ B;  1UUR A;  4UR9 A;  4CI1 B;  2H89 A;  2W63 A;  4U31 A;  4NUV A;  3ZST A;  4DR5 T;  5LYJ E;  2IW5 B;  1HR0 T;  3ZT5 A;  1BR4 A;  1D0Y A;  4HWC A;  4KX6 A;  3AE8 A;  4ASK A;  3ETU A;  3HA4 A;  4DV5 T;  2RP4 A;  3B13 A;  2WU5 A;  3LBX B;  3ZMU B;  3UUL A;  1ZEE A;  5JRE A;  4N78 D;  3CK6 A;  3FZF B;  2IAK A;  5A1L A;  2ACX A;  4X1Y E;  3AE6 A;  2H88 A;  3O1H A;  2N9D A;  3HI2 A;  3L39 A;  1NEN A;  4IIJ E;  4O2B E;  1HG5 A;  5EZY E;  3SOL A;  4YSY A;  1W09 A;  3UU4 A;  5ABF A;  5HXR A;  5L3F B;  5FL0 A;  3UTK A;  4U72 A;  4X66 T;  2G0U A;  4GK0 E;  1S94 A;  3PUR A;  1UUS A;  1Y01 A;  3KV6 A;  3VR8 A;  2Y6X A;  3P4P A;  1FJG T;  5HEG A;  2BG9 C;  1KEY A;  1H7C A;  4HFD A;  4YJ2 E;  3OVU A;  4UVC B;  1YQ4 A;  3RQW A;  4HWD A;  4B3M T;  4M1P A;  5ADX L;  2NW9 A;  2VKJ A;  5C3J A;  2JMK A;  5IUX A;  2A3D A;  2CE7 A;  3C64 A;  1DU2 A;  2DLR A;  4A98 A;  4A97 A;  2OA5 A;  4HFI A;  3NRY A;  3ZT7 A;  3FZL B;  3AE2 A;  3ZPO A;  2E8I A;  2KSR A;  4H9S E;  1OED B;  2NW7 A;  2VWA A;  3H3M A;  3RC3 A;  1UGO A;  3CIR A;  3PU8 A;  3VU7 H;  5JR9 C;  2JPF A;  1E2A A;  2Q9Q C;  1VCT A;  3AAE B;  5LCY A;  3RYI E;  4DVD A;  2IUB A;  3LG7 A;  5BMV E;  3LK3 B;  3ZCJ A;  4DV4 T;  4AXP A;  3F2E A;  5J0Z A;  3P4S A;  2J4G A;  5JVD E;  4JI2 T;  4Q25 A;  5AQU B;  1YXR A;  2LJL A;  3AE4 A;  4TWD A;  4QXB B;  1HS7 A;  2D0U A;  4MLK A;  3CPZ A;  2W67 A;  5AQJ B;  2LKG A;  4NXM T;  4GYS A;  4NUU A;  2A2F X;  1T98 A;  2VQE T;  4K0K T;  2V7L A;  2BKN A;  4HN9 A;  3R84 B;  2KWI B;  4QWN B;  4CN6 A;  3N5L A;  4UV8 B;  5LJN A;  5LHG B;  3SFE A;  2WP9 A;  2ODU A;  3FXE B;  1N34 T;  4X5T A;  2LRK A;  4YSZ A;  5AQL B;  3ETV A;  2V7K A;  3GN5 B;  1UK5 A;  1Y64 B;  2LSG A;  3CQC B;  4MAL A;  2NTX A;  4B3T T;  2XAH B;  4EV6 A;  4GKJ T;  5LHH B;  4X65 T;  2X0L B;  5AQN B;  3RRW A;  4B6X A;  3Q5D A;  1HX8 A;  5FYM A;  4IDQ A;  5HCJ A;  4CN1 A;  5AQH B;  4DV6 T;  3VKG A;  4P0B A;  5EK4 A;  1WRD A;  5IHY A;  3A8Y C;  3PUY F;  4E7Z A;  2RA1 A;  2WY2 A;  4DV2 T;  