3D0TA

Structure of the bnb domain of the hsp70 cochaperone bag2
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
84
structure length
77
Chain Sequence
SEESLKHATRIIDEVVSKFLDDLGNAKSHLMSLYSACSVDQKFQSIVIGCALEDQKKIKRRLETLLRNIDNSDKAIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of nucleotide exchange and client binding by the Hsp70 cochaperone Bag2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone
molecule keywords BAG family molecular chaperone regulator 2
total genus 37
structure length 77
sequence length 84
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-05-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.890 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3d0tA00
3CQXC 3D0TA
chains in the Genus database with same CATH superfamily
5JDQA 2J47A 3U78A 2RP4A 3BQKA 4X1IE 1E2AA 2OA5A 2V6XA 2QVAA 2YK0A 3UFGA 2KINB 2BS3A 3T1YT 4ZI2D 4YJ3E 3LJCA 2LM9A 2MBGA 3FB2A 4O4JE 2LSJA 3ANWB 4M1PA 4U3CA 3ZJ1A 1U5PA 5HYAA 3RPUA 5LNKA 4X66T 4G63A 1XMOT 3CMLA 3I0QA 5HEOA 5AQNB 2UUBT 4ZS3A 2E9XD 5LYJE 2HH7A 4AKGA 1MMNA 1SUMB 1YQ3A 4ILUA 2K3WA 1VCTA 2V7MA 5EK2A 2VVNA 1M7KA 2IUBA 2W67A 2J62A 3PJAA 2BKNA 1OXZA 3FXDB 3HI2A 2XQ7A 2NW8A 3RGLA 3TLUA 5L3GB 1KEYA 4JI6T 4GKKT 4PW8A 3PU3A 5JRCA 2NW7A 4PFPA 1N34T 2H7VC 3MACA 4QKNA 3ZSTA 4KHPT 3CQGB 3P4SA 4O4LE 5AQOB 5L3BB 3ANWA 3ZC0A 2XQ3A 4AQGA 5JR9C 1QSDA 5FVKA 3UT5E 4UELA 3VU7H 1KNPA 2W63A 4ZZBA 3AVRA 2LHRA 2VKDA 4XBFB 4LMKA 1HNWT 3UFEA 4QXBB 3B57A 3FHNA 4DVDA 1MIWA 2X51A 1UUSA 2V7KA 2YKSA 3C98B 4XZCA 3PUAA 3KV6A 4MHCA 3Q5XA 4ANJA 3CKDA 5FL1A 2WS3A 4EB6E 2XQ6A 3AEEA 4ERRA 2DHRA 1UCUA 2YEVC 2JJ9A 3C64A 2IC6A 2XPKA 1HG5A 4U2ZA 4CQIA 2CBIA 4AKLA 4IDZA 2YU2A 3BQIA 4EAHA 4X62T 1T7SA 2BG9B 5DJQC 3T8OA 4EIWA 3ESLA 5LGNB 1QUUA 5L3CB 2E8IA 4O4HE 2J4GA 2XQ5A 1L0VA 2CXLA 2LJLA 4AQFC 2JQ9A 2WP9A 3C4XA 2FJEA 1YKEB 4HN9A 2WU5A 3VHLA 2X68A 4DMVA 1XZYA 3B13A 4HKAA 2XUEA 3RI5A 2I6HA 4ASKA 4YY3T 2I0MA 3PTRB 2CRBA 5AQHB 4O2BE 5LG3A 2YDRA 5BMVE 3D0TA 4L5GA 2XY8B 4ISSA 2XHEB 3PUZF 3AXJB 3PUSA 5CB4E 1MIVA 2UXBT 2LKGA 1MMAA 1HS7A 4IL9A 2D0UA 2H88A 5BR8T 3DP7A 4OYKA 3AA0B 4DMWA 1FJGT 5CA0E 3L3PA 4GYRA 2VASA 3RIFA 4UVCB 1Z8UA 5KXJA 5J0ZA 4ILAA 2WDRA 3ZC1A 2M6IA 2WSSV 3OBVE 3N9MA 3N5LA 3PUQA 2XQ4A 4ZOLE 2D5UA 3MK7C 5HCJA 5HEGA 3NWIA 3F2EA 4A97A 4FI5A 2X0HA 3P8CD 1I94T 4DR7T 2ES0A 5IYZE 3KVBA 4KUMB 4O2AE 5JQGE 5TAOA 2MYSA 3N2GE 4MALA 5LMUT 2LHNA 4AKHA 2W00A 4YSYA 2SPCA 5LG4A 4JI1T 5LHIB 1LKXA 2VL0A 2YU1A 1XMQT 2JMHA 1NEKA 2L8KA 5F5WA 5FXVA 2X66A 3ZMZB 2B76A 4DBQA 3ZEFB 3UQ7A 1KNZA 2A3DA 4U7IA 5AQTB 4ZI3D 2WAUA 4TNVA 5FMNA 3RYCE 3SOLA 4NPPA 3OKQA 2IW5B 3AAIA 3AA6B 3AA7B 3GWHA 3ZCJA 4LF5T 4A98A 3ZLIA 5A1LA 3UUXB 3JCFA 1AJ3A 5HXRA 4H63V 2W61A 2CBJA 3UU8A 5L47A 3L8RA 2BG9E 1WCRA 4TX5A 5L3EB 4U74A 2HN2A 3I9YA 2V8SV 2V7LA 2LSGA 3UUNA 3KBUA 1T72A 5HXCA 3AE7A 2CWYA 3TLSA 2EHOD 4J2CA 3J9X1 4YLHA 2DWGA 2OLTA 3H3MA 3PE0A 4X64T 4H9NC 3N9NA 2QGSA 4N78D 3A8YC 4HFCA 5ETWA 3ZYLA 3NKZA 4O4IE 4EYUA 5JDNA 2BZBA 5FXXA 2KZ7B 4GOUA 3AEFA 4KBMB 4YSZA 4LFCT 2BS2A 3AE3A 2I59A 2L3LA 1U4QA 2IIUA 3DTOA 4YTMA 3RYFE 3ONXA 5H6QB 2CXFA 5JR9A 3UUBA 2R6GF 3RHWA 2LRKA 3AE4A 5FYMA 5J1GA 1UK5A 3RKOA 4CN6A 4DV2T 2UXCT 3LBXA 2V5DA 5JH7E 2W62A 4PK4A 2LSYA 2WQYA 3VR8A 3MZKB 4HFVA 3AE2A 4F6RC 5HXSA 3UULA 2D0TA 2DL1A 2CLYB 2X9XA 1WYCA 1H7CA 2XM2A 3HKEE 4TV8E 4YT0A 5AFUL 4NXMT 3BK9A 2Y8DA 4UV9B 3RQUA 5AQPB 3ZJ2A 2CPTA 2LLYA 3CWZB 3A5XA 2X0YA 4HWDA 4YFSA 4CN1A 4Z91A 1HTJF 4EEDA 1KFYA 2H3RA 2LKHA 3P50A 2WMNA 4JBWF 2IHR1 3ZYKA 3PUVF 1BR0A 3EABA 4IE6A 5JR9B 3GN5B 4MLKA 3CX6B 5JVDE 2Z6EA 3AEDA 3TKLB 2C5IT 4BJNA 3CX8B 3ABVA 4K0UA 3JC6C 1YKHB 5EK4A 1W09A 2AE9A 4DV5T 2WZHA 2CCQA 3AA1B 3WAJA 2ZM6T 3LK2B 2K48A 3FZKB 3CX7B 3ETUA 2AXDS 3V5UA 5IHYA 2E9XC 3C50A 2Q9QD 4G2AA 1EZ3A 3ZT7A 5LCYA 4BA9A 4NIQA 4OHFA 3PUGA 4MBQA 4CZZB 4DV3T 4GIWA 4H9SE 3ZCIA 2ACXA 1GQEA 2BDEA 4DR2T 5FKYA 2BBHA 2FJDA 2RPAA 4CXXA 4YHJA 1D1AA 2VURA 4C91A 5JDMA 4IDQA 4U31A 1T8BA 1M62A 2L9QA 3JAFA 3ZMSB 5HAXA 4DV0T 2CHNA 4AQYT 5L3DB 3E0ZA 1W0AA 2OV9A 4CXWA 3RH3A 5FY1A 1CHUA 2NTYA 2WCAA 3FBLA 2NTXA 3FZLB 4QXHB 4X5TA 3SS1A 4FJOA 3HA4A 2NP9A 3EDVA 3NVOA 2CXDA 3RQWA 5J2UE 4PJMA 3EHZA 4XAXB 3QOFA 1FIOA 2XAQB 3IBPA 1VCSA 4QH5A 1KF6A 1SHZC 3VRAA 4YTNA 5JDGA 5LHHB 