3D0TA

Structure of the bnb domain of the hsp70 cochaperone bag2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
84
structure length
77
Chain Sequence
SEESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Chaperone
molecule keywords BAG family molecular chaperone regulator 2
publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2.
pubmed doi rcsb
source organism Mus musculus
total genus 37
structure length 77
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3d0tA00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
2V7KA 4PJMA 2I59A 3R84B 4EZ4A 4IDQA 3I9WA 3SS1A 1KNZA 3RGLA 4OK0A 1US7B 3ZKRA 2IHR1 4H9PC 2Z6EA 2AE9A 1N34T 2W4XA 2PG8A 4BA9A 2WB5A 3KV6A 3GA8A 3AAIA 1XZYA 3QC9A 1NENA 4IE0A 2EHOA 2IAKA 2SPCA 2D2SA 3Q5XA 4WW0A 4WYVA 2CXDA 5L3FB 4IDNA 2V7LA 1HFAA 4JI6T 3O1IA 2Y6XA 4QWNB 3Q9DA 2H7OA 4HGAA 3K1SA 2Y8DA 5DJQC 3Q5EA 1SUMB 4U31A 3T8OA 3L09A 5LGTB 4OHFA 2LSJA 3I0QA 4DR7T 4DV1T 3QB5K 2C0SA 4KP3C 4TV9E 1IBMT 2BS4A 4E7ZA 2E9XA 5HWYA 3I1AA 3OBVE 5TAOA 3OKQA 2DHRA 2ZLYA 5JDQA 4DVDA 5L47A 2VWAA 3KV9A 2LOSA 3AVSA 2CXLA 3Q2MA 1CUNA 3B57A 5A1LA 3QK6A 4Z8XA 3K3QC 3UU6A 4QH5A 1J5WA 4EYUA 5AQUB 3RYHE 4XZCA 3PV0F 1QUUA 1D0XA 5FVKA 4B3MT 3CK6A 1LKXA 4LFCT 2BG9C 2KWHA 3IEEA 4CXYA 2M67A 3OYZA 3OYXA 2WU2A 4PK5A 2YN6A 2XAFB 2MBGA 2G0UA 1ZOYA 4IHJE 5KDMC 4EIWA 2KINB 2VL0A 2XM1A 3FZKB 2NW9A 1H7CA 3RIUA 2CLYC 2YINA 4YFSA 5FYMA 3FZMB 1V9DA 4Z90A 2GK9A 1MMNA 4PNIA 4DMVA 4ASKA 2I0MA 1OXZA 4YXDA 4LF9T 3GN5B 2C5KT 1HR0T 4ILAA 3T1YT 4GK5E 3N9QA 4QH4A 5AQVB 4QXBB 2VASA 3C4ZA 5HXCA 2JIWA 3P4RA 4HWCA 5M4YA 4AISA 3P4WA 3AE5A 3AE7A 2L8KA 4X1KE 4X1IE 2UXCT 1E7PA 4GIWA 3IA3A 3N9LA 1KEYA 4DBRA 5LYJE 4DV5T 3LK2B 4CXWA 2XQ8A 4OYJA 5HAXA 1D1BA 5AFUL 4DV6T 4HFEA 2YDQA 5LHHB 2J62A 3N9NA 1Z8UA 1Y64B 3FZHB 2K5BB 3AE3A 2D0TA 3LBXA 4DR3T 2LLYA 3N9MA 4U72A 3RKGA 2DI4A 1G8XA 2X0HA 2CA5A 5L4HA 4O4HE 3UQ7A 1BR0A 4DMWA 4KHPT 2WWVA 2I6HA 5LB7B 3ZMUB 3C98B 2LSKA 2CRBA 1WYCA 5EK3A 4ADZA 3UU4A 3CX6B 3RRWA 2YDRA 3LSVA 2HHHT 5HYAA 3RQUA 3GN5A 5FVLA 1LVKA 3V5SA 1HG2A 5J2TE 1W0AA 2WY2A 4I50E 2NWBA 4HKAA 1BR1A 3L39A 3L8RA 1YXRA 4QXHB 4DR5T 3ZT5A 2HH7A 2QVAA 4JBWF 3ZPOA 3C4WA 3AEAA 4P1NA 4YSYA 3ZMZB 5JRCB 4YSZA 5JTGA 2WMNA 3ONJA 4CN1A 1UCUA 2XSBA 4WBOA 2XASB 3VU7H 4DUZT 1SA0E 3CVRA 5JR9A 1FMWA 4ILUA 4N78D 2CBIA 3AXJA 3TLVA 2W66A 2ZM0A 5AQNB 4LFAT 3AE4A 2L3LA 4TWDA 1XNRT 2J1DG 2VQFT 3ZJ1A 5LNKA 5H6RB 5ABFB 4EV6A 2WDQA 4YTPA 5AQKB 1YKEB 1J5ET 2YKSA 1OEDB 3OTOT 1OEDE 4IL9A 1HTJF 4JV5T 1HNZT 4DV2T 2DNXA 3A7MA 4ZI3C 5IYZE 3UU8A 3DP7A 3ANWA 3LK3B 2XUEA 3UUBA 3DTOA 4DIDB 4HEAA 4ZS3A 1Y01A 2BS3A 5J0ZA 1J1JA 3K3NA 5JDMA 1WLXA 1HCIA 3OVUA 4H63H 2JMKA 4IGUA 3RYIE 4HWDA 3FZFB 4HFHA 4X20E 4F8HA 4CN4A 2VQET 2UUCT 2IDOB 5FXWA 1SE7A 2F4VT 1UK5A 1KK7A 1T72A 2N9DA 5JDGA 4U74A 4P0BA 2FBWA 2NW8A 3F57A 1YW0A 3NBXX 2WWUA 4GYRA 5L3EB 4I55E 3H37A 4O4IE 3V5UA 4HTEA 2V26A 4U2ZA 4GOUA 3T1HT 4U7YA 5LHIB 1FEWA 2E5VA 4CI2B 2V7JA 1HF8A 3B13A 4OYKA 5JDLA 2EHOB 2V7IA 3AEEA 4H9QC 5AQHB 2YU1A 1W9RA 2XAHB 3NWIA 1JNZA 3AA6B 5JQGE 4JI2T 4TZ4C 2KMFA 5FP3A 3HR0A 1MMDA 2LT3A 2UXNB 4TWHA 2WU5A 1B7TA 2D0UA 2ACZA 2YOEA 2W61A 3AB3B 1S35A 4ZI3D 3C4XA 1AJ3A 3QUJA 2WDVA 5KMGP 4GYSA 4PFOA 5C2TA 3JAFA 5JREA 3VHLA 2A9UA 2VB6A 4KUMB 2JPFA 2XAGB 3AEBA 2FUPA 5BR8T 2E9XB 4UV9B 5L3BB 2XQAA 2MTQA 3IBPA 4BJMA 4QKNA 1HNWT 2BBJA 4V1Av 4AQGA 4GK0E 5HXHA 3LFMA 5LOVE 2RPAA 2ZM8A 4Q25A 3EDVA 4K0KT 3RI5A 3HI2A 3JCFA 4AQFC 5JVDE 4X5TA 4PK6A 4J2CA 1N33T 2ZMAA 2XQ4A 3AE2A 2BDEA 4IIJE 2BKPA 4UELA 3L3PA 2WCAA 2OV9A 1HX8A 2KNDA 3PU8A 3NZPA 2CMRA 3CQCB 1U4QA 4CXXA 4O8SA 5HWXA 3UU5A 4AKLA 2XPKA 2H88A 3N9OA 3LG7A 2KXPB 1YKHB 1OWAA 2WBLA 3QB5A 2H89A 4BAYB 4LF4T 3GMIA 3P50A 1EZ3A 1HG5A 3CX8B 4TX5A 3WI3A 4MLKA 4MALA 3MK7C 3MZKB 1BR4A 4BJNA 2W62A 4UEMA 5LMUT 4IREA 1ZP0A 3CIRA 2XQ3A 3RYFE 5FMNA 4XAXB 3ZEFB 3EI0A 5FY0A 2BS2A 3MJXA 4JLEA 1ZKEA 3NRXA 4H9NC 3UFEA 4KMCA 2ZM2A 2MPKA 2P9BA 4ZZBA 3KVBA 4P0AA 3UFGA 5ADXL 4HFDA 3ZLIA 3ZC0A 2FJAA 4X66T 5AQFB 3HKDE 4F6RC 4DBQA 2WZHA 3PUSA 3KINB 3UULA 2LRKA 3KV4A 4DR1T 2X9HA 5HXRA 4QHOA 2CWOA 1NAFA 4JI3T 1MNDA 4ERRA 2XAQB 1D0ZA 3ESLA 4TWFA 1XDOA 2Q9QA 3LBXB 3OPCA 2XAJB 1W0BA 3U78A 3X1DA 3ONLC 2YDSA 5DQWA 2ACXA 1OEDC 5F3JA 1R8IA 3O1JA 