4AI6 A;  5HXS A;  3EAM A;  3ONJ A;  3IEE A;  4ZXL A;  2LE8 A;  2V6Y B;  3TLW A;  3A7M A;  4LF9 T;  2FBW A;  4H9R C;  4TNV A;  4GKK T;  3GWH A;  3WAJ A;  4IE7 A;  3RPU A;  4BAY B;  1XWM A;  4ISS A;  3UUB A;  2KZ7 B;  4U2Z A;  5IYZ E;  5ETW A;  2K5B B;  2NOX A;  2QGS A;  4HWH A;  4LFC T;  5H6Q B;  5JDL A;  1UX4 A;  2XHE B;  2X0H A;  4IE4 A;  1W0B A;  4ZI2 C;  5JTG A;  2UXB T;  1YKH B;  2PTF A;  2M67 A;  4IL9 A;  5FXW A;  1WYB A;  3DP7 A;  3I9Y A;  5M4Y A;  2D2S A;  3SS1 A;  4ZZC A;  2LSI A;  4QXC B;  3AXJ B;  4X62 T;  2LM9 A;  1OED A;  2EHO A;  2X9X A;  4QXH B;  4WZX A;  5LBM A;  4AQF C;  3IBP A;  2J47 A;  3LDQ B;  5JQG E;  1IBM T;  3CQG B;  3ZMT B;  2HH7 A;  5KXJ A;  5LGU B;  5FNV E;  5AQT B;  4DND A;  2MYS A;  2XSA A;  4YTN A;  5ABH A;  3UFG A;  5LOV E;  1IJ5 A;  3K3Q C;  3P7I A;  4I0U A;  4DO0 A;  3KV5 A;  4EXT A;  4JI8 T;  2WSS V;  5HWY A;  2DI4 A;  4P09 A;  2OLT A;  3PTR B;  5AQI B;  5JR9 A;  3OPC A;  4ZI7 E;  4H9O C;  2WCA A;  1IAP A;  3ZLI A;  2W62 A;  3UUX B;  2CRB A;  2VQF T;  3OBV E;  2E5L T;  3N9Q A;  5LNK A;  5HXH A;  1D1B A;  2DHR A;  4LFB T;  2YKS A;  1MMG A;  1IBK T;  2BG9 E;  3Q5E A;  4DUZ T;  4DV0 T;  4QKN A;  2H7O A;  2D0T A;  3CKD A;  4EZH A;  3HKC E;  3CML A;  4HE8 A;  2BVL A;  4TZ4 C;  4LF8 T;  3HKB E;  2ZLY A;  4TUY E;  4YY3 T;  1FMW A;  2FUP A;  4JEH B;  1D0X A;  3KBT A;  3CX8 B;  4HEA A;  3EUH A;  5LGN B;  5JDH A;  2R6G F;  4JBW F;  1MND A;  3N2O A;  1QLB A;  5HEU A;  4IE5 A;  3CX6 B;  4MBQ A;  4TWH A;  1YKE B;  4JI5 T;  4HWF A;  5FL1 A;  3O1J A;  2V8S V;  2XTL A;  3KFW X;  4HFC A;  2V7J A;  3LJC A;  5LMU T;  3PJA J;  1IZN B;  4O8S A;  3UU6 A;  3PUA A;  4JI0 T;  3H37 A;  2MAW A;  3PUG A;  4L0R A;  5LJM A;  2WAU A;  2HPJ A;  3ABV A;  1KFY A;  3Q9D A;  4PJJ A;  2JJ9 A;  2E9X C;  2XM2 A;  3LBX A;  1WFD A;  3FZK B;  1ZP0 A;  3HR0 A;  3P4R A;  2YU1 A;  3RH3 A;  3JAE A;  3FBZ A;  4WNK A;  4ZI2 D;  2XQ3 A;  3MJX A;  4PJM A;  4CN4 A;  1CUN A;  4YJ3 E;  2PBI A;  4C91 A;  1B7T A;  3Q2M A;  3QOF A;  3I0O