3LBXB 2X9WA 3R6NA 3PU8A 1XDOA 4I0UA 4IDNA 3EI0A 2EHOA 1D1BA 3NBXX 4HWFA 4IDOA 4UVAB 4ZI3C 5CJ5A 1UX4A 2CEAA 2QA7A 5AQFB 3PURA 3AE6A 2PJQA 1BR2A 2MTQA 1D0ZA 1XWMA 4X1KE 3U3IA 3E08A 1S94A 4TWHA 2XSBA 4UVBB 1ZP0A 2X9HA 4QH1A 3MJXA 4OYJA 5HWXA 1KNRA 3K3OA 3LK42 5CA1E 2CE7A 4IE5A 4TNWA 1KK7A 1ZV4X 3IEEA 3RC8A 2BS4A 2BKPA 4PJJA 5GONE 3UUMA 1BR1A 3J7Yq 4QX7B 4ILBA 3GN5A 3ZSSA 2CLYC 4COFA 2KSRA 4DUYT 2HN1A 5LA6E 4KMCA 4ZHQE 3OYXA 2P9BA 2NW9A 2YN6A 3UU5A 2DCFA 1N36T 4AI6A 1LRZA 4HFHA 3UU4A 5AQJB 2XAHB 3T1HT 4UIGA 5FP3A 3ZYMA 3AE8A 4WYVA 2VVSA 1J5ET 3C51A 5AQVB 4KI0F 5AQMB 4EEBA 1SA0E 1O3XA 2VL8A 4IREA 2X9YA 3KBTA 5AQLB 4GKJT 4IT4A 2D9DA 2M67A 3RX6A 3QB5K 2BKOA 4ISTA 5C3JA 4X1YE 3O1IA 4HFDA 4IE7A 5HWYA 4YTPA 2KNDA 2BBJA 2WM9A 4L0RA 1IBMT 4IE4A 4X20E 2N2NA 2GK9A 4EZHA 5LJMA 3Q9DA 5IWAT 1D1CA 3HR0A 4DR1T 2LT3A 3VKGA 3QUJA 3EAMA 1X79A 3IHRA 3KV9A 4UR9A 5DQWA 2WMOA 4LMJA 5FY7A 4WNKA 1IBKT 3UU6A 5JREA 4OX9T 2LSKA 2V6YB 2W2UA 3C4WA 2BVMA 2H89A 3I9WA 5JDFA 1WR6A 2ODUA 5IUXA 3QC9A 1LVFA 5C8YE 4LF7T 3AEGA 4U33A 3ONJA 2KT9A 3P4QA 3M3ZB 4JLEA 2XSAA 3AEBA 4PFOA 1MMDA 2C0SA 2QRXA 4HEAA 4TWDA 5FY0A 5AQGB 2CWOA 5LOVE 4CI3B 1US7B 3QK6A 4NUUA 3N9QA 4IDPA 3FZHB 3WAKA 4DUZT 5F3JA 3R84B 2W0GA 2M6BA 3FZFB 2KLQA 2KMFA 3HKCE 3AAAB 3N9PA 3Q2MA 1FMVA 3NZPA 2V7IA 3CQCB 4PJNA 2F4VT 1JNZA 2LSIA 3N2OA 3AXJA 2E9XA 4JEHB 3I0OA 4UXNB 2FJAA 2WY2A 3JADA 2D2SA 3CK6A 3EDUA 1HNZT 4EZ4A 1HG2A 2N1GA 2WDQA 4UF0A 3UU3A 4JEUB 2IMLA 3HL6A 3JAEA 3A7MA 3ONLC 2UUAT 2G0UA 2NOXA 4TUYE 4CI2B 1N33T 4JUYA 4WBOA 1W0BA 5L4HA 1BR4A 2XZEA 4HWHA 4CXYA 1E7PA 3W15B 5ABHA 1NAFA 4DV4T 1HR0T 1CUNA 5LMNT 5AQIB 2FBWA 4NUVA 2E5VA 3VRBA 1MIYA 3DJBA 4UEMA 5LHGB 5HEHA 2XQYA 4O8SA 4A56A 4ZEYA 3RIUC 1N32T 4JI7T 4JI2T 2UXXB 2LEHA 4KP3C 4MFRA 4OFZA 4DBRA 3ZKRA 4QH4A 4EXTA 3AB3B 4H9OC 1MNEA 3OVUA 3M65A 3IA3A 1YQ4A 3P4RA 2UXNB 5F8PA 5H6RB 1YXRA 3G06A 4K0KT 3AAEB 1WRDA 1I6ZA 1X9BA 2XM1A 4IL4A 4KHZF 2VKHA 2H7OA 2VKJA 3ZPOA 4BAYB 4I55E 2XJ7A 2ZMAA 4DR5T 3P4PA 3AVSA 4JI0T 1WFDA 3B5MA 4DR6T 3S4UA 3AECA 3UQ4A 4DV7T 4P0AA 2LRLA 4EYYR 4TWFA 4C90A 1E1HB 1OEDE 2Y48B 4UV8B 5FVLA 3LK3B 4IHJE 2WBLA 2UXDT 2A72A 4A5XA 3KV5A 4IGUA 4DR3T 4CI1B 2XQ9A 3ZMUB 4HFBA 1DU2A 5ABGA 4TN7B 4DIDB 5AQQB 4WBNE 4YXDA 1T98A 3OJAA 2JRKA 1HNXT 1NWMX 3JC6D 5ADXL 4BJMA 2ZM0A 2JQHA 1VRBA 2DNXA 1IJ5A 2XAFB 2DLRA 4LMLA 3RIAA 4HFIA 4AKRB 3CQXC 2CA5A 2WU2A 2WWVA 5ABFA 2JMKA 3OTOT 2LE8A 4H9PC 4P1NA 3SFEA 5HCMA 5JRCB 4YHHT 2V1DB 5E0OA 4NXNT 4WZXA 5LP6E 2J1DG 4Q25A 1VOMA 3RIUA 2W4XA 3ETVA 4HE8A 4HGAA 5LGUB 3P7IA 1IJ6A 3H3AA 4IIJE 2E2AA 4Z90A 3ZN1B 1JNRA 4EGWA 1XDPA 3I1AA 2ACZA 3RRWA 3QB5A 4GK0E 5HEJA 5LBQB 5HXEA 4ADZA 5ABEA 2W66A 4H9QC 3L39A 2CHOA 4U2YA 3ZT5A 3RF1A 4ZS2A 4LF8T 3EUHA 3O1JA 2MOZA 4PNIA 1WR0A 4B3ST 2A2FX 3RLFF 4B3RT 3MXZA 1D0YA 4HFEA 3F31A 1LVKA 1ZOYA 2XASB 1ZHCA 1WYBA 2X0LB 2YINA 3K3NA 4GYSA 4TZ4C 3V5SA 4DO0A 4JI4T 2LOPA 5CFBA 3KFWX 3E22E 3HKDE 3OYZA 2XAGB 5J2TE 2X67A 3LFMA 3TLTA 1IZNB 5M4YA 3SWHA 1SE7A 4I4TE 4PJLA 4TV9E 5LXTE 4CN4A 2YDSA 4QXCB 3GMIA 4I43B 3RKGA 3LSVA 1HX1B 1UGOA 2VB6A 5KDMC 5LGTB 2K24A 3GA8A 2IAKA 3FXEB 3N9OA 3KV4A 3NRXA 4PAGA 4B3TT 3WI3A 3ZMTB 3OPCA 5CGMA 4LFBT 2QYWA 2YOEA 2VQET 3KDSE 5EK3A 4F8HA 1Y01A 4AISA 2PBIA 3K3QC 1OWAA 2ZM2A 2KXPB 4LFAT 4JI3T 2ZLYA 1UX5A 4P0BA 5EZYE 4DNDA 1OEDA 3MA9A 2PTFA 5JDHA 5FL0A 3Q5DA 4IE0A 4YJ2E 1UURA 2DI4A 2VWAA 2LM2A 5JTGA 2E5LT 2CM0A 1XNRT 3AE9A 3NZQA 3CPZA 1Z0PA 4LF9T 2JQQA 2N9DA 4DR4T 2FUPA 2MPKA 1XNQT 4JV5T 3RYHE 2HPLA 1YW0A 2UUCT 4ZZCA 2ODVA 5AQSB 5HXHA 2BVLA 3SFDA 2IC9A 2A9UA 4AQFA 3LDQB 5HEUA 4AKIA 2Y6XA 2K9AA 1S35A 1QLBA 3PJAJ 3H37A 2BG9C 3RC3A 5L4EA 3O1HA 1IAPA 2V26A 3PUXF 4AXPA 4YSXA 5C2TA 2Q9QA 3SRZA 2K5BB 4JYAT 2B1EA 1YD8G 4V1Av 3Q5EA 2JIWA 1NENA 4I50E 2KWHA 2XAJB 5ABFB 1MMGA 2V5CA 2Q9QC 4P09A 2Q9QB 3FZMB 2XQAA 4QWNB 2V6YA 4LF4T 5FNVE 3VR9A 2BG9A 4QX8B 4X65T 2HPJA 2XQ8A 3N2KE 3O4XE 4OK0A 1J1JA 3N9LA 3KINB 4H63H 4Z8XA 5KMGP 3K1SA 3MKDA 4ZI2C 4DV1T 3AEAA 2DWKA 1R8IA 3PV0F 3HKBE 2WWUA 3PUWF 2VK9A 4JI5T 2WB5A 1HCIA 1D0XA 3AE5A 3TLVA 2RA1A 4KX6A 3X1DA 5KX5E 4PK6A 4LF6T 3ZN0B 1ZKEA 2V7JA 2EHOC 3QNUA 5LJNA 2HHHT 1W9RA 4PK5A 1OEDC 2KWIB 3LG7A 4UF0B 2NWBA 2YDQA 1HX8A 4GK5E 3C4ZA 4U72A 4QHOA 3L09A 1V9DA 5LB7B 2PFVA 5FXZA 2UU9T 3VKHA 3Q5WA 4ZXLA 2MAWA 1HFAA 1ZEEA 2PG8A 4WW0A 5AQKB 3PUYF 1IBLT 2C5KT 1J5WA 3RRCA 4E7ZA 3BQLA 5JDLA 3ZMVB 4U7YA 1HF8A 2IDOB 3UTKA 4B3MT 1MNDA 4HTEA 3TLWA 1G8XA 3ZT6A 5L3FB 4H9RC 4DV6T 5AQRB 2NR4A 5FXWA 3EVYA 4EOZB 3IF8B 5LBMA 4B6XA 4EV6A 5L2LA 3O9XA 3PDYA 2VQFT 2ZM8A 2CMRA 2C5JA 5DABA 3FBZA 5DQVA 2JQKA 3P4WA 2WZIA 2FJBA 3CIRA 2LOSA 4HWCA 1FMWA 2XTLA 3F57A 1WLXA 4L9IA 2JPFA 1Y64B 2VKOA 3KVAA 1OEDB 3CVRA 4AIUA 3NRYA 4JI8T 4ILCA 2EHOB 1G73A 2WDVA 1B7TA 3K8PC 4HWIB 5AQUB 3AE1A 4ZI7E 4E7SA 3RYIE 1FEWA 2E9XB
