3D0TA

Structure of the bnb domain of the hsp70 cochaperone bag2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
84
structure length
77
Chain Sequence
SEESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BAG family molecular chaperone regulator 2
publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 37
structure length 77
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3d0tA00
3D0TA 3CQXC
chains in the Genus database with same CATH superfamily
5FNVE 1D1BA 4EEDA 1ZP0A 3O1IA 1W09A 4GYRA 2JMKA 2C5JA 2MPKA 4GKKT 4CXXA 3JCFA 3NRYA 5J1GA 4H9NC 1HFAA 4B3MT 1OWAA 4UVBB 5CFBA 3TLSA 4P0BA 4QH5A 2W67A 3E0ZA 2LSIA 1G73A 4AISA 2X0LB 4HFHA 5FVKA 5LJNA 3RIUA 3AA0B 2JQHA 5FY7A 3AEEA 3CK6A 5HAXA 3PUYF 4NIQA 2PG8A 4U7IA 2X9XA 4AI6A 2H88A 5DQWA 4CN1A 4AQYT 4U31A 4JUYA 5JDHA 3UQ4A 5GONE 5J2UE 3AEAA 4JYAT 4DV6T 2LLYA 2NW9A 1ZHCA 2Y8DA 5FXXA 5FYMA 3NZQA 3I0OA 4MBQA 4UF0B 2XUEA 4QH4A 3IEEA 1WR0A 2WY2A 5FXVA 2UXBT 2IIUA 5EK4A 2LJLA 4A97A 5LOVE 3UT5E 3PTRB 2BS2A 2WU2A 3N2KE 4I50E 1HX1B 5AQUB 3K1SA 5IYZE 1YQ3A 5C3JA 4IL9A 1N33T 3KVAA 1SUMB 3FZMB 3LDQB 4ZI3D 4QXHB 3VR9A 4DR3T 4LFCT 5LXTE 4F6RC 2BG9E 3EUHA 3IA3A 1U4QA 4IE5A 4JI2T 5HXCA 4IIJE 4HFDA 3NKZA 5AQQB 3KBUA 4HN9A 5JR9B 2LHRA 2XAQB 4YSZA 3Q9DA 1UURA 4HFCA 1YXRA 1B7TA 2NTYA 3ZYLA 2RP4A 2V6YB 4LFBT 3AVRA 3OBVE 3WAKA 1WYBA 2E9XD 3RQUA 4LF6T 4DUZT 2KXPB 5J2TE 2LOSA 3RC8A 2KZ7B 4EOZB 3QC9A 4J2CA 2OV9A 4NUUA 4QH1A 5IUXA 4HFEA 4DV3T 4HWHA 1HS7A 3RH3A 2E2AA 5JVDE 1OEDC 2CLYC 2LKHA 2QVAA 3PDYA 2A72A 3RX6A 4IHJE 1MMGA 2V5CA 3VKGA 2WB5A 3QUJA 1XDOA 2YDSA 3PUQA 4HFIA 2RA1A 2FJBA 2UXXB 3KV4A 5L2LA 2A2FX 2LE8A 5AQPB 2V5DA 2JJ9A 2LSJA 3FZLB 4Q25A 5JREA 5DABA 3Q2MA 2EHOD 2XTLA 4PFOA 4YJ3E 4O4LE 4GYSA 2KWHA 3T8OA 3N5LA 2UUBT 2V6XA 2LHNA 2YKSA 4H9PC 5LBQB 3PJAJ 3TLTA 5JDGA 3ZC1A 4QXCB 4GKJT 4ZI2C 1XZYA 3J9X1 4DV1T 5AQMB 2LRKA 3LSVA 2PBIA 3ZJ2A 2UU9T 3NWIA 3DP7A 1MMNA 2V26A 1O3XA 4AKRB 2BBJA 2VWAA 4A56A 1S35A 3I9YA 3ZYMA 1MMAA 3EDUA 2YDQA 2UXDT 2K48A 2XQAA 4EIWA 2CXDA 4HKAA 5IWAT 5LNKA 2BBHA 2I0MA 2VKOA 1J5WA 2XQ6A 2XPKA 4HFVA 2XM1A 5L3EB 4BJMA 3PUGA 4U2ZA 2QYWA 2KINB 5BR8T 1ZKEA 2P9BA 2RPAA 3ZLIA 1XMOT 4DO0A 2ODUA 1D0YA 1UUSA 4X1IE 3MXZA 4JI3T 2N2NA 2BG9B 4OK0A 3RHWA 2F4VT 1S94A 1E2AA 3H3AA 4XBFB 2FJDA 2W61A 3U78A 4G63A 4YLHA 1D0ZA 5HYAA 2JRKA 3HKDE 2E5LT 3U3IA 4AXPA 3PUVF 3P7IA 5LMUT 4IREA 4U72A 2XSBA 2IMLA 4PK6A 3RYIE 4UELA 4QKNA 1OEDA 2WZIA 5KXJA 2N1GA 3ZC0A 1E1HB 3G06A 3HKEE 5ABGA 5LG4A 3C4XA 4B6XA 2IHR1 4LFAT 2NR4A 3P4PA 4YT0A 4AKIA 3BK9A 2WBLA 1IJ5A 5L4EA 2E9XB 1QSDA 2D0TA 4LF7T 4WNKA 3RIUC 2XQ5A 3KINB 3N9PA 1MIYA 5EK2A 3SWHA 2MAWA 4X1YE 4ANJA 1KFYA 3WI3A 4P09A 3FHNA 2D0UA 3BQIA 4QX7B 1OEDE 2WSSV 2X9WA 2V7JA 2X51A 3ZCJA 2WMNA 2NWBA 1FIOA 2ZMAA 5LHGB 2ACZA 3AE3A 5C8YE 4KHPT 5L3FB 5ABFA 3UUBA 2LRLA 2AE9A 4EEBA 2Q9QA 4Z90A 4EZ4A 1U5PA 2EHOB 5L3DB 4JI6T 3FXDB 1IZNB 3F2EA 5HCJA 5FY1A 4AQGA 2H7OA 3ZN1B 4O4JE 1T72A 2E8IA 3LBXB 5HEJA 5JDFA 4H63V 4F8HA 5TAOA 5HEHA 1UX4A 1UGOA 1BR2A 3UQ7A 2WU5A 2K5BB 1X9BA 2OLTA 5FKYA 3HR0A 3PURA 2CBIA 4B3TT 1T8BA 2C0SA 4JBWF 1BR1A 3AE8A 4O2AE 2HN2A 4ILAA 3K3OA 3OYZA 4COFA 5AQOB 3OJAA 3MZKB 2BKOA 2XAJB 2PFVA 2M67A 1Y64B 4KUMB 4WW0A 3PUXF 4ILBA 4DR7T 4QHOA 2LT3A 4DV2T 2BKPA 5FXWA 4O4IE 3B5MA 4LF5T 1W9RA 2VKJA 4Z91A 3I9WA 1GQEA 2JPFA 2A9UA 2XSAA 3ZYKA 3JC6C 4DBRA 2CHOA 2MYSA 2J4GA 4HWIB 3FZFB 2I6HA 2GK9A 1XNQT 2XQYA 3GN5A 4PJJA 2N9DA 3RRWA 2G0UA 1NENA 3PJAA 4KP3C 4UEMA 4LF4T 2FJEA 2QGSA 5ADXL 2VKHA 1VCSA 5AFUL 2VURA 3N9OA 3UU6A 2BVMA 5L3GB 1W0AA 3P4SA 1MIWA 2XZEA 4YTPA 3N9LA 1OEDB 1I94T 1OXZA 3ESLA 2KWIB 3KV6A 2DWKA 3A8YC 4WBNE 3RYHE 2IUBA 3AA7B 3K3NA 4ZZCA 3M3ZB 5FMNA 3LG7A 3L39A 5LCYA 4DNDA 3P8CD 3NVOA 2WWVA 3S4UA 4HWDA 5LYJE 2YU1A 4H9QC 4TWHA 4XAXB 2V7MA 1XWMA 2VL8A 4TWFA 2YINA 1XDPA 3UULA 1US7B 4LF9T 2R6GF 1MNEA 5F3JA 3JADA 2KNDA 3UUNA 2PJQA 1HG2A 1J5ET 2VQET 5CGMA 1LKXA 3AE5A 4PNIA 1WCRA 5EZYE 2JQKA 4FI5A 3JAFA 2H3RA 4HWFA 5LGUB 4QWNB 4E7SA 2W0GA 1W0BA 1YKHB 3RKOA 3FZHB 4WBOA 3ZMVB 5LGTB 1HNXT 3ZMUB 4OX9T 2K9AA 2W62A 4YSXA 5LP6E 4DR4T 5HEOA 2ZM6T 2D2SA 2XQ9A 2Y48B 3ZCIA 4JI4T 3AECA 1IBKT 2LM9A 3ANWA 2V7KA 2V7LA 5AQVB 3ZKRA 2CRBA 5LB7B 1N34T 4H9OC 5JRCB 4JI1T 2D9DA 1N32T 3LJCA 4EB6E 4DBQA 4QX8B 