A;  2YK0 A;  5DJQ C;  4XZC A;  1OXZ A;  1XDP A;  4YSX A;  1VCS A;  3I1A A;  5FXZ A;  1U4Q A;  2HN2 A;  4GYR A;  4JI4 T;  4LF5 T;  4KP3 C;  3QK6 A;  3GN5 A;  5HXE A;  5H6R B;  3FHN A;  5AQF B;  2HHH T;  1BR2 A;  1V9D A;  4NPP A;  2ACZ A;  4H9P C;  4JI3 T;  2CPT A;  3I0Q A;  3KV4 A;  2XAG B;  4FJO A;  4LFA T;  4G2A A;  4WYV A;  2I59 A;  2XAQ B;  4UF0 B;  3ZKR A;  4YHH T;  2X9Y A;  2W66 A;  2FJA A;  2I6H A;  3AEA A;  2WU2 A;  2V5D A;  5LGT B;  2AE9 A;  5LP6 E;  4V1A v;  5L3E B;  2LSK A;  2VUR A;  3F57 A;  4QX7 B;  4XAX B;  2LSJ A;  5FY0 A;  4IE6 A;  4EIW A;  2Q9Q B;  3FZH B;  3W15 B;  5LHI B;  2Z6E A;  3T8O A;  2IDO B;  4EED A;  4QHO A;  1JNZ A;  1NWM X;  1MIY A;  2CM0 A;  3L8R A;  4JEU B;  4O4J E;  4KHZ F;  1HG2 A;  2UXX B;  2IML A;  5JRC B;  3UUN A;  3AVR A;  2N2N A;  2QYW A;  1MIV A;  1XZY A;  3D0T A;  4Z90 A;  3J7Y q;  2UXC T;  2JQK A;  1G73 A;  2KT9 A;  3AEE A;  5LA6 E;  3KV9 A;  2YEV C;  1XMQ T;  4ZEY A;  2PFV A;  4DR4 T;  3K3O A;  4AQG A;  2VAS A;  4DV1 T;  4KI0 F;  1XMO T;  3P8C D;  4PK5 A;  2MBG A;  4JI6 T;  4DR6 T;  3EVY A;  4HWI B;  5KX5 E;  3CVR A;  3N9O A;  3H3A A;  3RIA A;  5JDQ A;  4QH4 A;  3RI5 A;  1MMD A;  3TLV A;  2LRL A;  2XQY A;  3ZJ1 A;  2CXF A;  3ANW B;  3EI0 A;  3L3P A;  4TX5 A;  3KIN B;  1T72 A;  5LG3 A;  1MIW A;  4O4L E;  2BDE A;  2BKP A;  3O9X A;  2VKD A;  5LB7 B;  5JRC A;  3NBX X;  1KK7 A;  2JIW A;  3WI3 A;  3I9W A;  4CXW A;  2XQA A;  3N9L A;  4I4T E;  4KBM B;  5AQQ B;  3UFE A;  2E2A A;  3GMI A;  2XQ8 A;  2C5J A;  3ZJ2 A;  3M65 A;  4U7I A;  4HTE A;  4ANJ A;  4PNI A;  4AKI A;  4LML A;  5J2U E;  2XJ7 A;  5C2T A;  5AFU L;  4QX8 B;  2X0Y A;  2CWY A;  3PUQ A;  3AA0 B;  4ZHQ E;  2C5I T;  2NP9 A;  3T1H T;  4DBR A;  1O3X A;  2BG9 B;  2JMH A;  4IDO A;  2ZM8 A;  1G8X A;  1WR0 A;  2XQ5 A;  1Z0P A;  1J1J A;  3KVB A;  1SE7 A;  1HNW T;  5FY1 A;  4GOU A;  4CZZ B;  1NEK A;  4DID B;  4O2A E;  2VK9 A;  3AEG A;  3RYC E;  1FEW A;  2UXD T;  2VVS A;  2WDV A;  4OHF A;  2K3W A;  2MTQ A;  2L8K A;  3VRA A;  4P0A A;  