2E2AA 3AEDA 3RC3A 4I43B 5CFBA 3VRAA 2Y48B 4X65T 4A5XA 2JQKA 2DCFA 3PU3A 1I6ZA 4IDOA 3KBTA 4JEUB 4B3RT 1LVFA 5KXJA 3TKLB 4C91A 4UVBB 3PTRB 4JUYA 2XTLA 4O4LE 3AAEB 5IWAT 2YK0A 5ABGA 4HFIA 4A56A 2LOPA 2WZIA 3ZCIA 3P4QA 4YSXA 5LG4A 1NWMX 4G2AA 3C64A 4HWIB 3ZMSB 2LM2A 2IC9A 2M6BA 4X1YE 4E7SA 3P4SA 1M62A 3PURA 3PJAA 4AXPA 4DR4T 1KNRA 4LF7T 2K9AA 3LDQB 5ETWA 4UXNB 2X0YA 2XSAA 3RF1A 2ZM6T 2PJQA 1MMGA 4CQIA 5E0OA 4LMJA 4ZS2A 2LM9A 5FXXA 3RIFA 5JR9B 2EHOC 5H6QB 2K3WA 2MOZA 3AXJB 3RH3A 3JC6C 2XQ9A 3UUNA 2WAUA 5LCYA 4IDPA 2CBJA 4DNDA 4U3CA 5AQOB 2V1DB 2PTFA 4YY3T 4A98A 4ILCA 3AA1B 5HEJA 2VKOA 5FL0A 4I0UA 4QX8B 3ZSTA 5AQPB 5FY1A 3ANWB 4U33A 3PUAA 1DU2A 4UF0A 4IE7A 2JQ9A 1ZHCA 4DV3T 3RKOA 2E9XC 3W15B 4MFRA 3Q5WA 4OX9T 3BK9A 1IJ5A 4DV7T 2V5DA 2PFVA 5LMNT 5HEHA 1XWMA 3EUHA 5JDHA 4PW8A 1UX5A 4ZXLA 4JI1T 3RIAA 2IIUA 3FBLA 4HFVA 1SHZC 5FXZA 4EGWA 4JYAT 3K8PC 3C50A 3MA9A 2R6GF 3QNUA 5HEUA 4IT4A 1IJ6A 1KFYA 5IUXA 4O4JE 3VKHA 4H9RC 3ZYLA 3E22E 4ZEYA 3O4XE 4WNKA 2ODUA 3MACA 2NTYA 2Q9QC 1MIVA 2EHOD 2LSIA 2M6IA 2LE8A 2VVNA 4HFBA 4KI0F 3JC6D 4DV4T 2X51A 3AE8A 2MAWA 3RIUC 2AXDS 5HEOA 3ZMTB 3J7Yq 1BR2A 2IW5B 3PUVF 2JQHA 2VKJA 1UURA 3ZT6A 1XNQT 1VCTA 2LKHA 3WAKA 3AE1A 2B76A 4DUYT 5FL1A 2D9DA 5DQVA 2LHNA 2XQ7A 2X68A 5ABHA 4AI6A 4ISTA 4EEBA 1Z0PA 4TNWA 1HX1B 3IF8B 2E9XD 1WCRA 2C5IT 1QSDA 4TN7B 2X9YA 3N2KE 5LGNB 3SOLA 3NZQA 3ZT7A 2CPTA 1GQEA 5F8PA 1WFDA 3FZLB 5CA0E 3PE0A 2QA7A 4U2YA 2V8SV 3EABA 2VVSA 3MKDA 2JQQA 2KSRA 2VL8A 2BVLA 4EYYR 3VKGA 3GWHA 5JH7E 4TNVA 5L3CB 5FY7A 2JJ9A 4PK4A 4EEDA 2L9QA 1VCSA 2UUBT 4YHHT 3CWZB 5C8YE 3ZSSA 2KZ7B 2WM9A 3G06A 4UR9A 3ABVA 2V6YA 3VRBA 5LXTE 2Q9QD 1LRZA 1D0YA 2BG9A 2PBIA 4TV8E 2A2FX 2X67A 5LJNA 4MHCA 4EZHA 2W63A 5FXVA 4JI7T 5L3DB 3O9XA 3N9PA 2N1GA 3UTKA 5JDFA 4EAHA 3ZMVB 3BQKA 3AE9A 3QOFA 3U3IA 5BMVE 4EXTA 2XHEB 4M1PA 1UGOA 4ZHQE 4JI5T 2XY8B 4HN9A 2QYWA 2K24A 4LF8T 3NKZA 3J9X1 2LEHA 3FHNA 1CHUA 3KFWX 2CWYA 2ODVA 4KBMB 2VKDA 5KX5E 2BKNA 4HE8A 3E08A 2CXFA 3CX7B 2CCQA 3ZC1A 4L9IA 3I9YA 4FI5A 5EK2A 2UUAT 3ETVA 2FJBA 3SFDA 3FBZA 5JR9C 2UXXB 3EAMA 3O1HA 3RX6A 4ZOLE 2UXBT 2OLTA 4YLHA 2N2NA 5AQSB 1X9BA 3IHRA 4KX6A 5AQRB 2Q9QB 4DR2T 2JMHA 3WAJA 4DV0T 1ZEEA 2RP4A 1MNEA 2LSGA 3VR8A 2NTXA 3LJCA 4ILBA 4PFPA 5CA1E 3PUYF 4JI0T 2V6XA 4A97A 4NIQA 5AQLB 4PJNA 4EOZB 1MIYA 3CQXC 3RYCE 2W2UA 4B3TT 4QXCB 4U7IA 5L4EA 3F2EA 2BKOA 3H3AA 5EZYE 4YHJA 2QRXA 4QH1A 3R6NA 4JI4T 5JDNA 3TLSA 2H3RA 3P4PA 2XJ7A 3CQGB 4LF5T 3AEFA 4ZZCA 3UUXB 2X9XA 3ONXA 2XQYA 5L2LA 4LF6T 2WSSV 4L5GA 4IE5A 1N36T 2UU9T 1FMVA 3UT5E 2UXDT 3HL6A 4H9OC 3HKEE 1W09A 4IE6A 3JADA 1S94A 3UU3A 5HEGA 1IAPA 3AVRA 5GONE 3RPUA 2E8IA 2IC6A 1X79A 4ISSA 4NPPA 3TLTA 3UQ4A 1M7KA 3RC8A 1O3XA 2E5LT 2HN1A 4CI1B 1YD8G 5LGUB 3OJAA 5AQMB 1I94T 2KT9A 4HFCA 1T7SA 2YU2A 1NEKA 3CMLA 2XZEA 3AAAB 2WDRA 5HXSA 3MXZA 2QGSA 5C3JA 4UF0B 1MIWA 1FJGT 3VR9A 4CN6A 1VOMA 2BZBA 3SWHA 3M65A 4XBFB 2WS3A 1MMAA 2W0GA 2YEVC 4WBNE 3HKBE 1VRBA 4AKRB 4O2BE 3E0ZA 4JI8T 1QLBA 1KNPA 3HKCE 5F5WA 4B6XA 3AECA 2K48A 4QX7B 2BVMA 1T98A 4I4TE 3AA0B 4PAGA 2V5CA 4CZZB 4YTMA 1IBKT 3ZN0B 3SFEA 5HCJA 5J1GA 4X64T 4H63V 2J4GA 2RA1A 2W00A 4H9SE 1WR0A 4HWFA 4IL4A 2D5UA 1E2AA 2H7VC 1HNXT 1IBLT 4NUUA 3BQLA 4AKHA 4JEHB 5LJMA 2DLRA 2X9WA 4O2AE 2B1EA 4HWHA 2CHNA 1N32T 4LFBT 2KWIB 3D0TA 3UUMA 5LP6E 3SRZA 4UVCB 5LG3A 5AQGB 1YQ3A 1WYBA 4YJ2E 2CE7A 3A8YC 4UVAB 3DJBA 4KHZF 4DR6T 1L0VA 3N2GE 3TLUA 2BBHA 5CB4E 2WMOA 2DWKA 3KDSE 3BQIA 2C5JA 1HS7A 3EVYA 4WZXA 3RHWA 3ZN1B 4PJJA 3CPZA 4OFZA 2OA5A 3S4UA 2DL1A 3PUQA 2LRLA 5IHYA 2J47A 4ZI2C 5HXEA 4CI3B 1T8BA 3P7IA 2V7MA 2CM0A 1XMOT 2XM2A 4GKJT 4AQFA 2KLQA 5LA6E 3RLFF 2FJEA 4NXNT 2V6YB 3TLWA 4GKKT 3NRYA 3CKDA 3LK42 1WR6A 2VURA 2BG9B 4ANJA 3AE6A 2BG9E 3ETUA 3FXDB 3RRCA 4AQYT 1D1CA 4AKIA 4UIGA 2VK9A 1G73A 1IZNB 5LBMA 2A3DA 3KVAA 5L3GB 2X66A 3PUXF 2WP9A 3JAEA 2CLYB 4LMLA 2IMLA 2X0LB 3NVOA 5CGMA 4IDZA 3PJAJ 3PDYA 5LBQB 3ZYMA 2NW7A 4X62T 4PJLA 5AQQB 3K3OA 3KV5A 3ZCJA 4YT0A 1FIOA 2XQ5A 3AA7B 4COFA 2HN2A 1XMQT 5LHGB 4LMKA 4Z91A 5ABEA 1JNRA 4B3ST 4NUVA 1UUSA 3N5LA 3ZYKA 3EDUA 5JRCA 3I0OA 4IE4A 1U5PA 2NP9A 3EHZA 4YJ3E 5HCMA 2MYSA 2IUBA 2W67A 5AQTB 2JRKA 3Q5DA 4ZI2D 4FJOA 5CJ5A 3F31A 2DWGA 2A72A 1UX4A 3A5XA 3PUZF 1WRDA 3AEGA 4L0RA 2LKGA 3FXEB 3H3MA 3PUGA 5DABA 5AQJB 3C51A 4DO0A 4UV8B 1E1HB 2HPLA 1D1AA 5FNVE 1XDPA 4AKGA 2HPJA 4C90A 3KBUA 2LJLA 2CHOA 5ABFA 2ES0A 4NXMT 4K0UA 3B5MA 1OEDA 3PUWF 4EB6E 2LSYA 2NOXA 3RQWA 3FB2A 4TUYE 4G63A 2VKHA 5FKYA 2XQ6A 2FJDA 2WQYA 3P8CD 3HA4A 3ZJ2A 2NR4A 4MBQA 5EK4A 5J2UE 4P09A 5AQIB 1YQ4A 4YTNA 2LHRA 4AIUA 3N2OA 3M3ZB 1KF6A 2CEAA 4ZI7E 1ZV4X