3CVRA 4V1Av 4CZZB 4U33A 3ZT7A 1UK5A 5CJ5A 3AXJB 1MIVA 2QRXA 2CXLA 3C98B 2LSYA 2VQFT 3AE6A 3OKQA 5LMNT 4HEAA 2WMOA 2BDEA 4O8SA 3ONXA 1E7PA 4CI1B 2Z6EA 2UXNB 3M65A 3NRXA 5HXHA 3AVSA 3QNUA 3TLVA 1QUUA 2WQYA 2CE7A 3RKGA 1D0XA 5FL0A 4ZI7E 2JMHA 4UVCB 2MBGA 2KT9A 3AEBA 4IDNA 1HF8A 3SOLA 5JDQA 4DV7T 5JR9C 5JDNA 3T1YT 1SHZC 3PE0A 3ABVA 2Q9QC 2YDRA 3VRAA 1M62A 2YEVC 4ISTA 4ZOLE 5HWXA 3P4QA 2Y6XA 3Q5EA 3SRZA 2M6BA 1R8IA 4UIGA 1BR4A 2SPCA 4M1PA 3GN5B 3CQXC 1LVKA 4U7YA 3RF1A 4IDPA 3NBXX 4IE4A 4I4TE 2W63A 4HWCA 4JEHB 2B76A 3E22E 3UUXB 4CI3B 3EAMA 3PUAA 1YKEB 2V7IA 3J7Yq 3ZSSA 4IT4A 3AE4A 3W15B 5HXEA 1N36T 1WR6A 2NTXA 3HL6A 2CBJA 4AKLA 2NW8A 4DVDA 4YTNA 3CQCB 3RLFF 4PJMA 5EK3A 2J1DG 4DR5T 4UF0A 4CXYA 4X62T 2BS3A 3TKLB 3I1AA 4MFRA 5AQFB 1KNRA 3CKDA 5KMGP 4ILCA 5JTGA 3PUWF 1H7CA 2PTFA 4OYKA 5HEGA 5JDLA 1VCTA 1FJGT 1ZV4X 3ZEFB 2LSGA 1UCUA 2IC6A 4YXDA 4L0RA 3PUSA 3ZN0B 4EV6A 5AQJB 3B13A 3MACA 3AAEB 1HNWT 4JI8T 2X0YA 4H63H 3RIFA 4MALA 5AQIB 3EHZA 3C4ZA 4NPPA 3V5UA 5JDMA 4IE6A 2CWYA 3FXEB 5KX5E 1M7KA 3ZPOA 5DQVA 2LOPA 3RQWA 3DJBA 2OA5A 3UU8A 5JR9A 3ANWB 2W66A 3OVUA 4B3ST 2V1DB 3SS1A 5CA0E 4HTEA 4ZI2D 3O1JA 2V6YA 4AQFA 1Z0PA 3FBZA 3BQKA 3AE2A 5H6QB 3AE1A 4A98A 3F57A 4PJLA 4X5TA 1WFDA 4Z8XA 2UUAT 4P1NA 4YTMA 4ZI3C 2XQ4A 3I0QA 4ZS3A 3ONJA 2HH7A 2CA5A 2W4XA 1MMDA 3L09A 2LSKA 1G8XA 2DL1A 5LA6E 3RI5A 3T1HT 5DJQC 2CM0A 4U3CA 3VKHA 4H9SE 3L3PA 2XAGB 3GWHA 3DTOA 3CPZA 5KDMC 4CXWA 1HG5A 1HNZT 2VL0A 3R6NA 4MLKA 2XQ8A 3IF8B 4IE7A 5A1LA 3OTOT 2E9XC 1KNPA 4DMWA 4KHZF 3C4WA 2YOEA 2CMRA 4X20E 3RYCE 3LK3B 4EAHA 3RYFE 1SA0E 4ZXLA 2KMFA 4OYJA 4PFPA 2YN6A 1IBLT 3AAAB 4HE8A 3N2GE 2W00A 4DR2T 4L5GA 3Q5DA 3V5SA 2BS4A 2XAFB 2ACXA 4AKGA 3BQLA 5HCMA 3UFEA 5LHIB 3K8PC 2ZM0A 4A5XA 2WS3A 4H9RC 3ZSTA 4TZ4C 4QXBB 2CHNA 3R84B 2CPTA 4ZHQE 4BJNA 3AAIA 2WDQA 2J47A 1WLXA 2X67A 1XMQT 5AQRB 4JI0T 1ZEEA 4TX5A 5L47A 2EHOC 4LMKA 4YHJA 5HEUA 1FMWA 1KNZA 4TN7B 2DWGA 1IAPA 3AB3B 4IL4A 3B57A 3RRCA 3P4RA 2X9YA 2BG9A 1SE7A 3ETUA 4GIWA 2CLYB 1AJ3A 4E7ZA 2X66A 3NZPA 3QB5K 4HGAA 3C51A 4PAGA 5ABHA 4KX6A 2FBWA 4ISSA 3UU4A 2BVLA 1IJ6A 3UUMA 4DV0T 2NOXA 2WAUA 2XQ7A 4PK5A 5HXSA 4K0KT 4AKHA 3L8RA 1BR0A 4UV8B 3WAJA 2DCFA 1FMVA 1EZ3A 2IC9A 4YJ2E 5AQTB 3ZMSB 3N9QA 4IDOA 5H6RB 3ZJ1A 3EDVA 4DR1T 4GK5E 2VKDA 2WM9A 2HPLA 2H7VC 4KBMB 3D0TA 3O9XA 5AQLB 4B3RT 4EXTA 3E08A 5ABEA 1JNRA 1LVFA 5LG3A 2JIWA 2E9XA 3CIRA 5ABFB 4EYUA 3AEFA 2HPJA 1IBMT 3UTKA 4NUVA 2Q9QB 4YHHT 3KDSE 3IHRA 1Y01A 4N78D 3A7MA 4U2YA 2HHHT 5HXRA 1CUNA 3KFWX 4TNWA 3ETVA 3EI0A 1WRDA 4KI0F 4ILUA 2CCQA 3MK7C 3PU3A 3O4XE 4XZCA 3ZMTB 1NAFA 2BKNA 4DIDB 1KK7A 5FP3A 2L8KA 4HFBA 2VB6A 3RGLA 4C90A 3HI2A 2NP9A 3Q5XA 1MNDA 2EHOA 2ZM2A 4GK0E 3UU5A 3VRBA 4UXNB 2IW5B 3OPCA 3GA8A 3N2OA 4I43B 3JC6D 2LKGA 3FB2A 1KF6A 4ZZBA 4JI5T 4I55E 1L0VA 4WZXA 1VRBA 3CX8B 3H37A 3LBXA 1HX8A 2CWOA 2K24A 4DV4T 3K3QC 2NW7A 4IE0A 4IDZA 5HWYA 3X1DA 1HR0T 1YD8G 1LRZA 4JI7T 4EZHA 4UV9B 1D1AA 2XAHB 2B1EA 2IAKA 3PU8A 5LHHB 4ERRA 1NWMX 4TV8E 5L4HA 2FUPA 4OHFA 2JQQA 3CWZB 4PJNA 2CXFA 3LK2B 1HTJF 4PW8A 2I59A 3CX6B 2H89A 5FY0A 3ZMZB 5ETWA 3Q5WA 2XASB 3RPUA 2XQ3A 3ZT5A 2C5IT 2BZBA 5BMVE 3PUZF 4CN6A 2HN1A 4AQFC 2WDVA 2QA7A 1ZOYA 2WDRA 4CQIA 2YK0A 2ZM8A 3ONLC 3AA1B 4NXNT 2XHEB 5AQKB 4L9IA 5L3CB 3UU3A 3AE7A 3GMIA 4AIUA 4YY3T 4TWDA 4UR9A 3TLWA 2LM2A 3AE9A 2KLQA 1D1CA 2KSRA 1NEKA 3QB5A 1CHUA 3MJXA 2YU2A 2UUCT 3RC3A 3RIAA 4OFZA 3N9NA 3UFGA 5M4YA 1JNZA 2M6IA 3P50A 2C5KT 2MTQA 3H3MA 4C91A 3OYXA 3N9MA 4ZEYA 2X68A 2X9HA 2ES0A 2E5VA 1DU2A 4LF8T 4ASKA 4WYVA 4P0AA 3KBTA 4LMLA 3HA4A 4JEUB 4ZS2A 3HKBE 1FEWA 4IDQA 2WP9A 2A3DA 3KV5A 2DNXA 4K0UA 3KV9A 4X66T 5FVLA 3P4WA 5AQHB 3JAEA 2K3WA 2J62A 1WYCA 5IHYA 2WWUA 2VVNA 3CX7B 3A5XA 1T7SA 3QK6A 1XNRT 3LK42 3KVBA 2UXCT 3C64A 4BA9A 4NXMT 4ADZA 4BAYB 4G2AA 2JQ9A 4CN4A 4O4HE 4X1KE 5C2TA 2VASA 4MHCA 4IGUA 4EGWA 4X65T 4YSYA 1YW0A 2LEHA 2D5UA 4GOUA 3AA6B 4PK4A 4FJOA 5CB4E 2DHRA 4JV5T 1Z8UA 4U74A 1KEYA 2L9QA 4TUYE 5FL1A 2BG9C 2IDOB 1YQ4A 3CQGB 2XY8B 1VOMA 2X0HA 5E0OA 1X79A 3MA9A 2ODVA 3VHLA 4EYYR 2FJAA 2WCAA 4DR6T 1V9DA 5LGNB 4I0UA 3VR8A 2Q9QD 1UX5A 2ZLYA 5AQSB 2L3LA 1I6ZA 3FZKB 4TNVA 4YFSA 4DMVA 2AXDS 2WZHA 4KMCA 2XJ7A 3IBPA 4LMJA 3EABA 4TV9E 5JRCA 3PV0F 2DLRA 2CEAA 4DV5T 3HKCE 1QLBA 5F5WA 1T98A 3AEDA 5LJMA 4CI2B 1HCIA 3F31A 3QOFA 4JLEA 3MKDA 5CA1E 3SFDA 5AQGB 4DUYT 5FXZA 2XM2A 5AQNB 3EVYA 5JH7E 1J1JA 3AXJA 3AEGA 4X64T 3CMLA 2W2UA 3TLUA 2DI4A 3VU7H 4O2BE 5L3BB 3LFMA 2MOZA 2VVSA 2V8SV 5JQGE 5LBMA 4UVAB 3SFEA 5F8PA 3ZT6A 3O1HA 3FBLA 2VK9A 5J0ZA 3C50A