4H63 H;  2E9X B;  3RX6 A;  3ZMZ B;  2IC9 A;  4YHJ A;  4HFV A;  3PUZ F;  3NZP A;  5FP3 A;  4CI3 B;  5AQK B;  3ONL C;  5L4H A;  4C90 A;  3ZN0 B;  2J1D G;  4QH5 A;  3UQ4 A;  5KMG P;  2YU2 A;  5L4E A;  1I94 T;  1XDO A;  5LBQ B;  4E7S A;  1ZOY A;  4MHC A;  2CHN A;  2CEA A;  2ES0 A;  5L2L A;  1YQ3 A;  3Q5W A;  4K0U A;  5C8Y E;  5AQP B;  2CBJ A;  5GON E;  1SHZ C;  2YDS A;  5BR8 T;  1UX5 A;  4KHP T;  2UU9 T;  1US7 B;  4EYY R;  2Y48 B;  4AKG A;  1OWA A;  4LMJ A;  2XAF B;  3V5U A;  2B76 A;  2DL1 A;  2BZB A;  3VHL A;  4BJN A;  3OTO T;  3C51 A;  4P1N A;  3AAI A;  2XY8 B;  4PFP A;  3S4U A;  2UUB T;  3BQL A;  2PG8 A;  1FMV A;  3AE9 A;  3ZMS B;  2A72 A;  2CLY B;  2CMR A;  2X68 A;  1U5P A;  2EHO D;  2W00 A;  3ZYM A;  5LG4 A;  4X20 E;  4HKA A;  4EB6 E;  4ILA A;  2VKH A;  4AQY T;  5HAX A;  3DJB A;  2L3L A;  2WB5 A;  1MNE A;  3N9P A;  4U74 A;  4PAG A;  2MPK A;  4DR7 T;  2GK9 A;  2BS3 A;  2D5U A;  4TWF A;  4I55 E;  5LXT E;  4F6R C;  3DTO A;  4CXY A;  4PFO A;  3UUM A;  2LLY A;  1BR1 A;  1R8I A;  4O4I E;  4DR2 T;  5L3D B;  4TN7 B;  2DWK A;  3BK9 A;  3B5M A;  5JH7 E;  2XQ7 A;  3RRC A;  2I0M A;  3IHR A;  5JDF A;  2DWG A;  4PJN A;  1M7K A;  4O4H E;  3TLT A;  4IDP A;  1MMN A;  1ZHC A;  2K24 A;  1E1H B;  3QB5 A;  4JLE A;  4UEL A;  4UIG A;  4GK5 E;  2CWO A;  4JI7 T;  3FBL A;  3MA9 A;  3VRB A;  4DMV A;  2WDR A;  2C0S A;  5FMN A;  4KUM B;  3ZC1 A;  4AKR B;  4Z91 A;  2V5C A;  5ABF B;  2M6B A;  1AJ3 A;  4IDZ A;  4IRE A;  1BR0 A;  2LM2 A;  4G63 A;  5AQV B;  2CXD A;  3RIF A;  3ZMV B;  4U3C A;  2Q9Q D;  1WLX A;  1LRZ A;  2JQ9 A;  4IST A;  5LMN T;  4YTP A;  2E5V A;  4HGA A;  1HF8 A;  2EHO B;  2JQQ A;  4KMC A;  3PUX F;  3RIU A;  2ZM6 T;  4XBF B;  3OYX A;  2LHN A;  5AQM B;  5FXX A;  3P4Q A;  1HX1 B;  4I50 E;  4IT4 A;  2C5K T;  2RPA A;  1T8B A;  2LOP A;  2XQ9 A;  1WCR A;  5L3C B;  2KWH A;  3AE3 A;  4LF4 T;  3FB2 A;  3RLF F;  3KDS E;  2BBJ A;  1OED E;  3U78 A;  2JRK A;  2W4X A;  2ZM0 A;  2WS3 A;  5FVK A;  5FVL A;  5E0O A;  4H9N C;  3JCF A;  3NWI A;  2VB6 A;  4WBN E;  1D1A A;  2X9H A;  3OYZ A;  4IGU A;  4HFB A;  5FY7 A;  4NIQ A;  2XPK A;  1L0V A;  3SWH A;  4IL4 A;  1HNZ T;  3IF8 B;  2W2U A;  2WM9 A;  4OYJ A;  4X1I E;  2OV9 A;  2XUE A;  3OKQ A;  3PU3 A;  3RKG A;  1X9B A;  2ODV A;  2IC6 A;  4DUY T;  2N1G A;  3L09 A;  3NRX A;  3VKH A;  5AQR B;  2IIU A;  3EAB A;  4ZI3 C;  4A56 A;  1IJ6 A;  1KNP A;  2WMN A;  4TNW A;  5L47 A;  2K9A A;  5AQO B;  1SA0 E;  1NAF A;  2FJE A;  4L5G A;  1YD8 G;  3N9M A;  5CFB A;  4JYA T;  2X9W A;  3QC9 A;  2IHR 1;  1HCI A;  3TLU A;  3FZM B;  4BA9 A;  5DQV A;  4ZZB A;  2LSY A;  3AEC A;  3LK2 B; 
#chains in the Genus database with same CATH homology
 3C50 A;  2CA5 A;  3OJA A;  3R6N A;  2KND A;  3PDY A;  4DMW A;  5TAO A;  2WBL A;  3RYF E;  1QUU A;  4PK6 A;  4CI2 B;  3GA8 A;  1UCU A;  4ZS2 A;  3V5S A;  4TV8 E;  1WR6 A;  2B1E A;  2X66 A;  3E0Z A;  3E08 A;  3KVA A;  3C4W A;  4CXX A;  3QUJ A;  4BJM A;  2NW8 A;  3PUS A;  3N9N A;  4UXN B;  3AA1 B;  4OK0 A;  1ZKE A;  2BVM A;  5JDN A;  2MOZ A;  3K3N A;  2V7M A;  2QA7 A;  1HFA A;  2L9Q A;  2LEH A;  2WWU A;  5EK2 A;  5J2T E;  3LFM A;  4YFS A;  2LOS A;  3ZYL A;  5HWX A;  3CWZ B;  4WBO A;  5JDG A;  2ZMA A;  3Q5X A;  3LK4 2;  3CQX C;  3ONX A;  1X79 A;  4ZI3 D;  2XAS B;  3MZK B;  4UVA B;  4ADZ A;  2LHR A;  3AB3 B;  3JC6 D;  3AA6 B;  3EDV A;  4UEM A;  2UXN B;  3SRZ A;  2EHO C;  4AQF A;  2VKO A;  4L9I A;  4PW8 A;  3ZN1 B;  3BQK A;  2SPC A;  4ILU A;  2X67 A;  3O4X E;  5L3G B;  1S35 A;  2W61 A;  3E22 E;  2CLY C;  3HKD E;  3O1I A;  1WYC A;  3N2K E;  3UT5 E;  3HL6 A;  2CCQ A;  2E9X A;  3HKE E;  2H7V C;  2YIN A;  2DCF A;  1VRB A;  3A5X A;  5DAB A;  4UV9 B;  5L3B B;  1YW0 A;  5F8P A;  1LVK A;  2V7I A;  3CX7 B;  5KDM C;  1KNZ A;  3RC8 A;  3F31 A;  1HTJ F;  5F3J A;  3C4Z A;  3J9X 1;  3MK7 C;  1EZ3 A;  4X1K E;  2KXP B;  4AKL A;  3B57 A;  4AKH A;  2W0G A;  4WW0 A;  3PE0 A;  5HXC A;  2VL8 A;  4DBQ A;  4EOZ B;  5CA1 E;  2WMO A;  4PJL A;  2HPL A;  3AVS A;  3RYH E;  2CXL A;  3RKO A;  3C4X A;  2V26 A;  4UVB B;  1FIO A;  5DQW A;  