chains in the Genus database with same CATH topology
3DTOA 4DNDA 4HEAA 4ZS3A 1FMVA 3UT5E 3HL6A 4H9OC 2V7KA 3HKEE 2V1DB 4PJMA 2I59A 3R84B 4IE6A 3K3NA 1S94A 4EZ4A 5JDMA 1WLXA 3I9WA 3SS1A 3AA1B 1HCIA 1IAPA 3AVRA 1KNZA 2VKOA 4H63H 2JMKA 5GONE 4IGUA 4QX8B 3RYIE 4OK0A 3RPUA 1US7B 2E8IA 2IC6A 1X79A 4X20E 4ISSA 5FY1A 4H9PC 3ANWB 3PUAA 2Z6EA 4UF0A 4IE7A 3RC8A 1O3XA 1ZHCA 3RKOA 4CI1B 1YD8G 2E9XC 5FXWA 5LGUB 3OJAA 2PG8A 4BA9A 2KT9A 3W15B 3KV6A 1KK7A 3GA8A 4MFRA 2YU2A 3Q5WA 2N9DA 3CMLA 3BK9A 4U74A 5JDGA 4P0BA 3AAIA 3AAAB 2NW8A 1IJ5A 3F57A 5HXSA 3MXZA 2PFVA 3QC9A 4IE0A 2EHOA 2QGSA 2IAKA 1YW0A 2SPCA 2D2SA 3NBXX 2WWUA 4GYRA 3EUHA 5JDHA 4PW8A 3Q5XA 4WW0A 1UX5A 2CXDA 5L3EB 4UF0B 4I55E 3H37A 5L3FB 4O4IE 3V5UA 3FBLA 4HTEA 4HFVA 1SHZC 1MIWA 5FXZA 2V7LA 2V26A 4GOUA 1HFAA 3O1IA 3K8PC 3C50A 5LHIB 1FEWA 2Y6XA 4QWNB 1VOMA 3MA9A 3Q9DA 2BZBA 3SWHA 4CI2B 2H7OA 4HGAA 2V7JA 2Y8DA 1HF8A 5DJQC 3M65A 3B13A 1IJ6A 4OYKA 3T8OA 4XBFB 5JDLA 2EHOB 2V7IA 3L09A 4O4JE 5LGTB 1MMAA 3VKHA 2W0GA 2YEVC 4OHFA 4WBNE 3HKBE 4H9RC 3ZYLA 3E22E 4H9QC 3O4XE 2YU1A 1VRBA 2LSJA 2XAHB 3I0QA 4AKRB 4O2BE 3AA6B 4WNKA 3E0ZA 5JQGE 2ODUA 2C0SA 4TZ4C 2KMFA 3MACA 4KP3C 3HKCE 5FP3A 4TV9E 2NTYA 3HR0A 1MMDA 2Q9QC 1MIVA 4B6XA 2LT3A 2UXNB 2EHOD 2E9XA 4E7ZA 2K48A 3I1AA 2LSIA 4QX7B 2BVMA 5HWYA 3OBVE 5TAOA 1T98A 4I4TE 1B7TA 2LE8A 3OKQA 2D0UA 3AA0B 2DHRA 4PAGA 2ZLYA 4CZZB 5JDQA 2W61A 3JC6D 3AB3B 4DVDA 2X51A 1S35A 4ZI3D 3C4XA 2VWAA 1AJ3A 3KV9A 2LOSA 3QUJA 3ZN0B 3AVSA 5KMGP 3ZMTB 3J7Yq 5J1GA 4GYSA 4PFOA 2CXLA 1BR2A 3Q2MA 4H63V 2IW5B 5JREA 1CUNA 3VHLA 3B57A 2RA1A 2VKJA 2VB6A 2W00A 4KUMB 2JPFA 2XAGB 5A1LA 4H9SE 3QK6A 2D5UA 4Z8XA 3WAKA 3K3QC 2H7VC 2E9XB 4UV9B 5L3BB 4EYUA 3RYHE 4NUUA 3BQLA 5DQVA 2LHNA 4XZCA 4AKHA 4JEHB 2MTQA 1QUUA 1D0XA 5LJMA 2DLRA 2X68A 3IBPA 2X9WA 4BJMA 4O2AE 4ISTA 4QKNA 4AI6A 2B1EA 4V1Av 1Z0PA 4AQGA 3IF8B 1LKXA 4GK0E 2E9XD 2KWIB 3D0TA 5HXHA 3LFMA 5LOVE 2KWHA 3IEEA 3UUMA 4CXYA 2M67A 5LP6E 2C5IT 3OYZA 1QSDA 4TN7B 3SRZA 2ZM8A 3OYXA 4PK5A 2X9YA 3EDVA 3N2KE 5LGNB 3HI2A 3SOLA 2XAFB 4UVCB 4AQFC 3NZQA 5JVDE 4PK6A 4J2CA 2MBGA 5F8PA 2G0UA 2ZMAA 4IHJE 5KDMC 5CA0E 3PE0A 4EIWA 2KINB 2BDEA 2QA7A 4IIJE 1WYBA 4YJ2E 2CE7A 2NW9A 4UELA 3L3PA 1H7CA 3MKDA 2CLYC 2YINA 2JQQA 4YFSA 2VL8A 2BVLA 4EYYR 1HX8A 2KNDA 3PU8A 3VKGA 3GWHA 3NZPA 4UVAB 3DJBA 5FYMA 5JH7E 2CMRA 3CQCB 1V9DA 1U4QA 5L3CB 4CXXA 5FY7A 2JJ9A 3N2GE 4PK4A 2L9QA 4O8SA 5HWXA 2GK9A 1MMNA 4AKLA 3CWZB 2WMOA 4PNIA 5CB4E 4DMVA 5C8YE 2DWKA 3KDSE 3N9OA 3LG7A 4ASKA 1OXZA 3BQIA 2C5JA 2KXPB 1HS7A 3EVYA 1YKHB 1OWAA 2KZ7B 2WBLA 2WM9A 3GN5B 3ZN1B 4PJJA 4BAYB 2C5KT 3CPZA 5LXTE 4OFZA 2Q9QD 2OA5A 3GMIA 3S4UA 4GK5E 1EZ3A 1HG5A 3CX8B 3N9QA 1LRZA 1D0YA 4TX5A 4MLKA 3WI3A 3PUQA 2PBIA 4QXBB 4TV8E 4MALA 2A2FX 2VASA 5IHYA 4ZI2C 2X67A 3C4ZA 3MK7C 3MZKB 5HXCA 5LJNA 1BR4A 4MHCA 4BJNA 2W62A 4EZHA 4CI3B 2W63A 5FXVA 4UEMA 3P7IA 2V7MA 5HXEA 2CM0A 5L3DB 5M4YA 3O9XA 3N9PA 2KLQA 4AQFA 2N1GA 5LA6E 3UTKA 3RYFE 2L8KA 4X1KE 4X1IE 5FMNA 4XAXB 3ZEFB 5JDFA 4GIWA 5FY0A 3N9LA 3MJXA 4JLEA 1ZKEA 4EAHA 3ZMVB 3BQKA 4DBRA 3NRYA 3CKDA 3LK42 3NRXA 4H9NC 3UFEA 1WR6A 2ZM2A 4KMCA 5LYJE 2P9BA 3LK2B 4CXWA 4ANJA 3U3IA 4OYJA 5HAXA 5BMVE 3KVBA 1D1BA 3ETUA 5AFUL 5ADXL 4EXTA 4P0AA 5LHHB 2XHEB 3ZLIA 4M1PA 3ZC0A 3N9NA 3FXDB 4ZHQE 3RRCA 1Y64B 1D1CA 4AKIA 2K5BB 4HN9A 3HKDE 2K24A 2D0TA 4F6RC 3LBXA 4UIGA 2VK9A 4DBQA 3PUSA 1G73A 3KINB 1IZNB 3N9MA 4U72A 3J9X1 3UULA 5LBMA 2DI4A 1G8XA 2CA5A 2LEHA 2A3DA 3FHNA 3KVAA 3KV4A 5L3GB 3KFWX 2CWYA 2X66A 4O4HE 2ODVA 1BR0A 2CLYB 4DMWA 2X9HA 5HXRA 2X0LB 4KBMB 4QHOA 2CWOA 1NAFA 4IDZA 1MNDA 2VKDA 3PDYA 4ERRA 2XAQB 5LBQB 3C98B 4HE8A 3ZMUB 2LSKA 3ZYMA 5KX5E 1D0ZA 2NW7A 3ESLA 3E08A 2CXFA 4PJLA 3CX7B 2CCQA 3ZC1A 1WYCA 3K3OA 3KV5A 3ZCJA 1FIOA 4L9IA 5EK3A 2Q9QA 3LBXB 3I9YA 4ADZA 3AA7B 2XAJB 4FI5A 5EK2A 3ETVA 3U78A 3CX6B 3RRWA 5LHGB 3FBZA 5JR9C 5HYAA 2UXXB 3O1HA 2ACXA 5DQWA 3GN5A 5F3JA 1LVKA 3O1JA 