chains in the Genus database with same CATH topology
5JDQA 3U78A 2RP4A 3BQKA 4X1IE 2OA5A 2YK0A 2KINB 4ZI2D 4YJ3E 3LJCA 2LM9A 2MBGA 3FB2A 4O4JE 2LSJA 3ANWB 4M1PA 3ZJ1A 1U5PA 5HYAA 3RPUA 5LNKA 4G63A 3CMLA 3I0QA 4ZS3A 2E9XD 5LYJE 2HH7A 4AKGA 1MMNA 4ILUA 2V7MA 5EK2A 3FXDB 1OXZA 3HI2A 5L3GB 2NW8A 4PW8A 3PU3A 5JRCA 2NW7A 4PFPA 2H7VC 3MACA 4QKNA 3CQGB 4O4LE 5L3BB 3ANWA 4AQGA 5JR9C 1QSDA 3UT5E 4UELA 3VU7H 2W63A 3AVRA 2LHRA 2VKDA 4XBFB 3UFEA 4QXBB 3FHNA 3B57A 4DVDA 1MIWA 2X51A 2V7KA 3C98B 4XZCA 3PUAA 3KV6A 4MHCA 3Q5XA 3CKDA 4EB6E 2DHRA 1UCUA 2YEVC 2JJ9A 3C64A 2IC6A 4CQIA 1HG5A 5JDHA 4AKLA 4IDZA 2YU2A 3BQIA 5DJQC 5LGNB 3T8OA 4EIWA 3ESLA 1QUUA 5L3CB 2E8IA 4O4HE 2CXLA 2LJLA 4AQFC 3C4XA 3VHLA 1YKEB 4HN9A 2X68A 4DMVA 3B13A 4HKAA 2XUEA 4ASKA 3PTRB 4O2BE 5BMVE 3D0TA 4L5GA 4ISSA 2XHEB 3PUSA 5CB4E 1MIVA 1MMAA 1HS7A 2D0UA 3DP7A 4OYKA 3AA0B 4DMWA 5CA0E 3L3PA 4GYRA 2VASA 4UVCB 3ZC1A 2WSSV 3OBVE 3N9MA 3N5LA 3PUQA 4ZOLE 2D5UA 3MK7C 3F2EA 4FI5A 3P8CD 2ES0A 5IYZE 3KVBA 4KUMB 4O2AE 5JQGE 5TAOA 2MYSA 3N2GE 4MALA 2LHNA 4AKHA 2W00A 2SPCA 5LG4A 5LHIB 1LKXA 2YU1A 2JMHA 2L8KA 5FXVA 1KNZA 2X66A 3ZMZB 4DBQA 3ZEFB 2A3DA 2WAUA 5FMNA 3RYCE 3SOLA 3OKQA 2IW5B 3AAIA 3AA6B 3AA7B 3GWHA 3ZCJA 1AJ3A 3ZLIA 5A1LA 3UUXB 5HXRA 4H63V 2W61A 5L3EB 4TX5A 4U74A 3I9YA 2V7LA 2LSGA 3UUNA 3KBUA 5HXCA 2CWYA 2EHOD 4J2CA 3J9X1 4YLHA 2DWGA 3PE0A 4H9NC 3N9NA 2QGSA 4N78D 4EYUA 5ETWA 3ZYLA 4O4IE 5JDNA 2BZBA 5FXXA 2KZ7B 4GOUA 4KBMB 2I59A 2L3LA 1U4QA 3DTOA 3RYFE 3ONXA 5H6QB 2CXFA 5JR9A 4ERRA 4AKIA 5J1GA 5FYMA 3RKOA 3LBXA 5JH7E 2W62A 4PK4A 2LSYA 3MZKB 4HFVA 4F6RC 5HXSA 3UULA 2D0TA 2X9XA 2CLYB 3HKEE 1WYCA 1H7CA 4TV8E 5AFUL 3BK9A 2Y8DA 4UV9B 3ZJ2A 3CWZB 3A5XA 4YFSA 1HTJF 2H3RA 2WMNA 3ZYKA 1BR0A 4IE6A 5JR9B 3GN5B 4MLKA 3CX6B 5JVDE 2Z6EA 3TKLB 2C5IT 4BJNA 3CX8B 4K0UA 3JC6C 1YKHB 3AA1B 2CCQA 3WAJA 3LK2B 2K48A 3CX7B 3ETUA 3V5UA 5IHYA 2E9XC 3C50A 2Q9QD 4G2AA 1EZ3A 5LCYA 4BA9A 4OHFA 3PUGA 4MBQA 4CZZB 4GIWA 4H9SE 3ZCIA 2ACXA 2BDEA 4CXXA 4YHJA 1D1AA 4C91A 5JDMA 2L9QA 3ZMSB 5HAXA 5L3DB 3E0ZA 4CXWA 3RH3A 5FY1A 2NTYA 3FBLA 2NTXA 4QXHB 3SS1A 4FJOA 3HA4A 2NP9A 3EDVA 2CXDA 5J2UE 4PJMA 4XAXB 1FIOA 2XAQB 3IBPA 1SHZC 5LHHB 5JDGA 3LBXB 2X9WA 3R6NA 3PU8A 2EHOA 1D1BA 3NBXX 4UVAB 4ZI3C 1UX4A 2CEAA 2QA7A 3PURA 1BR2A 2MTQA 2PJQA 1D0ZA 4X1KE 3U3IA 4EOZB 3E08A 1S94A 4UVBB 5HWXA 3O9XA 2X9HA 3MJXA 4OYJA 3K3OA 3LK42 5CA1E 2CE7A 4IE5A 1KK7A 1ZV4X 3IEEA 3RC8A 4PJJA 5GONE 3UUMA 1BR1A 3J7Yq 4QX7B 3GN5A 2CLYC 5LA6E 4KMCA 4ZHQE 3OYXA 2P9BA 2NW9A 2DCFA 4AI6A 1LRZA 2XAHB 4UIGA 5FP3A 3ZYMA 3C51A 1SA0E 1O3XA 2VL8A 2X9YA 3KBTA 2M67A 3RX6A 4ISTA 4X1YE 3O1IA 4IE7A 5HWYA 2KNDA 2WM9A 4L0RA 4IE4A 4X20E 2N2NA 2GK9A 4EZHA 5LJMA 3Q9DA 1D1CA 3HR0A 2LT3A 3VKGA 3QUJA 1X79A 3IHRA 3KV9A 5FY7A 5DQWA 2WMOA 4WNKA 5JREA 2LSKA 3I9WA 5JDFA 3C4WA 2BVMA 3RYIE 4ANJA 1WR6A 2ODUA 3QC9A 1LVFA 5C8YE 4JLEA 2KT9A 4PFOA 5FY0A 4ZI3D 1MMDA 2C0SA 4HEAA 5LOVE 4CI3B 4EAHA 2CWOA 1US7B 3QK6A 4NUUA 3N9QA 3WAKA 5F3JA 3R84B 2W0GA 5EK4A 2KLQA 2KMFA 3HKCE 3AAAB 3N9PA 3Q2MA 1FMVA 3NZPA 2V7IA 3CQCB 4PJNA 2LSIA 3N2OA 2E9XA 4JEHB 3I0OA 4UXNB 2D2SA 3EDUA 4EZ4A 1HG2A 2N1GA 4UF0A 4JEUB 3HL6A 2G0UA 2NOXA 4TUYE 4CI2B 4JUYA 4WBOA 4CXYA 1BR4A 3W15B 1NAFA 1CUNA 4NUVA 1MIYA 3DJBA 4UEMA 5LHGB 2XQYA 4O8SA 4A56A 2UXXB 2LEHA 4KP3C 4MFRA 4OFZA 4DBRA 4EXTA 3AB3B 4H9OC 1MNEA 3M65A 2UXNB 5F8PA 5H6RB 3AAEB 1WRDA 2VKHA 2H7OA 2VKJA 3ZPOA 4BAYB 4I55E 2ZMAA 3AVSA 3S4UA 4P0AA 4EYYR 4C90A 1E1HB 2Y48B 4UV8B 3LK3B 4IHJE 2WBLA 2A72A 3KV5A 4IGUA 4CI1B 3ZMUB 4TN7B 4WBNE 1T98A 3OJAA 2JRKA 1NWMX 3JC6D 5ADXL 4BJMA 2ZM0A 1VRBA 2DNXA 1IJ5A 2XAFB 2DLRA 4AKRB 3CQXC 2CA5A 2JMKA 2LE8A 4H9PC 5JRCB 2V1DB 5E0OA 5LP6E 2J1DG 1VOMA 3ETVA 4HE8A 4HGAA 5LGUB 3P7IA 1IJ6A 3H3AA 4IIJE 3ZN1B 3I1AA 3RRWA 4GK0E 5LBQB 