5EK3 A;  2Y8D A;  3ESL A;  3KBU A;  5J1G A;  4MFR A;  2PJQ A;  4YLH A;  3EDU A;  2LT3 A;  3ZC0 A;  4CQI A;  3ZCI A;  3ANW A;  2P9B A;  5CA0 E;  4H9Q C;  5JR9 B;  1D1C A;  4Z8X A;  4ZS3 A;  4EAH A;  3MAC A;  4OFZ A;  4PK4 A;  3AA7 B;  4IE0 A;  5JDM A;  3JC6 C;  2H3R A;  3U3I A;  3FXD B;  4UF0 A;  1LKX A;  3C98 B;  5HYA A;  2DNX A;  4I43 B;  1D0Z A;  4FI5 A;  5FXV A;  3N2G E;  2E9X D;  4JUY A;  2Q9Q A;  2NWB A;  5CB4 E;  2NTY A;  4GIW A;  3MKD A;  2X51 A;  1VOM A;  4ERR A;  1ZV4 X;  3WAK A;  4OYK A;  4J2C A;  1QSD A;  2ZM2 A;  1LVF A;  4ZOL E;  2KLQ A;  2V1D B;  4EZ4 A;  1MMA A;  3ZYK A;  4EYU A;  2KIN B;  2K48 A;  3AAA B;  3BQI A;  3K8P C;  3NZQ A;  3MXZ A;  4H63 V;  4TV9 E;  3ZEF B;  4IHJ E;  5LHI B;  2KMF A;  2XAJ B;  4CI1 B;  2W63 A;  4NUV A;  5LYJ E;  2IW5 B;  1BR4 A;  1D0Y A;  4ASK A;  3ETU A;  3HA4 A;  2RP4 A;  3B13 A;  3ZMU B;  3LBX B;  3UUL A;  1ZEE A;  5JRE A;  4N78 D;  2IAK A;  5A1L A;  2ACX A;  4X1Y E;  3O1H A;  2N9D A;  3HI2 A;  4O2B E;  4IIJ E;  3SOL A;  1HG5 A;  5EZY E;  5L3F B;  5HXR A;  3UTK A;  4U72 A;  2G0U A;  4GK0 E;  1S94 A;  3PUR A;  3KV6 A;  2Y6X A;  1H7C A;  4YJ2 E;  4UVC B;  4M1P A;  5ADX L;  2NW9 A;  2VKJ A;  2JMK A;  2A3D A;  2CE7 A;  3C64 A;  2DLR A;  2OA5 A;  3NRY A;  3ZPO A;  2E8I A;  4H9S E;  2NW7 A;  2VWA A;  3RC3 A;  3PU8 A;  3VU7 H;  5JR9 C;  2JPF A;  2Q9Q C;  3AAE B;  5LCY A;  3RYI E;  4DVD A;  5BMV E;  3LG7 A;  3LK3 B;  3ZCJ A;  4AXP A;  3F2E A;  5JVD E;  2LJL A;  4QXB B;  1HS7 A;  2D0U A;  4MLK A;  3CPZ A;  4GYS A;  4NUU A;  2A2F X;  1T98 A;  2V7L A;  4HN9 A;  3R84 B;  2KWI B;  4QWN B;  5LJN A;  3N5L A;  4UV8 B;  5LHG B;  2ODU A;  3FXE B;  3ETV A;  2V7K A;  3GN5 B;  1Y64 B;  2LSG A;  3CQC B;  4MAL A;  2NTX A;  2XAH B;  5LHH B;  2X0L B;  3RRW A;  4B6X A;  3VKG A;  1HX8 A;  5FYM A;  4P0B A;  5EK4 A;  1WRD A;  5IHY A;  4E7Z A;  2RA1 A;  4AI6 A;  5HXS A;  3IEE A;  2LE8 A;  4H9R C;  3GWH A;  3WAJ A;  4IE7 A;  3RPU A;  4BAY B;  4ISS A;  2KZ7 B;  5IYZ E;  5ETW A;  2K5B B;  2NOX A;  2QGS