3RC3A 4I43B 3RX6A 4ZOLE 3V5SA 4NUVA 1HG2A 4YLHA 3N5LA 3ZYKA 2Y48B 2N2NA 5J2TE 3EDUA 3IHRA 4I50E 5JRCA 2NWBA 2DCFA 3PU3A 4HKAA 1BR1A 3I0OA 4IE4A 3KBTA 1U5PA 4QXHB 2Q9QB 2NP9A 4YJ3E 4JEUB 2JMHA 3WAJA 2MYSA 1LVFA 1ZEEA 2RP4A 1MNEA 2JRKA 2LSGA 4ZI2D 3TKLB 2HH7A 4FJOA 4C91A 3F31A 4UVBB 3ZPOA 2NTXA 2DWGA 2A72A 3LJCA 1UX4A 4PFPA 5CA1E 3A5XA 3C4WA 1WRDA 3PTRB 4L0RA 4JUYA 3FXEB 4PJNA 3ZMZB 4EOZB 5JRCB 2XTLA 1MIYA 4O4LE 3PUGA 5DABA 3AAEB 3CQXC 3C51A 2WMNA 3RYCE 4DO0A 2YK0A 1UCUA 4UV8B 4WBOA 1E1HB 2XASB 4A56A 2HPLA 2LOPA 3VU7H 1D1AA 5FNVE 3ZCIA 4QXCB 4AKGA 2HPJA 1SA0E 4C90A 5LG4A 3KBUA 2LJLA 3F2EA 1NWMX 4G2AA 2ES0A 3C64A 3H3AA 3CVRA 4K0UA 3ZMSB 5JR9A 5EZYE 1FMWA 4YHJA 2IC9A 4ILUA 3R6NA 4N78D 4X1YE 4E7SA 5JDNA 2H3RA 3PURA 4EB6E 2LSYA 2NOXA 2ZM0A 4AXPA 3FB2A 4TUYE 4G63A 2VKHA 3CQGB 2K9AA 5ETWA 4UXNB 2L3LA 2J1DG 2PJQA 3UUXB 2X9XA 3ONXA 3P8CD 1MMGA 3ZJ1A 4CQIA 5LNKA 5H6RB 3HA4A 5E0OA 2XQYA 4ZS2A 5FXXA 2LM9A 5L2LA 3ZJ2A 5JR9B 1YKEB 2EHOC 4MBQA 5EK4A 5J2UE 4P09A 5H6QB 2MOZA 2WSSV 3RH3A 1HTJF 2LHRA 3JC6C 3N2OA 4L5GA 2DNXA 4ZI3C 5IYZE 3UUNA 3DP7A 3ANWA 2WAUA 4IE5A 2CEAA 3LK3B 2XUEA 5LCYA 4ZI7E 1ZV4X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 2V7K A;  4PJM A;  2I59 A;  3R84 B;  4EZ4 A;  4IDQ A;  3I9W A;  3SS1 A;  1KNZ A;  3RGL A;  4OK0 A;  1US7 B;  3ZKR A;  2IHR 1;  4H9P C;  2Z6E A;  2AE9 A;  1N34 T;  2W4X A;  2PG8 A;  4BA9 A;  2WB5 A;  3KV6 A;  3GA8 A;  3AAI A;  1XZY A;  3QC9 A;  1NEN A;  4IE0 A;  2EHO A;  2IAK A;  2SPC A;  2D2S A;  3Q5X A;  4WW0 A;  4WYV A;  2CXD A;  5L3F B;  4IDN A;  2V7L A;  1HFA A;  4JI6 T;  3O1I A;  2Y6X A;  4QWN B;  3Q9D A;  2H7O A;  4HGA A;  3K1S A;  2Y8D A;  5DJQ C;  3Q5E A;  1SUM B;  4U31 A;  3T8O A;  3L09 A;  5LGT B;  4OHF A;  2LSJ A;  3I0Q A;  4DR7 T;  4DV1 T;  3QB5 K;  2C0S A;  4KP3 C;  4TV9 E;  1IBM T;  2BS4 A;  4E7Z A;  2E9X A;  5HWY A;  3I1A A;  3OBV E;  5TAO A;  3OKQ A;  2DHR A;  2ZLY A;  5JDQ A;  4DVD A;  5L47 A;  2VWA A;  3KV9 A;  2LOS A;  3AVS A;  2CXL A;  3Q2M A;  1CUN A;  3B57 A;  5A1L A;  3QK6 A;  4Z8X A;  3K3Q C;  3UU6 A;  4QH5 A;  1J5W A;  4EYU A;  5AQU B;  3RYH E;  4XZC A;  3PV0 F;  1QUU A;  1D0X A;  5FVK A;  4B3M T;  3CK6 A;  1LKX A;  4LFC T;  2BG9 C;  2KWH A;  3IEE A;  4CXY A;  2M67 A;  3OYZ A;  3OYX A;  2WU2 A;  4PK5 A;  2YN6 A;  2XAF B;  2MBG A;  2G0U A;  1ZOY A;  4IHJ E;  5KDM C;  4EIW A;  2KIN B;  2VL0 A;  2XM1 A;  3FZK B;  2NW9 A;  1H7C A;  3RIU A;  2CLY C;  2YIN A;  4YFS A;  5FYM A;  3FZM B;  1V9D A;  4Z90 A;  2GK9 A;  1MMN A;  4PNI A;  4DMV A;  4ASK A;  2I0M A;  1OXZ A;  4YXD A;  4LF9 T;  3GN5 B;  2C5K T;  1HR0 T;  4ILA A;  3T1Y T;  4GK5 E;  3N9Q A;  4QH4 A;  5AQV B;  4QXB B;  2VAS A;  3C4Z A;  5HXC A;  2JIW A;  3P4R A;  4HWC A;  5M4Y A;  4AIS A;  3P4W A;  3AE5 A;  3AE7 A;  2L8K A;  4X1K E;  4X1I E;  2UXC T;  1E7P A;  4GIW A;  3IA3 A;  3N9L A;  1KEY A;  4DBR A;  5LYJ E;  4DV5 T;  3LK2 B;  4CXW A;  2XQ8 A;  4OYJ A;  5HAX A;  1D1B A;  5AFU L;  4DV6 T;  4HFE A;  2YDQ A;  5LHH B;  2J62 A;  3N9N A;  1Z8U A;  1Y64 B;  3FZH B;  2K5B B;  3AE3 A;  2D0T A;  3LBX A;  4DR3 T;  2LLY A;  3N9M A;  4U72 A;  3RKG A;  2DI4 A;  1G8X A;  2X0H A;  2CA5 A;  5L4H A;  4O4H E;  3UQ7 A;  1BR0 A;  4DMW A;  4KHP T;  2WWV A;  2I6H A;  5LB7 B;  3ZMU B;  3C98 B;  2LSK A;  2CRB A;  1WYC A;  5EK3 A;  4ADZ A;  3UU4 A;  3CX6 B;  3RRW A;  2YDR A;  3LSV A;  2HHH T;  5HYA A;  3RQU A;  3GN5 A;  5FVL A;  1LVK A;  3V5S A;  1HG2 A;  5J2T E;  1W0A A;  2WY2 A;  4I50 E;  2NWB A;  4HKA A;  1BR1 A;  3L39 A;  3L8R A;  1YXR A;  4QXH B;  4DR5 T;  3ZT5 A;  2HH7 A;  2QVA A;  4JBW F;  3ZPO A;  3C4W A;  3AEA A;  4P1N A;  4YSY A;  3ZMZ B;  5JRC B;  4YSZ A;  5JTG A;  2WMN A;  3ONJ A;  4CN1 A;  1UCU A;  2XSB A;  4WBO A;  2XAS B;  3VU7 H;  4DUZ T;  1SA0 E;  3CVR A;  5JR9 A;  1FMW A;  4ILU A;  4N78 D;  2CBI A;  3AXJ A;  3TLV A;  2W66 A;  2ZM0 A;  5AQN B;  4LFA T;  3AE4 A;  2L3L A;  4TWD A;  1XNR T;  2J1D G;  2VQF T;  3ZJ1 A;  5LNK A;  5H6R B;  5ABF B;  4EV6 A;  2WDQ A;  4YTP A;  5AQK B;  1YKE B;  1J5E T;  2YKS A;  1OED B;  3OTO T;  1OED E;  4IL9 A;  1HTJ F;  4JV5 T;  1HNZ T;  4DV2 T;  2DNX A;  3A7M A;  4ZI3 C;  5IYZ E;  3UU8 A;  3DP7 A;  3ANW A;  3LK3 B;  2XUE A;  3UUB A;  