chains in the Genus database with same CATH topology
1QSDA 2H7VC 2D0TA 5FNVE 4KBMB 1D1BA 3D0TA 3O9XA 4WNKA 2KT9A 1HF8A 3O1IA 3SOLA 4EXTA 4GYRA 2JMKA 5JDQA 3E08A 2C5JA 5JR9C 3KINB 4CXXA 1LVFA 3NRYA 3N9PA 1MIYA 5J1GA 5EK2A 1SHZC 3PE0A 4H9NC 3SWHA 2Q9QC 1HFAA 5JDNA 4X1YE 4ANJA 2E9XA 2YEVC 3WI3A 4P09A 4ISTA 4EYUA 1OWAA 3FHNA 4UVBB 2D0UA 3BQIA 4QX7B 4ZOLE 5HWXA 2HPJA 2Y6XA 2WSSV 2X9WA 3UTKA 2V7JA 2X51A 4P0BA 3SRZA 3ZCJA 4NUVA 2WMNA 2NWBA 1FIOA 2Q9QB 3E0ZA 2ZMAA 3KDSE 4UIGA 3IHRA 1BR4A 4N78D 2SPCA 4M1PA 5LHGB 2LSIA 1G73A 5C8YE 2X0LB 5L3FB 5HXRA 3GN5B 3CQXC 5LJNA 1LVKA 3AA0B 1CUNA 3KFWX 5FY7A 3ETVA 2Q9QA 5HAXA 1WRDA 2PG8A 3NBXX 4IE4A 4ILUA 2X9XA 2CCQA 4EZ4A 4AI6A 1U5PA 3MK7C 2EHOB 3PU3A 3O4XE 4I4TE 4XZCA 5DQWA 2W63A 5L3DB 3ZMTB 1NAFA 4JEHB 3FXDB 1IZNB 3E22E 1KK7A 4JUYA 5FP3A 3UUXB 4CI3B 5JDHA 2L8KA 5GONE 3F2EA 2VB6A 3PUAA 5J2UE 4C90A 3HI2A 2NP9A 5FY1A 4AQGA 1YKEB 3Q5XA 2H7OA 3ZN1B 1MNDA 2EHOA 2NW9A 2ZM2A 1ZHCA 2V7IA 2Y8DA 4GK0E 3J7Yq 4O4JE 5FXXA 5FYMA 3NZQA 2E8IA 3LBXB 5JDFA 3I0OA 4H63V 4MBQA 4UXNB 3W15B 2IW5B 5HXEA 4UF0B 3GA8A 2XUEA 5TAOA 3N2OA 1UX4A 3IEEA 1WR6A 2NTXA 4I43B 3HL6A 3JC6D 5FXVA 1BR2A 3FB2A 5EK4A 2LJLA 5LOVE 2K5BB 3UT5E 4AKLA 2NW8A 3PTRB 4I55E 4DVDA 1VRBA 3CQCB 3CX8B 3H37A 3N2KE 3HR0A 4PJMA 5EK3A 3LBXA 3PURA 1HX8A 2J1DG 2CWOA 2K24A 4I50E 4UF0A 3K3QC 5IYZE 4CXYA 2NW7A 4IE0A 4IDZA 3TKLB 3I1AA 4MFRA 5HWYA 3CKDA 2C0SA 5KMGP 1YD8G 1LRZA 1BR1A 3KVAA 1H7CA 4O2AE 4EZHA 4ZI3D 4UV9B 3K3OA 1D1AA 3OYZA 4OYKA 2XAHB 4QXHB 3OJAA 2B1EA 2IAKA 3MZKB 5JDLA 1ZV4X 3ZEFB 5LXTE 2XAJB 3PU8A 4F6RC 2LSGA 1UCUA 5LHHB 4ERRA 1NWMX 2PFVA 2IC6A 4TV8E 3EUHA 4OHFA 4L0RA 2JQQA 2M67A 3CWZB 4PJNA 2CXFA 3PUSA 3LK2B 1HTJF 1U4QA 4PW8A 3ZN0B 2I59A 1Y64B 3CX6B 4IE5A 5FY0A 3ZMZB 4KUMB 5ETWA 3Q5WA 4WW0A 5HXCA 2XASB 4IIJE 3RPUA 3B13A 3KBUA 3MACA 4QHOA 3AAEB 2LT3A 2C5IT 2BZBA 4H63H 5FXWA 5BMVE 4MALA 3C4ZA 4HN9A 3V5UA 5JDMA 4AQFC 5JR9B 4IE6A 2CWYA 4O4IE 2LHRA 2QA7A 2XAQB 3FXEB 5KX5E 4CQIA 3Q9DA 2YK0A 2ZM8A 3AA1B 3ZPOA 2VKJA 2XHEB 3I9WA 5DQVA 2JPFA 4L9IA 5L3CB 1B7TA 3ZYKA 2LOPA 2NTYA 3ZYLA 2RP4A 3DJBA 3GMIA 2OA5A 3JC6C 4DBRA 2MYSA 3AVRA 3OBVE 5JR9A 3ANWB 3WAKA 1WYBA 2E9XD 2V1DB 3SS1A 2KXPB 5CA0E 5J2TE 4HTEA 4ZI2D 2LOSA 2GK9A 2KLQA 3RC8A 1D1CA 2XQYA 2KZ7B 3GN5A 4PJJA 3O1JA 3QC9A 4J2CA 4EOZB 2N9DA 3MJXA 4AQFA 1Z0PA 3FBZA 3RRWA 2YU2A 3RC3A 3BQKA 2G0UA 4OFZA 3N9NA 5H6QB 4NUUA 5M4YA 3F57A 4PJLA 4KP3C 4Z8XA 4UEMA 1HS7A 3RH3A 2C5KT 2MTQA 2QGSA 4ZI3C 5ADXL 5JVDE 2VKHA 2CLYC 3I0QA 5AFUL 4ZS3A 4C91A 3N9OA 3OYXA 3PDYA 2A72A 2BVMA 2HH7A 3RX6A 3N9MA 4IHJE 5L3GB 1MMGA 2CA5A 2X68A 2X9HA 1MMDA 3VKGA 3QUJA 2ES0A 3L09A 2LSKA 1G8XA 1MIWA 3PUQA 5LA6E 4ASKA 4P0AA 2RA1A 4UVCB 3N9LA 3KBTA 2UXXB 3KV4A 1OXZA 5L2LA 2A2FX 3ESLA 2LE8A 3HA4A 4JEUB 2JJ9A 4ZS2A 2KWIB 3HKBE 3KV6A 1FEWA 2LSJA 2DWKA 5DJQC 2A3DA 4WBNE 3RYHE 3KV5A 2DNXA 5DABA 5JREA 3AA7B 2CM0A 3K3NA 3Q2MA 2EHOD 5FMNA 3LG7A 3VKHA 2XTLA 4H9SE 4K0UA 4PFOA 3KV9A 3L3PA 4YJ3E 2XAGB 3GWHA 4O4LE 4GYSA 3DTOA 3CPZA 2KWHA 5LCYA 4DNDA 3T8OA 3P8CD 5KDMC 3N5LA 4CXWA 1HG5A 1WYCA 3R6NA 4MLKA 2LHNA 5IHYA 3S4UA 4IE7A 3IF8B 5A1LA 2WWUA 5LYJE 2YU1A 3CX7B 4H9QC 4H9PC 3A5XA 5LBQB 2E9XC 4XAXB 2V7MA 4DMWA 3C4WA 2VL8A 3QK6A 2CMRA 5JDGA 2YINA 4X20E 3RYCE 3ZC1A 3LK42 3UULA 3KVBA 3LK3B 4QXCB 4ZI2C 3J9X1 3C64A 4BA9A 1US7B 4EAHA 3RYFE 1SA0E 4ADZA 1MNEA 2PBIA 5F3JA 3ZJ2A 2KNDA 3UUNA 4BAYB 2KMFA 2PJQA 4G2AA 1HG2A 3DP7A 4OYJA 4O4HE 1MMNA 4PFPA 4X1KE 2V26A 1O3XA 1LKXA 4AKRB 3AAAB 2VWAA 4HE8A 4PNIA 4A56A 3N2GE 2VASA 4MHCA 5EZYE 2W00A 4IGUA 4L5GA 4FI5A 1S35A 2H3RA 1YW0A 2LEHA 3I9YA 3ZYMA 3V5SA 1MMAA 3EDUA 5LGUB 2D5UA 2K48A 2XAFB 4GOUA 2ACXA 4QWNB 4E7SA 4AKGA 2W0GA 3AA6B 3BQLA 1YKHB 4EIWA 2CXDA 4HKAA 4PK4A 3UFEA 5LHIB 5LNKA 3RKOA 3K8PC 2ZM0A 4FJOA 4WBOA 3ZMVB 5LGTB 5CB4E 3ZMUB 2DHRA 4H9RC 2VKOA 4TZ4C 4HFVA 2K9AA 2W62A 4QXBB 4U74A 3R84B 5L3EB 4BJMA 3PUGA 2L9QA 4TUYE 4ZHQE 2KINB 4BJNA 5LP6E 1ZKEA 2P9BA 3AAIA 1WLXA 2X67A 2D2SA 3CQGB 2Y48B 3ZCIA 1ZEEA 