A;  5H6Q B;  5JDL A;  2XHE B;  1UX4 A;  4IE4 A;  4ZI2 C;  1YKH B;  5FXW A;  2M67 A;  1WYB A;  3DP7 A;  3I9Y A;  5M4Y A;  2D2S A;  3SS1 A;  2LSI A;  4QXC B;  2LM9 A;  5LBM A;  2EHO A;  2X9X A;  4QXH B;  4AQF C;  3IBP A;  5JQG E;  3CQG B;  3ZMT B;  2HH7 A;  5LGU B;  5FNV E;  4DND A;  2MYS A;  5LOV E;  1IJ5 A;  3K3Q C;  3P7I A;  4DO0 A;  3KV5 A;  4EXT A;  2WSS V;  5HWY A;  2DI4 A;  4P09 A;  3PTR B;  5JR9 A;  4ZI7 E;  4H9O C;  3ZLI A;  1IAP A;  2W62 A;  3UUX B;  3OBV E;  3N9Q A;  5LNK A;  5HXH A;  1D1B A;  2DHR A;  1MMG A;  4QKN A;  2H7O A;  2D0T A;  3CKD A;  4EZH A;  3HKC E;  3CML A;  4HE8 A;  2BVL A;  4TZ4 C;  3HKB E;  2ZLY A;  4TUY E;  1FMW A;  4JEH B;  1D0X A;  3KBT A;  3CX8 B;  4HEA A;  3EUH A;  5LGN B;  5JDH A;  3TKL B;  1MND A;  3N2O A;  4IE5 A;  3CX6 B;  4MBQ A;  1YKE B;  3O1J A;  2XTL A;  3KFW X;  2V7J A;  3LJC A;  4O8S A;  1IZN B;  3PUA A;  3H37 A;  3PUG A;  4L0R A;  5LJM A;  2WAU A;  2HPJ A;  3Q9D A;  4PJJ A;  2JJ9 A;  2E9X C;  3LBX A;  3HR0 A;  3RH3 A;  2YU1 A;  4ZI2 D;  3FBZ A;  4WNK A;  3MJX A;  4PJM A;  1CUN A;  4YJ3 E;  2PBI A;  4C91 A;  1B7T A;  3Q2M A;  3I0O A;  2YK0 A;  5DJQ C;  4XZC A;  1OXZ A;  3I1A A;  5FXZ A;  1U4Q A;  4GYR A;  4KP3 C;  3QK6 A;  3GN5 A;  5HXE A;  5H6R B;  3FHN A;  1BR2 A;  1V9D A;  4H9P C;  3I0Q A;  3KV4 A;  2XAG B;  4FJO A;  4G2A A;  2I59 A;  2XAQ B;  4UF0 B;  2X9Y A;  5LP6 E;  5LGT B;  4V1A v;  5L3E B;  2LSK A;  3F57 A;  4QX7 B;  4XAX B;  2LSJ A;  5FY0 A;  4IE6 A;  4EIW A;  2Q9Q B;  3W15 B;  2Z6E A;  3T8O A;  4QHO A;  2CM0 A;  1NWM X;  1MIY A;  4O4J E;  4JEU B;  1HG2 A;  2UXX B;  5JRC B;  3UUN A;  3AVR A;  2N2N A;  3D0T A;  1MIV A;  3J7Y q;  1G73 A;  2KT9 A;  5LA6 E;  3KV9 A;  2YEV C;  2PFV A;  3K3O A;  4AQG A;  2VAS A;  3P8C D;  4PK5 A;  2MBG A;  3EVY A;  5KX5 E;  3CVR A;  3N9O A;  3H3A A;  5JDQ A;  1MMD A;  2XQY A;  3ZJ1 A;  2CXF A;  3ANW B;  3L3P A;  4TX5 A;  3KIN B;  1MIW A;  4O4L E;  2BDE A;  3O9X A;  2VKD A;  5JRC A;  3NBX X;  1KK7 A;  3WI3 A;  3I9W A;  4CXW A;  4I4T E;  