3DTO A;  4DID B;  4HEA A;  4ZS3 A;  1Y01 A;  2BS3 A;  5J0Z A;  1J1J A;  3K3N A;  5JDM A;  1WLX A;  1HCI A;  3OVU A;  4H63 H;  2JMK A;  4IGU A;  3RYI E;  4HWD A;  3FZF B;  4HFH A;  4X20 E;  4F8H A;  4CN4 A;  2VQE T;  2UUC T;  2IDO B;  5FXW A;  1SE7 A;  2F4V T;  1UK5 A;  1KK7 A;  1T72 A;  2N9D A;  5JDG A;  4U74 A;  4P0B A;  2FBW A;  2NW8 A;  3F57 A;  1YW0 A;  3NBX X;  2WWU A;  4GYR A;  5L3E B;  4I55 E;  3H37 A;  4O4I E;  3V5U A;  4HTE A;  2V26 A;  4U2Z A;  4GOU A;  3T1H T;  4U7Y A;  5LHI B;  1FEW A;  2E5V A;  4CI2 B;  2V7J A;  1HF8 A;  3B13 A;  4OYK A;  5JDL A;  2EHO B;  2V7I A;  3AEE A;  4H9Q C;  5AQH B;  2YU1 A;  1W9R A;  2XAH B;  3NWI A;  1JNZ A;  3AA6 B;  5JQG E;  4JI2 T;  4TZ4 C;  2KMF A;  5FP3 A;  3HR0 A;  1MMD A;  2LT3 A;  2UXN B;  4TWH A;  2WU5 A;  1B7T A;  2D0U A;  2ACZ A;  2YOE A;  2W61 A;  3AB3 B;  1S35 A;  4ZI3 D;  3C4X A;  1AJ3 A;  3QUJ A;  2WDV A;  5KMG P;  4GYS A;  4PFO A;  5C2T A;  3JAF A;  5JRE A;  3VHL A;  2A9U A;  2VB6 A;  4KUM B;  2JPF A;  2XAG B;  3AEB A;  2FUP A;  5BR8 T;  2E9X B;  4UV9 B;  5L3B B;  2XQA A;  2MTQ A;  3IBP A;  4BJM A;  4QKN A;  1HNW T;  2BBJ A;  4V1A v;  4AQG A;  4GK0 E;  5HXH A;  3LFM A;  5LOV E;  2RPA A;  2ZM8 A;  4Q25 A;  3EDV A;  4K0K T;  3RI5 A;  3HI2 A;  3JCF A;  4AQF C;  5JVD E;  4X5T A;  4PK6 A;  4J2C A;  1N33 T;  2ZMA A;  2XQ4 A;  3AE2 A;  2BDE A;  4IIJ E;  2BKP A;  4UEL A;  3L3P A;  2WCA A;  2OV9 A;  1HX8 A;  2KND A;  3PU8 A;  3NZP A;  2CMR A;  3CQC B;  1U4Q A;  4CXX A;  4O8S A;  5HWX A;  3UU5 A;  4AKL A;  2XPK A;  2H88 A;  3N9O A;  3LG7 A;  2KXP B;  1YKH B;  1OWA A;  2WBL A;  3QB5 A;  2H89 A;  4BAY B;  4LF4 T;  3GMI A;  3P50 A;  1EZ3 A;  1HG5 A;  3CX8 B;  4TX5 A;  3WI3 A;  4MLK A;  4MAL A;  3MK7 C;  3MZK B;  1BR4 A;  4BJN A;  2W62 A;  4UEM A;  5LMU T;  4IRE A;  1ZP0 A;  3CIR A;  2XQ3 A;  3RYF E;  5FMN A;  4XAX B;  3ZEF B;  3EI0 A;  5FY0 A;  2BS2 A;  3MJX A;  4JLE A;  1ZKE A;  3NRX A;  4H9N C;  3UFE A;  4KMC A;  2ZM2 A;  2MPK A;  2P9B A;  4ZZB A;  3KVB A;  4P0A A;  3UFG A;  5ADX L;  4HFD A;  3ZLI A;  3ZC0 A;  2FJA A;  4X66 T;  5AQF B;  3HKD E;  4F6R C;  4DBQ A;  2WZH A;  3PUS A;  3KIN B;  3UUL A;  2LRK A;  3KV4 A;  4DR1 T;  2X9H A;  5HXR A;  4QHO A;  2CWO A;  1NAF A;  4JI3 T;  1MND A;  4ERR A;  2XAQ B;  1D0Z A;  3ESL A;  4TWF A;  1XDO A;  2Q9Q A;  3LBX B;  3OPC A;  2XAJ B;  1W0B A;  3U78 A;  3X1D A;  3ONL C;  2YDS A;  5DQW A;  2ACX A;  1OED C;  5F3J A;  1R8I A;  3O1J A;  2E2A A;  3AED A;  3RC3 A;  4I43 B;  5CFB A;  3VRA A;  2Y48 B;  4X65 T;  4A5X A;  2JQK A;  2DCF A;  3PU3 A;  1I6Z A;  4IDO A;  3KBT A;  4JEU B;  4B3R T;  1LVF A;  5KXJ A;  3TKL B;  4C91 A;  4UVB B;  3PTR B;  4JUY A;  2XTL A;  4O4L E;  3AAE B;  5IWA T;  2YK0 A;  5ABG A;  4HFI A;  4A56 A;  2LOP A;  2WZI A;  3ZCI A;  3P4Q A;  4YSX A;  5LG4 A;  1NWM X;  4G2A A;  3C64 A;  4HWI B;  3ZMS B;  2LM2 A;  2IC9 A;  2M6B A;  4X1Y E;  4E7S A;  3P4S A;  1M62 A;  3PUR A;  3PJA A;  4AXP A;  4DR4 T;  1KNR A;  4LF7 T;  2K9A A;  3LDQ B;  5ETW A;  4UXN B;  2X0Y A;  2XSA A;  3RF1 A;  2ZM6 T;  2PJQ A;  1MMG A;  4CQI A;  5E0O A;  4LMJ A;  4ZS2 A;  2LM9 A;  5FXX A;  3RIF A;  5JR9 B;  2EHO C;  5H6Q B;  2K3W A;  2MOZ A;  3AXJ B;  3RH3 A;  3JC6 C;  2XQ9 A;  3UUN A;  2WAU A;  5LCY A;  4IDP A;  2CBJ A;  4DND A;  4U3C A;  5AQO B;  2V1D B;  2PTF A;  4YY3 T;  4A98 A;  4ILC A;  3AA1 B;  5HEJ A;  2VKO A;  5FL0 A;  4I0U A;  4QX8 B;  3ZST A;  5AQP B;  5FY1 A;  3ANW B;  4U33 A;  3PUA A;  1DU2 A;  4UF0 A;  4IE7 A;  2JQ9 A;  1ZHC A;  4DV3 T;  3RKO A;  2E9X C;  3W15 B;  4MFR A;  3Q5W A;  4OX9 T;  3BK9 A;  1IJ5 A;  4DV7 T;  2V5D A;  2PFV A;  5LMN T;  5HEH A;  1XWM A;  3EUH A;  5JDH A;  4PW8 A;  1UX5 A;  4ZXL A;  4JI1 T;  3RIA A;  2IIU A;  3FBL A;  4HFV A;  1SHZ C;  5FXZ A;  4EGW A;  4JYA T;  3K8P C;  3C50 A;  3MA9 A;  2R6G F;  3QNU A;  5HEU A;  4IT4 A;  1IJ6 A;  1KFY A;  5IUX A;  4O4J E;  3VKH A;  4H9R C;  3ZYL A;  3E22 E;  4ZEY A;  3O4X E;  4WNK A;  2ODU A;  3MAC A;  2NTY A;  2Q9Q C;  1MIV A;  2EHO D;  2LSI A;  2M6I A;  2LE8 A;  2VVN A;  4HFB A;  4KI0 F;  3JC6 D;  4DV4 T;  2X51 A;  3AE8 A;  2MAW A;  3RIU C;  2AXD S;  5HEO A;  3ZMT B;  3J7Y q;  1BR2 A;  2IW5 B;  3PUV F;  2JQH A;  2VKJ A;  1UUR A;  3ZT6 A;  1XNQ T;  1VCT A;  2LKH A;  3WAK A;  3AE1 A;  2B76 A;  4DUY T;  5FL1 A;  2D9D A;  5DQV A;  2LHN A;  2XQ7 A;  2X68 A;  5ABH A;  4AI6 A;  4IST A;  4EEB A;  1Z0P A;  4TNW A;  1HX1 B;  3IF8 B;  2E9X D;  1WCR A;  2C5I T;  1QSD A;  4TN7 B;  2X9Y A;  3N2K E;  5LGN B;  3SOL A;  3NZQ A;  3ZT7 A;  2CPT A;  1GQE A;  5F8P A;  1WFD A;  3FZL B;  5CA0 E;  3PE0 A;  2QA7 A;  4U2Y A;  2V8S V;  3EAB A;  2VVS A;  3MKD A;  2JQQ A;  2KSR A;  2VL8 A;  2BVL A;  4EYY R;  3VKG A;  3GWH A;  5JH7 E;  4TNV A;  5L3C B;  5FY7 A;  2JJ9 A;  4PK4 A;  4EED A;  2L9Q A;  1VCS A;  2UUB T;  4YHH T;  3CWZ B;  5C8Y E;  3ZSS A;  2KZ7 B;  2WM9 A;  3G06 A;  4UR9 A;  3ABV A;  2V6Y A;  3VRB A;  5LXT E;  2Q9Q D;  1LRZ A;  1D0Y A;  2BG9 A;  2PBI A;  4TV8 E;  2A2F X;  2X67 A;  5LJN A;  4MHC A;  4EZH A;  2W63 A;  5FXV A;  4JI7 T;  5L3D B;  3O9X A;  3N9P A;  2N1G A;  3UTK A;  5JDF A;  4EAH A;  3ZMV B;  3BQK A;  3AE9 A;  3QOF A;  3U3I A;  5BMV E;  4EXT A;  2XHE B;  4M1P A;  1UGO A;  4ZHQ E;  4JI5 T;  2XY8 B;  4HN9 A;  2QYW A;  2K24 A;  4LF8 T;  3NKZ A;  3J9X 1;  2LEH A;  3FHN A;  1CHU A;  3KFW X;  2CWY A;  2ODV A;  4KBM B;  2VKD A;  5KX5 E;  2BKN A;  4HE8 A;  3E08 A;  2CXF A;  3CX7 B;  2CCQ A;  3ZC1 A;  4L9I A;  3I9Y A;  4FI5 A;  5EK2 A;  2UUA T;  3ETV A;  2FJB A;  3SFD A;  3FBZ A;  5JR9 C;  2UXX B;  3EAM A;  3O1H A;  3RX6 A;  4ZOL E;  2UXB T;  2OLT A;  4YLH A;  2N2N A;  5AQS B;  1X9B A;  3IHR A;  4KX6 A;  5AQR B;  2Q9Q B;  4DR2 T;  2JMH A;  3WAJ A;  4DV0 T;  1ZEE A;  2RP4 A;  1MNE A;  2LSG A;  3VR8 A;  2NTX A;  3LJC A;  4ILB A;  4PFP A;  5CA1 E;  3PUY F;  4JI0 T;  2V6X A;  4A97 A;  4NIQ A;  5AQL B;  4PJN A;  4EOZ B;  1MIY A;  3CQX C;  3RYC E;  2W2U A;  4B3T T;  4QXC B;  4U7I A;  5L4E A;  3F2E A;  2BKO A;  3H3A A;  5EZY E;  4YHJ A;  2QRX A;  4QH1 A;  3R6N A;  4JI4 T;  5JDN A;  3TLS A;  2H3R A;  3P4P A;  2XJ7 A;  3CQG B;  4LF5 T;  3AEF A;  4ZZC A;  3UUX B;  2X9X A;  3ONX A;  2XQY A;  5L2L A;  4LF6 T;  2WSS V;  4L5G A;  4IE5 A;  1N36 T;  2UU9 T;  1FMV A;  3UT5 E;  2UXD T;  3HL6 A;  4H9O C;  3HKE E;  1W09 A;  4IE6 A;  3JAD A;  1S94 A;  3UU3 A;  5HEG A;  1IAP A;  3AVR A;  5GON E;  3RPU A;  2E8I A;  2IC6 A;  1X79 A;  4ISS A;  4NPP A;  3TLT A;  3UQ4 A;  1M7K A;  3RC8 A;  1O3X A;  2E5L T;  2HN1 A;  4CI1 B;  1YD8 G;  5LGU B;  3OJA A;  5AQM B;  1I94 T;  2KT9 A;  4HFC A;  1T7S A;  2YU2 A;  1NEK A;  3CML A;  2XZE A;  3AAA B;  2WDR A;  5HXS A;  3MXZ A;  2QGS A;  5C3J A;  4UF0 B;  1MIW A;  1FJG T;  3VR9 A;  4CN6 A;  1VOM A;  2BZB A;  3SWH A;  3M65 A;  4XBF B;  2WS3 A;  1MMA A;  2W0G A;  2YEV C;  4WBN E;  3HKB E;  1VRB A;  4AKR B;  4O2B E;  3E0Z A;  4JI8 T;  1QLB A;  1KNP A;  3HKC E;  5F5W A;  4B6X A;  3AEC A;  2K48 A;  4QX7 B;  2BVM A;  1T98 A;  4I4T E;  3AA0 B;  4PAG A;  2V5C A;  4CZZ B;  4YTM A;  1IBK T;  3ZN0 B;  3SFE A;  5HCJ A;  5J1G A;  4X64 T;  4H63 V;  2J4G A;  2RA1 A;  2W00 A;  4H9S E;  1WR0 A;  4HWF A;  4IL4 A;  2D5U A;  1E2A A;  2H7V C;  1HNX T;  1IBL T;  4NUU A;  3BQL A;  4AKH A;  4JEH B;  5LJM A;  2DLR A;  2X9W A;  4O2A E;  2B1E A;  4HWH A;  2CHN A;  1N32 T;  4LFB T;  2KWI B;  3D0T A;  3UUM A;  5LP6 E;  3SRZ A;  4UVC B;  5LG3 A;  5AQG B;  1YQ3 A;  1WYB A;  4YJ2 E;  2CE7 A;  3A8Y C;  4UVA B;  3DJB A;  4KHZ F;  4DR6 T;  1L0V A;  3N2G E;  3TLU A;  2BBH A;  5CB4 E;  2WMO A;  2DWK A;  3KDS E;  3BQI A;  2C5J A;  1HS7 A;  3EVY A;  4WZX A;  3RHW A;  3ZN1 B;  4PJJ A;  3CPZ A;  4OFZ A;  2OA5 A;  3S4U A;  2DL1 A;  3PUQ A;  2LRL A;  5IHY A;  2J47 A;  4ZI2 C;  5HXE A;  4CI3 B;  1T8B A;  3P7I A;  2V7M A;  2CM0 A;  1XMO T;  2XM2 A;  4GKJ T;  4AQF A;  2KLQ A;  5LA6 E;  3RLF F;  2FJE A;  4NXN T;  2V6Y B;  3TLW A;  4GKK T;  3NRY A;  3CKD A;  3LK4 2;  1WR6 A;  2VUR A;  2BG9 B;  4ANJ A;  3AE6 A;  2BG9 E;  3ETU A;  3FXD B;  3RRC A;  4AQY T;  1D1C A;  4AKI A;  4UIG A;  2VK9 A;  1G73 A;  1IZN B;  5LBM A;  2A3D A;  3KVA A;  5L3G B;  2X66 A;  3PUX F;  2WP9 A;  3JAE A;  2CLY B;  4LML A;  2IML A;  2X0L B;  3NVO A;  5CGM A;  4IDZ A;  3PJA J;  3PDY A;  5LBQ B;  3ZYM A;  2NW7 A;  4X62 T;  4PJL A;  5AQQ B;  3K3O A;  3KV5 A;  3ZCJ A;  4YT0 A;  1FIO A;  2XQ5 A;  3AA7 B;  4COF A;  2HN2 A;  1XMQ T;  5LHG B;  4LMK A;  4Z91 