3ZLIA 1VOMA 4DO0A 2ODUA 4TX5A 2EHOC 5E0OA 1D0YA 2LM9A 1X79A 3MA9A 4X1IE 4YHJA 3ANWA 3MXZA 2ODVA 2V7KA 2N2NA 2V7LA 3VHLA 4EYYR 1FMWA 4OK0A 1KNZA 4TN7B 1S94A 2DWGA 1V9DA 1IAPA 4H9OC 3AB3B 5JRCB 5LGNB 3H3AA 4XBFB 3B57A 2W61A 2Q9QD 3U78A 3LJCA 3RRCA 1UX5A 2ZLYA 4G63A 4YLHA 2L3LA 4EB6E 1D0ZA 4DBQA 2X9YA 5HYAA 2JRKA 4QX8B 3HKDE 3CVRA 4V1Av 4YFSA 4DMVA 3ETUA 4KMCA 4CZZB 4GIWA 2CLYB 1AJ3A 3IBPA 4E7ZA 4TV9E 5JRCA 3U3IA 2DLRA 2CEAA 2X66A 3HKCE 4AXPA 3P7IA 3NZPA 1T98A 4HGAA 4U72A 3C51A 4PAGA 1MIVA 5LJMA 4CI2B 2CXLA 1HCIA 3F31A 4PK6A 3C98B 4ISSA 4UELA 4JLEA 3RYIE 2BVLA 1IJ6A 3UUMA 3MKDA 5CA1E 2NOXA 2WAUA 2LSYA 4QKNA 5FXZA 4PK5A 5HXSA 3OKQA 3EVYA 2N1GA 3ZC0A 4AKHA 1E1HB 5JH7E 4HEAA 2WMOA 1BR0A 3CMLA 2BDEA 4UV8B 2DI4A 3HKEE 4O8SA 3VU7H 3ONXA 4O2BE 5L3BB 5LG4A 4CI1B 3LFMA 3WAJA 2DCFA 1FMVA 1EZ3A 2IC9A 3C4XA 2Z6EA 4B6XA 2UXNB 4YJ2E 3M65A 3NRXA 2MOZA 3ZMSB 3N9QA 5HXHA 5JQGE 5H6RB 4AKIA 3AVSA 5LBMA 3BK9A 3ZJ1A 2WBLA 3EDVA 4UVAB 4GK5E 1IJ5A 1QUUA 5F8PA 2CE7A 1D0XA 2VKDA 2WM9A 3O1HA 3FBLA 2VK9A 2HPLA 4ZI7E 2E9XB 2JMHA 3C50A 2MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D0T A;  3CQX C; 
#chains in the Genus database with same CATH topology
 5FNV E;  1D1B A;  4EED A;  1ZP0 A;  3O1I A;  1W09 A;  4GYR A;  2JMK A;  2C5J A;  2MPK A;  4GKK T;  4CXX A;  3JCF A;  3NRY A;  5J1G A;  4H9N C;  1HFA A;  4B3M T;  1OWA A;  4UVB B;  5CFB A;  3TLS A;  4P0B A;  4QH5 A;  2W67 A;  3E0Z A;  2LSI A;  1G73 A;  4AIS A;  2X0L B;  4HFH A;  5FVK A;  5LJN A;  3RIU A;  3AA0 B;  2JQH A;  5FY7 A;  3AEE A;  3CK6 A;  5HAX A;  3PUY F;  4NIQ A;  2PG8 A;  4U7I A;  2X9X A;  4AI6 A;  2H88 A;  5DQW A;  4CN1 A;  4AQY T;  4U31 A;  4JUY A;  5JDH A;  3UQ4 A;  5GON E;  5J2U E;  3AEA A;  4JYA T;  4DV6 T;  2LLY A;  2NW9 A;  1ZHC A;  2Y8D A;  5FXX A;  5FYM A;  3NZQ A;  3I0O A;  4MBQ A;  4UF0 B;  2XUE A;  4QH4 A;  3IEE A;  1WR0 A;  2WY2 A;  5FXV A;  2UXB T;  2IIU A;  5EK4 A;  2LJL A;  4A97 A;  5LOV E;  3UT5 E;  3PTR B;  2BS2 A;  2WU2 A;  3N2K E;  4I50 E;  1HX1 B;  5AQU B;  3K1S A;  5IYZ E;  1YQ3 A;  5C3J A;  4IL9 A;  1N33 T;  3KVA A;  1SUM B;  3FZM B;  3LDQ B;  4ZI3 D;  4QXH B;  3VR9 A;  4DR3 T;  4LFC T;  5LXT E;  4F6R C;  2BG9 E;  3EUH A;  3IA3 A;  1U4Q A;  4IE5 A;  4JI2 T;  5HXC A;  4IIJ E;  4HFD A;  3NKZ A;  5AQQ B;  3KBU A;  4HN9 A;  5JR9 B;  2LHR A;  2XAQ B;  4YSZ A;  3Q9D A;  1UUR A;  4HFC A;  1YXR A;  1B7T A;  2NTY A;  3ZYL A;  2RP4 A;  2V6Y B;  4LFB T;  3AVR A;  3OBV E;  3WAK A;  1WYB A;  2E9X D;  3RQU A;  4LF6 T;  4DUZ T;  2KXP B;  5J2T E;  2LOS A;  3RC8 A;  2KZ7 B;  4EOZ B;  3QC9 A;  4J2C A;  2OV9 A;  4NUU A;  4QH1 A;  5IUX A;  4HFE A;  4DV3 T;  4HWH A;  1HS7 A;  3RH3 A;  2E2A A;  5JVD E;  1OED C;  2CLY C;  2LKH A;  2QVA A;  3PDY A;  2A72 A;  3RX6 A;  4IHJ E;  1MMG A;  2V5C A;  3VKG A;  2WB5 A;  3QUJ A;  1XDO A;  2YDS A;  3PUQ A;  4HFI A;  2RA1 A;  2FJB A;  2UXX B;  3KV4 A;  5L2L A;  2A2F X;  2LE8 A;  5AQP B;  2V5D A;  2JJ9 A;  2LSJ A;  3FZL B;  4Q25 A;  5JRE A;  5DAB A;  3Q2M A;  2EHO D;  2XTL A;  4PFO A;  4YJ3 E;  4O4L E;  4GYS A;  2KWH A;  3T8O A;  3N5L A;  2UUB T;  2V6X A;  2LHN A;  2YKS A;  4H9P C;  5LBQ B;  3PJA J;  3TLT A;  5JDG A;  3ZC1 A;  4QXC B;  4GKJ T;  4ZI2 C;  1XZY A;  3J9X 1;  4DV1 T;  5AQM B;  2LRK A;  3LSV A;  2PBI A;  3ZJ2 A;  2UU9 T;  3NWI A;  3DP7 A;  1MMN A;  2V26 A;  1O3X A;  4AKR B;  2BBJ A;  2VWA A;  4A56 A;  1S35 A;  3I9Y A;  3ZYM A;  1MMA A;  3EDU A;  2YDQ A;  2UXD T;  2K48 A;  2XQA A;  4EIW A;  2CXD A;  4HKA A;  5IWA T;  5LNK A;  2BBH A;  2I0M A;  2VKO A;  1J5W A;  2XQ6 A;  2XPK A;  4HFV A;  2XM1 A;  5L3E B;  4BJM A;  3PUG A;  4U2Z A;  2QYW A;  2KIN B;  5BR8 T;  1ZKE A;  2P9B A;  2RPA A;  3ZLI A;  1XMO T;  4DO0 A;  2ODU A;  1D0Y A;  1UUS A;  4X1I E;  3MXZ A;  4JI3 T;  2N2N A;  2BG9 B;  4OK0 A;  3RHW A;  2F4V T;  1S94 A;  1E2A A;  3H3A A;  4XBF B;  2FJD A;  2W61 A;  3U78 A;  4G63 A;  4YLH A;  1D0Z A;  5HYA A;  2JRK A;  3HKD E;  2E5L T;  3U3I A;  4AXP A;  3PUV F;  3P7I A;  5LMU T;  4IRE A;  4U72 A;  2XSB A;  2IML A;  4PK6 A;  3RYI E;  4UEL A;  4QKN A;  1OED A;  2WZI A;  5KXJ A;  2N1G A;  3ZC0 A;  1E1H B;  3G06 A;  3HKE E;  5ABG A;  5LG4 A;  3C4X A;  4B6X A;  2IHR 1;  4LFA T;  