5HXEA 4ADZA 4H9QC 4ZS2A 3EUHA 3O1JA 2MOZA 4PNIA 2A2FX 3MXZA 1D0YA 3F31A 1LVKA 2XASB 1ZHCA 1WYBA 2X0LB 2YINA 3K3NA 4GYSA 4TZ4C 3V5SA 4DO0A 2LOPA 3KFWX 3E22E 3HKDE 3OYZA 2XAGB 5J2TE 2X67A 3LFMA 1IZNB 5M4YA 3SWHA 4I4TE 4PJLA 4TV9E 5LXTE 4QXCB 5KDMC 3GMIA 4I43B 5LGTB 2VB6A 2K24A 3GA8A 2IAKA 3FXEB 3N9OA 3KV4A 3NRXA 4PAGA 3WI3A 3ZMTB 3KDSE 5EK3A 2PBIA 3K3QC 1OWAA 2ZM2A 2KXPB 2ZLYA 1UX5A 4P0BA 5EZYE 4DNDA 3MA9A 4IE0A 4YJ2E 2DI4A 2VWAA 2CM0A 3NZQA 3CPZA 1Z0PA 2JQQA 2N9DA 3RYHE 2HPLA 1YW0A 2ODVA 5HXHA 2BVLA 4AQFA 2IC9A 2Y6XA 2K9AA 1S35A 3H37A 3RC3A 3O1HA 1IAPA 2V26A 4AXPA 2Q9QA 3SRZA 2K5BB 2B1EA 1YD8G 4V1Av 4I50E 2KWHA 2XAJB 1MMGA 2Q9QC 4P09A 2Q9QB 4QWNB 5FNVE 4QX8B 2HPJA 3N2KE 3O4XE 4OK0A 3N9LA 3KINB 4H63H 4Z8XA 5KMGP 3MKDA 4ZI2C 2DWKA 3HKBE 2WWUA 2VK9A 1HCIA 1D0XA 5KX5E 2RA1A 4PK6A 3ZN0B 1ZKEA 2V7JA 2EHOC 5LJNA 4PK5A 2KWIB 3LG7A 4UF0B 2NWBA 4GK5E 1HX8A 4U72A 3C4ZA 3VKHA 4QHOA 3L09A 1V9DA 2PFVA 5FXZA 3Q5WA 1HFAA 1ZEEA 2PG8A 4WW0A 2C5KT 3RRCA 4E7ZA 3BQLA 5JDLA 3ZMVB 1HF8A 3UTKA 1MNDA 4HTEA 5L3FB 1G8XA 4H9RC 5FXWA 3EVYA 3IF8B 5LBMA 4B6XA 5L2LA 3PDYA 2ZM8A 2CMRA 2C5JA 5DABA 3FBZA 5DQVA 2LOSA 1FMWA 2XTLA 3F57A 1WLXA 4L9IA 2JPFA 1Y64B 2VKOA 3KVAA 3CVRA 3ZC0A 3NRYA 2EHOB 1G73A 3K8PC 1B7TA 4ZI7E 4E7SA 1FEWA 2E9XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CQX C;  3D0T A; 
#chains in the Genus database with same CATH topology
 5JDQ A;  2J47 A;  3U78 A;  2RP4 A;  3BQK A;  4X1I E;  1E2A A;  2OA5 A;  2V6X A;  2QVA A;  2YK0 A;  3UFG A;  2KIN B;  2BS3 A;  3T1Y T;  4ZI2 D;  4YJ3 E;  3LJC A;  2LM9 A;  2MBG A;  3FB2 A;  4O4J E;  2LSJ A;  3ANW B;  4M1P A;  4U3C A;  3ZJ1 A;  1U5P A;  5HYA A;  3RPU A;  5LNK A;  4X66 T;  4G63 A;  1XMO T;  3CML A;  3I0Q A;  5HEO A;  5AQN B;  2UUB T;  4ZS3 A;  2E9X D;  5LYJ E;  2HH7 A;  4AKG A;  1MMN A;  1SUM B;  1YQ3 A;  4ILU A;  2K3W A;  1VCT A;  2V7M A;  5EK2 A;  2VVN A;  1M7K A;  2IUB A;  2W67 A;  2J62 A;  3PJA A;  2BKN A;  1OXZ A;  3FXD B;  3HI2 A;  2XQ7 A;  2NW8 A;  3RGL A;  3TLU A;  5L3G B;  1KEY A;  4JI6 T;  4GKK T;  4PW8 A;  3PU3 A;  5JRC A;  2NW7 A;  4PFP A;  1N34 T;  2H7V C;  3MAC A;  4QKN A;  3ZST A;  4KHP T;  3CQG B;  3P4S A;  4O4L E;  5AQO B;  5L3B B;  3ANW A;  3ZC0 A;  2XQ3 A;  4AQG A;  5JR9 C;  1QSD A;  5FVK A;  3UT5 E;  4UEL A;  3VU7 H;  1KNP A;  2W63 A;  4ZZB A;  3AVR A;  2LHR A;  2VKD A;  4XBF B;  4LMK A;  1HNW T;  3UFE A;  4QXB B;  3B57 A;  3FHN A;  4DVD A;  1MIW A;  2X51 A;  1UUS A;  2V7K A;  2YKS A;  3C98 B;  4XZC A;  3PUA A;  3KV6 A;  4MHC A;  3Q5X A;  4ANJ A;  3CKD A;  5FL1 A;  2WS3 A;  4EB6 E;  2XQ6 A;  3AEE A;  4ERR A;  2DHR A;  1UCU A;  2YEV C;  2JJ9 A;  3C64 A;  2IC6 A;  2XPK A;  1HG5 A;  4U2Z A;  4CQI A;  2CBI A;  4AKL A;  4IDZ A;  2YU2 A;  3BQI A;  4EAH A;  4X62 T;  1T7S A;  2BG9 B;  5DJQ C;  3T8O A;  4EIW A;  3ESL A;  5LGN B;  1QUU A;  5L3C B;  2E8I A;  4O4H E;  2J4G A;  2XQ5 A;  1L0V A;  2CXL A;  2LJL A;  4AQF C;  2JQ9 A;  2WP9 A;  3C4X A;  2FJE A;  1YKE B;  4HN9 A;  2WU5 A;  3VHL A;  2X68 A;  4DMV A;  1XZY A;  3B13 A;  4HKA A;  2XUE A;  3RI5 A;  2I6H A;  4ASK A;  4YY3 T;  2I0M A;  3PTR B;  2CRB A;  5AQH B;  4O2B E;  5LG3 A;  2YDR A;  5BMV E;  3D0T A;  4L5G A;  2XY8 B;  4ISS A;  2XHE B;  3PUZ F;  3AXJ B;  3PUS A;  5CB4 E;  1MIV A;  2UXB T;  2LKG A;  1MMA A;  1HS7 A;  4IL9 A;  2D0U A;  2H88 A;  5BR8 T;  3DP7 A;  4OYK A;  3AA0 B;  4DMW A;  1FJG T;  5CA0 E;  3L3P A;  4GYR A;  2VAS A;  3RIF A;  4UVC B;  1Z8U A;  5KXJ A;  5J0Z A;  4ILA A;  2WDR A;  3ZC1 A;  2M6I A;  2WSS V;  3OBV E;  3N9M A;  3N5L A;  3PUQ A;  2XQ4 A;  4ZOL E;  2D5U A;  3MK7 C;  5HCJ A;  5HEG A;  3NWI A;  3F2E A;  4A97 A;  4FI5 A;  2X0H A;  3P8C D;  1I94 T;  4DR7 T;  2ES0 A;  5IYZ E;  3KVB A;  4KUM B;  4O2A E;  5JQG E;  5TAO A;  2MYS A;  3N2G E;  4MAL A;  5LMU T;  2LHN A;  4AKH A;  2W00 A;  4YSY A;  2SPC A;  5LG4 A;  4JI1 T;  5LHI B;  1LKX A;  2VL0 A;  2YU1 A;  1XMQ T;  2JMH A;  1NEK A;  2L8K A;  5F5W A;  5FXV A;  2X66 A;  3ZMZ B;  2B76 A;  4DBQ A;  3ZEF B;  3UQ7 A;  1KNZ A;  2A3D A;  4U7I A;  5AQT B;  4ZI3 D;  2WAU A;  4TNV A;  5FMN A;  3RYC E;  3SOL A;  4NPP A;  3OKQ A;  2IW5 B;  3AAI A;  3AA6 B;  3AA7 B;  3GWH A;  3ZCJ A;  4LF5 T;  4A98 A;  3ZLI A;  5A1L A;  3UUX B;  3JCF A;  1AJ3 A;  