A;  5ABE A;  1JNR A;  4B3S T;  4NUV A;  1UUS A;  3N5L A;  3ZYK A;  3EDU A;  5JRC A;  3I0O A;  4IE4 A;  1U5P A;  2NP9 A;  3EHZ A;  4YJ3 E;  5HCM A;  2MYS A;  2IUB A;  2W67 A;  5AQT B;  2JRK A;  3Q5D A;  4ZI2 D;  4FJO A;  5CJ5 A;  3F31 A;  2DWG A;  2A72 A;  1UX4 A;  3A5X A;  3PUZ F;  1WRD A;  3AEG A;  4L0R A;  2LKG A;  3FXE B;  3H3M A;  3PUG A;  5DAB A;  5AQJ B;  3C51 A;  4DO0 A;  4UV8 B;  1E1H B;  2HPL A;  1D1A A;  5FNV E;  1XDP A;  4AKG A;  2HPJ A;  4C90 A;  3KBU A;  2LJL A;  2CHO A;  5ABF A;  2ES0 A;  4NXM T;  4K0U A;  3B5M A;  1OED A;  3PUW F;  4EB6 E;  2LSY A;  2NOX A;  3RQW A;  3FB2 A;  4TUY E;  4G63 A;  2VKH A;  5FKY A;  2XQ6 A;  2FJD A;  2WQY A;  3P8C D;  3HA4 A;  3ZJ2 A;  2NR4 A;  4MBQ A;  5EK4 A;  5J2U E;  4P09 A;  5AQI B;  1YQ4 A;  4YTN A;  2LHR A;  4AIU A;  3N2O A;  3M3Z B;  1KF6 A;  2CEA A;  4ZI7 E;  1ZV4 X; 
#chains in the Genus database with same CATH homology
 3DTO A;  4DND A;  4HEA A;  4ZS3 A;  1FMV A;  3UT5 E;  3HL6 A;  4H9O C;  2V7K A;  3HKE E;  2V1D B;  4PJM A;  2I59 A;  3R84 B;  4IE6 A;  3K3N A;  1S94 A;  4EZ4 A;  5JDM A;  1WLX A;  3I9W A;  3SS1 A;  3AA1 B;  1HCI A;  1IAP A;  3AVR A;  1KNZ A;  2VKO A;  4H63 H;  2JMK A;  5GON E;  4IGU A;  4QX8 B;  3RYI E;  4OK0 A;  3RPU A;  1US7 B;  2E8I A;  2IC6 A;  1X79 A;  4X20 E;  4ISS A;  5FY1 A;  4H9P C;  3ANW B;  3PUA A;  2Z6E A;  4UF0 A;  4IE7 A;  3RC8 A;  1O3X A;  1ZHC A;  3RKO A;  4CI1 B;  1YD8 G;  2E9X C;  5FXW A;  5LGU B;  3OJA A;  2PG8 A;  4BA9 A;  2KT9 A;  3W15 B;  3KV6 A;  1KK7 A;  3GA8 A;  4MFR A;  2YU2 A;  3Q5W A;  2N9D A;  3CML A;  3BK9 A;  4U74 A;  5JDG A;  4P0B A;  3AAI A;  3AAA B;  2NW8 A;  1IJ5 A;  3F57 A;  5HXS A;  3MXZ A;  2PFV A;  3QC9 A;  4IE0 A;  2EHO A;  2QGS A;  2IAK A;  1YW0 A;  2SPC A;  2D2S A;  3NBX X;  2WWU A;  4GYR A;  3EUH A;  5JDH A;  4PW8 A;  3Q5X A;  4WW0 A;  1UX5 A;  2CXD A;  5L3E B;  4UF0 B;  4I55 E;  3H37 A;  5L3F B;  4O4I E;  3V5U A;  3FBL A;  4HTE A;  4HFV A;  1SHZ C;  1MIW A;  5FXZ A;  2V7L A;  2V26 A;  4GOU A;  1HFA A;  3O1I A;  3K8P C;  3C50 A;  5LHI B;  1FEW A;  2Y6X A;  4QWN B;  1VOM A;  3MA9 A;  3Q9D A;  2BZB A;  3SWH A;  4CI2 B;  2H7O A;  4HGA A;  2V7J A;  2Y8D A;  1HF8 A;  5DJQ C;  3M65 A;  3B13 A;  1IJ6 A;  4OYK A;  3T8O A;  4XBF B;  5JDL A;  2EHO B;  2V7I A;  3L09 A;  4O4J E;  5LGT B;  1MMA A;  3VKH A;  2W0G A;  2YEV C;  4OHF A;  4WBN E;  3HKB E;  4H9R C;  3ZYL A;  3E22 E;  4H9Q C;  3O4X E;  2YU1 A;  1VRB A;  2LSJ A;  2XAH B;  3I0Q A;  4AKR B;  4O2B E;  3AA6 B;  4WNK A;  3E0Z A;  5JQG E;  2ODU A;  2C0S A;  4TZ4 C;  2KMF A;  3MAC A;  4KP3 C;  3HKC E;  5FP3 A;  4TV9 E;  2NTY A;  3HR0 A;  1MMD A;  2Q9Q C;  1MIV A;  4B6X A;  2LT3 A;  2UXN B;  2EHO D;  2E9X A;  4E7Z A;  2K48 A;  3I1A A;  2LSI A;  4QX7 B;  2BVM A;  5HWY A;  3OBV E;  5TAO A;  1T98 A;  4I4T E;  1B7T A;  2LE8 A;  3OKQ A;  2D0U A;  3AA0 B;  2DHR A;  4PAG A;  2ZLY A;  4CZZ B;  5JDQ A;  2W61 A;  3JC6 D;  3AB3 B;  4DVD A;  2X51 A;  1S35 A;  4ZI3 D;  3C4X A;  2VWA A;  1AJ3 A;  3KV9 A;  2LOS A;  3QUJ A;  3ZN0 B;  3AVS A;  5KMG P;  3ZMT B;  3J7Y q;  5J1G A;  4GYS A;  4PFO A;  2CXL A;  1BR2 A;  3Q2M A;  4H63 V;  2IW5 B;  5JRE A;  1CUN A;  3VHL A;  3B57 A;  2RA1 A;  2VKJ A;  2VB6 A;  2W00 A;  4KUM B;  2JPF A;  2XAG B;  5A1L A;  4H9S E;  3QK6 A;  2D5U A;  4Z8X A;  3WAK A;  3K3Q C;  2H7V C;  2E9X B;  4UV9 B;  5L3B B;  4EYU A;  3RYH E;  4NUU A;  3BQL A;  5DQV A;  2LHN A;  4XZC A;  4AKH A;  4JEH B;  2MTQ A;  1QUU A;  1D0X A;  5LJM A;  2DLR A;  2X68 A;  3IBP A;  2X9W A;  4BJM A;  4O2A E;  4IST A;  4QKN A;  4AI6 A;  2B1E A;  4V1A v;  1Z0P A;  4AQG A;  3IF8 B;  1LKX A;  4GK0 E;  2E9X D;  2KWI B;  3D0T A;  5HXH A;  3LFM A;  5LOV E;  2KWH A;  3IEE A;  3UUM A;  4CXY A;  2M67 A;  5LP6 E;  2C5I T;  3OYZ A;  1QSD A;  4TN7 B;  3SRZ A;  2ZM8 A;  3OYX A;  4PK5 A;  2X9Y A;  3EDV A;  3N2K E;  5LGN B;  3HI2 A;  3SOL A;  2XAF B;  4UVC B;  4AQF C;  3NZQ A;  5JVD E;  4PK6 A;  4J2C A;  2MBG A;  5F8P A;  2G0U A;  2ZMA A;  4IHJ E;  5KDM C;  5CA0 E;  3PE0 A;  4EIW A;  2KIN B;  2BDE A;  2QA7 A;  4IIJ E;  1WYB A;  4YJ2 E;  2CE7 A;  2NW9 A;  4UEL A;  3L3P A;  1H7C A;  3MKD A;  2CLY C;  2YIN A;  2JQQ A;  4YFS A;  2VL8 A;  2BVL A;  