3N9L A;  4KBM B;  3UFE A;  3GMI A;  2C5J A;  3ZJ2 A;  3M65 A;  4HTE A;  4ANJ A;  4PNI A;  4AKI A;  5J2U E;  5AFU L;  4QX8 B;  2CWY A;  3PUQ A;  3AA0 B;  4ZHQ E;  2C5I T;  2NP9 A;  4DBR A;  1O3X A;  2JMH A;  2ZM8 A;  1G8X A;  3KVB A;  1Z0P A;  5FY1 A;  4GOU A;  4CZZ B;  4O2A E;  2VK9 A;  3RYC E;  1FEW A;  4OHF A;  4P0A A;  2MTQ A;  2L8K A;  4H63 H;  2E9X B;  3RX6 A;  3ZMZ B;  2IC9 A;  4YHJ A;  4HFV A;  5FP3 A;  3NZP A;  4CI3 B;  4C90 A;  3ZN0 B;  2J1D G;  5KMG P;  2YU2 A;  5LBQ B;  4E7S A;  4MHC A;  2CEA A;  2ES0 A;  5L2L A;  3Q5W A;  5C8Y E;  4K0U A;  5GON E;  1SHZ C;  1UX5 A;  1US7 B;  4EYY R;  2Y48 B;  4AKG A;  1OWA A;  2XAF B;  3V5U A;  3VHL A;  4BJN A;  2BZB A;  3C51 A;  3AAI A;  4PFP A;  3S4U A;  3BQL A;  2PG8 A;  1FMV A;  3ZMS B;  2A72 A;  2CLY B;  2CMR A;  2X68 A;  1U5P A;  2EHO D;  2W00 A;  3ZYM A;  5LG4 A;  4X20 E;  4HKA A;  4EB6 E;  2VKH A;  5HAX A;  3DJB A;  2L3L A;  3N9P A;  1MNE A;  4U74 A;  4PAG A;  2GK9 A;  2D5U A;  4I55 E;  5LXT E;  4F6R C;  3DTO A;  4CXY A;  4PFO A;  3UUM A;  1BR1 A;  4O4I E;  5L3D B;  4TN7 B;  2DWK A;  3BK9 A;  5JH7 E;  3RRC A;  3IHR A;  5JDF A;  2DWG A;  4PJN A;  4O4H E;  4UIG A;  1MMN A;  1ZHC A;  2K24 A;  1E1H B;  4JLE A;  4UEL A;  4GK5 E;  2CWO A;  3FBL A;  3MA9 A;  4DMV A;  2C0S A;  5FMN A;  4KUM B;  3ZC1 A;  4AKR B;  1BR0 A;  1AJ3 A;  4IDZ A;  4G63 A;  2CXD A;  3ZMV B;  2Q9Q D;  1WLX A;  1LRZ A;  4IST A;  4HGA A;  4KMC A;  1HF8 A;  2EHO B;  2JQQ A;  4XBF B;  3OYX A;  2LHN A;  5FXX A;  4I50 E;  2C5K T;  2LOP A;  5L3C B;  2KWH A;  3FB2 A;  3KDS E;  3U78 A;  2JRK A;  2ZM0 A;  5E0O A;  4H9N C;  2VB6 A;  4WBN E;  1D1A A;  2X9H A;  3OYZ A;  4IGU A;  5FY7 A;  3SWH A;  3IF8 B;  2WM9 A;  4OYJ A;  4X1I E;  2XUE A;  3OKQ A;  3PU3 A;  2ODV A;  2IC6 A;  2N1G A;  3L09 A;  3NRX A;  3VKH A;  4ZI3 C;  4A56 A;  1IJ6 A;  2WMN A;  2K9A A;  1SA0 E;  1NAF A;  4L5G A;  1YD8 G;  3N9M A;  2X9W A;  3QC9 A;  1HCI A;  4BA9 A;  5DQV A;  2LSY A;  3LK2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...