5HXR A;  4H63 V;  2W61 A;  2CBJ A;  3UU8 A;  5L47 A;  3L8R A;  2BG9 E;  1WCR A;  4TX5 A;  5L3E B;  4U74 A;  2HN2 A;  3I9Y A;  2V8S V;  2V7L A;  2LSG A;  3UUN A;  3KBU A;  1T72 A;  5HXC A;  3AE7 A;  2CWY A;  3TLS A;  2EHO D;  4J2C A;  3J9X 1;  4YLH A;  2DWG A;  2OLT A;  3H3M A;  3PE0 A;  4X64 T;  4H9N C;  3N9N A;  2QGS A;  4N78 D;  3A8Y C;  4HFC A;  5ETW A;  3ZYL A;  3NKZ A;  4O4I E;  4EYU A;  5JDN A;  2BZB A;  5FXX A;  2KZ7 B;  4GOU A;  3AEF A;  4KBM B;  4YSZ A;  4LFC T;  2BS2 A;  3AE3 A;  2I59 A;  2L3L A;  1U4Q A;  2IIU A;  3DTO A;  4YTM A;  3RYF E;  3ONX A;  5H6Q B;  2CXF A;  5JR9 A;  3UUB A;  2R6G F;  3RHW A;  2LRK A;  3AE4 A;  5FYM A;  5J1G A;  1UK5 A;  3RKO A;  4CN6 A;  4DV2 T;  2UXC T;  3LBX A;  2V5D A;  5JH7 E;  2W62 A;  4PK4 A;  2LSY A;  2WQY A;  3VR8 A;  3MZK B;  4HFV A;  3AE2 A;  4F6R C;  5HXS A;  3UUL A;  2D0T A;  2DL1 A;  2CLY B;  2X9X A;  1WYC A;  1H7C A;  2XM2 A;  3HKE E;  4TV8 E;  4YT0 A;  5AFU L;  4NXM T;  3BK9 A;  2Y8D A;  4UV9 B;  3RQU A;  5AQP B;  3ZJ2 A;  2CPT A;  2LLY A;  3CWZ B;  3A5X A;  2X0Y A;  4HWD A;  4YFS A;  4CN1 A;  4Z91 A;  1HTJ F;  4EED A;  1KFY A;  2H3R A;  2LKH A;  3P50 A;  2WMN A;  4JBW F;  2IHR 1;  3ZYK A;  3PUV F;  1BR0 A;  3EAB A;  4IE6 A;  5JR9 B;  3GN5 B;  4MLK A;  3CX6 B;  5JVD E;  2Z6E A;  3AED A;  3TKL B;  2C5I T;  4BJN A;  3CX8 B;  3ABV A;  4K0U A;  3JC6 C;  1YKH B;  5EK4 A;  1W09 A;  2AE9 A;  4DV5 T;  2WZH A;  2CCQ A;  3AA1 B;  3WAJ A;  2ZM6 T;  3LK2 B;  2K48 A;  3FZK B;  3CX7 B;  3ETU A;  2AXD S;  3V5U A;  5IHY A;  2E9X C;  3C50 A;  2Q9Q D;  4G2A A;  1EZ3 A;  3ZT7 A;  5LCY A;  4BA9 A;  4NIQ A;  4OHF A;  3PUG A;  4MBQ A;  4CZZ B;  4DV3 T;  4GIW A;  4H9S E;  3ZCI A;  2ACX A;  1GQE A;  2BDE A;  4DR2 T;  5FKY A;  2BBH A;  2FJD A;  2RPA A;  4CXX A;  4YHJ A;  1D1A A;  2VUR A;  4C91 A;  5JDM A;  4IDQ A;  4U31 A;  1T8B A;  1M62 A;  2L9Q A;  3JAF A;  3ZMS B;  5HAX A;  4DV0 T;  2CHN A;  4AQY T;  5L3D B;  3E0Z A;  1W0A A;  2OV9 A;  4CXW A;  3RH3 A;  5FY1 A;  1CHU A;  2NTY A;  2WCA A;  3FBL A;  2NTX A;  3FZL B;  4QXH B;  4X5T A;  3SS1 A;  4FJO A;  3HA4 A;  2NP9 A;  3EDV A;  3NVO A;  2CXD A;  3RQW A;  5J2U E;  4PJM A;  3EHZ A;  4XAX B;  3QOF A;  1FIO A;  2XAQ B;  3IBP A;  1VCS A;  4QH5 A;  1KF6 A;  1SHZ C;  3VRA A;  4YTN A;  5JDG A;  5LHH B;  3LBX B;  2X9W A;  3R6N A;  3PU8 A;  1XDO A;  4I0U A;  4IDN A;  3EI0 A;  2EHO A;  1D1B A;  3NBX X;  4HWF A;  4IDO A;  4UVA B;  4ZI3 C;  5CJ5 A;  1UX4 A;  2CEA A;  2QA7 A;  5AQF B;  3PUR A;  3AE6 A;  2PJQ A;  1BR2 A;  2MTQ A;  1D0Z A;  1XWM A;  4X1K E;  3U3I A;  3E08 A;  1S94 A;  4TWH A;  2XSB A;  4UVB B;  1ZP0 A;  2X9H A;  4QH1 A;  3MJX A;  4OYJ A;  5HWX A;  1KNR A;  3K3O A;  3LK4 2;  5CA1 E;  2CE7 A;  4IE5 A;  4TNW A;  1KK7 A;  1ZV4 X;  3IEE A;  3RC8 A;  2BS4 A;  2BKP A;  4PJJ A;  5GON E;  3UUM A;  1BR1 A;  3J7Y q;  4QX7 B;  4ILB A;  3GN5 A;  3ZSS A;  2CLY C;  4COF A;  2KSR A;  4DUY T;  2HN1 A;  5LA6 E;  4KMC A;  4ZHQ E;  3OYX A;  2P9B A;  2NW9 A;  2YN6 A;  3UU5 A;  2DCF A;  1N36 T;  4AI6 A;  1LRZ A;  4HFH A;  3UU4 A;  5AQJ B;  2XAH B;  3T1H T;  4UIG A;  5FP3 A;  3ZYM A;  3AE8 A;  4WYV A;  2VVS A;  1J5E T;  3C51 A;  5AQV B;  4KI0 F;  5AQM B;  4EEB A;  1SA0 E;  1O3X A;  2VL8 A;  4IRE A;  2X9Y A;  3KBT A;  5AQL B;  4GKJ T;  4IT4 A;  2D9D A;  2M67 A;  3RX6 A;  3QB5 K;  2BKO A;  4IST A;  5C3J A;  4X1Y E;  3O1I A;  4HFD A;  4IE7 A;  5HWY A;  4YTP A;  2KND A;  2BBJ A;  2WM9 A;  4L0R A;  1IBM T;  4IE4 A;  4X20 E;  2N2N A;  2GK9 A;  4EZH A;  5LJM A;  3Q9D A;  5IWA T;  1D1C A;  3HR0 A;  4DR1 T;  2LT3 A;  3VKG A;  3QUJ A;  3EAM A;  1X79 A;  3IHR A;  3KV9 A;  4UR9 A;  5DQW A;  2WMO A;  4LMJ A;  5FY7 A;  4WNK A;  1IBK T;  3UU6 A;  5JRE A;  4OX9 T;  2LSK A;  2V6Y B;  2W2U A;  3C4W A;  2BVM A;  2H89 A;  3I9W A;  5JDF A;  1WR6 A;  2ODU A;  5IUX A;  3QC9 A;  1LVF A;  5C8Y E;  4LF7 T;  3AEG A;  4U33 A;  3ONJ A;  2KT9 A;  3P4Q A;  3M3Z B;  4JLE A;  2XSA A;  3AEB A;  4PFO A;  1MMD A;  2C0S A;  2QRX A;  4HEA A;  4TWD A;  5FY0 A;  5AQG B;  2CWO A;  5LOV E;  4CI3 B;  1US7 B;  3QK6 A;  4NUU A;  3N9Q A;  4IDP A;  3FZH B;  3WAK A;  4DUZ T;  5F3J A;  3R84 B;  2W0G A;  2M6B A;  3FZF B;  2KLQ A;  2KMF A;  3HKC E;  3AAA B;  3N9P A;  3Q2M A;  1FMV A;  