4EYY R;  1HX8 A;  2KND A;  3PU8 A;  3VKG A;  3GWH A;  3NZP A;  4UVA B;  3DJB A;  5FYM A;  5JH7 E;  2CMR A;  3CQC B;  1V9D A;  1U4Q A;  5L3C B;  4CXX A;  5FY7 A;  2JJ9 A;  3N2G E;  4PK4 A;  2L9Q A;  4O8S A;  5HWX A;  2GK9 A;  1MMN A;  4AKL A;  3CWZ B;  2WMO A;  4PNI A;  5CB4 E;  4DMV A;  5C8Y E;  2DWK A;  3KDS E;  3N9O A;  3LG7 A;  4ASK A;  1OXZ A;  3BQI A;  2C5J A;  2KXP B;  1HS7 A;  3EVY A;  1YKH B;  1OWA A;  2KZ7 B;  2WBL A;  2WM9 A;  3GN5 B;  3ZN1 B;  4PJJ A;  4BAY B;  2C5K T;  3CPZ A;  5LXT E;  4OFZ A;  2Q9Q D;  2OA5 A;  3GMI A;  3S4U A;  4GK5 E;  1EZ3 A;  1HG5 A;  3CX8 B;  3N9Q A;  1LRZ A;  1D0Y A;  4TX5 A;  4MLK A;  3WI3 A;  3PUQ A;  2PBI A;  4QXB B;  4TV8 E;  4MAL A;  2A2F X;  2VAS A;  5IHY A;  4ZI2 C;  2X67 A;  3C4Z A;  3MK7 C;  3MZK B;  5HXC A;  5LJN A;  1BR4 A;  4MHC A;  4BJN A;  2W62 A;  4EZH A;  4CI3 B;  2W63 A;  5FXV A;  4UEM A;  3P7I A;  2V7M A;  5HXE A;  2CM0 A;  5L3D B;  5M4Y A;  3O9X A;  3N9P A;  2KLQ A;  4AQF A;  2N1G A;  5LA6 E;  3UTK A;  3RYF E;  2L8K A;  4X1K E;  4X1I E;  5FMN A;  4XAX B;  3ZEF B;  5JDF A;  4GIW A;  5FY0 A;  3N9L A;  3MJX A;  4JLE A;  1ZKE A;  4EAH A;  3ZMV B;  3BQK A;  4DBR A;  3NRY A;  3CKD A;  3LK4 2;  3NRX A;  4H9N C;  3UFE A;  1WR6 A;  2ZM2 A;  4KMC A;  5LYJ E;  2P9B A;  3LK2 B;  4CXW A;  4ANJ A;  3U3I A;  4OYJ A;  5HAX A;  5BMV E;  3KVB A;  1D1B A;  3ETU A;  5AFU L;  5ADX L;  4EXT A;  4P0A A;  5LHH B;  2XHE B;  3ZLI A;  4M1P A;  3ZC0 A;  3N9N A;  3FXD B;  4ZHQ E;  3RRC A;  1Y64 B;  1D1C A;  4AKI A;  2K5B B;  4HN9 A;  3HKD E;  2K24 A;  2D0T A;  4F6R C;  3LBX A;  4UIG A;  2VK9 A;  4DBQ A;  3PUS A;  1G73 A;  3KIN B;  1IZN B;  3N9M A;  4U72 A;  3J9X 1;  3UUL A;  5LBM A;  2DI4 A;  1G8X A;  2CA5 A;  2LEH A;  2A3D A;  3FHN A;  3KVA A;  3KV4 A;  5L3G B;  3KFW X;  2CWY A;  2X66 A;  4O4H E;  2ODV A;  1BR0 A;  2CLY B;  4DMW A;  2X9H A;  5HXR A;  2X0L B;  4KBM B;  4QHO A;  2CWO A;  1NAF A;  4IDZ A;  1MND A;  2VKD A;  3PDY A;  4ERR A;  2XAQ B;  5LBQ B;  3C98 B;  4HE8 A;  3ZMU B;  2LSK A;  3ZYM A;  5KX5 E;  1D0Z A;  2NW7 A;  3ESL A;  3E08 A;  2CXF A;  4PJL A;  3CX7 B;  2CCQ A;  3ZC1 A;  1WYC A;  3K3O A;  3KV5 A;  3ZCJ A;  1FIO A;  4L9I A;  5EK3 A;  2Q9Q A;  3LBX B;  3I9Y A;  4ADZ A;  3AA7 B;  2XAJ B;  4FI5 A;  5EK2 A;  3ETV A;  3U78 A;  3CX6 B;  3RRW A;  5LHG B;  3FBZ A;  5JR9 C;  5HYA A;  2UXX B;  3O1H A;  2ACX A;  5DQW A;  3GN5 A;  5F3J A;  1LVK A;  3O1J A;  3RC3 A;  4I43 B;  3RX6 A;  4ZOL E;  3V5S A;  4NUV A;  1HG2 A;  4YLH A;  3N5L A;  3ZYK A;  2Y48 B;  2N2N A;  5J2T E;  3EDU A;  3IHR A;  4I50 E;  5JRC A;  2NWB A;  2DCF A;  3PU3 A;  4HKA A;  1BR1 A;  3I0O A;  4IE4 A;  3KBT A;  1U5P A;  4QXH B;  2Q9Q B;  2NP9 A;  4YJ3 E;  4JEU B;  2JMH A;  3WAJ A;  2MYS A;  1LVF A;  1ZEE A;  2RP4 A;  1MNE A;  2JRK A;  2LSG A;  4ZI2 D;  3TKL B;  2HH7 A;  4FJO A;  4C91 A;  3F31 A;  4UVB B;  3ZPO A;  2NTX A;  2DWG A;  2A72 A;  3LJC A;  1UX4 A;  4PFP A;  5CA1 E;  3A5X A;  3C4W A;  1WRD A;  3PTR B;  4L0R A;  4JUY A;  3FXE B;  4PJN A;  3ZMZ B;  4EOZ B;  5JRC B;  2XTL A;  1MIY A;  4O4L E;  3PUG A;  5DAB A;  3AAE B;  3CQX C;  3C51 A;  2WMN A;  3RYC E;  4DO0 A;  2YK0 A;  1UCU A;  4UV8 B;  4WBO A;  1E1H B;  2XAS B;  4A56 A;  2HPL A;  2LOP A;  3VU7 H;  1D1A A;  5FNV E;  3ZCI A;  4QXC B;  4AKG A;  2HPJ A;  1SA0 E;  4C90 A;  5LG4 A;  3KBU A;  2LJL A;  3F2E A;  1NWM X;  4G2A A;  2ES0 A;  3C64 A;  3H3A A;  3CVR A;  4K0U A;  3ZMS B;  5JR9 A;  5EZY E;  1FMW A;  4YHJ A;  2IC9 A;  4ILU A;  3R6N A;  4N78 D;  4X1Y E;  4E7S A;  5JDN A;  2H3R A;  3PUR A;  4EB6 E;  2LSY A;  2NOX A;  2ZM0 A;  4AXP A;  3FB2 A;  4TUY E;  4G63 A;  2VKH A;  3CQG B;  2K9A A;  5ETW A;  4UXN B;  2L3L A;  2J1D G;  2PJQ A;  3UUX B;  2X9X A;  3ONX A;  3P8C D;  1MMG A;  3ZJ1 A;  4CQI A;  5LNK A;  5H6R B;  3HA4 A;  5E0O A;  2XQY A;  4ZS2 A;  5FXX A;  2LM9 A;  5L2L A;  3ZJ2 A;  5JR9 B;  1YKE B;  2EHO C;  4MBQ A;  5EK4 A;  5J2U E;  4P09 A;  5H6Q B;  2MOZ A;  2WSS V;  3RH3 A;  1HTJ F;  2LHR A;  3JC6 C;  3N2O A;  4L5G A;  2DNX A;  4ZI3 C;  5IYZ E;  3UUN A;  3DP7 A;  3ANW A;  2WAU A;  4IE5 A;  2CEA A;  3LK3 B;  2XUE A;  5LCY A;  4ZI7 E;  1ZV4 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...