2NR4 A;  3P4P A;  4YT0 A;  4AKI A;  3BK9 A;  2WBL A;  1IJ5 A;  5L4E A;  2E9X B;  1QSD A;  2D0T A;  4LF7 T;  4WNK A;  3RIU C;  2XQ5 A;  3KIN B;  3N9P A;  1MIY A;  5EK2 A;  3SWH A;  2MAW A;  4X1Y E;  4ANJ A;  1KFY A;  3WI3 A;  4P09 A;  3FHN A;  2D0U A;  3BQI A;  4QX7 B;  1OED E;  2WSS V;  2X9W A;  2V7J A;  2X51 A;  3ZCJ A;  2WMN A;  2NWB A;  1FIO A;  2ZMA A;  5LHG B;  2ACZ A;  3AE3 A;  5C8Y E;  4KHP T;  5L3F B;  5ABF A;  3UUB A;  2LRL A;  2AE9 A;  4EEB A;  2Q9Q A;  4Z90 A;  4EZ4 A;  1U5P A;  2EHO B;  5L3D B;  4JI6 T;  3FXD B;  1IZN B;  3F2E A;  5HCJ A;  5FY1 A;  4AQG A;  2H7O A;  3ZN1 B;  4O4J E;  1T72 A;  2E8I A;  3LBX B;  5HEJ A;  5JDF A;  4H63 V;  4F8H A;  5TAO A;  5HEH A;  1UX4 A;  1UGO A;  1BR2 A;  3UQ7 A;  2WU5 A;  2K5B B;  1X9B A;  2OLT A;  5FKY A;  3HR0 A;  3PUR A;  2CBI A;  4B3T T;  1T8B A;  2C0S A;  4JBW F;  1BR1 A;  3AE8 A;  4O2A E;  2HN2 A;  4ILA A;  3K3O A;  3OYZ A;  4COF A;  5AQO B;  3OJA A;  3MZK B;  2BKO A;  2XAJ B;  2PFV A;  2M67 A;  1Y64 B;  4KUM B;  4WW0 A;  3PUX F;  4ILB A;  4DR7 T;  4QHO A;  2LT3 A;  4DV2 T;  2BKP A;  5FXW A;  4O4I E;  3B5M A;  4LF5 T;  1W9R A;  2VKJ A;  4Z91 A;  3I9W A;  1GQE A;  2JPF A;  2A9U A;  2XSA A;  3ZYK A;  3JC6 C;  4DBR A;  2CHO A;  2MYS A;  2J4G A;  4HWI B;  3FZF B;  2I6H A;  2GK9 A;  1XNQ T;  2XQY A;  3GN5 A;  4PJJ A;  2N9D A;  3RRW A;  2G0U A;  1NEN A;  3PJA A;  4KP3 C;  4UEM A;  4LF4 T;  2FJE A;  2QGS A;  5ADX L;  2VKH A;  1VCS A;  5AFU L;  2VUR A;  3N9O A;  3UU6 A;  2BVM A;  5L3G B;  1W0A A;  3P4S A;  1MIW A;  2XZE A;  4YTP A;  3N9L A;  1OED B;  1I94 T;  1OXZ A;  3ESL A;  2KWI B;  3KV6 A;  2DWK A;  3A8Y C;  4WBN E;  3RYH E;  2IUB A;  3AA7 B;  3K3N A;  4ZZC A;  3M3Z B;  5FMN A;  3LG7 A;  3L39 A;  5LCY A;  4DND A;  3P8C D;  3NVO A;  2WWV A;  3S4U A;  4HWD A;  5LYJ E;  2YU1 A;  4H9Q C;  4TWH A;  4XAX B;  2V7M A;  1XWM A;  2VL8 A;  4TWF A;  2YIN A;  1XDP A;  3UUL A;  1US7 B;  4LF9 T;  2R6G F;  1MNE A;  5F3J A;  3JAD A;  2KND A;  3UUN A;  2PJQ A;  1HG2 A;  1J5E T;  2VQE T;  5CGM A;  1LKX A;  3AE5 A;  4PNI A;  1WCR A;  5EZY E;  2JQK A;  4FI5 A;  3JAF A;  2H3R A;  4HWF A;  5LGU B;  4QWN B;  4E7S A;  2W0G A;  1W0B A;  1YKH B;  3RKO A;  3FZH B;  4WBO A;  3ZMV B;  5LGT B;  1HNX T;  3ZMU B;  4OX9 T;  2K9A A;  2W62 A;  4YSX A;  5LP6 E;  4DR4 T;  5HEO A;  2ZM6 T;  2D2S A;  2XQ9 A;  2Y48 B;  3ZCI A;  4JI4 T;  3AEC A;  1IBK T;  2LM9 A;  3ANW A;  2V7K A;  2V7L A;  5AQV B;  3ZKR A;  2CRB A;  5LB7 B;  1N34 T;  4H9O C;  5JRC B;  4JI1 T;  2D9D A;  1N32 T;  3LJC A;  4EB6 E;  4DBQ A;  4QX8 B;  3CVR A;  4V1A v;  4CZZ B;  4U33 A;  3ZT7 A;  1UK5 A;  5CJ5 A;  3AXJ B;  1MIV A;  2QRX A;  2CXL A;  3C98 B;  2LSY A;  2VQF T;  3AE6 A;  3OKQ A;  5LMN T;  4HEA A;  2WMO A;  2BDE A;  4O8S A;  3ONX A;  1E7P A;  4CI1 B;  2Z6E A;  2UXN B;  3M65 A;  3NRX A;  5HXH A;  3AVS A;  3QNU A;  3TLV A;  1QUU A;  2WQY A;  2CE7 A;  3RKG A;  1D0X A;  5FL0 A;  4ZI7 E;  2JMH A;  4UVC B;  2MBG A;  2KT9 A;  3AEB A;  4IDN A;  1HF8 A;  3SOL A;  5JDQ A;  4DV7 T;  5JR9 C;  5JDN A;  3T1Y T;  1SHZ C;  3PE0 A;  3ABV A;  2Q9Q C;  2YDR A;  3VRA A;  1M62 A;  2YEV C;  4IST A;  4ZOL E;  5HWX A;  3P4Q A;  2Y6X A;  3Q5E A;  3SRZ A;  2M6B A;  1R8I A;  4UIG A;  1BR4 A;  2SPC A;  4M1P A;  3GN5 B;  3CQX C;  1LVK A;  4U7Y A;  3RF1 A;  4IDP A;  3NBX X;  4IE4 A;  4I4T E;  2W63 A;  4HWC A;  4JEH B;  2B76 A;  3E22 E;  3UUX B;  4CI3 B;  3EAM A;  3PUA A;  1YKE B;  2V7I A;  3J7Y q;  3ZSS A;  4IT4 A;  3AE4 A;  3W15 B;  5HXE A;  1N36 T;  1WR6 A;  2NTX A;  3HL6 A;  2CBJ A;  4AKL A;  2NW8 A;  4DVD A;  4YTN A;  3CQC B;  3RLF F;  4PJM A;  5EK3 A;  2J1D G;  4DR5 T;  4UF0 A;  4CXY A;  4X62 T;  2BS3 A;  3TKL B;  3I1A A;  4MFR A;  5AQF B;  1KNR A;  3CKD A;  5KMG P;  4ILC A;  5JTG A;  3PUW F;  1H7C A;  2PTF A;  4OYK A;  5HEG A;  5JDL A;  1VCT A;  1FJG T;  1ZV4 X;  3ZEF B;  2LSG A;  1UCU A;  2IC6 A;  4YXD A;  4L0R A;  3PUS A;  3ZN0 B;  4EV6 A;  5AQJ B;  3B13 A;  3MAC A;  3AAE B;  1HNW T;  4JI8 T;  2X0Y A;  4H63 H;  3RIF A;  4MAL A;  5AQI B;  3EHZ A;  3C4Z A;  4NPP A;  3V5U A;  5JDM A;  4IE6 A;  2CWY A;  3FXE B;  5KX5 E;  1M7K A;  3ZPO A;  5DQV A;  2LOP A;  3RQW A;  3DJB A;  2OA5 A;  3UU8 A;  5JR9 