3NZP A;  2V7I A;  3CQC B;  4PJN A;  2F4V T;  1JNZ A;  2LSI A;  3N2O A;  3AXJ A;  2E9X A;  4JEH B;  3I0O A;  4UXN B;  2FJA A;  2WY2 A;  3JAD A;  2D2S A;  3CK6 A;  3EDU A;  1HNZ T;  4EZ4 A;  1HG2 A;  2N1G A;  2WDQ A;  4UF0 A;  3UU3 A;  4JEU B;  2IML A;  3HL6 A;  3JAE A;  3A7M A;  3ONL C;  2UUA T;  2G0U A;  2NOX A;  4TUY E;  4CI2 B;  1N33 T;  4JUY A;  4WBO A;  1W0B A;  5L4H A;  1BR4 A;  2XZE A;  4HWH A;  4CXY A;  1E7P A;  3W15 B;  5ABH A;  1NAF A;  4DV4 T;  1HR0 T;  1CUN A;  5LMN T;  5AQI B;  2FBW A;  4NUV A;  2E5V A;  3VRB A;  1MIY A;  3DJB A;  4UEM A;  5LHG B;  5HEH A;  2XQY A;  4O8S A;  4A56 A;  4ZEY A;  3RIU C;  1N32 T;  4JI7 T;  4JI2 T;  2UXX B;  2LEH A;  4KP3 C;  4MFR A;  4OFZ A;  4DBR A;  3ZKR A;  4QH4 A;  4EXT A;  3AB3 B;  4H9O C;  1MNE A;  3OVU A;  3M65 A;  3IA3 A;  1YQ4 A;  3P4R A;  2UXN B;  5F8P A;  5H6R B;  1YXR A;  3G06 A;  4K0K T;  3AAE B;  1WRD A;  1I6Z A;  1X9B A;  2XM1 A;  4IL4 A;  4KHZ F;  2VKH A;  2H7O A;  2VKJ A;  3ZPO A;  4BAY B;  4I55 E;  2XJ7 A;  2ZMA A;  4DR5 T;  3P4P A;  3AVS A;  4JI0 T;  1WFD A;  3B5M A;  4DR6 T;  3S4U A;  3AEC A;  3UQ4 A;  4DV7 T;  4P0A A;  2LRL A;  4EYY R;  4TWF A;  4C90 A;  1E1H B;  1OED E;  2Y48 B;  4UV8 B;  5FVL A;  3LK3 B;  4IHJ E;  2WBL A;  2UXD T;  2A72 A;  4A5X A;  3KV5 A;  4IGU A;  4DR3 T;  4CI1 B;  2XQ9 A;  3ZMU B;  4HFB A;  1DU2 A;  5ABG A;  4TN7 B;  4DID B;  5AQQ B;  4WBN E;  4YXD A;  1T98 A;  3OJA A;  2JRK A;  1HNX T;  1NWM X;  3JC6 D;  5ADX L;  4BJM A;  2ZM0 A;  2JQH A;  1VRB A;  2DNX A;  1IJ5 A;  2XAF B;  2DLR A;  4LML A;  3RIA A;  4HFI A;  4AKR B;  3CQX C;  2CA5 A;  2WU2 A;  2WWV A;  5ABF A;  2JMK A;  3OTO T;  2LE8 A;  4H9P C;  4P1N A;  3SFE A;  5HCM A;  5JRC B;  4YHH T;  2V1D B;  5E0O A;  4NXN T;  4WZX A;  5LP6 E;  2J1D G;  4Q25 A;  1VOM A;  3RIU A;  2W4X A;  3ETV A;  4HE8 A;  4HGA A;  5LGU B;  3P7I A;  1IJ6 A;  3H3A A;  4IIJ E;  2E2A A;  4Z90 A;  3ZN1 B;  1JNR A;  4EGW A;  1XDP A;  3I1A A;  2ACZ A;  3RRW A;  3QB5 A;  4GK0 E;  5HEJ A;  5LBQ B;  5HXE A;  4ADZ A;  5ABE A;  2W66 A;  4H9Q C;  3L39 A;  2CHO A;  4U2Y A;  3ZT5 A;  3RF1 A;  4ZS2 A;  4LF8 T;  3EUH A;  3O1J A;  2MOZ A;  4PNI A;  1WR0 A;  4B3S T;  2A2F X;  3RLF F;  4B3R T;  3MXZ A;  1D0Y A;  4HFE A;  3F31 A;  1LVK A;  1ZOY A;  2XAS B;  1ZHC A;  1WYB A;  2X0L B;  2YIN A;  3K3N A;  4GYS A;  4TZ4 C;  3V5S A;  4DO0 A;  4JI4 T;  2LOP A;  5CFB A;  3KFW X;  3E22 E;  3HKD E;  3OYZ A;  2XAG B;  5J2T E;  2X67 A;  3LFM A;  3TLT A;  1IZN B;  5M4Y A;  3SWH A;  1SE7 A;  4I4T E;  4PJL A;  4TV9 E;  5LXT E;  4CN4 A;  2YDS A;  4QXC B;  3GMI A;  4I43 B;  3RKG A;  3LSV A;  1HX1 B;  1UGO A;  2VB6 A;  5KDM C;  5LGT B;  2K24 A;  3GA8 A;  2IAK A;  3FXE B;  3N9O A;  3KV4 A;  3NRX A;  4PAG A;  4B3T T;  3WI3 A;  3ZMT B;  3OPC A;  5CGM A;  4LFB T;  2QYW A;  2YOE A;  2VQE T;  3KDS E;  5EK3 A;  4F8H A;  1Y01 A;  4AIS A;  2PBI A;  3K3Q C;  1OWA A;  2ZM2 A;  2KXP B;  4LFA T;  4JI3 T;  2ZLY A;  1UX5 A;  4P0B A;  5EZY E;  4DND A;  1OED A;  3MA9 A;  2PTF A;  5JDH A;  5FL0 A;  3Q5D A;  4IE0 A;  4YJ2 E;  1UUR A;  2DI4 A;  2VWA A;  2LM2 A;  5JTG A;  2E5L T;  2CM0 A;  1XNR T;  3AE9 A;  3NZQ A;  3CPZ A;  1Z0P A;  4LF9 T;  2JQQ A;  2N9D A;  4DR4 T;  2FUP A;  2MPK A;  1XNQ T;  4JV5 T;  3RYH E;  2HPL A;  1YW0 A;  2UUC T;  4ZZC A;  2ODV A;  5AQS B;  5HXH A;  2BVL A;  3SFD A;  2IC9 A;  2A9U A;  4AQF A;  3LDQ B;  5HEU A;  4AKI A;  2Y6X A;  2K9A A;  1S35 A;  1QLB A;  3PJA J;  3H37 A;  2BG9 C;  3RC3 A;  5L4E A;  3O1H A;  1IAP A;  2V26 A;  3PUX F;  4AXP A;  4YSX A;  5C2T A;  2Q9Q A;  3SRZ A;  2K5B B;  4JYA T;  2B1E A;  1YD8 G;  4V1A v;  3Q5E A;  2JIW A;  1NEN A;  4I50 E;  2KWH A;  2XAJ B;  5ABF B;  1MMG A;  2V5C A;  2Q9Q C;  4P09 A;  2Q9Q B;  3FZM B;  2XQA A;  4QWN B;  2V6Y A;  4LF4 T;  5FNV E;  3VR9 A;  2BG9 A;  4QX8 B;  4X65 T;  2HPJ A;  2XQ8 A;  3N2K E;  3O4X E;  4OK0 A;  1J1J A;  3N9L A;  3KIN B;  4H63 H;  4Z8X A;  5KMG P;  3K1S A;  3MKD A;  4ZI2 C;  4DV1 T;  3AEA A;  2DWK A;  1R8I A;  3PV0 F;  3HKB E;  2WWU A;  3PUW F;  2VK9 A;  4JI5 T;  2WB5 A;  1HCI A;  1D0X A;  3AE5 A;  3TLV A;  2RA1 A;  4KX6 A;  3X1D A;  5KX5 E;  4PK6 A;  4LF6 T;  3ZN0 B;  1ZKE A;  2V7J A;  2EHO C;  3QNU A;  5LJN A;  2HHH T;  1W9R A;  4PK5 A;  1OED C;  