A;  3ANW B;  2W66 A;  3OVU A;  4B3S T;  2V1D B;  3SS1 A;  5CA0 E;  4HTE A;  4ZI2 D;  3O1J A;  2V6Y A;  4AQF A;  1Z0P A;  3FBZ A;  3BQK A;  3AE2 A;  5H6Q B;  3AE1 A;  4A98 A;  3F57 A;  4PJL A;  4X5T A;  1WFD A;  4Z8X A;  2UUA T;  4P1N A;  4YTM A;  4ZI3 C;  2XQ4 A;  3I0Q A;  4ZS3 A;  3ONJ A;  2HH7 A;  2CA5 A;  2W4X A;  1MMD A;  3L09 A;  2LSK A;  1G8X A;  2DL1 A;  5LA6 E;  3RI5 A;  3T1H T;  5DJQ C;  2CM0 A;  4U3C A;  3VKH A;  4H9S E;  3L3P A;  2XAG B;  3GWH A;  3DTO A;  3CPZ A;  5KDM C;  4CXW A;  1HG5 A;  1HNZ T;  2VL0 A;  3R6N A;  4MLK A;  2XQ8 A;  3IF8 B;  4IE7 A;  5A1L A;  3OTO T;  2E9X C;  1KNP A;  4DMW A;  4KHZ F;  3C4W A;  2YOE A;  2CMR A;  4X20 E;  3RYC E;  3LK3 B;  4EAH A;  3RYF E;  1SA0 E;  4ZXL A;  2KMF A;  4OYJ A;  4PFP A;  2YN6 A;  1IBL T;  3AAA B;  4HE8 A;  3N2G E;  2W00 A;  4DR2 T;  4L5G A;  3Q5D A;  3V5S A;  2BS4 A;  2XAF B;  2ACX A;  4AKG A;  3BQL A;  5HCM A;  3UFE A;  5LHI B;  3K8P C;  2ZM0 A;  4A5X A;  2WS3 A;  4H9R C;  3ZST A;  4TZ4 C;  4QXB B;  2CHN A;  3R84 B;  2CPT A;  4ZHQ E;  4BJN A;  3AAI A;  2WDQ A;  2J47 A;  1WLX A;  2X67 A;  1XMQ T;  5AQR B;  4JI0 T;  1ZEE A;  4TX5 A;  5L47 A;  2EHO C;  4LMK A;  4YHJ A;  5HEU A;  1FMW A;  1KNZ A;  4TN7 B;  2DWG A;  1IAP A;  3AB3 B;  4IL4 A;  3B57 A;  3RRC A;  3P4R A;  2X9Y A;  2BG9 A;  1SE7 A;  3ETU A;  4GIW A;  2CLY B;  1AJ3 A;  4E7Z A;  2X66 A;  3NZP A;  3QB5 K;  4HGA A;  3C51 A;  4PAG A;  5ABH A;  4KX6 A;  2FBW A;  4ISS A;  3UU4 A;  2BVL A;  1IJ6 A;  3UUM A;  4DV0 T;  2NOX A;  2WAU A;  2XQ7 A;  4PK5 A;  5HXS A;  4K0K T;  4AKH A;  3L8R A;  1BR0 A;  4UV8 B;  3WAJ A;  2DCF A;  1FMV A;  1EZ3 A;  2IC9 A;  4YJ2 E;  5AQT B;  3ZMS B;  3N9Q A;  4IDO A;  5H6R B;  3ZJ1 A;  3EDV A;  4DR1 T;  4GK5 E;  2VKD A;  2WM9 A;  2HPL A;  2H7V C;  4KBM B;  3D0T A;  3O9X A;  5AQL B;  4B3R T;  4EXT A;  3E08 A;  5ABE A;  1JNR A;  1LVF A;  5LG3 A;  2JIW A;  2E9X A;  3CIR A;  5ABF B;  4EYU A;  3AEF A;  2HPJ A;  1IBM T;  3UTK A;  4NUV A;  2Q9Q B;  4YHH T;  3KDS E;  3IHR A;  1Y01 A;  4N78 D;  3A7M A;  4U2Y A;  2HHH T;  5HXR A;  1CUN A;  3KFW X;  4TNW A;  3ETV A;  3EI0 A;  1WRD A;  4KI0 F;  4ILU A;  2CCQ A;  3MK7 C;  3PU3 A;  3O4X E;  4XZC A;  3ZMT B;  1NAF A;  2BKN A;  4DID B;  1KK7 A;  5FP3 A;  2L8K A;  4HFB A;  2VB6 A;  3RGL A;  4C90 A;  3HI2 A;  2NP9 A;  3Q5X A;  1MND A;  2EHO A;  2ZM2 A;  4GK0 E;  3UU5 A;  3VRB A;  4UXN B;  2IW5 B;  3OPC A;  3GA8 A;  3N2O A;  4I43 B;  3JC6 D;  2LKG A;  3FB2 A;  1KF6 A;  4ZZB A;  4JI5 T;  4I55 E;  1L0V A;  4WZX A;  1VRB A;  3CX8 B;  3H37 A;  3LBX A;  1HX8 A;  2CWO A;  2K24 A;  4DV4 T;  3K3Q C;  2NW7 A;  4IE0 A;  4IDZ A;  5HWY A;  3X1D A;  1HR0 T;  1YD8 G;  1LRZ A;  4JI7 T;  4EZH A;  4UV9 B;  1D1A A;  2XAH B;  2B1E A;  2IAK A;  3PU8 A;  5LHH B;  4ERR A;  1NWM X;  4TV8 E;  5L4H A;  2FUP A;  4OHF A;  2JQQ A;  3CWZ B;  4PJN A;  2CXF A;  3LK2 B;  1HTJ F;  4PW8 A;  2I59 A;  3CX6 B;  2H89 A;  5FY0 A;  3ZMZ B;  5ETW A;  3Q5W A;  2XAS B;  3RPU A;  2XQ3 A;  3ZT5 A;  2C5I T;  2BZB A;  5BMV E;  3PUZ F;  4CN6 A;  2HN1 A;  4AQF C;  2WDV A;  2QA7 A;  1ZOY A;  2WDR A;  4CQI A;  2YK0 A;  2ZM8 A;  3ONL C;  3AA1 B;  4NXN T;  2XHE B;  5AQK B;  4L9I A;  5L3C B;  3UU3 A;  3AE7 A;  3GMI A;  4AIU A;  4YY3 T;  4TWD A;  4UR9 A;  3TLW A;  2LM2 A;  3AE9 A;  2KLQ A;  1D1C A;  2KSR A;  1NEK A;  3QB5 A;  1CHU A;  3MJX A;  2YU2 A;  2UUC T;  3RC3 A;  3RIA A;  4OFZ A;  3N9N A;  3UFG A;  5M4Y A;  1JNZ A;  2M6I A;  3P50 A;  2C5K T;  2MTQ A;  3H3M A;  4C91 A;  3OYX A;  3N9M A;  4ZEY A;  2X68 A;  2X9H A;  2ES0 A;  2E5V A;  1DU2 A;  4LF8 T;  4ASK A;  4WYV A;  4P0A A;  3KBT A;  4LML A;  3HA4 A;  4JEU B;  4ZS2 A;  3HKB E;  1FEW A;  4IDQ A;  2WP9 A;  2A3D A;  3KV5 A;  2DNX A;  4K0U A;  3KV9 A;  4X66 T;  5FVL A;  3P4W A;  5AQH B;  3JAE A;  2K3W A;  2J62 A;  1WYC A;  5IHY A;  2WWU A;  2VVN A;  3CX7 B;  3A5X A;  1T7S A;  3QK6 A;  1XNR T;  3LK4 2;  3KVB A;  2UXC T;  3C64 A;  4BA9 A;  4NXM T;  4ADZ A;  4BAY B;  4G2A A;  2JQ9 A;  4CN4 A;  4O4H E;  4X1K E;  5C2T A;  2VAS A;  4MHC A;  4IGU A;  4EGW A;  4X65 T;  4YSY A;  1YW0 A;  2LEH A;  2D5U A;  4GOU A;  3AA6 B;  4PK4 A;  4FJO A;  5CB4 E;  2DHR A;  4JV5 T;  1Z8U A;  4U74 A;  1KEY A;  2L9Q A;  4TUY E;  5FL1 A;  2BG9 C;  2IDO B;  1YQ4 A;  3CQG B;  2XY8 B;  1VOM A;  2X0H A;  5E0O A;  1X79 A;  3MA9 A;  2ODV A;  3VHL A;  4EYY R;  2FJA A;  2WCA A;  4DR6 T;  1V9D A;  5LGN B;  4I0U A;  3VR8 A;  2Q9Q D;  1UX5 A;  2ZLY A;  5AQS B;  2L3L A;  1I6Z A;  3FZK B;  4TNV A;  4YFS A;  4DMV A;  2AXD S;  2WZH A;  4KMC A;  2XJ7 A;  3IBP A;  4LMJ A;  3EAB A;  4TV9 E;  5JRC A;  3PV0 F;  2DLR A;  2CEA A;  4DV5 T;  3HKC E;  1QLB A;  5F5W A;  1T98 A;  3AED A;  5LJM A;  4CI2 B;  1HCI A;  3F31 A;  3QOF A;  4JLE A;  3MKD A;  5CA1 E;  3SFD A;  5AQG B;  4DUY T;  5FXZ A;  2XM2 A;  5AQN B;  3EVY A;  5JH7 E;  1J1J A;  3AXJ A;  3AEG A;  4X64 T;  3CML A;  2W2U A;  3TLU A;  2DI4 A;  3VU7 H;  4O2B E;  5L3B B;  3LFM A;  2MOZ A;  2VVS A;  2V8S V;  5JQG E;  5LBM A;  4UVA B;  3SFE A;  5F8P A;  3ZT6 A;  3O1H A;  3FBL A;  2VK9 A;  5J0Z A;  3C50 A; 
#chains in the Genus database with same CATH homology
 1QSD A;  2H7V C;  2D0T A;  5FNV E;  4KBM B;  1D1B A;  3D0T A;  3O9X A;  4WNK A;  2KT9 A;  1HF8 A;  3O1I A;  3SOL A;  4EXT A;  4GYR A;  2JMK A;  5JDQ A;  3E08 A;  2C5J A;  5JR9 C;  3KIN B;  4CXX A;  1LVF A;  3NRY A;  3N9P A;  1MIY A;  5J1G A;  5EK2 A;  1SHZ C;  3PE0 A;  4H9N C;  3SWH A;  2Q9Q C;  1HFA A;  5JDN A;  4X1Y E;  4ANJ A;  2E9X A;  2YEV C;  3WI3 A;  4P09 A;  4IST A;  4EYU A;  1OWA A;  3FHN A;  4UVB B;  2D0U A;  3BQI A;  4QX7 B;  4ZOL E;  5HWX A;  2HPJ A;  2Y6X A;  2WSS V;  2X9W A;  3UTK A;  2V7J A;  2X51 A;  4P0B A;  3SRZ A;  3ZCJ A;  4NUV A;  2WMN A;  2NWB A;  1FIO A;  2Q9Q B;  3E0Z A;  2ZMA A;  3KDS E;  4UIG A;  3IHR A;  1BR4 A;  4N78 D;  2SPC A;  4M1P A;  5LHG B;  2LSI A;  1G73 A;  5C8Y E;  2X0L B;  5L3F B;  5HXR A;  3GN5 B;  3CQX C;  5LJN A;  1LVK A;  3AA0 B;  1CUN A;  3KFW X;  5FY7 A;  3ETV A;  2Q9Q A;  5HAX A;  1WRD A;  2PG8 A;  3NBX X;  4IE4 A;  4ILU A;  2X9X A;  2CCQ A;  4EZ4 A;  4AI6 A;  1U5P A;  3MK7 C;  2EHO B;  3PU3 A;  3O4X E;  4I4T E;  4XZC A;  5DQW A;  2W63 A;  5L3D B;  3ZMT B;  1NAF A;  4JEH B;  3FXD B;  1IZN B;  3E22 E;  1KK7 A;  4JUY A;  5FP3 A;  3UUX B;  4CI3 B;  5JDH A;  2L8K A;  5GON E;  3F2E A;  2VB6 A;  3PUA A;  5J2U E;  4C90 A;  3HI2 A;  2NP9 A;  5FY1 A;  4AQG A;  1YKE B;  3Q5X A;  2H7O A;  3ZN1 B;  1MND A;  2EHO A;  2NW9 A;  2ZM2 A;  1ZHC A;  2V7I A;  2Y8D A;  4GK0 E;  3J7Y q;  4O4J E;  5FXX A;  5FYM A;  3NZQ A;  2E8I A;  3LBX B;  5JDF A;  3I0O A;  4H63 V;  4MBQ A;  4UXN B;  3W15 B;  2IW5 B;  5HXE A;  4UF0 B;  3GA8 A;  2XUE A;  5TAO A;  3N2O A;  1UX4 A;  3IEE A;  1WR6 A;  2NTX A;  4I43 B;  3HL6 A;  3JC6 D;  5FXV A;  1BR2 A;  3FB2 A;  5EK4 A;  2LJL A;  5LOV E;  2K5B B;  3UT5 E;  4AKL A;  2NW8 A;  3PTR B;  4I55 E;  4DVD A;  1VRB A;  3CQC B;  3CX8 B;  3H37 A;  3N2K E;  3HR0 A;  4PJM A;  5EK3 A;  3LBX A;  3PUR A;  1HX8 A;  2J1D G;  2CWO A;  2K24 A;  4I50 E;  4UF0 A;  3K3Q C;  5IYZ E;  4CXY A;  2NW7 A;  4IE0 A;  4IDZ A;  3TKL B;  3I1A A;  4MFR A;  5HWY A;  3CKD A;  2C0S A;  5KMG P;  1YD8 G;  1LRZ A;  1BR1 A;  3KVA A;  1H7C A;  4O2A E;  4EZH A;  4ZI3 D;  4UV9 B;  3K3O A;  1D1A A;  3OYZ A;  4OYK A;  2XAH B;  4QXH B;  3OJA A;  2B1E A;  2IAK A;  3MZK B;  5JDL A;  1ZV4 X;  3ZEF B;  5LXT E;  2XAJ B;  3PU8 A;  4F6R C;  2LSG A;  1UCU A;  5LHH B;  4ERR A;  1NWM X;  2PFV A;  2IC6 A;  4TV8 E;  3EUH A;  4OHF A;  4L0R A;  2JQQ A;  2M67 A;  3CWZ B;  4PJN A;  2CXF A;  3PUS A;  3LK2 B;  1HTJ F;  1U4Q A;  4PW8 A;  3ZN0 B;  2I59 A;  1Y64 B;  3CX6 B;  4IE5 A;  5FY0 A;  3ZMZ B;  4KUM B;  5ETW A;  3Q5W A;  4WW0 A;  5HXC A;  2XAS B;  4IIJ E;  3RPU A;  3B13 A;  3KBU A;  3MAC A;  4QHO A;  3AAE B;  2LT3 A;  2C5I T;  2BZB A;  4H63 H;  5FXW A;  5BMV E;  4MAL A;  3C4Z A;  4HN9 A;  3V5U A;  5JDM A;  4AQF C;  5JR9 B;  4IE6 A;  2CWY A;  4O4I E;  2LHR A;  2QA7 A;  2XAQ B;  3FXE B;  5KX5 E;  4CQI A;  3Q9D A;  2YK0 A;  2ZM8 A;  3AA1 B;  3ZPO A;  2VKJ A;  2XHE B;  3I9W A;  5DQV A;  2JPF A;  4L9I A;  5L3C B;  1B7T A;  3ZYK A;  2LOP A;  2NTY A;  3ZYL A;  2RP4 A;  3DJB A;  3GMI A;  2OA5 A;  3JC6 C;  4DBR A;  2MYS A;  3AVR A;  3OBV E;  5JR9 A;  3ANW B;  3WAK A;  1WYB A;  2E9X D;  2V1D B;  3SS1 A;  2KXP B;  5CA0 E;  5J2T E;  4HTE A;  4ZI2 D;  2LOS A;  2GK9 A;  2KLQ A;  3RC8 A;  1D1C A;  2XQY A;  