2KWI B;  3LG7 A;  4UF0 B;  2NWB A;  2YDQ A;  1HX8 A;  4GK5 E;  3C4Z A;  4U72 A;  4QHO A;  3L09 A;  1V9D A;  5LB7 B;  2PFV A;  5FXZ A;  2UU9 T;  3VKH A;  3Q5W A;  4ZXL A;  2MAW A;  1HFA A;  1ZEE A;  2PG8 A;  4WW0 A;  5AQK B;  3PUY F;  1IBL T;  2C5K T;  1J5W A;  3RRC A;  4E7Z A;  3BQL A;  5JDL A;  3ZMV B;  4U7Y A;  1HF8 A;  2IDO B;  3UTK A;  4B3M T;  1MND A;  4HTE A;  3TLW A;  1G8X A;  3ZT6 A;  5L3F B;  4H9R C;  4DV6 T;  5AQR B;  2NR4 A;  5FXW A;  3EVY A;  4EOZ B;  3IF8 B;  5LBM A;  4B6X A;  4EV6 A;  5L2L A;  3O9X A;  3PDY A;  2VQF T;  2ZM8 A;  2CMR A;  2C5J A;  5DAB A;  3FBZ A;  5DQV A;  2JQK A;  3P4W A;  2WZI A;  2FJB A;  3CIR A;  2LOS A;  4HWC A;  1FMW A;  2XTL A;  3F57 A;  1WLX A;  4L9I A;  2JPF A;  1Y64 B;  2VKO A;  3KVA A;  1OED B;  3CVR A;  4AIU A;  3NRY A;  4JI8 T;  4ILC A;  2EHO B;  1G73 A;  2WDV A;  1B7T A;  3K8P C;  4HWI B;  5AQU B;  3AE1 A;  4ZI7 E;  4E7S A;  3RYI E;  1FEW A;  2E9X B; 
#chains in the Genus database with same CATH homology
 5JDQ A;  3U78 A;  2RP4 A;  3BQK A;  4X1I E;  2OA5 A;  2YK0 A;  2KIN B;  4ZI2 D;  4YJ3 E;  3LJC A;  2LM9 A;  2MBG A;  3FB2 A;  4O4J E;  2LSJ A;  3ANW B;  4M1P A;  3ZJ1 A;  1U5P A;  5HYA A;  3RPU A;  5LNK A;  4G63 A;  3CML A;  3I0Q A;  4ZS3 A;  2E9X D;  5LYJ E;  2HH7 A;  4AKG A;  1MMN A;  4ILU A;  2V7M A;  5EK2 A;  3FXD B;  1OXZ A;  3HI2 A;  5L3G B;  2NW8 A;  4PW8 A;  3PU3 A;  5JRC A;  2NW7 A;  4PFP A;  2H7V C;  3MAC A;  4QKN A;  3CQG B;  4O4L E;  5L3B B;  3ANW A;  4AQG A;  5JR9 C;  1QSD A;  3UT5 E;  4UEL A;  3VU7 H;  2W63 A;  3AVR A;  2LHR A;  2VKD A;  4XBF B;  3UFE A;  4QXB B;  3FHN A;  3B57 A;  4DVD A;  1MIW A;  2X51 A;  2V7K A;  3C98 B;  4XZC A;  3PUA A;  3KV6 A;  4MHC A;  3Q5X A;  3CKD A;  4EB6 E;  2DHR A;  1UCU A;  2YEV C;  2JJ9 A;  3C64 A;  2IC6 A;  4CQI A;  1HG5 A;  5JDH A;  4AKL A;  4IDZ A;  2YU2 A;  3BQI A;  5DJQ C;  5LGN B;  3T8O A;  4EIW A;  3ESL A;  1QUU A;  5L3C B;  2E8I A;  4O4H E;  2CXL A;  2LJL A;  4AQF C;  3C4X A;  3VHL A;  1YKE B;  4HN9 A;  2X68 A;  4DMV A;  3B13 A;  4HKA A;  2XUE A;  4ASK A;  3PTR B;  4O2B E;  5BMV E;  3D0T A;  4L5G A;  4ISS A;  2XHE B;  3PUS A;  5CB4 E;  1MIV A;  1MMA A;  1HS7 A;  2D0U A;  3DP7 A;  4OYK A;  3AA0 B;  4DMW A;  5CA0 E;  3L3P A;  4GYR A;  2VAS A;  4UVC B;  3ZC1 A;  2WSS V;  3OBV E;  3N9M A;  3N5L A;  3PUQ A;  4ZOL E;  2D5U A;  3MK7 C;  3F2E A;  4FI5 A;  3P8C D;  2ES0 A;  5IYZ E;  3KVB A;  4KUM B;  4O2A E;  5JQG E;  5TAO A;  2MYS A;  3N2G E;  4MAL A;  2LHN A;  4AKH A;  2W00 A;  2SPC A;  5LG4 A;  5LHI B;  1LKX A;  2YU1 A;  2JMH A;  2L8K A;  5FXV A;  1KNZ A;  2X66 A;  3ZMZ B;  4DBQ A;  3ZEF B;  2A3D A;  2WAU A;  5FMN A;  3RYC E;  3SOL A;  3OKQ A;  2IW5 B;  3AAI A;  3AA6 B;  3AA7 B;  3GWH A;  3ZCJ A;  1AJ3 A;  3ZLI A;  5A1L A;  3UUX B;  5HXR A;  4H63 V;  2W61 A;  5L3E B;  4TX5 A;  4U74 A;  3I9Y A;  2V7L A;  2LSG A;  3UUN A;  3KBU A;  5HXC A;  2CWY A;  2EHO D;  4J2C A;  3J9X 1;  4YLH A;  2DWG A;  3PE0 A;  4H9N C;  3N9N A;  2QGS A;  4N78 D;  4EYU A;  5ETW A;  3ZYL A;  4O4I E;  5JDN A;  2BZB A;  5FXX A;  2KZ7 B;  4GOU A;  4KBM B;  2I59 A;  2L3L A;  1U4Q A;  3DTO A;  3RYF E;  3ONX A;  5H6Q B;  2CXF A;  5JR9 A;  4ERR A;  4AKI A;  5J1G A;  5FYM A;  3RKO A;  3LBX A;  5JH7 E;  2W62 A;  4PK4 A;  2LSY A;  3MZK B;  4HFV A;  4F6R C;  5HXS A;  3UUL A;  2D0T A;  2X9X A;  2CLY B;  3HKE E;  1WYC A;  1H7C A;  4TV8 E;  5AFU L;  3BK9 A;  2Y8D A;  4UV9 B;  3ZJ2 A;  3CWZ B;  3A5X A;  4YFS A;  1HTJ F;  2H3R A;  2WMN A;  3ZYK A;  1BR0 A;  4IE6 A;  5JR9 B;  3GN5 B;  4MLK A;  3CX6 B;  5JVD E;  2Z6E A;  3TKL B;  2C5I T;  4BJN A;  3CX8 B;  4K0U A;  3JC6 C;  1YKH B;  3AA1 B;  2CCQ A;  3WAJ A;  3LK2 B;  2K48 A;  3CX7 B;  3ETU A;  3V5U A;  5IHY A;  2E9X C;  3C50 A;  2Q9Q D;  4G2A A;  1EZ3 A;  5LCY A;  4BA9 A;  4OHF A;  3PUG A;  4MBQ A;  4CZZ B;  4GIW A;  4H9S E;  3ZCI A;  2ACX A;  2BDE A;  4CXX A;  4YHJ A;  1D1A A;  4C91 A;  5JDM A;  2L9Q A;  3ZMS B;  5HAX A;  5L3D B;  3E0Z A;  4CXW A;  3RH3 A;  5FY1 A;  2NTY A;  3FBL A;  2NTX A;  4QXH B;  3SS1 A;  4FJO A;  3HA4 A;  2NP9 A;  3EDV A;  2CXD A;  5J2U E;  4PJM A;  4XAX B;  1FIO A;  2XAQ B;  3IBP A;  1SHZ C;  5LHH B;  5JDG A;  3LBX B;  2X9W A;  3R6N A;  3PU8 A;  2EHO A;  1D1B A;  3NBX X;  4UVA B;  4ZI3 C;  1UX4 A;  2CEA A;  2QA7 A;  3PUR A;  1BR2 A;  2MTQ A;  2PJQ A;  1D0Z A;  4X1K E;  3U3I A;  4EOZ B;  3E08 A;  1S94 A;  4UVB B;  5HWX A;  3O9X A;  2X9H A;  3MJX A;  4OYJ A;  3K3O A;  3LK4 2;  5CA1 E;  2CE7 A;  4IE5 A;  1KK7 A;  1ZV4 X;  3IEE A;  3RC8 A;  4PJJ A;  5GON E;  3UUM A;  1BR1 A;  3J7Y q;  4QX7 B;  3GN5 A;  2CLY C;  5LA6 E;  4KMC A;  4ZHQ E;  3OYX A;  2P9B A;  2NW9 A;  2DCF A;  4AI6 A;  1LRZ A;  2XAH B;  4UIG A;  5FP3 A;  3ZYM A;  3C51 A;  1SA0 E;  1O3X A;  2VL8 A;  2X9Y A;  3KBT A;  2M67 A;  3RX6 A;  4IST A;  4X1Y E;  3O1I A;  4IE7 A;  5HWY A;  2KND A;  2WM9 A;  4L0R A;  4IE4 A;  4X20 E;  2N2N A;  2GK9 A;  4EZH A;  5LJM A;  3Q9D A;  1D1C A;  3HR0 A;  2LT3 A;  3VKG A;  3QUJ A;  1X79 A;  3IHR A;  3KV9 A;  5FY7 A;  5DQW A;  2WMO A;  4WNK A;  5JRE A;  2LSK A;  3I9W A;  5JDF A;  3C4W A;  2BVM A;  3RYI E;  4ANJ A;  1WR6 A;  2ODU A;  3QC9 A;  1LVF A;  5C8Y E;  4JLE A;  2KT9 A;  4PFO A;  5FY0 A;  4ZI3 D;  1MMD A;  2C0S A;  4HEA A;  5LOV E;  4CI3 B;  4EAH A;  2CWO A;  1US7 B;  3QK6 A;  4NUU A;  3N9Q A;  3WAK A;  5F3J A;  3R84 B;  2W0G A;  5EK4 A;  2KLQ A;  2KMF A;  3HKC E;  3AAA B;  3N9P A;  3Q2M A;  1FMV A;  3NZP A;  2V7I A;  3CQC B;  4PJN A;  2LSI A;  3N2O A;  2E9X A;  4JEH B;  3I0O A;  4UXN B;  2D2S A;  3EDU A;  4EZ4 A;  1HG2 A;  2N1G A;  4UF0 A;  4JEU B;  3HL6 A;  2G0U A;  2NOX A;  4TUY E;  4CI2 B;  4JUY A;  4WBO A;  4CXY A;  1BR4 A;  3W15 B;  1NAF A;  1CUN A;  4NUV A;  1MIY A;  3DJB A;  4UEM A;  5LHG B;  2XQY A;  4O8S A;  4A56 A;  2UXX B;  2LEH A;  4KP3 C;  4MFR A;  4OFZ A;  4DBR A;  4EXT A;  3AB3 B;  4H9O C;  1MNE A;  3M65 A;  2UXN B;  5F8P A;  5H6R B;  3AAE B;  1WRD A;  2VKH A;  2H7O A;  2VKJ A;  3ZPO A;  4BAY B;  4I55 E;  2ZMA A;  3AVS A;  3S4U A;  4P0A A;  4EYY R;  4C90 A;  1E1H B;  2Y48 B;  4UV8 B;  3LK3 B;  4IHJ E;  2WBL A;  2A72 A;  3KV5 A;  4IGU A;  4CI1 B;  3ZMU B;  4TN7 B;  4WBN E;  1T98 A;  3OJA A;  2JRK A;  1NWM X;  3JC6 D;  5ADX L;  4BJM A;  2ZM0 A;  1VRB A;  2DNX A;  1IJ5 A;  2XAF B;  2DLR A;  4AKR B;  3CQX C;  2CA5 A;  2JMK A;  2LE8 A;  4H9P C;  5JRC B;  2V1D B;  5E0O A;  5LP6 E;  2J1D G;  1VOM A;  3ETV A;  4HE8 A;  4HGA A;  5LGU B;  3P7I A;  1IJ6 A;  3H3A A;  4IIJ E;  3ZN1 B;  3I1A A;  3RRW A;  4GK0 E;  5LBQ B;  5HXE A;  4ADZ A;  4H9Q C;  4ZS2 A;  3EUH A;  3O1J A;  2MOZ A;  4PNI A;  2A2F X;  3MXZ A;  1D0Y A;  3F31 A;  1LVK A;  2XAS B;  1ZHC A;  1WYB A;  2X0L B;  2YIN A;  3K3N A;  4GYS A;  4TZ4 C;  3V5S A;  4DO0 A;  2LOP A;  3KFW X;  3E22 E;  3HKD E;  3OYZ A;  2XAG B;  5J2T E;  2X67 A;  3LFM A;  1IZN B;  5M4Y A;  3SWH A;  4I4T E;  4PJL A;  4TV9 E;  5LXT E;  4QXC B;  5KDM C;  3GMI A;  4I43 B;  5LGT B;  2VB6 A;  2K24 A;  3GA8 A;  2IAK A;  3FXE B;  3N9O A;  3KV4 A;  3NRX A;  4PAG A;  3WI3 A;  3ZMT B;  3KDS E;  5EK3 A;  2PBI A;  3K3Q C;  1OWA A;  2ZM2 A;  2KXP B;  2ZLY A;  1UX5 A;  4P0B A;  5EZY E;  4DND A;  3MA9 A;  4IE0 A;  4YJ2 E;  2DI4 A;  2VWA A;  2CM0 A;  3NZQ A;  3CPZ A;  1Z0P A;  2JQQ A;  2N9D A;  3RYH E;  2HPL A;  1YW0 A;  2ODV A;  5HXH A;  2BVL A;  4AQF A;  2IC9 A;  2Y6X A;  2K9A A;  1S35 A;  3H37 A;  3RC3 A;  3O1H A;  1IAP A;  2V26 A;  4AXP A;  2Q9Q A;  3SRZ A;  2K5B B;  2B1E A;  1YD8 G;  4V1A v;  4I50 E;  2KWH A;  2XAJ B;  1MMG A;  2Q9Q C;  4P09 A;  2Q9Q B;  4QWN B;  5FNV E;  4QX8 B;  2HPJ A;  3N2K E;  3O4X E;  4OK0 A;  3N9L A;  3KIN B;  4H63 H;  4Z8X A;  5KMG P;  3MKD A;  4ZI2 C;  2DWK A;  3HKB E;  2WWU A;  2VK9 A;  1HCI A;  1D0X A;  5KX5 E;  2RA1 A;  4PK6 A;  3ZN0 B;  1ZKE A;  2V7J A;  2EHO C;  5LJN A;  4PK5 A;  2KWI B;  3LG7 A;  4UF0 B;  2NWB A;  4GK5 E;  1HX8 A;  4U72 A;  3C4Z A;  3VKH A;  4QHO A;  3L09 A;  1V9D A;  2PFV A;  5FXZ A;  3Q5W A;  1HFA A;  1ZEE A;  2PG8 A;  4WW0 A;  2C5K T;  3RRC A;  4E7Z A;  3BQL A;  5JDL A;  3ZMV B;  1HF8 A;  3UTK A;  1MND A;  4HTE A;  5L3F B;  1G8X A;  4H9R C;  5FXW A;  3EVY A;  3IF8 B;  5LBM A;  4B6X A;  5L2L A;  3PDY A;  2ZM8 A;  2CMR A;  2C5J A;  5DAB A;  3FBZ A;  5DQV A;  2LOS A;  1FMW A;  2XTL A;  3F57 A;  1WLX A;  4L9I A;  2JPF A;  1Y64 B;  2VKO A;  3KVA A;  3CVR A;  3ZC0 A;  3NRY A;  2EHO B;  1G73 A;  3K8P C;  1B7T A;  4ZI7 E;  4E7S A;  1FEW A;  2E9X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...