2KZ7 B;  3GN5 A;  4PJJ A;  3O1J A;  3QC9 A;  4J2C A;  4EOZ B;  2N9D A;  3MJX A;  4AQF A;  1Z0P A;  3FBZ A;  3RRW A;  2YU2 A;  3RC3 A;  3BQK A;  2G0U A;  4OFZ A;  3N9N A;  5H6Q B;  4NUU A;  5M4Y A;  3F57 A;  4PJL A;  4KP3 C;  4Z8X A;  4UEM A;  1HS7 A;  3RH3 A;  2C5K T;  2MTQ A;  2QGS A;  4ZI3 C;  5ADX L;  5JVD E;  2VKH A;  2CLY C;  3I0Q A;  5AFU L;  4ZS3 A;  4C91 A;  3N9O A;  3OYX A;  3PDY A;  2A72 A;  2BVM A;  2HH7 A;  3RX6 A;  3N9M A;  4IHJ E;  5L3G B;  1MMG A;  2CA5 A;  2X68 A;  2X9H A;  1MMD A;  3VKG A;  3QUJ A;  2ES0 A;  3L09 A;  2LSK A;  1G8X A;  1MIW A;  3PUQ A;  5LA6 E;  4ASK A;  4P0A A;  2RA1 A;  4UVC B;  3N9L A;  3KBT A;  2UXX B;  3KV4 A;  1OXZ A;  5L2L A;  2A2F X;  3ESL A;  2LE8 A;  3HA4 A;  4JEU B;  2JJ9 A;  4ZS2 A;  2KWI B;  3HKB E;  3KV6 A;  1FEW A;  2LSJ A;  2DWK A;  5DJQ C;  2A3D A;  4WBN E;  3RYH E;  3KV5 A;  2DNX A;  5DAB A;  5JRE A;  3AA7 B;  2CM0 A;  3K3N A;  3Q2M A;  2EHO D;  5FMN A;  3LG7 A;  3VKH A;  2XTL A;  4H9S E;  4K0U A;  4PFO A;  3KV9 A;  3L3P A;  4YJ3 E;  2XAG B;  3GWH A;  4O4L E;  4GYS A;  3DTO A;  3CPZ A;  2KWH A;  5LCY A;  4DND A;  3T8O A;  3P8C D;  5KDM C;  3N5L A;  4CXW A;  1HG5 A;  1WYC A;  3R6N A;  4MLK A;  2LHN A;  5IHY A;  3S4U A;  4IE7 A;  3IF8 B;  5A1L A;  2WWU A;  5LYJ E;  2YU1 A;  3CX7 B;  4H9Q C;  4H9P C;  3A5X A;  5LBQ B;  2E9X C;  4XAX B;  2V7M A;  4DMW A;  3C4W A;  2VL8 A;  3QK6 A;  2CMR A;  5JDG A;  2YIN A;  4X20 E;  3RYC E;  3ZC1 A;  3LK4 2;  3UUL A;  3KVB A;  3LK3 B;  4QXC B;  4ZI2 C;  3J9X 1;  3C64 A;  4BA9 A;  1US7 B;  4EAH A;  3RYF E;  1SA0 E;  4ADZ A;  1MNE A;  2PBI A;  5F3J A;  3ZJ2 A;  2KND A;  3UUN A;  4BAY B;  2KMF A;  2PJQ A;  4G2A A;  1HG2 A;  3DP7 A;  4OYJ A;  4O4H E;  1MMN A;  4PFP A;  4X1K E;  2V26 A;  1O3X A;  1LKX A;  4AKR B;  3AAA B;  2VWA A;  4HE8 A;  4PNI A;  4A56 A;  3N2G E;  2VAS A;  4MHC A;  5EZY E;  2W00 A;  4IGU A;  4L5G A;  4FI5 A;  1S35 A;  2H3R A;  1YW0 A;  2LEH A;  3I9Y A;  3ZYM A;  3V5S A;  1MMA A;  3EDU A;  5LGU B;  2D5U A;  2K48 A;  2XAF B;  4GOU A;  2ACX A;  4QWN B;  4E7S A;  4AKG A;  2W0G A;  3AA6 B;  3BQL A;  1YKH B;  4EIW A;  2CXD A;  4HKA A;  4PK4 A;  3UFE A;  5LHI B;  5LNK A;  3RKO A;  3K8P C;  2ZM0 A;  4FJO A;  4WBO A;  3ZMV B;  5LGT B;  5CB4 E;  3ZMU B;  2DHR A;  4H9R C;  2VKO A;  4TZ4 C;  4HFV A;  2K9A A;  2W62 A;  4QXB B;  4U74 A;  3R84 B;  5L3E B;  4BJM A;  3PUG A;  2L9Q A;  4TUY E;  4ZHQ E;  2KIN B;  4BJN A;  5LP6 E;  1ZKE A;  2P9B A;  3AAI A;  1WLX A;  2X67 A;  2D2S A;  3CQG B;  2Y48 B;  3ZCI A;  1ZEE A;  3ZLI A;  1VOM A;  4DO0 A;  2ODU A;  4TX5 A;  2EHO C;  5E0O A;  1D0Y A;  2LM9 A;  1X79 A;  3MA9 A;  4X1I E;  4YHJ A;  3ANW A;  3MXZ A;  2ODV A;  2V7K A;  2N2N A;  2V7L A;  3VHL A;  4EYY R;  1FMW A;  4OK0 A;  1KNZ A;  4TN7 B;  1S94 A;  2DWG A;  1V9D A;  1IAP A;  4H9O C;  3AB3 B;  5JRC B;  5LGN B;  3H3A A;  4XBF B;  3B57 A;  2W61 A;  2Q9Q D;  3U78 A;  3LJC A;  3RRC A;  1UX5 A;  2ZLY A;  4G63 A;  4YLH A;  2L3L A;  4EB6 E;  1D0Z A;  4DBQ A;  2X9Y A;  5HYA A;  2JRK A;  4QX8 B;  3HKD E;  3CVR A;  4V1A v;  4YFS A;  4DMV A;  3ETU A;  4KMC A;  4CZZ B;  4GIW A;  2CLY B;  1AJ3 A;  3IBP A;  4E7Z A;  4TV9 E;  5JRC A;  3U3I A;  2DLR A;  2CEA A;  2X66 A;  3HKC E;  4AXP A;  3P7I A;  3NZP A;  1T98 A;  4HGA A;  4U72 A;  3C51 A;  4PAG A;  1MIV A;  5LJM A;  4CI2 B;  2CXL A;  1HCI A;  3F31 A;  4PK6 A;  3C98 B;  4ISS A;  4UEL A;  4JLE A;  3RYI E;  2BVL A;  1IJ6 A;  3UUM A;  3MKD A;  5CA1 E;  2NOX A;  2WAU A;  2LSY A;  4QKN A;  5FXZ A;  4PK5 A;  5HXS A;  3OKQ A;  3EVY A;  2N1G A;  3ZC0 A;  4AKH A;  1E1H B;  5JH7 E;  4HEA A;  2WMO A;  1BR0 A;  3CML A;  2BDE A;  4UV8 B;  2DI4 A;  3HKE E;  4O8S A;  3VU7 H;  3ONX A;  4O2B E;  5L3B B;  5LG4 A;  4CI1 B;  3LFM A;  3WAJ A;  2DCF A;  1FMV A;  1EZ3 A;  2IC9 A;  3C4X A;  2Z6E A;  4B6X A;  2UXN B;  4YJ2 E;  3M65 A;  3NRX A;  2MOZ A;  3ZMS B;  3N9Q A;  5HXH A;  5JQG E;  5H6R B;  4AKI A;  3AVS A;  5LBM A;  3BK9 A;  3ZJ1 A;  2WBL A;  3EDV A;  4UVA B;  4GK5 E;  1IJ5 A;  1QUU A;  5F8P A;  2CE7 A;  1D0X A;  2VKD A;  2WM9 A;  3O1H A;  3FBL A;  2VK9 A;  2HPL A;  4ZI7 E;  2E9X B;  2JMH A;  3C50 A;  2MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...